4QJ5A

Structure of a fragment of human phospholipase c-beta3 delta472-581, bound to ip3 and in complex with galphaq
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
317
structure length
317
Chain Sequence
ARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPSYLPTQQDVLRVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular mechanisms of phospholipase C beta 3 autoinhibition.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein/hydrolase
molecule keywords Guanine nucleotide-binding protein G(q) subunit alpha
total genus 105
structure length 317
sequence length 317
ec nomenclature
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00503 G-alpha G-protein alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.400.10 Mainly Alpha Orthogonal Bundle GI Alpha 1, domain 2-like GI Alpha 1, domain 2-like 4qj5A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4qj5A01
4TMVA 2F6RA 5GVRA 3CX7A 4JVLA 5SZIA 1OIVA 2VP5A 4V0OA 2WWXA 5C2JB 5EQTA 1E2NA 1DO2A 5DO9A 4UNSA 1UFQA 2QG6A 1E0AA 2DFNA 1GNQA 5EXTA 1GDDA 2R2AA 2XTNA 1E6CA 4HLUC 1LS6A 3DPUA 4JLAA 4M9XA 2IUTA 4KSCA 4TL7A 3G0HA 1OF1A 3ZZ0A 2WSSD 4DLRA 1NBMA 4NKRA 1N6HA 2DWPA 1FW6A 4URUR 5B64A 4AC9A 2ZYWX 1QHIA 2IX3A 1TQ4A 2OLJA 2E87A 2QTVB 5P21A 2BIFA 2ZUBA 3NDBB 3KB1A 1MV5A 4B3FX 2GJAA 4M21A 1KDTA 3RS0A 4NONA 4TYNA 2DCUA 3VR2A 5L8VA 4PR0A 1DAFA 1QDEA 2Z4SA 4B3DA 1R2QA 1ZM4A 4XJXA 2TMKA 3VR1A 2ZJOA 4PSAA 2EFDB 1TF2A 2GJSA 3ZGXA 4Y0VA 2FGJA 3G5UA 2F7SA 5H70A 2DB3A 1KYIA 2YWHA 2C5LA 4AKGA 3VHLB 1E99A 1XXHE 2ZYTX 3OE7A 1YKSA 2IS1A 1NLZA 821PA 3TQCA 4MUBA 4MRPA 2ERYA 4LBWA 3SEAA 3K0CA 2ORVA 2QENA 2PH1A 2QE7A 1TADA 5KPDA 4HEJA 4OK3A 1VYUA 4IJMA 1XXHA 2L0XA 4D0NA 5C4MA 3D3QA 3KB2A 3AP3A 3EZ6A 2V1UA 5J4HA 5FBWB 3D31A 4TZ0A 4Z54A 4QHTA 1Z08A 2ATXA 1XMJA 1A2BA 4IEEA 2BBSA 4B44A 4LV8B 5FPYA 4DDWA 5HKKA 2XXAA 2BBTA 1OH8A 2ERXA 1JR6A 3ZD6A 4E5UA 2ZM5A 2JJ2D 1FOEB 3L0IB 2QGZA 2OV2A 1GNRA 3KJHA 3P26A 4XD7D 3Q5DA 2HLDA 1Q3HA 2BMDA 1U94A 2RKOA 3TLXA 2VIIA 1NI3A 1T91A 4TQUS 2P6UA 3CX8A 2GEDA 5E7JA 4U7DA 1CULC 3U7EB 1VMAA 4BWYA 2MSDB 2IYSA 1NMYA 3AVQA 3GLIA 3QPVA 4ERNA 3LLMA 3I1FA 4M8NE 2X77A 2CVFA 2F9MA 1TQ2A 5CIWA 3U2QA 3I72A 2ZETA 2XX3A 4NE2A 3RRZA 1FP6A 1FQKA 1IJFA 2OG2A 3N2EA 4D0GA 1YZKA 4DEYA 1XTJA 3IILA 4G0NA 3ADDA 3GEIA 1ETUA 1VCNA 1D2EA 1JEDA 4S2EA 1WXQA 1UKZA 2G88A 2I1QA 4GBMA 4Q21A 2VH5R 2WOOA 4D0LB 4NCKA 1A4RA 2ZEJA 3KUCA 3LAWA 1NVWQ 1W7AA 5FOSA 4FMDF 1HEIA 3W8RA 4UXIA 1W36B 1NKTA 4Z1MA 2G1JA 3NKVA 5FBLB 1KO8A 1W0KD 1Z0JA 2FSFA 4MH0R 1Y3AA 4P31A 5JJIA 2J87A 3NH6A 5F3WB 5JSZA 1YQTA 4LPKA 4TLAA 1NG1A 3CW2A 3ADBA 1XEWX 3SJAA 1KO4A 1NKSA 5TB5A 2ZJBA 3FHTA 4DT1A 2FPKA 3I5XA 2QM7A 1UJ2A 3QVUA 2RCNA 4LYJA 2H7VA 4WOPA 1HV8A 1XZPA 2IYQA 1U8AA 1VIAA 1ZM9A 3OIYA 5FOWA 1XJCA 4QRHA 2LKDA 4WXRA 1A5TA 5F9HA 5FUYA 2ONKA 3UMSA 3CF2A 2C77A 2QORA 3SHFA 3TW8B 4X8LA 1IN4A 4BZXA 2FZLA 2NG1A 3B60A 3W5IA 4AKHA 1ZUHA 4CVNA 3QEJA 1XJQA 3TQFA 1G3QA 1T0JB 3K09A 3L43A 1XU4A 3P4XA 2AKAB 3QKUA 4LZZA 4Q19A 4WXPA 1S3GA 4R2HA 2ZE8A 1US8A 2ZU6A 3AQ4A 2EVWX 3ZIAA 4X8OA 1X8KA 1W5SA 2ANBA 1WQ1R 3D8BA 5FTKA 3KXIA 3QENA 4DVGA 1Z83A 4AY2A 1ZNYA 3L0SA 4TWZA 2AD1A 3IBGA 2DYKA 4TLBA 4FMBB 3T1TA 2B21A 4URYR 1P2VA 3K70B 1QF9A 1I2DA 2IS6A 3AKCA 5L3QA 2XSZA 4RZXA 1K5GA 1PLJA 2YINC 2KJQA 4OI1A 4KV9A 3CPHA 1OXSC 4JBWA 2IBMA 4DXAA 3K09C 4KODA 4QGHA 2QROA 4RZ2A 1FFHA 1M1YE 1G7RA 1IONA 4NDZA 1GKUB 3B2EA 3CRRA 1KMHA 1FTNA 2NGRA 2V3CC 5IK2D 4ZV4A 1J70A 2AXPA 2R62A 2C04A 4LI0A 1IN7A 2EWVA 4US1R 3SJZA 1P62B 1RRCA 4M1TA 5BWMA 4QBHA 1A1VA 1YZNA 4TYQA 5E3HA 1KAGA 4Q7JB 2F1JA 3C41J 3DKPA 3K9HA 3UKDA 4PPGA 3DVLA 4FD2A 2BMEA 4U00A 2CLSA 5GADl 1OB5A 2GXUA 3LQQA 4AURA 4UXJA 1XCMA 5FL3A 4DZZA 2WJJA 2J3EA 3OEHA 2QI9C 2DFKB 3D6TB 4LHYA 2V55B 2ODNA 1WRBA 3IHLA 3AVOA 2J7PD 3KQNA 4Q4AA 5JI3E 1CF4A 1IY0A 2X8AA 3I61A 4QBIA 5EP4A 3T1QA 4Q4HB 3WYGA 1EWRA 2XJ4A 3PVSA 3MJRA 1KK0A 2GJ8A 3CONA 2ZE6A 4GPTA 3FMFA 2CL7X 3N5CA 1LNZA 1SQ5A 2ZJ5A 3K0FB 1B0UA 1IQPA 2NQ2C 4RZUA 4BFVA 4OQXA 1G3UA 3AF1A 2UZIR 3A37A 1IY2A 4DSTA 4NCHA 5JRZA 1R5NA 4LYHA 2FWRA 1G8HA 1IJEA 1Z0FA 2GF9A 2ZJ8A 2C8VA 3QIAA 3W6PA 4C0JA 5FOXA 5JJLA 1XRJA 3EZ7A 1X8LA 1SKYB 4BASA 3ZIAD 4A8JA 4LHZA 1OH7A 3ADCA 4M1YA 1EX7A 1N5JA 1JXOA 1S3SA 3LH5A 3E1SA 2PMKA 2ORIA 1N5IA 1LFDB 3CR7A 1UBFA 4XTRA 3HYTA 5FH9A 3MJHA 5F98A 2IT1A 1K8RA 3IQWA 1KI2A 3G82C 1QHGA 1IY1A 2C9CA 4C4PA 1TMKA 3LNCA 2D3WA 4J0QA 2C98A 1T8UA 2OILA 2YYZA 4W5WA 3WBKA 1MKYA 4EKDA 2KWIA 1GKIA 4BEBA 5JWRA 1OXXK 2ECKA 2O0JA 1R0YA 5M04A 2QRNA 4Q4JA 1G18A 1JR3A 4XD7A 3SJCA 1K6MA 3M1IA 3TR5A 4B2IA 1MO4A 4BFUA 3Q7PA 4V02A 1S4QA 4GP7A 2GXQA 1G8FA 1OPXA 1XJ0A 4X8MA 2GK7A 2AWOA 1HURA 3PQCA 1GILA 3IPXA 2YWGA 2JJ2A 4M2LA 2A3RA 2H57A 4PFSA 2ZE7A 5ANRB 1Z8FA 4DIEA 2VO1A 3B1WA 3GFTA 4PC6A 2WKQA 5IRCD 2Y8EA 2ZRNA 3R7WB 1GITA 5HZHA 2HYDA 3WXMA 1OIXA 3QJYA 3SN6A 2IUSA 4RD2A 5CK5A 3EIEA 4NYJR 1TNDA 4Q4HA 3E70C 3DM9B 4RZ3A 4EFMA 1SXJE 2WMNB 3LXRA 2A7QA 4XH9B 2D7DA 3C15C 3HYRA 1EFRA 3THWB 1RYFA 4QM7A 5KDOA 1NMZA 4RCYA 5HZKA 3PIRA 4O25A 2JCSA 3U7FB 5AJWA 4OBEA 3P27A 3U3KA 4GRAA 2XZLA 2OAP1 4HATA 1T3LA 5JHHB 3GLFB 4JL5A 4Q1EA 4KFUA 4BECA 1Z3IX 2IHBA 4A8JB 4I1UA 4BZPA 2GETA 4A92A 5G41A 1HT1E 1D2MA 2IW3A 1XEWY 1YZTA 3KQUA 4Q66C 4JL8A 2O8DA 4MKHA 5KSZA 1XCGB 1FQJA 1ZAKA 4M1WA 3LWNA 1S8FA 2HJGA 1VYVA 3AUYA 1OKKD 4LBVA 3QKRB 5CJPA 2XZPA 5FUXA 5FTMA 1EESA 1DG1G 4DLWA 1AJEA 2CCJA 4A6PA 3QKTA 3CR8A 4CYMA 1R5OA 4W5JA 2KBFA 3ASZA 4K81B 4NYIR 4PO1A 2IWHA 4G1UC 2OUKA 1CKEA 3W6OA 2VF8A 4HUQA 4B73A 1EFCA 4P4TA 2QAGA 4BE7B 3SQXA 2J0UB 1E98A 1XWIA 4QGFA 3W6NA 1JJ7A 2HT6A 3M0EA 2IA5A 1VCIA 3KQHA 3BBPA 5KPJA 2GZAA 5H1YA 2J5XA 4QKQA 4NCIA 5TDHA 4L8GA 1ZNXA 5DH9A 3EA5A 4R98A 1OHHD 2WTUA 1OFHA 4LCBA 4ACAA 3VKHA 4GSYA 3NXSA 4O2RA 2Q6TA 4IXMA 4KLNA 1YR8A 2B8WA 2V1XA 4RD6A 3UXMA 1ANKA 4L4UA 5EJEA 2FZ4A 2XNSA 1PLKA 1Q0UA 2C9OA 2FX3A 3NEJA 4GMXA 2GCOA 2MSEB 2A5DA 3FKQA 2CHGA 3UATA 3TIFA 5IT5A 2NTYC 3LXXA 2QAGC 4ASUA 1SXJC 3OEED 5EZ5A 4LHVA 1GOTA 2WSSA 1E2JA 3RS5A 3MLEA 4B33A 1N5KA 2GVZC 1A82A 2JLUA 2XGJA 3QXXA 1OFIA 4OK5A 4B3CA 3BWDD 5L3VA 4GZMA 1DEKA 2FA9A 3LLUA 2C95A 4I4LA 2REOA 4IOKA 2UZ3A 3QF7A 4URVR 3MCAA 5J5CA 1TL7C 1G3MA 2VHCA 4IOMA 2J0SA 4RVCA 2QE7D 1BOFA 5J4LA 2OT3B 3EA0A 4TSFD 2KSQA 3OAAD 5AK0A 4LBZA 2R6GA 4XTCS 4TTPA 2GCPA 2WJVA 3K0EA 2ZRPA 4A0GA 4G01B 1WP9A 2WWWA 4URWR 5IK2A 1I4TD 3TVTA 2D62A 5KUTA 5JMTA 1ZBDA 1GVNB 3P1JA 1TUEA 5C46F 2ZRMA 4WZBE 3TR0A 1O87A 4FI3C 4KBGA 2UKDA 1G17A 1L8QA 4JL6A 1HYQA 5KSYA 4JLBA 1GRNA 5AUOB 3H2YA 2WAYA 3U7GA 3H0KA 1NLFA 1GL6A 4YMTA 3U4QA 4Q18A 2WPDD 4URXR 3TSOA 3CPJB 3LRPA 1E9SA 4GMDA 3ND9A 4JLNA 1KJWA 2W00A 1CLUA 1MRSA 3MG9A 1E2PA 1N6PA 4M53A 1ZRHA 2FPLA 1EFTA 5FTJA 1ZU5A 2IF2A 2YJTD 4FXPA 3I8SA 4HUTA 1DVRA 3TSZA 1J8YF 2ZROA 1H65A 3UANA 2QL6A 2RGBA 4B75A 1W36D 2XTMA 4CEHB 1KNXA 4PAQA 1CTQA 4OHXA 5KSOA 4Q9IA 2F43A 4QHYA 3OEEA 4KI0A 1E2DA 2OBMA 3QUSA 4NYMQ 4DUGD 5AJZA 1S2MA 4WZ6A 4PSVA 1AGPA 2Q3HA 2JLVA 3UMRA 3JVUA 5KHOC 3SDZA 2FNAA 3QXSA 3CF0A 2ZRJA 4D4MA 2FSIA 4IOJA 2CE7A 1X6VA 2D06A 4ZDWA 2ZYUX 3DDCA 4KSBA 1KIMA 1IOZA 2BBOA 3CLVA 4Q03A 4NHOA 3VMFA 3PEYA 1JPNA 1KI4A 1W46A 1X8JA 3L82B 2GZDA 2WOJA 5TY0A 1P75A 5DN6A 2RAPA 2F9LA 1E4YA 4TTQA 3CH5A 1RVDA 5BN4A 3U6BA 2ZTSA 1YHNA 1N5LA 2ZRAA 1XCPA 1N6KA 2XNDA 1GIAA 3DKVA 3WMFA 5JSZB 1HTWA 4JS0A 2WIBA 1IN6A 3OZXA 1N6RA 4X8HA 1KOFA 1G8GA 1QHSA 2EU8A 1IAQA 3C8UA 4GT1A 1ZU4A 3RHFA 2N1BA 3IIMA 5JFGA 2W6ID 1N0WA 3A1TA 4PC3A 1AIPA 4M22A 4C30A 2QM8A 3L2OB 2QTHA 1J8MF 2QBYA 4QNRA 2DHRA 3FMIA 3ZLJA 4DEXA 3QE0A 1W0KA 3CRQA 4DDVA 5FL7D 2PJRA 2JLWA 2ORWA 2G77B 4I1VA 1KO5A 3RLFA 1Q21A 1PVOA 4G5RA 2IUUA 4C9BA 4F4JA 2P6NA 5HE8A 5CK4A 3ZS8A 2BHRA 4XVRA 1J2JA 3PUYA 2JJ1D 4HB4A 4DKXA 1VG0B 5F2EA 1E9EA 1RE0A 3NTUA 2O8FB 4BUJA 2OCYC 1UEIA 2OZEA 1QG4A 1II9A 1DAHA 1ZYUA 3LBIA 4GOJA 3X2SA 4HAVA 1XXHB 3KTAA 2IYUA 4TMZA 5JHGB 2OFXA 4DDUA 3H1TA 4I99A 3TAUA 2AN9A 4Q7LA 4F4CA 5SZHB 1Z0KA 3VNUA 1WCV1 3K9GA 2ZVQX 1UADA 2ZQ5A 3DHWC 2OCAA 4IOLA 2ZI3A 3PXGA 4B6FA 5IHPA 4A36A 3EASA 1LTQA 1PUJA 2A5JA 1GM5A 1BO6A 4PSKA 4XVQA 1HQYE 2NOAA 4OJQA 3AKYA 1UKYA 3IIJA 4R7ZA 1ZCBA 1G3IA 3FVQA 3P20A 5FPTA 3HU3A 4B2LA 2HF9A 2ZRLA 1G7TA 2QT0A 4CEIA 2OCBA 2VHQA 2WWIA 1OE0A 2IXGA 4W9MC 1SKQA 3FFAA 3CPEA 1UF9A 3HPRA 1M2OB 2V9PA 3VKGA 4II7A 2VHJA 2K5UA 1G3RA 1KJYA 1JNYA 1IBRA 3MD0A 1W4CA 3WP0A 1KI1A 3KKNA 2IS2A 4JZKA 4L5BA 4IFBA 1T8TA 3CKLA 1YZUA 5GJBA 2A9KA 4JT4A 3L8ZA 5EP2A 3Q8XB 2ASEA 1Z47A 2PLRA 4KJZA 2CLDX 2EFCB 5EP1A 2ODEA 4A4DA 4K8OA 1G9XA 1AGRA 2BM1A 2QZ4A 2GA8A 4CEJB 3OHMA 3CH4B 1W0JD 3GD7A 5JWHA 4DJTA 4XVUA 1DADA 3SI7A 4LJAA 4KAXA 1WMSA 4ACBA 2ZUDA 2QA5A 3C16C 1PJRA 1HA3A 1II0A 3OEHD 4P4UA 4UQOA 2NPFA 5CLLA 4HZUA 1TTTA 4A0FA 2ZREA 3GJXC 2J7KA 3QEOA 1C1YA 5KOYA 2A5FA 1YR7A 1R0WA 3ECCA 3SYLA 1TQDA 2VPPA 5EXSA 2O52A 3KQKA 3WYAA 2Z4RA 721PA 4KYIB 4PHTA 2ZPTX 4M9ZA 3MFYA 3VNVA 1T3HA 3ETLA 2VP4A 5DI3A 1NBMD 2DY1A 3CNNA 4O0MA 4C2TA 4AYWA 1KZ7B 1IM2A 3R9XA 2C96A 4TT3A 5DYIA 5GJCA 3CIOA 1W4BA 4LJ6A 4MQBA 1T4GA 1CJTC 5DI3B 2G0TA 2J0QA 2Q9BA 4CGZA 1JALA 1S9HA 3BFKA 4CT4B 1XBTA 3HJNA 1VDZA 4A15A 3I5YA 3W90A 1GUAA 4PC2A 3X1XA 3LQRA 4OHWA 1E96A 3GMTA 5FOUA 4P0TA 3LO5A 3SYKA 4TSFA 1S1MA 2ZJAA 1NVXQ 1E9CA 1M7BA 1N6LA 2H1LA 2GK6A 4KVAA 4ZPXA 4YMVA 4A8JC 2R44A 1U98A 5EE9A 3WNDA 4KLZA 2IYYA 1TPZA 4E03A 4MITA 3PUVA 4JKYA 3IIKA 4W7SA 3HR8A 3GLGE 1CJKC 4D81A 4XSHA 1SULA 3GJ0A 4L16A 4C3ZA 2PLFA 3Q72A 4DCSA 1D5CA 1W47A 4LX0A 3MSXA 4TLDA 4YC7A 3W8NA 3A4LA 4JJKA 2WHXA 2G0NA 1AS3A 1TEXA 3B85A 3QPUA 4PXAA 1XD2A 5IF9A 2ZRGA 1R4AA 2F1HA 1MABB 1AZSC 1XP8A 4HI0E 1R10A 2QSYA 1FX0B 4OQMA 2VEDA 3VTKA 1SZPA 4CZ2A 4POAA 3WRXC 4TT3D 1LS1A 5BQ5A 4EFNA 5AJXA 1RKBA 4ZIRB 3NBXX 1C9KA 3HPQA 1L4UA 3RS7A 4TZ6A 3LW7A 3P4YA 4LJ9A 2G1KA 4EPXA 1ZM2A 1LV7A 5KU1A 4Q9LA 2CNWA 1G5TA 2OXCA 4GNKA 1DAIA 1GG2A 2YVUA 4LPSA 3CUEF 4PTLA 2RGNC 3N70A 4IDOA 2FSHA 5JCZA 3W9YA 1OXVA 1E2IA 3RSOA 3X1DA 1E32A 2WICA 3GLFE 4HSEA 4B2PA 1ZIPA 5K8LA 1CS4C 3WNCA 4TYPA 1VG1A 4MRSA 4LJ7A 3RDPA 4CT5A 2W6JD 4B3GA 3LDAA 1Z28A 3Q9LA 3DZDA 1P73A 1YZGA 3MMPA 3BK7A 1W1WA 1Z6YA 2HCBA 4FCVA 4OQNA 4PX9A 1OKKA 2WWHA 2I3BA 2AFHE 1F60A 4UXHA 4AWXA 5JBQA 2RHMA 4DLYA 2AL7A 2QN6A 5EE3A 1MRNA 1VG9B 2O8EB 4EPRA 1E2MA 3L0OA 4MGIR 3QKSB 4Z1MD 3BXZA 3TE6A 1XZQA 1UBGA 2O0HA 2FFQA 1FNMA 2GZHA 3NHBA 3QKSA 4DLXA 2B8TA 2QNRA 2WV9A 4EPVA 1ZP6A 3FOZA 2WMOB 1VKJA 3BC1A 4N0DA 4M1OA 4C2UA 1NSFA 1OSNA 1KGDA 5CM9C 4LV6A 1Z2AA 1ZD1A 3U3RA 1E1QA 1D6JA 5EE5B 1N25A 5DHFA 2XITA 4AG6A 4JLVA 4DCNA 3VQTA 3VKWA 2OHFA 3RWOA 3TJZA 3A1SA 3GFOA 4BLTA 5BXQC 3K70C 4TTRA 3C5CA 2R8RA 2PT7A 3GJ4A 4B48A 3SHWA 3KJGA 3BJIC 3WHKA 3ZQJA 5L3SB 1NLYA 2C03A 4N3NA 4S35A 4NYJQ 3ZVNA 2ZSDA 3PFIA 2C78A 1UKEA 3T61A 1RPZA 2WWGA 1D9ZA 3U5ZB 2OCPA 3I4LA 4MGYR 4EFLA 1OJLA 4G5QA 3AF2A 5FPSA 4EJSA 1XTQA 4DRZA 4NCNA 2I4IA 3SYNA 4FW9A 3UG6A 3SQWA 2ZR0A 5DISB 3RS3A 2FFAA 2R6AA 4EAQA 2XSZD 4TMXA 3RC3A 3W3AA 1VECA 4OYHA 3AKDA 1CJVC 2UVQA 4DB2A 4B71A 5AUPB 2PJZA 1Z6GA 4BFXA 4YQFA 4OQLA 1R7RA 3BORA 1EK0A 4D82A 4UNNA 2QPTA 4YMUA 1ZD8A 2GBLC 1NP6A 4BLOA 3WMEA 4RCZA 3K0CC 4MGZR 4U02A 4RFSA 3QI2A 2VSFA 2XJ9A 2KE5A 5DI9A 4EJSB 1UDWA 3UG7A 621PA 2H17A 1NF3A 3ZVMA 1E2HA 1OFTA 1AKYA 3TAHA 2FDCA 1KSFX 4L15A 3WNBA 2O8FA 2Q21A 3CWQA 2GHIA 5JECA 4PHHA 1II8A 5BN3A 3QBTA 5EE0A 1NG9A 4MYUA 1F3OA 1SXJB 5EUMA 5BW8A 3EG5A 1OH5A 1TQ6A 4QOSA 2P0EA 2GBLA 4KBFA 4DDTA 4GL2A 1BH2A 4JMPA 1DELA 4B3XA 2G3YA 3KFVA 4CRWB 2BM0A 3MGCA 1KMQA 2ZS7A 5ELXA 3K9NA 4LYAA 2FN4A 2BJWA 2ZAOA 3DL0A 3V4FA 1W4RA 2JGNA 4OI4A 4YDHB 4GOKA 4IDQA 4HAZA 4ZKDA 1H8HA 1U8ZA 3ZQ6A 4BPBA 2OFWA 1CJMA 1DBSA 5HPYB 3PUXA 1E1QD 4Q9HA 4XIGS 5C4GB 4PQRA 2P6RA 1G5PA 3LBNA 1ZNWA 2NZ8A 1LVGA 2F3RA 1KO7A 3AVYA 2IXEA 3AV0B 1NSTA 1Z63A 1SGWA 2Q9CA 3A58B 3IO5A 4HAYA 2DBYA 2BBWA 4ZDIA 3NBYC 2JDID 1IXRC 1ZUNB 3EC2A 2CL6X 2IYWA 4TN1A 4RD0A 1F2UA 3O8DA 4M1MA 3HR7A 5FOTA 2EFEB 1NVVR 3I3SR 4TL6A 2AXNA 3AVUA 4JLMA 4RJLA 1TU3A 4LSGA 3FMPB 2DPXA 4KVGA 1P61B 4DCVA 1Q44A 2CDNA 4OHYA 3B9QA 3Q5EA 4WBSA 4TL9A 1CRPA 5FTLA 2O8CB 4PZLA 3SU8A 3PITA 2PEZA 3PR1A 1R0ZA 2WVJA 4RSGA 2IYVA 1NVVQ 2BDTA 1ZJ6A 2QMEA 3BGWA 1Z0IA 3I8XA 1TUIA 3IO3A 4BRUA 3AVVA 3PEUA 2ATVA 2IEZA 4LJ8A 3I32A 1YVDA 3KJEA 5BN5A 4TMWA 1L2TA 4PPQA 4PPFA 3LVQE 4NPHA 4K46A 2VA8A 2V6IA 2GXAA 3TNFA 5DYGA 4CDGA 2OSBA 1H8EA 1CIPA 3RANA 1W2HA 1ZC4A 3MUFA 2ZRFA 4MKGA 4WIAA 2OAQ1 1CR4A 3VX3A 3F8TA 4DLZA 2IYXA 5AWFC 4V0MA 3TRFA 3ZH9B 1DAMA 1FZQA 3LW8A 2AKYA 3T34A 1JQLB 1JBKA 5FOVA 1E9BA 4Q1CA 5FTNA 3RRMA 2OLKA 2GJ9A 4D2IA 1QRAA 3AH8A 2IHYA 1EFRD 1XEXB 2JJ8A 1RRGA 2ZU0C 2IWRA 3TMKA 4ZKEA 3RWMB 3NC1C 1U99A 3LVRE 1XTIA 4HAUA 2HEIA 3BB1A 4ZCLA 1MO5A 2WM9B 1A2KC 4C0AC 2RGAA 1NMXA 4KXFB 4BLSA 1G64A 3KZ1E 4OK6A 4QM6A 1A7JA 5C1BA 1VG8A 1RC8A 2Q3FA 2SHKA 4ZDJA 1TEVA 2D4HA 3TK1A 3OE7D 2XZOA 4A2WA 1SVSA 3V00A 4W5HA 2QY9A 4Y0AA 1ODFA 4DLSA 4JKIA 2XB2A 2PBRA 1NN5A 4OQFA 2GRJA 1KJZA 4MKIA 2VHTA 3EWAA 1HQCA 3AKEA 3WHLA 1KSGA 5JEDA 4IKEA 1RW4A 4KFTA 1G4UR 4YLGA 2JDIA 3PUZA 4HYYA 3NVAA 2KBEA 4IW3B 1N0VC 4HLDA 5HKKD 4V0NA 4NZYA 3U4QB 3CRMA 4EPYA 2WAXA 1KDRA 1JEEA 4IEIA 3C14C 3RRNA 3PENA 1CXZA 2ZSBA 1G8YA 2IK8A 5LB4A 5HR5A 3T1OA 3AVWA 3EW9A 2RHDA 2FFHA 4IDHA 5JEEA 1R0XA 4UNRA 5BYJA 3AVPA 2R65A 3QXCA 1F48A 2CMKA 4JJZA 1ZD9A 5HCIA 2RMKA 3EWSA 1COWD 3EZ9A 3NIBA 4JSTA 3R7WA 3GJ7A 5G53C 4Q47A 4BLPA 4GZLA 3R8CA 1OLOA 1GAJA 1DPFA 3B6EA 3U3JA 2F3TA 5KDDA 3RNLA 1Z06A 2ZSEA 4HUQB 1U0LA 1Y63A 2WZQA 4IDNA 2NPIA 2DFLA 4DIDA 3AP2A 3HU1A 3RAPR 5LD2B 5FBRB 1G7SA 3U61B 1R5BA 1NN0A 1S96A 2ZI5A 3TGPA 4QXAA 1II8B 2CXXA 3F5FA 3M6AA 4TL8A 5J4YA 2P5TB 4BQSA 1S0UA 1XMSA 4HZIA 4LRWA 3O8CA 4R9UC 221PA 2ZAMA 1NJFA 4A2PA 2QMHA 3T15A 4XWAA 3QVVA 1Q1QA 1NNEA 2NO0A 5EZ6B 2A30A 4KHZA 4QJ5A 3GLIB 1NN3A 2R6DA 5FR2A 1NY5A 2A5GA 4UNPA 1W49A 4JLDA 2BMFA 3CNLA 4ZDKA 2V4ZA 1FX0A 1K5DA 4MRVA 4Q1DA 3VHXA 5JI2E 4JVSB 5CDFE 1P9WA 1BYIA 4HDCA 4JVNA 3S1AB 3U3MA 3CM0A 4H1UA 4ZCMA 5JWOA 3B7GA 3F0TA 5D3MA 2ZRDA 2PT5A 5E7IA 5FPHA 3EPKA 3AF4A 1RRFA 1SHKA 3K1JA 1HY3A 2W2XA 2JAQA 5FUVA 2CCKA 5LB2A 2IC5A 2V54A 4MA4A 2D2EA 2PX0A 4FWTA 2J9RA 3I73A 4BFWA 4LHWA 3FB4A 3U60B 2F55A 2JA1A 2V6JA 1XD8A 5K8UA 2V7QA 4LJ5A 1G5RA 2O5VA 2WIAA 4KITB 4DSUA 2B7CA 2ZIAA 2FH5B 3EZ2A 4YDSA 3FFBA 1XPRA 1Z07A 4P4SA 1RJ9B 2RH5A 2RGNA 1XTSA 4EIWA 2OXRA 4V0ME 3FHCB 2REXB 3VR5A 2D74A 2X1VA 2BJVA 3FE2A 4IRUB 2NMVA 4YMSA 2IXFA 1QBKC 3T5GA 1ESMA 2ZJZA 1G6HA 1M8PA 2EYQA 4GP6A 5HCNA 3IPYA 2D2FA 4PAMA 3KQLA 2CK3A 1W0JA 4V03A 1P4SA 5CDFA 1R8SA 1E94E 4TMTA 3E5HA 2ZXUA 1B23P 3QNUA 4JLJA 1MT0A 1Q1EA 3JZAA 4B74A 2NO9A 3AF0A 1F6BA 1CR1A 4RD3A 1XD2B 4LGMA 2ODWA 3REGA 2MSCB 1LY1A 3BB4A 3MWYW 2W6IA 4ZI2A 5CJ2A 5AUNB 1WA5A 4FIDA 4HB3A 1QHHB 1Z29A 2AR7A 1VIYA 4MUAA 2ZRIA 4PQFA 3BH7A 4DB4A 2ZVPX 1KDOA 1SVMA 1YR9A 3I92A 2HCJB 2EQBA 3IDQA 4PAOA 2W0MA 4ON9A 1OYYA 1LB1B 4KFSA 2FMXA 3THWA 3PV0A 3REFA 5TXGA 3BERA 1KHTA 1RRPA 5GJVC 2BMJA 5DSZA 3CWZA 1KI9A 1MR3F 4ZCIA 4UJ5A 3WP1B 1SXJA 2QMUA 1XDBA 1NY6A 4C0SA 4O2LA 3GLHE 4HLUA 2BKUA 3GLHB 5F9FA 1V43A 5DLQC 1EWQA 3M4YA 3SE0A 5CYPA 3SOPA 1M6NA 3QKRA 3K53A 5TARA 4WZAE 2FFBA 1ZM7A 3DO6A 2QBYB 2ZI9A 3MAAC 3BH6A 3A1UA 1QZXA 3GEEA 3NWJA 3K0AB 2V7QD 1BMFD 2YC2C 2OE2A 3GEHA 3MRSA 3MWLA 3T35A 2JLRA 4JVMA 2JJ1A 4ITRC 2REBA 2WKRA 4NCJA 4R2IA 5B2ZA 5SZJA 5CM8B 2EW1A 4KCGA 1X1SA 1KO1A 1FUUA 3OFND 4M9SA 1E9FA 5KTYA 1OFUX 3RSLA 3Q85A 5CYOA 5JJKA 2YOHA 1G6OA 3MWJA 5JS7A 4G5GA 1E2EA 1KI6A 1AK2A 2ZUCA 4DLUA 3GJ5A 4F38A 3THYB 1GTVA 1E0SA 5TV2A 2RGXA 5CLQA 1SVWA 1XEXA 5DNYB 1ONBA 4AKEA 2QP3A 4NP6A 5B57C 4FCTA 4E22A 4C7OB 1E9RA 5G3ZA 1JI0A 1N6NA 4QHSA 3B9PA 3QXJA 2FGKA 2WWYA 5CB8A 1M7GA 2FG5A 3BE4A 2OBLA 1JR3D 1U9IA 3B5JA 1COWA 2GILA 3IGFA 1CR0A 2Z83A 3KFXA 1BYUA 2PZEA 2AWNA 2E9SA 2MMGA 3HDTA 2RGEA 3SBEA 3B78A 2DWOA 3QXHA 1Z6AA 1NIPA 1QG2A 3DOEA 1JXMA 2FF7A 2GNOA 1SVOA 4H9GA 4Q1BA 2ZE5A 5E7MA 3WBJA 2IL1A 1DOAA 3LX8A 4GI7A 5D3QA 4GFDA 2BCGY 3KKPA 4MYHA 5G40A 4C0LA 1DG3A 1EXMA 2PZFA 3NDPA 1XNJA 1E0KA 2MMCA 4NYIQ 1Z2CA 4Q9JA 3A6PC 4KYUA 4Q4JB 1W48A 4A0HA 1OIWA 1XX6A 2CL0X 4PC1A 3RS4A 4B47A 1WBDA 2LWIA 2I1VB 1P2UA 1J99A 3EIHA 3FKSA 2ZRKA 4B35A 1TX4B 3KKQA 4BFZA 2B6HA 2BV3A 3CZQA 3DMNA 5JLJA 2O8DB 3CO5A 1KZGB 1G8PA 4F91B 2J0VA 4OI0A 2ODBA 1E79D 4FMCF 4ZIRA 5L3RA 3VAAA 4M1SA 1QHNA 2CCGA 3NHAA 2BKEA 1UM8A 3SS8A 1L7VC 3LV8A 4F92B 4IXNA 1NIJA 3B1ZA 1HE1C 1KKLA 3EPJA 4I1SA 3FMOB 1BMFA 3DM5A 2VP6A 4HAWA 1FNNA 2C99A 2W2VA 1P60A 1QHHA 1SVKA 5AJVB 2YWFA 2IEYA 3U7HB 3NBFA 5IDVA 1AN0A 1T3SA 1UEJA 2HXYA 4V0LA 3SFZA 5JZVA 5LPNA 2GCNA 1XMIA 1XFAA 3TUIC 5GVSA 2C9YA 2NZJA 4PHFA 4AK9A 4HZUB 3ICQB 2B92A 3THYA 4DUGA 1N0UA 3K0FA 1ZNZA 4EQ6B 2H8KA 1FPMA 3B82A 1MO6A 1KK1A 3EARA 2ZJYA 1NN1A 1YE8A 4ARZA 1E2FA 1GNPA 2ZR9A 3A36A 4C7OA 2A2ZA 3SJBA 4JLOA 1DS6A 2BEKA 2O8BB 5FL7A 1KK3A 3CF6R 1CP2A 3CRW1 2O8EA 2GXSA 2FSGA 3GP8A 1DO0A 2OESA 2OBNA 1D8TA 1UDXA 5B58C 4QG7A 3QBVA 4P4SB 3N2IA 4ZO4A 2W58A 1SVIA 2IYZA 3PEVA 2RGCA 1KI3A 1U9IC 1R8QA 1KI7A 4M0LA 1EX6A 3PEWA 2VP9A 2VP0A 3TVDA 1AS2A 3W34A 3Q7QA 2CHQA 2F1IA 1EG7A 4KO8A 1Q20A 4JLPA 4BLRA 2O8BA 2J45A 1E4VA 3DOFA 1E2LA 2ZJ2A 3HP1A 2QQEA 1MH1A 2ZI4A 5J4VA 3FTQA 3LX5A 3ZYCA 3A4MA 2H18A 1KI6B 2WKPA 1KNQA 2ANCA 4KU4A 1ZMXA 1TF7A 3L0PA 4DC9A 3T12A 1OT3A 4JBXA 3U44B 1VTKA 1DARA 2QGNA 4ABYA 3EPHA 4CEJA 4QFMA 1FL9A 2DFTA 2WBLC 4LV5B 5HTKA 2IYRA 3R9IA 4RD4A 4PANA 2R9VA 4OL0A 2G83A 2P3SA 3ZS9A 2N42A 1G291 2CK3D 2QP9X 3S1AA 2X2FA 3WRYC 2WJGA 1Q3TA 4Q7MB 5SZKB 1ZM3A 5KSPA 4Q7KA 1IN8A 1NVUQ 4YXWD 2YC4C 4DCUA 2Q9AA 2CLCX 2ZANA 2E1RA 4QJ4A 1E79A 3OIUA 4BZQA 5H8WA 1LW7A 1O3YA 2C2HA 3WYFA 3ADKA 5JRJA 4KFRA 2WJHA 1IN5A 1TF5A 2P2LA 3BIFA 2EFGA 2Q0HA 2X2EA 1P5ZB 3BH0A 3GLGA 3THXA 1FTSA 1G1MA 3K8YA 4RKFA 4IVPA 3T5DA 1E2GA 1X1RA 1JR3E 3AVXA 4AI6A 2YWEA 3GLGB 2WPDA 1X86B 2N46A 3BS4A 4HDOB 2CHVA 1Z6XA 4PO8A 1JB1A 4FMDB 3VFDA 4L9SA 4GOXA 2EFHB 5AUQA 3R9WA 4EJSC 1XMVA 1XPUA 2VL7A 2FJUA 1P72A 2J1LA 2FOLA 4TMKA 4B32A 5K8TA 3GLIE 4MDFA 2EWWA 1AQYA 1CU1A 2WSMA 3D7MA 4L9WA 1NJGA 4D4LA 1HH4A 2RGDA 3FGNA 3Q3JB 1JECA 4P3YA 1G21E 4NH0A 1MO3A 4HAXA 1KMHB 4QGGA 2W83A 1VHTA 1Z6TA 1P9NA 4PZYA 3SFVA 3V9PA 1FMLA 4D26A 5FPKA 5UKDA 5KNDA 2IS4A 1E3MA 2AFIE 2Z5FA 4B6EA 1G4AE 4WA7A 3OFNA 4XWKA 2R6CA 4QBFA 1D9XA 4B3BA 4DSOA 1EGAA 2O8CA 5EXPA 2JATA 1U0JA 4N1AA 1XEFA 2O0KA 3DEFA 2F43B 1E2KA 3CBQA 1I4LD 4YONB 4D4JA 1FP7A 3QY0A 4A9AA 2XNDD 1KSJA 5D3MB 4YXWA 4QJ3A 3UIEA 2JIZD 3CX6A 1OHHA 3DMDA 4PC7A 2VQSA 2JLSA 3ONWA 2HYIC 2VTKA 3EAQA 4FMCB 3SNHA 4FN5A 2XOKA 1QVRA 4BFTA 1T0HB 5FI1B 5EE1A 3R20A 3EC1A 2AD5A 3GJ8A 5LBIA 1P2SA 1ZW6A 4JYCA 1F5NA 3B1XA 1LF0A 4LJYA 2NO1A 2CE2X 4DLTA 1WB9A 4AIIA 2HDNB 4LWZA 2D7CA 2QEQA 3AVTA 4Z51A 1JAIA 3C5HA 5GJWC 3A8TA 3UPUA 3AM1A 2GF0A 3AF3A 3TH5A 3ZVLA 4JYBA 4GDFA 1CBUA 1DAKA 4HDQB 4AG5A 3HU2A 2F1RA 2RGGA 4LC0A 3A1VA 2PL3A 4C0BA 4TYWA 4Q48A 1XF9A 2QMOA 2H5EA 2RB4A 4MRRA 4JBYA 4I81A 4Q9KA 1GFIA 5A5GA 4Q02A 6Q21A 2OO7A 3O47A 2WJYA 2J41A 1GRRA 1R6BX 3ZDQA 4RKEA 2NIPA 4RD1A 1WE2A 3CRVA 2A78A 1U90A 2IYLD 3KKMA 3OESA 2FPMA 4LY6A 1T5IA 3V4RA 1Q57A 5KNCA 4ARZB 4Q5IA 4QGAA 1T5LA 3WMGA 4G3XA 4A6XA 1KSHA 1JQJC 2QAJA 1Z0DA 2B7BA 3GLHA 4PHGA 3C4JA 2DR3A 1CJUC 3X1WA 5A4JA 1G19A 1Q22A 4C0HA 4TQAA 1U0HC 1YU9A 2Z0MA 2YV5A 1Z5ZA 1GKYA 4TYYA 2PZGA 1YRAA 2JASA 4ESVA 1L4YA 3KJIA 3OAAA 1AKEA 4IFEA 2VBCA 3SR0A 1ZIOA 3LD9A 2HUPA 2QP4A 5AJYA 3KUDA 3KXKA 3IEVA 4AKIA 2QSZA 1E2QA 1F2TB 5CITA 1RJ9A 3AB3A 3FDIA 5JS8A 4BLQA 4XSGA 2Z43A 3A4NA 5DIFA 3KL4A 2QAGB 1P2TA 4IVQA 2CEAA 3KKOA 1ZINA 1T6NA 2GESA 2J0UA 1IHUA 3AGQA 1SHZA 1F2UB 2H16A 2VF7A 1BS1A 1V5WA 2VP2A 4PQYA 4B43A 4LOAA 3VR4A 3O8RA 3B1VA 3NC0C 1JJVA 1Z0AA 1KTVA 2PEYA 3ZD7A 3PCRB 2V8OA 3FPAA 2HV8A 2GEVA 2ZRBA 1RYHA 3LBHA 4DT1B 4F93B 1AQUA 2YHSA 1P3JA 1N6IA 3FHOA 5LD2C 3L8YA 4US0R 3QG1A 4LC1A 2GCOB 3QOFA 4TLEA 3GQBA 4F7WA 2VSXA 3NG1A 3P32A 1Q12A 1WDTA 3PG5A 3AGPA 5EP3A 4NYMR 4EDHA 4HLCA 3LFUA 3A1WA 2IF0A 4LUCA 3IKJA 1W5TA 4OJKA 4FWIB 1BIFA 2VRWA 3T1VA 3W5JA 3W3ZB 4EUNA 1TAGA 3FYHA 4QL3A 1WF3A 1UBCA 1ZC3A 4OKSA 3U3OA 1G20E 1MOZA 2WJIA 2GAOA 4LJ4A 2HT1A 1CRQA 2QRZA 4A0RA 3I62A 2XAUA 1J90A 4TLCA 2ZR7A 4OI2A 3RVBA 1EFHA 4IHQA 3AP1A 1I2MA 1KAOA 4MRNA 1CEEA 2H92A 4Z8XA 2OM2A 4AYXA 4PO9A 5TVKA 4E07A 1UPTA 1NBME 4AYTA 1YZLA 3QF4B 1XB2A 5E4FA 4NBSA 3AEZA 4HLQB 4M1KA 5DN6D 4OHZA 1S1CA 1UAAA 1G7CA 5CIQA 4TQ9A 3H4MA 1VCOA 4PPNA 4JT2A 2VSOA 1M7HA 1OXUA 2ZSFA 2CJWB 1W44A 4WW0A 1HT2E 2G6BA 1SVLA 3K70D 3EIQA 3BB3A 1GP2A 2J59A 4P32A 1NL3A 5FBVB 4RFVA 3JZMA 3J81k 5J47A 2JLYA 1TU4A 4MYCA 2FV8A 4PZZA 4WVFA 4CIDA 4M9QA 4DBLC 1QVAA 3HWSA 2HLDD 3KTAB 3VR3A 3U44A 4BEJA 2JLXA 2FEMA 2GAAA 4A1FA 2OFOA 1Q1ZA 4DHEA 3FKSD 1P6XA 2CBZA 3OIVA 4MYTA 2GTPA 3TW4A 1BKDR 1H8HD 2CJWA 5J40A 4HB2A 4MGKR 3B1YA 3UK6A 3EZFA 2YZ2A 2VHUA 3OF5A 3X1ZA 1YR6A 2PCLA 1ZVQA 2CNWD 4UJ3A 3RYTC 2NO7A 3K9LA 3OIWA 2VYFA 4OHVA 3RC8A 4LBYA 4Q00A 4BRWA 4M4SA 1MABA 1OYWA 2FU5C 1E0JA 1JPJA 4FINA 1N6OA 4FCWA 5B30A 3TSWA 4R71A 3BOSA 2QUZA 1KK2A 5E95A 2KI5A 5G3YA 1PV4A 3IUYA 1PZNA 2JIZA 3B13B 4MKFA 4F4IA 2BOVA 2PCJA 4YMWA 3SBDA 2KB0A 3BFVA 5TMPA 2W0SA 3TUZC 1IXZA 4D25A 4JLKA 1RZ3A 1OXTA 4DLVA 3O8BA 1M74A 1HE8B 5EUQB 4QBGB 3THXB 2XTZA 3VU9A 3BRWD 2ONJA 4Q1AA 3KDSE 1RIFA 1XTKA 1E1RA 2GVDC 5A0FA 4BFSA 2LCFA 3ND8A 3JVVA 3PJRA 4A82A 2ZSAA 1U8YA 1AM4D 1AZTA 2Z6VA 4CEHA 2JEOA 8OHMA 4JIMA 4Q4LA 3TBKA 1M34E 1C4OA 2ZRHA 3MWKA 1FMJA 1YRBA 2XEXA 4NL4H 5DGXA 1GL9B 2BWJA 5CB6A 2GDJA 2AX4A 5KO2A 2ZITA 2YOFA 5KNBA 2WWFA 4CEIB 1QHYA 1JAHA 3ZZTA 4DCTA 1E9AA 1YJ5A 2GWHA 2QTFA 3GCGA 3LA6A 1E69A 1I4DD 4EQ6A 2IYTA 4DWJA 1VYTA 5HE9A 3QPWA 4BGDA 3QQ5A 1VCMA 3NBZC 4NU0A 4US2R 2J7PA 2ZS8A 1N3BA 2QU8A 1OW3B 2HF8A 4LDJA 4B76A 4JSYA 2ZS9A 4ILEA 4WAUA 1ESNA 3LY5A 4MDEA 4O3MA 3IEUA 1SKYE 5FUWA 3BFXA 1ZCAA 4NTZA 3IBYA 5J4KA 1X3SA 2GKSA 5L3SA 1VPLA 3T06B 3PUWA 1OB2A 3BD9A 1OH6A 1GZSA 1QHXA 4EPTA 2FEOA 4Q1FA 4U5XA 1US8B 1U81A 3VR6A 2W2TA 3KXLA 4CW7A 1DTSA 2JLQA 4QNMA 3RRYA 5H68A 5LDDC 3K0AA 1KY3A 4ASUD 1KDPA 3EPLA 4IVRA 3FWYA 4V0KA 1KKMA 2JLZA 3GJ6A 4XOIA 4RY2A 1XPOA 4ESHA 4H1VA 4HB0A 2PMDA 1EFUA 1NRJB 4C0QC 2OEPA 1PLLA 4CF7A 4N0EA 3WY9A 2DWQA 2HXSA 2P65A 421PA 2PX3A 4IDPA 1Q1BA 3TKLA 2GJKA 2R6FA 5KDLA 5FR1A 4Z8YA 1E1RD 5JCPA 1KY2A 1DAEA 1J7KA 4UNQA 4XWOA 1Z22A 3F3YA 4AD8A 1UBEA 4RFSB 1N2CE 3QSYA 3X1YA 5L3QB 1FUKA 1P7CA 1T9HA 2BEJA 2A5YB 1KI8A 1GL7A 4G5SA 4G5OA 2YNMA 2XOKD 2W6JA 4P33A 1IXSB 3QG5A 1SXJD 3ICEA 3GLFA 4QC2A 1YZQA 1F2TA 2AK2A 3ASYA 3ZVRA 2AK3A 5C18A 2YKGA 2QT1A 5EXXA 3KX2A 2BC9A 3THOA 3IQXA 3SC3A 2P67A 3R8FA 5FFMA 2QPAA 3UWKA 3E2IA 2J46A 4LK2A 2GEUA 1OV4A 1PUIA 3CZPA 3NH9A 3SZRA 2QQ0A 1UKVY 2XB4A 1WBBA 2BVNA 521PA 3EX7C 4D80A 3BAFA 4EPWA 2EYUA 2VLIA 2P5SA 3H86A 3ZZUA 4DSNA 5DE3A 1AS0A 3UMFA 2NO6A 4Q4AB 2BCJQ 3H84A 1G16A 2HJVA 3NEYA 3UWOA 5K8IA 4D6PA 4LHXA 3AUXA 1XD9A 3U6KA 1GRQA 4A2QA 1ELOA 5FI0B 2ZI7A 2G9NA 1DE0A 2YOGA 3CNOA 3B8HA 4B34A 1D2NA 2FE4A 3CB4A 5DHAA 4ZI3A 2X19A 4NMMA 1CR2A 2AHOA 3K0SA 1VHLA 4D4KA 2Q3MA 3ZJYA 3RS2A 4UKDA 3QF4A 3VX4A 4LYFA 1W2GA 1AA9A 1E9DA 3EXAA 2CVHA 5FBQB 4BFYA 1H8ED 3VU9B 3C7KA 5KYKA 1ZUIA 1LF5A 5BYKA 3GJ3A 121PA 4I1OA 3GPLA 2XXAB 1DAGA 5AR1A 1W4AA 2ZI6A 2ZYVX 1P9RA 1S9DA 2LKCA 1W36C 1G41A 1XTRA 1GSIA 4URZR 3RABA 2QPOA 3TUJC 4E09A 3GFPA 1HUQA 1U2RA 1GWNA 2ZRCA 4C0KA 3DZ8A 4Q01A 1RFLA 3IHWA
chains in the Genus database with same CATH superfamily
2B2CA 2OK7A 2F6RA 5GVRA 5SZIA 2VN8A 3GGSA 3CZMA 5C2JB 3W5SA 3G5TA 1P5RA 4EZIA 1DO2A 2OV3A 3IBTA 1U2QA 4TKUB 3U9TA 5IDXA 1K7XB 3UUEA 4ZMBA 1E6CA 1I2ZA 3EPJA 4JLAA 3HCEA 3KVNA 3BT7A 2IODA 3TD2A 4HG2A 1M2KA 2M1XA 4DLRA 4NKRA 4LWOA 5ICMA 3MILA 4URUR 2PUHA 2JGDA 1CUFA 1ES9A 1JMVA 3KSMA 4I55F 1GPNA 4NZZA 2E87A 2F2TA 1TMGE 4B3FX 4PBRA 4UEOA 3FD8A 3JYLA 4M21A 3HVUA 3T0FA 5HNKA 1U31A 1IHDA 1QJ4A 1LV8A 2DCUA 3H04A 3NOOA 5ALMA 3T9CA 3FOWA 2JI7A 3G5LA 4A8TA 5I9LA 1F5SA 4DVGA 3R0ZA 1A9YA 2ZJOA 3BGIA 3CA8A 1TF2A 4KUHA 4M49A 4UULA 4W8OA 4Y0VA 4PLHA 5AQEA 3VC7A 3QE3A 2CKDA 3MBIA 4ND3A 1KYIA 1PS8A 5H70A 4CR6A 1RWMA 2C5LA 4HWTA 3HO1A 1MAHA 2NZVG 1E99A 1ML4A 4UPVA 3VHLB 2EFJA 2ZYTX 3RT9A 3TOXA 3ZWDA 2OPHA 3ZHQA 3D1JA 4MUBA 2PMCA 5TEVA 5TNXA 4KK3A 3SEAA 4HN9A 4ZZ2A 4ZVOA 5GP1A 1CZKA 4G36A 4GEKA 2GEFA 3ZV3A 5HWSA 5KPDA 1NGSA 1T25A 4O0LA 4OK3A 2L0XA 3LI2A 4JP5A 3ZC3A 3FYSA 1QGUA 2NU7A 3KB2A 1I7SB 3W4IA 3PRKE 2V1UA 5AW3A 1Z4OA 5JS2A 4LZOA 4E94A 1V37A 1MHTA 4TZ0A 1BHO1 1AGYA 1KC3A 1NTOA 4IGKA 4MYRA 2ATXA 1NZDA 2FE1A 2H2FA 4RACA 4WLFA 2ID8A 4LV8B 2FMFA 4B44A 3V4PB 5IABA 2DBVO 3I0ZA 3ZD6A 2JJ2D 1QWOA 2OZLA 2CLIB 2Q5IA 4NR0A 4GKAA 3YASA 1LI4A 4DYVA 4PM4A 1FOEB 1SIUA 3OZAA 4WFJA 2PFKA 1YQDA 2OV2A 3K9QO 4MV5A 4QBTA 5M5BA 3GBSA 3EXFB 3L7YA 3EIXA 3P26A 1CVLA 4MR8A 4V24A 4XD7D 5FUBA 3TTVA 1JL3A 3OE1A 3SPXA 4WLVA 5IKEA 1QTIA 2HU5A 3K1AA 4TQUS 5LP6C 2P6UA 2QSJA 1AQ6A 4RYLA 5AXAA 5AW0A 1I7PA 4LCEA 2GEDA 4XPIA 1FJ2A 3LQ2A 2Z2ZA 3F4BA 3IS3A 4MPRA 4QNNA 4RY0A 1UC9A 1YRWA 3KQYA 1VMAA 3IUEA 3ZYZA 3FF1A 5K2OA 3BF7A 2MSDB 1EHIA 2GQ0A 1IC6A 1NMYA 1XI2A 1MJNA 2QG9A 2PGNA 3QPVA 4I0WB 3U7IA 3I0MA 1QR2A 2QTGA 3LLMA 4O3FA 1NULA 5IM4F 2X77A 5ALQA 4AJ2A 2F9MA 2HLNA 3MBOA 2XX3A 3OF2A 3OBIA 5ED0A 3LY7A 4OX9Y 1YBFA 3GNSA 5IVKA 3PTZA 1T3ZA 2BUAA 2VKTA 4WGFA 3W7VA 3PNVA 4OJYA 4DEYA 2DMRA 1FQKA 2FFRA 1TAQA 4D0GA 4G0NA 4WK6A 1VCNA 4C01A 1UQTA 1D2EA 4S2EA 2G88A 3TNYA 3CSUA 1N9GA 2I1QA 4KIJA 1FRFS 4Q21A 2Q99A 2VH5R 2C3UA 3BX1A 5AD1A 1PE0A 3DAGA 4GWLA 4TRJA 5FOSA 4D9JA 4EUEA 4YT4A 5B7QA 1W7AA 2WJ6A 1XZBA 2C7OA 4JXZA 3PP8A 4FOLA 3H2GA 2WB4A 2CBXA 2I2WA 3UEOA 1NXWA 2XLBA 2Z9BA 4CV0A 4L0MA 3AR2A 1P1CA 1Z0JA 2FSFA 3HA3A 1Y3AA 1ETHA 1UC5B 1VJRA 2ZIZA 2RHJA 1ODLA 3HY4A 1XEAA 4L57A 4QUHA 3T9BA 3ZK8A 4XX1A 2JFBA 5LU9A 1P9OA 4DAOA 4BTVA 2HB6A 2JGAA 1UFRA 1KO4A 4CLHA 5TB5A 5IJWA 1EDEA 2FPKA 1CNFA 4CKCA 2D0PB 3A1EA 4MUJA 4LYJA 1B3RA 2XLCA 3C6KA 2IYQA 1ZM9A 4Z7OB 1EJ0A 5DIZA 3DVAB 1CUIA 1QYXA 3OEYA 4NU5A 5C1OA 1H4QA 4RA6A 3RTCA 3SHFA 5AQ1A 4QT0A 3PQDA 4X8LA 3B60A 3MWEB 3W5IA 1L6RA 1NOIA 1ZJYA 2NWQA 3GPDG 4MV8A 4WINA 3MLAA 1QOPB 3QEJA 3DKRA 3GMDA 4N01A 1QRRA 4NECA 3WGYA 3UV7A 2MT9A 3L43A 1XK7A 1FP4B 3P4XA 5EOVA 1RM3A 5JMWA 4H35A 4WXPA 1S3GA 1FPQA 2AN5A 4FW8A 4R2HA 3C24A 4TV8F 4UZFA 5LDHA 2Q3CA 5LP6B 2XE8A 1T4CA 2EVWX 3WV5A 3WAJA 2O54A 1TCBA 3FSGA 1KHHA 1I24A 3KXIA 3QQPA 4QTTB 3FR7A 4RM2A 3CVVA 5KAMA 3UMYA 1ZNYA 2ID9A 3L0SA 3LYHA 5ICGA 3IODA 3DE2X 4D8UA 4GM1A 1MX1A 1NYRA 1UANA 4UW9A 1I2DA 2P9EA 3AKCA 3T94A 1Z34A 2I4RA 2QDXA 4FE7A 4RZXA 4JXXA 3C8DA 5LQCA 1TW3A 1Y3DE 1K7EB 4G65A 4KOAA 4OI1A 2IHVA 8MHTA 2AFVA 5ALGA 2O14A 2P3QA 4KODA 4QGHA 2RE8A 2E6KA 2PVSA 1T1IA 2J6CA 4MVJE 4F96A 1GKUB 4OQDA 3B2EA 1BCRB 4D3DA 1KA9H 2V3CC 4FKBA 5IK2D 2M9MA 2R62A 4J1SA 3WGJA 5LXTB 1VL0A 1CDOA 1GUYA 3EXEB 1LXCA 3O9VA 3IH5A 3DQZA 1RRCA 3DEKA 3I9JA 3FJ1A 4D56A 5BWMA 1ORRA 1A1VA 1R9GA 5E3HA 1HBJA 3OOJA 4IMRA 2F1JA 5DVZA 1GSOA 4PPGA 1HWYA 4FD2A 1PFQA 2P5YA 4WNIA 2E4UA 2Y9MB 3LQQA 3TI7A 4BO8A 2FUCA 1OA0A 1EUDB 3LUFA 3PE4A 4QO7A 4ZEXA 2GLUA 3DJYA 5ALEA 3OEHA 1PN3A 4RTJA 4CFZA 3UHFA 1SIBE 4U7DA 3OJLA 1WRBA 4IKPA 2ZSKA 1JGTA 2XNHA 4F72A 2MR6A 5JRZA 1X7ZB 4GP9A 1C2TA 3AFMA 1HDZA 2HA2A 3FCXA 3R40A 4CV1A 4H1HA 4Q4AA 3TXAA 3M81A 5CA1F 5JI3E 2X8AA 5JDIA 3VPXA 4KX3A 1U2DC 3OO1A 3PWKA 4M38A 2JVJA 5EP4A 4ENSA 1ISMA 1EWRA 3HJUA 2IHUA 2XYGA 1M66A 5CYFA 4P84A 2FX2A 4CTOA 2A9QA 2ZE6A 3FMFA 4EI7A 1QZ3A 1X42A 1OAKA 1SQ5A 3K0FB 1ADFA 1UJCA 2D8MA 3U39A 1O0CA 4RPKA 3E1GA 3LDFA 4B8YA 4EA8A 4OQXA 5BV2P 1G3UA 2DPGA 4DSTA 1TI7A 3A37A 3H8WA 3ABRB 3MPUA 1R5NA 4LYHA 2ODAA 4ROTA 1IZ9A 2GF9A 5IDWA 3QNWA 3CLUD 4F5YA 3QZUA 4DMLA 4GKBA 5K4AA 5A1JA 2WU8A 1XZ8A 3W6PA 3D6JA 4C0JA 5FBKA 1JU3A 1OH7A 4NMLA 2J3MA 2BEWB 4LHZA 1EX7A 1ZD4A 4DABA 1N5JA 4F11A 1O94C 3C1TA 3CGGA 3FLEA 4R8SA 3GJZA 2AMYA 4WLNA 4ZVKA 2ORIA 1L4GA 4R1QA 4ZJUA 4R3WA 3BK2A 4RM3A 4MTCA 3IQWA 3F6BX 1Z33A 1OZHA 3FYUA 3IDAA 4IUBS 1ZJ5A 4OOFA 2AQIA 4C4PA 1MV8A 1TMKA 3D3JA 2C98A 1CCWA 1OC2A 2OILA 1NXTA 2KWIA 1QK4A 1NYQA 2NU6B 2ODQA 2QRNA 3RUAA 2G9RA 4OU4A 3T52A 1VXOA 3H11A 4TQGA 3SYMA 3M1IA 4WNYA 3H4VA 2I4TA 4ND5A 5HQJA 4PLPA 3UHAA 3TW6A 4B2IA 4D3ZA 3JD1A 1S4QA 1OI7A 2GXQA 1R4ZA 1ZLXA 3EVCA 4DPKA 3I45A 2GK7A 1ZD3A 3K2BA 1GILA 2PZ8A 4JJ4A 2OOKA 2HBQA 3I1YA 4PNHA 1GLVA 1FX1A 4JEIA 1L1RA 2GPWA 1P2FA 1GV0A 1QMGA 4M2LA 3VC1A 3OT1B 2ZE7A 3HY3A 1YBVA 2FQXA 2IQIA 5BR8B 4OH7A 4ADSG 2Y8EA 4W7HA 4ZJPA 3FNIA 2PPLA 3WXMA 1WF6A 3QTLA 4WUTA 3ZY3A 1OFGA 4WKCA 4AQ7A 4XCQA 2NU6A 1ADYA 4YR7A 2YXLA 1K5HA 2HK6A 3H8VA 4UEQA 1HDEA 2WJ3A 4J7UA 4MMXB 1FS4A 4NYJR 3REQA 2YHBA 1U0TA 3DZHA 3SVTA 2FRVA 1DQNA 1DAOA 4FGSA 4RZ3A 3BTUA 4ZVPA 5KJEA 1L5SA 1SXJE 1DRWA 2A7QA 3D5QA 3L3BA 3ITDA 4GM0A 5E38A 1GN9A 2AG1A 2H4FA 4NFYA 3SZOA 1J21A 3E5NA 4OMUA 4TS1A 5F1OA 5SYAA 1U7OA 5AJWA 3P27A 1V39A 2YRFA 4J0HA 5K3DA 4D9HA 2BKLA 2R00C 1JP7A 1T3LA 3GLFB 4OYYA 3ROGA 5IWCA 5E0OA 3A6DA 4U6SA 4I4TB 5IT0A 2BR4A 5IT9A 1JX6A 3OMLA 4I1UA 4L4YA 2VUSA 4RADA 5AKLA 1K08A 3B8EA 1SKUA 2IW3A 1M5TA 1IVSA 4R1UA 5IN5A 1FSSA 3BKXA 2P6PA 4B3SB 4CJXA 2O8DA 3H83A 3IURA 5C8DA 3LUCA 2RSLA 5KSZA 3E22B 1FQJA 4B3HA 2NTVA 4JT8A 4FIZA 1H3NA 1H5NA 2QZPA 4O2BB 3I64A 4QPJC 4D92A 5BY2A 1VYVA 1EESA 3NO4A 2R79A 4HNAA 4DLWA 5ARCA 1AJEA 1M8JA 3DP7A 4A6PA 2XYRA 3CE9A 3CR8A 4HQRA 3DEYX 1T2VA 1P7PA 5CRIA 2KBFA 2PDAA 1NONA 3ASZA 1RHJA 1CZHA 1SD2A 3ORFA 4GLFA 4PO1A 4X7PA 3W4KA 3Q8MA 4C7JA 3LQKA 2FP4A 3KDPA 1EINA 3W6OA 4WCVA 4PZPA 2R1TB 2XUFA 1RBYA 3E15A 1JYEA 1YI8A 1E98A 2IYEA 4IGIA 1Q0HA 1P6QA 3W6NA 2PU7A 3C8ZA 5KNDH 4PIPA 1VCIA 1Q92A 5KPJA 3JR3A 3GJYA 2J5XA 1JSRA 3A28A 3F97A 4NCIA 4MW1A 4L8GA 3KOXA 2ZYIA 3EA5A 4IJ5A 3ZQUA 1OHHD 3FETA 4BX9A 3T3DA 2FWMX 3VV3A 4LCBA 1NUUA 1AKUA 1DXYA 4KRYA 3NXSA 4P1ZA 4XCVA 1NU8A 2X86A 4B1FA 1PLKA 2FX3A 3JRXA 3H5RA 3H1EA 3TQTA 3KD2A 3R23A 3R5JA 4IIBA 4OXYA 2AE2A 3ABSB 1KFJB 4RPLA 3ZCQA 3UATA 5IT5A 4FYWA 1SBTA 2NTYC 1ML3A 3CZCA 3D4LA 3LXXA 5BOVA 1SXJC 1IWOA 2EZ4A 1JLLA 3DOHA 3M3HA 3WV4A 4YV7A 1N5KA 1RMTA 3CYFA 4AJNA 2JLUA 1C3XA 4D9BA 2I1WA 3C8HA 4B3CA 3V4OA 4DNOA 1JW9B 3HXLA 4IOKA 3TIXB 5HF8A 4P2GA 4I50A 3ADOA 5JVDF 1EP9A 3MCAA 3OZRA 1TL7C 1G3MA 2CUKA 3PWZA 4ND4A 3VR6H 2O50A 2VZLA 1UPBA 2AHRA 4CFSA 3STWA 2IYFA 1GVHA 3EA0A 4FP9A 4TSFD 2HMVA 2KSQA 1ZMRA 3OAAD 1UZMA 1TYDE 3VKFA 1JPUA 1CX9B 3DO5A 1ZEMA 2WWTA 4XTCS 1HOTA 2O3QA 3CT6A 1T4CB 4Z6KA 1OILA 5KAPA 1XYGA 2FZWA 4G01B 1DCMA 1WP9A 4R5HA 3WWOA 3QEBZ 1LFAA 2PGDA 1V3TA 2FY8A 1W52X 3PHCA 1VLMA 3PFGA 4QXPA 3TVTA 1U2SA 1ZBDA 2YFYA 3E53A 1GPDG 3FI0A 4U3JB 4G07A 1RLOA 4R1MA 5C46F 1NUSA 1Q0ZA 1T9DA 1Y1RA 5KYGA 1O87A 4FI3C 3SZ3A 2JD1A 5HIMA 1W25A 1I51A 1HYQA 1SOMA 2X5XA 2CV0A 2X13A 1GRNA 1PSDA 4D8WA 5JW6A 1YJCA 1O96A 2Q5FA 2Y1LA 4GQIA 4KQXA 3E4DA 3G0DA 4RF2A 5KQMA 3U4QA 2Q1XA 5C7LO 4U8HA 3AFGA 2ZJ1A 4CQLB 4URXR 3CPJB 3UC9A 5JATA 3FBGA 3FNRA 5JAOA 3M6WA 4GMDA 1JQKA 2QJRA 2R3SA 2Z56A 3NCTA 1E6LA 4JLNA 4FKMA 5I48A 1GZUA 1E2PA 2BGIA 3WYEA 3R7AA 3UOAB 4PE5B 5LVAA 4JA0A 1VHQA 1EFTA 2FPLA 2H1FA 2IF2A 1ZIDA 2CN1A 4FXPA 2Q41A 3OECA 3R9XB 1DVRA 1RHQA 4J16C 4ZV9A 1GDHA 3UANA 4PIVA 4B75A 1G98A 3IE2A 4CEHB 4HQOA 4W82A 4HBGA 4QHYA 1DNPA 2PYIA 4IH4A 1SKAA 1X77A 6ABPA 3AUFA 1UUFA 1KYYA 1HORA 4NYMQ 3UY4A 4DUGD 4HVCA 1PV1A 2JFUA 1S2MA 2J3KA 4GNRA 4RGYA 3WGTA 1H94A 3AI7A 2JLVA 3L8GA 3D7SA 3JVUA 4QTYA 5LZ7A 5KHOC 2FNAA 2IS6A 3QVTA 1DEOA 4O2BF 2VZ0A 2FSIA 3J7TA 5JNTA 4YCBA 2GBPA 3FAZA 2AOVA 2IZOA 3B53X 3VMMA 4QTUB 5K5EA 1IZ0A 4K3VA 4UM5A 3ER6A 3KYDA 3VMFA 1IUPA 1W46A 3BSFA 2WOJA 3GT4A 2XA2A 5DN6A 4DSAA 5ADUS 4YLEA 3WQQA 1XALA 3CH5A 1ZL2A 4O4JF 5AW7A 1XA4A 3HKDA 1N75A 5CLHA 5D51S 2YY6A 3OQ1A 5ICSA 1N5LA 3BZWA 2A0KA 2ZXEA 3IQFA 5K0SA 1XCPA 4ROSA 5KJCA 3HXMA 3G0GA 2FZGA 1SXPA 3BQ9A 4CMIB 5HYVA 1RLUA 1QHSA 2J4DA 3PE3A 4GT1A 1HZJA 3TEMA 4AWXA 1ZU4A 2AMFA 3H5IA 3MLBA 2JKYA 3N2LA 4HQFA 5FWYA 4XWWA 1N0WA 1X80A 3QFFA 3QWAA 4LKRA 1TD1A 4PC3A 3VZRA 2NUPB 1GXSB 1K7FB 5BVHB 5I47A 1QB7A 1GG5A 1BVUA 1U4NA 4M22A 5CPBA 4YQEA 3DVRX 4HNRA 1J1ZA 4ND7A 3VPGA 2QBYA 1ORVA 2XWPA 4DNFA 2F4VB 1I6LA 3LGSA 4Y2GA 3FTEA 2PY6A 3QE0A 1W0KA 3JX9A 2JI8A 3VU1A 2PBZA 2GAIA 2XDWA 3KEGA 1SMKA 1ISIA 1Z7BA 3HUUA 4JB0A 2IP1A 4OGGA 4EHLA 1GQYA 2HPHA 3RLFA 1QPGA 4A0QA 1RMQA 4G5RA 4C9BA 1T9GR 1EVQA 3ZS8A 2W8BB 4G0PA 3WMWA 2A0XA 1T0BA 2AJCA 4HB4A 1E9EA 2AH5A 3RPEA 2Y67A 5IZCA 5LM3A 4BUJA 2HU8A 2OCYC 5AVRA 1N2ZA 4AO6A 3UMMA 1II9A 3GYGA 4H59A 4GOJA 3DBLA 4FC6A 1ZQ9A 3EJWA 3X2SA 2RHHA 2Z98A 1X1QA 4WFQA 2RH4A 5CDHA 3ESYA 2VWGA 4AY6A 2GPYA 2OFXA 4B4WA 3WKBA 4H7EA 4DDUA 4BX8A 2AN9A 5FNVA 1ODKA 3N28A 5SZHB 4F0JA 4F4CA 1WCV1 4PCUA 4B83A 3CTPA 3CNHA 1K2WA 4Z3OA 4E70A 5LMZA 2WIKA 3PXGA 1C80A 3OMXA 2RK3A 1E64A 2EEZA 2OHGA 3EPPA 4QU8A 4TXNA 4BCCA 1PTJA 1ZIYA 1ZX1A 1H9BA 1VYHA 3ZV6A 1O96B 4D3XA 3IAS1 5BURA 3O82A 5DB4A 1HQYE 2NOAA 1UKYA 1VE5A 4ZAXA 1P0MA 1UWVA 5FPTA 3REOA 1VP9A 3T38A 3GK3A 3FRIA 3O0DA 1RKVA 3C1OA 4CTNA 2XB6A 4CEIA 1EG2A 2WKWA 2WWIA 3L8MA 2WAOA 2IUEA 4DKJA 1LEHA 1MD9A 3JSAA 4ZAZA 5GONA 3VPCA 5AXBA 3EBLA 3VKGA 3ZDXB 1NPTO 2R2GA 4II7A 2Y1GA 4GBJA 2W2MA 3WIEA 1Z56C 2XEDA 3KKNA 1ZGZA 1B42A 4IFBA 5F35A 1MJ5A 2AXQA 3CKLA 1IXKA 1J09A 3KSUA 3VYRB 4DRXB 5IDQA 5MF6A 4Z0TA 3Q8XB 3R77A 1Y48E 3DBIA 2QQFA 2EFCB 2XUJA 3Q87B 4R3UC 3NHLA 1AGRA 3QHAA 1Y6FA 4BQRA 4CEJB 2H9IA 3CH4B 2B30A 2HA3A 3PIDA 4XVUA 1MRZA 1X2BA 4I4CA 2X1HA 1GAQA 4LJAA 5E6RB 2IOFA 1N3YA 2YXDA 4R68A 3ZGLA 3GHYA 2ZUDA 2QA5A 1JUDA 3COVA 3GUUA 4QYSA 1R0SA 1ZRMA 1HA3A 1II0A 4P4UA 1V11B 2BEUB 3Q98A 4P7BA 4A0FA 2YQ5A 2H1CA 4BQQA 2IY8A 3WOVA 2J08A 2J7KA 2PX4A 3WR5A 1B14A 3H2ZA 1C1YA 4DRYA 1HDGO 2VYCA 3WL6A 3AUUA 2HT1A 2V59A 3Q10A 1LTHR 4CM9A 5I6DA 2X3FA 2H0QA 4BZZA 2HKIA 1ZFNA 2P2YA 3PGMA 3ZR4B 2DR2A 1GDTA 4KPYA 3LTEA 3OM0A 4KYIB 2ZPTX 1ENOA 3U5TA 2OVFA 1B93A 3WQBA 3VNVA 3MCUA 4LE0A 3ETLA 3QUBA 2VP4A 1ZN8A 1NBMD 2C3OA 3WSVA 1PJTA 1RQ7A 3COWA 3GUYA 3IMEA 1D0IA 5B1IA 1LK0A 3TN7A 4CL2A 1M2WA 4UZSA 3NW9A 3MXTA 4MQBA 3QHPA 1CJTC 2Q0XA 2G0TA 2J0QA 2Q9BA 3JWGA 4FFNA 1S9HA 4MP8A 4DA0A 5BSTA 3ZUGA 2O7VA 1XBTA 1NX6A 2FP4B 3Q5GA 2HQ1A 3RUFA 1XZLA 3EX7C 4G24A 4RBNA 3OTOB 1RU3A 3I5YA 1Y8QB 2ADFA 1PT8A 3ZHRA 3E48A 4HNTA 3MWEA 5FOUA 3SYKA 3EZGA 4TSFA 1S1MA 1ZXBA 2ZJAA 4WSOA 2H1LA 2FIQA 5EJ7A 1YVUA 3SE7A 1TM5E 3U56A 1AO3A 3GGJA 8ADHA 3DFMA 3H9JA 1QK5A 3CLRC 3HS3A 4I9HA 4IV0A 1HNWB 4LAFA 2XCUA 1PG0A 5THKA 2OQRA 2X7HA 4HMQA 2B82A 2YCBA 4XSHA 3CZ5A 3O5AA 1XP5A 3Q72A 3QTTA 1D5CA 1LDYA 1W47A 4LX0A 4YC7A 1EK6A 3RHFA 5BUZA 3IEKA 3W8NA 2BYTA 2WHXA 1S8OA 1XD2A 1DX6A 3SX0A 1H3FA 1MABB 1AZSC 1GGKA 2M2IA 3QU4A 4TZ6A 1K1EA 5IX8A 4O4IA 4OQMA 2VEDA 3VTKA 1PKXA 4MS4B 3TOSA 1JHRA 2FAXA 2ZUSA 5BQ5A 2JK1A 2POQX 5ALZA 1I2CA 1I4WA 2C0PA 4XQ0A 1SU4A 4HCJA 3M9LA 2YYAA 2QVLA 3P4YA 4LJ9A 5FTWA 3S70A 2G1KA 2RC6A 4EPXA 1ZEJA 5KU1A 4UNIA 2PT9A 4N18A 3FZNA 2RHTA 3QFSA 1WCWA 4UEJA 3U80A 1KERA 3CUEF 3MOIA 5LQSA 2JG3A 5AKIA 2GTHA 2W8ZA 1UJ4A 2HRCA 2G9UA 3MTIA 5JFOA 1YB1A 1M0SA 4PGAA 4XKJA 3GLFE 4N40A 3KHTA 3TJMA 3WL3A 4B2PA 1CS4C 5K8LA 4MWTA 1IK4A 4H6VA 2VJYA 3F3SA 1DPGA 3WNCA 4P4GA 4TYPA 1VG1A 5CFPA 2WILA 1RXSA 1JHXA 4WJLA 3I12A 1TAUA 4CKEB 3GLUA 1HNZB 3NGLA 3TXVA 1PR3A 1RLJA 3EMDA 4LMBA 4TOIA 1ZONA 4CETA 5JSUA 4YUYA 1LPSA 3WNQA 5K8VA 4YT2A 3BK7A 4N5NA 4HXGA 4OQNA 2X0FA 2Q50A 1ACLA 4D46A 1DC4A 3E8MA 2PGXA 2WWHA 3PNMA 3HE3A 1R18A 2WZDA 4UXHA 5JBQA 1O9GA 2I2DA 3ECAA 4DJDC 4XIJA 2XCSB 2QN6A 1HFJA 2GN9A 2GN6A 1CEQA 1VG9B 1MA3A 3L0OA 4MZXA 3FH0A 5E6RA 3ZTTA 2NU9B 3Q12A 1NVDA 2O0HA 3DTYA 3AU8A 2ZIVB 1XCLA 2FP3A 2GZHA 4KQHA 2B8TA 4EY3A 3DZKA 8ABPA 2WMOB 3DZFA 4M1OA 1NSFA 1OSNA 5EG5A 2PL1A 5CM9C 3TNLA 4LV6A 1AKWA 2DTEA 2GZSA 4UCQA 1HYHA 2XITA 3PDCA 3EZYA 1JTEA 1YDFA 4FHDA 3TJZA 4INPA 4XJSA 1YDHA 2QR2A 4W9NA 3K70C 4TTRA 4NI5A 3C5CA 4N39A 1W59A 4KZKA 1BX3A 4Y67A 4AN4A 4LMAA 2O3JA 3NHKA 3KJGA 2X8JB 5K3AA 5AKZA 3ZCUA 3UXHA 2YJ5A 2XA9A 3E2MA 3ENZA 4ZVLA 2WJ4A 1NLYA 1UBNA 3FA2A 3LC7O 1QQ5A 4N3NA 3RU2A 4NYJQ 3DBOB 2IIVA 3HRKA 4YACA 5FWNA 3PFIA 2UVDA 1UKEA 3C4QA 2DTDA 4NNOA 4F06A 4KIFA 5ALOA 4RF4A 4MGYR 1JDNA 1X9IA 3KJZA 4LE2A 3C6BA 4EFLA 2CW5A 4JBGA 5TS3A 1SUCA 1PS0A 3BRQA 1Z4QA 1RR6A 4DRZA 3SYNA 3IVGA 3KHKA 1PGOA 1U5BA 4R2WA 3UG6A 3NFRA 1B00A 2HU2A 2ZR0A 3BGSA 3H7AA 3OVMA 4HV4A 2HV9A 3H2SA 4EAQA 3W3AA 3DH0A 1VECA 5LZ8A 3DF7A 4KQCA 1E6EA 2FMHA 1KR2A 4ERXA 3PBKA 1VHDA 2FEPA 2LXNA 3EOBI 2NXJA 1W8DA 1Z6GA 3MTBA 3TLZA 4BFXA 4CPDA 5EIBC 2GTIA 4JJ6A 2JBHA 1EJ2A 4D82A 3CMCO 4UNNA 1DOHA 1NP6A 1YRQA 2H1SA 1IIRA 1K63A 5DNVA 3ND5A 4RCZA 3K0CC 4MGZR 1NFFA 4I1IA 1FU4A 4I5FA 4QASA 1W35A 5H7XA 3AEQB 2O8CB 2WU0A 1U1EA 3A9UA 1C81A 3KKEA 5DI9A 3IKTA 5EEGA 1EUYA 3DE5X 4FGJA 4L9AA 3UG7A 1E1NA 1TK9A 3CPSA 4K0RA 2QJTA 3QVOA 4JV5B 4PLZA 4ATNA 3WISA 4MJ3A 4PICA 5C51B 5KCMA 1ZOSA 3GFBA 2VR1A 2XVXA 3O73A 4GW3A 4INAA 4W1SA 2GHIA 5JECA 2O2IA 3KZCA 1II8A 1K4YA 2N1MA 3QBTA 3HCAA 4MYUA 3RVOA 5EUMA 3S55A 2JCXA 1C1DA 3N05A 1TQ6A 3I34X 3R44A 5IBRA 5C37A 2P0EA 2MYNA 1A9QA 1DP4A 4BZWA 3L4BA 3KOMA 4DDTA 1J00A 5IWAB 4EHNA 4RZSA 3PHGA 4JMPA 4DDHA 1DELA 1JFVA 3HI6A 1Z88A 4CRWB 2SICE 2ZSJA 3O1IC 4DCOA 1YS6A 2O4UX 3I5UA 2JW5A 2IV7A 3A7DA 3UT5B 3WDMA 4MW6A 2ZS7A 5A9SB 5ELXA 5IUNC 3ESZA 3EEFA 4X85A 1QKKA 2CYCA 1IQ0A 4LYAA 4RA9A 2FN4A 2BJWA 3RHSA 4LE1A 1FB5A 4GOKA 3G9ZA 4N41A 1NI5A 1H8HA 4XXHA 3ZQ6A 3JVDA 3V2IA 3WK9A 2NU9A 2JH3A 4FEEA 5HPYB 2QVZX 2PWAA 1MEEA 3EQ9A 4H18A 5AMXA 1E1QD 4UUQA 4C5CA 4R1OA 3JQ8A 3ZE6A 3LBNA 2YVKA 4JEMA 1VGVA 1LVGA 5E4JA 3S5JA 5AM3A 4N6NA 1QUEA 1G38A 4YRKA 4Y2XA 3AV0B 2NXWA 3V1MA 1HL3A 2HLHA 4MTLA 3FSRA 4H7FA 3D54D 3VGPA 3LBAA 1DKOA 1Z37A 2NW6A 3D8NA 3IO5A 4JCCA 2NADA 3FLMA 4QDXA 1T9GS 3KPVA 5BR1A 4ZO6A 3DP9A 3SJ7A 3ICCA 4IIEA 1KH1A 2IYWA 3EFBA 4EO7A 2AIRA 4E2XA 1JR4A 1WDMA 2ID4A 3F47A 5G0UA 1S4MA 3I3SR 1WD7A 3TLMA 1YQEA 2HJ9A 2HK8A 1TU3A 1G8MA 3FMPB 2DUJA 4DCVA 4ZCTA 3F1LA 4F46A 3D4IA 4B3RB 2ZWOA 1VMIA 3CW9A 1GPWB 3N86A 4J3NA 5I7RA 3ORYA 2HX1A 2EGUA 3FY4A 2F8MA 1EUQA 1HM5A 3FNBA 4LRUA 1YL5A 4QULA 4F71A 1F4LA 4R2MA 5AFSA 3ZWYA 3PR1A 3ZWMA 2PN1A 2OVBA 2SKDA 3UWDA 2ZIXB 5L51A 1FYVA 3MJFA 4LN1A 1MAWA 2VBFA 2GK3A 3OUUA 1ZJ6A 5C5IA 3T5PA 4EY4A 1Y8QA 2RB5A 3GY0A 3WJAA 3IVCA 4EX6A 3VVCA 1YTLA 2R87A 3I8XA 4JASB 3IO3A 3E5RA 1BWQA 1C9DB 3PEUA 4U5QA 5E1OA 3THRA 5EJFA 3TZ6A 1A9XB 2IU4A 3O26A 4OQQA 2P0AA 4YT5A 4DA6A 2E55A 2EZTA 3LPLA 1PJCA 4K46A 1VSUA 4MCHA 2FMKA 2NAFA 1CWUA 3TLGA 4F5WA 4HYTA 1FSFA 4TV9A 2OB2A 4OTZA 4QELA 1D4FA 1NAIA 2DH5A 3VX3A 3LVBA 1PFUA 1JSZA 1ZWLA 2J3IA 4NMXB 4RETA 3IJPA 2BHSA 2IYXA 4E88A 4FZVA 4V0MA 4MLDA 5AW2A 2LPMA 3FCOA 3LW8A 3T34A 3IV6A 5DF1A 1M76A 5TEWA 1SVUA 1JQLB 2IDZA 5ALSA 5IC4A 4ZGWA 3GP5A 2FSVA 5ALHA 1BE6A 5FOVA 4Q1CA 3TVYA 3RRMA 1RM0A 1HDIA 1VB3A 2OLKA 3Q15C 3AH8A 1PZEA 2MCFA 3TLBA 4D2IA 5MN4A 3ZJUA 4F45A 2AJ8A 2JJ8A 3ZD9A 1DX9A 5FQNA 2VUHB 3DE7X 2IWRA 4U9UA 2J3DA 3GX1A 4ZKEA 2INGX 3KYCA 3LVRE 5G0WA 1NMQA 3ZTYA 4ZCLA 1SUWA 2WM9B 4ALKA 2WUWE 3DEHA 1A2KC 3O1JC 1PNQA 3NBUA 1SXHA 1TPYA 2LZ0A 3GG2A 4ZVUA 2RGAA 1NMXA 1M1YB 5KYNA 2EBWA 4H16A 4X63A 4MWZA 4RLHA 3Q40A 1WZCA 2PWPA 1VG8A 1TGYA 5BWCA 4ZDJA 4EUFA 2DETA 1TEVA 3ZXXA 4JB8A 3TK1A 2G5CA 5FADA 2QN8A 2NO5A 4JQOA 2AA3A 3LUPA 4YH1A 3D6HA 4PF1A 1KF0A 2ACVA 4Y0AA 3BWEA 4AN1A 2PBRA 1H6CA 1SC1A 1A5BB 3G6WA 4MKIA 2AJDA 2VHTA 3A1CA 3H2KA 4CFYA 3VHQA 2C61A 5JYDA 1BMDA 3U7QB 3IQHX 3RSQA 2Q27A 3GRCA 4YLGA 1Z36A 3PUZA 1PJSA 4IW3B 2O05A 4L73A 3PI7A 4HLDA 3NLLA 1YTUA 4LXHA 1Q2UA 1IBCA 3KOUA 3CRMA 3OPXA 4LEIA 3D8RA 3RTGA 1KDRA 3ILXA 2IBSA 1FFDA 2B69A 1HGXA 4P81A 1SBZA 8GPBA 3IAS6 3JR7A 4NBNA 1U7ZA 2KQUA 4DLAA 4K87A 3O8QA 5HR5A 3AVWA 3EW9A 2RHDA 3VJMA 2G67A 3QA9A 3LUDA 1Z2PX 4IDHA 5JEEA 5BYJA 2KHZA 1FFGA 5IH3A 4YB8A 1YFLA 2CMKA 4IMIB 2WFLB 4O2BA 2PMEA 3EWSA 3K9WA 1COWD 3HKEB 3NIBA 4JSTA 4Z9BA 4EDFA 3IRVA 3R7WA 3QPCA 3HYSA 3JQFA 4Q47A 5IYZF 3R8CA 4DXHA 4J7CA 1GAJA 1DPFA 3B6EA 3JYOA 5KWSA 2F3TA 1GRVA 4J6EA 1VLQA 1DJOA 3PTAA 1NXOA 2ZSEA 2GARA 4WA8A 1U0LA 1F2DA 2N9UA 2P2DA 2XE6A 3JZIA 5LYYA 4Y6OA 3RAPR 4R6XA 2JBAB 4CMHA 3W2HA 1G7SA 4YUXA 3G2PA 3ROPA 1X15A 1FFSA 1NN0A 1S96A 4KO3S 4TL8A 1II8B 2JIBA 3DPSA 3F5FA 5DTQA 5DNDA 5J4YA 3KUKA 4X66B 1SQFA 2A33A 3JQBC 4LXXA 4XVHA 4BQSA 1S0UA 1BHJA 1XMSA 1WPGA 2CYBA 3AXSA 4HZIA 1C9JA 1K88A 3H4TA 4L6IA 2GD6A 3BHMA 2Q4EA 3IQGX 3BXXA 1QH9A 3WO0A 1CUAA 4IIYA 1ZW1A 4FNGA 3SMQA 1DDGA 1QGYA 4H17A 4BGUA 3FTCA 1QUFA 5B7PA 4CMJA 1NY5A 1Q2XA 2PQ0A 3OOHA 2A5GA 2OP1A 2VNHA 4MLPA 1OUMA 4MUEA 4X92A 1HX7A 1DQZA 3MS2A 1KOLA 1DL5A 3HB1A 1FX0A 2QVXX 4OX9B 4Q1DA 4QYIA 5CDFE 3THSA 2QUHA 4X84A 5DX1A 2JKZA 3LHIA 5EERA 5G0VA 3PFCA 3A10A 3B7GA 3F0TA 4MW4A 1L7PA 4HLNA 1YXMA 3EPKA 2VJAA 3AF4A 1A71A 3RIEA 3PX3A 1I5RA 4LWPA 2FPUA 1W1IA 3FR8A 1NBEA 3L6EA 3PS9A 1I7LA 1RRFA 2EKDA 1RLMA 3K1JA 1FE8A 2XDAA 3LY8A 4K5QA 4IG9A 3TZEA 4XUEA 1ISGA 3K2QA 2CCKA 1GZDA 2QW0X 4JUAA 4XUDA 1C0LA 1HZZA 2D2EA 1OU4A 4JHXA 2UUCB 3VBEA 1SU7A 5AKYA 3K96A 5TPWB 4K03A 4OG2A 2GN8A 1ZESA 4OAOA 2I8CA 5G0TA 1VFNA 1MNAA 1MJGM 2ZR8A 1XD8A 3D4PA 2C7VA 1JMKC 2V7QA 4IINA 2QRUA 5EIHA 2OLEA 4BX0A 3FPSA 4EHBA 2WU4A 2G09A 2W7TA 3E1KA 1YMUA 3W8FA 3WGMA 2ZIAA 4J6FA 5K45A 4NMWA 1V5IA 2X76A 1S2GA 3EZ2A 4PG5A 1HKUA 3FFBA 3A6ZA 1D3AA 1J24A 4FJ2A 2WAAA 1RJ9B 3WKDA 2YV3A 1KRHA 3AUKA 2QRQA 3PD7A 3KR0A 3N5KA 4FYKA 2RH5A 4MA0A 3ZI0A 2BP7A 3HDHA 1HFEL 4QOIA 2FCRA 2W6PA 4N48A 2REXB 5BV1A 3L1KA