4QJ5A

Structure of a fragment of human phospholipase c-beta3 delta472-581, bound to ip3 and in complex with galphaq
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
317
structure length
317
Chain Sequence
ARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPSYLPTQQDVLRVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanine nucleotide-binding protein G(q) subunit alpha
publication title Molecular mechanisms of phospholipase C beta 3 autoinhibition.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein/hydrolase
total genus 105
structure length 317
sequence length 317
ec nomenclature
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00503 G-alpha G-protein alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.400.10 Mainly Alpha Orthogonal Bundle GI Alpha 1, domain 2-like GI Alpha 1, domain 2-like 4qj5A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4qj5A01
2WV9A 4LBZA 3O8CA 4GDFA 2Q6TA 5G41A 5KUTA 3DHWC 3U7HB 2PJZA 4PO9A 1W46A 2QP4A 3E1SA 4XWOA 3LXRA 1VIAA 1XP8A 2W6ID 2F7SA 3KJIA 3WNBA 4HZUA 2GCOB 4I99A 3IBYA 2OSBA 2ZE6A 2FGJA 3LQQA 4JYBA 3KZ1E 1WA5A 3P26A 1Z06A 3GEEA 3PITA 3L8ZA 1N0VC 1AS3A 3UK6A 3KL4A 3GLGE 1OYYA 1P61B 1VKJA 2OFOA 1V43A 5JJIA 1KI7A 2RH5A 2RHDA 2V4ZA 2NZ8A 2OT3B 4RD1A 4JLJA 2XTMA 4QGHA 4C0LA 1Z08A 2A5JA 1TX4B 1II8A 1KKMA 2XOKA 5FTKA 3HDTA 4FMDB 1YE8A 3TUJC 3U5ZB 4OI0A 2J0UA 1VHLA 4E03A 5JSZA 1JPJA 2FEOA 2IXGA 4M9QA 4JT2A 1J8YF 2PMDA 2FSGA 1AJEA 4HLUC 5LD2B 1AM4D 1G3IA 4RD0A 4JLOA 4IJMA 4Q4LA 1PLKA 4FN5A 1X8JA 2WSSD 4EIWA 5DLQC 1OPXA 1K5GA 3TR5A 4Z1MD 1SXJD 2VHQA 2ZI6A 2OV2A 3H84A 1VG1A 4H1UA 1E1QD 1HQCA 4PSKA 3LDAA 4B43A 2PEYA 2WOJA 4QNRA 2XGJA 1KDPA 2FPMA 2NO7A 1GRNA 3HP1A 3U3KA 3GCGA 2EFHB 4IXNA 1AQYA 3L0IB 4B6EA 3LLMA 1OLOA 2WSSA 4ON9A 3DKVA 4NMMA 2GEUA 3CPHA 2ZITA 3K9LA 4Z1MA 5JFGA 5JWRA 2ZAOA 2WAXA 5K8LA 1HT2E 1NF3A 3WRXC 2HV8A 1GUAA 1H8ED 4I1VA 1QG4A 3RS2A 3B8HA 1KDTA 3BH6A 2MSDB 5EP3A 1NN5A 1W36B 1U2RA 4M21A 4LJ6A 1P62B 4IEIA 1P73A 2OBLA 5JEDA 2IS2A 421PA 3M4YA 3WMGA 1T9HA 4KXFB 2EFGA 2GVZC 3EPLA 1E0KA 4BLTA 3EWSA 4Q1CA 1XEWX 3JVUA 4LC1A 1AKEA 4ERNA 1CULC 4KHZA 5K8TA 1N6HA 4ASUD 1XTKA 4TMXA 721PA 3FKSD 1J2JA 2W6JA 1XXHB 3IGFA 4II7A 2RGDA 3BK7A 3ECCA 4TZ6A 1Z22A 3K9GA 2DY1A 4NHOA 4PO8A 1GNRA 1MO6A 1TF5A 5JS7A 3F0TA 3IIJA 1GILA 5KSYA 1DAFA 2F43B 2YKGA 1YZTA 2QU8A 2AR7A 2F55A 1UKVY 3CLVA 3RLFA 4DLYA 3FKSA 1FQJA 1T3HA 3HR7A 2YWHA 3T12A 4BWYA 2B8WA 5HE9A 1QHYA 4IDNA 2YYZA 5FOTA 3TQCA 4TL9A 1OF1A 3QXCA 1RRPA 4EJSC 3VX4A 3ZD7A 5IF9A 1XTJA 1H8HA 3AM1A 3LX8A 5G40A 2QI9C 4AWXA 4XSGA 2EW1A 3IBGA 2R6GA 4BFXA 2B7BA 2FFAA 1S9DA 1MH1A 2D2EA 5D3MB 5AJXA 3WHKA 4A1FA 4HDCA 2HYIC 3BFKA 4OHZA 3KUDA 3FGNA 1IJFA 3CR8A 2JLRA 2OEPA 1HH4A 3VHXA 1RRCA 2WMNB 1E96A 2O52A 4NP6A 3UIEA 4JJZA 3IEVA 3TK1A 3TSZA 3K0AB 3U4QB 1ZC4A 2Q21A 5KPDA 2KB0A 2WSMA 2ZI7A 1ZRHA 5J4HA 8OHMA 4IDPA 4PPGA 1E2EA 5SZJA 2ZU6A 4MUBA 2V8OA 2ZEJA 3KKNA 3T06B 4LJ5A 1P9RA 4YC7A 1OH7A 4QG7A 4F4IA 4AD8A 3AVTA 3NH9A 5F9HA 1F2UA 1CJKC 2ZS9A 3H0KA 3EG5A 1ZD1A 2A5GA 2FDCA 4LPKA 4IOJA 1SKYB 2V1XA 3LBNA 4JSTA 4LHXA 4C30A 4GOJA 3GJ0A 4OHXA 5FOWA 1KNQA 4BQSA 1FNMA 1GNQA 4PQRA 1P72A 5GJVC 3AKDA 4Q1DA 3AF2A 2KWIA 2TMKA 3FMIA 4P0TA 4XWAA 3EPJA 3K9NA 1E79A 1XJCA 3CKLA 4JKIA 3OE7D 1GFIA 1A7JA 1E9CA 1KDOA 4KVAA 2WJVA 1ZU5A 2BVNA 3NG1A 3CUEF 2HT6A 3DPUA 3K0CA 4JBXA 4H9GA 1Q0UA 1XMIA 1R7RA 2FZ4A 2EU8A 4HZUB 1LTQA 2MMGA 3R9XA 1IN5A 4XD7D 3U2QA 3EPKA 3CH5A 2CDNA 1PZNA 2FF7A 3THOA 5G3YA 4LGMA 1GZSA 1Z6GA 2C5LA 5J4KA 2R9VA 5KDOA 5CM9C 1CU1A 1FPMA 3T5GA 4AKHA 4JVSB 4BFUA 1XCMA 4ESHA 1OE0A 3ADBA 1I2MA 2IT1A 1YZGA 4I1SA 4XD7A 2G9NA 4AY2A 3LRPA 3TR0A 2DYKA 1II8B 2PLRA 2ZJBA 4G1UC 2GRJA 4MH0R 4A8JA 5B30A 1DAMA 3AEZA 4KODA 3RABA 5GJBA 4LUCA 1K6MA 2QM7A 2GEVA 4LV6A 3EZ7A 4GP7A 4QFMA 2J0UB 4KAXA 1F48A 3SQWA 2VQSA 5JSZB 4GT1A 2JIZA 4H1VA 5FTJA 1Z6YA 4X8OA 5FL7D 4PSAA 2HXYA 5IDVA 4CT4B 1VYVA 3WRYC 4N0EA 2N46A 2PCLA 3EPHA 4EDHA 3T35A 4AG6A 1VIYA 1Z29A 2ZI5A 3TVTA 1CLUA 4W7SA 3VR4A 5JHHB 3DVLA 4PQFA 4IRUB 2R8RA 2QEQA 3U6KA 1YZQA 4AI6A 2IXEA 2VF8A 3TKLA 2VSFA 2MMCA 2PX0A 1W48A 4LJ7A 3I92A 2GNOA 4YMTA 3Q85A 4KI0A 3PIRA 2A5YB 3A1TA 4LCBA 5EUQB 4RZUA 2IHYA 4A9AA 3KJHA 2AKAB 1TEVA 3A36A 3NC1C 4B3FX 1KJYA 4LY6A 2ZUBA 4HUQA 5C4MA 3RAPR 1KNXA 3PCRB 4JLVA 2ANCA 2D4HA 3HJNA 4OHYA 1S1MA 5EXXA 3B13B 1E9SA 3RS4A 2FFHA 2ZM5A 1XTSA 1EWQA 4LPSA 1UF9A 4ZDWA 2JLYA 1G8HA 4C2UA 1CR2A 5CJ2A 2E87A 2JLUA 4C2TA 1XEXA 2RKOA 2PH1A 4A2QA 3FB4A 4DUGD 2NQ2C 2ZI4A 2CHQA 2X19A 821PA 5TMPA 3SS8A 1BYUA 3PQCA 1S0UA 2J9RA 3B7GA 2BOVA 2NO6A 2VIIA 4ZCIA 3RRZA 3AVPA 3WY9A 2PX3A 4OHWA 5H8WA 2QGNA 1JJ7A 2ANBA 1OXSC 2FPLA 3QVUA 3ICEA 1E2JA 2AK2A 3BAFA 5BN3A 4RD3A 2ZRCA 1Z6XA 2FFBA 2V3CC 3OEHA 3GEIA 1Z5ZA 4M1SA 4LYAA 2OLKA 2HJGA 2IYZA 1DG1G 1E4VA 2IW3A 5CYPA 3I5XA 3CNOA 4YMSA 1UBFA 621PA 4AYTA 1JR3D 2ORVA 3R7WA 5C2JB 3UMFA 4JS0A 1KI8A 1SXJE 5HKKD 2P0EA 5L3QA 4OHVA 1ZP6A 4TQ9A 5HE8A 2VP6A 4TMVA 1C1YA 3PUVA 4NCJA 2J0QA 4MRPA 1U0HC 3MD0A 2NZJA 1S1CA 1HY3A 2E9SA 2ORWA 5EP1A 2JAQA 1RZ3A 4YXWD 4WZAE 3N70A 3IKJA 3ZZUA 3VKWA 2F3TA 4RD6A 3FKQA 4OKSA 4P31A 3ZD6A 2ZAMA 1SHKA 1AS0A 1XB2A 3JZAA 4KFSA 1F2UB 5JZVA 2ZSEA 1P7CA 3N5CA 4KJZA 2BEKA 2WPDD 4P33A 3T34A 5D3QA 2GESA 1OB5A 3P27A 5KDLA 3K70C 3C41J 5SZHB 1OXUA 3KXIA 4G5SA 2XITA 1E2GA 1G3MA 3CWZA 3AH8A 4EPVA 1VDZA 4ZV4A 4IKEA 3TRFA 3D7MA 2WPDA 1PV4A 1T5LA 1L2TA 2NO1A 2CLCX 2PL3A 2DFTA 2GZAA 4F4JA 2WIAA 4CGZA 3QSYA 3I32A 2J1LA 2GDJA 1CR1A 1GTVA 2QTVB 1X6VA 2BBOA 1F5NA 4GFDA 3ADDA 5FOUA 4FW9A 3U6BA 2HF8A 1PUJA 2N1BA 2PT7A 4EQ6A 1TL7C 1CS4C 1HTWA 4B3CA 3MWYW 3PVSA 2GTPA 4GP6A 4V03A 3OZXA 4B32A 1XJQA 1KOFA 2Z0MA 2ZREA 5C46F 1QF9A 3P4YA 5KSOA 2XNDD 2JEOA 3TIFA 4C0SA 3NVAA 1VYUA 3OESA 4AYXA 5JI3E 5KNBA 3E70C 1N5LA 3AVXA 3ZVLA 4UQOA 1CR4A 2DHRA 2ZE5A 1IXSB 3CONA 2G88A 3VR6A 1FTSA 4HLDA 1AQUA 4DEXA 2OCPA 3IHWA 2Q9BA 3MG9A 3TJZA 5J40A 4P4TA 1CTQA 3A4LA 2A9KA 2QQEA 1M34E 4TQAA 1DS6A 4M2LA 4YMUA 2RB4A 1CP2A 1AZTA 4G0NA 2WJHA 3B78A 5H68A 1A2KC 1DO2A 2ZU0C 4BZPA 2O8CA 4KSBA 1Z47A 2QRZA 3CZQA 3GMTA 5B58C 2O8BA 3A1SA 1W2GA 2DBYA 2QP3A 4FD2A 4Q7KA 1JXOA 2O8EA 2Q9AA 5AJVB 3R8CA 2VP0A 2ZR0A 5K8IA 3WHLA 2F9LA 1IN8A 1NBME 3LH5A 1UPTA 1COWD 1YR6A 4WZBE 3SYNA 4C0QC 1MRSA 3D31A 3LY5A 3AQ4A 3QXHA 5C1BA 3DM5A 1Q1ZA 1XTQA 4LBWA 2O0KA 3ZLJA 1NN3A 1E94E 3CX8A 4YMWA 4MRSA 4MRRA 1G7TA 3OIUA 1KI4A 5AUPB 1ESNA 3MJHA 3RWMB 3I62A 1HURA 1OKKA 4K8OA 2GAAA 3LNCA 2BIFA 1EX6A 2EWWA 2ZSAA 3AKCA 1RE0A 3ADCA 3L82B 3AF4A 2ONJA 3ZQJA 4ZI2A 5EJEA 3GLFE 4HUQB 3RSLA 2XB2A 4ACBA 2PLFA 2PT5A 2J46A 1U94A 3VTKA 2N42A 3I1FA 2C77A 1FL9A 4V0NA 3F8TA 3QG5A 3T1QA 1E2LA 4Q4JA 1II0A 3GPLA 5JWHA 2JA1A 4BEJA 1MABA 3RRMA 1GIAA 4AG5A 4DJTA 1U9IC 2OG2A 3CWQA 5FR1A 2O8DA 3IQXA 1UAAA 1XEXB 1TMKA 4PAMA 4Q9HA 1OW3B 3U3OA 4AYWA 1ANKA 1OIXA 2QY9A 1ZVQA 1QZXA 2ODNA 1KSJA 2ZRGA 3CRMA 3CW2A 3IPXA 4TTRA 4NYMQ 1OSNA 3BBPA 3TE6A 4Q9JA 4TLCA 2IEYA 4A92A 1E9FA 4DDTA 1U8ZA 1XFAA 5DN6A 1SHZA 3V9PA 1W36C 4RFVA 4E07A 3FMFA 1Z6TA 1NN0A 3KTAB 2QAGA 2CCKA 4NONA 4ZCMA 1SVLA 2VF7A 2OILA 1CJVC 5B64A 1NMXA 1LF5A 2FSHA 3FFBA 2A30A 2CHGA 5BWMA 3IDQA 3K9HA 3KKQA 1TQ2A 4D2IA 3EXAA 3WMFA 2P65A 1P75A 1OIVA 1X8KA 4HB3A 4F92B 5KOYA 4KFUA 1VHTA 2Q3FA 2UVQA 2VP5A 3BE4A 3LQRA 2HLDD 1RVDA 2WBLC 4HAXA 1NLYA 1GNPA 1NSFA 1YRAA 2C2HA 3F3YA 3L0SA 4V0ME 4Q9LA 3W6NA 1TF2A 3PG5A 4WVFA 4HSEA 5EE1A 4L8GA 5G3ZA 5L3QB 2AHOA 2JATA 1D9ZA 1ZD8A 2NGRA 3N2EA 4A15A 2BCJQ 4JJKA 1AGRA 2D2FA 2XEXA 5FOVA 2XJ9A 2QA5A 1UKEA 2HLDA 3QXSA 1Z8FA 2QP9X 4HZIA 1NG9A 3EZ9A 2FJUA 4QM6A 4Q02A 1YR7A 2QROA 1VG8A 3H2YA 2XB4A 2QT0A 3VFDA 1E99A 4PC3A 1NIPA 1JAHA 3ZVMA 5DI3A 3QBVA 3VQTA 5JJLA 4B73A 5KHOC 3PEWA 3NXSA 1W5SA 2BCGY 2CNWD 3BB4A 2ZRDA 5AK0A 2V6JA 4RKEA 4L15A 2X77A 5EQTA 4B6FA 1NP6A 3EC2A 3B5JA 3KJEA 3UG7A 3NEYA 4TL7A 5LDDC 5HCNA 1S2MA 1LY1A 3P4XA 3NTUA 2GJAA 1KI2A 2IUSA 121PA 3AP3A 2R6CA 3ICQB 1WP9A 2I1VB 3TVDA 1E2MA 2Z6VA 4NYMR 5GVSA 1HA3A 4BFYA 3THXA 4Z51A 4MDEA 4DXAA 4PZZA 4EKDA 3PUXA 1KJZA 1HE1C 1QHXA 4JL5A 4MGZR 4C0AC 3W8RA 1M2OB 1N5IA 1NVXQ 1KK0A 2Q9CA 3B85A 4C0JA 3FFAA 2IYRA 3TGPA 1OHHA 1U98A 1EESA 1D9XA 1E2NA 2P3SA 4EQ6B 1G19A 3QXXA 2VYFA 4ARZA 1KI1A 3CM0A 1WBDA 3B1WA 4Q1BA 1F60A 2QMUA 3FVQA 2BBWA 4HAVA 3LW7A 4N1AA 1G6HA 2VHJA 1S8FA 2J41A 3SE0A 4FXPA 3GJ4A 1Z28A 5HPYB 3GEHA 2RGBA 5AJWA 5FBVB 1N6PA 3QOFA 4DLVA 3NDBB 1QVRA 2J3EA 5JEEA 1LV7A 2W6IA 1JXMA 5CM8B 1JR3E 3OIYA 5EUMA 1YKSA 2D7DA 1R0WA 1VG9B 2IX3A 2WAYA 3EZFA 4TT3D 3HU3A 2C04A 2G0NA 1G18A 1CJMA 1IHUA 4LHVA 2O8CB 5JBQA 1KI6A 4DSOA 3AVWA 1E2DA 2O8BB 4NYJQ 2O8EB 4HLUA 2VLIA 2BBSA 3TLXA 2G1JA 1XU4A 4TLBA 4QJ3A 1JEEA 4D0GA 2ZR9A 4OQFA 4DB4A 1LS1A 2H17A 1N5KA 1NVVR 2FA9A 1W4AA 1WMSA 3KKOA 1E2QA 3QPWA 1ODFA 1G5TA 1NVWQ 2UZ3A 3H4MA 4NYIQ 5EZ6B 2F1HA 3KQNA 1DE0A 4M9ZA 3A1VA 2FPKA 2OBNA 5CLQA 4Q01A 3LA6A 2NTYC 2VHCA 3A8TA 3V4RA 1LF0A 2YWEA 4DIEA 1E9EA 3IIKA 1PLLA 1IY0A 1CIPA 3Q8XB 1Z0KA 2J0SA 2EYUA 2JLQA 3KXLA 1OFHA 3GFPA 4MRVA 4BUJA 2IWRA 1W4RA 1SXJA 1G1MA 4ZIRA 4EFMA 1VYTA 1E1QA 4A0HA 4IOKA 1JPNA 4QXAA 1I4TD 1T0JB 2XZPA 4LRWA 2CHVA 4GZMA 1W44A 5SZIA 4LJ4A 4AC9A 1GWNA 2ERYA 4DZZA 4A0FA 4Q4JB 4DDWA 2O8FA 3N2IA 1XPRA 4CIDA 1ZNYA 2B92A 1MABB 2WJJA 1D2EA 3BFXA 2DFKB 1N3BA 2O8DB 1H8EA 3CIOA 3RRNA 1T6NA 3ZH9B 2R2AA 3A4MA 2GBLA 5C18A 3BB3A 4B3DA 4ITRC 1G21E 1FTNA 4OYHA 2P67A 5GVRA 1PJRA 3NEJA 1R0YA 4M53A 5J4VA 3TQFA 4BFZA 2ERXA 4RJLA 1GRQA 1QRAA 2IWHA 3NBZC 2ASEA 2YVUA 3KXKA 2GK7A 2WZQA 4M4SA 4PC2A 4PX9A 1DAHA 1M1YE 2WJGA 3SBEA 4ASUA 4DLSA 4EPWA 1D5CA 2FV8A 1OJLA 3T61A 4XTRA 2QAGB 2ZVPX 3B9PA 4TYWA 3Q72A 4Q9IA 4EJSA 4NYJR 4CZ2A 1ZUIA 3IO5A 1D2NA 4FMCB 1T0HB 5B57C 2ZYWX 1Z0AA 5FOXA 4EPXA 3MGCA 4IFBA 3GJXC 2IYVA 1OFTA 5JWOA 4BPBA 3ZGXA 4BLRA 4TYPA 4L9SA 4NYIR 1YJ5A 5KO2A 3THWA 4B76A 2ZRKA 2B21A 2BMJA 1ZIPA 2Q3HA 3VR3A 221PA 2RGNC 4DHEA 1LVGA 4LJYA 2NG1A 5TB5A 5JCPA 1XTIA 1BOFA 3FWYA 1NLZA 4MYHA 1SULA 2NPIA 4JKYA 3W90A 5FPKA 2GZDA 5KNCA 4KYIB 1G7RA 3HYRA 1R8QA 1FNNA 4R7ZA 3ND8A 4OQXA 3IQWA 4YDSA 2C99A 4I1OA 4EFLA 4MGKR 4G5RA 3VAAA 3DEFA 3BIFA 2YZ2A 3Q5EA 4D26A 5LBIA 2NO9A 3NBFA 3KQKA 4ZDJA 4HI0E 2XTZA 1NBMD 3IHLA 3KQUA 5H1YA 5DI3B 4TTQA 3CB4A 2XSZD 1JNYA 2H16A 2RAPA 2WJYA 3AP2A 4XWKA 2G83A 3TW4A 3VKHA 5FBWB 4A6PA 4TLDA 3THYA 1W4BA 2Z4RA 3C7KA 2FH5B 3RS0A 2GJKA 4PHHA 5BQ5A 1L8QA 4ILEA 2GILA 4D80A 4EPYA 3U3RA 5KU1A 1P6XA 5GADl 3GLHE 1KHTA 1YU9A 2B7CA 1G41A 2LKDA 2OHFA 3BJIC 3GLIE 4BE7B 5DE3A 5JLJA 1NRJB 4CEHA 1T8TA 4AKEA 4A2WA 3QE0A 3THXB 1Q22A 3MCAA 3P32A 4TSFD 4CEIA 2H18A 3CF6R 1WXQA 4B34A 2IYLD 4LZZA 3U44A 1QHGA 4MGIR 1R4AA 5KSZA 1GL9B 2QZ4A 4ABYA 4HAYA 1J70A 1NLFA 3RC3A 4B2LA 4P4UA 1KSHA 2X1VA 3AKEA 2ZQ5A 4ARZB 2MSCB 3GLFA 4TSFA 4TMWA 1AA9A 1JQJC 5EP4A 1NN1A 2QSZA 4PZYA 4HUTA 4LYJA 2ODBA 4UJ5A 4M9SA 3FHCB 3I8SA 1JEDA 2KSQA 4HLQB 2JLSA 2V7QD 5KTYA 5FBRB 5DIFA 3QVVA 5KYKA 1Z3IX 1RW4A 3OE7A 3TSWA 1XWIA 2A7QA 4OJQA 5FI0B 4OI2A 2IYQA 4DT1A 4TMKA 3UPUA 2GXAA 1IN4A 1LB1B 3GJ6A 4DBLC 4UJ3A 2IYTA 3QKRA 1H65A 3SYKA 4C0HA 3EZ2A 4POAA 2H7VA 4B33A 2WTUA 2IYSA 3CRQA 1KI6B 4G01B 4V0OA 3SOPA 3TMKA 2V6IA 3ZIAD 1Q21A 1Q1EA 3SN6A 4DLWA 5JRZA 1O87A 4LBYA 5DSZA 3R9WA 3CNLA 1Z0JA 5GJWC 3RSOA 4QBFA 2JJ8A 1YRBA 4FWTA 5FH9A 2W58A 4LK2A 2PZFA 2VHTA 1WE2A 1YQTA 2CL6X 1QHIA 5L3SA 2FU5C 2VEDA 4NZYA 2F9MA 1OV4A 3WYGA 1R0XA 1MRNA 1NI3A 2IYYA 1GRRA 2QGZA 4KV9A 4XVRA 4A6XA 4UNRA 1NY6A 1ZM7A 4LJAA 1JR6A 4JLNA 3LVQE 1G9XA 1N2CE 4V0MA 4KLZA 3ASZA 5FL7A 1S9HA 1ZCAA 4PXAA 5CB8A 1YHNA 4X8LA 4DDVA 3ZS9A 4BRUA 5CDFE 1HT1E 2AXPA 4FWIB 1MOZA 4GOKA 4ZDKA 1SXJB 2ZI9A 1A82A 4JMPA 5EZ5A 5TDHA 4GSYA 4ZIRB 5JS8A 4M9XA 1RPZA 2JDID 2P2LA 2BC9A 4BLOA 4A82A 4B48A 5BN4A 1XMJA 5DH9A 4WXRA 5P21A 1B0UA 3U7GA 1E2KA 1LFDB 2CL7X 3FHTA 4DLUA 3D3QA 2PBRA 4O2LA 1X1RA 3RVBA 2BJVA 4GL2A 1ZM2A 5TXGA 5KPJA 4DCVA 1M6NA 1QBKC 3S1AA 4DCNA 2A3RA 4XH9B 1KK1A 3QEJA 3DO6A 4FIDA 3UMSA 3DOFA 2JCSA 3B2EA 1VMAA 4MUAA 4B71A 2JJ1D 3E2IA 3X1XA 1NNEA 2ZRBA 4B35A 3SBDA 4KBFA 2GJ8A 4LJ9A 1OB2A 4LHYA 4IOLA 3W6OA 2ZRAA 4G5QA 1J99A 1KK2A 2B6HA 2QPAA 1KAOA 3GD7A 3GJ7A 4KITB 2C98A 2EVWX 2GHIA 4LWZA 1NG1A 4EJSB 1FMJA 2VP4A 2W83A 2ZJOA 3FMOB 3QG1A 4DUGA 1AGPA 1JECA 4MGYR 4DRZA 3LO5A 5DISB 4LSGA 4LJ8A 1HEIA 1ZYUA 1UEIA 1BIFA 5FTNA 4Q1EA 2ZRPA 2AL7A 1AKYA 1FFHA 1GKUB 4Q7MB 1F6BA 3BD9A 3THWB 4BFVA 1M7BA 1OH5A 5DYIA 2DCUA 1O3YA 3CNNA 1I2DA 4MRNA 5DYGA 4IVRA 4P32A 1XX6A 3X2SA 1NSTA 1Q3HA 3B1YA 2IYWA 2HEIA 3D6TB 2FFQA 3E5HA 2ZYTX 4G5OA 4B2PA 1BH2A 4Q18A 2NOAA 1XJ0A 5TY0A 2JJ2D 2ZRHA 3GLGA 2DWOA 2Z5FA 3W3ZB 1T91A 3BXZA 3W8NA 3K70D 2AX4A 3PV0A 2ZE7A 1YZKA 2ZE8A 1JR3A 2HUPA 1W47A 3SJZA 1Z63A 4NL4H 3T1VA 4MKFA 2VBCA 1FX0A 3JVVA 4MKIA 2CMKA 2FX3A 4X8HA 2FSFA 3THYB 5HKKA 2VH5R 5FPSA 1QDEA 1MR3F 3NC0C 4MYUA 1DAKA 4UNPA 5JHGB 2WVJA 4TMZA 1RJ9A 1SVSA 4Z8YA 1X8LA 1MV5A 1UBGA 2WWWA 2QNRA 2GXQA 3EAQA 5F2EA 1W0KD 3I8XA 5GJCA 4YXWA 5E95A 1E2PA 1OXTA 4RZXA 4JLMA 4MITA 1NMYA 1KO5A 4S35A 4CDGA 4TYNA 3PEVA 1W1WA 4URZR 3GP8A 1YR8A 1UBCA 1ETUA 2BKUA 3LLUA 3UATA 4TYQA 2MSEB 2ZSDA 4JZKA 2PJRA 4CEHB 2W2VA 2WKPA 3I73A 2ZSFA 3GFOA 4NBSA 5HZHA 2CJWA 4JVLA 2QL6A 3QKSA 1RYHA 2YWFA 4CEIB 3AVYA 1W5TA 1II9A 1W0JD 1RRGA 2PCJA 3GJ5A 4QL3A 4HATA 3U44B 1NJFA 3K09C 1G4UR 3NBXX 4B75A 3TNFA 4CVNA 1KDRA 4JBWA 2C9CA 4OL0A 5CITA 3GLFB 3FTQA 4DCSA 4RSGA 4NU0A 1RKBA 2ATXA 2DR3A 2J5XA 4G3XA 3A58B 2F1RA 3TSOA 4ACAA 4BRWA 1KMHA 2Y8EA 2AFHE 5TV2A 3WXMA 3ZDQA 5H70A 3U61B 1PVOA 5F9FA 4Z54A 3VNVA 3L0PA 4QHYA 4OK5A 2GXSA 1G7SA 4JVMA 5FI1B 1KO1A 1UADA 3RWOA 2RGGA 1Y3AA 3CBQA 2GK6A 1FQKA 1EGAA 2J0VA 4DT1B 4LYFA 2ECKA 1JI0A 3SDZA 5FBLB 2NPFA 2ZRJA 3A1UA 1R5NA 1TTTA 4ZKEA 3QKRB 1BO6A 1E1RD 4M22A 1GKYA 2XNDA 1Q3TA 3B60A 1E2HA 3RANA 1A2BA 4A8JB 1A4RA 1SVKA 1IAQA 1GL7A 2DWQA 2GZHA 1I4LD 2HJVA 3LXXA 1CRQA 4PPNA 4TN1A 1TF7A 4V0LA 1E0AA 4IXMA 1R5BA 3PENA 4YLGA 4PC1A 4TLEA 1D8TA 3LBIA 1C9KA 3FPAA 5L3SB 1IY1A 1N25A 3PUZA 3CPEA 2QMHA 4JIMA 2QBYA 3LX5A 2RMKA 3NKVA 2WWFA 3VX3A 4IVQA 3ADKA 3QPUA 4M1TA 2NO0A 2KI5A 1YZUA 3MFYA 4RVCA 3CZPA 4Q48A 1FUKA 1ONBA 4PHTA 3LW8A 4PO1A 3T1OA 4Q7JB 1XZQA 3OAAD 4UXIA 1TUIA 1COWA 1UKYA 4C3ZA 3W3AA 1CR0A 2ZRNA 3CH4B 1G4AE 2AWOA 1XF9A 3OFND 4BECA 4UNQA 1VCNA 1FP7A 3HR8A 4FI3C 3WP1B 2KE5A 3QXJA 2IA5A 4ZPXA 2K5UA 1SVOA 3O8DA 4C7OA 1QHHA 3SHFA 1AZSC 2VPPA 2GCNA 2Z4SA 2Z43A 3B1XA 3W5IA 3AUXA 3RRYA 3VU9A 2GCPA 3QY0A 3EX7C 5LD2C 2PMKA 1M7HA 3EARA 4JL8A 2X2EA 4PANA 1GP2A 4M1MA 3T15A 1FOEB 4MKHA 2BHRA 1W36D 2QG6A 5A5GA 1G3UA 3ASYA 5J47A 4Q19A 1ZNWA 4NKRA 1B23P 2D74A 1M74A 3FHOA 2R6AA 3W6PA 3GLHA 1Q12A 1W2HA 2G77B 1NL3A 3GLIA 3HPRA 5AR1A 1E0JA 1I4DD 4HAWA 4DCUA 2CXXA 2WHXA 4DEYA 4TMTA 4O0MA 4RZ3A 1SGWA 2GF0A 5EE0A 2BMDA 3AVOA 5CYOA 1ZINA 3HYTA 3VR5A 1CJTC 1S3SA 4QJ5A 1QVAA 3WP0A 3KQLA 1G16A 3BFVA 2QMOA 2QORA 3C14C 4JYCA 2OM2A 1Z83A 3EC1A 3QPVA 1XCGB 1AN0A 2IEZA 2RHMA 4UNNA 4W5JA 1E3MA 1HYQA 1OXVA 1MO4A 3A6PC 1IBRA 4WIAA 1EG7A 4V02A 5L8VA 4DKXA 3BC1A 3OF5A 2LCFA 5CIWA 4QJ4A 3WNCA 4D4JA 1L4YA 1S3GA 2G1KA 1IXRC 1MKYA 5CK5A 2F43A 2P5TB 4TL6A 3R7WB 1X86B 2W0SA 2IK8A 2BKEA 5EE5B 2QTHA 2J7PD 3W34A 1GG2A 3ZVNA 3DKPA 3GLGB 4NDZA 1NIJA 2IBMA 2V55B 3DM9B 2QAGC 3K53A 4EAQA 4TL8A 1R10A 3L2OB 5FPTA 2RGCA 3SJBA 2BM1A 2RGAA 3X1YA 1OFUX 1U8AA 2H1LA 1FX0B 1KMQA 2J7PA 1WDTA 3SC3A 5AUOB 2IC5A 3BGWA 4TYYA 4LOAA 1A5TA 1JALA 1DOAA 2HYDA 2XAUA 3HU1A 1RJ9B 4KCGA 4Y0AA 3NH6A 1SQ5A 4W5WA 4A0RA 2VTKA 4KU4A 3BH7A 4BZXA 4B74A 3B82A 3CF2A 2Q0HA 1GSIA 4KO8A 1IY2A 4HB4A 4OK6A 2VP9A 4BLQA 2F1IA 1U0JA 2FMXA 2CJWB 1G8GA 3QKSB 2CNWA 5HTKA 4MYTA 4QNMA 4DLXA 4L4UA 1E69A 4NTZA 2WM9B 2XJ4A 1EFHA 4DDUA 3DMNA 5F3WB 1GAJA 1IM2A 3VNUA 1L7VC 2EFDB 5AJZA 4G5GA 2REXB 1IJEA 2VP2A 2AFIE 1UEJA 2FGKA 2UKDA 4W9MC 3HU2A 1DAGA 2XXAB 2GF9A 1KMHB 1MO3A 1KO8A 4IOMA 4TTPA 1VCMA 3V4FA 4YMVA 1DBSA 5L3RA 5E7MA 3MAAC 4D4KA 4JT4A 3FE2A 2Q3MA 4MYCA 4PTLA 3I3SR 2ODWA 1XPUA 1ZAKA 3DL0A 4URUR 4HB2A 2EYQA 1IOZA 4JVNA 4LYHA 3SYLA 1P3JA 4CYMA 1Y63A 1ZU4A 1WQ1R 3M0EA 2CK3D 2QSYA 4HB0A 2IL1A 5FL3A 3REGA 1AS2A 4BFWA 2QTFA 3X1ZA 2AD1A 4KVGA 4B2IA 3ZYCA 2NMVA 1G291 4QGGA 4QRHA 3KDSE 3UKDA 1XNJA 1GL6A 4R2IA 5J5CA 1E6CA 4A0GA 5IK2D 1ZBDA 4FINA 4US0R 2H5EA 1Z07A 5FBQB 1KKLA 2C03A 2O0JA 3Q9LA 3BRWD 2CK3A 4BLSA 2AKYA 3R8FA 4DCTA 1W7AA 1OH6A 1GDDA 1E9AA 1R8SA 3SU8A 4PAOA 1S96A 3DZ8A 5ELXA 1PLJA 4BLPA 1W49A 2HCJB 2XOKD 2H57A 5IK2A 1IXZA 3ONWA 2QBYB 2AWNA 4R2HA 4TT3A 4DVGA 4LDJA 4MDFA 1KI9A 2ZUDA 1KZ7B 5DGXA 3EZ6A 1JAIA 2LKCA 4K81B 2OBMA 3H1TA 2WKRA 4UNSA 2F6RA 2ODEA 2YV5A 3AV0B 3C15C 3LV8A 1VECA 3AKYA 5KNDA 3ZZ0A 5FOSA 5FPYA 4M1YA 2WKQA 5EXSA 2W2XA 1IN6A 1SZPA 5IRCD 6Q21A 1Q1BA 4KFRA 2ZRLA 1SVIA 2GJ9A 2X2FA 4C7OB 1QHHB 3GQBA 3A1WA 2OUKA 3I72A 3KUCA 1KIMA 3U3MA 1NY5A 2ZR7A 3VU9B 5J4LA 4KYUA 1X3SA 2A2ZA 4CT5A 4B47A 1DPFA 2Z83A 1WCV1 1FZQA 2WWGA 1G7CA 5E7JA 4AIIA 1WB9A 2BDTA 2E1RA 4JLBA 1M7GA 4BFTA 5AUQA 2KBEA 1ELOA 5TARA 4OJKA 4V0KA 1WF3A 2YWGA 4QM7A 2HDNB 4US2R 4WW0A 2ORIA 3GLHB 1CEEA 4HDQB 1KK3A 4OQNA 4Q47A 4W5HA 3SQXA 5AUNB 1ZMXA 5UKDA 3SNHA 4AK9A 3O47A 3GLIB 3VR2A 1GKIA 3AGPA 1SXJC 1JJVA 3QEOA 2QPOA 1QHSA 2H8KA 3PUWA 1G8FA 2B8TA 2CL0X 2W6JD 1XEFA 4QC2A 5FTMA 3Q7QA 1XD2A 4GI7A 2QENA 1N5JA 2YC2C 1R2QA 4IEEA 3K0SA 4D25A 2GVDC 2HT1A 1UJ2A 4E09A 4Q9KA 3EIHA 4DWJA 4TZ0A 1NKTA 1BKDR 2EFCB 4I81A 4IW3B 5DO9A 5LPNA 4EUNA 1R5OA 3B1VA 1ZIOA 1JB1A 4PAQA 2RGNA 3A4NA 3QQ5A 2GBLC 4HDOB 1TPZA 1HQYE 3IILA 2P6UA 2XZLA 2ZS8A 2GKSA 5JRJA 1U0LA 3DOEA 3PXGA 3VHLB 1N6LA 4Q5IA 1Q20A 1H8HD 1N6NA 3GJ8A 4D0NA 1EXMA 2IUTA 5L3VA 2ZPTX 2KJQA 4WAUA 4B3GA 4KSCA 4XOIA 4QHTA 4RFSA 1D2MA 3RC8A 3L43A 2IHBA 1E9RA 3OEED 2GEDA 3QENA 1CF4A 4BASA 3OIVA 5M04A 1XD9A 1MT0A 2ZJYA 1Z0DA 1BS1A 4OQLA 1Z0IA 3LVRE 2X8AA 2O0HA 1Z6AA 3FDIA 1UKZA 3R20A 4U5XA 5EXPA 2ZI3A 4IDHA 3K0EA 3EIEA 3T1TA 1U90A 4WA7A 1Q44A 5EE9A 1TQ6A 3OEEA 1G8PA 1OH8A 5JCZA 4Q4HA 4CEJA 1XBTA 2D06A 1T5IA 4GBMA 1NBMA 1Q57A 2I3BA 3BOSA 2EWVA 2WJIA 1ZW6A 2XSZA 4S2EA 4IVPA 1E2IA 4GMXA 4JLPA 3AP1A 4HLCA 3ZJYA 3MLEA 5E7IA 3WYFA 5FUXA 4UKDA 2ZYUX 3AVQA 1CRPA 2OLJA 4LX0A 1NMZA 1EWRA 1KAGA 1KY3A 4CW7A 1R0ZA 2VHUA 1XPOA 2FN4A 2GJSA 1E9DA 3DMDA 2LWIA 2VO1A 4E5UA 3KKPA 4Q7LA 5KDDA 4N0DA 1LNZA 1RYFA 2I1QA 4E22A 1XXHE 1E79D 5E3HA 2REOA 4OI4A 3BH0A 4HEJA 3UXMA 1ESMA 1G5RA 5BW8A 1G64A 1TUEA 1NKSA 1QHNA 4OBEA 1RFLA 2ZRIA 1P4SA 4DSTA 3B1ZA 3CF0A 1GM5A 1G8YA 1HUQA 2OZEA 2L0XA 3VMFA 3AUYA 2VA8A 4I1UA 2WWYA 3SHWA 1XEWY 5K8UA 3AF1A 3P1JA 2OCAA 4RD4A 2VRWA 2ZXUA 2OCYC 2V7QA 4Q4AA 3GFTA 4Q00A 4DLZA 2R62A 4LHZA 1ZNXA 1TADA 2QAJA 1YVDA 1G3RA 1XZPA 1MO5A 1CKEA 5DI9A 4D0LB 1VTKA 5DNYB 1N6OA 4IDOA 4L5BA 3K0CC 4P4SA 1P2UA 4UXJA 1ZUHA 5SZKB 2J7KA 3MSXA 1P2TA 5CJPA 3C8UA 5TVKA 2IUUA 3FOZA 3NHAA 3KFVA 4URVR 3RYTC 4F4CA 4ZCLA 2JIZD 3AF0A 3LBHA 2HCBA 3KFXA 3ZIAA 5JJKA 1Q1QA 1ZNZA 4FMBB 4XSHA 4F93B 2V54A 3CRW1 2KBFA 3K8YA 1RRFA 3SJAA 4C9BA 5JI2E 2CVFA 3RS5A 3OHMA 4R9UC 2WICA 2ZVQX 4F91B 2BM0A 4AKIA 3W5JA 4A8JC 4P3YA 1LW7A 2OXRA 3QKUA 2D62A 2FEMA 2FE4A 2QMEA 2XTNA 2IS4A 3BB1A 2DWPA 3M6AA 3UMRA 5FTLA 2JLZA 1BMFD 2CEAA 3SJCA 4DLTA 3RS7A 2OAQ1 3K0FA 1N6RA 1SKYE 2O5VA 4QGAA 4NCHA 4Q03A 2BJWA 2ZJ5A 4JLDA 4FCVA 2O8FB 1EFTA 3I5YA 2PZGA 4A2PA 1BMFA 4GOXA 5BXQC 2JDIA 2JLWA 2R6DA 2G3YA 2AN9A 1GITA 4RCYA 5LB4A 3JZMA 3BS4A 3Q5DA 1F2TA 2FZLA 2QQ0A 4QHSA 2W2TA 1TEXA 1VCIA 4PPQA 3KJGA 2QT1A 1JBKA 1E2FA 3T5DA 1HV8A 4DSUA 1CJUC 4LV8B 1QG2A 1ZD9A 1KZGB 1P2SA 4HAUA 2WWXA 3SEAA 2XZOA 3C16C 2OESA 5JECA 2ZIAA 3DDCA 1XD2B 2BMFA 3ETLA 4C4PA 1UM8A 1C4OA 1VCOA 4JSYA 3FMPB 2GXUA 4M1OA 3PR1A 2WMOB 1EFCA 3NWJA 2R65A 2JJ1A 4U7DA 1U8YA 1XDBA 2ONKA 2IF0A 1KYIA 2A5DA 4KLNA 3REFA 3WMEA 1PUIA 1EX7A 3NHBA 2ZJ8A 2RGEA 4JLAA 5BN5A 1TNDA 1ZM3A 4QBHA 2IYXA 2D7CA 3QUSA 1DVRA 3MUFA 4LV5B 1TQDA 3TH5A 2FWRA 3OEHD 3TUZC 1YR9A 2GA8A 2P5SA 2ZANA 3RDPA 4YONB 5FR2A 1ZM9A 2JASA 1OYWA 4IDQA 3KTAA 2C9OA 3QBTA 4RFSB 5A0FA 1UFQA 1VPLA 2YJTD 3AVUA 1FMLA 3QI2A 4HAZA 2W0MA 2G0TA 4KBGA 4US1R 1P9NA 1IONA 2A5FA 2GWHA 2OE2A 2C78A 4M1KA 4OI1A 3CR7A 3DZDA 4MQBA 1Z0FA 1KSFX 3ZVRA 1U81A 3IO3A 2C8VA 1RC8A 2OXCA 3PJRA 4NCIA 2F3RA 1FUUA 1XRJA 2VSOA 4I4LA 2JJ2A 1SVWA 2YOHA 2YOFA 3PEYA 2ATVA 5ANRB 3B9QA 2C95A 4Q4HB 1US8A 4R98A 2AXNA 3P20A 5B2ZA 3MWLA 1KY2A 3PEUA 2SHKA 3UWOA 4CEJB 5HR5A 2REBA 3X1DA 4LHWA 4BEBA 5FPHA 4ZDIA 3RS3A 1U99A 4B3BA 2QRNA 4L16A 4OK3A 4MA4A 1KSGA 4MKGA 3K09A 2CE7A 1YZNA 2CLSA 3NBYC 3BWDD 5IT5A 5C4GB 4X8MA 3HWSA 1W0KA 1G3QA 3MJRA 3VKGA 5DHFA 4KFTA 1W4CA 2WOOA 2UZIR 3K1JA 4NCKA 2OFWA 4EPTA 3U60B 4TWZA 1P2VA 4JLKA 1KI3A 3QF7A 1J90A 1E98A 2J87A 2VSXA 1CXZA 3U7FB 1DG3A 4TQUS 4U00A 4DSNA 1E4YA 1W0JA 2FNAA 3EIQA 5FFMA 5KSPA 3G82C 3QF4A 4D4LA 3C4JA 4M0LA 3ZZTA 2BBTA 3SZRA 1P60A 1HE8B 4CF7A 4CRWB 4FCWA 1KO7A 4GMDA 4D81A 1F3OA 3KB1A 1OIWA 4EPRA 3H86A 2PEZA 3LAWA 4QBGB 2PZEA 2ZJ2A 1DAEA 2R44A 1DAIA 3EASA 4Y0VA 1TAGA 1DO0A 2WWHA 4ESVA 1P5ZB 4Q4AB 3CRVA 2DB3A 2YINC 4URXR 4QGFA 1J8MF 2OO7A 1K8RA 4HYYA 2HXSA 4JBYA 5HZKA 3F5FA 3KQHA 3D8BA 1CBUA 4JL6A 4PC6A 4P4SB 4QKQA 2GCOA 2CVHA 1YZLA 5AWFC 4U02A 3WNDA 2ZROA 2V1UA 2VL7A 3O8RA 2ZRMA 3ZS8A 4F7WA 1UBEA 5FUYA 1E1RA 5J4YA 4RKFA 4WXPA 2CCGA 1ZC3A 3AGQA 1UDXA 3UG6A 1AK2A 1X1SA 3BORA 4YQFA 1SKQA 3KKMA 4WZ6A 3I4LA 2YNMA 2J45A 2ZRFA 2JGNA 3IIMA 5EXTA 3SR0A 3CX6A 1T8UA 3TW8B 1KTVA 2JLVA 4RY2A 2BV3A 2CCJA 4XIGS 4BGDA 2GETA 4B3XA 3PFIA 4J0QA 4LC0A 4K46A 1G17A 2F1JA 1ZJ6A 2GAOA 3R9IA 2AK3A 2I4IA 1WRBA 3IUYA 4BFSA 4PZLA 4D4MA 2IS1A 2DPXA 4NCNA 1R6BX 3WYAA 1WBBA 1P9WA 4M1WA 4TLAA 4URWR 3MMPA 4DB2A 2D3WA 4Q1FA 1XCPA 1T3LA 1DTSA 1OKKD 3FYHA 3K0FB 5CK4A 3UANA 3L8YA 1EFRD 2ZJAA 3G0HA 3OAAA 3QIAA 1DARA 5AJYA 4RZ2A 3RNLA 1JQLB 1KO4A 2FSIA 4D82A 2DFLA 3EA5A 2FOLA 3CX7A 1U9IA 3L0OA 5E4FA 4DIDA 1N0WA 5HCIA 3X1WA 4A36A 3OFNA 1L4UA 3S1AB 1RIFA 3QJYA 2YOGA 1NJGA 3LFUA 1V5WA 1F2TB 1EFRA 3AF3A 1G20E 1K5DA 4IHQA 4LBVA 4ZKDA 5IHPA 2EFEB 5EE3A 5G53C 4A4DA 1J7KA 1D6JA 3AB3A 1DELA 2BMEA 4IFEA 4Z8XA 4XVUA 1T4GA 3B6EA 4RCZA 1A1VA 4FMDF 1ZCBA 2RCNA 3TAUA 1IN7A 2AD5A 2V9PA 2ZSBA 3AVVA 3IPYA 2R6FA 1Z2CA 2IS6A 1BYIA 4BZQA 4C0BA 3WBKA 3J81k 2QM8A 521PA 5CLLA 1OFIA 1TU4A 4GZLA 2HF9A 4Q1AA 1KGDA 2OCBA 4D6PA 4XVQA 1N6KA 1IQPA 1XMSA 5A4JA 5DN6D 4NH0A 1OT3A 3MRSA 2G6BA 3SFVA 3LD9A 3KX2A 4WBSA 1EFUA 4GPTA 2QE7D 5CB6A 3IEUA 2IYUA 5EP2A 1XXHA 2CE2X 3W9YA 3QKTA 4O25A 1FW6A 5BYKA 2ZYVX 3I61A 1EK0A 4PR0A 2P6RA 4GNKA 3TUIC 1G6OA 3EA0A 1T3SA 4PPFA 3WBJA 1E9BA 4PC7A 1SVMA 3GJ3A 4XJXA 4DC9A 2QE7A 1M8PA 1N6IA 5F98A 3Q3JB 4Q21A 2CBZA 2DFNA 2WWIA 4GRAA 4EFNA 1GOTA 4O3MA 4FCTA 2QUZA 1Z2AA 3SFZA 5CIQA 3MWKA 1KJWA 2CLDX 4F38A 2IF2A 3V00A 1ZUNB 4NPHA 2H92A 4NE2A 4QOSA 4C0KA 3C5CA 2P6NA 4AKGA 2WIBA 2J59A 5BYJA 2C9YA 4ZI3A 4LI0A 4B44A 4UXHA 3K70B 2IXFA 4O2RA 5D3MA 1US8B 4PHFA 1GVNB 4OQMA 4URYR 1TQ4A 4R71A 4PQYA 2RGXA 2W00A 2JLXA 5FUVA 2A78A 3CRRA 3ND9A 3CPJB 1UDWA 2NIPA 1S4QA 4QBIA 4WOPA 4ZO4A 5DHAA 2YHSA 3K0AA 3U4QA 5FUWA 3SI7A 2ZJZA 1OXXK 1ZM4A 1XD8A 2YC4C 1LS6A 3C5HA 3TAHA 2OAP1 4PFSA 3VR1A 3NDPA 4M8NE 1XMVA 3U7EB 2QN6A 3ZQ6A 1DEKA 4Q66C 4FMCF 2ZETA 1TU3A 2QPTA 2ZS7A 1DADA 1AIPA 4YDHB 1NVVQ 2ZTSA 5CDFA 4PSVA 1VG0B 3LWNA 1E32A 4XTCS 3TBKA 3A37A 3NIBA 3Q7PA 4PHGA 3G5UA 2XXAA 3CO5A 1N0UA 5JMTA 3QF4B 1XTRA 4RD2A 2XNSA 3UWKA 3RHFA 3MWJA 3U3JA 3EW9A 5LB2A 1OHHD 3PUYA 2EQBA 4N3NA 1G5PA 2BEJA 1E0SA 3BERA 2XX3A 1FP6A 2C96A 4AURA 3EWAA 3KB2A 2OFXA 1NVUQ 2ZUCA 2BWJA 3HPQA 4DLRA 2FG5A 4L9WA 3QNUA 3OIWA 3M1IA 3O8BA
chains in the Genus database with same CATH superfamily
1JTVA 3K2QA 2WV9A 2C7RA 3WLHA 1Z4LA 4PYLA 3S8YA 1L5YA 5KUTA 3A9VA 4PO9A 1YL6A 2G4CA 3E1SA 1XNHA 4FFPA 1P31A 2BR5A 1XP8A 2X5OA 4L6AA 3WNBA 4ZA2A 3TB4A 1C29B 3N8DA 2OSBA 2ZE6A 3M6VA 5GONA 4NOLA 4EY5A 3K2BA 1UCFA 2XLCA 4RMHA 4DJEC 4EI2A 3Q6NA 4BFCA 1AZLA 4JYBA 5HQ3A 3VUEA 4QYTA 2FWJA 3T5BA 4F12A 3L8ZA 2O8FA 1O8BA 2H85A 1OYYA 3AIOA 3EGCA 3GLGE 4WKOA 2P77A 2AYXA 1KI7A 1QYWA 2RHDA 2VWGA 4HNSA 2R1TA 4R6WA 1RMQA 1ZVKA 3BRWA 1VPVA 2A3NA 2OT3B 5KWEA 1KRXA 1C1HA 4JLJA 1M8KA 4FOOA 4RY0A 3N0TA 4WESA 1GUFA 1JQDA 2A5JA 3O75A 4PZPA 2XOKA 2PQ0A 4FGZA 2F8TA 3MGKA 1Y8RB 4RMJA 5K9ZA 4FMDB 4B8YA 2AB0A 1YE8A 1NQTA 1PWYE 2IE0A 4JV5B 3DE5X 4CQNA 4E03A 2GARA 4RK6A 4M9QA 2IXGA 5JSZA 2Q3EA 1AN9A 1CFZA 1PD1A 3AM5A 4C43A 1UBKS 4R1PA 5E6UA 2FSGA 3ROQA 2CFRA 3VM6A 5JSHA 2PSFA 1O5TA 2WYWA 4BAGA 4C4SA 2G8NA 2L18A 2OORA 1PNQA 1Q92A 1X8JA 4DIOA 1FNDA 4I5FA 4PLVA 5DLQC 2WTAA 3NORA 3O26A 4KR0A 3S2FA 3GFFA 2PRYA 2NX2A 2ZBVA 1E1QD 2DQZA 4PSKA 3G8CA 4B43A 2PEYA 4DIUA 3B12A 2EFYA 3EVFA 4QNRA 2NO7A 1SCDA 1M5RA 5DT2A 2Y4NA 3KWLA 3QWHA 1IZ9A 1IB0A 3BWCA 2FP4B 4IDEA 3AJ8A 2P0AA 3U4MA 3OLVA 4S0XA 2X2PA 3OZFA 3LUPA 3DKVA 4BNZA 1N2BA 2JB9A 1DJOA 4HGNA 4OB8A 4NBLA 5ENVA 5GZ1A 5K8LA 2VT2A 1QAMA 4CKCB 4WCFA 1NAHA 2NT3A 4H77A 5I4BA 4I0WB 4FTWA 2XXJA 4M21A 4LYEA 1HE5A 1KDVA 4IEIA 4DUZB 1Q7TA 4XB2A 5BV7A 2BM8A 2IS2A 5BUSA 421PA 4NZZA 3ZKAA 3M4YA 4Y98A 5B4UA 2I29A 5D5PA 1T9HA 2H2AA 3O8NA 4KXFB 4QPPA 4EHAA 1YBHA 3EZLA 3VJRA 3O91A 1E0KA 1FFCA 3QMVA 5P8WA 3F9CA 4B87A 4BLTA 4BQRA 3U5TA 3GA7A 4LC1A 4RMGA 5FEUA 3KXPA 3P2JA 3R74A 3DWEX 2BEVB 1FFBA 2X1HA 721PA 1LI5A 3FKSD 2GI4A 3QX9A 4M9CA 4KR9A 3H8SA 4AF7A 4DMGA 3BK7A 3ECCA 1Z22A 3S0JA 1RLIA 1TQHA 5KBYA 5IFKA 3ZWCA 3IIJA 1ZRMA 1C9YA 1CUIA 3KYDB 4RY9A 2YKGA 1JLHA 4QDOA 4D5EA 4DLYA 3VNBA 1U7ZA 3FKSA 1MX5A 1FQJA 3EY9A 3AZPA 4WGFA 5LBTA 5KX5B 2YWHA 1NBHA 3T12A 4YWHA 5F76A 1SA0A 3VJKA 2X41A 3ZWOA 2X9QA 1IHOA 2YYZA 3AIKA 1JQ3A 4HR7A 4HTAA 4RF3A 5DKFA 3TQCA 1RSZA 3MT8A 4WXYB 3QXCA 2CMDA 4EJSC 3CU5A 3CLSC 5C7LO 3GNSA 3C7CB 3ZD7A 3E1KA 4D6XA 5FWAA 3KBBA 3SZGA 1CE8B 2DXIA 1H8HA 3CEAA 4LRXA 4NG4A 1GZVA 1OROA 3JPWA 3UGQA 3UA3A 2WYVA 4C78A 2EW1A 5B4VA 3WZLA 1S2GA 2XTAA 1TVMA 1SO8A 2R6GA 2B7BA 1TW2A 5EY5B 1A72A 3KQMA 1MH1A 5D3MB 1IRIA 4YRGA 4I4NA 1EVKA 3OFJA 3WHKA 1QGYA 3PC8C 4Z2AA 4YCNA 1AXRA 3BTVA 2PZLA 3KUDA 1EHCA 3R24A 5F35A 4M98A 3G5AA 1RRCA 2O52A 4NP6A 3UIEA 4FHEA 1VJDA 1QVZA 4UEOA 3U4QB 4R9NA 4DXHA 1N5RA 4FE4A 4MHTA 5CAEB 2G8LA 3D6FA 5AM4A 1YIDA 3OICA 4M6WB 4FP9A 1YC5A 4X20A 2FUNB 2OQRA 4UHCA 3DE2X 1NUHA 5EQJB 3MTEA 1GFZA 3I2IA 1Z8DA 4YC7A 3TCXB 2H4JA 3VH1A 4JLWA 3AHFA 1G8AA 3AR7A 5IP5A 4AWAA 5E2IA 3X1JA 4C5AA 8MHTA 1F2UA 4FYMA 4JWKA 3DNMA 4J0GA 2I76A 3GFSA 1IYZA 1NBAA 1YR3A 5KVCA 3I3OA 2VJOA 1XALA 1EBFA 4P54A 1A9ZA 1SD2A 1XNGA 1KRHA 4IOJA 2QB5A 2V1XA 2FWPA 3LBNA 1XV5A 5CB0A 1VP9A 1CRLA 1OVMA 3UJ8A 4FDTA 4TXMA 4GOJA 2O2DA 1V8BA 3A9CA 3BIWA 3G17A 5EKUA 5EJ9A 4OHXA 1KNQA 3NBQA 2CF5A 1K68A 3RRFA 2AR0A 4PQRA 4KV7A 4BNYA 3U19A 4WNYA 2VSQA 3IPAA 3OOSA 3AKDA 3PDHA 1W25A 3MB8A 2TMKA 3FMIA 4XWAA 4FQ7A 4MXDA 3WK9A 1FXSA 3P71T 5FAKA 3J7AC 3OPYI 1QKIA 2R97A 1ECPA 4CI0B 1GFIA 1IPHA 1ZD5A 2GTIA 4WFIA 4Y2PA 5JAHA 2WJVA 1I3OA 1H2RS 3AEXA 1S02A 3LNTA 3NG1A 1OZFA 2KX7A 3EMDA 3K0CA 5AYVA 4H9GA 5KSWB 3Q7TA 5KWSA 5KYYB 1RQRA 3VHQA 1FFDA 3GRFA 1GA1A 2IUEA 1LTQA 5JNSA 3WZ2A 1CHNA 1YGYA 3BGOS 2B0CA 2I7TA 3G88A 4MNTA 4QIHA 3MJEA 3VU8A 4CDMA 1KTIA 4R40A 3T7CA 5G3YA 1WD7A 1TI7A 3P9YA 4M87A 1A7UA 4LGMA 4GAEA 4G5YA 4HO1X 4PNHA 4TXJA 5KDOA 5TR9A 1CU1A 4KQMA 3SF0A 3VPCA 5MGNA 3BCRA 5ALNA 3ONFA 2EIXA 1YMUA 1ABEA 1TYDE 2VCEA 4I5DA 3TLJA 2WVGA 5IABA 4BFUA 1F8XA 1XCMA 2EZTA 1OE0A 2WZBA 3N3AC 4MCIA 3UNXA 4ESHA 3ADBA 3QYAA 2IT1A 1YZGA 4DV3B 2JLBA 2IOFA 3LRPA 2INGX 2DYKA 3TR0A 4A8JA 4Z1OA 4G1UC 3W79A 3BRCA 5HUHA 1DAMA 3AEZA 1AHHA 3QFRA 4KODA 3RABA 1K6MA 2QM7A 2PNJA 3SQDA 3VNRA 1U7PA 1K8QA 2J0UB 4N9WA 4XX0B 4XYEA 2VQSA 1YD7A 3H2GA 4TVKA 1XIVA 4PS0A 5AVJA 4E30A 3RYIA 4QSMA 5KNLA 2R86A 2XECA 5KJ1A 3MD9A 4RFLA 3A6DA 3UMVA 1XZFA 4X8OA 1IM8A 4ENPA 4TKVA 3NKLA 4PSAA 4XLZA 2H54A 2PCLA 4AIRA 4J7UA 4UHKA 3RPEA 3VDRA 2XYQA 1EDZA 2WUDA 3T35A 8ABPA 2Q7DA 4D9FA 1VIYA 4MWCA 4NARA 1L7RA 1V7ZA 3ROXA 1IXYA 2R8RA 2QEQA 3IRUA 1Z7EA 1HL3A 2V0GA 5AOBA 4YT2A 1LBHA 3EDCA 4IICA 1Z2OX 3ORHA 2B0JA 3RIXA 5K3SA 1NJ8A 1PTKA 2GNOA 4YMTA 4KI0A 3NKFA 3PIRA 4LCBA 5EUQB 4RGBA 1U0NA 2AKAB 2I71A 3SQNA 3LCJA 5F1PA 3TPFA 4LY6A 3C6MA 3JYHA 4HUQA 1DAPA 1VLVA 2D4HA 4GU5A 2JGRA 3EOBI 3RCBA 1AK1A 5EXXA 5LMNB 3I9LA 3GN1A 4HP8A 2FFHA 2LIVA 5I7RA 1XTSA 2J6CA 2V5VA 1EWQA 1K9VF 4LPSA 4Y2JA 5D51S 4ZDWA 3SVZA 4CR7A 4FLFA 5EL0A 4CMGA 1P1IA 3MCUA 5H82A 1QZUA 2I8AA 3INYA 2GCIA 4BB6A 2X5XA 1G4HA 1XEXA 3LX4A 2PH1A 3TTSA 2QRVB 3RJMA 2QZZA 3FB4A 4D96A 4DQLA 4DUGD 1T4DA 3LT5A 3OM1A 2CHQA 3ENNA 3JWPA 1RM0A 1TLLA 4DLBA 3PPIA 3KLPX 4A10A 4BKUA 3BL8A 1HKUA 2C9ZA 3DHYA 3GCWA 3OT5A 1NVMB 5LBUA 1ZVVA 3G8BA 2Y0CA 2VIIA 1X92A 2HPHA 2QTBA 4A1OA 5JH7A 2PGLA 2G4LA 2PX3A 4OHWA 4JB3A 3SF8A 1CY1A 4ZCSA 3D8HA 3ICEA 3GGCA 3QVUA 4DCJA 2I55A 1NWCA 1Z34A 2RKWA 3FPEA 3OJLA 3E3MA 4D9JA 1YB7A 1R4NA 3UB3A 3L7OA 4TUYB 1S8OA 1EFKA 1YK1A 3EGXB 3GEIA 4DJFC 2OLKA 3ENZA 4G9GA 5AOAA 3SOZA 1DKRA 1GGKA 1K0FA 2IW3A 3EQ7A 4FFRA 4IIVA 1R8XA 1X7XB 2IPAB 4BO6A 1J5PA 4MA5A 1UBFA 621PA 1FVXA 1PNVA 4KRYA 1RYMA 1SHLA 2X40A 3UJNA 2Q3JA 4AYTA 1ZOPA 1JR3D 4JEHA 3ZGZA 3BMCA 1H1LA 1LC3A 3ZUPA 2O7NA 2DE0X 3AINA 4R1SA 4UD6A 3LPMA 3VR5H 3A6LA 1SXJE 4EB6A 3U7QA 3VHXB 2P0EA 4XJTA 1LZLA 2VP6A 2XGOA 4F4HA 3MGGA 3N53A 2Q7XA 2Q3BA 5AIAA 1NQUA 3V46A 1U0HC 5FBZA 3TSCA 2ORWA 4YXWD 1LPNA 3PQEA 3NW9A 4QFCA 3IBFA 3MFQA 2B4AA 4HDAA 3VKWA 3P9RA 3UGTA 2EWMA 2F3TA 2R85A 5U1PA 4P31A 4OKSA 1BJKA 1SHKA 1XB2A 1G60A 5FEMA 4KXUA 3QA3E 3URMA 3DD5A 4P33A 2WHRA 2GESA 1J7JA 1TUGA 3W2GA 1QFYA 3NV9A 4CODB 2D5LA 4E5NA 4YB8A 1VKOA 2BLLA 2RB5A 3NT2A 2ZYIA 4J0IA 3S7ZA 1ZS9A 1NVAA 3C41J 3LF2A 3PQ6A 4YMIA 3W2FA 5HIKA 4L6IA 1NYTA 1I3MA 5HM8A 2XITA 3CLKA 1E2GA 1G3MA 4FZJA 4NZOA 4IKEA 4O1IA 4AMZA 4ZEVA 1SC6A 3TQOA 4YCSA 3D7MA 1WUYA 3BGVA 2P9HA 4UCFA 4DLAA 5BYAA 1T5LA 3N8HA 1PV4A 4QUJA 2QX4A 2DC1A 4GHWA 2VJBA 3IP7A 3HDVA 4Z7QB 1OTYA 4CGZA 4HDMB 5JAOA 1LDMA 1AKMA 2HWWA 4HVCA 1WNFA 3NTRA 3ADDA 5K45A 5G02A 4G1BA 1DEOA 2GSDA 4FT4A 5D84A 2PVCA 3USES 2OSVA 3U6BA 5FUQA 1TT5A 5FYQA 3O90A 3EFBA 4RF4A 6LDHA 1OJ7A 3LPAA 1HTWA 4B3CA 4YRLA 2JRLA 4GWLA 4PXSA 1V3VA 3PDJA 3TZHA 3OZXA 1XJQA 2ZREA 4RV5A 4KXVA 2VDRB 3DO8A 4F11A 2I33A 5KSOA 2JEOA 2VDWB 1CB7A 1YE3A 5ILQA 3UENA 1VYUA 4YIHA 3HL4A 2VAXA 3G2LA 3OCCA 5LYYA 3E70C 1U1EA 1VOTA 1WPQA 2RJOA 3H16A 2B83A 1TFRA 6AT1A 3AVXA 4REQA 3RB8A 3TI9A 1VHWA 2G88A 2R8OA 4YNBA 4YJGB 3RSHA 3VC3A 4F3KA 2YHBA 1P9OA 3AZQA 4YXFA 1W94A 2JIOA 3H8WA 4CKBB 3BA1A 5J40A 2D1YA 4P4TA 3NO4A 4U2FA 3USZA 2QQEA 2O6LA 3QYPA 4CFZA 3UGKA 3LDUA 3QE9Y 3EG9B 3LKBA 1XWFA 2CZGA 4M8LA 4IJUA 1E7SA 5B7PA 3B5IA 3B78A 4J3FA 1A2KC 1DO2A 2HRCA 4EGFA 5FADA 1YK0A 1Z47A 4KR3A 1D2GA 2B30A 2GYWA 3CZQA 4JN6B 4BQEA 2O4CA 1SXIA 2BZ0A 2DBYA 2QP3A 4Q7KA 4RDXA 2V7UA 1XNRB 5AJVB 3R8CA 2VP0A 1JKJA 3ANMA 3HRIA 4N40A 1NUSA 5JPCA 5TPZD 3LH5A 1U0RA 4K1LA 1XCBA 4KQCA 1J39A 3LY5A 4S2UA 5HW0A 5JC1A 3HUEA 2DHDA 5ALQA 4ZYWA 3ROGA 5C1BA 1C9JA 3DOHA 3W3AD 3K0BA 3Q7IA 1T43A 1ORWA 2W6CX 4LBWA 1UDBA 3HXLA 4PLPA 3ZLJA 3R0ZA 1E94E 3ZJUA 2XXAA 1KPGA 2JAOA 2IZZA 4YMWA 4NFYA 5I7SA 4MRRA 4R9RA 1D1TA 3LTNC 1ESNA 2YNMC 1R0CA 3U62A 4LZOA 4PSCA 2QS9A 1EX6A 3RVOA 1T29A 2VQ6A 2C2YA 3E3OA 2J07A 3ZIUA 3DLBA 4EF5A 2BW0A 3OUZA 1YOBA 1NRWA 4MR9A 2IV3A 5EJEA 3GLFE 1G9TA 1V5GA 1PFGA 2I66A 2UYYA 1X1TA 1Z4IA 2PY6A 5IS2A 3D4PA 5CT4A 3KSRA 3VTKA 2N42A 3U13A 5C35A 4MR7A 2XWJI 3I1FA 3GJYA 1MVOA 2C77A 3VH4A 3JY6A 4OAPA 2G5TA 5KYXA 3VVLA 1AX9A 1BA2A 3DBIA 1U3UA 4JBHA 3D5EA 4CLHA 1E2LA 2A57A 4Q4JA 1C3OB 1II0A 3LWBA 5BT8A 3SLKA 1MABA 2R4TA 4LDRA 3RRMA 1IEWA 2WW8A 1ZY2A 1T6YA 4F3TA 2GBCA 2WI8A 1U9IC 4J6EA 5FR1A 1QQ7A 3IQXA 3RS8A 1UAAA 1N78A 3Q10A 4PAMA 3RKUA 1O57A 1OW3B 3MT9A 3OLCX 4FDVA 4ID9A 1K92A 2HJHA 3BEDA 3LWZA 1UMCA 3HKDA 4Y2GA 3CW2A 1QZXA 3PBKA 1KSJA 2DJ5A 1QP8A 1UMDA 4B9EA 2OZLB 2P91A 4RX1A 1Y4DE 4NYMQ 5JCOC 1OSNA 3BBPA 4Q9JA 1GNVA 4YUVA 2D0PB 5CBPB 1NBIA 1XFAA 3BE8A 3OOYA 2XUFA 2JGFA 3IDSA 4ZT3A 5B2FA 3FVTA 3RRJA 2NVWA 3PDUA 3ZTYA 4E07A 4QXRA 1FVFA 3QW2A 3WGVA 10MHA 3ES9A 3H9CA 4RO0A 2CCKA 1P4HA 1JVSA 5I9MA 2BPOA 3K9BA 5C8XA 5BN3B 1VSVA 3ZEAA 2NUAB 1PGPA 1HTTA 2D5CA 2GEFA 3FFBA 2A30A 2RAFA 5BWMA 2MSWA 4KWTA 3QEMB 1P5JA 4OBBA 2WU4A 3PC3A 3K9HA 5E2BA 4EW3A 4D2IA 4C14A 5HRAA 2NUTA 2BSQA 3LKDA 3EXAA 1T9CA 1UK8A 1HGXA 1P75A 1TMOA 4IG4A 4HB3A 3W4IA 3WBFA 2QX6A 4A6DA 5A7HA 1VHTA 2Q3FA 2UVQA 5KOYA 2HLDD 3D6MA 1YRAA 1NSFA 3L0SA 4V0ME 4GPEA 4Q9LA 3QEBZ 4JNKA 5EMHA 5AHWA 1SC9A 3ZWVA 2BKXA 3F78A 2Y1OA 4WVFA 2V7TA 4BNWA 1IG0A 2CFIA 4PYMA 5EE1A 3SD7A 2ILVA 3WYDA 5L3QB 3LPDA 2AHOA 2BZGA 2BCJQ 1AD2A 5ALPA 1WW3A 5FOVA 3D4LA 2QA5A 3E8MA 2HLDA 4YDRA 5T3YA 1NG9A 4PG8A 3SSAA 3DE1X 3P2IA 2DG2A 3TD2A 3S1SA 4Q02A 3TLKA 4JUDX 4FD3A 1V7QA 5J9FA 2ZSKA 3OF3A 3VQTA 3IOBA 4D41A 5SYMA 5JJLA 1VLQA 3OOHA 3NXSA 4TT8A 4ZJPA 5ALRA 4X85A 1W5SA 2BCGY 4PAGA 5TT0A 3T4UA 4QO7A 3GGOA 5GIOE 2Y4OA 1WABA 4JGGA 5CLHA 2EJWA 4FDLA 4L15A 3DXZA 1NP6A 3H1AA 3NFYA 3UG7A 4F2DA 4LF8B 3NEYA 3HA2A 1MOQA 3TN7A 5F5XA 4AL4A 5LDDC 5HCNA 3RSCA 1I94B 4GPZA 4NE9A 5LWHA 1LY1A 2ICAA 3FWZA 1YQUA 5GV8A 1IBCA 1R9MA 2GJAA 3GPCA 1H69A 5CTAA 4EUSA 1KI2A 2IUSA 121PA 4X90A 5NULA 3ICQB 1WP9A 4S05A 3G5LA 3HXQA 3UVEA 2C5SA 3P5BA 4KQHA 1AQJA 1HA3A 4OB7A 3CS3A 1CIVA 3N8GA 3IP9A 4JEIA 4Z51A 1TJYA 1X7WA 4DXAA 3CT6A 1U1DA 3THRA 3CPSA 2ZWMA 1RS0A 2C07A 2VS1A 4C0AC 1QHXA 1YIOA 2O1XA 4BLVA 3W8RA 4DS3A 5BV2P 3PLRA 4KH0A 2H4HA 3B85A 2EBUA 3RVMA 4C0JA 4HWRA 1G98A 3TGPA 4JEMA 1IK4A 1I7NA 2M1ZA 1A4UA 3HU5A 1EESA 5LZ5A 2EX0A 4MV1A 4EQ6B 2ZVDA 1YVPA 1GYPA 5KWJA 3CM0A 3B1WA 1F60A 1GTG1 1IEVA 2BHTA 3BE5A 1J00A 1IQUA 3BG5A 3RU2A 4CJXA 4N1AA 5HZMA 4MEBA 5J4KA 1O94C 2FPSA 1VBMA 3WLQA 1A8PA 4UUNA 1W5EA 1ZLYA 4Y0NA 5HF5A 4BMXA 1HQDA 2PKQO 2RGBA 2CJFA 5AJWA 1Z5GA 5I4KA 4XARA 4DLVA 3NDBB 5IX8A 3P9PA 2CGEA 1I7LA 4MV3A 4NMWA 2R8BA 1OASA 2VJCA 4ZAWA 3T3PB 1F4LA 4Q39A 5CM8B 1E1NA 1ACMA 1Z7BA 2CWDA 1RD4A 1TCBA 1XFDA 3LY8A 5HOEA 1R0WA 1VG9B 2OLEA 4OUDA 5ERGB 1H2BA 2WAYA 2IX3A 3EZFA 1G18A 1K1EA 3IBSA 3DVSX 1IHUA 4K9NA 4BE4A 5JBQA 2O8CB 1PJ3A 5I9TA 1Y6RA 1E2DA 2GB4A 1IUPA 3EK2A 4JJGA 3FTPA 5I5GA 4HLUA 2VLIA 3QKWA 5IC5A 3TLXA 1T8WA 4TLBA 1XU4A 3TX6A 1C7JA 2M1XA 5KNDD 2PS3A 3KOOA 1P7VA 3MBKA 2WQZA 3HEBA 2GZ3A 2GD2A 4GECA 4Q37A 5LLSA 5ITZB 2H17A 1N5KA 3V8QA 1W4AA 1WMSA 4F4FA 4YCJA 2OC9A 2UZ3A 1DG9A 4GL4A 4NYIQ 2CVZA 2F1HA 2HI0A 2IIPA 1DE0A 3OLWA 2XVXA 4FFMA 1FRZA 2ZGVA 3OSZA 4M9ZA 5H3CA 4PSUA 3CSSA 4HWKA 5CLQA 4Q01A 5LU8A 3PNYA 3LA6A 5E3IA 1K7EB 4Q05A 3MEQA 2YWEA 5L3ZA 3MS7A 1GUZA 4C89A 2IH2A 3KQSA 5HDBB 5ESXA 3QMWA 4RTQA 3VSEA 2VLBA 1NPDA 2PD4A 4F96A 1MGPA 2J0SA 5BV1A 3S2UA 2EYUA 2VAVA 1Q6ZA 2P9YA 1TAUA 4MRVA 5FIUA 3N74A 1SXJA 1EJ6A 1N36B 2KLBA 1NE7A 1F5SA 2EZUA 3MJ4A 4MIKA 4IOKA 3GJZA 1JPNA 1I2BA 1VSUA 3FF4A 5LXTF 1W88A 5D3KA 3WB2A 3GK3A 2I4TA 1SVNA 4L57A 1P4AA 5K0GA 2CHVA 1B0AA 3HXMA 2PUBA 4WY2A 2OAGA 4ZVQA 1GWNA 3VYRB 3AWDA 4A0FA 1B7GO 3FOEC 4ZGGA 3N2IA 1XPRA 4CIDA 5ISMA 2WLSA 3U26A 2WJJA 3R9KA 5EPEA 4WADA 4HBZA 2B34A 2C9MA 4HH0A 4GYYA 4RCVA 4F3CA 4MQLA 2O8DB 1ZONA 3CIOA 4MYDA 4AZ0A 1A9SA 4MPJA 3HCBA 3NPAA 1PR5A 3BB3A 1VB5A 3C24A 1SQ0A 3K4HA 1FTNA 4OYHA 2P67A 3NEJA 1P0MA 1R0YA 4LF6B 1F9AA 3DTTA 4M53A 1R50A 1TYAE 3R6WA 2BF7A 4FKMA 3CEHA 1T5DX 2C61A 4H7KA 1HZZA 3FAZA 4V0RA 2ASEA 1HNNA 4IF4A 5AW8A 3D4IA 4M4SA 4DGSA 3SBEA 1ES9A 2HPAA 3GLSA 2FPIB 2JLAA 3U4DA 5K0CA 3GNTA 1I3NA 4RLSA 2FZWA 1OC4A 4IFIA 1D1SA 1BD3A 4BNJA 4TYWA 5A4AA 1F2DA 3Q72A 3V1MA 2ZB7A 5JCXA 2AEMA 1XMQB 3OT4A 3IO5A 1JAYA 1YSCA 5HF9A 1C3LA 3EA4A 4JQCA 3T7IA 1T0HB 2XKJE 4YT5A 4V1CA 5K01A 5FOXA 1W2WB 3R7LA 1KYWA 4IFBA 2BZSA 4HSGA 5JWOA 4G8CA 2O2XA 4GM4A 4L9SA 3NYRA 4V3CA 1SBNE 3IA7A 1HZJA 3A1FA 2Q3HA 4K28A 2VPWA 3RFUA 5BWCA 5AVQA 4DHEA 1XTIA 3CVWA 4MIOA 4F1KA 1OFGA 4L0QA 1L5QA 5I7OA 1NLZA 4L6CA 3I9NA 4AUKA 3ICWA 5FPKA 3I42A 3W90A 5EKXA 3HYRA 3FHJA 1JGTA 4X97A 1FS4A 4YDSA 1WPRA 2HRBA 3ZV6A 5ALIA 1EDBA 3FHLA 4RGVA 5TQJA 1HDCA 2YZ2A 1UWVA 1JAZA 1QRDA 1BU5A 5FPQA 4DR2B 4DARA 2MWMA 5TQ2A 3KQKA 3GP5A 5LMZA 2C4UA 2BFCB 3JALA 4AO6A 1LWOA 3WGUA 1JNYA 2RAPA 4B3RB 4XWKA 3BZUA 1MLDA 2NVUB 3VKHA 4GZ5A 4I4IA 4TLDA 4NCBA 3C7KA 4F8JA 3WJAA 1SUDA 1LTHR 2A9OA 3LBFA 3BHIA 3OT1B 4WN3A 4D80A 1JZSA 3ACCA 3OKFA 3U3RA 1KDYA 4ND7A 5KU1A 1V6CA 4WLOA 1KYZA 1YU9A 3MCVA 1G41A 2HRQA 3P7MA 2LKDA 4G89A 3AUFA 2O8CA 2ZIZA 4BE7B 5JLJA 3EB9A 1P1BA 1KU6A 1NRJB 2O2HA 3TLGA 5CDYA 4DWVA 4XIIA 5HQTA 3AI7A 5JDCA 2KMLA 2Z6AA 4A2WA 4D8TA 1J22A 5FWYA 3THXB 2XOEA 1XHFA 3MCAA 3JQDA 2ZWPA 4CEIA 5DULA 4B34A 1PEKE 2MOKA 1R4AA 1YBFA 2AG8A 4LQDA 4LEIA 2C4TA 1J70A 2DQ4A 1KSHA 4IQ4A 5CH5A 2X1VA 5M34A 1I4EB 1TJ4A 4MS1B 3SE7A 3H4VA 2Z8YM 5FUBA 2W6PA 4ARZB 3GLFA 1AA9A 2CSXA 5JTUA 2QSZA 4YIKA 2FZVA 5FNVF 3FTNA 4M9SA 3FHCB 1Y1PA 3I8SA 3RFCA 4D9IA 1NLUA 4HLQB 5KTYA 3KSUA 5FBRB 5DIFA 5CPFA 2WB2A 2D6FA 3DAGA 4IVNA 3C3AA 1IBSA 2G40A 2PIAA 4OJQA 2Z2ZA 5AQEA 2GZ1A 2IYQA 3K0HA 4KUEA 1QJCA 2GD1O 4IDDA 4DT1A 1DDOA 4R4JA 2XMQA 3ON5A 4TMKA 2PXCA 3LI2A 1LB1B 4HEA1 2H9YA 4GEGA 4RKWA 3U9SA 3RADC 4YI3A 2FFJA 3NS7A 3QKRA 1H65A 4F9TA 4FYJA 2GEKA 5CXSA 1TM2A 4IHJF 3LLCA 2NXJA 3D7KA 1R64A 4X61A 3FBGA 3RODA 3PX2A 3SN6A 2EATA 2ZFUA 3TNYA 3F46A 2QHXA 4GG1A 4QUAA 3R9WA 4AN1A 4JC4A 3DAYA 3IAEA 3D3WA 3RSOA 5JMPA 5KTKA 1YRBA 1DJLA 1KETA 4ZOLB 1N8KA 3VDNB 2YYAA 1U6JA 1N2GA 5EVJA 4TXHA 2W58A 4IGIA 1VL0A 2HNAA 1QHIA 4M9RA 4E6EA 4E32A 4ZZ1A 2F9MA 2VDLB 3WYGA 3B5EA 2G1PA 1HDYA 4UBIA 1BTOA 1GRRA 4XVRA 3D6UA 1RVV1 3E5NA 5J59A 4UNRA 3NC4A 1RXSA 1JR6A 1L5VA 2GK4A 2O57A 4V0MA 5ERYA 4ZJYA 5FL7A 1FYEA 1S9HA 3ND5A 1YHNA 2QRKA 2GNPA 2QT9A 3M6FA 3ZS9A 4NNOA 2AXPA 3LQ1A 4E5DA 1MOZA 1PZHA 1ICEA 2D2IA 5TDHA 3QK7A 2AS0A 2ZT5A 4XYMA 1RPZA 2WFLA 3ZDBA 2BC9A 4L8LA 4ZV9A 4P7BA 3RVDA 5SYAA 1YJBA 4A82A 2AYYA 5DH9A 1GPUA 1KERA 2FW7A 2UZ1B 1B0UA 4O2BA 4WXRA 2XBMA 1L7DA 3FGPA 1U6KA 4IKOA 1AY0A 1INLA 1T1JA 6PFKA 4NCAA 4EL0A 4C7MA 4PTYA 2AOXA 4G6ZA 2BJVA 3LMKA 2QW8A 4YAFA 4DCVA 1QBKC 1TM7E 2WAAA 3EQ6A 2XUKA 3AEKA 3B3JA 2ZIFA 3KAJA 3QEJA 1FNSA 4ZQBA 3HNRA 3DO6A 3GD5A 4GRIA 1AXEA 5K20A 3UMSA 2C20A 2CNBA 3BKWA 3DOFA 2NUPA 1ZHHA 4YFVA 5LQNA 1NNEA 3E2IA 1BXKA 5ICFA 3X1XA 5B2EA 1U4SA 2I7XA 3CR3C 4GQBA 3WO0A 4J16A 4CG1A 3R9IA 3W5AA 1MTOA 5BOSB 4BN4A 1YTLA 2VUTA 2ZRAA 3PD0A 5EFZA 3WSTA 2B6HA 3TWOA 3BTOA 3I83A 5IUNC 3KPYA 1E8MA 2C83A 4LWZA 2VK8A 1LX6A 3OC6A 4FUQA 5U4QA 3V3KA 5IN4A 2M9MA 1L4MA 2W83A 4EA8A 5K2OA 4B4UA 3ZJVA 2JD2A 1AGPA 4MGYR 4GUAA 3VI3B 3W1VA 4EYQA 3NHWA 4F3NA 1RWMA 4LSGA 1DB3A 1G2OA 1BSVA 3BQMB 1NU8A 4PX2A 3G2PA 3NHLA 2G9RA 2IYPA 2W5UA 1RRVA 2Y99A 4RS4A 3BXXA 3GF4A 2PYZA 1LW6E 3OA2A 4NVRA 3QITA 4NQRA 4Q7MB 4TYMA 5F21A 3THWB 1XN1A 2FB9A 1CUXA 2X7JA 2V4UA 3AEUA 5CR9A 5DYIA 2DCUA 1NC3A 1Y37A 1FP1D 3LA8A 4J1TA 3ESZA 3T5CA 4EABA 3GI1A 3IVGA 1C8KA 5DYGA 4EGSA 4CBVA 2C2WA 3IUSA 2Q6VA 3CLTC 5C52B 1Q3HA 5IVKA 5AICA 3VNSA 4Y1RA 2GPWA 2F3SA 4AXXA 4EA9A 4G5OA 4Q18A 3L5OA 5TY0A 5E4TA 4WNCA 4O1MA 2Z5FA 1JB9A 3W3ZB 5MN4A 1T91A 2C00A 4YRIA 1FA9A 2ZE7A 5IZ4A 1OZ0A 2XUHA 1M34B 3K71B 1KH2A 1ZVJA 3GJTA 1Y4AE 3D4OA 4O4IF 2YN2A 1Z7YA 3I58A 2I6GA 2IDMA 1K6EA 4TXLA 4DV2B 1Z9BA 3VRHA 3JVVA 4ME6A 4H0FA 5IULC 4M36A 1JX6A 2Z1MA 4I5EA 5HKKA 4DSAA 2A0XA 1MR3F 2WE7A 2J4CA 3O73A 1CY2A 2X4DA 3NC0C 4UNPA 1NU6A 2WVJA 3JYPA 1M6EX 1MV5A 2L69A 2LCIA 3RFTA 3U61B 2R5WA 3EAQA 2Z57A 1BN7A 1W0KD 3LC0A 4WZBB 5F2EA 3E4CA 5GJCA 1E2PA 1L5GB 4S35A 3B9BA 4JLMA 1JFLA 1NMYA 3Q5GA 3RSFA 4TYNA 4MUJA 5TEWA 4CL2A 3TEMA 1UBCA 2VATA 3B70A 3KAPA 4YREA 1G0OA 2AUTA 1A50B 2ZSFA 4NBSA 1T1IA 2B4QA 1GY8A 4LYYA 4JVLA 4AJKA 5HZHA 3LQYA 2YWFA 5C53B 1W0JD 2PCJA 1Z13A 3FUTA 1Y98A 4IHJB 3LTEA 1XT6A 2PFKA 3HO6A 4FB5A 3K09C 2UUBB 1CQIB 2ODQA 4MW9A 1UZMA 1KDRA 4XR9A 4LDAA 5K8JB 1SD1A 4B79A 3Q9NA 1SOVA 1AUQA 3ZQUA 3RTEA 4NU0A 3IURA 1RKBA 2DR3A 4RULA 3TSOA 1JU4A 2VZ8A 2Y8EA 3IR7A 5TV2A 1PVOA 2VWQA 2VJKA 2ZUFA 3A0RB 4NV0A 3L49A 3TPZA 5A4IS 4QHYA 2PZJA 1W35A 4OK5A 2GXSA 3TEJA 2FEAA 5I5EA 4R05A 1DIAA 1KBOA 1KC1A 4PIMA 2RGGA 3WLOA 1R0LA 4P3KA 3RHTA 3HBFA 2J0VA 2LVBA 3TLYA 3KOYA 2ECKA 1W5FA 2J3MA 2X6RA 5FBLB 2NPFA 5THKA 1A8UA 4B84A 5IXSA 2PH7A 2ZRJA 4CFYA 3A1UA 4BBPA 4R2WA 3F5DA 4CTOA 1YDGA 2WPNA 3L4BA 1MV8A 4R0NA 3KSAC 4M22A 4XYLA 3WWEA 1J9EA 4AF8A 1L8OA 1A4RA 1G1AA 5TPWB 1SVKA 3GCZA 5ESRA 1JHZA 1I4LD 1QHEA 2PUTA 3LL4A 2AMLA 3S2YA 1Z0ZA 4JI0B 3OTOB 4UNIA 4L02A 2B8EA 3STTA 1I30A 5ENDA 1U3DA 1WVIA 4KKXB 2E5FA 2OBFA 2Q2QA 2O7VA 1JSLA 3OI7A 4UBLA 5KREA 3O1IC 1WKVA 2X8BA 3NBAA 1MF7A 4YMGA 1F51E 5IU6A 1IY1A 5L3SB 3O1LA 4W99A 2BGWA 3R3ZA 5AI5A 4YV1A 5HS6A 1MW9X 3FUXA 4LZNA 1CWUA 1YZUA 3I9OA 4I5GA 4KIGA 3T7SA 4B6RA 4RVCA 3CZPA 1AQNA 4Q48A 1ONBA 3KQYA 4PO1A 2PGXA 3H3XA 4NJOA 4Q7JB 3DB2A 2GYYA 3OAAD 4UXIA 2YJGA 4G63A 1H42A 4N3GA 1TUIA 3GARA 3ZY6A 1Z26A 1Y8AA 5CH8A 3GC6A 1KQOA 1PQUA 2WJ3A 2WKWA 3KYJB 1CR0A 1QV7A 2I67A 4ZU3A 4F85A 1DQNA 3OFND 2QE6A 1VCNA 3GLQA 3ITNA 5JD4A 3QMPA 5F64A 4X44A 1UXHA 2R96A 3QXJA 1AUPA 3B2QA 5BN4B 5A9SA 5ESWA 4LECA 4RENA 1IDN1 4ZPXA 2L2QA 3GFBA 4FUTA 3TQQA 5CB4F 5DTRA 5IH7A 2ZM6B 3VO8A 1GFWA 1RWOA 3PGMA 4QUHA 3I0ZA 3OU2A 1BWPA 4JFAA 1IBKB 2Z4SA 1BVUA 2Z43A 3B1XA 1H3EA 3W5IA 1HX7A 5HJ5A 3EX7C 1PJ4A 2HNKA 1M7HA 4KTTE 1U4NA 4PX5A 5K0LA 2GPAA 3UHFA 3RJTA 5TLSA 1GLGA 4DNPA 1U0TA 1V5EA 1YHYA 5E9JA 4L0MA 3VISA 1QZTA 3PNOA 3QVGA 1QOQB 2RONA 3CF4A 1ZNWA 4BVEA 1L5RA 1FDSA 3GEPA 2D74A 3AKZA 4UAVA 3ABIA 4XM0A 1NNSA 3FJ1A 1Z5WA 4G23A 3W6PA 2DF8A 3KBOA 4LG1A 1K5PA 1NL3A 4L0CA 2GD6A 1Q15A 2PA0A 1OFVA 4HAWA 4DYHA 3WP0A 2QRHA 3EHDA 3F98A 1A4XA 1E6KA 3KIPA 4K9MA 1BMDA 4TMTA 3OZIA 2DM6A 4XCVA