4QJ5A

Structure of a fragment of human phospholipase c-beta3 delta472-581, bound to ip3 and in complex with galphaq
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
317
structure length
317
Chain Sequence
ARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPSYLPTQQDVLRVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular mechanisms of phospholipase C beta 3 autoinhibition.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein/hydrolase
molecule keywords Guanine nucleotide-binding protein G(q) subunit alpha
total genus 105
structure length 317
sequence length 317
ec nomenclature
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00503 G-alpha G-protein alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.400.10 Mainly Alpha Orthogonal Bundle GI Alpha 1, domain 2-like GI Alpha 1, domain 2-like 4qj5A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4qj5A01
1SVKA 1KO1A 4F4JA 4Q66C 3FKSD 4OQFA 1PLLA 4LHXA 4F38A 4NCNA 1X1RA 4GPTA 4R2HA 3IEVA 2R62A 1TTTA 3TW4A 2J1LA 1HA3A 2ZI9A 4GP7A 2QG6A 4P0TA 2V54A 2CHGA 1ZUNB 4EAQA 3IHLA 1F60A 1Q0UA 1P60A 4Y0VA 1Q1BA 4A15A 3BRWD 3WNDA 2W6IA 2NIPA 3TJZA 1D8TA 1GVNB 1MRSA 1OFHA 4O2LA 4BFWA 1ZM7A 5AWFC 5CLQA 1Q22A 4HSEA 4Q1DA 1QHSA 3LXXA 1GRRA 3ZLJA 2ZJ5A 2EYUA 3VHLB 5C2JB 5L3SA 4TQAA 3OHMA 1F48A 4P32A 3KKQA 4C0BA 3HPRA 5FPTA 3VNVA 2DCUA 3LXRA 2D4HA 3NEYA 1E1RD 1W44A 3DEFA 3LV8A 4DCNA 4DLYA 4LDJA 2O8DA 3LD9A 4F91B 4IEIA 1YR8A 3TUJC 1FZQA 1T3HA 1N6RA 1LF0A 4OQMA 3P4YA 1W0KD 4X8LA 2QM8A 3HYTA 1IJFA 4BPBA 3W5IA 2OE2A 3ASZA 4DCUA 2WWIA 2GBLC 1XD2A 2IL1A 1RE0A 4EQ6B 1GP2A 1Z5ZA 1XTQA 2RMKA 4RZUA 4RCYA 2CLSA 1R5NA 2PMDA 2J0UA 2FNAA 3H86A 4C3ZA 1KAGA 1YE8A 4A2QA 421PA 3GLIE 1XD2B 2FN4A 2Q6TA 1T0HB 1FP7A 1YZGA 3AVVA 2FPLA 1YVDA 3HU2A 1EFTA 2QP9X 4FI3C 3T12A 1S96A 3GCGA 1W2GA 2XTNA 4NCHA 1KI7A 2YZ2A 5AK0A 1KDPA 4P33A 1VYVA 2OFXA 3CW2A 2RGAA 4TMWA 1R7RA 3GPLA 2CE2X 2J7KA 3CF0A 4KODA 4DXAA 1E96A 4TN1A 1N5KA 2GCOB 1NN0A 2ZUCA 4DDTA 2XTZA 1GUAA 1G291 1COWA 4H9GA 3VU9A 4B35A 1E0SA 1PJRA 3RABA 1IY1A 1N6KA 4BFUA 5HTKA 1VIAA 1ZU4A 3ICEA 3IKJA 4LY6A 1EFRD 1KNQA 3AF2A 2H92A 2VP5A 1I4TD 2XX3A 1FUUA 5HZHA 3OE7A 2EW1A 1R8SA 2FJUA 3J81k 5DLQC 4IOKA 4LHYA 2WZQA 1KAOA 1JNYA 4JLKA 2CCKA 3DKVA 1KK1A 1UDXA 4C4PA 3AKCA 2O8EA 4OHYA 1UEJA 1FNMA 4FXPA 3K0AB 2YOGA 1J2JA 4OI4A 4HB4A 2Q9CA 4W5WA 5BWMA 4PFSA 4WBSA 1AK2A 1M2OB 2C9OA 3K0SA 4JJKA 4ARZB 3VR6A 4BGDA 2I4IA 3U7FB 3ZIAA 1EFHA 2HYIC 4M21A 2WWFA 1HH4A 2GKSA 2VEDA 2GEUA 4O0MA 1UBFA 4B3BA 2WKQA 3ZH9B 5AUOB 1W47A 5AR1A 3VNUA 4P4UA 2DWPA 5ANRB 4I99A 1U0LA 1KK3A 2JDID 1H8EA 1H8HA 1X8LA 1OKKD 5CLLA 4IDNA 3WYGA 4BLPA 1JR6A 1II9A 2A30A 3R8CA 2JJ2A 5B2ZA 3MWKA 4LPKA 3AVTA 3NXSA 2YOFA 5LD2B 3REFA 3RRZA 4AYXA 3N2EA 1Z6TA 5JS8A 3EZ2A 4US2R 1TQ2A 1F5NA 1VCMA 4BLRA 3ZVNA 5JRZA 3AF0A 3KXKA 3ZVLA 3AVOA 2VTKA 3REGA 3OEED 2LWIA 3K09C 5LPNA 3QBVA 3LBHA 2VP6A 4EPYA 1NLYA 3H1TA 4IDHA 1QZXA 4PSKA 1O3YA 4ITRC 1DARA 2YYZA 4B33A 4Q7KA 3U3KA 4QM6A 1W48A 1KK2A 1XRJA 3RS5A 3CWQA 3KXIA 5CB8A 5BN5A 3TSWA 5B57C 4NCKA 5FOXA 4RD1A 2ANBA 3MG9A 3WYFA 2VP4A 5JFGA 4MRSA 3LFUA 4PPFA 4LYFA 1T5IA 2YC2C 3C15C 1XTRA 3NBYC 4D6PA 3GP8A 1TQDA 4A2PA 3IBGA 1SXJB 4YMWA 2H57A 1XJQA 2O0HA 4KSBA 4Q21A 4YQFA 2NO9A 5EXSA 1DBSA 1IY2A 2D7DA 1QVRA 2F43A 2RGGA 1PLJA 4LBZA 3IIMA 5EP1A 4BRWA 5EE0A 4DUGD 4JS0A 4GOJA 1W1WA 1G3UA 1FW6A 1OB5A 1Q1ZA 4JKIA 2G0NA 1EFUA 1E2FA 1K5DA 5DHAA 1OPXA 3L8ZA 1Z83A 2CL7X 3OESA 821PA 3FKQA 2Y8EA 2X8AA 3W3AA 3JVVA 1XEWX 4AIIA 1JPJA 4CEHA 4HZUB 4BZQA 4KFSA 4C0KA 3MCAA 2QL6A 5TY0A 4RCZA 4LJ8A 1VPLA 2FFBA 4TLDA 5DNYB 1W2HA 2WWGA 3D8BA 3RS2A 1MV5A 4G0NA 3QI2A 3NBXX 4HLQB 2FFHA 4JL8A 1GL9B 5IDVA 4D4JA 4TMKA 4JVSB 5D3QA 4EQ6A 3WYAA 2ZVPX 2G77B 3U3JA 4DDVA 1DAIA 1DOAA 1E3MA 1VHLA 3O47A 4AKEA 2IS1A 4DSTA 3AV0B 4PHHA 1Z2AA 2FOLA 2HV8A 2WWXA 2C2HA 1ODFA 1ZW6A 4Z1MA 2XB4A 2AL7A 1OW3B 3KB2A 4B3GA 2WMOB 4UQOA 4OQNA 1VCOA 5DN6D 1XCGB 1SXJA 5C1BA 4MKIA 1AN0A 2XTMA 5DISB 2R6GA 1KK0A 4G5SA 3T15A 5F3WB 2J87A 1KYIA 1E1QD 1G7CA 2IK8A 2F9MA 4YMUA 4DKXA 2XJ9A 4R98A 3BERA 4OK6A 1W36D 2GVZC 3GLIA 4C0AC 3CNLA 2JJ8A 1RRFA 4W5HA 1D9XA 4QC2A 2CDNA 5FBWB 4AURA 4BECA 4GNKA 3BWDD 4ZKEA 4QHYA 3B6EA 4C0HA 2KBEA 3LNCA 3TUZC 1R0WA 4E5UA 4PC3A 1NVVR 4A0FA 3L2OB 3JVUA 3B78A 1OIVA 2ZSFA 1QHHB 4TYPA 4V0NA 4DCVA 2JJ1D 4Q7LA 4Q4AA 1UKEA 4OK5A 2D2EA 3LY5A 1FQJA 4FCTA 4JSTA 3T1TA 2V55B 4DT1B 4PO8A 4M1SA 2J0VA 4E22A 2I1QA 3KJGA 3ADCA 1W46A 1E0JA 2BOVA 4HB3A 4IDQA 3I61A 4LZZA 1IN5A 2XSZA 3HYRA 3EX7C 3W90A 4HLDA 4ZDKA 3X1WA 2JEOA 2PCJA 3LH5A 4DWJA 4W7SA 2FSHA 4LRWA 4BFZA 2WSMA 3O8RA 3BS4A 3FWYA 3NC0C 1E2MA 3UANA 1MOZA 2VLIA 3AVPA 4MYUA 4GZMA 2P65A 3A6PC 2BV3A 4URYR 2A5JA 1NJFA 1ONBA 1X6VA 2OCYC 4B3FX 3QY0A 1G8HA 2WOJA 3NH6A 4B71A 1NJGA 1A2KC 2IEYA 1W4AA 1TF5A 3C7KA 3HPQA 4XD7A 4CYMA 5C46F 2KE5A 2GF9A 4XVQA 2V7QD 3I5YA 2QAJA 4MRPA 1E2EA 2WM9B 3EA5A 4I1SA 2YINC 1TEXA 1W5TA 2AD1A 4LGMA 2Z5FA 3GFTA 4G5OA 4L16A 4Q4LA 1AKEA 1KO5A 3A4LA 3RC3A 3X1DA 4MKGA 1XMSA 2ZJOA 2V6JA 2IWHA 2GEVA 1ANKA 2XEXA 3K70C 4JL6A 2QTVB 3FTQA 1U0JA 1ZC4A 5J4YA 3PITA 2R6AA 2OBMA 2ZE8A 1OHHD 1AZTA 1RRGA 2IF0A 2V3CC 1XTJA 2CE7A 1CIPA 1XU4A 2EFDB 3K9HA 3OEHA 2QBYA 4JLPA 3H0KA 3CB4A 2W6JD 2REBA 4HDOB 3TRFA 5IF9A 2EFEB 4G5QA 2ATXA 5FPHA 1HTWA 3QF7A 4AYTA 2ZSDA 3LDAA 3WRXC 4AYWA 2JLWA 2DWOA 2HDNB 4M1WA 5F9HA 2BM0A 2HLDD 2ZRIA 2BKEA 3IQXA 3ADBA 1R8QA 4KAXA 2XXAA 2OG2A 3A8TA 4PC2A 4Z51A 3DMNA 5L3VA 2DFKB 3GJ0A 4IXNA 2WPDD 2AWNA 1UDWA 3R9WA 4CRWB 2VF7A 3CBQA 1NBMD 3O8DA 3QXSA 5UKDA 4XOIA 5JSZA 3E2IA 3H84A 2XITA 1II8B 1QVAA 2B21A 3EC1A 1YKSA 2VA8A 1WRBA 2ZVQX 3AQ4A 5CK4A 2WIAA 4JVMA 1AS2A 2V1XA 2ZRFA 3ECCA 3M1IA 3CWZA 3MWLA 4JLJA 4QHSA 4BWYA 1NMZA 4HAXA 4QM7A 4LBYA 1ZP6A 4XJXA 3F3YA 3QNUA 2VSXA 5FOVA 4B2LA 1PUIA 2IHBA 1X3SA 3B5JA 2CJWA 5G3ZA 1SHZA 2UZ3A 3EWAA 5EJEA 1BYUA 1KY2A 2ZRCA 3EAQA 4V03A 3FPAA 4B76A 2J0SA 4IOJA 1DVRA 1U94A 2ZSAA 1TU3A 2Q9AA 1S1MA 3B7GA 1VG0B 3LBNA 3CX6A 4BLQA 4TYWA 1U90A 4ZCMA 2VHUA 2A5GA 3EPJA 3RWOA 1NVVQ 3B13B 4IW3B 1XEFA 3SDZA 3RNLA 2ZR9A 3QSYA 1Q1QA 1OFIA 2JA1A 2FFQA 1AGRA 1YJ5A 4DZZA 1EXMA 1P4SA 4FCWA 1GIAA 1XB2A 4A36A 3WNCA 1BO6A 2RGCA 2IXFA 1IN7A 2CNWA 1R10A 2GWHA 3LLUA 4OBEA 4IVQA 1OIWA 2GNOA 1DEKA 3PIRA 4QNRA 2QPTA 4URWR 5CB6A 3Q72A 4LYJA 2WSSD 5EE9A 3AGQA 4RZXA 3AKEA 1PUJA 221PA 1TU4A 3QXXA 2J5XA 3K0AA 3CNNA 3CF2A 4RZ3A 2EWWA 5AJWA 4BFSA 1G8PA 5JJIA 1RYFA 4PO9A 1ZIOA 2WAXA 4HLCA 4XWOA 4TT3D 1AS0A 5DI3A 3CX7A 1A7JA 1GOTA 1Z6GA 2I1VB 4JLDA 2RGEA 4GFDA 3DHWC 4R7ZA 1NSTA 3N5CA 1WP9A 4X8MA 5K8LA 1KSHA 4KLNA 3RVBA 3V4RA 1M8PA 2NMVA 2FG5A 2FSGA 4MGIR 4KYUA 4Z54A 2A5FA 2O8FA 2X1VA 1G5PA 2WJYA 3KKOA 1YZNA 4M9QA 2XNDA 2HF9A 4OI1A 5HR5A 1JBKA 1T6NA 4A6XA 1N6IA 3IO5A 1S4QA 3QXCA 1KSGA 4GOXA 1NF3A 3KX2A 2N42A 4LYHA 5AUNB 3NKVA 5GJWC 1E2NA 1CEEA 3SU8A 1GTVA 4C0JA 5TDHA 4MKFA 3CX8A 1SULA 4EPWA 1D2EA 4ESHA 3CR8A 2BIFA 4FMDB 4DIDA 4JLAA 4DJTA 1H65A 3CH4B 4D0NA 4JKYA 2RAPA 1MRNA 3EPLA 3GMTA 3PEUA 4NYMQ 4D4MA 3AVUA 2G3YA 2H17A 2N46A 3U5ZB 3LRPA 4NYJR 3P26A 3M4YA 1G19A 4GP6A 2GZAA 2BMEA 3OAAA 1P9RA 4KBGA 4XH9B 4YXWA 4B34A 1MR3F 2FV8A 2OCAA 3ZJYA 4HEJA 2E9SA 4EJSC 3V9PA 5JLJA 5KNCA 2QQEA 4QBGB 3UWOA 3B1YA 5JJKA 2EVWX 1E4YA 5EXTA 1OYYA 4MGKR 1E9EA 3QOFA 2GAOA 4NDZA 1EG7A 4C0SA 4B2PA 5JCZA 5HE9A 4AY2A 4H1VA 2HJVA 3GLHA 4M1KA 4DIEA 2F43B 4XWKA 4NMMA 1WBBA 1JR3E 1R0XA 1AM4D 1U9IC 2FSIA 2XZPA 1GKIA 2ZS9A 3DPUA 3QPWA 4B74A 4PQFA 3LO5A 1QF9A 3SBDA 3VU9B 3WBJA 2BMDA 3Q7PA 1RJ9B 2J59A 2ZJYA 1EFRA 2QNRA 1TL7C 2ZREA 1XTKA 3UMRA 1CJKC 2DFLA 3P32A 5AJZA 4Q01A 2ZRJA 2BBTA 2X2EA 3QG5A 3SHWA 1BS1A 1E98A 3IHWA 4PAOA 1LTQA 2WKPA 2O52A 1OT3A 5M04A 1VG9B 4D81A 1N0VC 1Z0KA 4LV8B 2ZJZA 3I8SA 1GITA 2G6BA 5JI2E 1D9ZA 3UG6A 4URZR 5C4GB 5D3MA 2X77A 2AFIE 3VX4A 1Z0FA 1KI4A 2G83A 3C5CA 5KSPA 5LD2C 1KJYA 1E9CA 1T0JB 2AR7A 2DY1A 3K0CA 4MYCA 1IM2A 2GK6A 4ZKDA 3ZVMA 2XGJA 1UBEA 621PA 4C2TA 3WXMA 3RS7A 3GLFB 4AC9A 3S1AA 1TUIA 3K70B 3EASA 4A8JC 1JAIA 2FH5B 2O8CA 2ZE6A 2IBMA 4KFUA 4LK2A 3LVQE 3U6BA 2JDIA 4WIAA 1OKKA 2GXAA 2FA9A 1VYTA 4JLMA 2LCFA 1Z29A 3ZVRA 2VRWA 2JJ2D 3DL0A 1OSNA 3Q5EA 3MFYA 1R2QA 2PH1A 1GL6A 1F2UA 3SJCA 5FOTA 4R71A 5KYKA 1CJMA 2O8BB 4Q4JA 4A2WA 2CBZA 1OYWA 4TMXA 1P73A 3I5XA 3KQUA 5J4LA 2N1BA 3TLXA 1P72A 3U3MA 2JLXA 4EJSA 1KDRA 1S9DA 3PUVA 4BZPA 2NO0A 3CPJB 2NGRA 2FU5C 2J9RA 1MO3A 3TH5A 3VKHA 1MO5A 5CYPA 1TF2A 2BEJA 2F6RA 1KJZA 1A82A 1TPZA 4TQ9A 3ZS8A 3C8UA 2OCPA 3FDIA 1E0KA 4IEEA 4A82A 4ZCLA 1RW4A 2GJAA 1CF4A 1QHHA 2ZRKA 1IAQA 4FMBB 3K0FA 2GAAA 4LWZA 1U9IA 5CM8B 4YDSA 4DLRA 2J0QA 3W5JA 2KB0A 3LW7A 4ZI3A 3LW8A 4U7DA 4NTZA 3SQWA 2YHSA 1SKQA 3U7HB 1JR3D 3PG5A 1AS3A 4HB0A 4ZV4A 1KSFX 2DBYA 2OFWA 1MH1A 4NYMR 5D3MB 3UIEA 1SKYE 3P4XA 5FL3A 1M7GA 2AN9A 1WE2A 4ZPXA 3ND8A 2DWQA 3GJ3A 3THXB 2OXRA 4TLCA 4CT4B 3AH8A 3KTAB 4Q5IA 3RRNA 2IYTA 4RKFA 5CJPA 3RS0A 4FWTA 5H8WA 5FBVB 4FD2A 2QSZA 4UNNA 3KTAA 4DLZA 4DUGA 3K09A 2PEYA 2OEPA 1GWNA 2VYFA 3ZQ6A 2O8FB 1RRCA 4N0DA 4HUQB 4IJMA 1ELOA 5FPSA 3GJXC 2PLFA 3QKRA 4OHZA 3GFPA 1JXMA 1G3RA 2QRNA 4TYYA 3SR0A 1NIPA 4I1VA 2PBRA 2ZYWX 1Z22A 4P4SB 2ZYTX 1Q3HA 5FR2A 5LB4A 3SEAA 1LS1A 1XMIA 3U6KA 3CONA 2R6CA 4RFSA 2RGXA 1L4YA 4C7OA 1DO2A 1E2DA 2FEOA 2QAGA 2ZAMA 1E32A 2C03A 2DFNA 4N3NA 3SC3A 2OSBA 3V00A 1NVXQ 1N5JA 1ZUHA 3EPKA 4JZKA 5FL7A 4F4IA 5A5GA 1N6OA 2QMEA 3FMOB 1KI6B 2UVQA 2G88A 5BW8A 4ZDWA 5JS7A 1DAMA 4OK3A 5C4MA 5E7JA 3FE2A 1X8JA 1XXHB 2WMNB 1AQUA 3T35A 3HR7A 3SJZA 4KITB 3SNHA 5KHOC 4JBXA 4A4DA 4JVNA 2NO7A 4FMDF 4CEIA 1L4UA 3A1SA 1N0WA 3TKLA 4JVLA 4BZXA 5TARA 4DHEA 3DO6A 5FI0B 4Z1MD 2H1LA 1FMJA 4WXRA 4WXPA 1ZRHA 2FZ4A 4Q1EA 1TMKA 2A5DA 2GHIA 4QHTA 5DN6A 5DI9A 1ZYUA 4BLSA 3DZDA 5EE5B 2QUZA 3KFXA 3LBIA 4K8OA 4E07A 2OHFA 5E95A 1KIMA 521PA 2ZI3A 1E1QA 3SOPA 1JXOA 1KJWA 1SGWA 1DAGA 2ZAOA 4G5GA 2HYDA 3QVVA 2QMHA 1Z28A 2ZSBA 1OH8A 4RVCA 3SJAA 2F1IA 2G1JA 3FHCB 2YKGA 1S2MA 1NI3A 2ZE7A 3X2SA 1GILA 1VIYA 4YMVA 4TQUS 1MT0A 4DSOA 2AX4A 1XZQA 1G3IA 4F7WA 3TSZA 4OHVA 5AJYA 2VO1A 1IHUA 4D4LA 3K8YA 5SZKB 1UAAA 1Z2CA 3EIQA 1DO0A 2ANCA 2NPIA 2QPOA 3R7WB 4JYCA 1B0UA 4KSCA 4DB2A 1XPUA 3BB4A 2NPFA 3ZZUA 4NP6A 5F9FA 2ZANA 5GJBA 1RIFA 4X8OA 2QPAA 4EUNA 4PC1A 3U7EB 2GETA 2ZRBA 4D25A 4JIMA 1DAKA 2WVJA 4KVAA 3GJ5A 2NZJA 1N5IA 4BFYA 1IN6A 1R5BA 3VTKA 1QHNA 2PT7A 1FUKA 1IXSB 1OLOA 6Q21A 2QENA 3RAPR 2O8CB 2V4ZA 3C14C 4TL9A 2R8RA 5E7MA 1P9NA 4Q1CA 3RS4A 3E5HA 3WMGA 4EPRA 2QGNA 1DAHA 4HATA 1DTSA 4M1TA 4LJ6A 4M4SA 3X1XA 1KSJA 3L8YA 2GILA 1SZPA 1X1SA 2IEZA 4UXJA 4CVNA 4LX0A 1YRBA 2A3RA 3RLFA 121PA 1KI1A 1XEWY 3EG5A 3BD9A 4DLVA 2D2FA 3AUYA 1SHKA 1ZNYA 2PJZA 5CYOA 4D4KA 2IXEA 1E2QA 2GCOA 3CLVA 2IXGA 2PZFA 1MABA 2C9YA 3D6TB 3GLHE 3KQNA 1QHYA 2W0SA 4HYYA 4UNRA 1G4UR 2ZU0C 2MMCA 1C1YA 3DZ8A 2AK2A 2ZJBA 4LSGA 5DHFA 3TE6A 1G1MA 1SXJE 4TYQA 5HKKA 5CDFA 3MJRA 2IYVA 3RHFA 3CPEA 4PSVA 1OHHA 4O25A 4QBFA 4KI0A 3NDPA 4CEHB 5FH9A 1FP6A 1Z08A 3RS3A 2ODEA 4F93B 3PCRB 4HUTA 3CRRA 4QKQA 1N2CE 5SZJA 3BH6A 1SQ5A 3BFVA 3FMIA 4A0HA 5KSYA 3EWSA 3OIUA 4Q4AB 3T06B 1XTSA 2A7QA 3K0EA 3NWJA 2J0UB 3VMFA 1US8B 2BC9A 3NBZC 1NY5A 4KVGA 1SVIA 2WV9A 1T91A 2IX3A 4B73A 1E94E 4NONA 3K9LA 2JLZA 3CRMA 2Q9BA 1RVDA 1E2IA 1Q12A 5CIWA 4UXIA 2F9LA 3WRYC 1KO8A 1K5GA 2IWRA 4UKDA 2BJVA 2RGBA 2PJRA 1KO4A 1WMSA 2OXCA 2Z0MA 3VAAA 4V0LA 2QORA 4ILEA 1LNZA 2F1RA 1YZUA 3Q5DA 1P61B 4A0GA 4JLNA 1G16A 1NBMA 1OF1A 3VR2A 2JIZA 4NL4H 3R20A 1G5RA 5A0FA 1XMVA 4KBFA 2IS6A 1OH7A 2OBLA 3QBTA 4Y0AA 5AJVB 4N1AA 2O0KA 4HDQB 1E99A 4P4SA 3CO5A 4NPHA 4P31A 1W0JA 3SZRA 1OB2A 1N6LA 4Q9LA 5JI3E 1RJ9A 5GJVC 2NO1A 2A78A 3FFAA 5L3SB 1NG1A 2WJVA 2YVUA 3EZFA 1Q1EA 2YNMA 3TQCA 1UF9A 4D0LB 1G64A 3DVLA 1Y63A 1QBKC 4NCJA 4WZAE 5B64A 3THYB 1N25A 3AUXA 3WHLA 4GMXA 1WCV1 2QBYB 3UPUA 2O8DB 2PL3A 2BVNA 4PR0A 4O3MA 3EW9A 1KI2A 2PX3A 2P67A 1EK0A 3GLHB 3W6OA 3KJHA 4G1UC 1M1YE 1E4VA 2P6UA 3MRSA 3T1OA 2V1UA 3SBEA 1XPOA 1VCNA 2V9PA 1U2RA 4FWIB 4MYHA 4X8HA 1OIXA 3IILA 4M1OA 5FR1A 2CEAA 2VQSA 2ZI4A 2CK3A 1AZSC 2H8KA 3G5UA 2DHRA 3LWNA 1J90A 3MAAC 1JJVA 1M6NA 2PLRA 1XBTA 3AF3A 3Q9LA 2BMJA 4FMCB 4LV5B 5L3QA 4JYBA 3I73A 2CNWD 4JT2A 4MYTA 3WP0A 2QT1A 3BIFA 3QXHA 3F5FA 2EQBA 4MH0R 2XZOA 2WSSA 2ERXA 1T8UA 2QP4A 2ZUBA 2PCLA 1CRQA 1W7AA 2BJWA 4WZBE 1P9WA 1NMXA 1UADA 2O5VA 3ASYA 3Q8XB 4N0EA 2G1KA 3IGFA 4POAA 4PAQA 4CZ2A 2CVFA 2REXB 5E4FA 2C98A 2QE7D 1BKDR 4PZLA 2FPKA 4TT3A 5DGXA 1OJLA 4QRHA 2O8EB 2GRJA 2IC5A 3GQBA 2GEDA 2HXYA 2WJIA 2F3RA 1Z63A 2OLJA 1E9SA 3UATA 2G9NA 2QQ0A 1XFAA 2QY9A 5KPDA 1BOFA 1GL7A 3NC1C 4KHZA 1RKBA 4B3CA 1XJ0A 2XNDD 5BYJA 4DLWA 2ZSEA 5JCPA 1RZ3A 5KTYA 2CLDX 3KQHA 2H16A 2WJGA 4R2IA 2ZRDA 3NIBA 2P2LA 5B58C 3K70D 3AM1A 2CJWB 2ZYVX 2B8WA 2IYXA 2LKDA 1GNQA 3U61B 4BQSA 3HP1A 4M22A 3BXZA 4CW7A 5KSOA 5KNDA 4MDEA 1VCIA 1NN1A 1SVSA 2O0JA 3NEJA 4HLUC 4RJLA 1CKEA 3IIJA 1QHGA 3BAFA 3VFDA 3WBKA 1NVWQ 1NL3A 5EUQB 3HDTA 2VL7A 1OXTA 2FPMA 3RRMA 1XPRA 1SVWA 1NRJB 3U3OA 3KFVA 2BEKA 4D80A 4RD2A 4Q4HA 2QAGB 1XD8A 3OAAD 5K8IA 1ZU5A 4HB2A 4B6FA 4Z8YA 1Q44A 5CITA 3KDSE 2W2XA 3QKRB 3T34A 4YXWD 1Z8FA 1Z3IX 4Q9IA 3VHXA 3VKWA 4OJQA 3B60A 1N6NA 1OXUA 1HYQA 1W4RA 2IUUA 3TVTA 2QT0A 5FTJA 2ZYUX 1E9FA 1N6HA 3BOSA 3RC8A 3ZS9A 3PR1A 4PC7A 3RWMB 1YRAA 5IHPA 1Z0JA 3RDPA 4GOKA 2IYUA 3AVXA 4BRUA 1S1CA 3I8XA 1XCMA 1Q21A 2NQ2C 2J46A 3TQFA 1TX4B 3CRVA 2AWOA 4AK9A 4JBWA 1NN5A 1W4BA 1NG9A 5JECA 3T61A 1WA5A 3THWB 5BYKA 2IHYA 3ETLA 2D7CA 4MUAA 1ZM2A 5CJ2A 2R44A 2QTHA 2XNSA 1R0ZA 1VG1A 4ZDIA 4XSGA 3FHTA 3CUEF 1G8YA 1WB9A 1CU1A 1GKUB 4M8NE 1TF7A 2VHTA 1GG2A 1KMHA 1U99A 2XOKD 4HZIA 4L4UA 4MQBA 2MSEB 4V0ME 4P3YA 3Q3JB 1RFLA 4B44A 2J3EA 1XTIA 3R9IA 3U44A 4YMSA 5FTLA 3A1VA 1CP2A 4GSYA 2GK7A 5C18A 1S9HA 4TL7A 3VR5A 2ZJ8A 4TTQA 4JJZA 3MMPA 1VHTA 1GZSA 2HF8A 5GVSA 2EYQA 3I32A 3OF5A 3ZDQA 3THOA 1E9RA 1QDEA 2FZLA 2HCJB 1ZNZA 1HQYE 1T4GA 1CR0A 4H1UA 2RGNC 5J47A 4QBHA 5EP2A 3ZZ0A 1E9BA 1HY3A 1J8MF 4LCBA 2LKCA 1G8FA 4UNPA 4PQRA 4QGHA 1Q3TA 1U8AA 2ERYA 4A6PA 4II7A 4TZ0A 3A37A 1TAGA 1D2MA 4QJ3A 5IT5A 2HXSA 4ERNA 3PVSA 2CCJA 4L5BA 1G6HA 4MDFA 1CJVC 3RYTC 3PV0A 1KNXA 2VPPA 5KNBA 4US1R 5FTKA 4A92A 1EFCA 3GJ6A 1RRPA 2WWWA 2ZRHA 4Q4JB 1JQLB 1NLFA 4B2IA 3L0SA 4YLGA 1E0AA 4L9SA 4Q47A 2ODNA 5JEDA 4RSGA 5J40A 4CT5A 1E2GA 3LA6A 1AA9A 2OM2A 1EWQA 4S35A 1JI0A 1T3SA 4IVPA 2C96A 1UFQA 5KSZA 1YR9A 4UNSA 3JZAA 4CEJB 2DFTA 5FUVA 1JEDA 2ASEA 1L7VC 2ZJAA 4NU0A 4BASA 1C9KA 2QGZA 4B3XA 2ORWA 1IQPA 3GJ4A 3TUIC 4JLVA 4XWAA 1E2PA 3TMKA 1KZGB 4YONB 5GJCA 2XXAB 1NMYA 1JR3A 2KBFA 4TLBA 2YV5A 5FUWA 3N70A 2Q3HA 4DLXA 2VF8A 1ESNA 2GJ9A 2IA5A 5JRJA 3BBPA 1OE0A 2GJ8A 3GLGA 2QEQA 4MKHA 2C77A 3QJYA 4RD4A 2IYSA 3S1AB 3OFNA 5AJXA 4PPNA 1KI9A 1QRAA 4MUBA 1G4AE 4UJ5A 4QG7A 5DO9A 3MSXA 3KKPA 1FTSA 1AGPA 1EGAA 2X2FA 2G0TA 4HAVA 1EX6A 1N5LA 3CRW1 4Q00A 4V0MA 3PUZA 3IQWA 4OKSA 2R6DA 4FW9A 1CTQA 4LHVA 1IOZA 4JSYA 4Q1AA 3NDBB 3K9NA 1ZCAA 4I1UA 1JECA 1EESA 3HU1A 4HUQA 3DKPA 4ZI2A 2GXQA 5FBQB 2QMOA 3SI7A 5FI1B 3FFBA 2PT5A 1LV7A 4KFTA 5P21A 1UJ2A 4DBLC 3KUCA 1RC8A 1U81A 2PZEA 4M53A 4EKDA 2BHRA 2Z6VA 4LJAA 2H7VA 3W8NA 2EWVA 4KXFB 4PPQA 2J7PD 5HCNA 5FL7D 1KKMA 4BFTA 4ACAA 2I3BA 1OH6A 1X8KA 3UKDA 4TLAA 4AKHA 4P4TA 2R9VA 5EE1A 2FGKA 4PZYA 4B32A 4NKRA 3GEHA 1S3GA 1OXSC 3SS8A 5FOWA 5J4KA 2W2TA 2WWYA 1P2UA 1GNRA 5DYIA 2W00A 5J4HA 3GLGB 1J99A 4C9BA 4WVFA 2VSOA 1J8YF 4DC9A 1MKYA 1ESMA 4B48A 4MRVA 4A0RA 2H5EA 4TMZA 1F2TA 2HJGA 3IEUA 5LBIA 2IYWA 1N6PA 2NG1A 3OZXA 3PENA 2H18A 1CR4A 1E79A 1YZLA 2J45A 3KJIA 3B8HA 1FL9A 4BE7B 1XD9A 3CZQA 2QP3A 3NH9A 2YWHA 4IKEA 4QGAA 4KJZA 2JAQA 2ZRMA 3KKNA 1E9DA 2C78A 1AJEA 2GF0A 4ASUA 3L82B 1VMAA 1I4DD 1OXVA 4UXHA 4PC6A 3A4MA 2YC4C 2ZS7A 3FYHA 2CHQA 1RYHA 3VQTA 5TB5A 2BCJQ 2F3TA 1ZD9A 3HU3A 1QHIA 5FBLB 1TUEA 2Q0HA 4C0LA 1DAEA 1S0UA 2IW3A 4PXAA 1XWIA 2DPXA 5A4JA 4AI6A 2CXXA 1DADA 5KDOA 1KI3A 3SQXA 2B6HA 3CKLA 5JSZB 2QU8A 2IS4A 3EARA 3IDQA 1SVLA 1G17A 2JLQA 4EPXA 3IPXA 1ZM4A 5L8VA 5F98A 4NHOA 3T1QA 4GL2A 1HUQA 1Y3AA 4BEBA 4CEIB 3K0CC 1UM8A 5KOYA 1YHNA 2F1JA 1JQJC 3SFVA 5K8UA 1Z47A 4LJ9A 4Q03A 4DDUA 4L15A 4AG6A 2GESA 2CL6X 4A8JA 5FTNA 2V6IA 1M7HA 1CJTC 5LB2A 1LW7A 4IVRA 2WIBA 4PZZA 4RD0A 3VR3A 3WHKA 2ONKA 4FCVA 4TLEA 4M9ZA 3ONWA 1XXHA 4FN5A 4LYAA 4LV6A 3SFZA 2YWEA 2WKRA 2NOAA 2IYYA 3AKYA 3L0PA 4QBIA 3NG1A 2QSYA 5IK2D 3HJNA 3B9PA 1VTKA 5DYGA 3SN6A 2FSFA 3P20A 4NYJQ 2P6RA 1I2MA 4F4CA 3AF4A 3BB1A 2YWFA 1F3OA 5IRCD 3BFKA 3TAHA 3MJHA 2QZ4A 3OIWA 1G6OA 1FX0A 2FX3A 3D3QA 3KUDA 1BMFA 2ZPTX 1G5TA 4PANA 2BDTA 2P6NA 3PFIA 2ODWA 3UWKA 5HKKD 1T5LA 1G41A 4PHGA 5JWRA 2C5LA 5JBQA 2JCSA 4AWXA 4RFSB 4B6EA 4W9MC 3MGCA 4NZYA 4L9WA 2VHJA 4OHXA 4C2UA 2BWJA 4KCGA 2JASA 3V4FA 3CRQA 1NLZA 2Z83A 2CCGA 4AKIA 2IS2A 3PUYA 4D26A 1WDTA 1UBCA 4LJYA 5FBRB 5FTMA 3DOFA 4DCTA 4G01B 4ACBA 3WNBA 3CZPA 2GVDC 1DE0A 5KDLA 1OFTA 3M6AA 4PHFA 1JB1A 1PZNA 2ZS8A 1HQCA 2BCGY 5H1YA 4DSNA 5JWHA 3OIYA 5CIQA 1XJCA 3SE0A 2AXPA 5HZKA 2JLYA 2QMUA 5DI3B 3EXAA 3I4LA 2JIZD 4IDPA 2ZJ2A 3BORA 4MGZR 1R4AA 4QFMA 4QXAA 1JJ7A 1MO4A 3KZ1E 2J41A 3FB4A 4HDCA 5J5CA 1ZIPA 1F2UB 3AVWA 5J4VA 4A9AA 1DAFA 1PVOA 4LJ5A 2ZRGA 3MD0A 1W36B 1W0JD 5K8TA 4TMTA 2ZR7A 4Q4HB 2XB2A 1BYIA 3FHOA 1E69A 4HAYA 4US0R 3X1YA 5DSZA 1YR6A 1FX0B 2B7CA 2C8VA 3GEIA 4UNQA 1DS6A 1IJEA 4LHZA 1R0YA 2QAGC 4U00A 2PZGA 1TEVA 1P7CA 1YR7A 4FMCF 3NHBA 1TADA 3ZYCA 2KJQA 1SVOA 2ZE5A 2NTYC 1NY6A 4RZ2A 5GVRA 1XCPA 3I3SR 2JATA 2QI9C 4XVRA 2R6FA 3GD7A 4HZUA 2NZ8A 5KUTA 3U3RA 3PQCA 2GTPA 2A2ZA 4GI7A 1CR1A 3GJ8A 3P27A 4NYIR 2X19A 4TSFA 2OILA 4XSHA 3GLGE 3H2YA 1W5SA 3KQLA 4I4LA 3CPHA 2CK3D 1IBRA 3RANA 2FMXA 2JLRA 3HR8A 1KDOA 2ZI5A 3CR7A 1IONA 3TGPA 1KO7A 3THYA 1Z6YA 3W3ZB 4YMTA 3PEWA 4ZIRB 3ZGXA 4DDWA 1IY0A 2ORIA 2C95A 5FPKA 1ZJ6A 3LQQA 1E2JA 4JLBA 4FINA 2ZI7A 4TTRA 4LI0A 1MO6A 2ECKA 5TMPA 2AHOA 4EFMA 4M1MA 3QEJA 3I92A 1NVUQ 4OI0A 3FKSA 4LBVA 1I4LD 2QE7A 1E6CA 1Q20A 1YQTA 1DPFA 3W6NA 3BC1A 1KKLA 1UPTA 3D7MA 1M34E 5L3QB 1CULC 5KDDA 5L3RA 3M0EA 1YZTA 2QA5A 1DG1G 3GLIB 1U98A 3EA0A 1T3LA 1Z6XA 3TBKA 5G41A 2W6ID 3K0FB 1XNJA 1CS4C 3QE0A 1AKYA 1ZINA 2IF2A 1ZD8A 2DR3A 4HI0E 5SZHB 1E2HA 4DSUA 3BJIC 4GBMA 2W2VA 1HURA 3C4JA 3ADDA 2WTUA 4V02A 2MSCB 3GLFA 2KSQA 5JEEA 3T5DA 1P5ZB 5DH9A 2B92A 3QUSA 3ND9A 2WICA 2ZRPA 3QXJA 3BE4A 3LVRE 5HPYB 1EX7A 1E1RA 3EZ7A 3U4QB 1A5TA 1XEXB 4XIGS 4B3DA 4BFVA 1K8RA 1Z0AA 3AP2A 2A9KA 3IBYA 2QRZA 2RH5A 3B1XA 3E70C 4JMPA 3RRYA 4Q18A 4U5XA 5CK5A 1D2NA 4D82A 1CRPA 2DYKA 5G40A 1BH2A 1G8GA 1W0KA 1NIJA 1OFUX 1XEXA 2ATVA 2UZIR 4PAMA 2ZI6A 3U60B 3R8FA 2O8BA 2OZEA 4Q48A 4D0GA 1J7KA 1UEIA 3QF4B 3FOZA 3ZZTA 3X1ZA 1G18A 4IOLA 4TL8A 4QJ4A 5FOUA 2BMFA 2CHVA 3HWSA 4ESVA 2WWHA 5FPYA 4PHTA 3VX3A 3LLMA 2MMGA 3ZQJA 5G3YA 1WBDA 3AP3A 1E9AA 2R2AA 1OXXK 4AG5A 5GADl 3R9XA 2MSDB 4PTLA 1SXJC 2OESA 1GAJA 2JLSA 4C7OB 3SHFA 5TV2A 1TNDA 2IYRA 4G5RA 2ZROA 2ODBA 4AD8A 3CNOA 1IXRC 1LS6A 3CIOA 4JLOA 4EJSB 5KU1A 4O2RA 4OQXA 3QKSB 2AKYA 4TWZA 1P2VA 3K9GA 1II0A 1ZM9A 1G21E 1COWD 1QG4A 4WW0A 4A1FA 4K81B 4Q7JB 2D3WA 2WBLC 1N0UA 4HAWA 2EFCB 2D74A 1KDTA 1XMJA 2BBOA 2VP2A 5TXGA 3THWA 1VYUA 3PEYA 3C5HA 3OE7D 4CDGA 2OUKA 4JT4A 2SHKA 1P2SA 3KL4A 4XTRA 2P0EA 3T5GA 3B1ZA 2XOKA 1JEEA 4ZO4A 4IXMA 2CMKA 1XX6A 2L0XA 2JLUA 3BH0A 2B8TA 1JPNA 2R65A 1GNPA 3TK1A 2QM7A 3KXLA 4QGGA 1D6JA 3UMSA 4G3XA 4GZLA 1KOFA 4B47A 3ZIAD 1QHXA 1CJUC 4RD6A 3I62A 3QEOA 2OO7A 4LOAA 1FFHA 4GT1A 1D5CA 5AUQA 1FPMA 1G7SA 1H8HD 1H8ED 3DM5A 2W0MA 3N2IA 4LUCA 4Q02A 1KMQA 3B85A 3TNFA 4FIDA 3G82C 1Z0IA 5EXXA 4IFEA 1U8ZA 2OLKA 2QTFA 1ZMXA 2EFHB 2OFOA 4PQYA 3W9YA 4QOSA 4EIWA 3I1FA 1T8TA 5LDDC 3SYLA 1O87A 5DE3A 4Q9JA 3C16C 2AD5A 2RHMA 5CM9C 4KO8A 2IYQA 4Q1BA 4BUJA 1GRQA 2F1HA 1G20E 1NSFA 4URVR 1VG8A 4BEJA 1EWRA 3OEEA 4XTCS 4LHWA 4RD3A 4OQLA 3AGPA 3A36A 1XDBA 4OHWA 1US8A 1KI8A 4IFBA 3GEEA 1IXZA 2FGJA 1SKYB 2WJJA 1P3JA 3UMFA 4ABYA 4CEJA 2ZTSA 3QVUA 5JWOA 2K5UA 1W4CA 1E2LA 2ZIAA 3DOEA 3F0TA 3QG1A 4LBWA 4OJKA 3TSOA 4IDOA 3AKDA 1K6MA 2GJSA 3PUXA 4IOMA 3QENA 4Q7MB 1HE8B 4M2LA 5BQ5A 2WAYA 5E7IA 2VHCA 2Z43A 3BGWA 4KU4A 3TVDA 1Z0DA 1LF5A 1N3BA 1GFIA 1MABB 2AKAB 3OFND 4MRNA 4CGZA 3EZ6A 4Z8XA 1PLKA 1KHTA 2HEIA 4RKEA 3U44B 2JLVA 2GA8A 4CF7A 3IIKA 3DM9B 1HE1C 3FVQA 4LC1A 5ELXA 3WP1B 1RPZA 1L8QA 2XJ4A 4EPTA 1KY3A 2RKOA 5HE8A 4M1YA 3NTUA 3CM0A 4BFXA 4C30A 3MUFA 3QKTA 4M9SA 4LPSA 4RFVA 2JGNA 1WQ1R 1X86B 2W83A 4TTPA 3PJRA 4OI2A 1XZPA 4HAUA 2EU8A 4IHQA 3RSLA 2C99A 4Q9HA 4OL0A 5EUMA 5DIFA 2ZRLA 3KKMA 4V0OA 5B30A 2E1RA 3PUWA 1IN4A 5JHGB 1U8YA 2VH5R 3A4NA 3A1UA 3BFXA 1OH5A 3UK6A 8OHMA 2D62A 2UKDA 3T1VA 1ETUA 2WJHA 2J7PA 1GSIA 1HV8A 1NN3A 5KPJA 3IPYA 2Z4SA 4L8GA 2REOA 2A5YB 3EIEA 2NO6A 2RB4A 3B1WA 3OIVA 4EFNA 5EP4A 3UXMA 4DEXA 5FUXA 4ON9A 1Z6AA 3KQKA 4E09A 5EQTA 4M0LA 2FFAA 1L2TA 1ZBDA 3E1SA 3O8BA 2YOHA 2GDJA 4U02A 2FDCA 4GDFA 1FTNA 3WY9A 2D06A 1WXQA 5JMTA 4ZDJA 1NNEA 1CXZA 5HCIA 3SYNA 3D31A 1G7RA 2HT1A 1SXJD 3L0OA 3MWYW 1LB1B 1P6XA 5EZ6B 4WZ6A 1T9HA 1UKYA 1A4RA 4W5JA 2ZM5A 2ZEJA 1E79D 3H4MA 1ZCBA 3P1JA 4DT1A 3QKSA 4LJ7A 4TMVA 4F92B 1CBUA 3CH5A 1G3QA 2HUPA 1ZD1A 3A1TA 3B9QA 3B82A 4PX9A 5H70A 2XZLA 3MLEA 1HT1E 2F55A 3LQRA 4DLUA 4TYNA 3K53A 3L0IB 1S3SA 4WOPA 1J70A 4ASUD 3U7GA 4KFRA 4S2EA 5FOSA 3PXGA 1G7TA 2CVHA 4I1OA 3RSOA 3DDCA 1B23P 2YWGA 2YJTD 2OAQ1 2JJ1A 2P3SA 4GRAA 3GLFE 721PA 1FOEB 2WOOA 2RHDA 3BH7A 4QNMA 4EPVA 3SJBA 1PV4A 5BN4A 2P5SA 5FFMA 4URXR 1TQ4A 3BB3A 4EFLA 1UKVY 2AXNA 4DLTA 3A1WA 1S8FA 2ZITA 5JHHB 3KB1A 3QPUA 1ZNXA 4URUR 3LX8A 2Z4RA 4J0QA 1YU9A 2GZHA 1LY1A 2OBNA 2XAUA 3TIFA 4CIDA 2XSZD 1ZM3A 3A58B 3NBFA 4BLTA 2OT3B 4NE2A 4ZIRA 1P75A 2VSFA 4KYIB 5EZ5A 4DLSA 3ADKA 2Q21A 3EC2A 2Q3MA 1VECA 3ZD7A 2PEZA 4KV9A 1AIPA 2GCNA 2TMKA 2CLCX 5FUYA 4NYIQ 3O8CA 3JZMA 2IT1A 3AP1A 5TVKA 1UBGA 4TL6A 4DCSA 2VBCA 2RGNA 5SZIA 1F2TB 1W49A 4QL3A 3W6PA 2FE4A 4WAUA 3AVQA 2ORVA 2KWIA 1NKSA 3AB3A 4B43A 1M74A 2RGDA 4XD7D 4NBSA 3NVAA 2GXUA 4KLZA 5IK2A 2V7QA 4B75A 1ZC3A 1KI6A 1CLUA 2ZETA 5EP3A 1F6BA 2BKUA 2BM1A 4QGFA 1II8A 2E87A 3ICQB 2W58A 3WMFA 4NCIA 4C0QC 1V43A 3IO3A 4YDHB 3UG7A 3GJ7A 4A8JB 3I72A 4MRRA 2GXSA 3L43A 3LAWA 1BMFD 4EDHA 5CDFE 3TR5A 2OV2A 1DELA 4Q19A 5JJLA 1NKTA 1WF3A 3QF4A 2KI5A 4MA4A 4BLOA 4D2IA 4DB4A 2F7SA 2B7BA 3AF1A 4K46A 2DB3A 1YZQA 2C04A 2V8OA 4HAZA 4HLUA 4MGYR 3W34A 4TZ6A 2GZDA 3WMEA 1YZKA 3OEHD 3VR4A 1ZAKA 2W6JA 4V0KA 3R7WA 1G3MA 2GCPA 3TAUA 4GMDA 1E2KA 2IUTA 2Q3FA 1Z06A 1KGDA 5F2EA 1P62B 2VP9A 2BBSA 2PMKA 3EZ9A 1KTVA 4NH0A 1ZVQA 4IRUB 2ZR0A 2HLDA 1GRNA 1JALA 3QIAA 3K1JA 3EPHA 2VHQA 1BIFA 5EXPA 1C4OA 1CR2A 4JL5A 3AEZA 3U4QA 3ZD6A 1VKJA 3Q7QA 2ZUDA 3B2EA 2WPDA 1I2DA 1QG2A 1AQYA 3Q85A 3EIHA 5H68A 3FMPB 3THXA 2OCBA 1P2TA 4LC0A 1G9XA 4ARZA 2FF7A 1NBME 1NP6A 5EE3A 2FEMA 1Z07A 5BN3A 1ZUIA 1V5WA 1UKZA 1VDZA 2OAP1 1A1VA 2IYLD 1ZNWA 1LVGA 1M7BA 2QN6A 5AUPB 1GKYA 2EFGA 3KJEA 3B1VA 3TW8B 1XP8A 1JAHA 1GDDA 1DG3A 2IUSA 4DVGA 2C9CA 1W36C 3PEVA 3FMFA 1KMHB 2HT6A 3MWJA 3QKUA 3F8TA 2WHXA 4R9UC 1HT2E 4Q9KA 3TR0A 1FMLA 1U0HC 1R6BX 2HCBA 2ZXUA 2AK3A 4DEYA 2PX0A 1LFDB 4YC7A 2VP0A 1OV4A 4JBYA 5BXQC 2GBLA 5KO2A 1FQKA 1XF9A 3QPVA 2AFHE 3QQ5A 2VIIA 4PO1A 4E03A 1A2BA 2ZU6A 3AVYA 2QROA 3DMDA 4TSFD 2FWRA 4M9XA 4I81A 3FGNA 4DRZA 3GFOA 1SVMA 3C41J 3U2QA 4AKGA 2ONJA 4XVUA 1XXHE 2IYZA 3W8RA 1FNNA 4MITA 2GJKA 4LJ4A 3LX5A 4RY2A 5G53C 3G0HA 1R5OA 1TQ6A 4UJ3A 4QJ5A 3VKGA 1HEIA 5JZVA 1GM5A 2ZRAA 2P5TB 2RCNA 3NHAA 1IN8A 4Q1FA 2ZRNA 4ZCIA 3IUYA 4PPGA 4WA7A 2ZQ5A 3SYKA 4OYHA 5E3HA 4PSAA 1KZ7B 3CF6R 3VR1A 1Q57A 2CL0X 2BBWA 3BK7A
chains in the Genus database with same CATH superfamily
1ZGHA 4HYQA 3W6ZA 1NX6A 4Q66C 4OQFA 2ACWA 2AN1A 2H52A 3R1IA 5ECYA 1S6YA 4AUNA 3NHSA 2R8BA 3IEVA 5HOQA 4HCJA 2J1LA 1FFXA 1HA3A 4Q7QA 2P9ZA 3WLQA 1EE9A 3HCNA 4KG7A 4NFHA 2CHGA 4P0TA 4GI3A 4TV8B 4C29A 1PNVA 5M29A 1N33B 1P60A 2YMPA 1F5SA 1ODSA 3A28A 4A15A 5EESA 1NXTA 2PKRA 1CUCA 3AWIA 4C78A 2W6IA 4LXGA 3PCXA 2G1UA 2QVXX 1D8TA 1HZJA 2I2FA 4O2LA 1C9JA 4LYGA 3NANA 4GKAA 1MA3A 4Y2XA 1RWVA 3EBOA 4LECA 1Q22A 3EEQA 5AWFC 4B3RB 2YDXA 1KRHA 3KAQA 4P2GA 3G5MA 4Y2RA 1YZHA 1JDNA 2BGNA 2R87A 2QJFA 4DQLA 2OHGA 5FPTA 5DXFA 3H2JA 1E1RD 3MBOA 5KX5F 4RABA 3TKAA 5E6UB 3VZCA 1FLVA 4I5GA 2R7KA 4OLHA 3O6VA 4BQEA 3UGTA 4EJFA 1YR8A 2C92A 2BE9A 2C4TA 4F3KA 1B15A 1B8VA 1GSAA 1Z36A 2F9FA 4ZJZA 1NZJA 2Z8XA 3R77A 1GCIA 4RUKA 3CH7A 1T9DA 1G98A 1NU8A 2QM8A 3AYXB 4NNJA 1DKRA 3II6X 5BORA 2PMBA 2IP4A 3ASZA 5AYVA 4YUVA 3ZHQA 1XD2A 2FP3A 3B6MA 4LJLA 4YCAA 3WIDA 3C8DA 1ISPA 1NPTO 1WXFA 1XTQA 4G8BA 2RMKA 1BX3A 2YTZA 3DZFA 2PGAA 4RCYA 2G9ZA 1DEXA 1TIPA 2X8WA 5DT9A 4Y8VA 4H1WA 3GLIE 4RLQA 1QIIA 1BWRA 2CFSA 2Q6TA 4AXBA 2KYRA 2OV6A 3HYNA 4LOHA 2RGYA 1YVDA 3T12A 2E37A 2QP9X 4NI5A 1W2GA 4HQNA 1ZCJA 4P33A 1VYVA 1DBVO 1L7EA 3W5SA 3P0IA 2PZBA 4RF5A 3M6FA 3JD3A 3GPLA 1J6UA 2OHIA 4HGZA 4W8OA 5ARBA 2P4EA 1RXUA 4KODA 1K68A 1N5KA 1SCJA 2GCOB 3FYUA 1B00A 3O4VA 2ZUCA 4PZ9A 4Q12A 2XTZA 2NTNA 4NENB 4NOLA 3M9WA 1COWA 4CM3A 4B35A 2NZXA 3L7MA 4P3KA 1PJRA 4LSWA 1HMYA 4E5SA 1FIUA 4IIGA 5F52A 1X92A 2Y1FA 1P0MA 4R8SA 4PZDA 5HTKA 1UBOS 1B6RA 1VIAA 1YHZA 1ZU4A 4PLWA 4LY6A 1U2ZA 1ZSVA 3HNOA 3LBFA 3ZJTA 1GAWA 1RP1A 3TSYA 2VP5A 5KQRA 2XX3A 1FUUA 5EIWA 2J4FA 3SVLA 3MTDA 4EABA 5HZHA 2FJUA 1R8SA 4LCJA 4ALIA 4QDTA 5DLQC 3F6SA 3TL3A 1A27A 4LHYA 2WZQA 1KAOA 3A6FA 4LQCA 2W71A 4W7HA 5B1IA 5TNXA 1J0CA 2CCKA 3DKVA 1XI2A 3QKWA 5TF0A 4DYHA 1WD5A 3SXJA 4OHYA 5ALDA 1UEJA 1CWUA 1NHGA 4WE3A 1J2JA 3JQAD 1RHKA 4OI4A 5KSWB 3PZBA 3BXGA 2AH5A 3MTJA 4FDUA 3PIIA 4PFSA 1JL3A 3NUZA 4JJGA 3P2OA 4LE0A 1AK2A 5AKGA 2VDRB 4DUZB 4YPFA 2PT6A 3IAM6 4JJKA 1P91A 4PG6A 3VJMA 3HFJA 5CLFA 1U5AA 5DM0A 2HD4A 4Q6BA 2X0IA 4GBJA 1S7CA 3ZIAA 3M6MD 5HJ2A 2ONZA 4GEGA 2GEUA 4XJVA 2OGZA 3NUGA 1QE0A 1SBZA 4LRQA 3HSYA 1SHLA 1WMBA 2AN3A 3D7KA 5LMCA 2MYUA 3P96A 3ROTA 3VNUA 4FX2A 4I99A 5IDWA 2JDID 1H8EA 3VAZA 1X8LA 2Z5VA 4YRGA 2QM3A 1SVUA 3HHEA 1K4MA 4PGHA 1JJIA 3BEDA 1WMFA 4KIUA 1JR6A 1BEUB 5K3BA 5K3SA 5EIFA 4L5YA 4EG1A 5ALKA 1WX1A 1YUBA 1MQ8B 3ZVKA 5SYMA 4IGAA 3NXSA 4TXLA 5B1EA 3RRZA 2WILA 1FSZA 1CCWA 3FYSA 5DCLA 3F5SA 1AGYA 1TQ2A 2IEDA 4QGSA 2EX1A 1DBRA 1AUVA 4XDHA 2PFGA 2VTKA 3REGA 3OEED 1V6AA 3HY4A 3K09C 1RZUA 1NYTA 5FNVA 4EECA 4I4CA 1QK4A 1HG1A 2WIJA 1NLYA 3H1TA 4GIBA 4JR2A 2Y1KA 3VHXB 3TPZA 4N49A 3ZX5A 1XGKA 1O9GA 1UJMA 2YJ6A 3CEMA 1ZUD1 2YYZA 4G9BA 4JYPA 2RK4A 3EEFA 3NT5A 2GD6A 4G97A 4Z3DA 3U3KA 3FPJA 1PEKE 3L1KA 2GR9A 2VHYA 4WBXC 4BCBA 3RS5A 5ICMA 5AOBA 1U11A 3NT4A 3W1VA 4U3JB 2ET6A 3IKTA 3CWQA 4P08A 2J5QA 5CB8A 1PT7A 3HFGA 4UQLA 3UCEA 4MR8A 2P9BA 3LXUX 2OK8A 4JGIA 3FYCA 2ISSD 3LYAA 5AKJA 4RV4A 5TGTA 5E9QA 5FOXA 5B6PA 3WYFA 4I4IA 4RM2A 3V8QA 3E03A 1ZL2A 3NHWA 5K0CA 1BWPA 2GK3A 1QK3A 4GZ6A 5DBHX 4MRSA 3EZLA 1T5IA 4O5OA 4W82A 5CTAA 3NBYC 1IUKA 5LBUA 5CFOA 7GPBA 3N2GA 1ZIYA 2Z8YM 1B7GO 4YMWA 2H57A 1XJQA 2FKNA 1C29B 3FJOA 4AZ3B 1S2NA 2H1VA 2F43A 1VGRA 1PLJA 5SYAA 3EVBA 5EE0A 4BATA 4ZCSA 4JS0A 3DE4X 3WL5A 4CM9D 5J4HA 3FFWA 3A6JA 2QUJA 3NRJA 2LCQA 1EWVA 1Q11A 3E27A 1EFUA 5K3EA 1E2FA 2ZWIA 5I8PA 1OPXA 1N2BA 2J3QA 2VJLA 2X3FA 1QHFA 4GWLA 3O7WA 1E6EA 5GONB 5FBHA 2PJDA 3E7PA 4LFCB 2XE4A 3V42A 1SWVA 3H9GA 3JVVA 2ZM6B 3OPYA 1ECGA 2HHAA 1W87A 3O91A 3U09A 4CEHA 4CLRA 4HZUB 2I4LA 3MCAA 1LPPA 2BFEB 4OBXA 4E88A 3AR4A 3GL9A 4C4OA 4F2WA 4TLDA 1FTQA 1QPBA 2CUTA 3FH0A 5K0NA 1B0AA 1OBFO 1VL0A 3PRKE 4X1KB 1HEUA 4HLQB 4JL8A 2FFHA 3VGJA 2AFHB 3TGWA 1U28C 4JVSB 3O2QB 1RU3A 3VPCA 3HA3A 3OCVA 1HMPA 1V95A 3U4IA 5CM2Z 2GO7A 4DLLA 3NYQA 2EZUA 4TMFA 3LUPA 5TPWA 4KN6A 2ZYAA 2BFPA 4Z4GA 3O47A 1V4VA 1AY0A 4Z53A 1HLFA 2WB4A 1Z2AA 3H5AA 4AJOA 2NP7A 1QZUA 1GYPA 3FUVA 3CINA 3FWZA 3ORYA 5IHXA 4LSZA 4UQOA 1A95A 4OQNA 5A05A 4IZIA 3RAFC 1RADA 1XCGB 2HZ7A 4J1TC 1SXJA 2C97A 3IKMB 4DC0A 4Y6PA 2XTMA 5DISB 3QELB 2A9OA 2ZTLA 3NDRA 5F3WB 2JZOA 1E1QD 1G7CA 1Z5VA 3WGQA 4BN5A 2I87A 2WHQA 4M0DA 2XJ9A 1XRSB 3VR0A 1HE3A 1N4AA 4F2PA 4LMAA 4ZHQA 1NFRA 2FEKA 3N76A 4C7VA 2JJ8A 3LFHA 1FNBA 4W5HA 4QC2A 1JMKC 2CDNA 4BECA 3PQ8A 4JP3A 4GNKA 1BX1A 1XRRA 4RVGA 1EFPB 4L4YA 2GRUA 2VDUE 3CLUD 3LKZA 3IQIX 3TUZC 4A0FA 4X61A 4EZIA 3HGTA 2FPWA 2QTVA 4NCXA 5B36A 1NBOA 1PGNA 3JQGA 2B3DA 4R81A 3SS9X 4F86A 2IQ5A 5C81A 2J3IA 1FQJA 1IQRA 1ISJA 3TDMA 4CKEB 1S2LA 1FFGA 4J1SA 4LF9B 2V55B 4DT1B 1QRTA 4EX7A 3VDRA 1CUFA 2LR0A 3KJGA 3ADCA 5D5HA 1R15A 2BOVA 1UT6A 4UCWA 1AO0A 1Y9DA 1CE8B 5K51A 4KW7A 1JXQA 2V7VA 4IDQA 1SO8A 1IQ0A 4LF4B 1EVJA 3W90A 4JI7B 1E5TA 4DCCA 5JR3A 4DCPA 4WCDA 4HEHA 2FSHA 4W7SA 4WT7A 2PWBA 3WGLA 1LJ8A 5KWEA 3QOYA 2CMHA 1Y5MA 2IUEA 4FYJA 2QXYA 4LOIA 1NAIA 3B6ZA 3NC0C 1D1PA 1Z33A 2HSZA 3GCDA 4EI7A 2XCTB 1PF7E 2VLIA 4I1RA 3KVVA 1QZZA 3LC0A 5J2TB 2XMZA 1PBNA 4MTLA 2OCYC 1NXPA 4JP5A 1X6VA 3FAZA 3QTBA 1C3OA 4GS5A 2LNDA 3PRJA 1A97A 1G8HA 4HN4B 2G1AA 2WOJA 1FP1D 2Q7XA 3NH6A 3T9CA 3ZW8A 4JP2A 5IAGA 5I4IA 1GV0A 3NGMA 2H1SA 1N57A 1JFFB 2PA0A 2SKDA 5HKAA 4TS4A 4CETA 4XD7A 2FB9A 2Q4RA 1A50B 5GZ3A 5HZMA 3RHSA 3AKZA 1NPYA 2KE5A 3KPVA 3I5YA 4QOJA 4JBIA 1SCUA 3NYRA 3W4JA 1E3DA 1E2EA 5FPQA 3LGXA 2YINC 4BMZA 1H1TA 2Z5FA 2EC5A 2HU2A 3PZRA 4Q4LA 2CMGA 3A4LA 3PC2A 3RFFA 4MKGA 5I7SA 2MHCA 1NPDA 2C82A 4HXGA 1UJNA 3L3BA 1JAYA 2H65A 1JVSA 2EZ9A 3MWEB 5JANA 4O63O 3K70C 4D98A 4QDZA 5CCEA 2Y66A 2X1MA 4HNRA 5J4YA 5JYBA 1PW7A 4JJIA 5DT2A 3PITA 3DH0A 4K9KA 2WMDA 2WIDA 3ZXSA 1PKEA 1RRGA 1QVWA 4PPYA 1QS0B 1Z68A 4YALA 4OA5A 1EM6A 1H3NA 1GO2A 4XEUA 3O7MA 4IG9A 2CE7A 3F2VA 1CUJA 3LG2A 3T99A 4F5ZA 2VATA 5H4GA 3OQNA 2YWDA 5SY9A 1I13A 3CE9A 5CFMA 1NJSA 3K9HA 3T3DA 4HMPA 4F1KA 2AI3A 3TFWA 4E5PA 3H0KA 1FDTA 4HTFA 4QFCA 2J5RA 1JFTA 5KOHA 1T4DA 2OGSA 2WD8A 5IF9A 1KZ6A 2FKAA 2QKYA 1JHVA 2WYUA 1HTWA 3R5JA 1XRLA 4CR8A 1GQFA 3H1EA 2Z98A 3LDAA 4RTSA 4AYWA 2JLWA 5AVYA 2I6SA 5F9HA 2C3PA 3ERCA 3KAJA 4ENVA 3IQXA 3ADBA 3IYLW 3DBVO 2Z56A 2OG2A 4L51A 4H27A 3T5TA 2F3PA 4DYVA 2AB0A 3HKCA 3WLFA 3M4ZA 1HFJA 2HOQA 4DV1B 1TT5B 2B69A 3DNMA 1PR0A 1QCDA 1FRNA 1XNGA 1YVUA 3OM9A 3PKJA 5U4QA 4CPDA 4V2UA 2PRSA 3BHNA 4ZP1A 1NBMD 3CEPB 3O8DA 3QXSA 4J03A 1ORIA 1W96A 3ZV5A 4CF6A 5EEHA 3E2IA 2VYNA 1C9MA 1QVAA 3PP8A 1YKSA 4EB3A 1QP0A 2P62A 2IHUA 5B2FA 4JVMA 2ZRFA 3TN7A 3G8CA 4F9GA 3MWLA 1VQ1A 1NMZA 4MW0A 1RI2A 4LBYA 1U0OC 2QN1A 1OI2A 2ZUUA 3GK3A 4XJXA 3SE7A 3QNUA 2D00A 2VSXA 1ZOLA 4UMDA 1U8FO 2ONCA 1N0IA 2ECQA 5FOVA 1ZQ9A 4B2LA 5BMVF 1TO1E 3A3PA 2CJWA 2V65A 4MB0A 5EJEA 5LQRA 3ICOA 3VH1A 1DRWA 1XQ6A 2F8LA 3W05A 1DVRA 3ZX4A 1YSCA 1X19A 1GHTA 2QDKA 5LKRA 1VG0B 1IZ8A 2ZB8A 1V6CA 4JCCA 3A9CA 4O1MA 2Q8PA 4O4IB 4ED9A 5L51A 2X4GA 5EYPA 4EUHA 1ML4A 2CDCA 1FXWF 4RMGA 1UPUA 3OKCA 4JEIA 2A5GA 2XNHA 3EPJA 4G0MA 2PIDA 2GM4A 3EJ6A 5DEIA 4E3WA 3C6BA 3THRA 3L7BA 1CZHA 1KETA 1IJBA 1FRVA 1RLMA 3TOCA 3WIBA 5CCXA 4ZGBA 4IIEA 3OE4A 3L6EA 2Z6AA 2W9XA 2QMQA 2W8BA 3PX3A 3VPDA 2O19A 1T1GA 3I42A 4IAOA 1BD3A 1EB9A 4AP9A 4MWGA 3N7UA 4RKRA 2N75A 3BIJA 2DU8A 3OUTA 3WNCA 3IV6A 2C42A 1W85B 5EMLA 1IN7A 1KU0A 1NXVA 3L18A 4OBEA 3NOQA 2GNOA 1D2CA 1X70A 5J5VA 5A5DA 4QNRA 1N1MA 5F23A 3UXEA 4JK3A 4BNLA 5EE9A 4LYJA 4DMUB 16PKA 2BI8A 4JR1A 1VBFA 4D8XA 4RZXA 5BMVB 3ZGZA 1PUJA 1Y5RA 3G8AA 3QXXA 2RBKA 2J5XA 5C5DA 3P9PA 3CF2A 3BMQB 4WBNA 3W5BA 4EG6A 5K4HA 2ZUSA 1YCDA 1CUHA 1YOVA 4RPJA 3RFXA 4DV2B 1DC4A 5IWCA 4IHJA 3WLKX 4XCQA 3PHLA 1JVBA 3QEAZ 3GVXA 4N0QA 3ORFA 2BKVA 4QXPA 3CX7A 2O8VA 1GOTA 1Y9ZA 4TT3D 5DI3A 1KDZA 3V97A 3WWDA 4W9RA 4GFDA 4L4ZA 3HCCA 3WOHA 2Q2QA 4CG1A 4FHZA 1ZRMA 5JY6A 1U3WA 4KLNA 5LC1A 5K8LA 1FTGA 4DR1B 3FUUA 4TX1A 2FG5A 2ON6A 1H2BA 3MS2A 1TJ5A 4LTMA 1FUYB 3PDHA 5DHUA 5F35A 5AVZA 1I9CA 1VC2A 4EG0A 3KSRA 2HO4A 1YS4A 3VJRA 3E22B 4M9QA 2XNDA 2N9UA 4KQGA 2RHTA 2OV1A 4A6XA 2VZLA 2XMQA 4RVNA 5CX1B 2DMRA 4BO0A 3V8NA 3QXCA 1KSGA 4G1MB 3GO4A 4IIJB 4RKQA 2N42A 1THMA 5HIIA 1VJ5A 5GJWC 4X90A 5AUNB 4PHCA 1B2LA 1MGOA 4A16A 2YCLA 3IV7A 4C0JA 5BVHB 4YJGA 3TECE 1I6MA 4LNAA 1JHPA 3U1TA 4AXXA 4EPWA 3CX8A 1RSZA 1ZXLA 4RESA 4A6EA 1CERA 5KNDD 1D2EA 2BSQA 1KMCA 1VLLA 4PINA 3FGZA 4TLLB 4EEZA 2BIFA 2J3HA 5FA6A 4N8SA 5J5AA 4DIDA 2OD7A 1AO3A 4R8RA 1D4AA 3NBAA 4LZOA 3O5AA 2P79A 4D0NA 2A9RA 4J0GA 3EPLA 3GMTA 4QG3A 3PEUA 1VPVA 4N3AA 1TCBA 3U9SA 3ZR4B 2G3YA 4D4MA 3RBAA 3LRPA 2GQ0A 3M4YA 3O94A 3ONVA 4CDRA 2JIOA 2AFRA 1G19A 1S2OA 3S3TA 4FGJA 5FOQA 3RVJA 3O2NA 2QX7A 4LSMA 1DB3A 2V3VA 5EN4A 2PD4A 2HDWA 4LTDA 3WLRA 4RVSA 3B5EA 5KJEA 1WUTA 3BG5A 3I09A 1IEVA 4JOBA 2I80A 3ZV3A 4YUWA 4EPYA 1XZ8A 4IEFB 5ER9A 5DGDA 5I5EA 4BRSA 3V9PA 5JLJA 2OO5C 4RTQA 4QBGB 5JQGF 3UWOA 1KHHA 3HUUA 2DPYA 5IUJC 3AUFA 1FUIA 1I9GA 1MIOB 2Q49A 3EGVA 3L1JA 4BXOB 1Z6PA 4D43A 4DQXA 3PKIA 1T0IA 1ZO8A 2JC3A 2WUEA 5EWMA 1EG7A 1U4SA 5BVGA 2HPVA 5HE9A 2G72A 3C6ZA 4ZMBA 3GLHA 4W8GA 3IALA 3N7AA 4DIEA 4R41A 1SOWA 3SCZA 2OYCA 3RFUA 3VC1A 1TFUA 4BAGA 1GKIA 1RWQA 2ZS9A 2YN4A 4B74A 3U7RA 3FLAA 3JQFA 2IYEA 3VU9B 5AW6A 4H3VA 3Q7PA 5CA1B 2GN1A 2B30A 4YDQA 4QNNA 4E12A 2CNLA 2I9PA 1CPYA 2RDMA 4QELA 4MUJA 1XTKA 4J16A 1C9EA 1O89A 5AJZA 1WSBA 3ZN2A 2BBTA 1O6CA 3FCYA 3QG5A 1BS1A 1E98A 3IHWA 1AHNA 3IE0A 4PAOA 1LTQA 2IPXA 2O52A 2OV4A 2WKPA 4AP6A 2R1VB 1EFVB 5CVCA 3E9DA 3TM5A 5KVSA 3IPAA 5K2OA 4BP1A 1K8XB 3I8SA 1GITA 1QDUA 1VJDA 5JI2E 3Q12A 2V0NA 4G2TA 2AFIE 1Y81A 4HX5A 3UA3A 3VX4A 5K5EA 4RO0A 3KIPA 4PLZA 1TKCA 3OWOA 3COSA 4A0QA 2D6FA 3K0CA 4DNQA 2ZYHA 1IM2A 2M6RA 2PQ2A 4EMUA 1TCCA 5H81A 4LTNA 3WXMA 2ZUWA 4ALLA 3S1AA 1RYZA 3N9IA 3WK9A 3ZLVA 3EMDA 4QWWA 3L8GA 2IBMA 2ZAIA 4UE2A 3HKBB 4HR7A 5H4HA 5F5NA 2G7MC 4C6RA 3NGXA 3COVA 2FA9A 3T7EA 3MEQA 4GYKA 4Z2YA 4M54A 2DE0X 2XT9A 1ORRA 2VRWA 4NIMA 2JJ2D 1SXPA 1RJDA 3WSVA 1UBJS 3DO8A 1LDEA 2P90A 3MFYA 2QYSA 1GL6A 3AK4A 1F2UA 2R4QA 3SJCA 4R71A 1WQ4A 2DR0A 1V1MA 3EXFB 3ND6A 1CJMA 3ENQA 4GI2A 4EG4A 2HJHA 1BDIA 3KQUA 3VU1A 3TBHA 1P72A 4UVIA 4P93A 3PLAE 1KDRA 1OWPA 4FT2A 3LHKA 2XD4A 1RQXA 1SJ9A 3CN9A 4WMLA 2ZZNA 1RXCA 4AUMA 1PJTA 3EG9B 3VKHA 4MB2A 1A82A 1M2FA 1YMVA 3AU9A 3FDIA 1OFGA 5K05A 2I6XA 2I71A 3T4UA 2AJCA 5JATA 4ZCLA 1N7GA 4O8ZA 4GUDA 2C1ZA 2ZRKA 3REQA 3ITNA 3PGXA 4YDSA 5CM8B 2ZXFA 4BX3A 4E14A 2J0QA 5FNZA 2KB0A 1T8SA 1O96A 1RBQA 1HOXA 1M5UA 4D99A 3JQFC 1KYYA 3ANYB 2YHSA 4NTZA 1SKQA 1USWA 2FLKA 3GB9A 3RTGA 3BKWA 4HB0A 1VLZA 4K2AA 4RXMA 3E7WA 1MH1A 3GARA 3KZOA 4PYIA 4CLDA 1HYEA 1O54A 4EGCB 2G06A 1SKYE 4MVJH 1EAYA 1GA1A 2XADA 4PAGA 3K1ZA 4J16C 3ND8A 2DWQA 2CZCA 3GJ3A 5AHXA 1J09A 4TLCA 4CT4B 5GOTA 4DGQA 1Y1RA 2P4UA 3JWJA 1EEHA 3WJAA 4DJDC 2PLAA 1GTMA 4ZFNA 3S2ZA 1R12A 2NSLA 5CJPA 1RM3A 2QRJA 3NORA 1LFAA 2ZIXB 4GPAA 2QSZA 2JGRA 3GAZA 4WLOA 4PSUA 3INRA 3PPWA 4NICA 2FR8A 1NXXA 2GARA 5D7BA 3ZQ6A 5JC1A 5KQMA 2O8FB 3ABRB 1MX1A 3FCOA 2IHKA 3AOEA 4N0DA 4OJMX 1VSUA 4Q37A 4BJ5A 5C7LO 1ULAA 3PHIA 3OMLA 4HUQB 1ELOA 3I2IA 1YC2A 4FDVA 2P9EA 4UUOA 3RTAA 4CHGA 5ICGA 3M5DA 1UC8A 1GTG1 2QRNA 4Y2YA 3QWFA 1T2DA 4TVBA 5AM3A 3K9FC 3NU1A 1QYRA 3CURA 1Z22A 3IVAA 3TZKA 1H6CA 1Q3HA 3N2GB 5LB4A 1Y7LA 1NM5C 3UHAA 3KYBA 3BRSA 1XMIA 2ZIZA 2O3RA 4HH0A 2EBFX 3PL5A 1YNOA 3BVPA 1L4YA 4Y2HA 1DO2A 3EYAA 2CXPA 2ATCA 3MAJA 5AK4A 1E32A 4OJTA 4YT4A 4FR0A 1T8YA 2ZDQA 2DFNA 3KEMA 5AKKA 4TGLA 3SC3A 1T1JA 2JGIA 1KWKA 1L3BA 4XGQA 4LJSA 4J07A 3X0DA 2I2WA 1KI6B 2QRQA 2RHBA 3F3MA 2QNBA 3P9KA 4HGRA 3G2KA 3HVHA 5GONA 5B1DA 4F96A 1DAMA 3VV3A 5C4MA 3PA6A 1D8AA 3D7RA 3K20A 4G23A 4RHUA 4PYOA 1GRCA 2H07A 4EOGA 2V6MA 2AOVA 4DIBA 2WU0A 3SNHA 4GPEA 4OCZA 1RD4A 1REQA 1V3TA 4JVNA 3TWOA 4CEIA 2CFRA 1FLDA 3H5VA 5HIKA 2NZWA 1EHYA 4Z9XA 5TARA 3E1GA 2GAFA 1PIWA 3JX9A 3GZTB 5FI0B 2FP4A 3WLMA 4JC8A 4WVLA 4Z1MD 4KGDA 2DFVA 2ZWMA 4GP9A 4OHUA 4BQNA 1FMJA 4WXRA 1ZRHA 1C4XA 1TMKA 5DN6A 3FTPA 4BLSA 2WHEA 1ZNQO 4IF6A 1F7VA 4JSRA 2EARA 4Y1GA 3KFXA 3CZ5A 3GBVA 521PA 1KIMA 4E07A 1RWOA 4J2OA 4XWTA 1PL8A 4JLWA 1KJWA 4UEQA 1KFKB 2REQB 4DR5B 3RJMA 4YECA 2HYDA 3I6BA 4NARA 1SM4A 3LHFA 2ZSBA 4O2AF 3EXHB 4EZBA 1OZGA 3QLVA 2F1IA 1PT8A 3NM6B 3P94A 3FHCB 5EKDA 2FAXA 1KVSA 3HK2A 2D54A 2Z1NA 3ITDA 2H0AA 2RGUA 4N5LA 3X2SA 3OZUA 1GILA 2VUTA 3UPDA 4YMVA 5JAZA 4E11A 2XD9A 2P9JA 4WGGA 1VJGA 4F7WA 1OX6A 4OHVA 2Q5HA 2NQTA 2VO1A 4B4DA 3STHA 1KBQA 1IHUA 4KPFC 4HH3C 2I7CA 4CQJA 3WGVA 2QD1A 4X6XA 1CY8A 3L6OO 4XYBA 2FZVA 4K1XA 4LOJA 4B6PA 2ANCA 2QPOA 3I1JA 3TIGA 2H2GA 4AX8A 4REMA 4DB2A 2VQ6A 1YJCA 3CMCO 1OY1A 1C0PA 4UHCA 3OCZA 1WPXA 4Y1FA 5F9FA 3L93A 5GJBA 1C1HA 4X8OA 2QPAA 4CMIA 4S2UA 1KORA 4WESA 5KTSA 3KTDA 1QGAA 2CYBA 2IHZA 2WU8A 1R4NA 2GETA 2WVJA 4KVAA 3GJ5A 1OTHA 4KQ2A 5F7OA 4MP3A 4ETNA 1J97A 4MUFA 3VTKA 4H4CA 2PT7A 5CA0A 5A5VA 1Y7HA 4UTOA 4UHEA 1GTJ1 3EVFA 3KYCA 4Q3BA 4B40A 2V6GA 4P8RA 5E7MA 3UA4A 1D0VA 2X2OA 1PJBA 5J9FA 4Y6GB 3RS4A 2FPGA 3E5HA 1DLIA 1RWXA 3WV5A 4KO4S 4M1TA 2LGJA 3M83A 4RADA 5T4BA 3L0YA 3L8YA 2BE7A 2BJHA 1X1SA 1E1DA 4LZPA 4B81A 5C8DA 1MXFA 1YRBA 2A3RA 1M1NB 3P4UA 2VJKA 3PHHA 3WIUA 2PT9A 3SBOA 5KWJA 3J80A 2XUDA 2W70A 3RUDA 1QV9A 3W5AA 2DSTA 1WXXA 3ZD8A 2DERA 5HEKA 3ELWA 1FB5A 3AU8A 5CYOA 3S27A 2DBVO 5GZ1A 1E2QA 2IXGA 4BU1A 4N8DA 3KQNA 2LDXA 3MWDA 1QHYA 2CL5A 1RZRD 4E70A 3N05A 3IP5A 3KWMA 1DQNA 1YR1A 3SEZA 4XJTA 2QPLA 2PH3A 2MJLA 2QRLA 2P0YA 4LSGA 1FW8A 1RAFA 5DHFA 4BQFA 4HGQA 1ZGZA 5KYWB 3U1BA 4MR9B 3JD0A 1C3LA 1SXJE 2Z57A 1CZOA 4FOSA 5BWBA 5CDFA 1QMGA 1OAOA 2I8LA 1ZD5A 2DP4E 1Q95A 2FK7A 1OHHA 3S6JA 4WFKA 1XL0A 5T4EA 4KI0A 5C7OO 4X93A 3JQ8A 2YWXA 5DTIA 5FH9A 2X8JB 1R6AA 1SUWA 1A8QA 3N8GA 2ODEA 2A0WA 3QLVC 1X7ZB 4QRDA 3RS3A 2CJXA 3UJ8A 1JRLA 4FTWA 3NW9A 1C3XA 5DM4A 3FPEA 1GXSA 2VBGA 3OIUA 5IW8A 4F11A 1XTSA 2UDPA 2QN3A 3MGBA 4G0XA 4GLFA 1TGYA 4UDNA 2J0UB 3VMFA 3BD6A 4RTNA 2ETVA 1PGOA 3NBZC 3UMJA 3KQYA 3H2GA 1ZOSA 4NONA 3OF3A 2JLZA 1HYGA 2Q9BA 1RVDA 3PGKA 2P5YA 4GSKA 4ZQHA 1ZEJA 2F9LA 1COZA 2GK4A 1HORA 2HJWA 4HDNB 4O2AA 4EYGA 4UKDA 2JCBA 1IJKA 1C7JA 2C61A 1UDAA 1P1BA 1P4HA 1DWOA 4OOEA 2I2BA 1HQDA 4ILEA 3RFTA 1XZJA 1QXSA 2VDVE 1ABFA 4JLNA 2Q7DA 4A0GA 4YMLA 4F84A 2JIZA 3RYCB 4BKRA 4G41A 2ZB2A 5LSAA 1EZ4A 4KBFA 4W6QA 2W37A 1ZGAA 5A3RA 3EEBA 4N1AA 1FDUA 1SQFA 3UENA 4RQBA 3T4PA 4G1EB 3UJDA 1OB2A 4AICA 3ZLUA 2V7WA 4LNHA 4FEGA 1UPFA 5JI3E 2K7ZA 3AR7A 4WEOA 2YFKA 2NO1A 5GJVC 3WNZA 2HRCA 3CC8A 4E5VA 4OU5A 3DF9A 1AK1A 1NG1A 3GPCA 3ZK7A 1Q1EA 1G64A 4YT5A 3EXEB 1Y63A 1Z2EA 1JT9A 4NCJA 4UDXX 2FFJA 4HXFB 1RRMA 1XZFA 1N25A 2MSKA 3F7OA 3WHLA 3ZWQA 1WCV1 5L7TA 2QBYB 3UPUA 3I6ZA 2Z3VA 4FYIA 4IL5A 3ENWA 1G60A 2V4UA 4Z9FA 4D1YA 4K26A 3SJ7A 1PFKA 1BW9B 2OY0A 4OGKA 4OD0A 4KEAA 4NZ9A 5TGZA 1EK0A 3D5TA 4MUGA 4YCSA 3GDWA 1AQLA 1M1YE 4GGPA 4C04A 4D0SA 1XPOA 1EWYA 1OAOC 5H9VA 10MHA 4MYHA 1ORHA 2WABA 1SG0A 3Q2OA 3QIVA 4OIFA 5J23A 4DY6A 3HBNA 4L5IA 1JE0A 2OCXA 3DW3X 5FTKA 3SLKA 2BZGA 1J90A 3AF3A 3DMTA 1PR5A 1S3FA 4UARA 5IC6A 5L3QA 1RXVA 1VGQA 2W6PA 4URHA 3VPXA 1DCMA 3BIFA 1BA3A 3O8LA 5CXSA 5A06A 2QUBA 2GYVA 1M54A 4JOCA 2ID7A 1FBTA 1WZUA 4MH0R 5DNDA 1G66A 3KPYA 2XZOA 2WSSA 3D8TA 3DWFA 4EB6B 4UUBA 1P1CA 2PCLA 3PFBA 2E4ZA 5MF6A 3D3NA 1VLVA 3MELA 2GX6A 4PQGA 5CFQA 3Q8XB 4ND5A 1R16A 2O6HA 1U63A 3BTSA 4LDRA 3PNPA 3I61A 2REXB 4DLKA 3Q6IA 4WPGA 1XFDA 2DGDA 4FFRA 2HHHB 4PZLA 2FPKA 2ABWA 2VYVA 4MW4A 3MTQA 3N07A 1XELA 1XWWA 2DTEA 2GBPA 2H4WA 3K96A 4I6JA 4MQUA 4H18A 5T4HA 2HPAA 1PHPA 2H2AA 2GRJA 3I8OA 3MUNA 2GEDA 3T38A 5AW8A 3GOQA 4JX9A 1Z63A 2Q3BA 2OLJA 3I9NA 2WY2D 3X1KA 4IXWA 2G9NA 3MC1A 4KK3A 3K0BA 3UH0A 2QY9A 3WGNA 3LT1A 4TKLA 1GL7A 4UBLA 4FJ2A 3R44A 4XX0A 4WK4B 3SWWA 5C1IA 3HZRA 5GIPE 1XJ0A 3INTA 1BE8A 1KQOA 1BJKA 1RYDA 2B0JA 3K0HA 5BYJA 3V4ZA 5IM4F 4MS4B 3HP4A 1UWVA 1F14A 3KQHA 4R2IA 3V2UA 1U7XA 2OKGA 1ULTA 2XGMA 3NIBA 4IUBS 3SYMA 1JI3A 2HXGA 4R9RA 4E13A 5B58C 1EVIA 3NBUA 3H99A 3K70D 3AM1A 2B8WA 2IYXA 3H1BA 2LKDA 2WLSA 3LZ6A 1Y3IA 3OT5A 5IFLA 1OMOA 4AX4A 4BQSA 4QSHA 1O6FA 3A9VA 4YP6A 3NHKA 1I7QB 4G65A 3BA6A 5EOVA 4OXIA 4V3CA 1VCIA 1SVSA 2O0JA 4MWTA 3C3PA 3DC2A 4YUAA 3ZJVA 2AXEA 3TW8A 4KO2S 1CKEA 4G6ZA 4WLFA 2VXBA 3AR5A 2IP2A 1N2GA 2V6BA 1NVWQ 1NL3A 4MZDA 4TV9B 4WKNA 3RADC 2AI1A 1I14A 4MMZB 3T7SA 4BKPA 2FZKA 1M8GA 4LFBB 3RRMA 5KKCA 2VUSA 3B3GA 2Q45A 2VNJA 1F6WA 1KFCB 3LYLA 4QTZA 5DYNA 4D80A 1OX4A 2FN8A 3HZOA 1T2CA 3OAAD 1BHO1 4HB2A 3DNPA 4EA8A 4X6UA 4Z8YA 4MVCA 1ISGA 2H1WA 3S0JA 3DA8A 1HNXB 1DFIA 1Z8FA 1DX4A 4F4DA 4H6WA 4GPBA 1NWCA 3VHXA 3GRCA 4DJ5X 1ISMA 4B4UA 2RB5A 1OXUA 1PZHA 3OQ1A 3F6YA 4DLNA 1W4RA 4I46A 2HREA 1LH0A 1J9GA 4HXEB 2FRVA 1E9FA 1DIRA 1N6HA 2C94A 3RSSA 4PC7A 1YRAA 3QA9A 3EAFA 3OU7A 1JAZA 3QFTA 4JJFA 2W2QA 5D8DA 2IU0A 1G1AA 3H8SA 1JA1A 2C9DA 1HFKA 5FPPA 1XCMA 2P6MA 2NQ2C 1XROA 2WD9A 3KXDA 4YB8A 1TX4B 4ARBA 4Q3NA 4HGNA 2PLWA 5ECWA 2EBUA 3PBKA 2QRKA 1NG9A 5JECA 1WA5A 3THWB 3L8EA 4DR6B 4MICA 3GMDA 1K4YA 3IP6A 2C2MA 5CD1A 4MEAA 1NQAO 3F6EX 1X7HA 2XNSA 5ALJA 1V16A 2QVZX 3GZNA 5C3MA 1G63A 1WB9A 1CU1A 5HKOA 3COZA 1RKQA 2IXDA 4M8NE 1TF7A 2VHTA 5ALEA 3F4LA 1KMHA 1RM5A 3MUOA 4UTNA 5SY6A 2ECOA 3P97A 1PK8A 5ENDA 4JI2B 1Y34E 2AJBA 3U44A 2O1EA 2QRUA 2BGMA 1CP2A 4UZEA 4LRUA 3VR5A 1KBZA 2Z2YA 3I9KA 3E3OA 4F71A 1U7UA 1K92A 4HQ6A 4R51A 3RIEA 5H80A 5MGNA 3SR4A 4IGIA 4JOSA 1GZSA 3WNVA 3I32A 4FD3A 3OF5A 4LEIA 1L3CA 2QB5A 2HCJB 4EW2A 2FMHA 2FYTA 1LBHA 1CR0A 1XPJA 3JQ9C 5J47A 1SKAA 4QBHA 1KOLA 3WLOA 4XPZA 1E9BA 1HY3A 1UBUS 3AW9A 4EX6A 3G3EA 1EDEA 1O6ZA 4QU0A 2VTEA 1MA0A 2CLKB 3EDRA 4UNPA 1WP4A 4PQRA 5HRCA 1Q3TA 4AMUA 2O48X 2JIDA 1AUQA 3QPAA 2ERYA 2JBWA 4HNAA 4II7A 1E5DA 1W5BA 1XIVA 2COKA 3A2NA 2BGIA 3E9RA 4WJLA 4XVHA 4NULA 4Y1EA 2HA6A 1K6JA 4MV8A 4ERNA 4MEJA 3K9QO 4Z4FA 1KAQA 4FPXA 5C53B 4CTKA 4WJZA 4TWBA 2Z2XA 2PFKA 1G6HA 1H4VB 3NOVA 3I5UA 4S1OA 1LLDA 1SUDA 1CJVC 2PIAA 4RDIA 3PV0A 4K9OA 3TOSA 2FUKA 1KNXA 2VPPA 4Y9UA 1Y6GA 2Y0CA 4NXNB 5U9CA 1NMSA 2OVBA 4A92A 1EQUA 1C1XA