5JYCA

Crystal structure of the e153q mutant of the cftr inhibitory factor cif containing the adducted 14,15-eet hydrolysis intermediate
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
297
structure length
297
Chain Sequence
AEEFPVPNGFESAYREVDGVKLHYVKGGQGPLVMLVHGFGQTWYEWHQLMPELAKRFTVIAPDLPGLGQSEPPKTGYSGEQVAVYLHKLARQFSPDRPFDLVAHDIGIWNTYPMVVKNQADIARLVYMQAPIPDARIYRFPAFTAQGESLVWHFSFFAADDRLAETLIAGKERFFLEHFIKSHASNTEVFSERLLDLYARSYAKPHSLNASFEYYRALNESVRQNAELAKTRLQMPTMTLAGGGHGGMGTFQLEQMKAYAEDVEGHVLPGCGHWLPEECAAPMNRLVIDFLSRGRHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pseudomonas aeruginosa sabotages the generation of host proresolving lipid mediators.
pubmed doi rcsb
source organism Pseudomonas aeruginosa (strain ucbpp-pa14)
molecule tags Hydrolase
molecule keywords CFTR inhibitory factor
total genus 109
structure length 297
sequence length 297
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5jycA01
3G9UA 3IULA 3WL8A 1CUWA 1Y37A 3FOBA 3QITA 1GQSA 1XZKA 2WIDA 4UHDA 4AO7A 3MGAA 1YA8A 2BJHA 1CUXA 3WJ1A 1QOZA 2DHDA 1MN6A 4X00A 4TPKA 2AXEA 1XRMA 4HXGA 5JARA 5EHNA 4B9EA 3W9BA 5CRIA 3FLAA 4CG1A 1MU0A 4Y2JA 1D07A 1BEEA 2XMBA 3JYHA 4H7IA 4K6HA 3PF8A 1XLUA 5K3FA 2D0DA 3WMRA 1ODTC 1G4HA 3HI4A 3BE8A 4Q3LA 3U0VA 2GBFA 2DSNA 2H7YA 4FMPA 2PSEA 3EQ7A 2Y2VA 3FSGD 1GPNA 2Z8XA 3G0IA 2XMDA 4BE9A 4UBMA 3GFFA 5J3JA 3LP5A 3QVMA 3I6MA 4ZI5A 1E66A 2W22A 4G9EA 5BWCA 1JKMA 2XQGA 1NU8A 1EK1A 4G4JA 3BIWA 2XLBA 5JAUA 3H2IA 5HF6A 2VT7A 4H7DA 2ZJFA 3H17A 3WLAA 1EI9A 3WA6A 3G0GA 4FNGA 5ALGA 4C87A 2DQYA 3AILA 4Y9SA 1XZIA 2K2QB 4AO6A 5KREA 1IMJA 4AZ0A 4AO8A 4X94A 1QIIA 4BVJA 2RHWA 1P0PA 2WHPB 2CUTA 2OPHA 1CEXA 2WILA 3M83A 4OB8A 2YXPX 3H2HA 2BGRA 2VTVA 1XZLA 2VSQA 5AOCA 2V98A 3M81A 1MAAA 3H2GA 1Q83A 2GYUA 5DJ5A 4U2FA 5LZ5A 1X70A 1QZ3A 1IUNA 4G4GA 1CUZA 3AIKA 4CI9A 3FCYA 2CZQA 3F9CA 5IVIA 1LPBB 4BAGA 2WTNA 2J4CA 1BRTA 1CR6A 4FTWA 2I3DA 4P9NA 1ZI8A 1LPMA 5ALWA 3C5VA 4B83A 4X6XA 4Y2PA 4QDUA 5ALIA 2HA2A 1R9MA 5DNUA 4IH1A 3EBLA 1C7IA 3STVA 5K3EA 1LBSA 4EY8A 2OCKA 1XZBA 2PSFA 1YCDA 2VAXA 2Z3WA 3FBWA 4DNQA 2ZYHA 4WFIA 4GLBA 1X2EA 3CCCA 3O95A 4WFJA 2DQZA 5CT9A 1AKNA 3PUHA 4WFKA 5CMLA 2PSHA 3A2MA 3DEAA 2V96A 3AUKA 4EY6A 2ZSHA 2QXTA 3FYUC 2C0QA 3DCNA 3IUMA 3KWFA 4X90A 4DMKA 4Y2RA 2PX6A 5SYNA 3Q0TA 4ZV9A 2WG1A 3FYUA 3SC2A 3E3AA 1LBTA 1CUFA 4I4CA 3ESCA 3IUNA 3DKRA 4WDQA 5JZBA 2VJDA 5AKLA 5AH0A 4KE6A 1XZAA 3QH4A 2JGLA 3PI6A 2IIVA 5CXUA 5DLPA 3X3HA 3WL5A 4RNCA 1ISPA 1CRLA 4H18A 5HQ3B 5JAOA 2C4HA 5LLSA 1BCRA 3ZLVA 5ALLA 4QDZA 5AKXA 4HS9A 4PNZA 3R41A 5JANA 4MEBA 1XRQA 3A2LA 2H7XA 3WI7A 3V1NA 4EY7A 3LIPA 5ALUA 4X85A 4N8EA 1GT6A 2OCIA 4L9AA 1WB4A 1N5MA 1CUEA 1Y7IA 3R3UA 5T4EA 4KE9A 1BCSA 1J2EA 1QIGA 1TRHA 2XUPA 1W76A 1VE6A 3HRHA 5HF5A 1CUGA 1UOOA 3GROA 5CTAA 3GA7A 2RGUA 4UFOA 3U1TA 4G4IA 3HEAA 3F98A 6YASA 1LPNA 4BCCA 3LLCA 5AI5A 1LZLA 1EH5A 1W6RA 3OM8A 1LLFA 2O2IA 3DOHA 4KE7A 1U4NA 3WL6A 1GXSA 1XLVA 2G5PA 2BUCA 2XQJA 1A7UA 1MPXA 3LS2A 2V97A 1ACJA 1U2EA 1BEZA 4EY5A 5HKAA 1DT3A 4UBKA 5EGNA 1AUOA 5IKXA 4LYEA 4WY8A 1O6FA 2I78A 1VXOA 1R9NA 5SYMA 4WDRA 3FYUB 2GZRA 5DTJA 4UFPA 2CKMA 2D5LA 4KAAA 5JATA 3DYVA 4F5ZA 5A62A 1DQZA 3AZPA 2Y1KA 4ITVA 1XRPA 5CT4A 3W06A 1TQHA 4UBOA 1H2WA 4J3JA 5JZ9A 1ETHA 2OGSA 2VQ6A 2Y6UA 1ZD3A 4L0CA 4BB0A 1G66A 1S8OA 4BBZA 3CXUA 3H2JA 3WL7A 4BDTA 1CUCA 2FJ0A 4X92A 5ALMA 2QM0A 5JD5A 1MX9A 2PPLA 4X71A 1GQRA 1TAHA 1AGYA 1TIBA 4ARBA 4B84A 4CFSA 3RM3A 2B4KA 4H0CA 1CFJA 4RPCA 3QBJA 1VA4A 2OQIA 4UHEA 3H2KA 4ROTA 4V2IA 1CUHA 3D3NA 4EA6A 3O4HA 4FKBA 3C87A 3R3YA 4OB7A 2WJ6A 2PL5A 4ZGBA 3F96A 4ZRDA 5AK6A 3IA2A 4UUQA 5AKEA 4JYMA 1Y7HA 2OCLA 4MYSA 2HU5A 1UK6A 3I2JA 3GUUA 1IZ7A 4BTLA 5YASA 5EFZA 1ZD5A 4IO0A 2QRUA 4DMHA 3ICWA 1WM1A 3DYIA 4CIBA 3C6XA 1TKRA 1QO7A 4GECA 2QOEA 3E1GA 3QMVA 2C58A 1MT3A 5ALNA 2XMCA 1AC5A 4GI1A 3UUFA 2OLEA 1UK8A 3EF3A 3BIXA 3DD5A 4C4XA 4J0IA 2V9ZA 3PUIA 3V9AA 1BN6A 2H1IA 4LXGA 2HA0A 5ALEA 1P0IA 5ALZA 1AMNA 4CCYA 5E4YA 4ZV7A 3KXPA 3HC7A 1BS9A 2H7CA 1XKLA 1UT6A 5HCUA 5C8ZA 2HA3A 4N8DA 1WB6A 3F67A 4W63A 3R3ZA 4S0XA 4OD0A 4QWMA 3FNBA 1LNSA 4NMWA 4EHBA 5HKBA 2E3JA 5AO9A 3G0BA 3A6ZA 4EUSA 4H7EA 2XMGA 2HHAA 4DSZA 4B9AA 4LIPD 1LPAB 3D7RA 2UZ0A 5CXXA 3WKDA 5JADA 3AIOA 5A7GA 3B5EA 3T4UA 4QWWA 1CUSA 2NW6A 1ZGBA 1PV1A 2AJLI 2QKYA 3OOSA 1A8QA 4Y2VA 1H22A 1OILA 2J3QA 3TEJA 3L1HA 1F6WA 1EK2A 3UUEA 2RI6A 2QZPA 2EEPA 1GPKA 4I19A 3WIOA 1JU4A 3ZV7A 2VF2A 5C7YA 3K6KA 1UXOA 2IX9A 4G8DA 3ZWQA 1EHYA 1P0MA 4WY5A 1R88A 2BGNA 2HA6A 1EVQA 2BUBA 2XE4A 3BWXA 1L7RA 1G5FA 3GBSA 4P92A 5KWJA 1GGVA 3R40A 3I28A 4Q1VA 1UKBA 3WK7A 1ACLA 3MUOA 3FVTA 2EDCA 3STTA 3DOIA 4HXEB 4TVKA 4J0GA 1UWCA 2ZYSA 2Q0XA 3RLIA 4KR0A 1XRRA 2WHRA 5EIHA 4ZREA 1EXWA 4UBIA 2PU5A 4HZGA 3DLTA 5D7BA 4KAFA 4FHZA 3R3XA 1QTIA 1XFDA 2BCEA 4GXNA 3WWEA 3FCXA 1ZICA 2B9VA 4JNCA 2QT9A 3AZOA 1CUDA 1XZEA 4MQLA 1A8UA 4YK7A 4KE8A 4AX4A 5JZSA 2HU7A 3QPDA 4TGLA 4EZIA 2CBGA 3ZI7A 4GBGA 4J0HA 2ZJ6A 1YAHA 2WHQA 5ALRA 1H2XA 2YH2A 4O08A 4QEKA 4LKOA 5DWDA 1JJBA 3PDCA 2ROQA 3I6ZA 1F0NA 4U2BA 5C81A 1JJIA 3BDVA 2ONCA 4M0EA 2DHEA 4CIAA 1QFSA 1EDBA 1QIEA 3G7NA 4D9JA 3WYNA 3ED1A 4X3CA 1Q0ZA 1WCYA 3I2GA 1R3DA 4Z49A 5IVDA 2WUGA 4F0JA 2VA9A 2VT6A 1N1MA 1OCEA 1XZMA 4QDOA 2JGEA 1J1IA 1I6WA 3WKBA 4YPVA 4QDTA 1HBJA 5CT6A 2OGTA 3WWDA 3FAKA 2CMFA 4OPMA 1N8SA 5JASA 5JD6A 4AB1A 1ZIYA 1Q0RA 1FFCA 2RHTA 2ZYRA 3GZJA 4MQMA 4U2DA 4F60A 1QTRA 1CV2A 4JYPA 5JIBA 1UKAA 4AXBA 2PBLA 1B6GA 3L1JA 4BZZA 3IURA 1O6GA 1W1IA 1E89A 1X2BA 5ALOA 5K3AA 3I2FA 2HA7A 2EDAA 3D4LA 4M0MA 4DMCA 1QIFA 3DKKA 2O7RA 4IHAA 1L7QA 1FFBA 4GW3A 1XZDA 1GKLA 5AM5A 1W75A 3B12A 5JAHA 3F8SA 4C4YA 3V1MA 3EQ9A 1JI3A 2X5XA 4F21A 5D6OA 4BRZA 3DQZA 4M0FA 3WKAA 2Z3ZA 3C70A 3QYJA 4FLMA 5I8PA 5DTIA 3ESDA 3QMMA 3G9XA 5AICA 2C0PA 4L3WA 2CB9A 1ZD2P 2XUGA 3QPAA 3E0XA 2GBGA 3STYA 3V48A 4BC1A 4OB6A 3O4GA 1JMKC 1VJ5A 4UBLA 1MNAA 3RK4A 5EHZA 1CPYA 1SOMA 1CQZA 5ALDA 4ARAA 3I2KA 2QR5A 4BCDA 5EHXA 5ALQA 2ZJ7A 2DHCA 1ZI9A 4QNNA 1K4YA 1SC9A 3PF9A 3PE6A 4IQ4A 4K6KA 3D2CA 2XI4A 3WK8A 5AKHA 4X7BA 1VE7A 1UOPA 5JAPA 4X95A 1FFEA 4ETWA 4C89A 3H0CA 4J0DA 1LPOA 1QIDA 1U8EA 5CT5A 1DU4A 1G42A 4Y2YA 1YS2X 3HLKA 1E8DA 3ILSA 1SCKA 1W4LA 3G9TA 1XRLA 4OUKX 4WJLA 4MXDA 4QLOA 2WU4A 1CUVA 5IVKA 4Y2XA 4G8CA 4BAZA 1VLQA 1DTEA 1MX1A 4K2AA 5BOVA 4UPDA 5AHXA 3M82A 3OPMA 3IB3A 4YX9A 3GELA 4PO3X 2Y2UA 1QJ4A 2GYVA 1QLWA 1HQDA 5EI5A 2HFKA 5LKRA 2HL6A 3DDUA 3WJ2A 3H19A 3NGMA 4BVLA 5C8VA 5LZ4A 1BROA 2JGMA 2HDWA 1IVYA 3P2MA 4DGQA 1Z68A 5FKJA 1SFRA 2PUHA 2VEOA 5ISMA 5JD4A 5ALVA 4N5IX 4E11A 1CQWA 4DTCA 1ZJ5A 4H7HA 1P0QA 2PSJA 1VZ2A 4HVTA 4AN0A 2X76A 4MWSA 4BRSA 1ZGCA 4OCZA 3W2TA 3S8YA 1J07A 1QIJA 3L1IA 5AK4A 1GPLA 3DL7A 1L7AA 2XUDA 3R0VA 3I1YA 1BU8A 4WCVA 5AKZA 3STUA 5AM0A 3DL4A 4N5HX 3FVRA 3FSGA 2WJ4A 5AM2A 1YB7A 5ALKA 2WFZA 3PICA 5ALJA 1VOTA 4ZWNA 1XQYA 3IIIA 4C01A 1C7JA 1WHSA 1XRNA 3M3DA 4KAJA 1FJ2A 4EY4A 2C5FA 3VJKA 1AURA 2B20A 5ALXA 1NU6A 5HK9A 5HK8A 2XQIA 1YAJA 3K9BA 3FLEA 1TCCA 2ACEA 3O4IA 4HRYA 5AKIA 1WHTA 5ALFA 1TCBA 1TK3A 1IUPA 1QONA 2WUFA 1DWQA 1YR2A 4X6YA 3G02A 3W05A 2C5GA 4N8SA 1M33A 3UMJA 5CH5A 4GWLA 2R11A 2OAGA 4AMZA 1GZ7A 1QIMA 5FLKA 4MJ3A 5CBKA 5DYWA 1YASA 4H7JA 5EIEA 4AQDA 2AJ8A 2JIDA 2Z5GA 3A2NA 4KJXA 4IH4A 2QVBA 4DIUA 4K5QA 3O9MA 4INZA 5AOBA 2WKWA 3SX4A 3ZLUA 1WPXA 1DWOA 2PM8A 5DNVA 5BWBA 2JGKA 2ORYA 2ACKA 2VJCA 5I9IA 1F8UA 3E4DA 1TCAA 3ICVA 3JW8A 5AK5A 4UHHA 3OTQA 4HXFB 1QIHA 5A7HA 4B81A 1THGA 2G4LA 2WM2A 3FWHA 1E5TA 1DQYA 1XZCA 4E15A 4B6GA 3BF7A 3R3WA 2B61A 4AZ3A 5DNWA 4Q3OA 2CJPA 2Y6VA 4A16A 1VKHA 3VXKA 5K3BA 2HM7A 4BP8A 7YASA 2BAGA 5LZ8A 4DNOA 5LZ9A 1OXMA 5A71A 4L72A 3O4JA 4Y7DA 5ESRA 1CUAA 2XUOA 3O9VA 3H1AA 4J7AA 1HL7A 4HRXA 4KYVA 4Q82A 4W1QA 3WZMA 5KBYA 4BCBA 4B85A 5E4JA 1J06A 1ORWA 3D2BA 3I1IA 4B82A 3H18A 2QMQA 1CVLA 1K5PA 2WLSA 2P8SA 3N2ZB 4BYMA 2G63A 1H23A 5LP1A 5FDFA 3K2IA 4CG2A 2YYSA 4DSAA 3STXA 3AINA 3LIIA 1CLEA 2O7VA 2PKYX 1F0PA 4MWTA 1UOQA 1RP1A 4A23A 2XMRA 4E46A 4HTAA 1YSCA 5FPPA 1PFQA 2WFMA 5AI4A 2XQKA 4E14A 1WB5A 2X8BA 4K6GA 5AI0A 4W1SA 3WK5A 3QPCA 2QS9A 2OCGA 2LIPA 1LZKA 5FXMA 2XUKA 4ZXFA 1E8MA 5FRDA 3ANSA 4H35A 3KD2A 4MEAA 5T4HA 1ODSA 3CCBA 4BDSA 2JBWA 2H9YA 4AN1A 1MO2A 2XT0A 4FFWA 3C8HA 2WIJA 5HQ3A 4X91A 1GKKA 5AKJA 3WYDA 4LXIA 5CT8A 5HF9A 3IVMA 3VVMA 2ES4A 4KEAA 4BTVA 1U65A 1W52X 3CN7A 1QO9A 2HIHA 5JYCA 1RWQA 1WOMA 4UBNA 4QZVA 5DYTA 2FX5A 4OYYA 1WPRA 4U2EA 3NWOA 4XIIA 4UHFA 3SK0A 4CCWA 4PV7A 5AI9A 2XMQA 4JUIA 5CW2A 3NOXA 2O2GA 3G0DA 5AP9A 4XX1A 1EA5A 2BUAA 3D5EA 1XROA 1IZ8A 3HYSA 1KU6A 1ZIXA 3WWCA 1EX9A 3C5WP 1KU0A 1K63A 2WIFA 2XUIA 2JGJA 3D0KA 3JWEA 1YB6A 4BZWA 2G5TA 3AJAA 4J0KA 4CG3A 3O0DA 5AK3A 5T4FA 3WK6A 1ZOIA 5H3HA 3G9ZA 1IUOA 5AM1A 3HABA 1RYYA 5K3CA 5LKAA 1UZAA 4JEIA 3YASA 1XLWA 2OQVA 4LHEA 1R1DA 2FJPA 4RGYA 2QXUA 1UFOA 1ODCA 5HFNA 4DM7A 5ALPA 2WTMA 3BJMA 2GBIA 3F97A 5KWIA 3D2AA 2WUDA 1VXRA 4MYDA 1E8NA 5AI6A 1AZWA 3VJLA 1UKCA 2WHPA 4BATA 4J03A 1B41A 1MX5A 2OG1A 3DNMA 2WSLA 4OU5A 4EBBA 1N5RA 3KDAA 4U2CA 3G8YA 1LPPA 2CEKA 1DWPA 1QE3A 3VKFA 4OU4A 5EHQA 4BVKA 1EB8A 5LZ7A 3AZQA 1R4ZA 3WZLA 5IH7A 1XZFA 4GDMA 1CIJA 2HA5A 2HADA 2QJWA 2R8BA 3AIMA 4Y2SA 3KWJA 3WK9A 1PJAA 2VJBA 4HAIA 4P08A 3HSSA 1LGYA 4UBJA 2XUQA 3BL8A 1K6EA 3OC0A 5AKKA 3AFIA 2ZYIA 4Q3KA 3BDIA 4BE4A 4XJVA 1XZGA 5AM3A 3STWA 3EQ8A 5K5EA 3MUNA 1MAHA 1CUUA 4QDXA 5C8XA 1EDDA 2VJAA 3SWWA 2BFNA 3WKCA 4H7KA 4KACA 3W9UA 2WFLB 1UK9A 2XUJA 5AI8A 1R50A 4PSDA 3MVEA 1XQVA 2WG2A 1NX9A 4A5SA 1JT2A 1BN7A 2PSDA 5ALSA 1THTA 3C6YA 3N0TA 5D3KA 1MJ5A 5AOAA 1ZI6A 3W04A 3KSRA 4G9GA 4PQEA 4U2GA 1H2ZA 4B7ZA 4DNPA 2JEZA 5EIAA 2I3ZA 3FYTA 2YASA 2O2HA 2QUBA 1MNQA 2J4FA 5AKYA 2HFJA 4P93A 1XZJA 5HF8A 1LPSA 2WIKA 4FBLA 1H2YA 4QA9A 3S2ZA 3ANTA 4PW0A 1JU3A 4NS4A 2OAEA 4LXHA 4DMFA 5I7UA 4W9RA 1T2NA 2WFLA 4I3FA 3C6ZA 4FLFA 5DYYA 3WA7A 1DINA 1Q84A 1UK7A 3IUJA 4RE6A 3DJYA 3WKEA 2Z8ZA 2XDWA 4X93A 1CUYA 2PUJA 1KEZA 2ZVDA 3HACA 4XVCA 3B3QA 4GEGA 1QIKA 5E2IA 3V1LA 2HRQA 3IDAA 2WJ3A 4NZZA 2GBCA 3WWPA 4LYDA 5LIPA 2OXEA 2HA4A 5FP0A 3C8DA 5FV4A 1CUIA 2VATA 4UHCA 3IUQA 5CURA 2JGFA 3D59A 2ZSIA 1JMYA 1A88A 1CUJA 1ZD4A 3LCRA 3OG9A 1DT5A 4OYLA 3ZPXA 2AJCA 3TGLA 4BP9A 3KOOA 1EDEA 1QFMA 1VA5A 1EB9A 4DLNA 3C6BA 3WWOA 4B0PA 3T52A 2GZSA 2XB6A 5ALHA 2JGIA 3HJUA 5ALTA 5JALA 5D3ZA 1HKHA 5AJHA 2IITA 1JJFA 1HLGA 4EB0A 2RAUA 2I03A 4BC0A 2DR0A 3I2HA 4J0JA 5K3DA 1BE0A 5AM4A 4FLEA 4FNMA 4UHBA 1DX4A 1XQXA 1USWA 2DCMA 5BV7A 5FUMA 2QJRA 2OGZA 2XMZA 3EIOA 3QZUA 1FFAA 5AIAA 3RARA 1A8SA 3QMWA 4H77A 1HDEA 4NVRA 4RE5A 2BKLA 4BAUA 2QUAA 1DX6A 1T4MA 5E4TA 4Y2QA 5ALYA 3VVLA 3Q8WA 5FPQA 3QM1A 3BXPA 2RONA 2XMSA 4PF1A 3BJRA 2WU3A 3H04A 4W1RA 4KRYA 2AJBA 5LYYA 2WIGA 4FWBA 4QLAA 3CN9A 4CCYB 1ZJ4A 3I6YA 4C88A 1EVEA 1XKTA 4G5XA 5LZ2A 5IVHA 3IBTA 1K8QA 3WQHA 4C6HA 4W1PA 4DNFA 3VISA 4G1FA 1SCIA 2WG0A 4G8BA 1EINA 4FBMA 4Y2TA 4KRXA 3C45A 2RIPA 3PFCA 2VAVA 4IH9A 5CH3A 3TRDA 3DS8A 2PVSA 5F4ZA 3C43A 1MTZA 2WUEA 1C4XA 4XWGA 2XUAA 3WIBA 4B0OA 4Q05A 3BF8A 3ESBA 1SCQA 2WQZA 5A2GA 2W6CX 1CUBA 4AMYA 3HZOA 2AJDA 2J3DA 2XUFA 1AQLA 3A70A 4X6UA 3RKSA 5CH8A 3HXKA 3R3VA 3V1KA 1ORVA 2PU7A 1YS1X 5T4BA 3TJMA 4PSUA 4YASA 5A7FA 2ECFA 1QGED 4JH0A 3PFBA 2JEYA 3VDXA 2GYWA 4H7FA 5A6VA 1AX9A 3G0CA 4B80A 3H1BA 2XLCA 4GHWA 5AKGA 2C7BA 5FOQA 4C4ZA 3NUZA 4PSCA 1YA4A 4FOLA 4OSEA 4DYHA 4J0CA 4X97A 1HPLA 1E3QA 3FLBA 2QTBA 5AIBA 1FFDA 4FFVA 2DFPA 2JF0A 3I2IA 4Y2UA 5K3FB 1XZHA 3WK4A 4UFNA 2XQFA 4FDMA 3ZLTA 2HRRA 1XQWA 4Q34A 1VZ3A 1FSSA 3VJMA 3ESAA 1JFRA 2FUKA 4QE3A 2HU8A 5HZGA 5HFAA 3OURA 2XUHA
chains in the Genus database with same CATH superfamily
4ZEVA 3MBIA 3JQAD 1QF9A 1U3CA 2F43A 2W7TA 2DH5A 2FSFA 4FFMA 4EB6B 5K0CA 1YJ5A 3FOBA 4CV2A 3JS5A 5FO1A 1WJGA 5I9BA 1N2XA 5DM4A 1D1TA 4CDNA 3OQNA 1ZIOA 1CUXA 4UVDA 4YA6A 3FZNA 3NM5A 1DE0A 4DCVA 1NDQA 2DHDA 4J3FA 3GF4A 1A3CA 2EC5A 1HETA 2XD9A 1TIPA 1PUJA 4FWIB 2JFUA 4PICA 4ZO6A 5F3WB 1K2VN 3O8CA 2FLVA 3LDFA 4RV4A 1P5HA 1XJ5A 3NTVA 3K5IA 3WHLA 1QHGA 1H3NA 3Q85A 4E08A 5C1BA 5E0OA 1G55A 3PRHA 3W2GA 4NZYA 3HCPA 3UV3A 1PLLA 3UMCA 1ZP6A 2OMEA 2DPHA 2XD4A 3ABSB 3MUFA 3NX4A 1ZVKA 2W6ZA 3NQ41 1IM2A 1J23A 1VIMA 3HE3A 2DUUA 4GR4A 4OBEA 4Y2JA 5A03A 1BEEA 2XMBA 3R23A 3WADA 4H7IA 1XL1A 4YNBA 1M6NA 1RCUA 3G9QA 1XLUA 2X0IA 5K3FA 1N7IA 3P8ZA 4WW0A 1O87A 2D0DA 4PAGA 2HPAA 3O1JC 1ODTC 2R79A 1C0LA 3A7EA 1IXSB 3WNZA 1M6VB 3BE8A 4F72A 3F4KA 5GMOA 1XB2A 4YLYA 2QLMA 4GYKA 2V3VA 1L4KA 3FOCA 5KCMA 3TRJA 2GBFA 1JHMA 4KWTA 3WGNA 4BVEA 1PYOA 1UC9A 3TKAA 4FMPA 5D3MA 1U5BB 3K6SA 2PKEA 3D7NA 3FSGD 5INTA 2CT8A 4E6EA 2Z8XA 3G5TA 2C98A 3OZAA 4UBMA 4R2IA 3W79A 3ANXA 1D1QA 2VNJA 4B79A 2CDBA 4IR7A 3TFOA 3KETA 4O02B 2P9EA 1UC4B 4NE9A 4JKYA 3LP5A 5LJLA 1U7PA 3GJXC 3KJEA 1P81A 1JJAA 4MKIA 5FI0B 1YVEI 4LUCA 5J2UF 4HGOA 1TM7E 4FDAA 4KI0A 3I6MA 4TTRA 1J49A 3GGGA 1MA0A 3PT9A 3PITA 3GARA 1X80A 2BY4A 3AL2A 2XTJA 5BWCA 1JKMA 4HATA 4KYTA 4PCLA 1R4NA 1M2VA 1YOVA 2WHXA 4QFDA 5BN5B 4LE2A 4JSRA 2VRNA 1UAGA 1P1HA 1FC0A 3CZCA 4MIEA 5LWHA 1LCIA 4XIFA 4YCBA 3LDUA 4U5QA 2WF8A 4EW3A 4JLJA 2L19A 1CETA 3K1JA 1ZK2A 3L07A 2XLBA 4XE5A 4ZEWA 5JAUA 3H2IA 2CXPA 1A69A 5KKNB 2Q27A 4JAVC 4C3VA 2XDQA 5HF6A 3RC3A 1NF2A 2B6HA 4Z0PA 4H7DA 3HB5X 3SXUA 1P0FA 5I8WA 4CQLA 3H3JA 5KWSA 1VHTA 3HMKA 3WFJA 1KI3A 1A4IA 3WLAA 4DBZA 5K4GA 1FNNA 4PQRA 2NX2A 1V25A 2W98A 3G6WA 1SQ5A 3GDGA 1ULUA 2BEWB 4FNGA 1M54A 5ALGA 4YUZA 4CKWB 3WZ2A 4UNNA 2DQYA 2QV0A 3AILA 3GEMA 3KJFA 3LQKA 2GXUA 5DI9A 3DXYA 3TZKA 3R1IA 4AO6A 2P4UA 2Y1LA 1X6VA 1V6CA 2IEAA 3HUEA 4QU5A 1U80A 5F4BA 1EQUA 1I3NA 3A3PA 4V3CA 5EPOA 4AO8A 2EYQA 1J0AA 5CB4F 5LOVF 4A27A 4W7HA 3ZKWA 4XYLA 1X7XA 2HCTA 2WDZA 5EIBC 1EIWA 3PIRA 1OV6A 2AT1A 3E2MA 4OGFA 1C3EA 4QGAA 2E4UA 3WSWA 4UQLA 3WY9A 3R77A 3EEOA 2MJLA 1N6IA 4WZBA 1CEXA 2WILA 3NIDB 5IJ0B 3M83A 1P73A 5BR1A 5D84A 4CM1A 2XB4A 2Y0CA 4OQQA 4PX9A 1B74A 4YAJA 1MQ9A 1J0BA 3BL6A 5KAPA 4LRSB 1DO0A 2GHTA 2WMNB 1TVMA 1XZLA 2VSQA 5AOCA 2V98A 3QELA 1CFZA 3L1VA 2NU6B 1G8PA 2VUHB 2VXOA 1MVLA 2P78A 1ZUIA 2F6RA 4O4LA 5CAEA 4C06A 1EE2A 4XSVA 4O3FA 4HQ6A 1DBVO 3FM9A 1MAAA 5HIMA 1Q83A 5I5GA 3V7YA 1OLXA 1K3FA 1KY3A 4U2FA 3CRMA 1UM8A 3PDUA 1XC7A 1U8UA 3ANNA 3EASA 3IT1A 2PAFA 4KX3A 1XTTA 5TVGA 3ROZA 4A0FA 2HJSA 4BFTA 4YDQA 1S9DA 1KY2A 1EFUA 2IA5A 4PZLA 1UMDB 2ZJ4A 1D2EA 3CRRA 4JLVA 4UXHA 5B1HA 3TNJA 3K9FC 2JD2A 2C7PA 2MSLA 4IJUA 3IQIX 1PI3A 4DLXA 5BSUA 3DMNA 5HWSA 2CZQA 4EAQA 4EPRA 3BWCA 3LT4A 3UGQA 4GKKB 2XYGA 2WI8A 1JEYA 3T0IA 1BRTA 3D6MA 5DXFA 1CR6A 4FTWA 4EO4A 1GPDG 2Y93A 4UKDA 1HQKA 3C4VA 1OLUB 3C5VA 3FDZA 1M75A 1C3OA 1OD6A 1DBIA 1QO0A 1ZUHA 2H65A 1C14A 2FW8A 3QHPA 4QDUA 4QXMA 4X6XA 4Q4JA 5K03A 2VP5A 3C7AA 1KI8A 4Q1CA 3WYBA 1BMQA 5IW8A 5KDLA 1W5AA 4CM6A 1JIJA 2QP3A 2H1FA 2RH8A 2GMWA 4ZVVA 3PEFA 5K0JA 2B2NA 2RK6A 3ABZA 1XZBA 4MJ7A 4FILA 4N0DA 2EARA 3ZV3A 5BW8A 4QQRA 1KQGA 2A4KA 2VAXA 4PXYA 2Z3WA 4IDBA 4UM7A 2FPRA 2MMGA 1PV2A 2ZYHA 1T8WA 3F1KA 4X5OA 3UK7A 3ZBQA 2FMIA 3MCVA 3IBSA 4FYVA 3TPCA 1XRSB 4WSOA 1KBZA 4GR5A 3O95A 2DQZA 1AKNA 3W4IA 1XEXB 1L4NA 5JBQA 4RHEA 1SUCA 4UU7A 4AKSA 4NBRA 1CRPA 2QW1A 3DBLA 1RAAA 4IFTA 5JLJA 4IJMA 4PYLA 5IRCD 4UNPA 3OWHA 5CYFA 4DIMA 1FL9A 1UBRS 2V96A 3MOSA 1RPAA 2ZSHA 2QXTA 3IGFA 1ZCBA 3RRFA 1T1SA 4K9PA 1EVIA 4RMJA 3RC1A 2YMLA 2QL6A 2BFEB 3LLSA 3QXGA 4NR0A 1EK0A 1W88B 3A28A 5ARCA 2A7QA 1VC2A 2AK2A 2AK3A 2NAFA 3G8CA 3L0OA 4TKUA 5SYNA 3ZHVA 2SKDA 2XBMA 2NVBA 3TTYA 4R9UC 2O20A 1XJ0A 3GHHA 1C1HA 2OCYC 4KQFA 4LK3A 3EAFA 2LXNA 4GAEA 5TS2A 2VI5A 5KNLA 2B8NA 2ECPA 2JLUA 1LBTA 4BMDA 1GRCA 2CYCA 3T3GA 4D6PA 3HI6A 2EJTA 2HMYB 1JKIA 1KP9A 3ESCA 4WDQA 5JZBA 1JQAA 2HCJB 3LLVA 1LLUA 5FEMA 5KC8A 4HH4A 4LZNA 4NG4A 4ZO7A 4Q9AA 5TT0A 3DZCA 3M34A 2I8LA 4ONEA 3UEOA 1DOHA 1NMZA 2ATIA 3R4CA 5AH0A 3M9WA 1UFQA 2J5XA 4IG9A 3PI6A 4JI4B 1MC1A 2HSZA 3RDPA 1XK7A 4HYEA 2GD0A 5DLPA 3C48A 3X3HA 1YO6A 4A73A 3WL5A 1XTJA 4EGJA 3FPBA 4GZ6A 3V3KA 5K3OA 2HJGA 1R5BA 3TSOA 2FH5B 1ISPA 3EJWA 4IMJB 4L6AA 1CRLA 1Q0UA 3GN1A 5HQ3B 5I6DA 3C3PA 1JYFA 3DAHA 2ZR0A 5ERGB 3VR6D 3QGMA 1ZC3A 1H2AS 3WLSA 2HT1A 4ALIA 5BRAA 4RZUA 5BQOA 2CVZA 1BCRA 2LW7A 3DB1A 3KAKA 4MQUA 2J08A 2NU9B 2PR2A 2XR1A 2C4TA 4MEBA 1XRQA 3A2LA 4BKUA 2F3RA 3DLCA 1P44A 2Q21A 5AJTA 3WTBA 3W5IA 4HFRA 5JYEA 3IPAA 3ZZNA 2EKQA 1D4ZA 2Q4BA 1ECPA 1U6KA 1V7PC 2M32A 2W2KB 3VA7A 5HOQA 1OQAA 4Y67A 4KVZA 5ALUA 1ULTA 4PX3A 3D5TA 5HIJA 3U4HA 2BMFA 3Q72A 3EMBA 4FJ0A 4RF5A 3RB8A 1GFWA 4RXUA 2DTDA 1P8JA 5DKFA 1WZ2A 2QMHA 4FSHA 4YRCA 3O3CA 3WGLA 4QXRA 4R31A 2K4MA 1CUEA 4UVHA 5EE5B 1BKYA 4C4AA 4UTRA 2PT5A 1JIKA 2W4QA 2J6HA 4L85A 4KE9A 4HLCA 5BNIA 4ZAVA 2FG5A 4QOSA 5AUOB 3QBEA 2WSMA 3GOQA 3PQ5A 1IWPB 1ONBA 2F2TA 4FOSA 4JC8A 4E6PA 4FYYA 2PGNA 3LF2A 5KHLB 3VZQA 2WYWA 3JARB 5FBVB 1A2BA 3HJGA 4MQ6A 2IU6A 4FQ7A 1UOOA 2QL7A 4CVNA 2PFSA 1QHXA 4HQKA 4Z1MD 5AQ1A 3TTTA 1PGPA 1Z56C 3PUZA 1DV2A 4BX0A 1N4AA 2PUCA 5ECWA 3ZE2B 3OQJA 3BRQA 2JLWA 3RG8A 3INYA 4RNDB 1HR0B 3MWGA 3I5AA 3QPWA 1LRLA 2OC4A 4G4IA 3DUFA 3U1TA 3RK1A 4ARUA 2MOKA 1C80A 2Z0MA 3I6QA 3NAQA 2BEKA 1RLIA 2W0SA 2YY6A 3FDFA 3FF4A 2MDTA 1I2DA 2FZLA 4MGZR 1FUYB 1W36C 2A5YB 1AHHA 4MW6A 1FVFA 1HDOA 3DZKA 3UFXB 2KHZA 2X42A 3AUJB 2NTYC 3K8QA 4L78A 5IUKC 4KE7A 1ULSA 4MWGA 2QA5A 2O1EA 4B4VA 4Z4GA 3IUYA 4U7GA 2ET6A 3F5DA 2WVAA 4QXAA 1U0SY 2HH9A 4WASA 3S8EA 4YDHB 2G5PA 1E2PA 1G3MA 1A7UA 1QDLB 3ITDA 3LS2A 4B17A 4IDDA 4JU8A 3TW6A 4RHYA 3ZK9A 1G7SA 1ACJA 1FP6A 4P5PA 5KB3A 1NFFA 2GRJA 3DOJA 3L0IB 3SMQA 2GN1A 4DYDA 3KSBC 2FUEA 4A6EA 2C31A 2Q6OA 3OF2A 1CSEE 3R7SA 2W2LD 3SXJA 4CN8A 4EY5A 3CUEF 4LY0A 1EUCB 4HGNA 4AMUA 2GD2A 2Y0BA 4Z3OA 1V5FA 3ZNNA 1VXOA 2BEUB 3LQ4A 5JVDB 3CVXA 5EJ9A 2VTDA 5LBIA 4DJDC 1H9BA 4RVUA 3DZFA 3V00A 2P68A 3T54A 4M89A 4EG6A 5KVSA 5EYPB 3RBXA 4FIDA 3W4KA 4RW0A 4UFPA 5JS6A 4LF4B 2CKMA 2CXSA 3IV6A 3PS9A 4QVIA 4KAAA 3PR3A 3TTVA 3DYVA 1R6VA 2GCEA 5A9SB 4CEJA 1WPQA 4Q0MA 3KSUA 3GXOA 1XRPA 1SXIA 1YIDA 1M83A 3M4ZA 1JHYA 1ICEA 4UARA 2GUWA 1TQHA 2C3UA 4G01B 4YAEA 2G6TA 5H3LA 4HAVA 3W8FA 1G6Q1 1Q7TA 2YBEA 2Y6UA 3D8HA 4KU4A 1XCPA 1UWVA 5JFOA 5AW0A 1X1AA 4PN7A 4U8HA 1CR4A 2VBGA 1Q11A 1QWSA 2CMHA 4BN0A 4HVAA 2CV2A 1V4BA 1U7HA 3TD6A 4GVXA 1SD1A 1WS6A 2GWRA 3H1FA 4MRPA 1BW9A 2CXOA 2PRZA 1NQUA 1YACA 3CXUA 3H2JA 2X0NA 3DCJA 2M6RA 1CUCA 1JEOA 4BX2A 3X1DA 3C3JA 3TUIC 4BHTA 2XGSA 5LQSA 1D8TA 3N8HA 2Z1NA 3MLBA 2AHRA 3Q1KA 2OSVA 1EP2B 1QYIA 3CH6A 3OCWA 2BV3A 1WE2A 2I55A 4QQNA 5EZQA 5BNFA 4CM8B 1GQRA 2V7QA 2VBFA 2YRXA 4CIVA 1KMHA 4IV5A 1WBDA 1DMSA 1G5QA 2R8XA 1S2OA 3K9NA 5EJEA 4EJSB 4X1KA 3I72A 2CHGA 4CFSA 2YDYA 4M37A 2V1XA 1NSFA 2IHVA 4N0MA 4AP6A 1T8RA 3RGWS 1E1RD 4RTLA 4KK4A 1THZA 4B3SB 2YZNA 4ZU1X 1IE3A 5DYNA 2YUIA 4JNKA 3T7JA 5BWMA 2PGLA 4LMBA 2ODQA 3AY3A 3OY7A 2PN1A 2PCJA 1ZM2A 4ROTA 5JRZA 3HP4A 3NBXX 2ZZMA 1JVSA 3CKMA 3JYPA 3KQUA 1T6XA 1Z0IA 3UGJA 3PFNA 1CUHA 2BMJA 3B1FA 3D3NA 5G3ZA 2VQFB 1WTAA 9ABPA 3O4HA 2C07A 2NU7A 1JU9A 5BSEA 2GK7A 4CNQA 2W11A 1H5UA 2AG8A 2I7CA 4I4IA 2AOXA 3KAPA 1PVOA 3FA2A 4D9EA 3A4IA 3BL5A 3UXYA 1U1FA 5IT9A 5GWXA 5C7OO 1HZZA 3IHWA 1RPZA 1EWQA 1E92A 1V41E 2CXXA 2PL5A 4ND4A 4UD2A 5GZ1A 1NFRA 1AUXA 1RHRA 2GHRA 4S04A 1XD2B 2Y1OA 4NNPA 3SX2A 2WF9A 2VJMA 4ZRDA 2JVIA 4DV6B 5AK6A 4KR9A 4TLAA 2JK1A 3GJYA 4RIHA 3QELB 3PUKA 2VIIA 1VPWA 1VE5A 3IA2A 1EM8B 1RWVA 1SVUA 2UZAA 4M3NA 4UUQA 3AEUB 2H1LA 3MGBA 4JYMA 4Q4AA 1Y7HA 4Z2YA 4BNXA 5K3SA 1QB8A 2RGGA 2VVTA 2PDAA 2HU5A 2YCBA 1H3FA 3DKIA 4HH3C 5DNAA 5ICCA 2B1JA 3HXLA 3L7IA 4LV5B 4QBIA 1G3QA 4KXYA 3GUUA 3OKAA 4RKWA 3W4JA 4F3KA 1MRSA 1JKXA 2Q5CA 1NA5A 3ZE0B 5CBPA 1L7DA 5DIZA 5CFRA 2PX5A 1T26A 3KV3O 4M0DA 2VK8A 2ZUUA 2OCBA 1YB4A 3CPEA 5CB8A 2I6SA 1M0WA 2WJGA 3L7JA 1ZD5A 1KDYA 2QRUA 5FULA 1DIAA 4EARA 1CCWA 1US8B 1WM1A 3LHSA 2XX3A 1TD9A 1NTRA 1UANA 1AUQA 3C6XA 5F1OA 1TKRA 4GECA 2CJWB 1VPLA 1XTSA 5IEJA 4AJKA 3PUWA 2Z6VA 1V8OA 2MR5A 3IMKA 4OH7A 2QRMA 1PT9A 2QN3A 2DFLA 1NXVA 3A6LA 4F04A 1P77A 3MMSA 5A1TA 4C4SA 5JS7A 3GT0A 4LNUA 2I3BA 4F8EA 3IMCA 4FMBB 1YL6A 2OLEA 3EF3A 1KWGA 5CR9A 2D0IA 4A6DA 3SIPA 5CD1A 1W7AA 3O47A 1MJGM 2E4YA 3KPJA 4C4XA 3GEIA 4J0IA 3ZCVA 1C9MA 1KEVA 4JB0A 2H1IA 2YXNA 3EEIA 2HA0A 3OCZA 4LXGA 3KZXA 3E22A 1ZOOA 1GNTA 4Y6OA 1Z2AA 2BFWA 3ISJA 1BHJA 1YOVB 1YR9A 4ZTBA 5ALZA 3R8FA 1F8YA 1C2TA 1GAQA 2GJ8A 2H0QA 3SDZA 3ULKA 1CJKC 5E4YA 1RHQA 2ZYGA 3MQFA 3KXPA 1ML3A 2FPWA 4EKNB 3HC7A 5A06A 1BS9A 3AEKA 1PK9A 1R0XA 4QO7A 5BPHA 1UT6A 3PJGA 4OIMA 4MYHA 4TV9B 4W63A 4B75A 1WB6A 2DGDA 3PWSA 1BXZA 3EWAA 3Q5GA 2Q4OA 4OQNA 1U2DC 2R1TB 3VU9A 1VJGA 4S0XA 4X65B 4OD0A 2AI1A 3S5UA 2FTKE 4QWMA 2R8RA 4MV3A 4NX2A 5E9QA 3GJRA 4CF5A 5CFOA 4L28A 4NMWA 1WKBA 4P4NA 3VR2A 2QD2A 3L8HA 1X87A 2Z9BA 3R3HA 3Q7SA 2E3JA 4RHXA 2XCOA 5JCZA 3LPNA 1I1QB 1IH8A 3OMXA 4KXMA 1LRKA 2W2XA 4Y9RA 3A1EA 4B45A 2BLLA 3VOBA 2EW2A 1HH4A 4RF4A 4AURA 4M60A 1E20A 4D3XA 3THWB 4ZI7F 1K6IA 2JFQA 4C7JA 1M10A 4YHHB 2B8TA 3UAZA 2Q5LA 1WZNA 3QU4A 4HUQA 4MVJG 3ZCUA 5CFZA 1U8YA 5AVTA 2WJYA 4J16C 1CYEA 1YMUA 1LPAB 2G07A 4BNUA 4MUBA 5FPKA 4RPIA 3B60A 4ZAFA 3PCXA 2VPYA 1LVUA 1Q5PA 2JHGA 3OHMA 5HRAA 2UZ0A 4XLLA 5JQWA 2IH2A 1ZNXA 3I01M 2ID7A 2PKWA 1O58A 1M76A 3WKDA 1SKYB 3HVIA 3OI7A 4JQSA 5BVHB 1OROA 3ZDQA 3EZXA 2NO6A 3PQ6A 1CUSA 2HN9A 2AMLA 2NW6A 2AJLI 2V7BA 2VN8A 1VL1A 1Q57A 1YVDA 2PZEA 1A8QA 1YB1A 2X13A 3IQWA 2WT8A 4R7TA 3CLRC 4Y2VA 5JFGA 1C9NA 1OILA 1SKBA 4F8JA 5BV2P 4M0CA 4PX5A 4KUGA 3QI7A 4KODA 3B85A 1C7RA 1F6WA 4PC6A 1EK2A 5IBPA 1ABBA 1NBMD 4NBTA 2EIXA 3DF7A 1E9CA 4HAUA 4N6GA 2QZPA 1G8FA 2EEPA 1GPKA 1PO7A 3IP6A 3SHVA 4F7DA 4H3SA 4RL6A 4EEXA 3FHOA 1HDRA 1QP0A 3U17A 2X0RA 5C7YA 2A0UA 4M21A 4LGYA 4BVBA 2AEEA 2O8EB 4H1TA 3EARA 1MTOA 1MRZA 4WZAB 3QPUA 7GPBA 2IX9A 3NWBA 5C34B 1DBWA 4HNVA 1FY2A 1W5BA 3KKOA 2PLRA 5IM5A 4HDMB 4NPCA 4JXJA 2F55A 4WN3A 3L9XA 2OCPA 1T6NA 2BGNA 4HBGA 2Y67A 2P5SA 3JXEA 1YZ3A 3RVJA 1E69A 1VHDA 1BD4A 3BWXA 4RJIA 3PL5A 5EL0A 1HY3A 2IQ5A 3K31A 2PT7A 4P4SA 2V0CA 1I30A 2VXCA 4RVOA 2FYTA 1E77A 4MDHA 5HBRA 1R00A 4HGQA 3SQXA 5E7MA 3MINA 2IBMA 3GLIB 2D2IA 3BXZA 3DW3X 2UXBB 3N3AC 2XEXA 3OQ6A 3S3TA 3X2FA 2IDMA 3TB4A 4YCAA 3WK7A 2FDRA 4HY3A 4UREA 7MDHA 5JSQA 3FVTA 3ZKAA 1GPJA 2EDCA 2H11A 4P3PA 1MJHA 2BGKA 3RWBA 4HXEB 3LUKA 3QIAA 4J0GA 2Q2OA 4X20A 5GZ6A 2PZJA 1LD3A 3RNLA 1ZMTA 2CUNA 3RAFC 3EA5A 1IHDA 3L7OA 3CF4A 3R7LA 1SULA 5JNVA 1I4EB 3LBHA 4J0FA 2BTOA 5EIHA 3A58B 3HCFA 2FZKA 1JQDA 3F4LA 1JEAA 5FUBA 3CW9A 3SHOA 5B1YA 1CJBA 1SVNA 2BONA 4JLPA 1EESA 1C0EA 2E49A 2GUGA 1SBHA 1TECE 1ACMA 2BCEA 2YOGA 2ZROA 3AFGA 3WWEA 2AWNA 3ZHSA 1ZICA 2HPHA 1EP9A 1EM6A 3I8OA 3WBKA 2WVHA 5BNZA 3FGOA 3GG9A 2IYPA 1RHUA 3L7CA 2GKGA 1MBZA 4FIZA 1U7WA 1UBOS 5CEFA 2YYZA 1XK6A 3UTDA 5KVAA 4JLUA 3M89A 2HU7A 4TGLA 2LDXA 4C1NA 1X7HA 3PQEA 4DIOA 4WQMA 2W2LA 4E31A 3H13A 1N5KA 3WAGA 1JFVA 5BN3B 1U94A 3Q3VA 4DMRA 1KNQA 4K9KA 4KH1A 3COYA 1AV7A 2H00A 1WUJS 4TQUS 2Q7OE 4JMLA 3EYAA 2IOFK 1QZXA 3H4TA 4CCAA 2P41A 3ZHZA 1M72A 5E3JA 2HAEA 3L8CA 4H27A 2YH2A 3NEPX 4O08A 4DRZA 4PNEA 3D1LA 4I9GA 1YS7A 1L5MA 1PUIA 1H0KA 2WM3A 3DW1X 2QZJA 3SVLA 3PDCA 1E2MA 1JIXA 1VPVA 3D4OA 3LZDA 1JV2B 4NOKA 3UATA 4P8RA 4DWVA 1P3Y1 1T2EA 3RT9A 3QOXA 1XUOA 1E0JA 3LX4A 3FPAA 3L01A 1TAGA 1Z47A 4U2BA 2WKRA 3ZWOA 3U44A 3BDVA 3OCCA 3RSLA 1RWMA 2ONCA 4M0EA 1N2HA 1PX0A 4UAGA 2ZRJA 3O2SB 1IBCA 1QFSA 1ENPA 1W44A 2XCUA 4GVPA 4IDGA 1CR1A 4R1OA 5NLLA 5H8WA 1T4CA 1EDBA 4XEUA 1FLAA 4QUKA 5D87A 5KTYA 1A8PA 1J2RA 3W90A 2O3QA 4L07A 4URFA 5MGNA 5BVHA 5C80A 1G6KA 1TA4A 1Z0UA 1R3DA 4P7JA 1RJFA 5EE3A 4JEMA 1ZMBA 3ZQ6A 2NV0A 4X8LA 4ZCIA 3BWYA 1BO6A 4KHPB 5AHWA 3QW4B 5E9WA 1N1MA 2O52A 2F62A 1YFZA 3O5AA 2A59A 2P77A 1JQLB 4LDJA 3R6DA 2VWHA 4MYCA 4EEKA 2VRWA 4QDOA 2JGEA 3IDFA 1J1IA 3KYJB 1CY2A 4IILA 4MV7A 1UJBA 1JFFA 9LDBA 4YPVA 4XUDA 1YK0A 1GVNB 2ZRHA 1P31A 4F46A 2C5LA 3UB4A 5CT6A 1X9HA 2INGX 1PJ4A 2J3HA 2E21A 2CNBA 3PKIA 3JWHA 4IIYA 4D6YA 2BM0A 4YS6A 5U4XA 2VCYA 1BXGA 2FQYA 3OE7A 3VDNB 2I4TA 4PHGA 4B3RB 1D0SA 3HB4X 3RCBA 5IULC 4HYYA 5JASA 3IQEA 1DHRA 1YNOA 3UAVA 3V1UA 3O3NB 3OJOA 3IMFA 4WCFB 2ZYRA 2QP9X 2XWQA 4BJ6A 2ZSFA 2DUNA 2VDPB 3PNSA 3DLHA 3JQ9A 1HEYA 4PLYA 5KNDH 1SUSA 3HKCA 3RVQA 4WEQA 4GPTA 4IXWA 8ATCA 2E4WA 2O3UA 3FG9A 1EG7A 1UXGA 1V2HE 1BYUA 2X9GA 4CV1A 4YVFA 4BLPA 5I7HA 4QGHA 5EUBA 4EUKA 1WOYA 1NMEA 1EE1A 1UKAA 4EOGA 2PBLA 4ETNA 2WZQA 4XX0B 5JI3E 5HJEA 2XA1A 1P1IA 3E8MA 4AS1A 2W6IA 1XXHA 2EF0A 4DQ0A 1J42A 3LGAA 1TRKA 5E3IA 1T5LA 4DLAA 4JQOA 1XP5A 3HJAA 3LSYA 3EC2A 2AKEA 3ISVA 1QS0B 4D4JA 2ZSEA 2AOVA 3D4LA 1REQB 4DW8A 3FRIA 2RHGB 2XYHA 4L8FA 1QFXA 4LVOA 4WLNA 1U7DA 4ZEOA 4ZANA 3DQQA 3RIMA 1DBSA 1TF7A 3ZIUA 1NMYA 2O7RA 3LC7O 5GP1A 4AYXA 2YFQA 4BN5A 1KJJA 3LTNC 5F7ZA 4BFCA 1FFBA 3B53X 4GW3A 4PVCA 1HLPA 1SQGA 2A3NA 4RADA 3NUGA 5AM5A 2DPGA 1RYZA 3FIJA 3UMFA 4WEOA 1K7XB 1W75A 3QSYA 2NYAA 2QMEA 1E3WB 1JHXA 4XD7D 1SPBS 4BRWA 4E70A 2G9VA 4AY2A 3CGWA 1RLOA 3W6NA 1SR8A 3V1MA 5GJBA 4FHCA 1JI3A 1KK3A 3K5PA 1O57A 5EP3A 5AVYA 4F9GA 4BRZA 1Y8QA 1Z0FA 1WVGA 2IKSA 1R9GA 3UC5A 5FOSA 3ZDDA 4B74A 3H8SA 5EZYB 3PJDA 1Z25A 4E1VA 4F5EA 4ARIA 2X9NA 3WKAA 3Q6NA 2Z3ZA 5EIXA 2YICA 3K2QA 1IB6A 2B8EA 3A3OA 5L3RA 5KSYA 4ABTA 3GVCA 3KJNA 2AF3C 4YJ3F 1EBFA 1UJ6A 2GXSA 4D82A 3AERB 1NVUQ 1GZHB 1NASA 2JJ1D 2C0PA 2VP0A 4YRAA 3RTCA 4Q4AB 1NSTA 3IJEB 3CSUA 3P1JA 1ZW6A 2CB9A 2WTBA 1ZD2P 2ZETA 1GXSB 5JPCA 4PLHA 3PRKE 3UGTA 4CDMA 5BUCA 5I4BA 2XZOA 1IBLB 4LHYA 2JZCA 3GLIE 5ESDA 4JYZA 1N25A 3CMMA 3ZQUA 4DNXA 5JDIA 2H4YA 4Q7JB 4Y6GB 3KDSE 3O4GA 4OQYA 2O57A 2CSXA 2ZAGA 3RVRA 4XW2A 1W1WA 4NZNA 5H16A 1OKKD 2IF2A 2R6FA 4AFNA 4H1WA 1MNAA 1T0HB 4O4JF 2UXDB 4HSGA 5KNBH 2X2FA 2VBIA 4Q7LA 1KAHA 2J0VA 1JRLA 2O4UX 5KTSA 1CQZA 2ZZKA 3BZBA 3I2KA 1KK0A 3DV0B 2OG2A 3PX3A 1BFUA 1HMYA 2QR5A 3QOWA 5I8ZA 3HQ4O 5EHXA 1N6NA 2ZJ7A 4GQAA 1ZI9A 3RJMA 2DBVO 2AQHA 1KEUA 4QNNA 1T10A 3CINA 3V4FA 3H5AA 4EKEA 4IQ4A 1NN3A 2EWWA 3PC8A 4J1SA 4OI0A 3DULA 5DTQA 5J5VA 5KTOA 5KX5B 2VPZA 3UHAA 4BPBA 3D2CA 3GQVA 3KELA 3O8DA 3T5CA 2XI4A 3WK8A 2PS1A 2Z98A 2ZUDA 2H54A 3SS8A 4BZQA 2YN4A 3ZE1B 4YV2A 1ZC4A 1J5XA 1TEVA 1TDJA 2ZJ2A 1PN3A 4IJWA 4DDVA 4BFVA 5LQRA 4DQUA 1MW8X 1CTQA 1VSTA 3B52X 2RH9B 5JAPA 2JLXA 2A5GA 1FFEA 3U3XA 2H9IA 1GPWB 4H1HA 3H0CA 3I83A 3OEED 2HC9A 1LPOA 4CM8A 1VIVA 5HRCA 1RJ9A 3RSQA 1W46A 4AZSA 3V7NA 4EIWA 1NUUA 4U7WA 3D0OA 1VB3A 4UXJA 4F3CA 4TMTA 4N5MA 1FS6A 1H6BA 1MAVA 2D2VA 5DSXA 5F77A 3TTSA 4EECA 2FPKA 4IYJA 1Y5NA 3QVJA 3NCHA 4WT7A 1SKYE 1AQNA 1W5FA 4LI3X 5HDBB 4PRZA 1KYVA 1M73E 1A9YA 2IHYA 5H7XA 2RHBA 1NVKA 4P22A 3KU4A 3B1JA 3RV4A 2D7JA 4A2QA 4MRMB 2QD3A 5DCYA 1H6AA 3G9TA 1ZWLA 3M6FA 5B6JA 5A0TA 3P9RA 2UUBB 1H1LB 4A0SA 2AI2A 2IYTA 2RJOA 4FZRA 1ESZA 1ZPDA 4QTZA 2IF0A 2WU4A 2PVCA 4DILA 4HD8A 4Q9JA 5DE3A 1GYRA 2VRCA 4G8CA 4AMGA 4BAZA 1HE1C 1DTEA 1PTJC 3OOWA 1MX1A 1Z36A 3M9XA 1KWKA 2C4NA 2GDJA 4UPDA 3M82A 3KTFA 4X8MA 1FFXB 1UPTA 3B36A 4M1QA 4L0MA 3NBAA 4RPLA 1NE2A 5IVPA 4OXNA 3UG7A 3N59A 1QLWA 4A0RA 1HQDA 4MCHA 1EDZA 2PRYA 3QVOA 5SYAA 4DY6A 3NI2A 3RSZA 1PZEA 1PJZA 2VDWB 3NH6A 5AXDA 2JEOA 2IYEA 3DDUA 1T43A 3GRFA 3H19A 5DLDA 4BVLA 2WB4A 2MSDB 2CCGA 4C3UA 3QEBZ 2JI8A 3LQ1A 4BX3A 5FHRA 1M7GA 5KSOA 5IU6A 1XMVA 3W8RA 2DFDA 4I9FA 2A0XA 5FA5A 1DAOA 3N75A 2QTMA 5KDOA 2J3MA 3CH4B 4Q3NA 1SFRA 3JQBC 2YJ4A 1KSFX 1WD5A 2V7VA 2VEOA 5I7AA 4NENB 2YOFA 3KVVA 2V9PA 1QAQA 3AUUA 4S1NA 3P9ZA 4E5KA 3T3PB 4D2IA 1HDXA 2VHCA 4HO1X 1U5CA 1LTHR 1NKSA 4UASA 3DTTA 1KYYA 4BZXA 2O6LA 1QYCA 4R83A 3UZUA 2ODTX 3NHBA 2AL7A 2CFTA 3DTVD 4DTCA 4H7HA 1P0QA 1I5EA 1ZBQA 2HWXA 2PSJA 4RSRA 2YVLA 3SC6A 2IZOA 4QU9A 4BGDA 2IH5A 2C2MA 3KQLA 2X76A 2HJHA 4OCZA 1T1GA 4MHOA 3HV0A 1NJFA 1Z4KA 3BE4A 3O7WA 3TZCA 1FQKA 4LSWA 4S2EA 3U0BA 1OFUA 2H4ZA 2Y8EA 5JZVA 4EPTA 1IOWA 1MG0A 1Q16A 3NKLA 3MJHA 3IKLA 3ADBA 3PYXA 1E0KA 4O4JA 2PMEA 1EFCA 3GFBA 2CNNA 4GZLA 5HJ5A 3GD5A 4AJJA 4BKRA 1E32A 1XO1A 2YVUA 3AHHA 3GAZA 3NHFA 4GX2A 1L7AA 2A5DA 2GK3A 4HN9A 3E3OA 3FY4A 3KJXA 3CZ9A 3OU7A 4RU1A 5IDYA 3GX1A 3FMVA 1KC3A 3I1YA 3A26A 1BDJA 1JH9A 4F3TA 3FD8A 2O19A 4X63A 5IYZA 1U2GA 1BX1A 4R6WA 3ZU2A 4FNOA 1KSHA 2YJGA 5A3RA 3AM4A 3UKDA 4B40A 2B36A 4N5HX 2BRUA 1FTWA 2H16A 2J31A 2WNHA 1C9JA 3JATB 3L1KA 2PIAA 5GJWC 7ABPA 5IZ4A 2OVBA 1A27A 1L4MA 2A0WA 5AM2A 2GZ1A 4H60A 4N7JA 2IELA 5ALKA 4B3JA 1PRYA 4JYBA 2WFZA 2DC1A 3DBVO 3U7IA 1NV9A 5GVSA 5ALJA 3DC2A 2EZ4A 2GZHA 1GPYA 3MTBA 1VOTA 4LY6A 5B58T 1L5SA 5D1NA 5CJPA 3B3AA 4LWQA 5DHPA 1U1IA 1KHTA 4F4CA 3EVTA 4YC7A 3MYRA 4P53A 4CKEA 3U4IA 3SE7A 4CKCB 3I5XA 4GKAA 1C7JA 4DLYA 1WHSA 1BCRB 4I1IA 4HRAA 5IMSA 1XRNA 2WF5A 5TLSA 1YS4A 4QSHA 4N3CA 1ND5A 1FJ2A 2I0FA 4J8PA 1QH1A 3P9CA 3AM1A 1UBUS 4BUCA 3FN4A 1J7JA 2QRVB 1DPGA 2A94A 2BEVB 1AKQA 1ZLXA 1AURA 3IQDB 2BZSA 4PFJA 3TXXA 4EP1A 3E82A 1E7SA 3PXAA 4EPYA 2WB2A 1CU1A 4IIBA 2XWJI 1G8AA 2VJLA 2W2PA 4NPHA 5HK8A 3RYHA 2GFIA 3WLKX 1F9AA 1GZ5A 1IDOA 1Q7EA 1UDRA 1UQUA 1EIZA 2XQIA 4LOKA 4OJMX 3K9BA 3TD9A 3FLEA 3PHJA 2IPLA 4J43A 4U7FA 5BSGA 3JQGA 2A1IA 3Q8MA 4XVQA 2YFYA 4NU5A 3AEYA 3FUWA 3OE4A 3LNTA 4OJYA 3T3DA 4QGGA 4ARVA 5A02A 1WHTA 5ALFA 1TCBA 1T25A 4ND5A 1TK3A 3U9LA 4ZHSA 3I61A 2OHGA 3OTIA 4DV5B 3LCUA 1HV8A 4PG6A 3C5CA 4RZXA 4OLBA 1KVRA 3HKBA 3V34A 5K20A 3PLAE 5F64A 4L8WB 1YBMA 2WUFA 3TQFA 3Q7QA 1ITZA 3EGDB 3F6CA 3PEUA 4GMXA 3SAJA 3ER6A 2V7GA 3MIZA 4ND6A 3W05A 3I30X 5DN6D 3QKWA 1SHZA 2Q3DA 2DUMA 4II3A 3VM6A 1FUEA 1RJEA 1W88A 2GPWA 1H0HA 2E85A 4K87A 5CH5A 2R11A 2YY5A 3HH8A 3QTBA 1WMDA 5LU8A 4IXMA 1G6HA 4AMZA 3W6UA 5LB2A 2XE6A 3ON5A 3Q9LA 4IRXA 5FH9A 3AUFA 1T0BA 3MOGA 3SLGA 4D8TA 3FWPA 1U1GA 1JL3A 3K5WA 3OKCA 1RYDA 4H7JA 2ZIEA 1P4JA 2X6RA 4URZR 5EIEA 1YVPA 1IHPA 5L7YA 3L4KA 4FGWA 4OTZA 2JIDA 4TRJA 1YWGO 2Z5GA 1FP1D 3PPWA 4KJXA 2YJTD 2QVBA 3ZJUA 1LEHA 4AIIA 2GEJA 3QE4A 1KQPA 2E1PA 2R8YA 4QEDA 2G9ZA 5E6RA 4YRJA 1NNEA 2JVJA 3VO2A 2IHUA 2W2TA 4O29A 1P9NA 4C76A 1WCXA 1NQVA 1YZKA 1P75A 3JATA 3VR4D 2WKWA 3KVOA 4HZIA 3PNQA 3R5HA 4DMMA 1GAJA 4LYYA 2H1SA 2XKJE 4NMMA 3ZLUA 2WV9A 5BVGB 1F4PA 1AO0A 2HF2A 4N03A 4O2AA 1W25A 6PFKA 4I6GA 2AN1A 4Z99A 3TVYA 2CD9A 3LYUA 1M6HA 2I22A 2I4RA 2XA9A 2VJCA 2G25A 4GPAA 5E6SA 2QHXA 4ZDKA 1I7QB 4M53A 2O5EA 4IOLA 1ECLA 4YJ2B 1DKOA 5TSDA 3JYQA 5JXWA 1WP4A 4O4JB 2C83A 4A4DA 5B30A 3A9VA 1DHTA 2DBQA 4FNAA 3J7TA 1K4KA 4D0NA 1N3IA 3AHIA 1L8OA 2FN3A 3JW8A 2R87A 3BE5A 2JK0A 3LXRA 3LVRE 3ORRA 4OL9A 2GGSA 2HQOA 4GSKA 3VU8A 3TG2A 3NBFA 3OIWA 4HXFB 1QIHA 4G23A 3GYGA 2G28A 4B81A 2X40A 1THGA 1W36B 1NT2A 2ARKA 3QBDA 2AIRA 4NCHA 3RRXA 3FWHA 2G0AA 2J8ZA 4FS8A 1T5IA 1E5TA 1DQYA 2ZUWA 1T6BY 1SQ6A 3RJ9A 2JFZA 4B6GA 1AZTA 3M2TA 4H1VA 5KHOC 2B61A 2FPMA 3VR2D 1VJTA 3QEKA 4AZ3A 1NW5A 2X1LA 2JIQA 4Q3OA 5CFPA 4JYAB 3I09A 1UFVA 4RLHA 4M1ZA 4KQ6A 1Z7GA 1KBQA 1VP3A 2OFXA 5HOEA 4MRSA 3IL2A 4LJ7A 4U5XA 5HKAA 1CJUC 5BN4A 3NC4A 1NATA 3VXKA 5CA1F 2HM7A 2J0UB 3RUCA 4V3BA 2FOIA 2YOHA 3KL2A 2QX8A 4ZOCA 4MVJI 1WU8A 3O4JA 4X9XA 3RABA 1WUIS 2R2AA 2WLTA 1CUAA 4PLWA 1RBQA 1V43A 3HVUA 2HLDA 3O9VA 4YIKA 4JBHA 4E22A 1Y7LA 4FBGA 3G2LA 3ZWPA 1H8HD 1I8TA 4AZ0B 1KERA 1PZMA 2BMVA 4IBOA 4ZODA 1V5IA 5H68A 2YMQA 1WVMA 3G2NA 3QFSA 4RVDA 4W82A 3KTAB 3LCMA 2BGMA 3LQRA 2ODAA 3RODA 4EYOA 4EYKA 2WYVA 3CR3C 5KVVA 4Z9XA 2GASA 4EENA 1COWD 3HCBA 3OUZA 3VO8A 4BCBA 5FUYA 1QC5B 1AA9A 1MVOA 1PW5A 1ORWA 4M8IA 3RSCA 5JJLA 1BHQ1 1F7VA 2ZTHA 1SBNE 4DADA 1FJHA 3OEEA 4B48A 1VMIA 2QMQA 2ZR9A 3EFOB 3PQFA 3EH1A 1L4LA 3B6JA 3DUFB 2FQQA 3VU1A 2GA8A 3C3BA 1PR3A 1CD5A 3DVAA 3V4RA 3CYFA 3OFVA 4N7BA 4QG3A 5LP1A 4CIWA 4WI1A 3O8QB 2YQZA 3BJEA 1CHDA 3CX7A 4XWAA 2G1KA 1FXSA 2KI5A 2GZ2A 2YYSA 1M2VB 3FWNA 4JL5A 4ZYTA 3EOAI 4QVKA 4AIRA 4JT8A 3W8DA 3ZVLA 4KO3S 2I1WA 3EIUA 2ILTA 2PKYX 3PGVA 3M1AA 1EFRA 2C4VA 5DGCA 1UOQA 2YZ7A 3K8YA 2QTNA 4I5FA 5CA0B 3KLPX 3NUQA 5FJIA 2ATXA 3FMGA 4ZAZA 2FPOA 4IIJA 4HTAA 4E46A 3CJRA 3ENKA 1YSCA 3E1SA 1PUXA 4QT0A 1P1RA 1PFQA 2K6GA 1SXPA 4P3YA 2IS1A 5KMGA 4RVNA 3ZWAA 3BH0A 1I4LD 4I55A 1DS6A 3P9KA 3K6SB 2ZE5A 2PBRA 5K8TA 4KGXA 1R27A 16PKA 2B98A 2C96A 2FZCA 2FFAA 3O74A 2GR9A 3BGIA 4BU0A 3KKLA 5JXIA 1T5DX 2ZYTX 3C15C 5BMVF 1CVRA 5CCEA 3Q0EA 3QPCA 1G20E 3AKZA 1SXJB 2R4UA 4MLZA 3H5VA 3LUPA 4RSGA 4FUQA 3OIGA 3KBOA 3EY4A 5JTTA 4DZZA 3IIKA 4WGGA 5F9FA 3I42A 5E8JA 4BS9A 1WLYA 4PVDA 3TOVA 2Q3BA 2HQRA 2CDAA 2Q8PA 4MEAA 1R6UA 4V39A 3WISA 3M49A 1RIIA 2OUKA 1WWKA 2WHEA 3WDLA 1Q77A 2P62A 5JQGB 3M2PA 2RBKA 5A2QA 1PGQA 3MAAC 3WHPA 1RRKA 2BVNA 1MO2A 1QF7A 3OCVA 4HLNA 4M8LA 3OICA 5DBGA 3CA8A 1SKUA 1WAMA 3DAPA 4HKTA 4K9OA 4PG7A 5HQ3A 5CT8A 3SG0A 4D8UA 2B34A 5DX1A 4RFSA 5AW5A 1V8BA 4DLWA 4OQDA 3ZJVA 3AY7A 3ASYA 3HXOA 5E9JA 2ORWA 4IG4A 4KEAA 3IJ5A 4LE0A 4YR7A 3C6MA 1U65A 4DDMA 1OH8A 1KO8A 1T0IA 1W35A 3CT6A 2O5VA 1L3CA 3TBKA 3MRXA 1KDTA 3QKUA 4HWKA 4IQ8A 1HFWA 1QO9A 2HIHA 3AKCA 3EXHC 4KHZA 3HDHA 3OZEA 4BN4A 2WUWE 1PNRA 3KOYA 1V47A 3LA6A 1EXMA 1CY1A 1OXUA 2O0MA 3OEYA 2WYUA 4WXPA 2IS2A 2C3YA 4R8SA 3EXEB 1Q6ZA 3GUCA 2R8OA 3PA6A 3UJ8A 1LSUA 4QTYA 2QV7A 4MQ5A 4NNOA 2C2WA 1U28A 3FVQA 1BJTA 1FQWA 3BS4A 4DUPA 1ILEA 1QPZA 1GTZA 1GDDA 2AC4A 2EKZA 1TJNA 2ODNA 3FKQA 3HZZA 4UHFA 5DBOA 2EBFX 4C78A 2ZJ1A 4CCWA 4JUBA 3CPJB 1U8TA 5A3JA 4H4DA 1I01A 5JH7A 2XMQA 2GEDA 1C8BA 1YK1A 2BFEA 5AP9A 2P1RA 3A11A 4XX1A 1RLTA 2XNKA 1BKSB 4AL4A 4MR7A 1YZQA 1WPGA 4YO8A 2UZ3A 1XKXA 2B30A 4I8DA 4S2UA 3WFZA 1IZ8A 1XPOA 3ESXA 3HYSA 4XCQA 4XSHA 1BE6A 1REQA 4QUGA 1MC5A 4YQZA 3WSVA 4IKPA 4NU8X 1FXUA 3S2UA 4F1WA 4R5MA 2E7ZA 1EJ0A 3HXTA 3H6GA 1RDFA 1XCGB 1F20A 1YJCA 5FNVB 1PHPA 5DM0A 4BOYA 3F6RA 5KHAA 1YQTA 3F5QA 2MTBA 3PXXA 1QP4A 3TM5A 4D25A 5FA6A 2XUIA 4K0RA 1LC3A 3D0KA 5JY6A 1RTKA 2FZWA 4GIBA 4GE0A 2G5TA 4LBVA 1NVMB 3V4SA 2OORA 5KOIA 1P29A 4FQ8A 4IGKA 5T4FA 3FI0A 1DUIA 1OE0A 2ZI6A 3ANLA 1TM3E 2JHFA 1WDWB 1YR6A 1XQ1A 5AUQA 1IUOA 1E1CA 3HL4A 3ICEA 4EF4A 1NI4A 3GPBA 4TSKA 1RYYA 3ASZA 4QTXA 4DCCA 1HRKA 4WN9A 1RIFA 1XTRA 3TK1A 3X43A 3REGA 1N6OA 3M9LA 2E89A 1B7GO 1SZPA 4EQZA 1ANKA 1AT1A 1NR7A 1DDGA 3FGPA 4RA6B 3S5JA 3TIVA 1JG6A 2OP0A 2FN4A 3GLTA 1UZAA 3V4LA 4F91B 5L4SA 2ZWVA 3I9JA 3ESRA 2EZTA 5HZHA 3V55A 1KIAA 3E61A 4OEHA 3WGGA 2ZXUA 1XJWA 1Y48E 3L02A 4BECA 3K09A 3GOHA 4G0PA 4QPJC 5ILQA 3LOPA 6ADHA 3EC1A 2AVNA 3JRNA 2I67A 5FNZA 4X1YA 5AW3A 1Q1QA 3HB0A 4GOOD 5G41A 4BQPA 3YASA 1GUYA 3P2EA 4OHOA 2QAGC 3AOGA 3L6CA 1OLXB 1PWZA 3N39C 2OQVA 1G0NA 2NQ2C 3Q7TA 5T6MA 3EQ6A 4V0KA 3R5JA 3SQOA 2A86A 4YQFA 3K0SA 1K9SA 5LJIA 1HA3A 4UATA 5T6BA 4I46A 3RUAA 3K0EA 1ODCA 2XXJA 5HFNA 2QNRA 5IK2D 4DM7A 3O4FA 3KLOA 3JQ8B 1TJ4A 4MPJA 5T7BA 3P9XA 1CQJA 3D3JA 1G291 3ETNA 4OOFA 1QFYA 3AXSA 5KSWB 2GARA 1PBNA 5B2FA 2XNDA 4F86A 2Y71A 4M1OA 2JHPA 4EMSA 1QFZA 3A1WA 1FYWA 5FL7A 5FWYB 3KQNA 1B76A 4V03A 1D2NA 3T5DA 4RENA 4HNGA 1FLDA 3E5RA 4S24A 1AMOA 1XA0A 4MV1A 1V9LA 3HA2A 3T1HB 3B2NA 3G79A 1U6IA 1QKKA 1MX5A 2JCYA 1C0IA 5DLQC 4KRFA 3DNMA 2C7RA 4DDTA 3DZBA 4OHVA 2G80A 4EHIA 3KD3A 4D80A 1Y8RA 3U13A 1SEPA 3MTDA 5J40A 1FX0A 1ZMOA 5ILOA 1N5RA 4TLLB 1TMYA 4EGQA 1HNZB 4CPDA 3VR4A 2VCEA 3CTPA 3J81A 1O0SA 2RGAA 3GN2A 3ZCQA 2GKSA 4HG2A 3G8YA 5CDFA 1T1EA 3WRYC 1W36D 3T0GA 1WTCA 4H1UA 1U63A 1PR4A 3N5KA 3EBPA 3DL2A 3SJBA 2ZBFA 3BVPA 3HJHA 3MCUA 3RKUA 1RYEA 1I3OA 3QV1A 1X3LA 4PLFA 3EBOA 5ABPA 2HEGA 4LK2A 1RYHA 4KNYA 4EJ6A 5EHQA 4CLDA 2X4DA 4KXLA 5BN3A 1JHZA 1RPNA 3AZQA 3IE1A 4G5FA 3P32A 3IRVA 1QG0A 2VJPA 4M46A 1L3IA 3IP1A 4X24A 1T4DA 4BBJA 1DEXA 4L4XA 5A04A 1KO7A 1K5GA 1CIJA 1YQGA 2HA5A 2I6TA 4FOPA 4TQAA 1M34A 4S0ZA 3ENNA 2HUNA 1Y89A 1UODA 2ST1A 3PNOA 4QAJA 4XB1A 4DB4A 3OPVA 3THOA 1GRNA 2L17A 5JRDS 2VJBA 3RVBA 4WN9B 1NBME 2W8ZA 3AI7A 2C94A 3EE6A 2R86A 2EZ9A 2I66A 2IDZA 2D1YA 4P7BA 4YRLA 3U5TA 4OAQA 2AC2A 4DWWA 3V6MA 1OFGA 2Z43A 3V4OA 4O6VA 4AF8A 4P35A 1SVSA 3OLWA 5AKKA 2FWPA 1IXZA 1U9ZA 2IZ0A 2OM6A 1PSDA 2QP4A 2WU1A 3AFIA 3DZGA 4MV5A 4AN4A 1BHSA 1XZGA 3WP1B 4I4TA 2NUBA 4M88A 5EKDA 2OK8A 5B36A 3MWFA 5IZCC 1XCLA 1M8GA 5SICE 1P7YA 2HCBA 3GA5A 4C29A 3RHFA 4E4YA 3ZVNA 3KXKA 1YRBA 3T41A 5KYXB 3BXGA 3RYIB 1KEWA 1YKGA 4EFNA 3E9NA 1SXJE 1RFLA 3LWZA 4L76A 2YHUA 3O1IC 4OUDB 1QVAA 2DPMA 1VJRA 3I01A 3JZMA 3K0KA 3WLRA 4FEEA 5F2OA 1YRYE 3LOUA 2VYVD 4FFNA 1MGPA 1FPMA 1Z2EA 2JI7A 1ZDMA 2V54A 3NGLA 3JAKA 4KO2S 3U4CA 3WKCA 4D4HA 4PQYA 3MFQA 2P65A 4YMHA 1J2TA 2R6GA 3C1AA 4BO8A 1KQOA 4EJ0A 1MF7A 4RYLA 2OC9A 2IXAA 1Y7TA 3EEBA 4PZEA 4NOJA 5ER6A 4JOSA 3MVEA 4HX9A 4JBIA 1NX9A 3IEVA 3HBLA 4P4TA 5I4CA 4OKNA 5T41A 2ISQA 2QD4A 5GONB 1JT2A 1BN7A 4FKMA 4LFBB 4FGSA 1NIJA 2QG6A 3A6HA 2FVYA 4IMIB 4WZAA 3U48A 1QZTA 5ALSA 1EUDB 5DHRA 3N0TA 1TPZA 1MKYA 1Z0KA 2G71A 5D3KA 5HZMA 3D6FA 5FF9A 1ECCA 2PMFA 4YYEA 4XM0A 3LBNA 3W04A 1PZGA 3GBPA 3A1TA 4FS3A 3W2IA 1APBA 2VDNB 4PHCA 2M6LA 3OJWA 4G07A 4RCYA 5AESA 1OWNA 3DT8A 4YV1A 1IULA 5AUPB 4KXNA 2AR9A 1T3GA 2GCNA 2PYDA 3F90A 4NQZA 1QUEA 2I3ZA 2YASA 4PY2A 2O2HA 1L7OA 5KYUA 3KTOA 2VZ0A 4RFVA 3DO6A 3U16A 1O97D 3PXUA 4ILEA 1A7JA 3QK7A 3VHLB 1ABFA 3BWVA 4L9RA 1KRHA 1S01A 4G0YA 1Z15A 1GA1A 1O94C 2RGNA 5AKYA 4WVFA 2QPLA 4B1FA 1JE0A 3UJDA 3ZTYA 4AW9A 2XOKD 2WIKA 4NYJR 1FP7A 2VEDA 1H2YA 1LUAA 2EJWA 1QVZA 3PQ4A 4U8GA 4E03A 3QJ5A 2EFEB 4ID3A 4NS4A 2ZJOA 2ETXA 2P7IA 4J7CA 4K8OA 3UW1A 5E7QA 1T2NA 4OP1A 4D44A 3ZBUA 3OU2A 2NU8B 3IP3A 5JD3A 4PZUA 1AS3A 1NW6A 4LGMA 2HZBA 2V4MA 2JJQA 1Q84A 4OFXA 1UK7A 4DLTA 1ZK0A 3THWA 4GI5A 1Z06A 1T2CA 3DJYA 1EJ2A 2QSJA 3QXXA 4MB0A 4D9MA 2FWIA 2VP2A 1BVHA 4O2BB 4Z1OA 2YFKA 3KR1A 4R3UC 5I7VA 1CUYA 3FCUB 2XWPA 1KEZA 3SEZA 4XVCA 4MKXA 1ZAKA 4AJIA 1LW6E 3B3QA 3CZMA 4OA8A 5BPFA 4ZMRA 1F38A 4IRMA 1NNLA 2CFCA 2IKQA 1F8FA 1HZJA 3GR6A 3V1LA 5KPDA 5JNLA 3DMRA 4JVOA 2A5JA 2WJ3A 1OFUX 3CISA 4KXWA 3UH0A 2GBCA 2JH3A 4EO9A 1DCTA 3WWPA 4FOOA 2EBWA 4KPUB 1RCTE 1U04A 3L40A 5BT9A 5A9RA 5G1OA 3MA0A 5FP0A 1J8DA 4YP0A 3TDKA 5DMHA 3UJ3X 4ZMBA 3EAQA 4IX9A 3BXXA 2VATA 3OLVA 4KFCA 3T7DA 4GU5A 2FEPA 1PS9A 2ZTUA 3F4BA 3IUQA 3KYCA 4NZMA 1BOOA 2WK1A 1P72A 2JGFA 2X6QA 3D59A 4HLUC 4RDHA 4UUPA 1P7PA 1U3VA 2ZSIA 4N3BA 3EDRA 4C2BA 4GNKA 2OILA 1FMCA 3EDMA 2RK4A 2GN9A 2EKLA 2Y4OA 1D09A 4C3OB 1T9BA 2RG1A 4BP9A 1T8YA 1X19A 1EDEA 4HNHA 1QTQA 2W83A 1QFMA 1EB9A 4HMQA 3UC9A 3WNCA 1CQPA 2RGCA 4P4SB 4MJLA 4WKPA 4DLNA 3C6BA 3TXAA 3TQQA 1PJRA 3MN1A 1GUBA 1KXZA 1LBIA 1L9XA 3BGDA 4B0PA 3WGUA 4IGAA 1JKJA 4LBZA 1GNLA 1KNXA 3HZRA 1KHHA 1B1CA 4A8JC 3ZCSA 1C1XB 2FSPA 4F3RA 5JJBA 5KOJA 1CQIA 2PUWA 1UBMS 1W4ZA 3GRKA 3A6DA 5ILGA 4HT3B 2PD6A 4RPGA 4RVHA 2ZTSA 4K9SA 3PHLA 4R3NA 2UVPA 3SPXA 3EXAA 3EZ7A 3AVVA 2XRZA 1JJFA 2H7VA 3E2PA 1RE0A 1R15A 4XKJA 4PPGA 1N2CB 4BC0A 2BFCB 3I2HA 3VV3A 5SZKB 1SRRA 4EG1A 5DEOA 4WMLA 2BELA 4NFYA 2LCIA 1YFJA 5J47A 1NLYA 5D2CA 4AKHA 2ODWA 2C1XA 3A25A 3PQDA 1E2EA 4YRIA 3U09A 1JHRA 1UEXC 2ECOA 4EW2A 5IT5A 4XOUA 1V48A 5B7NA 3Q9SA 1FU4A 2DFKB 2XMZA 4EFDA 2PXCA 3TCNA 2IXTA 4HDQB 4I1YA 4RMNA 4A0HA 1OB2A 3EZ9A 2IZ7A 2PTHA 4XAQA 5EKUA 3W5HA 1P6QA 2JI6A 4XB6B 4AS2A 2W0MA 4FZ5A 1PR9A 1Q74A 2YN0A 3L18A 5MF6A 5J59A 2Y92A 1VPDA 3FPCA 1MUUA 2IGBA 4JR0A 4ZD6A 4DHWA 3ZR4B 4R84A 2D1RA 5BXYA 4DB2A 3JY6A 4H77A 4YDSA 3ROQA 2CV0A 4YJDA 2DUJA 3ZIAA 1ZVQA 4INAA 1ICIA 1GP2A 3QJGA 4ADSG 3N6VA 3ZHRA 1MOZA 1UDCA 3KLBA 3F78A 4NBVA 3VR1A 4Y9UA 4YMTA 3SLKA 3L0SA 4HXYA 4NAHA 4FM9A 1GGHA 2A4MA 3DV9A 1HSZA 4Y2QA 3WYAA 1OX4B 3CR7A 4CLXA 5K4HA 1SCAA 3IQXA 4Z4FA 1NG9A 5BYKA 2B92A 4WKCA 4G0VA 4MUHA 5FI5A 3UAXA 5LMZA 1CS4C 4OYRA 1VG0B 1JZTA 1JKFA 1DJPA 4ZHQA 3S1SA 3QPBA 5GAJA 3SNHA 2HK9A 1EAMA 3HGTA 1VBKA 1VIDA 2Q3JA 2QB5A 3CKLA 3ZYCA 3DAFA 5LLTA 2BFOA 3W8EA 2YX1A 1E58A 1MC4A 4W9NA 4D0LB 2CDCA 2Q2QA 4O2AB 1JZSA 2I5PO 3PV0A 4FWBA 3N6RA 2X14A 3OJCA 4ZVQA 4Y3UA 1NBHA 3ACBA 3F6EX 3JD4A 5IK2A 3CN9A 3ESZA 3EWNA 2LNDA 3NOVA 4LCBA 3ETCA 2I2DA 5JWHA 1D04A 5CDHA 4ND8B 5BSWA 1S2IA 2V7UA 3EIXA 4G5XA 4EHHA 3ND9A 4F2WA 5LZ2A 3X1ZA 5IVHA 1JHOA 3IXMA 3JZAA 3THRA 4D4MA 2GNOA 4O5AA 3WQHA 4M86A 3B7GA 1T4GA 1TO6A 4FYMA 2IY7A 2CHVA 4ZOLB 1E3EA 3TQOA 1FMTA 2CZCA 3DPIA 1S89A 1L5WA 3N2GA 4HEA1 2IXEA 4LJAA 3E9ZA 4OP2A 4YYZA 1OWOA 2AI3A 4G8BA 3PEWA 4JJ7A 4LNUB 1QHNA 2G5CA 4B32A 3GPLA 3RS4A 2I4IA 1Y1KE 1MD9A 4KRXA 4X8OA 1JBKA 2H0RA 8ADHA 1XFAA 4RD4A 1N1EA 2RIPA 4TL7A 1CP3A 2VQ3A 4L8LA 1GDHA 1FRFS 3N8NA 4AF7A 4IH9A 5J2UB 3DS8A 3L6OO 4RZHA 4CMIB 2CJWA 1OAAA 1GN9A 5BNWA 1XDZA 3K9QO 3DP9A 1HG1A 1GCOA 4PYQA 4RAOA 4DLZA 3UWSA 3ZG6A 3ET4A 3ZYZA 2ZI9A 2F3UA 3AEQB 3C43A 2JLVA 2OOKA 2EHJA 3L8EA 1W8DA 3MJEA 2BHNA 2ADOA 3COPA 3PWZA 5LYJB 3CNOA 2GYYA 1ORTA 3AFNA 1ZUWA 3F3MA 4HDSA 4GPBA 4KMOA 5EERA 3R7NA 3O90A 4LXUA 5CG1A 1C4XA 3Q4GA 1DOAA 2H2HA 3CRVA 5M04A 2W6NA 1QVRA 4G5YA 2X0DA 2JDID 4ATNA 4LSGA 3O1LA 3S55A 1WVIA 2O23A 2Q0HA 3NALA 4LISA 4WECA 2KX7A 5IDXA 2B94A 1DRJA 2ZQYA 3T6KA 3W1EA 4DIEA 3UWMA 2ATEA 2PPVA 4BWVA 2IY8A 2KMLA 4LZZA 3A9CA 5ECYA 1OLSA 1KTIA 1LI7A 3MTIA 1AQLA 4ZJUA 4QU8A 3RQIA 2VJMB 2P4SA 4YREA 3ZCPA 4WKOA 1UMBA 1U98A 2VAWA 3JD3A 2R6AA 4ZU3A 1U2SA 3DFZA 1WU7A 2WTAA 3ZWBA 4CKCA 1D2HA 3WLQA 2I9KA 1MDBA 2NZYA 1YDMA 3EFBA 2EIHA 2ON6A 4RQAA 3AJRA 1E79D 5T4BA 3TJMA 4IDOA 1LK0A 5KTPA 4WNAB 5BSHA 1P7WA 2CYBA 3EJ6A 1I7SB 4L4SA 3NFRA 1OBOA 3OT1B 2ZIXA 3D7KA 4BV3A 2ECFA 1F2VA 3UMRA 5F23A 3HBJA 4JCCA 4RAQA 3E23A 5A9TA 3IDQA 1G3RA 1RQ2A 4MV0A 2LVBA 3VDXA 3U3KA 4EI2A 4JELA 2GEBA 3GP3A 1HNWB 4TROA 4H7FA 4LOLA 1J8VA 3L6UA 3ZK8A 4YPOA 5A6VA 2Y9MB 2NMVA 3FUCA 2PUGA 1RWWA 5TX7A 3W5AA 2P6RA 2BFFA 6CHYA 3VV2A 1O08A 1CY6A 1V6SA 2GKOA 4HH0A 3PC3A 3H9BA 5TPWA 2CHQA 2ZBRA 3NUZA 3BERA 4NIMA 4PSCA 1FVHA 4C4ZA 1XDDA 3JX9A 3L82B 4WZ6A 4FCVA 1T9DA 3GI1A 5DFAA 4FOLA 1L2TA 5IDQA 4U9UA 3GJ3A 4N47A 4N76A 4D41A 1VL6A 1N7HA 1U3FA 1ZLYA 2JCXA 2WVJA 4M1MA 5IM4F 1D4OA 1P9WA 1PZHA 3F3KA 3N2EA 3TLZA