4QJ5A

Structure of a fragment of human phospholipase c-beta3 delta472-581, bound to ip3 and in complex with galphaq
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
317
structure length
317
Chain Sequence
ARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPSYLPTQQDVLRVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/hydrolase
molecule keywords Guanine nucleotide-binding protein G(q) subunit alpha
publication title Molecular mechanisms of phospholipase C beta 3 autoinhibition.
pubmed doi rcsb
source organism Mus musculus
total genus 105
structure length 317
sequence length 317
ec nomenclature
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00503 G-alpha G-protein alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.400.10 Mainly Alpha Orthogonal Bundle GI Alpha 1, domain 2-like GI Alpha 1, domain 2-like 4qj5A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4qj5A01
3PUWA 4TLCA 3U6KA 3ZVNA 1SKQA 1Z0IA 4C30A 4HUQA 4CEIA 4LJ5A 2P0EA 2XTMA 2J5XA 3BE4A 4LJ9A 4ZKDA 1U2RA 1EX7A 1E9RA 3D6TB 3DO6A 1JXMA 4JVMA 5EZ5A 5L3RA 1KI4A 3SC3A 4PQYA 5HKKA 1IN5A 3QF4B 5HE9A 2FFHA 1VG8A 3CRVA 2OXCA 2QT0A 5EUQB 3THOA 1E4YA 5FPTA 1IY2A 3FWYA 1EFCA 3THXA 2MSCB 4U02A 1E2PA 1U90A 3JZAA 4B3XA 2RHMA 1GKIA 4LOAA 3NDBB 1FUUA 4BFUA 2VHUA 2XITA 3QBTA 4P4UA 3GLFA 1RRPA 3H4MA 1JALA 4Q1BA 4Z8YA 1ZP6A 1QHYA 1Q0UA 3BFVA 2PBRA 2RAPA 4HEJA 2CHQA 2NPIA 1XWIA 2ZU0C 1E0SA 4ILEA 5DNYB 2IS2A 2EYUA 4WA7A 1ZM7A 1E2DA 2B92A 1HEIA 2YWGA 1G3IA 4Q1DA 5EXXA 4ASUA 1TX4B 4M1MA 2VO1A 1CULC 2IF2A 3TIFA 3M1IA 2FZ4A 2WIAA 2ZRAA 1RIFA 4LHVA 1GRQA 4I1VA 5DHAA 3TSWA 4KXFB 2WSSD 1Z6YA 4BFWA 4UNSA 1XDBA 2DWQA 3B5JA 4AURA 1NBMA 1Q21A 1UDWA 1X6VA 3OFNA 2C9YA 2QENA 5FOXA 1E9DA 1XTIA 4WAUA 5HTKA 3SJAA 1CJTC 2ZRFA 1KI9A 3W6OA 3EXAA 3ADDA 4II7A 2JLZA 2IXGA 4MRRA 1R0ZA 2HYDA 2V54A 4HYYA 4IOKA 3LW8A 2CL7X 3DM5A 4HB2A 5FOWA 3BK7A 3LX8A 3IPYA 1CJUC 3AGQA 4G1UC 4N0EA 2GHIA 3KL4A 3SR0A 2ASEA 4M1OA 4P32A 1WBDA 5H1YA 3WP1B 1DARA 1TEXA 2H1LA 1NIJA 2WJVA 3KXKA 4KCGA 4Q7MB 4NU0A 2FE4A 3MD0A 3PXGA 2FGKA 4IOLA 3MWLA 3K0AB 2B21A 3RRNA 4MITA 1KDOA 2GAOA 2C98A 5FPHA 2AN9A 2AX4A 1OF1A 4OHXA 2O0KA 2MSEB 1ZMXA 3WBJA 4PHFA 1C1YA 2O8FB 3O47A 2GCOA 3B78A 2VP4A 1U9IA 3CR7A 1ZNXA 4B3CA 3IDQA 4DVGA 3QPUA 4FMCF 2ZSBA 4HLUC 5BN4A 4JLOA 3CH4B 4LYFA 4AYTA 4DZZA 2RGEA 5JWHA 4V0NA 4HB3A 2HEIA 4ARZA 4QBFA 2F43A 5E95A 3ZS8A 2WKQA 2CLDX 3S1AB 5EE9A 4PHGA 2PMDA 3HDTA 4OI4A 1QG4A 3WMFA 2O8DA 5DIFA 4RZ2A 3E2IA 1NLFA 3U44A 4Z1MA 1GRRA 1KDTA 1E96A 3I92A 4OJKA 4U00A 3SU8A 3TR5A 2I4IA 2NTYC 2OBNA 3CF6R 2X2FA 1GG2A 2BWJA 3FVQA 4Q1FA 5KUTA 1Z2CA 1AM4D 2J1LA 5GJWC 1YR9A 2B8WA 4POAA 4LPKA 2FPLA 4HB0A 2GKSA 1D2NA 2A3RA 3JZMA 2D62A 1J99A 3PEYA 2GJAA 3M4YA 3Q8XB 1DAFA 4A82A 5K8IA 1PLLA 3SN6A 3ICQB 421PA 2PT5A 1G7SA 4P3YA 4M1YA 1Z6TA 4QOSA 1P2SA 1SXJB 5JS7A 3FKQA 3QENA 2AKAB 3REFA 2R8RA 2NO0A 3RSOA 3F8TA 3CR8A 4EAQA 4D6PA 3THWB 3OESA 3QKSB 5JSZA 2IW3A 2FSGA 2BC9A 4L5BA 3FMIA 4KODA 3NWJA 2JA1A 3VU9A 4YQFA 4TWZA 1Z0AA 1LNZA 2N1BA 4EPVA 2HLDA 1AS0A 3U7EB 4ACBA 1OH7A 2JEOA 4MKHA 4NZYA 2CNWD 2PJZA 2QRZA 4AWXA 4JBWA 1L4YA 1M1YE 2QORA 2W0SA 4M2LA 3VX3A 3THYA 3K9HA 4X8LA 2HT1A 3AVXA 1CR4A 2QEQA 5DI3A 2IYTA 1N6IA 4XOIA 3BRWD 2DHRA 1N0VC 2P2LA 1NJFA 2OCAA 2F3RA 1Z07A 4PX9A 4C0HA 3GEHA 1SZPA 4IVPA 4MRNA 3U3JA 1P60A 5JWRA 3UXMA 4HUQB 4TMZA 4CEIB 2XOKA 2FA9A 2P6RA 2FG5A 1P2TA 3T61A 1Q1QA 3H86A 5FOSA 1XU4A 2QP9X 4URYR 4E07A 4JYCA 1FQJA 2CCKA 3A1UA 2AHOA 2P5SA 2GVDC 2J41A 4GOJA 4NCNA 5FTLA 1H8HD 2FZLA 5FL3A 2JGNA 4A9AA 1P62B 2WM9B 3QY0A 2Z5FA 2NPFA 1A2KC 4DEYA 4P4TA 3THXB 1A7JA 5B64A 2DCUA 2TMKA 2PZEA 3GLFB 4GT1A 3B6EA 1LS1A 3K1JA 2NMVA 1GL6A 5K8UA 3P1JA 4PFSA 1W36D 1YRBA 5DH9A 4PO1A 4B3FX 4Q19A 1HA3A 1KI6A 3AF4A 4GRAA 5TDHA 3K0FA 4V0LA 1NNEA 3NHAA 1TAGA 4Q48A 4RSGA 1SKYB 3BERA 1GTVA 3K9LA 3GJ8A 2HCJB 3ZZ0A 2XGJA 1VYUA 2I1VB 4V0ME 2ZJOA 2ZPTX 2Q9AA 1W47A 5EP3A 1PZNA 2JLRA 5EE3A 1E32A 821PA 1E2QA 4QXAA 1U99A 1VCOA 3GEEA 1BYIA 5H70A 5TARA 5CDFA 3CW2A 4C9BA 2PEYA 4B32A 3U3MA 1ESMA 1OHHA 3FFAA 4QBHA 4AI6A 4DCNA 4Q7KA 3U5ZB 2BCGY 1YR8A 4EJSA 1TQ2A 4BASA 2OAQ1 2WWXA 3V4FA 4LC0A 2YYZA 3H1TA 4DKXA 5HE8A 1DAEA 2G0NA 4O25A 3NDPA 2BBOA 4LJ7A 3C41J 4PHHA 4RKEA 1UADA 4ERNA 4C2UA 1OXSC 3GMTA 4QFMA 4TT3D 3QSYA 3PR1A 2XSZA 4GOKA 1KK0A 4LYHA 4MYHA 3EPHA 2D2FA 2WPDD 4X8OA 1P3JA 1JEDA 1EWRA 2FNAA 3RHFA 2W6JD 4C4PA 2YOFA 3IQXA 2HCBA 1AKEA 3CIOA 4B33A 1QHNA 4QJ5A 2BV3A 1NN1A 2XNSA 2JIZD 2PL3A 4A4DA 3D3QA 4ZDIA 2JLSA 1SVMA 1KNXA 4C0SA 4Y0VA 4HZUA 3PVSA 1EWQA 1QRAA 2OCYC 1E9AA 1KI3A 1XP8A 5JJKA 1KNQA 4BFYA 5GVSA 3UWKA 1GWNA 4JLKA 3EW9A 3RS3A 1R8QA 4PPNA 2OCPA 4D4LA 2MMGA 4RD0A 3W3AA 1KO4A 3KDSE 5LPNA 2XNDA 3W8RA 1FW6A 1JBKA 1E79D 4JL6A 1KDRA 1MABA 3UANA 2A5JA 2R6DA 5ANRB 4DWJA 3KB2A 1LFDB 3CLVA 2XZOA 1CRQA 3L0SA 3BOSA 4XD7D 4B73A 1CTQA 4ARZB 4ZCMA 4IJMA 2F43B 1KK3A 2V55B 1TADA 2PJRA 4CZ2A 2Z6VA 2QN6A 1T3HA 2CLSA 2HUPA 2ZRKA 3RRMA 4E03A 1GAJA 1SVSA 1SVOA 2RGBA 4NDZA 2O8DB 2IK8A 3K70D 3FHOA 3U44B 1HE8B 3DHWC 1DS6A 5EZ6B 4FCVA 2VLIA 2OE2A 3CRRA 5FTMA 4EPWA 2FV8A 3A36A 3PFIA 3WNCA 1DG1G 4JJKA 3ZS9A 4CGZA 1G3UA 1XXHE 1LW7A 3DOEA 1E2JA 5CM9C 5KNBA 4D2IA 4DCSA 2EFCB 2RB4A 2PLRA 3QOFA 3MCAA 4PQRA 4DLYA 1EFRD 2P6UA 4JZKA 3IQWA 1BMFA 2XXAA 1AZSC 4UNPA 2WWYA 1D2MA 3EASA 3KQUA 4OQFA 4PZLA 3DMDA 1X86B 4Q7LA 3NBXX 3EA5A 3K9GA 4TL9A 3AKCA 1W0JD 3W5IA 1RRCA 2UZ3A 5AR1A 3U3RA 4M9SA 4IHQA 2E1RA 2VP2A 1Z2AA 1CR2A 5FFMA 4AIIA 2RGXA 1GSIA 1Y63A 2G0TA 2W2TA 1J7KA 3EZ9A 5K8TA 1ZW6A 4CT4B 3TH5A 3SFZA 4LBVA 5JSZB 4R98A 3U3OA 4G5OA 1KJYA 1F2TA 4F92B 3AP1A 1E69A 1ZM9A 4B48A 2H5EA 3VU9B 1XRJA 4F91B 1EFUA 3JVVA 2D74A 5AUQA 1U9IC 2G88A 2BDTA 4WW0A 2RCNA 3B1VA 3Q9LA 1M6NA 1M7GA 1N6NA 1PUIA 4JJZA 3THYB 3FMFA 3D7MA 2KJQA 4FMDB 3IEVA 5DI3B 4QM7A 1N2CE 1D8TA 4BZPA 4D80A 1YZNA 5KNDA 4IEIA 4N0DA 4D0LB 3AVOA 4BE7B 5DYIA 2QAGA 1NMXA 1ZJ6A 1Z29A 2BEKA 1ZNZA 4NH0A 4JT4A 1Z28A 3LQRA 4RD6A 1S3SA 5CB8A 4TTQA 4TTPA 1A1VA 5FBQB 1N25A 3KJIA 4WXPA 2A5GA 2X2EA 2YOHA 4U5XA 1AK2A 2Q21A 4NL4H 3PUXA 4YMVA 2ZI9A 4MKIA 3IUYA 1RC8A 1MO3A 5JJLA 3V4RA 4PC6A 4GP7A 1E9CA 4XSHA 1JR6A 3LY5A 2BMDA 2C03A 4DLUA 5EE0A 4EQ6A 1FOEB 1DAHA 2AFIE 2FPKA 5C1BA 3U3KA 3WY9A 1LY1A 4HI0E 4AD8A 3SYKA 3UIEA 2WJYA 1DG3A 1HV8A 4HSEA 3TLXA 5AUPB 1E2HA 1KI6B 3AF1A 3PG5A 4P4SA 2BBTA 1S1MA 3C15C 2Q3HA 3K0FB 4NYMR 1PJRA 1ZAKA 2ZS9A 3GLHA 4LBYA 2J0QA 1E6CA 4OI0A 5UKDA 1SHZA 1OH6A 3EC2A 1R8SA 1B23P 2OFOA 3TE6A 1NIPA 4QJ3A 1RYHA 1S96A 1G20E 5GJCA 1XB2A 3VHXA 3X2SA 4M1KA 1EFHA 1R6BX 3GCGA 1XX6A 2HJGA 4LRWA 3CX6A 4EJSB 5J4KA 2CNWA 2IC5A 4IVRA 1E2IA 1Q3HA 1RFLA 1G6OA 1RRFA 5L3VA 1N6HA 3K0CA 1FTNA 2R6FA 2VL7A 3QPVA 1XTRA 1P2VA 4D81A 3B9PA 3B60A 1KAGA 1ZM4A 1YJ5A 5AJWA 2REOA 2VSOA 3IO5A 4K8OA 1IQPA 1FZQA 1T8UA 2D4HA 3W8NA 4ZDWA 4DDTA 3CONA 2PZGA 3TNFA 3KFVA 5BYKA 3LLMA 1OSNA 3CZPA 1I4TD 1FX0A 2JDIA 1XMJA 3BH7A 4HZUB 4A92A 4KFRA 1MRSA 1VECA 4R7ZA 2X77A 3ZVRA 4HAYA 5JI3E 3C7KA 4MA4A 4OHVA 5AJYA 5JS8A 1N6PA 3VNVA 1D2EA 2FJUA 1Z0DA 3WHKA 4Q21A 4KSBA 5DHFA 4B71A 4JL8A 4IFEA 2OEPA 3KUDA 1R5OA 2C96A 3T1TA 1K5DA 1N5IA 1ZVQA 2JASA 3GJ5A 3ICEA 2LCFA 1MABB 3K9NA 5KYKA 2Z0MA 3SOPA 3OEHA 1YKSA 2J0SA 2NZJA 1AIPA 1YZUA 5TV2A 4UJ3A 4G5RA 1FUKA 1TMKA 4L4UA 3TBKA 5E3HA 4DJTA 2CEAA 5KSYA 3U6BA 4WXRA 4IDQA 1QVRA 2CK3A 2QNRA 5GJVC 4B3BA 2OBMA 1Z3IX 4LJ4A 4EJSC 2CHVA 1N0UA 3TRFA 3A4LA 1CXZA 4KI0A 2G6BA 3R20A 3A4MA 5LD2B 1HY3A 5DISB 1VCIA 3BGWA 2W6ID 3HWSA 2QSZA 2EFHB 1UF9A 4JKYA 4UXHA 1V5WA 2JLUA 3R9IA 3ZJYA 1N5KA 5SZHB 2ODBA 1TF2A 3U4QA 2XXAB 3VR1A 4Q9IA 5FPKA 3I8SA 2VHCA 4KSCA 1TQ6A 2QTVB 3AVPA 1CR1A 4DLSA 3PIRA 3QXJA 2ZSAA 3CRW1 1X8KA 3SJBA 2ERXA 1D5CA 4NYMQ 3TW4A 3U7GA 4S35A 1KKMA 4TLBA 2XB4A 1FTSA 2EFDB 4ZI3A 2Q3FA 2W6JA 4MGKR 2IYSA 4LJAA 2C77A 2FDCA 2ZYWX 1WXQA 3SQWA 4ZDJA 2ZR9A 4Q47A 4BGDA 1F2TB 3QEOA 1OT3A 1E9FA 1KJZA 2F7SA 1NN3A 4BZQA 1FFHA 1UBFA 2ZRBA 3SEAA 4WZAE 1AJEA 1E2NA 1OW3B 2ZR0A 5IHPA 2BM1A 3AQ4A 1KOFA 2K5UA 4Q02A 4Q01A 4XSGA 1HURA 1SHKA 1KTVA 3LD9A 4C3ZA 1YR7A 3AGPA 2CE2X 3N2EA 4YXWA 1P5ZB 3ADBA 3VR4A 4OJQA 2AD1A 2WKRA 2QAGB 3AH8A 4L8GA 4KITB 3FMOB 4XD7A 1R5NA 5BYJA 4PSVA 5JEDA 1C4OA 1NN5A 1E2FA 2R6AA 1E1QA 1NJGA 1KSHA 5LD2C 2DPXA 2ZSFA 1G17A 3GJ7A 1MT0A 4HDOB 5JJIA 1I4LD 1BIFA 2XEXA 4CT5A 5HPYB 1MO6A 1Z0FA 3W6NA 2A5FA 4ZKEA 2RGAA 2GESA 2IYLD 3SJCA 3WMGA 3ZGXA 5F9HA 5EE1A 4HAUA 1MRNA 4NP6A 1NKSA 3TVDA 1AGRA 3IPXA 2BEJA 1YHNA 5LB2A 1IY1A 1Z0KA 2A30A 4EQ6B 2QROA 4PC2A 1UBGA 3RYTC 4B34A 3L0PA 4A8JA 4DC9A 1S3GA 3WNBA 2FX3A 5B30A 2P67A 4HB4A 5BN3A 2WSMA 3EZ2A 4Q4HA 2B8TA 2CVHA 4P4SB 4ZO4A 3TAHA 4ACAA 3H2YA 3G0HA 3R9XA 1L8QA 1SQ5A 1H8ED 3GLHB 5SZKB 3E5HA 3V9PA 3GFTA 5CM8B 1Z47A 4KBFA 4F4IA 5JI2E 4DIEA 4E5UA 5EXTA 3K8YA 3KJHA 1LF0A 4TYYA 3RS0A 2O8CA 2JJ2D 4V02A 2A2ZA 4MYTA 4BRUA 3KTAA 5E7IA 4M4SA 3ZYCA 4B75A 2QAGC 1HE1C 2EFEB 3GJ4A 1KIMA 2IWRA 3TR0A 1HQYE 2IF0A 4MYCA 1VG0B 4URWR 4Q9HA 2D3WA 2AXNA 4OQXA 1SXJE 5DI9A 4U7DA 3OAAA 1R2QA 3HPQA 1KSGA 2XTNA 4QBGB 3M0EA 2OFWA 3GLIE 1OIXA 1G3QA 3RRZA 2J3EA 4IEEA 1U8AA 4WBSA 1TTTA 1CBUA 2ODEA 4TZ0A 2QMUA 2LKCA 1Z6GA 4LJ6A 1FX0B 2VQSA 2VF7A 4DB4A 3LW7A 4JVSB 3UWOA 1N5LA 2QGNA 5EP4A 1WP9A 4TLDA 4QM6A 1VYTA 1YR6A 1LF5A 3OEEA 3RS5A 1II0A 4ZI2A 1GRNA 1OIWA 1IN4A 3GFOA 4QGAA 1VDZA 5FTNA 4S2EA 2R44A 5DE3A 1P9RA 2BOVA 3AVVA 4TYNA 1EG7A 1EX6A 4PPFA 1CKEA 5FBVB 2ODNA 4LYJA 4DEXA 4P33A 3A37A 3L43A 3MLEA 5A0FA 2GILA 3LX5A 1P2UA 5L3QA 4XVRA 2F55A 5E7JA 3RDPA 3RRYA 1IM2A 5EXPA 1T3LA 1TQ4A 2KI5A 2GZHA 2RGNA 1OFTA 3AKYA 3D31A 4HAZA 4EPTA 1TUEA 1KI8A 4LY6A 5D3MB 1QHSA 1OE0A 3LAWA 4CYMA 5FUYA 3I5YA 2ZI7A 1AA9A 2O5VA 2QZ4A 3K0CC 3MFYA 1NG9A 4H1UA 4D82A 1F6BA 4LC1A 2FFAA 2AWOA 3SYNA 5HR5A 2REBA 1GOTA 1Z22A 1JQLB 2PZFA 3B9QA 3U4QB 1E2KA 2FOLA 2ZANA 1GKYA 1LB1B 2OLJA 2VRWA 4BWYA 1CJVC 1CIPA 2VTKA 1E3MA 1EK0A 1N6KA 2VF8A 3UKDA 1Q1BA 3QNUA 2QU8A 4HAXA 1G8HA 3IHWA 3MJHA 1R0YA 1G7RA 3ZD7A 1SVLA 3CZQA 2C99A 4US1R 4PANA 3VR2A 2H18A 3A58B 4OQMA 4F4CA 3AKDA 1KO7A 3RS4A 2QAJA 1II9A 2QMOA 2OAP1 1Y3AA 2QG6A 3QKRB 4ITRC 2DFLA 3PUYA 3UG6A 1NBME 1XD8A 3FKSD 4A0RA 1D9ZA 2CJWA 1IJFA 5J4HA 3KXIA 4IKEA 2IXFA 2VSXA 4DUGD 2ZQ5A 5H68A 4DLZA 1COWD 3NXSA 1XMSA 3T5GA 2WICA 2GDJA 3ZLJA 2IXEA 1DE0A 1HQCA 4RFSA 1WE2A 3V00A 2YWFA 2H92A 1UJ2A 2WWWA 2QMEA 1M2OB 2YC2C 3QG5A 4ABYA 4EIWA 1PLKA 2ZAOA 3HU1A 1U0LA 1KAOA 5E4FA 2QRNA 4RD1A 1F2UA 4WZ6A 4FD2A 2EFGA 4EKDA 1S2MA 2QL6A 4J0QA 3QBVA 2FPMA 4OK3A 4A6PA 4ZIRA 3FE2A 3F5FA 2ZITA 1U98A 1W4BA 3K0SA 1L7VC 1ZRHA 3BC1A 4LDJA 1FP6A 5J4YA 1G18A 4L15A 1JPNA 1N6RA 4B44A 3MWJA 1ZIOA 3BXZA 4GFDA 2OV2A 1TUIA 2Z83A 2F3TA 2DBYA 2QI9C 2QBYA 3ADCA 1WQ1R 1FPMA 1YVDA 2FFQA 4PQFA 2X19A 1HT2E 4P0TA 3VAAA 3QF7A 4BEBA 2GEUA 2J0UA 4JL5A 4V0MA 4CW7A 4EFMA 5FH9A 1OXTA 4TZ6A 1VMAA 4BLTA 2AFHE 3DDCA 1YZKA 2QQEA 4A8JB 1GITA 1G7CA 2OBLA 3NTUA 3SDZA 2WV9A 4Q4HB 2DB3A 1A4RA 1GL9B 4MUAA 4FMBB 2WVJA 4NPHA 4PXAA 1E0AA 5ELXA 1F5NA 1XMVA 1X1RA 4ZCIA 2D06A 1A5TA 4YDHB 3KKOA 1HT1E 2O8CB 3LBIA 2W83A 3RWMB 4BPBA 2XJ4A 4LZZA 4A2QA 2G1KA 4JSYA 4QGGA 3CPEA 2ZI6A 3KTAB 4E22A 1A2BA 3NVAA 2CCGA 4LWZA 4TLEA 1OYWA 3VFDA 1G41A 4FW9A 3AB3A 1FNNA 2FH5B 3B1YA 5AJVB 4DT1A 4W9MC 4LBZA 3TQFA 4F38A 2DWOA 2C04A 3VKWA 5KOYA 4M1SA 5C18A 2N42A 4Q9JA 3MWYW 1NSTA 2J0VA 3IHLA 1ZBDA 4R2HA 3SI7A 3K70C 2ZRCA 3T06B 4DHEA 3L8YA 4HDQB 4FWTA 1IY0A 2F1IA 2BM0A 2MSDB 1UDXA 1CR0A 1Z63A 4LHYA 4D4JA 3REGA 2ONJA 3VNUA 2NO6A 1AS2A 1NN0A 2V6JA 4G01B 4DLRA 4C0LA 2ZYTX 3GPLA 3NC1C 2G1JA 2GF0A 2VP5A 5TMPA 5HCIA 2JJ1A 3GD7A 3ZH9B 1CRPA 4EPRA 4OYHA 1JAHA 4JS0A 2GJ8A 1TQDA 2DFTA 4XTCS 2ZJBA 5A4JA 2EW1A 5AWFC 4A8JC 5IK2D 3W9YA 1G8YA 5CYPA 4H9GA 4M21A 2A78A 3TUZC 2N46A 3UPUA 1IHUA 1KMQA 1C9KA 2DR3A 2CE7A 1GDDA 2UZIR 4KV9A 2GXQA 4NYIR 4RZ3A 4C2TA 4AC9A 3CF0A 1YZTA 2BCJQ 4Q1EA 2DWPA 5CIQA 4M8NE 5JBQA 4K81B 4DB2A 2IS6A 1XXHA 3DEFA 2NO7A 3ZQJA 2QT1A 1OPXA 2HXYA 5L3QB 2L0XA 3Q7PA 1Z5ZA 4DLTA 1UPTA 4DDVA 2OO7A 2JAQA 2PT7A 3BAFA 4KVGA 4TLAA 1BH2A 1ZD1A 4RD4A 1P72A 1D9XA 4PSKA 1WBBA 5G41A 3E1SA 5D3QA 5TB5A 4LJ8A 1QHHA 1YZGA 2VH5R 1RRGA 2ZAMA 2GCOB 4RD3A 5L8VA 3MAAC 1Q1ZA 3UMSA 1NVWQ 2Z4SA 1GL7A 3W6PA 2V8OA 1LS6A 1NLYA 3QG1A 5KNCA 3OIUA 3GEIA 1P7CA 1ODFA 4G3XA 4DLWA 4ZDKA 1X3SA 3KUCA 1W0KD 3K53A 1W2HA 3NEJA 2ZE7A 1DAIA 4Q00A 1Z0JA 3U61B 1W1WA 1OFHA 1KI2A 3OE7D 3PEVA 1VIYA 4LPSA 1F3OA 3G5UA 1ZC3A 1T5LA 2V7QD 1R0XA 3NBYC 5J47A 3ZDQA 4DRZA 4QJ4A 3VR3A 2WSSA 1CJKC 5K8LA 1SXJD 3UATA 2ZJ8A 3BFXA 5FL7D 2XZPA 2IL1A 2H8KA 5LB4A 1EESA 2CJWB 3P4YA 2I3BA 3CNLA 3TMKA 3LBNA 1KY3A 4M0LA 2BBWA 2R9VA 5KSZA 2YC4C 3L0OA 1H65A 4JLVA 4W5JA 3A1SA 1MO5A 1N5JA 4YMWA 2WHXA 1KO1A 5HZHA 3H0KA 1IXRC 3WRXC 4Y0AA 3W3ZB 3RWOA 4RFSB 5F9FA 1W48A 1ZCAA 4IFBA 3G82C 3IIMA 1ZC4A 2RHDA 2RGDA 3EIHA 5EUMA 5FOUA 4EFLA 4EPXA 3U60B 2QE7D 4MDEA 1DTSA 4Q4AA 2RGNC 1W49A 4IDNA 1Z8FA 4GBMA 3QVVA 3O8RA 1IJEA 5E7MA 1UKEA 2JLWA 1QZXA 2ZS7A 1E2MA 2YV5A 2DFNA 3PENA 5BQ5A 3ZIAD 4ZIRB 3ZVMA 1E0JA 1N6OA 2J45A 3CO5A 2GTPA 4N1AA 3SBEA 2OHFA 3WHLA 1KKLA 5DSZA 2GXUA 1W5SA 4I1UA 1XTSA 5AK0A 3CBQA 1JJ7A 3HJNA 1KO5A 2JLXA 3FTQA 1Z6XA 1XD9A 4D4MA 4G0NA 3TJZA 5HKKD 4M53A 1U8ZA 5J5CA 2IWHA 2D2EA 3K09A 3L0IB 3VR5A 3ND9A 4LV8B 1KO8A 4KJZA 4AK9A 1S1CA 1ZUNB 3BJIC 2J0UB 1LV7A 1Q1EA 1ZM3A 1GILA 1ZNYA 2ZE8A 1AS3A 4NYIQ 2YKGA 1KDPA 2RGGA 3HYRA 2FEMA 4OL0A 4XH9B 2QPAA 3ND8A 2G9NA 1GM5A 1G64A 3Q5DA 4IOJA 1W7AA 2QSYA 4IRUB 3X1ZA 4K46A 3LH5A 2ERYA 4LBWA 2GJKA 1S9DA 5JECA 4KLZA 1FL9A 1VKJA 3ZQ6A 4PO9A 3B1ZA 2GJSA 5CIWA 3TSOA 4M9XA 4JSTA 3B1XA 1JR3E 1GZSA 1II8A 4TN1A 4URXR 2O8EA 2ZRIA 4WZBE 3PITA 5AJZA 1NMZA 4DCUA 2OM2A 3VX4A 1PLJA 5KSPA 2IEZA 2W2VA 4CRWB 4ASUD 1XF9A 4BFXA 4B76A 4OK5A 3JVUA 4TMXA 4OKSA 4Q9LA 1NL3A 2C9CA 3WXMA 1BOFA 3SHWA 3R9WA 4NONA 1ZIPA 2HXSA 4BECA 4TQ9A 4PAMA 2ZRJA 3OIWA 1NBMD 2IBMA 1XCGB 2P3SA 3OFND 3MG9A 1E2EA 521PA 1G4UR 5KDOA 3MUFA 4PZYA 5CITA 4LK2A 1TPZA 3B1WA 2GNOA 3HU3A 4YMTA 1RJ9A 1VG9B 1PV4A 2ANCA 5FOTA 1VIAA 2OSBA 4BFZA 3FFBA 3AUXA 3MJRA 1ZU5A 4M1WA 1K5GA 1M7BA 4UKDA 5B57C 3OHMA 1L4UA 4QRHA 4JKIA 4TYWA 3HU2A 3O8CA 1LVGA 2GWHA 2RGCA 4JVLA 2A5DA 1O87A 2NQ2C 5G53C 1RW4A 1YQTA 4R2IA 2JLVA 2R62A 1P75A 4FMDF 4RFVA 1UEIA 2OCBA 2GZAA 4HATA 2AKYA 4PPQA 2JLYA 1OXVA 3IILA 3I5XA 3PUVA 1ZU4A 2YOGA 4B43A 2EVWX 2QM8A 1BYUA 3GP8A 4N3NA 1DBSA 2A5YB 3EWSA 4WOPA 5FI1B 1VCMA 1XXHB 5TY0A 1RE0A 3N70A 2J46A 1AN0A 2XX3A 4MGYR 2O52A 2YINC 3B8HA 4B3DA 3BH0A 4C0JA 2A9KA 1KSFX 1QBKC 1M8PA 1XBTA 4QBIA 1E9BA 5JLJA 4R9UC 2WJIA 4BLOA 3UMFA 4B2PA 1QDEA 2IT1A 3CPHA 4PHTA 1H8HA 3OF5A 1Q3TA 3AVYA 3X1DA 1UFQA 2PH1A 1T4GA 3DKPA 4GSYA 2EYQA 2V4ZA 1JXOA 1QHHB 3BB4A 5H8WA 1T6NA 3MMPA 5SZJA 3LRPA 5B58C 5AUOB 2ZXUA 3CUEF 3TUIC 1OXXK 1GVNB 2C9OA 1QHIA 4GNKA 1JB1A 1QHXA 3U2QA 5FR1A 2R2AA 3W90A 3GLGA 2GCNA 1CU1A 1G19A 2BKEA 3AVTA 1KI1A 4D4KA 3LVRE 1XD2A 3RLFA 3CNOA 4BQSA 4L9WA 3QUSA 4FWIB 3GLHE 1R0WA 2B7CA 4H1VA 4B6FA 4CDGA 4LSGA 5FUXA 2VSFA 4KFSA 4LI0A 4Q1AA 2DY1A 2ORIA 1GP2A 4HUTA 5JRZA 4YC7A 2ZRDA 2A7QA 2W0MA 1DO0A 4L9SA 1YZLA 2PX3A 3NKVA 1W4RA 3TK1A 4L16A 3WP0A 5IT5A 1DELA 1US8A 5C4MA 2VPPA 4Q9KA 1RZ3A 3H84A 2QPTA 2IEYA 1V43A 5TXGA 1E2LA 3RS2A 1XFAA 4B3GA 1XCMA 4KLNA 1KY2A 4BRWA 1XPOA 3EZ7A 3NH6A 5IK2A 4GMXA 4UNRA 2C2HA 4XVQA 3B13B 4PTLA 4LV6A 2QTHA 4TT3A 1W2GA 3J81k 4TMKA 4GOXA 1WCV1 1Q22A 2CDNA 2WPDA 5FOVA 3KX2A 1YZQA 4DCVA 4YMUA 4Q4AB 1FNMA 1TL7C 1J8YF 2BJVA 4NCJA 2XB2A 3SHFA 1OXUA 4CEJA 3DMNA 2BMJA 1N0WA 2FF7A 2JIZA 3NG1A 2RKOA 3T1VA 5F2EA 3KFXA 4RKFA 2KSQA 2Q6TA 1TU4A 3BH6A 3VTKA 4AG5A 4A36A 5C2JB 1NMYA 2J7PD 2QM7A 2XOKD 1QVAA 2WAYA 1TU3A 3L82B 1U0JA 2ZVPX 4MRVA 5F98A 1Q57A 4OI1A 3PEWA 2OILA 2Z43A 1G7TA 3HR7A 4DSOA 1GFIA 2GCPA 3FHTA 2IYVA 2Q9BA 4HLDA 5CJ2A 2SHKA 1E79A 4NYJR 4A1FA 4QC2A 3LLUA 5KHOC 1G8FA 3I32A 3P4XA 4QGHA 1S0UA 3AP2A 5BWMA 2ZYVX 5EP1A 4W7SA 4TYPA 5JHHB 5TVKA 2H17A 3GJ0A 4QKQA 2R6CA 2VYFA 3T1QA 5JMTA 5KPDA 4KVAA 2ZYUX 2AWNA 3AM1A 1W4CA 2ZSEA 3OE7A 4TL7A 1GNQA 2BMEA 2QP3A 4KAXA 4V0KA 1QG2A 4BLQA 2Q3MA 4CIDA 3EPJA 1II8B 2O8EB 2ZJYA 2PEZA 3B7GA 4JBXA 2WOJA 1OV4A 3PV0A 1SXJA 3FYHA 1KHTA 1EGAA 3GLIA 2AL7A 2ODWA 4DSUA 3CWQA 3L8ZA 2VHJA 4ZCLA 4W5HA 3W5JA 3EX7C 1XTQA 4FN5A 2W2XA 1P4SA 4HLQB 1EFRA 3SNHA 5FPYA 3CRMA 2NZ8A 4GP6A 2H16A 4LV5B 5FTJA 3QKSA 1OLOA 3FPAA 4XTRA 3QXCA 3QIAA 4HZIA 1HYQA 1OHHD 5KO2A 1OYYA 3IBYA 3MSXA 4ESVA 1U81A 4GPTA 4OHYA 1ETUA 2IX3A 1W0JA 4GZLA 4WIAA 3CX7A 4LX0A 2VP0A 4TSFD 5IRCD 1KJWA 1ZNWA 1RJ9B 1HTWA 4I4LA 6Q21A 2ZJ5A 1XJ0A 4IDPA 4RD2A 3A8TA 4M9QA 4G5SA 4RZXA 3AVWA 2XSZD 5EXSA 4C0KA 3EPLA 3K09C 5FR2A 2HF9A 4AG6A 2FEOA 3U7FB 1G21E 4UQOA 3BBPA 3ZZTA 4O2LA 4TTRA 2ZJZA 3LXXA 1DPFA 3RS7A 1DAMA 4JMPA 4YDSA 4F93B 2QQ0A 1UM8A 2OG2A 3NEYA 3SQXA 3I1FA 1CP2A 2HF8A 3A1VA 4Q1CA 2ZUDA 1Z06A 1EXMA 4YONB 3I4LA 3M6AA 1MO4A 2W58A 4XIGS 1G9XA 4CEHA 2HJVA 3WNDA 3K0EA 3KKPA 4YLGA 3VMFA 2ATVA 1R4AA 4D25A 3T5DA 3RVBA 5CYOA 2VIIA 4DIDA 5G40A 2AXPA 3I8XA 4QNMA 2XNDD 3Q72A 4G5QA 3LWNA 3DZDA 4FMCB 4EPYA 4MRPA 2PCLA 2VP9A 4F4JA 4ZPXA 3R8FA 4KFUA 3IIKA 4IXNA 2ZE6A 5L3SA 2ZROA 3WBKA 1IN6A 2X8AA 4JLBA 2CXXA 4MGIR 1OB5A 4JIMA 2GEVA 1UBCA 4EFNA 2B6HA 1MV5A 2R6GA 4PC7A 4AKIA 2E9SA 1IAQA 4RY2A 5CJPA 4EUNA 4OK6A 3ETLA 4M9ZA 1MR3F 1G5PA 3ASZA 1JR3D 1O3YA 4NYJQ 2WWIA 1M7HA 5BW8A 4X8HA 4NCKA 3GLGB 1W36B 3O8DA 2PLFA 3T34A 1XPRA 3F0TA 1XD2B 2IYQA 3RSLA 4Z51A 3KQLA 4XWKA 4A15A 2ORWA 2J87A 1OJLA 2D7CA 4BZXA 3BIFA 1G6HA 3Q5EA 1BMFD 3CH5A 3BB3A 4M22A 4D0GA 3GJ3A 4OQNA 1QHGA 2BVNA 4PZZA 3SJZA 4A0FA 1JAIA 1E9SA 4A0HA 5EP2A 1JQJC 1KZGB 1US8B 3E70C 1UKYA 1IBRA 2REXB 4C7OA 3LNCA 4PR0A 3R7WA 5KPJA 3GLFE 4M1TA 3LA6A 2FSIA 1XEWX 2VEDA 4NHOA 1IXSB 4JVNA 5JCPA 1XZQA 2B7BA 3KQNA 3TQCA 1PUJA 1MOZA 3IIJA 2CVFA 1Z83A 3QKTA 2WBLC 4OI2A 1SKYE 1R10A 2G77B 1VHLA 2JLQA 2CL0X 4BFTA 4I81A 4A0GA 4DDWA 1G8GA 3EA0A 1KYIA 1HH4A 4CEJB 3VHLB 1J8MF 1FMJA 4KU4A 4CVNA 1T9HA 3Q3JB 2KWIA 3EARA 3N5CA 4BLRA 3A1TA 2GBLA 4C0BA 3B2EA 2IS4A 4BFSA 1FQKA 2P5TB 3SBDA 1DVRA 3RC8A 1AQUA 4DDUA 1I2DA 1W36C 3HYTA 2V3CC 2IUSA 3FGNA 1E98A 2FN4A 1OFIA 4MKGA 4AYXA 4IOMA 3UMRA 1F60A 2AD5A 3CM0A 3X1YA 1S9HA 2F6RA 5B2ZA 5JCZA 2IYZA 3IBGA 721PA 1L2TA 1G16A 3C8UA 5LBIA 3ONWA 2YHSA 2C78A 3CKLA 3KZ1E 1JJVA 4B2IA 4WVFA 1KMHA 2ATXA 4PC1A 1P9WA 1CEEA 2F1HA 4FINA 4DLVA 2WIBA 2IHYA 2F1JA 1AGPA 1WF3A 4OHZA 3K70B 1W4AA 3A4NA 1ZUHA 3R8CA 4LHXA 5DYGA 4IDOA 3EG5A 2QA5A 2WTUA 3IKJA 3HPRA 3OZXA 1XEWY 3CX8A 5EE5B 5HZKA 3GLIB 3C4JA 5KTYA 4QGFA 2ZUBA 3FDIA 2W6IA 3OIYA 4QNRA 4W5WA 4DSNA 2GF9A 3HP1A 4AKGA 2BIFA 1HUQA 1NVXQ 2RH5A 1E1RD 2G83A 2MMCA 3PQCA 3EC1A 2DFKB 3A1WA 3RABA 2AK2A 3RANA 3WYGA 4Z54A 4JLMA 2BJWA 1J70A 3ADKA 1UKVY 1XEFA 3C5CA 2HT6A 2O0HA 1E9EA 4TL6A 2FU5C 4OHWA 3RC3A 2OT3B 3TKLA 3TGPA 3SYLA 3F3YA 2QUZA 2ZVQX 2IYYA 4HLCA 2GXSA 2JCSA 2J7PA 4QHSA 4ON9A 3T15A 1Q12A 4Q18A 4PPGA 1DO2A 3QQ5A 3AF3A 2GXAA 3BFKA 1T5IA 2GZDA 2JDID 2PMKA 3OIVA 5FI0B 2IYWA 3SZRA 3KQHA 1UBEA 4PSAA 4RCZA 1ZCBA 2ZJ2A 5G3YA 4CEHB 1GKUB 1UKZA 3IEUA 3NBFA 4DBLC 2AR7A 4URUR 3D8BA 2C95A 4AKEA 4AKHA 3RNLA 1F48A 1SXJC 2VA8A 4ESHA 4FXPA 2JJ8A 3WYFA 2OESA 4MQBA 4XVUA 1SVIA 3EWAA 2CL6X 3QXSA 5FUWA 3GJXC 3OEHD 4FCTA 1AKYA 1T3SA 4OQLA 5L3SB 1NP6A 2ZSDA 4IDHA 2WJJA 4GDFA 5JRJA 2IYXA 3Q7QA 3U7HB 2CK3D 1TEVA 5DN6D 1S8FA 2FSHA 2IYRA 2PX0A 2WWGA 1RKBA 3FOZA 1DADA 2H57A 2WMOB 2YVUA 3EAQA 5DO9A 3AV0B 3KJGA 3B85A 5IF9A 1ZUIA 3AEZA 2OFXA 1VYVA 1JECA 2ZRGA 1CS4C 4C0AC 1H8EA 4TSFA 2C8VA 5DGXA 1ANKA 1OH8A 4OBEA 2BHRA 4F7WA 2KB0A 3BD9A 1X8LA 2ZREA 4TL8A 4Q4LA 4BLSA 4UNNA 1UAAA 2JJ2A 5AJXA 3TAUA 2WJHA 3I72A 4C0QC 4C7OB 4JLJA 4DLXA 4QHTA 1XMIA 3R7WB 1T0HB 4LGMA 4G5GA 2H7VA 4ZV4A 4IVQA 1AZTA 1MH1A 3LXRA 4IXMA 1XTJA 2NGRA 3DL0A 4TMTA 4NMMA 4XJXA 5GVRA 1TNDA 1QF9A 2OLKA 2CCJA 3KKQA 2BMFA 2LKDA 4KO8A 2GEDA 4YMSA 1SULA 3P27A 3KKMA 1GNRA 3PJRA 2V6IA 1M34E 3TVTA 3MRSA 3QXHA 1WMSA 2WZQA 3AVQA 1IN8A 1G3RA 5IDVA 5A5GA 1VPLA 1XTKA 5P21A 1OB2A 5CDFE 3NIBA 2ZE5A 4YXWD 1YE8A 3FHCB 4JBYA 5BN5A 2V1UA 3KXLA 1ESNA 1NLZA 2UVQA 2P65A 3ECCA 1X1SA 2QP4A 3X1WA 5EJEA 2ZRNA 1MKYA 2VHQA 4RCYA 2WOOA 1NSFA 4KYUA 3WRYC 4LYAA 3I73A 1E1QD 1K8RA 1YRAA 5C46F 4FI3C 1TF7A 4TMVA 1AQYA 1XNJA 1T91A 1BKDR 4I1SA 1JNYA 1JR3A 3I3SR 4RJLA 3KJEA 3BWDD 3LQQA 2G3YA 5FTKA 1Q20A 2ZR7A 5KDDA 1OKKD 4Q4JA 1F2UB 4TMWA 4BFVA 1KMHB 3UK6A 4Q03A 1P6XA 2UKDA 3AKEA 3DVLA 3VR6A 8OHMA 2J7KA 2ANBA 4B2LA 4NE2A 1JEEA 4B74A 2IUTA 2VHTA 4PAOA 3DZ8A 3QKUA 1I4DD 4PO8A 1XCPA 4TQUS 4XWOA 2ONKA 5M04A 4Z8XA 2Z4RA 2QBYB 1EFTA 1N3BA 2CBZA 2F9LA 3ASYA 3W34A 2IHBA 2F9MA 4US0R 2GJ9A 2WJGA 3N2IA 2ZRHA 2ZI5A 3WMEA 1NRJB 1J2JA 3UG7A 3EIEA 2QGZA 1U8YA 3KB1A 4JYBA 2KBFA 2ZU6A 1OH5A 3NC0C 4R71A 3FB4A 1XEXA 3SE0A 4O3MA 1P61B 1G8PA 3QEJA 4Q66C 1T0JB 2X1VA 2EU8A 2GVZC 1IXZA 1P9NA 2O8BA 5CLQA 2YZ2A 2GBLC 1OIVA 4LJYA 2ZUCA 2V1XA 2GRJA 3LO5A 3P26A 2XJ9A 1W5TA 3OAAD 1NVVR 3I61A 1RYFA 4NBSA 4A2PA 3T35A 3KQKA 2WWHA 3FKSA 5CK4A 1XJQA 1RVDA 1R5BA 3LDAA 4A6XA 2RMKA 1B0UA 2J9RA 2O0JA 5JFGA 2ZEJA 4P31A 5GJBA 4DUGA 3I62A 2FSFA 3LBHA 5F3WB 1COWA 3T1OA 4QL3A 4B35A 4URVR 3ZD6A 4DT1B 1IOZA 4JLNA 4FIDA 3QXXA 5FBRB 1X8JA 5J4LA 1KSJA 2NOAA 3LFUA 4DCTA 621PA 3QI2A 4IW3B 3SS8A 4RVCA 1NKTA 3EZ6A 2FWRA 1E99A 3KKNA 2VP6A 3OEED 4MH0R 3X1XA 3A6PC 2ZM5A 2ZS8A 2QTFA 2KE5A 121PA 1BO6A 1Q44A 1WB9A 4JT2A 1CJMA 2ZIAA 2OUKA 1VG1A 1WRBA 4HAVA 2J59A 4QHYA 2P6NA 2WKPA 3LVQE 3ZVLA 4DSTA 4GL2A 1IONA 3AF2A 1ZINA 1WA5A 4MRSA 2XZLA 5G3ZA 4V03A 3PUZA 4MGZR 3ZZUA 5JEEA 1D6JA 1G5TA 3NH9A 5FBLB 2NG1A 2CLCX 2ZRMA 4EDHA 1CLUA 3AP3A 2JATA 2ZRLA 3QF4A 4LUCA 2WAXA 2WMNB 3BS4A 3AVUA 2YWHA 3MWKA 1DAKA 1K6MA 1E0KA 1E2GA 3NBZC 4D26A 1E1RA 4UJ5A 2QPOA 5CK5A 4US2R 2OXRA 1A82A 4O2RA 4FCWA 4V0OA 2EWVA 2IUUA 1KK1A 3CWZA 4TQAA 2DYKA 2GK6A 5JZVA 3TSZA 1ZYUA 2GA8A 3TUJC 3VKGA 2VBCA 2XTZA 1ELOA 4GZMA 2D7DA 5AUNB 2ZRPA 5CLLA 4UNQA 4KBGA 4MKFA 5HCNA 4AYWA 2KBEA 3WYAA 2WWFA 3RAPR 4BLPA 2HV8A 5KSOA 3AUYA 2V9PA 1BS1A 1G291 221PA 4HLUA 1GIAA 2IA5A 2NO1A 4MYUA 4A2WA 2QY9A 1GUAA 1OFUX 5FBWB 5KU1A 3BORA 1YU9A 3DKVA 1SGWA 1ONBA 3DM9B 4Z1MD 1FP7A 3QE0A 2FMXA 3IO3A 3CNNA 1G3MA 1W46A 3VQTA 2FFBA 2BBSA 5LDDC 1U94A 3GQBA 2C5LA 4NCHA 5JHGB 2Q9CA 1ZD9A 2GK7A 1VTKA 4BEJA 3PEUA 1NY6A 1ZD8A 2GETA 4NCIA 5J4VA 3L2OB 3CF2A 2XAUA 4B6EA 1R7RA 5CB6A 4MDFA 3QVUA 1NVVQ 2ZETA 5DLQC 2YJTD 2NIPA 2W00A 1SVKA 4KYIB 1I2MA 3EIQA 4I1OA 3CB4A 1RPZA 4KFTA 3Q85A 5GADl 5FPSA 1M74A 2ZTSA 4CF7A 1XPUA 4O0MA 1DAGA 5DN6A 3B82A 4JLDA 2IYUA 5KDLA 1WDTA 2OZEA 4Q7JB 4URZR 1NF3A 3K0AA 5D3MA 1DOAA 4JLAA 2HLDD 1NVUQ 2EQBA 2EWWA 1J90A 1NI3A 4GMDA 4Q4JB 3T12A 4DXAA 5JWOA 2GAAA 2O8FA 1VCNA 3EZFA 3NHBA 2ZJAA 1KGDA 2QMHA 2R65A 3QJYA 3DPUA 5EQTA 4PAQA 2NO9A 1S4QA 1UEJA 4MUBA 1T8TA 4NKRA 2Y8EA 2CMKA 1Z08A 1SVWA 1W44A 3O8BA 1JI0A 1NY5A 3LV8A 4X8MA 4AY2A 1KZ7B 3S1AA 3CRQA 2YWEA 2LWIA 2CHGA 3QPWA 3HR8A 3GLGE 2HDNB 3QKRA 1G4AE 5SZIA 1XEXB 4JLPA 4LHWA 4E09A 4LHZA 1W0KA 1Z6AA 4NTZA 3EPKA 3C16C 2HYIC 2ORVA 1U0HC 2O8BB 1N6LA 2Q0HA 3MGCA 4Q5IA 2E87A 4QG7A 2YNMA 2V7QA 2ZI4A 1PVOA 1XJCA 3P20A 3DOFA 1IN7A 1VHTA 4TYQA 4LCBA 1JPJA 4UXJA 3TW8B 4BUJA 1GNPA 3PCRB 1LTQA 4RZUA 5FL7A 1E94E 1ZM2A 1P73A 4D0NA 2ECKA 1G1MA 3C14C 4XWAA 5J40A 3GFPA 2FGJA 2AK3A 3THWA 1KK2A 1KI7A 3CPJB 2I1QA 1TF5A 4HDCA 1G5RA 3SFVA 4GI7A 4B47A 3IGFA 2ZI3A 3FMPB 2JJ1D 3BB1A 4I99A 1FMLA 1XZPA 4KHZA 2QE7A 4PC3A 3P32A 5FUVA 3C5HA 3AF0A 5BXQC 2F1RA 1OKKA 5C4GB 2BKUA 2IS1A 1E4VA 3VKHA 2PCJA 4UXIA 1CF4A 4HAWA 3ZIAA 1NG1A 1DEKA 3GJ6A
chains in the Genus database with same CATH superfamily
2OXIA 4IGAA 1OWLA 1RAIA 4TLCA 3U6KA 3ZVNA 3ZG6A 4W9NC 1KU6A 1LK5A 4J0KA 1JQBA 4KK4A 1SEVA 3V4SA 2P0EA 3BE4A 2FN7A 5CFMA 4PX3A 4K26A 4I5DA 1EX7A 3D6TB 1CD5A 1R0SA 1S01A 2LVBA 3AIIA 1CVLA 1XQ1A 5DVZA 4CIBA 3QF4B 5ALTA 2X58A 3U1BA 5T6MA 1BMDA 3ANTA 1DKNA 2EBWA 3HRHA 2GSDA 4FSDA 5HE9A 2D5AA 5AHWA 5K0ZA 1M5UA 3CRVA 4MROA 3H1PA 4KGDA 2RHGB 3R8XA 2FEAA 4JBLA 5BR4A 1ETHA 3THOA 5FPTA 4C6SA 2NP7A 1CEYA 1XVVA 4ZRNA 1M6HA 3CW9A 3R0ZA 4Y98A 5FTWA 4IS2A 2UXDB 2ID4A 3OD1A 4U02A 3PNYA 4B3XA 2IYEA 2RHMA 4R8VA 2ODTX 3AJAA 1JFTA 1TCAA 3GLFA 3U39A 1RRPA 3FCYA 4GI2A 1W87A 4QOFA 4KR3A 2WP8J 4B45A 1B76A 1O96B 5BRAA 1E9VA 4Q1BA 4R51A 3KPUA 3E9YA 4YO8A 1QHYA 3OTHA 3R7LA 2O2JA 1E1CB 2O6LA 3G8AA 1MFZA 2CHQA 1IC6A 1ZOIA 5CFQA 3KEMA 2ROQA 1ZM7A 1E2DA 2B92A 2QOEA 4MUYA 4RYLA 2G76A 4N40A 2PUFA 4HKTA 1PFGA 1P7WA 2IF2A 5K2MA 3PHCA 5AVZA 4I1VA 4NEQA 1RBYA 4RGBA 4G07A 3VR3D 2V9CA 2WSSD 4OXKA 3LBAA 1V3VA 2VDOB 5E2BA 4P1ZA 3VC2A 5A5VA 2DWQA 3E22B 4YO7A 1N8KA 2JW5A 1UDWA 1M2GA 3OFNA 2FW7A 1KIFA 3ZY3A 1E9DA 3BWMA 4WAUA 4KOAA 5HTKA 2AUNA 4U2BA 3SJAA 1KI9A 2VJYA 4P2BA 4ZOLF 1JKFA 3M5CA 4KVZA 4N3AA 4RNCA 2X0IA 5FRDA 3ND6A 1DRVA 2J9ZB 1GQ2A 4MRRA 4MDYA 2HYDA 2V54A 5IC5A 4FFPA 4H2DA 1RWVA 1L8OA 1U9ZA 3EEOA 3LW8A 2CN1A 4LNHA 3W6UA 4HB2A 3F67A 3ABZA 3FZGA 5FOWA 1SBTA 1U3DA 1UIMA 1VJGA 3BK7A 4MW9A 3SKVA 1YH3A 4CLXA 4PZ9A 1CJUC 4AUEA 3AFHA 1X7ZA 1M0TA 2E6KA 1O95A 4PLGA 1O5IA 3VH4A 5GZ6A 4M7PA 2G4CA 1IXYA 4L95C 3WP1B 2ZSJA 1EWTA 3OP4A 4ZARA 1TEXA 3IULA 2GQ0A 2QN8A 2H1LA 3KXKA 4F8JA 4AZSA 1KMNA 2FE4A 1IUNA 2QS9A 4J9VA 4N7MA 1NX6A 3IJ5A 2FGKA 4I3HA 5C81A 2ECQA 3RRNA 3R23A 3VSBA 4W1SA 3GN2A 4NG4A 4MUXA 1OD6A 1BFKA 3AR3A 3DWEX 4FEGA 4MIOA 4XUGB 2HCRA 4CKWA 1YDHA 3WB1A 1ZMXA 3VR5D 5F64A 2HK9A 4MQ5A 4UCXA 4ZEMA 3ERCA 3LZCA 3CR7A 1NT2A 2JCYA 3IDQA 5FP0A 1PS0A 4A8TA 4FMCF 3DEIA 4BO5A 2G82A 1KZ9A 1HR0B 4ARZA 2E5FA 1KGSA 3GEBA 3A6ZA 4S1NA 4G0UA 4EHBA 1S2IA 5IS2A 1B2RA 2WHPA 4PHGA 5EE9A 3S1AB 4IMJB 3MWEB 4K6KA 2I7CA 1QG4A 3H6KA 3WGNA 4TTTS 1HBJA 2UZ4A 1BH6A 3HEMA 3UENA 1O77A 2P35A 4B7UA 3TECE 3SU8A 3AC0A 3TR5A 1E61A 1VPDA 5EEHA 4R0NA 2OTCA 4P36A 3CF6R 2X2FA 4HR7A 1V4NA 3NPMA 4QUIA 2ZJ3A 4YJDA 2WYHA 3QPAA 5HIJA 3JRNA 2L69A 2HA3A 5F33A 2VYQA 4FBLA 4NAUA 3GAFA 4IHJA 5GJWC 1YR9A 3HFRA 2D5IA 4HB0A 1E3SA 2GJAA 1SZCA 4JOCA 2F3SA 3O83A 4U3JA 5ARDA 2XRYA 5F2NA 4MS1B 2PT5A 4IVNA 2AJBA 4CQMB 3J80A 4EHDA 3ZBTA 4U6NA 2KPOA 4ZVRA 2I7DA 1U0GA 4AP9A 3EB9A 4L28A 1ISPA 4BNFA 4ZRMA 3ZDCA 5CCDA 2OKCA 5B5SA 1A76A 3JWGA 4PZEA 3RSOA 2PNFA 5AFSA 2CKDA 3CR8A 3D6AA 4PZCA 1IYZA 2DFVA 3HDVA 3EOZA 3N7TA 4UMEA 4DLBA 3MGBA 1U3UA 1DSSG 2VCHA 4ZCSA 4MWCA 4UDNA 4KODA 4RESA 5JPCA 2PYDA 1XZLA 2JA1A 4BGVA 1BWRA 4JMLA 3NBKA 2W8ZA 2WKWA 3Q7IA 5IBPA 4C4AA 3A6FA 4CUKA 3E9ZA 2HLDA 3PWSA 4P81A 4ACBA 5TQ0B 4LN1A 2PJZA 1Z5UA 1L4YA 3THYA 2C9ZA 4KIUA 3VX3A 4DIMA 2Z1MA 3AVXA 1CR4A 2FK8A 2ZVDA 3O8QA 3HHPA 1N0VC 1D8AA 1NJFA 2OCAA 4QTXA 4DMCA 3HJUA 1IB0A 4E7PA 2PYZA 2QIPA 4MRNA 4RULA 2QRKA 4NQRA 3CVWA 2QD5A 2MINB 1HYBA 5CVTA 5MF6A 1UPAA 3MWGA 3BWEA 4Z0TA 1U2QA 5FA6A 4DW8A 5JWRA 3B1JA 2EZ8A 3PQ6A 4HUQB 4IMRA 2XOKA 1EQ2A 1WV1A 1CC1S 3NCTA 2EJBA 2H4HA 4PY2A 5HIIA 2XUIA 2QRUA 3WBFA 1U5BB 1KS2A 3H86A 3PQ5A 4PGHA 2QZSA 1P4AA 4JR2A 1GXSA 3I28A 3VZDA 4KUGA 4WNIA 3W77A 4YAUA 2DBVO 1DJOA 2GPSA 5D5HA 3F6CA 4I5GA 2GVDC 2SKCA 4PFQA 1VIDA 3OT1A 4Y2VA 5FWYA 2FN8A 2QLMA 4P80A 1I4EB 3VPGA 3G5TA 2PUJA 2JD1A 3BL8A 2JFGA 4MP8A 1QUFA 5E1BA 1K1EA 2CHUA 2VPTA 2NPFA 1A2KC 1WPXA 2IKQA 1NW8A 4F8EA 1FIUA 1JZSA 5LQKA 5B64A 4YP7A 1R37A 4JYMA 2WF6A 4AJ9A 1KVTA 1ODKA 3RF6A 4EUKA 2TMKA 5JCJD 3K0KA 3I0NA 3PNPA 4TLMB 3CVUA 3MUOA 1ZL0A 3B6EA 1LS1A 1WXHA 3K1JA 2PX8A 1QM5A 2QVGA 3HKCB 3L4BC 4WECA 3DDHA 1YRBA 1JVSA 2FUNB 1W36D 1BQEA 4F3NA 3AF4A 5IJAA 4YRPA 2YJ3A 1XJ5A 1JJBA 4V0LA 3H8JA 1UT5A 3PDIB 4K6MA 2X0EA 2GN4A 1TAGA 2PMCA 1O03A 3IP6A 3K9LA 4RSGA 4XYEA 2HFJA 3HA7A 1SCUA 3N5KA 1OXBB 4N9WA 3E0QA 1R9JA 3UFXB 3NHFA 3X43A 5AQ1A 1PZNA 2OBYA 4PS0A 1E32A 3LMKA 1E2QA 2JK0A 3GEEA 1W581 4QXAA 5H70A 3T7JA 3CZ5A 3H9EO 1Z2NX 2WUGA 4UC0A 5CDFA 2PEYA 4CETA 4ZO7A 1L8XA 4Z0HO 5U9CA 2CV0A 1G6Q1 1OHHA 1ZEMA 1PL0A 2H4WA 1MEJA 4EITA 4AI6A 3LSYA 3IHKA 1XVTA 1YR8A 4ZQFA 1TQ2A 3AJDA 2WWXA 5KU7A 1T2FA 4H59A 5HE8A 4D8XA 3QVGB 4DKXA 3NDPA 1CY4A 3WZ2A 3ZDAA 3QHQA 4GLOA 3C41J 4LJ7A 2XOXA 1UADA 4ERNA 4C2UA 1JIIA 4X1OA 4RZSA 2A9FA 4ZVMA 5K99A 3GMTA 4OLAA 2PWZA 4MV6A 5HVNA 2IBSA 1I32A 3RUCA 1K63A 1NYTA 4QU0A 3GRAA 1G60A 3JATA 4BO3A 4R2LA 2D2FA 1X7DA 3V32A 2Q8NA 2W6PA 2R97A 5DCYA 1JHQA 2QTBA 4WADA 3PQFA 3RHFA 2W6JD 3MHPA 2YOFA 2WD7B 3K15A 4OGKA 3ZI4A 3EGWA 5BMVB 1YASA 4HNQA 4TPKA 3S55A 2Q4TA 4O1HA 5JADA 1MLDA 3H05A 3NTOA 4A4DA 2BP7B 4MCAA 1UPBA 3D3QA 1CUDA 2E1PA 1HTTA 1SVMA 3OJFA 3ZE2B 3SSMA 4KDCA 1F51E 4QUAA 2OCYC 4YAFA 2POCA 4J49A 3KO8A 4GPIB 2QT9A 3E2MA 2XYHA 3BEDA 3F49S 3KK0A 3ZWPA 3T9AA 4WKOA 3KLOA 4S0ZA 3K30A 4U2DA 2I4LA 1FS6A 4PG6A 4L9AA 3B5IA 1RAAA 2OCPA 2WAOA 2MMGA 4P53A 4PPNA 5IDQA 1JQ5A 5A7GA 4NCAA 1AKWA 3PC2A 4H7KA 3W8RA 5ADUS 1Z5GA 1JBKA 1UBLS 1E79D 3P9IA 4JL6A 5TGZA 4CF6A 4DA0A 4FEYA 1MABA 1YQXA 2A5JA 4P0QB 3KB2A 1LFDB 4UM7A 2FB9A 3DCIA 4XD7D 3H83A 4B73A 1CTQA 2J31A 4TRRA 2IZ7A 5A7HA 3CFYA 2PJRA 1P0MA 3M4NA 1EGQA 3FUXA 1T3HA 1QGUA 1RD4A 2VPQA 2HU8A 4DV6B 3LL7A 2IK8A 3ANNA 3K70D 3U44B 1JQ3A 2WLTA 3PUKA 4MW1A 4B7XA 4Z7NB 4Y9TA 2VN8A 3NR2A 1Z2DA 3H2JA 2VLIA 2OE2A 3CRRA 3P96A 4KRXA 4MVJA 3WSVA 4MINA 1O54A 4CGZA 1NJSA 2HTFA 3PFFA 1XU9A 1G3UA 1XXHE 1LDBA 3K2EA 3ER9A 1AXEA 3M4JA 2XUJA 1I8TA 2EEZA 3OWXA 4FDLA 3M81A 3T5MA 4D2IA 3FYUB 2RB4A 3Q9UA 2VF2A 1LSSA 3QOFA 1Q6YA 4PQRA 4DDVA 1AQIA 1Z38A 2PFGA 4A5OA 2H11A 5JD3A 3PD7A 4UNPA 1KDZA 1D2MA 1MVNA 1P7VA 4F71A 4GUDA 2VK8A 3NBXX 4OCZA 3SEZA 1QP7A 3K9GA 4TL9A 4JB3A 2Q2OA 1CJBA 3BXFA 4UAVA 3L3BA 5EWMA 4F86A 3AFOA 3CVJA 1W0JD 2XYVA 4RLFA 2DTXA 2UZ3A 3EDMA 3U3RA 5CB4F 1FSPA 1PJBA 4PZUA 1PTKA 2E1RA 4AF8A 1Z2AA 2FUKA 3WNVA 4Z4GA 1JAZA 2DAPA 2PGLA 1NW4A 4N7RA 1Y63A 3EZ9A 4R2JA 3EBOA 1J7KA 5JZSA 1ZW6A 4CT4B 4A3SA 4LBVA 3FCAA 4GXTA 4ANFA 2Y93A 1ESEA 3A9WA 3RO7A 1PVDA 2EKBA 1WLYA 2J33A 2Z8XA 3BE6A 3U9SA 4EY4A 3RAFC 4B48A 2OP1A 2Y2UA 3VU9B 1P0CA 3TDMA 4DJDC 4W7IA 1ESCA 3JVVA 1SQGA 2D74A 3IIEA 1G5HA 1ODJA 1U9IC 2B4AA 3ZU3A 5IXYA 4KR2A 2ST1A 2X1LA 3Q9LA 3PSHA 1RYBA 3PUJA 4JJZA 3L8HA 3I9V6 1Z0SA 1KERA 4X9XA 4FMDB 5FJIA 3FLBA 4U7GA 4D45A 3IEVA 1WB6A 4BJ6A 2PUEA 1D8TA 3JU3A 1U9CA 2WHEA 4BE7B 1P5RA 5DYIA 4UUOA 5LP6F 1E0DA 1XR3A 2KM1A 2VJNA 2Z98A 1NTRA 3JAWB 3LWZA 4C78A 1ZNZA 4EX6A 1B93A 4RK5A 1O2DA 2XLBA 4FILA 1R4MB 1A1VA 2JI6A 4MWEA 1N25A 2AKEA 3PPIA 4UCFA 2JCVA 2C0CA 3D2BA 5ESXA 2IH4A 1Q2XA 2X2EA 2YOHA 4H77A 3IAS1 4JI6B 2PKYX 2Q21A 4JOBA 3IMKA 5A6VA 3OQNA 3WWOA 5BO5A 1IULA 1QIJA 3PUXA 1MJ5A 4OUKX 1TA9A 5B12A 1GTG1 3DONA 1L1RA 2X3UA 5BPHA 3ROTA 5J2UA 3V4RA 1RC8A 4HBZA 5D1HA 1J97A 3S2UA 3E5RA 4KE8A 2B30A 3NTQA 1J6UA 5LC1A 4FZRA 3BE8A 2VUSA 3USZA 4DCCA 1UZMA 3ACDA 3E8SA 4JJGA 5LDHA 3WB9A 3N2NA 3SC2B 5EE0A 1FOEB 5IKXA 3GEGA 5JANA 5C1BA 2DJIA 3Q3IA 3WY9A 3I1IA 4HI0E 3LO8A 3QEMB 4AD8A 3GRFA 4JEMA 1RQLA 2FQXA 3M49A 5E6RB 3DWIA 1L4EA 5TMDA 3G8CA 4HSEA 2Z5VA 3ZGLA 2FP4B 4J3JA 3PU6A 5ALLA 3TD6A 1KI6B 2PU5A 3NFRA 3DVAA 2VWHA 3C15C 3FCUB 1BEZA 2Q3HA 4P6VF 4RNDB 4YT8A 3DBRB 2ZS9A 3KE8A 3LP5A 4DV0B 2O19A 3JARA 3PTAA 2J0QA 1E6CA 3TLGA 1LC0A 2VJMB 3AB8A 5UKDA 1PR2A 2GKOA 2ZFUA 3EC7A 4OI0A 1UWVA 1R8SA 2F00A 3TQOA 4KRYA 4DCJA 1SHJA 1KAEA 2OFOA 3TE6A 1QZ3A 3FIUA 3F5QA 3GGJA 5CBPB 4QJ3A 1HNZB 4P83A 4TGLA 4TVOA 1XVAA 3ZE7A 4EMSA 3DLCA 4TTVA 2OK8A 3E7DA 1XB2A 3X2SA 3LQYA 1EFHA 1T0PA 1AKQA 2VHXA 3MS7A 1N92A 4DC0A 3GCGA 1CQWA 1D07A 1XX6A 2ZBUA 2HJGA 5AT1A 4EJSB 3BAZA 2EZUA 4RK0A 5HW0A 2CNWA 4Q0MA 1I7LA 4MYSA 2IC5A 4EHJA 2GLXA 2Y66A 3U4DA 4IVRA 4EMBA 2C3UA 4OJYA 1U1FA 2P0AA 2H52A 1J8QA 3BRWA 3K0CA 1L5HA 1XRMA 1J0XO 1Y6FA 3M5DA 2QMQA 2VL7A 3S6JA 3QPVA 1XTRA 5SY9A 4G0VA 1RM3A 2JZOA 3QKWA 5AXBA 4UBJA 4K8OA 2W2PA 3AERA 1IQPA 1P3Y1 4KN8A 4AM8A 4H3HB 4UD2A 3TBFA 5KOHB 5BXYA 3CONA 3HEBA 5TMBA 5BYKA 2V6FA 5IBCA 1OI7A 2JL1A 3IBCA 1XMJA 3BH7A 4LVNA 4X1KA 2FX5A 2VNHA 3JAKB 1HTBA 2OO5C 1E18A 3H8SA 1VECA 2X77A 4HAYA 1J8FA 1WUHS 2YMLA 3R2JA 2FK7A 1Y8QA 3EVEA 3HCDA 4MA4A 4OHVA 4UDOA 1C50A 1N6PA 3A04A 3EUWA 4FS8A 5AOBA 3VNVA 2X22A 1NXQA 2JFVA 1DL5A 3I2GA 1PW5A 1FF9A 2XCOA 3QWHA 4WLVA 3WHKA 3HB5X 3N58A 4TMTA 3D4LA 2JI9A 4ZWNA 4B71A 4H0FA 3P9PA 4JL8A 1MRZA 1R0RE 4IFEA 5EC8A 3KUDA 5EMMA 5TT0A 1E1MA 1SG0A 5BWBA 1F5SA 1NRIA 1Q7CA 1UXIA 2A1TR 2I99A 2P9ZA 3D3KA 4DL9A 1EK2A 5KYKA 1YKSA 3IMEA 4PSDA 3CLRC 2NZJA 2J0SA 1AIPA 1UODA 1YZUA 3I05A 4HY3A 5F5NA 3T9BA 2XV1A 1B0PA 3GGGA 3ROKA 3VV2A 5DGDA 4K6HA 1VCHA 3OE1A 2CEAA 4YASA 5KSYA 4CM5A 2XYPA 1TT5B 1QVRA 3KD3A 1JE1A 2PUAA 5LZ8A 1H23A 3L8GA 4HX5A 1TFRA 3HN6A 2EGGA 4B3BA 1WHTB 5C32A 3OQVA 2CHVA 3LECA 1N0UA 3WO0A 5EHZA 3N2LA 1M1UA 1MAWA 3LK6A 5I8PA 4H0NA 3R20A 4YQZA 5FI5A 1EHIA 1IBKB 1VSBA 1PJSA 4J6FA 4CMGA 1N8TA 2BKVA 1HFKA 5CFRA 3HLTA 3BGWA 2W6ID 2ZK7A 4MDHA 3C3KA 4CG0A 1FRVA 3T9EA 4DFDA 4S1WA 2QTLA 4E33A 2JLUA 5ITZB 2E2WA 2H1CA 2JRCA 3AR9A 3RC2A 3KL2A 2XXAB 2P1ZA 4HH1A 3PNVA 2E7ZA 2VHCA 3G1UA 4I9NA 1U2DC 3A6EA 3FVRA 2H1HA 3F7MA 4N18A 3ITDA 1EVYA 5ILOA 1JVNA 5K2OA 3PIRA 4UHFA 4LCEA 3FMGA 2GH1A 4XEUA 4AJOA 3LKZA 2A88A 2ERXA 3SJBA 3TYXA 4G89A 1QPGA 4TLBA 5AVYA 2EFDB 4ZI3A 1RNLA 1W96A 1Y6QA 1PJCA 4MGKR 1QH1B 3IKVA 16PKA 3HB9A 5AKJA 3WIEA 3HV0A 3RHSA 4RJ2A 3EYAA 4RHTA 4F6LA 2IKSA 5IH3A 3WGUA 1NN3A 4J1TC 1YJXA 1FFHA 1Q50A 2R1ZA 4YY3B 3PQDA 3R3WA 5H59A 4ALJA 5JQGB 4IP0A 1B43A 1E2NA 4BJHB 3Q5GA 4MTCA 1P7YA 5IHPA 2BM1A 3AQ4A 3CZ4A 4L9RA 4CDMA 4ZTUB 2K5UA 2PSSA 1L3CA 4GX0A 1HURA 2OKGA 1QHFA 4IEFB 1ZHHA 1SOMA 4JUCA 4XSGA 2IV2X 3QUBA 2QVYX 2AT1A 4C3ZA 1YR7A 4TWRA 4V38A 2CE2X 3JZFA 4YXWA 3IURA 3VR4A 4OJQA 1M2OA 1XT6A 3QQPA 3KQTA 5K0BA 1OWOA 2P1RA 1M54A 4DC1A 4UTVA 1AHNA 2ZBGA 4ZALA 5DBFA 4UUNA 1U9JA 1E2FA 4O4IA 2CFRA 1E1QA 1GCAA 1KSHA 2PV0A 1ORIA 4G5HA 5LD2C 2QX7A 3ILXA 4G0YA 3B3GA 4MI1A 4W8GA 4INOA 4EKIA 3I0MA 1I4LD 3W5DA 5LUBA 4O6VA 4H7FA 2V7TA 3IH5A 2WABA 3P9RA 5D5QA 5DLYA 2BZSA 2O2HA 3E5MA 1M2FA 3PPVA 4ZKEA 2IPMA 3PC4A 2BEUA 1KXZA 2IODA 3ZGXA 3HBMA 2G8NA 2WP0A 4X93A 1MRNA 5EE1A 2B9VA 2RBKA 4EK9A 3TVDA 1FFYA 4INAA 5F2OA 4M7WA 3WK5A 3IPXA 5ICSA 1IY1A 1DKUA 5IXSA 4MP6A 2VZEA 3RV3A 3DCJA 4PC2A 3BREA 3CINA 2AZTA 4B34A 3IS3A 1UC4B 1JWBB 2GD2A 2WIDA 3IE2A 1YBHA 4L50A 4DC9A 3OF3A 1N3IA 2P67A 3GT7A 2WSMA 3KZKA 3CEHA 5AOAA 4ZO4A 4ACAA 2QRPA 5AVRA 4KHPB 1L8QA 1ECBA 1SQ5A 1TTHA 1F0KA 2JIBA 1UXHA 3U1TA 3E5HA 3GFTA 5CM8B 5JI2E 3CSUA 1NX9A 3RADC 4V2IA 4XFDA 1JHVA 1KRWA 3KSRA 3QKIA 1IEXA 3R3XA 3OPYA 4TYYA 1SR8A 3H97A 4NBRA 2WJ3A 2AOTA 3FNQA 3MUEA 4CR7A 2O8CA 2G7MC 2VKTA 3AUJB 3TDNA 4DQVA 4IO0A 4MYTA 2Y6UA 3AHDA 3UJ3X 1XAGA 3ROMA 3VAYA 4CE6A 4CN9A 3I6YA 3L4KA 2QAGC 1WPRA 4PS1A 5EUCA 3LUBA 2MT9A 2QV0A 1P9OA 2XQIA 3I04A 3OA2A 4E5VA 2GPNA 2IF0A 1FMCA 1IWOA 4G0PA 4MYCA 4DQ0A 3LT5A 2D3WA 2AXNA 4ZQEA 4QYMA 1NUTA 5SV2A 3WQQA 2NVBA 3ILVA 4TWBA 3FZNA 1KSGA 3ZWKA 2XTNA 2O2IA 1VL1A 3G0IA 3HEAA 3PJGA 3RBVA 4BMPB 4B09A 5A4AA 5JZMA 1G3QA 2PLNA 3AV3A 4L4RA 2GRAA 3GR6A 1J5PA 4DMMA 1RRVA 1FSFA 1DI0A 1Q14A 5FWXA 1ST3A 2VVTA 4DARA 2ZJ4A 3T4UA 2VJPA 3T38A 1CBUA 3TN7A 4LJ6A 2LKCA 1Z6GA 4DWWA 2DPYA 4O2BA 3U31A 5JXJA 1XROA 4UEOA 1EE9A 1DKLA 3BEOA 1KKUA 3LW7A 3N0XA 3UWOA 3EXG1 2QGNA 4PLHA 1FYXA 4IIJF 4OA5A 4CMKA 1FZTA 4E3WA 1NJ8A 4LE0A 4WNAB 3A25A 5REQB 5BNTA 1RADA 1U4SA 3WJ2A 1P0IA 3QX3A 3ZHBA 5H83A 4ZPJA 1GRNA 4K9OA 2EF0A 1KJJA 3O8OA 2W93A 4RTKA 1MV8A 1ZHOA 4E15A 1PWYE 3RUIA 1GGFA 2W2LA 2BOVA 1HLFA 3SIWA 4HNAB 1JFRA 5FNVB 4KPYA 4J1SA 2OHOA 2NVWA 2X5NA 3HWWA 2NUPB 2VZ8A 3OOHA 4PPFA 1CKEA 5FBVB 5BR1A 3IC5A 2IYAA 4LYJA 3L43A 4TWIA 1FPQA 3KYDB 5COBA 2EV9A 1F8GA 3WL8A 5KQRA 1SD2A 3REOA 1DWQA 2GILA 3BFPA 1U3TA 2ODQA 2YXDA 3B1KA 4HDSB 1Z6QA 4WJZA 1GNSA 1L5QA 5AI8A 2FY8A 2MU1A 3RVSA 3A1CA 4DIKA 3ZCTA 3ZX4A 4RVNA 4IAOA 4LZAA 5I7OA 2CYCA 4HWKA 5LR6A 5EGNA 3FXAA 1SKMA 5AI6A 5D86A 1TUEA 4WCDA 1AF4A 4RY8A 4JOSA 3LP8A 4LTNA 4J0JA 1TDJA 3NGMA 4QEKA 3O21A 5U1PA 4OO3A 4CMHA 1H3EA 3C43A 3H2GA 4NH4A 1AA9A 3H11B 4IQ8A 5LZ2A 1NF2A 5GVRA 1E66A 4LC1A 2FFAA 3DEHA 1WBJB 1T9GS 5TVGA 1BD4A 2REBA 3DL7A 4CKEA 2ABWA 2D4AA 2HMYB 1JQLB 2OMKA 2PZFA 3DO8A 3HO8A 1E2KA 3K35A 3KEQA 4U7HA 2IVZA 3I2FA 1YS1X 1Z34A 3KDPA 4IZHA 3ROGA 3UN1A 2C7OA 1HLDA 2X8JA 2OLJA 1CJVC 2CLHB 3OZCA 4TV9B 3UUWA 2VPXA 2CXHA 2OP0A 1J23A 1Q1BA 3BMQB 3QNUA 2HSZA 4HAXA 4BNZA 2I0FA 3D2LA 4US1R 2ZSHA 3VR2A 4PG7A 3DBIA 1N2BA 1CCWA 3ZV3A 3GFGA 1KO7A 3IESA 3BXGA 3RS4A 2QAJA 4IINA 2D1QA 3PXCX 3DE6X 3IT3A 1II9A 4U8HA 1NU8A 3SZ3A 3TSYA 4MMXB 5IC6A 2OAP1 1LPAB 2QG6A 3LLCA 1TZJA 5C7YA 3PUYA 3UG6A 1WY7A 1XD8A 3FKSD 4YRRA 4A0RA 2Y9MB 2W37A 3T3OA 1T1RA 3RIGA 2YUIA 1USGA 2IEDA 2IITA 4O63O 3FNIA 4LZJA 1L4HA 1YKFA 4M0CA 3UPTA 2C4VA 3NXSA 1RJFA 1XMSA 2CD9A 5B1EA 2Y27A 5MN4A 1LK0A 2C7VA 3ZLJA 2GN6A 1G8JA 3JYHA 4F4UA 2C3OA 2GZ2A 5L4LA 4K8RB 1LSOA 1XLTC 1E4EB 2WWWA 4E2XA 4JI5B 2YC2C 2JBWA 4DOMA 3C87A 1NMQA 3V4VB 4ABYA 3T7TA 4QLBA 1FRFS 1KAOA 2V98A 3D7NA 4PW0A 1EFVA 2QRNA 4RD1A 4CM4B 4WZ6A 1WCIB 3BCRA 1P3DA 2W4MA 4YR7A 2X3FA 2GA9A 4EKDA 3EQ2A 4RAOA 4OK3A 1QX3A 2WJ6A 4X6LA 4ZIRA 1E5QA 3K0SA 4I8DA 1J5XA 3QYPA 1EFLA 2AYXA 2IVFA 2WUDA 1G18A 4IFTA 1A8QA 3O91A 5H80A 2DUUA 1EBUA 1JLLB 1JPNA 4DM4A 1XDSA 2OV2A 3IV7A 4GFDA 4GL4A 1J1IA 3P19A 2Z83A 1Z7BA 2PS3A 1WQ1R 3PT5A 4PQFA 3ZY5A 2IHTA 2X19A 3EODA 4P0TA 2ATCA 5DB4A 3G9UA 1WR8A 2I34A 2VDRB 1ZRMA 2R6JA 3RUDA 2GEUA 4MIKA 3FETA 4AWBA 1EGMB 1ICIA 3UK1A 3DDCA 3TPFA 4H4CA 4KN6A 4OXXA 5AVXA 2NTJA 1G7CA 4G2NA 4PN3A 3A9RA 2BM8A 2WR8A 2VQ6A 2WV9A 3LHKA 4Q4HB 1GGHA 5BN3B 1IMJA 1G66A 4KXMA 3ZBUA 5ICCA 3R9XB 2JVJA 4NEGA 4EBFA 5IHXA 3EEBA 3ELDA 2Q1YA 1RXUA 4FMBB 3KE9A 4YGXB 3ZLTA 1NXXA 2SECE 3AU8A 4QUJA 5H5JA 4MAAA 2JIDA 4O59O 1W1IA 1WVMA 1E1KA 3DZBA 1XMVA 5ELXA 1MA3A 4OIMA 1SUCA 3QU7A 5IKEA 1A5TA 4Z4QA 3KKOA 4G23A 3LUHA 4BPBA 5I6DA 1E8DA 1ZVJA 2C92A 4A2QA 4CUJA 1ULUA 2X0KA 3MIZA 4JSYA 3U1VA 3ZDRA 3CPEA 4XAQA 1Q7GA 2YZMA 1A2BA 3T94A 2CCGA 4FSHA 1OYWA 1K5PA 2B1IA 2Y1WA 3DW1X 1FNNA 3B1YA 3G2IA 4X5OA 3R44A 3OF2A 3RJ9A 1AQLA 4GLFA 3B7PA 4P86A 4C0WA 4F04A 4WESA 2WKSA 3EZLA 3PFCA 4MJ3A 4F38A 5KOYA 1QIIA 2ORYA 3MD9A 4M1SA 4EI2A 2CLIB 1NW9B 4LGCA 5IAEA 4AX4A 2PG3A 3IHLA 4KQEA 1QIEA 2OAGA 4Y6QA 3AY0A 1VE7A 3NETA 4HRVA 4AX8A 1BZYA 3K70C 3EXIB 4N5IX 4WJKB 2FWAA 3L8YA 4HDQB 1PKXA 5F12A 3S0JA 5JNSA 4HPXB 1UDXA 1CR0A 3LRXA 2W70A 2PXCA 4PZ0A 2DF8A 1TUBB 2B3DA 2V6JA 1NN0A 1JHDA 2DR0A 4NI5A 4R8LA 2W2QA 1SUEA 3NC1C 2P9TA 4C29A 6REQB 5CT4A 3ZH9B 3EUAA 2B1JA 5HTOA 1CRPA 4HNVA 3PQ8A 3CS3A 4Y2TA 4WACA 4XTCS 2DFTA 1LXCA 2ZJBA 1INLA 1N2OA 2EW1A 2NYVA 3FWKA 1T5DX 3KS9A 5AWFC 5GM1A 3V2IA 4A8JC 4B4VA 1G8YA 5KNLA 3TRJA 1RZRA 3I9FA 1L5GB 3MM4A 1QC5B 3QLUC 1WUJS 4NBTA 1GQRA 3UHJA 1KMQA 4HS4A 1R4ZA 4KK3A 3UMBA 2W4IA 1ZD4A 2SCUA 4WUTA 4RZ3A 1CB7A 3F4LA 1YMUA 4AC9A 2Q1UA 2BCJQ 2QYOA 4KDFA 4Q1EA 1ZN7A 2QRVB 4M8NE 2GUGA 1Z2EA 4WDRA 5CDTA 5LOVB 4GKKB 3ZQJA 2NUAB 1OPXA 2HXYA 2EXXA 1A7KA 2L0XA 3Q7PA 4FFDA 4ZO9A 4O4LB 1UINA 3MJ4A 2VI5A 4BNNA 5LLDA 1EWVA 3U4IA 2EHJA 2M98A 1PEKE 2Y0CA 3AJ8A 3DV0A 1T5BA 2JAQA 4LXTA 4DLAA 3A3NA 3UJ9A 1GD1O 3SP1A 2CDAA 4R16A 4LTMA 4AXBA 3GH1A 2GX6A 5KNBH 4RD4A 2OL4A 4PSKA 1FNSA 4ENTA 3WAGA 2NM0A 1YRHA 4CTJA 3E84A 1B15A 3M83A 4JI8B 2AHRA 1PS9A 1YUBA 2QTAA 2VH5R 1RRGA 3NJ4A 4TKLA 2ZAMA 5L8VA 3MAAC 2O5EA 3QUAA 1T1GA 3S7ZA 1Q1ZA 3UMSA 1NVWQ 1NVAA 1GL7A 4RSMA 5KINB 5F4ZA 8LDHA 3DE3X 2X1HA 5EPEA 3GEIA 1P7CA 1ODFA 2O1XA 1K2VN 1W0KD 2DTEA 3NEJA 1COZA 5THXA 3TCKA 4Q16A 1AUOA 2UZAA 2PZMA 5DPMA 4GYJA 5LJIA 2BE9A 3OE7D 1VIYA 4GAEA 1F3OA 1TZCA 3I52A 2Y4NA 1YNSA 2PJUA 1R0XA 1BFDA 3COSA 3LTEA 4XPIA 1ML4A 2VYVA 4CF4A 5CAEA 3NBYC 3GIWA 4X0EA 4ETWA 3HVHA 4FZJA 2TYSB 5AKYA 1N2CA 2UUBB 5K8LA 1A9YA 1KA9H 3BFXA 2C94A 1DHTA 3P4YA 2I3BA 4EUFA 1Q7TA 4IRXA 2R9VA 5KSZA 1ADFA 3KVOA 1N5JA 3RIMA 3ANYB 4YMWA 4YUYA 3NHRA 5C34B 3DFMA 2JJMA 3W3ZB 1Q95A 4J90A 3H17A 1W48A 3TBHA 3WXBA 2VP3A 4L6AA 3P4UA 1Y3FE 5LQUA 3U09A 3G82C 3E0XA 1ZC4A 5CCXA 2QE7D 3HLYA 4Q4AA 1RKVA 3PP8A 4IDNA 1Z8FA 3BM5A 4GBMA 5BMVF 1UXOA 2GCGA 4KDEA 1QZXA 4Y18A 5I7EA 1E2MA 2ZB3A 3K5WA 5HRCA 2JLWA 3R3HA 5DTRA 2GTIA 3UGKA 1JHRA 4EG4A 2UYHA 2AF3C 1E0JA 4RVDA 3SBEA 1QQBA 2GTPA 4UTOA 1IL0A 4FYIA 1DJLA 3LT1A 1KKLA 4YVFA 1Z35A 2JFYA 2GXUA 2K2WA 3VVBA 4CLOA 5I3ZA 1FEZA 1HEUA 2FYTA 1KO5A 1PO7A 2I2BA 3CG4A 3IXLA 3EW7A 5EZYB 2NZYA 1O9HA 4A16A 3EXFB 4M53A 5J5CA 3TLMA 2D2EA 3K09A 2CD7A 3F7OA 4YT5A 5LVAA 1KMMA 2J0UB 1SXHA 3ECSA 4XIIA 5CH3A 1RHJA 2GZSA 1RBZA 1XQXA 2RGGA 3UXHA 1GM5A 1T5SA 2CC2A 4AMYA 4H08A 2QSYA 5AI5A 1W7AA 3E1GA 4R8RA 4YPFA 4P22A 1N9KA 1N8SA 3LA8A 5JJBA 2GJKA 3K4PA 1S9DA 4LXQA 3ZCXA 3ULKA 4WH0A 4FDAA 2B61A 3JS5A 2M6LA 2QTCA 3KALA 3UJAA 3ZQ6A 2H0QA 4MQEB 4JSTA 4P98A 4WSOA 5HM6A 1II8A 1Y6RA 2WUEA 2Y1CA 4JZYA 3D6MA 2ZYIA 5AXAA 3ABQB 3FUTA 4D79A 2O8EA 3PITA 5IKMA 1QIMA 2PAAA 2OM2A 4Y8VA 3WWZA 4R2KA 2W71A 4BLWA 4DM7A 2AZDA 5G1NA 2NZUG 3TX6A 4EB8A 2IEZA 4CRWB 1GPJA 1XF9A 1YC5A 2J6HA 4ODIA 3QMPA 1U7PA 5KYXB 3ILYA 4B76A 3JVUA 3OMXA 4TMXA 1I6LA 1HGXA 2DBQA 1K06A 4JFAA 4JYPA 3WXMA 1BOFA 3RVOA 2XCSB 4JJFA 5LQDA 1ZVKA 2RGRA 1I3KA 4BECA 1J0AA 4PAMA 2EJVA 2ZRJA 2H2GA 1DFHA 2HREA 3FLMA 4QPCA 5GQSA 2IBMA 1RCFA 1A5BB 3A6GA 2JF0A 1H2BA 3RPEA 1NYRA 2OCLA 1AK9A 3MUFA 3O7MA 4X6XA 4ZOLA 4JHXA 1IMOA 2B1GA 3SZOA 2B94A 4YMTA 2BLNA 3VJMA 3MGKA 3V80A 1B42A 4YT4A 4BWVA 1A9ZA 4J76A 4M1WA 2DCMA 1UC8A 3M7IA 4IX9A 1A7AA 1RKXA 4RF4A 1UOOA 4GGMX 4NRDA 4QRHA 1CHDA 1FRNA 5EIWA 3ROXA 1LVGA 1NBAA 2J4CA 3IAUA 4I1PA 2P2SA 5HQJA 3WWCA 1WLSA 3AYXB 2A5DA 2NUTB 1TIPA 2NQ2C 4NMXB 2O50A 3L0CA 1YQTA 1IWBB 3GUYA 2R62A 3D6HA 4JLWA 3IPRA 2QLFA 1P75A 2CMHA 4FMDF 4TS3A 3LCMA 3ZZMA 4CNBA 3I4FA 4U7WA 2AKYA 4PPQA 3HKBB 3T7DA 4UBMA 1F6DA 3IILA 4WKPA 4XWYA 3K8OE 5JNLA 5CVDA 3I5XA