5JYCA

Crystal structure of the e153q mutant of the cftr inhibitory factor cif containing the adducted 14,15-eet hydrolysis intermediate
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
297
structure length
297
Chain Sequence
AEEFPVPNGFESAYREVDGVKLHYVKGGQGPLVMLVHGFGQTWYEWHQLMPELAKRFTVIAPDLPGLGQSEPPKTGYSGEQVAVYLHKLARQFSPDRPFDLVAHDIGIWNTYPMVVKNQADIARLVYMQAPIPDARIYRFPAFTAQGESLVWHFSFFAADDRLAETLIAGKERFFLEHFIKSHASNTEVFSERLLDLYARSYAKPHSLNASFEYYRALNESVRQNAELAKTRLQMPTMTLAGGGHGGMGTFQLEQMKAYAEDVEGHVLPGCGHWLPEECAAPMNRLVIDFLSRGRHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CFTR inhibitory factor
publication title Pseudomonas aeruginosa sabotages the generation of host proresolving lipid mediators.
pubmed doi rcsb
source organism Pseudomonas aeruginosa (strain ucbpp-pa14)
total genus 109
structure length 297
sequence length 297
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5jycA01
4HXFB 2ZYSA 2EDCA 2XUKA 4UFOA 1LPBB 3O4GA 3AINA 1FFDA 4PO3X 2ZVDA 1XZJA 2JGIA 1MT3A 3WKCA 1A7UA 4FMPA 2O2IA 3ESDA 4WY5A 5ALHA 4MQLA 4OYLA 2GYVA 3R3ZA 4L3WA 4BB0A 4EY4A 5LP1A 1H23A 3IVMA 1UOPA 4G4IA 4MEBA 4X6XA 4BCBA 1QO7A 3CCCA 2WUGA 4P9NA 2HADA 3QPCA 5DNVA 4DYHA 4CG3A 2WU4A 1UZAA 3BDVA 2XUGA 4BZWA 2YYSA 3NGMA 3AUKA 1QZ3A 1R4ZA 3NUZA 4OB8A 1P0PA 3W2TA 2WHQA 4OB6A 3LCRA 2XMZA 3BIWA 3W9BA 1KU0A 4BC0A 4K6KA 4PSDA 3DDUA 1XQVA 2HA7A 5DWDA 3L1IA 4JNCA 4J3JA 4U2GA 4DM7A 1XZAA 2WUDA 3HJUA 4GLBA 1SFRA 2PBLA 4JYPA 3WL5A 1BEEA 5K3EA 3ICWA 2BUAA 1LZLA 3K2IA 3W04A 1YASA 3V9AA 1QFMA 2XMRA 3BE8A 3I2GA 2DHEA 5CT6A 4BAUA 3R40A 3DL7A 4WDQA 4ZREA 4X71A 3M81A 4Q34A 4GHWA 2HM7A 5AOBA 1TIBA 4O08A 4G1FA 3G9XA 2HA3A 4QWMA 1CUGA 1HDEA 5AOAA 4Y7DA 1ACLA 3NOXA 2VAVA 1L7QA 4X93A 5A71A 4B85A 1WCYA 3UUFA 2WG0A 5JANA 4MXDA 4QNNA 5HQ3A 1XZEA 5CT4A 1XQYA 4BTLA 4Q82A 2ZJ7A 2EEPA 2H7YA 4W63A 4AQDA 1E8NA 2Y1KA 1CUXA 4G8BA 4KE7A 5LLSA 2HFKA 5IKXA 4UFPA 3STUA 5BWBA 3CCBA 2WSLA 4MYSA 1P0QA 2R11A 1VXOA 4X92A 4OUKX 3HABA 5ALSA 3C45A 2QJWA 3WIOA 4UHBA 1A8SA 1YA8A 5LZ5A 4CCYB 4B0OA 1LZKA 4BVLA 1QO9A 3I2FA 4F0JA 3WI7A 1E3QA 5ALOA 1ZJ4A 3EQ9A 5AHXA 5H3HA 4ZXFA 3O4HA 3C8HA 3U1TA 1QTIA 4AO6A 4UBIA 4E46A 4NS4A 5AKXA 3BF8A 4FLEA 2OCKA 1U4NA 3A6ZA 1ZD2P 4J7AA 3D4LA 4ZV7A 4HRXA 4WFKA 3I1IA 3H19A 2Y6UA 2XUIA 4AN0A 2PSJA 4GEGA 5HCUA 3ZLTA 3WK7A 5LZ4A 3DYVA 3GELA 3H1BA 3GBSA 4X00A 4C6HA 2I03A 1WHTA 1GZ7A 1LPSA 4AXBA 5DNWA 1QFSA 4ITVA 1F0PA 4BATA 2AJLI 5CXXA 4Z49A 2B4KA 4MEAA 4XJVA 5AKHA 2C5GA 2OAEA 4MWTA 5ALJA 4WY8A 4QEKA 1Z68A 2WHPA 1MX5A 1MX9A 1N5RA 1CUJA 4EY6A 4UBKA 3PE6A 3D59A 1XRRA 1ODSA 3A2NA 1U65A 4BCDA 1XLWA 3WL8A 5ESRA 3H1AA 2WTMA 2BFNA 4EY5A 1BEZA 5DYYA 3FBWA 4B83A 1CUZA 3FSGA 3H17A 2OLEA 1CUVA 3AJAA 2HA2A 3V1KA 2QS9A 4J0KA 4FKBA 1XRNA 4W1RA 4Y2VA 4AB1A 3FAKA 4H7FA 5C8VA 2CBGA 1YSCA 1QIGA 4YK7A 5ALEA 1ISPA 1O6FA 4X6UA 5ALNA 5FDFA 4M0FA 4Q3KA 3W06A 3VJKA 4GDMA 5ALWA 3AIOA 1LBTA 1CUWA 3B12A 4UPDA 3LS2A 5KBYA 4OYYA 4GECA 4OSEA 4J0DA 5HF9A 5IVIA 5JAUA 2BCEA 3AZQA 4U2BA 1XZLA 1CV2A 3MUOA 2QMQA 3D2AA 2ORYA 4FLFA 3R3VA 1GQRA 3PF8A 2WUFA 1BN7A 2GZRA 1R88A 4UHEA 5LZ8A 4YASA 2HU8A 2OAGA 3WA7A 1CUCA 1R1DA 3O95A 2H9YA 3PF9A 4B7ZA 3V1MA 3DKRA 2J4CA 1EK1A 1QGED 5ALVA 1CQWA 4BVKA 2WIGA 5C8XA 2XT0A 5EHNA 1ZI6A 1EK2A 2OPHA 2Y6VA 4MYDA 3LP5A 4MWSA 1OCEA 2PU7A 4LHEA 1A88A 2XUDA 1SCKA 4H7KA 1CUEA 1XZDA 2J3QA 3G9UA 2PVSA 4DSZA 4DSAA 1DT3A 1K4YA 4NVRA 3A2MA 4KRYA 1JU4A 2E3JA 2OXEA 4KE9A 1WM1A 3EF3A 1QIHA 5F4ZA 1N5MA 5FPQA 1AKNA 2ZSHA 5CBKA 2G5PA 3ESAA 1M33A 3IDAA 5ALZA 3H2IA 1UOOA 5IVDA 2XMQA 3AIKA 4LXIA 2Y2UA 3ZWQA 4L9AA 4AMZA 2EDAA 4BP9A 4ARAA 1H2YA 4BDTA 3WYNA 4X90A 2QVBA 1THTA 5AP9A 4B80A 1XLVA 3FVTA 4Q3LA 2XB6A 1HLGA 1YB7A 4J03A 5JD4A 4BCCA 3I2IA 1EDDA 3ICVA 3OM8A 5AI5A 1XQWA 4C88A 5AKLA 1JJIA 3QH4A 2VQ6A 3B3QA 4AZ0A 2WHRA 4X7BA 5JIBA 2VT7A 5C81A 3BWXA 3KSRA 2QR5A 3IUQA 3L1HA 5AM5A 3SX4A 4KE6A 3E1GA 2QTBA 2WU3A 3C8DA 4Y2PA 4AMYA 4CIBA 2X5XA 2DR0A 2CKMA 3IIIA 1UKBA 1H22A 3LIPA 3R41A 1H2WA 2FJ0A 5BOVA 3C6ZA 3B5EA 4NMWA 3I6ZA 4LXHA 3UMJA 5AM4A 1N8SA 2XQFA 3FWHA 1J07A 4UBLA 2ZYIA 1XKTA 4Y2YA 1W76A 3IULA 3HZOA 2HA5A 3R3XA 2VJCA 1W52X 2QT9A 2OGZA 1UXOA 4TVKA 4UHHA 2Z5GA 1XRMA 5ALDA 1J1IA 4A23A 2WIDA 4DNFA 4KAAA 5D7BA 1VOTA 1XKLA 4CCYA 3WK4A 1EVEA 1G66A 5AKIA 3ZPXA 2VATA 2HRQA 3G0BA 4RNCA 3SC2A 4UBOA 3QYJA 5T4EA 3QMVA 4QWWA 3EBLA 3BJMA 1GPNA 3FLEA 3F9CA 1TCBA 5HFAA 2G5TA 5AK5A 3WJ2A 5A6VA 4FHZA 1EI9A 1MN6A 5A62A 1EA5A 3DLTA 1BE0A 5CH5A 3CN9A 4IH1A 1VA5A 4IO0A 5AK4A 2JGEA 5ALUA 4J0CA 1IUPA 3R0VA 5LKAA 3H2JA 3G8YA 5SYNA 3STTA 2GBIA 1CPYA 2VA9A 3C5VA 1T2NA 5CMLA 4IQ4A 2XMCA 2ACKA 2XI4A 4P92A 3GA7A 1VZ2A 2G63A 4DMFA 1UKAA 5K3FB 2CEKA 1UT6A 2XMSA 2AJBA 5A7FA 4K2AA 3FYUB 4ROTA 1BCRA 2V97A 1I6WA 5AI6A 1TRHA 5EIHA 3WK5A 4C87A 4LIPD 4V2IA 1QIKA 4FTWA 2OCLA 3TGLA 1ZGCA 1LPPA 3I6MA 1E89A 4CG1A 3DJYA 4N8SA 5IH7A 2RGUA 2JIDA 3D7RA 2ZJ6A 4F60A 4X91A 1LPMA 2WTNA 3FYTA 1CR6A 1GKLA 4M0MA 4OB7A 1XFDA 2WIKA 4X85A 4HS9A 2ECFA 1EH5A 4EB0A 4H77A 1CUYA 4B82A 3QPDA 4PSUA 2GBGA 1LGYA 1VE7A 3HXKA 3U0VA 4W1SA 2QUAA 2RAUA 2WIFA 1X70A 3ZLUA 3I6YA 4BRZA 4W1QA 4UUQA 4EA6A 3DD5A 5ALGA 4Y2JA 1YR2A 1QONA 5ALTA 3M3DA 3QBJA 1Y37A 1ETHA 4FFVA 4DMKA 3W9UA 1SCIA 1TCAA 2IX9A 3WZMA 2BGRA 1WOMA 2XUHA 4G8CA 4B81A 5AO9A 1MTZA 3C70A 4UBMA 2WQZA 2O7VA 5CH3A 5EGNA 1XZMA 2PUJA 1KU6A 4OD0A 1WPRA 1JU3A 4JUIA 1C7JA 1Q0RA 1TQHA 1VA4A 4UHCA 5ALPA 4AN1A 2OCGA 4EY8A 5AI4A 5I9IA 1MAAA 5YASA 4KR0A 2B61A 2AJCA 3PDCA 3D2BA 4I3FA 1TKRA 5DLPA 3V1LA 1ZJ5A 1CUUA 4FBLA 4E11A 4BRSA 2OG1A 1YA4A 1W1IA 3AZOA 1QTRA 2WILA 4N5IX 4JYMA 2GYUA 4HZGA 5AKGA 1WB5A 5DYWA 5CT9A 1ZGBA 2PPLA 1IZ7A 6YASA 1XZIA 5ALKA 2XQJA 1MU0A 5KWJA 1J2EA 1C7IA 1AMNA 3WK6A 2C5FA 5FP0A 4WFJA 4HVTA 1IZ8A 1CFJA 2WFMA 3BJRA 2Z8XA 2VJBA 3EQ8A 3DOHA 5FV4A 1D07A 2QKYA 3ED1A 3O4JA 4K6GA 3G9ZA 3QMMA 4K6HA 1HPLA 5JASA 2ZYRA 4I4CA 4UHFA 5CT8A 1H2ZA 5AI8A 3WKDA 2QJRA 1L7RA 3HC7A 4E14A 2R8BA 1VZ3A 2P8SA 3O4IA 1XZFA 4FNGA 3G02A 2ES4A 1ORWA 5AH0A 2X76A 3MUNA 2RIPA 5A7GA 1DQZA 5HKBA 1LBSA 3WWCA 1YAJA 4C4YA 1E66A 4OU5A 4BC1A 3VXKA 2PX6A 5HK9A 1MNQA 4H0CA 2WJ4A 1EB9A 2I3ZA 1DX4A 5K3AA 1BS9A 1J06A 1IUNA 3WL7A 2HHAA 3F67A 3DKKA 3OTQA 4H7DA 1UK9A 5DNUA 2X8BA 4BE9A 1CEXA 2DCMA 3WMRA 2D0DA 3C6YA 2GZSA 4IHAA 3ZLVA 2I78A 4B84A 1EDEA 2HRRA 1ZI8A 2XUJA 4N8EA 1SC9A 4UBNA 1FFBA 2XMDA 2HA6A 2RHTA 4H7HA 3AIMA 2HA4A 3PUIA 4M0EA 3KDAA 1KEZA 3RM3A 3S2ZA 2WFZA 4PQEA 4BYMA 1UK8A 2W6CX 3H04A 5JAPA 1DT5A 3ESCA 5JAHA 1UFOA 3F96A 2O2GA 4EBBA 2XUOA 5CW2A 2OCIA 3MGAA 2VJDA 2C0QA 3VKFA 4PNZA 4X3CA 4BAGA 4GBGA 1DX6A 2DFPA 2WIJA 1CUAA 1JJBA 1QIJA 3AILA 5IVKA 4J0HA 1UWCA 3RLIA 4FWBA 3H2GA 5AM0A 4YX9A 4QDUA 3G0DA 4DMHA 5FRDA 3O0DA 3HEAA 2OGTA 1MO2A 5KREA 2OQVA 2QXTA 5AIBA 1Q84A 2IITA 2Q0XA 4QDXA 4XWGA 3GUUA 1BN6A 4OPMA 1AZWA 2BKLA 2YXPX 3WKBA 1GPLA 3EIOA 1K6EA 2Z3ZA 4QA9A 2BUBA 1DWQA 5JATA 1CLEA 4GXNA 5K3FA 3D5EA 1PV1A 3P2MA 4EZIA 5ALLA 1RP1A 3FOBA 3STVA 3BL8A 4XIIA 5JD6A 3FYUA 3IB3A 5SYMA 4WJLA 1MNAA 1PJAA 4QLOA 4C4XA 2LIPA 2K2QB 4H35A 4JH0A 5CURA 1FSSA 4BZZA 1HQDA 2BAGA 5AK6A 5HF8A 4KAFA 1QOZA 2J4FA 3OG9A 2QUBA 4WCVA 5ISMA 3WWOA 2V96A 1F8UA 1SCQA 3WKAA 3IUJA 3OC0A 3E0XA 2DHCA 3KWFA 3ZV7A 3FLAA 2GBCA 2CMFA 3A70A 3VVMA 5LIPA 3M82A 4TGLA 3WKEA 2ZJFA 3QMWA 1ZOIA 5AJHA 3M83A 4QDZA 2HDWA 1LPNA 5LYYA 2PU5A 5JZSA 2Z8ZA 3JWEA 1WHSA 1JMKC 3DL4A 3R3WA 5K3CA 1FFAA 1T4MA 4Y2RA 4FDMA 3IUNA 1QIDA 3RKSA 3PICA 2XQGA 3QM1A 5FLKA 3WL6A 1VE6A 4U2EA 2AJ8A 3FSGD 3SK0A 1UKCA 2XQKA 1TCCA 1UK6A 1LPAB 2PSFA 5ALXA 1CUDA 5AKYA 3ANSA 1O6GA 5JARA 3HRHA 1AGYA 4LKOA 1RWQA 3FLBA 5FKJA 1ZICA 2XUFA 1VKHA 1JJFA 5AKJA 4MQMA 3DS8A 2OQIA 3OURA 4RPCA 4W9RA 1EB8A 1WB6A 1LNSA 2W22A 3R3YA 2C0PA 2O2HA 1FFCA 1TAHA 3PI6A 4U2FA 4DNOA 3A2LA 5JZBA 3PFCA 2C58A 5ALYA 2QZPA 5A7HA 2H7XA 5FUMA 4N5HX 1X2BA 3HYSA 4ETWA 4UBJA 2ROQA 1YB6A 2RHWA 4JEIA 4UFNA 1EINA 1G4HA 1QJ4A 1CIJA 1R3DA 1ODCA 1YCDA 5EIEA 3WZLA 4EUSA 5EHXA 1FFEA 4A5SA 4L0CA 1AQLA 5EHQA 4ZWNA 5CTAA 4OU4A 2I3DA 3I2JA 4GW3A 1CUIA 3OPMA 4D9JA 4RE6A 3O9MA 2HFJA 2DQZA 1R9MA 2PSHA 1CUSA 5K5EA 2FUKA 3N2ZB 3DEAA 2JGMA 4NZZA 4AZ3A 1XRQA 3FVRA 4YPVA 2VJAA 1FJ2A 5T4BA 4XVCA 4IH4A 3I1YA 2BJHA 1DWOA 3VVLA 1ZD5A 1A8UA 3YASA 5AIAA 1F6WA 4G5XA 2HL6A 3S8YA 4WFIA 5ALRA 2WKWA 1ORVA 2VF2A 3HI4A 1Y7IA 1AX9A 2XMBA 2D5LA 5LZ2A 2JGKA 4AO8A 4DLNA 4HAIA 4CCWA 4FFWA 4CG2A 5AKKA 3CN7A 4KACA 2PKYX 4LYEA 2WJ3A 4KE8A 2CB9A 2GBFA 4Q1VA 3L1JA 1E8DA 5AM3A 3RK4A 4B6GA 4QE3A 2XDWA 3I28A 3WIBA 1QIFA 3KD2A 5AM1A 2IIVA 5JD5A 1CUBA 1LLFA 5CH8A 2ZYHA 3WLAA 1UOQA 1K63A 4CI9A 5EHZA 3ESBA 1WPXA 3KWJA 3STXA 1MX1A 3LLCA 4ZGBA 4DTCA 5EFZA 1YAHA 3F8SA 1GPKA 3CXUA 4FBMA 1P0IA 3LIIA 1MJ5A 3WK8A 3K9BA 1PFQA 4BE4A 1DU4A 3VISA 5ALMA 2VEOA 1XZBA 4P08A 3QZUA 3PFBA 3FNBA 2WM2A 5K3BA 3WQHA 1GKKA 5EI5A 1X2EA 2B9VA 4BVJA 2PSDA 2VAXA 4F21A 4CFSA 3V48A 4RE5A 4HRYA 2V9ZA 3G0CA 1U8EA 5ALIA 2RONA 3G9TA 3TRDA 1IVYA 1H2XA 1S8OA 1BCSA 4OCZA 2JF0A 3JW8A 1ZIYA 4E15A 1R9NA 4Y2TA 5E4JA 5HK8A 4DGQA 2UZ0A 1TK3A 3D2CA 4G9EA 3BF7A 5IVHA 5EIAA 5HF6A 1NU8A 3FYUC 1GGVA 3OOSA 1F0NA 1XZCA 3T4UA 3HLKA 5D3ZA 1JT2A 4PW0A 3WJ1A 1DINA 2QRUA 4KEAA 5E4TA 4BTVA 4X94A 1VJ5A 1B41A 4H7JA 5AKEA 2V98A 2VSQA 1IMJA 4Q05A 3VDXA 1ZI9A 3VJMA 3C43A 1HL7A 1WB4A 1EVQA 4LXGA 3WYDA 5HKAA 3HSSA 3STWA 1A8QA 5DTJA 2BUCA 4CIAA 3E3AA 4EY7A 1Q0ZA 3PUHA 7YASA 1ZD3A 4P93A 4B9AA 5AI0A 1DQYA 1R50A 3DNMA 3QPAA 5JAOA 4B0PA 2WLSA 3C5WP 3O9VA 3C6BA 4HXEB 5CT5A 2OGSA 1XZHA 1YS2X 3H0CA 3AFIA 4W1PA 3NWOA 1W6RA 2PUHA 3DCNA 2WUEA 4H7EA 4ZRDA 3UUEA 3ILSA 2XQIA 3D3NA 1K5PA 1XROA 5DYTA 1VXRA 4RGYA 5J3JA 4U2DA 3FCXA 4X6YA 3E4DA 5BWCA 1BROA 3IA2A 1Y7HA 2WG1A 4N8DA 1ODTC 2H7CA 1U2EA 4Y2QA 4UHDA 4L72A 1GT6A 1XQXA 4Y2XA 4ARBA 1NU6A 5LZ9A 5ALQA 3HACA 1YS1X 4Y2SA 4LYDA 3X3HA 4HXGA 1XLUA 5ALFA 4BBZA 3QVMA 4DNPA 3I2HA 5D6OA 4GWLA 2WFLA 5AICA 5AOCA 1CQZA 2HU5A 2JGFA 1ACJA 2JEYA 4G8DA 4A16A 5HF5A 1AC5A 5JYCA 2DHDA 4WDRA 2PL5A 5DTIA 1CUHA 4GI1A 3IURA 3GROA 4G4JA 1THGA 2ACEA 1EX9A 4INZA 5C8ZA 5HZGA 1W4LA 1GQSA 2ONCA 3ANTA 2B20A 2ZSIA 2PM8A 5FPPA 3Q0TA 4J0IA 3KXPA 5D3KA 3IBTA 1JKMA 3IUMA 2GYWA 5CXUA 4G4GA 2QOEA 1XRLA 5HQ3B 3WWEA 4ZI5A 3WWDA 4DNQA 1G42A 1SOMA 3RARA 2CZQA 3V1NA 2XMGA 2QM0A 4H18A 3D0KA 4TPKA 2YH2A 4AX4A 2YASA 1QIIA 3BIXA 5T4HA 3STYA 1ZD4A 4PSCA 4I19A 4BDSA 2AXEA 1AURA 3TEJA 4BP8A 3N0TA 5FXMA 4C01A 5I8PA 1EXWA 3VJLA 5AI9A 1USWA 3K6KA 2CUTA 2RI6A 4J0GA 3T52A 4X95A 5BV7A 1QIMA 1Q83A 2Y2VA 1BRTA 5KWIA 5E4YA 5T4FA 2XLCA 3G7NA 3R3UA 1XRPA 1BU8A 4HTAA 5K3DA 5A2GA 1E8MA 1HBJA 4KJXA 4KAJA 5C7YA 2AJDA 4PF1A 1G5FA 3DOIA 1OXMA 4DIUA 1IUOA 1EHYA 2XUQA 4H7IA 4F5ZA 3C87A 1GXSA 4Q3OA 2JEZA 5JALA 4QLAA 1QLWA 3GZJA 2XUPA 2H1IA 2C4HA 3MVEA 5E2IA 2CJPA 1NX9A 2DQYA 3H2KA 4EHBA 2QXUA 1JI3A 4FOLA 1EDBA 2WHPB 1L7AA 3G0GA 3WK9A 5DJ5A 3AZPA 5FOQA 1K8QA 3BXPA 1QE3A 1CUFA 5JZ9A 1C4XA 1P0MA 5HFNA 2XE4A 4PV7A 4BAZA 2C7BA 1MPXA 1QIEA 2HIHA 2NW6A 4FLMA 5CRIA 3F98A 5I7UA 1CVLA 1HKHA 4QZVA 3Q8WA 4G9GA 4J0JA 2G4LA 5LKRA 4XX1A 2Z3WA 2WFLB 4KYVA 1VLQA 2HA0A 3ZI7A 1CRLA 3BDIA 4KRXA 3WWPA 3W05A 2FX5A 3DYIA 1DTEA 1XZKA 4B9EA 5LZ7A 3JYHA 2JGJA 1MAHA 4QDOA 4Y2UA 2DSNA 4U2CA 1E5TA 1RYYA 2JGLA 4Y9SA 3KOOA 4ZV9A 3FCYA 3TJMA 3I2KA 1XZGA 2O7RA 1JFRA 5AKZA 2VTVA 4IH9A 1AUOA 2WJ6A 3GFFA 5AK3A 1W75A 4MJ3A 1LPOA 4C4ZA 2XLBA 4C89A 4DMCA 3H18A 1UK7A 4K5QA 3EQ7A 4FNMA 3C6XA 1N1MA 2WG2A 3SWWA 2JBWA 4X97A 4QDTA 3DQZA 2J3DA 3WA6A 3H2HA 1OILA 4S0XA 2PSEA 3F97A 1DWPA 2BGNA 4AO7A 2VT6A 1ZIXA 5JADA 3G0IA 2FJPA 5AM2A 2XUAA 1B6GA 2HU7A 1JMYA 3QITA
chains in the Genus database with same CATH superfamily
3U31A 5E0OA 4ZAFA 3ZHTA 2VC2B 2WSSA 1IIBA 3WYAA 1O6ZA 1IIRA 1RR6A 2XUKA 2CNBA 1VJCA 3IALA 5DU2A 5IWAB 1ZGZA 1LPBB 2BY4A 3RVDA 3KB2A 4AJ1A 3AB8A 3AINA 1U9YA 2ZVDA 2QE7A 4A1FA 2AZDA 1VB3A 2OGWA 3H7IA 3D8NA 3TNJA 3OT1A 3WGVA 4U9HS 1MT3A 3H1TA 1A7UA 4R7TA 2WOOA 3O8OA 3QKTA 5LN1A 2FMTA 1EUDB 5JNSA 2HCBA 1NYLA 1Y5NA 1U0JA 1BGXT 4D0RA 2E4YA 4XVRA 4D02A 2A0WA 1FDUA 1FZQA 4OYLA 1R4NB 3CRMA 1NX6A 1H69A 1OWNA 1RXYA 4X5OA 3OT5A 4B47A 1UXJA 3UK7A 1EUCA 3A2KA 3EDCA 1CY2A 1O9HA 3S2GA 2ABWA 3M6UA 1OH8A 2VO1A 3IVMA 4LTMA 2FQQA 2H59A 3ZXIA 4LV5B 5E1DA 2LDXA 2VK2A 4MB0A 4C0HA 1TF7A 5SV2A 4B44A 4B3FX 4P3NA 4BLVA 5JROA 2NO9A 3CCCA 5J2TA 4BPBA 1GU7A 3O93A 4P9NA 4IHJF 4J29A 2WYWA 4WI1A 4N7BA 3L05A 4YREA 1WSAA 3LJKA 5C18A 1NQWA 2FSVC 3EXG1 3QPCA 2E4UA 3S7ZA 2O2DA 3WGOA 1EWQA 3ZJTA 1I30A 2AS0A 3QE0A 3U39A 1IBRA 4L15A 2B5VA 2RCYA 2YYSA 3NGMA 1WW3A 2DWCA 1Z6TA 2HF8A 2FWIA 2KWIA 4PBRA 4R9SA 1M5UA 3RFTA 3DLPX 3NMUF 3R23A 1M1UA 2BGWA 4KO2S 3A3NA 1KF0A 2RH8A 4IDPA 3MGBA 1R4ZA 4B6OA 3KS9A 3GU3A 3NUZA 3UNXA 1XJ5A 4E2WA 4PN3A 1YDEA 5LU8A 3KQHA 2REOA 3N8KA 3HR7A 2VF7A 3OLVA 3W2TA 4NU5A 2DEUA 1INLA 4IGAA 4HZUB 3ZCQA 4CUKA 1DJQA 3PNBA 3RH0A 4KPEC 1T36A 1BA2A 1OFVA 3ETLA 3LPLA 4L3OA 1EEXB 4MYUA 3TOXA 3HLYA 1A95A 3LCRA 4F91B 1RQXA 2SICE 4I1IA 4A36A 5T8KC 3L7AA 3P9SA 1M5RA 1YIOA 1XQVA 4OXQA 3L1IA 4BB5A 4J3JA 3VI4B 2GZAA 4KCGA 1XZAA 4KYIB 2NMVA 2HHLA 1GTSA 4OMUA 3UHAA 3L6RA 1AO0A 1XMSA 4GLBA 3VKGA 4DN6A 3FMGA 3HDHA 3V2HA 3CUUA 2BUAA 4MARA 2Z6QA 1VE9A 3RT7A 2A5GA 2XMRA 1RI2A 2ZBVA 3DXXA 5G3ZA 1M6WA 5CIWA 1XMOB 1PLJA 2Q6LA 1DEKA 1O4WA 2R6R1 1JQBA 1U98A 1ULZA 3ESYA 2GI4A 4BAUA 4W5QA 3SIRA 1I0LA 1N4DA 1Z37A 3QUSA 4NSNA 4ZREA 2P6MA 2IHZA 4LRYA 1V41E 3WISA 3NYWA 4BZPA 2I5PO 4Z4QA 1R6VA 1U1GA 2I29A 4GHWA 2QUHA 4L85A 5D5PA 4CNQA 1QG2A 1G5TA 3ILXA 5AOBA 5IWCA 4PM4A 1PTJA 1R6UA 1UT8A 2WSIA 1N1DA 5ICCA 1GQYA 5AOAA 1L6RA 3FPSA 3MCTA 2EW2A 4WXRA 5I7OA 1SULA 4MV7A 1XG5A 3B7GA 1RHMA 4CEJA 3FPJA 4GWGA 2CJXA 2G8LA 2VAVA 2H4HA 2P5UA 4RFLA 4R9RA 4KLCA 3BQ9A 1RXUA 4ZYZA 4TYPA 4PLPA 2JRCA 2M6SA 3HLTA 5K01A 4MXDA 2Y93A 3HZRA 2BSXA 1CQPA 3NM6B 2E0IA 1QHFA 3MZ0A 4LHSA 4PPFA 1VLVA 2CCKA 2I87A 3M6XA 1E62A 4KV7A 4LK3A 5CT4A 3T1NA 4B4KA 3J7TA 3QENA 3I5YA 2I1WA 3SI7A 2JFWA 4IOLA 4YUXA 4HNVA 2YNMD 1DAEA 4Q82A 1AKWA 3HCPA 1MO4A 4MQEB 1RJEA 2H51A 3QVOA 4DV3B 2PLNA 4AQDA 3HA3A 1I4TD 1E8NA 3NWEA 4LCJA 4UTOA 2IXTA 3PYMA 2EP8A 2VDPB 1IXKA 2JLCA 3B13B 4HYEA 4JBHA 3WLSA 4MRMA 4HSEA 4ZK2A 4XLZA 3LC2O 3GIWA 3CZ9A 1QK4A 1LLQA 3GLHE 5DCLA 3V46A 1N3YA 2JJYA 4MHSA 3AFNA 3WHIA 1G8MA 3HB7A 4MYSA 3HB5X 1QQTA 1OROA 3FFTA 2Q27A 2ID7A 1ESEA 2PH5A 2JCXA 3UN1A 1T5TA 3U9SA 4W5TA 4OUKX 3AFOA 2IEZA 5TPWA 4EFDA 3LQYA 5CDTA 4DEXA 2CY0A 2CXPA 3W3AD 4UHBA 3ZDXB 2C04A 4G6ZA 4PGGA 2VNIA 1YA8A 5C7OO 4IDHA 4PEVA 3NGXA 4BFSA 3KYIB 4BVLA 2NPOA 4YMIA 3WGZA 4QYSA 1SRRA 4CMJA 1UQRA 2BEVA 3C2QA 3I2FA 2GAFA 5AVTA 4DUGA 2V7VA 1MJHA 1Y1PA 3AYXB 1W59A 5CFLA 3AP2A 3VNUA 1T3HA 3PX3A 4JL5A 3PUYA 3PXBA 4LN1A 5GVRA 3C8HA 1GTRA 2D06A 1QYWA 2QSUA 3SC2B 3GD7A 4AWBA 3ISJA 5KSYA 1E6UA 1PJCA 2UUCB 1FFHA 2GHQA 3KJNA 1ODKA 4J43A 4ZT2A 3BF8A 2G83A 3R7BA 1MGOA 2QLJA 2PYDA 4FLEA 2OCKA 4AY4A 2HNKA 4JEHA 4JQCA 4DSNA 1MZVA 3VSBA 4D3SA 4Y1FA 1ZD2P 3HYNA 3D4LA 2EKDA 2EQ5A 4IJUA 4UUAA 3MRVA 5KOJA 4LQ4A 2CW5A 3U80A 3I1IA 2Y6UA 2BGMA 3EVDA 1N9ZA 2PSJA 3D7MA 4GBED 4I66A 4LA4A 1W8IA 1N32B 4KPUA 3FDFA 1Q21A 4M1ZA 4ATNA 2MHCA 2R8YA 3DYVA 3MT7A 2CCGA 5ITZB 4L4SA 1CIPA 1Q7CA 1P44A 1E99A 3GBSA 2FX3A 1GKIA 1TUEA 4X00A 3HRKA 5GZ3A 1XDDA 1SPBS 3GRPA 1PR5A 2Z98A 2GAAA 4O4HB 3U7FB 1GZ7A 1LTHR 4WTOA 1I4EB 3OZUA 4IDDA 1YZLA 4B3HA 4Z9AA 5HVNA 5FR2A 1I33A 1SHLA 3K0FA 1X9HA 3LKVA 4AXBA 2XA9A 1IN4A 4HYQA 1IXYA 4UCFA 5K8TA 1V47A 4D8YA 4BATA 1JAHA 1J4AA 2XSZA 6CHYA 2I6GA 2AJLI 4M53A 1T5HX 5KO2A 3OPNA 2P2NA 5H80A 5AFSA 5K6TA 2YQZA 1HEYA 1MO6A 1CNEA 3MLEA 3ZU2A 3DNFA 2AKYA 3FXAA 1IQPA 2ODPA 2OAEA 3LNCA 3Q72A 3LNTA 3B3AA 2QDKA 4D5GA 2GFQA 4WK4B 1EUCB 3KFLA 1GCAA 4FQ5A 4OTZA 4LBYA 5D51S 3P9IA 4GF5A 5IAAA 2DJ5A 3NDRA 2F9MA 2FSUA 1QVWA 1N5RA 4Q1CA 4NH4A 2CWDA 3NHLA 2ZS7A 5KOHB 4Q7EA 2QE7D 5C2JB 4IICA 1CUJA 3A6EA 2QL7A 4QUJA 1YBAA 4C04A 2AR9A 1UBFA 5EAIA 4AMUA 4EY6A 5J2TB 4UKDA 3D59A 3L04A 3P97A 4RZIA 5C7IO 1RTTA 1J0DA 4CMGA 4ZKEA 2XB8A 4RD2A 1WLSA 4BOYA 2W8ZA 1L7BA 1PGPA 4RTQA 2JLWA 3BXHA 1UMCA 3CUWA 3TXYA 4BCDA 1TM4E 3K72B 4G0UA 3WL8A 4PSAA 1ZLXA 1IHUA 1DRJA 4PNEA 4TZ0A 3H1AA 1YJXA 4EAAA 4O1MA 2HLPA 3I09A 4MVJD 3WQBA 1RI3A 1BEZA 2EW1A 4I9NA 2YBEA 1A77A 3DHEA 1XAGA 4JT4A 5H9WA 3IMKA 5DYYA 2W9XA 4NF2A 5ECDA 3ZOZA 1CZRA 3FBWA 4BNZA 1A4RA 2IDKA 3TW4A 2O7SA 3G8CA 3DC7A 2PX3A 1GNSA 3ZW9A 3V8RA 4ZQIA 4W5OA 3FDJA 4PS0A 3NHYA 1K9SA 3VU9A 5IK2D 4JIGA 5GGYA 2HA2A 3WRYC 5J2TF 3ZDFA 4M9RA 1T36B 2GRAA 4FPXA 4WHMA 1JXMA 2QS9A 5SZKB 3UK6A 2EIHA 4G5GA 4EX7A 2BTQA 4P53A 2VKQA 4Y2VA 4RM2A 2NO0A 2R7AA 3NVMB 1MQ8B 3IBCA 2VJPA 4LKRA 2IYUA 3EX7C 2GCNA 3NP7A 4B76A 3LWBA 4ER3A 3BK1A 2AOVA 3PP8A 5DX1A 3TTYA 1ZY2A 2NVBA 5EQTA 5LD2C 1NGSA 1YSCA 1IBCA 2VP2A 1U7WA 2QT0A 4QFCA 4TSKA 1RM0A 2GSDA 4E6EA 3IP1A 1AMOA 1DADA 3U3MA 4CF5A 1U8CB 1W94A 2C0CA 3QU2A 2R4QA 5IBQA 4TLCA 5KQGA 1TK9A 1U9CA 5JPDA 4FW8A 4CTOA 1E69A 4FFDA 2OHXA 3EARA 4UUBA 3AIOA 2FPIA 1CRZA 3TAHA 1KRXA 3SC4A 1CUWA 1ONNA 2DUJA 4OGKA 3DMYA 2BRUA 1M1ZA 2YYAA 5AW3A 1VIAA 4UPDA 2Q9AA 2REBA 2EZUA 3LS2A 1VI6A 4L7QA 3D5TA 1TCVA 3ZZUA 4GECA 1NM5C 3DV0A 2ECPA 4YDRA 5EHGA 1OLOA 1TA4A 3HK2A 1JIKA 2XZTA 5DWVA 4LJRA 2BCJQ 3O0TA 4WEOA 3ZI4A 5CM9C 1Y4SA 1SXPA 1LTQA 3CMMA 4IEIA 1CJUC 3AZQA 3KZKA 3BFKA 3GEEA 1XPOA 3GLGE 3L0PA 3MUOA 2L82A 4DR7B 2QMQA 3EVNA 4HNGA 3GCGA 4HWPA 4M46A 5GP1A 4P98A 1PD1A 1PWEA 1OWMA 5U4XA 5CA1B 4B3TB 1DZIA 4WZAA 4B4DA 1MVLA 1A9XB 4Q4JB 3GLKA 1GPAA 1PSZA 2EG9A 4AS3A 4ZODA 1BN7A 1ZSYA 2R1UA 1P7VA 3D31A 1KZ6A 4BQFA 4J0QA 4F3KA 4PN7A 2FW0A 5LZ8A 3SS9X 3L6UA 4LCBA 1VLZA 3F6CA 1HDYA 3KAQA 3L43A 4YASA 2HU8A 2OAGA 1YMVA 2OD7A 1I13A 2CF5A 4RUKA 4CV0A 1R1DA 1N2EA 3HJGA 1IHXA 2O59A 4MRMB 2AFVA 1KFBB 4P3XA 3G5MA 3JQBC 4N3NA 3U62A 3OE5A 1VYTA 2OVFA 5FOXA 5BSWA 3FPHA 2ZSFA 5KWEA 3V1MA 1RZUA 4M9SA 2J4CA 4DY6A 3IVGA 3T95A 5KNLA 3JY6A 3MERA 3UW3A 5TPWB 2JASA 1QGED 4B32A 2YJZA 1JKFA 3DVSX 3IVXA 4M8SA 4ZYTA 1KZ7B 5GM2A 3LHFA 1T35A 1VE3A 3AB3A 3STHA 4Z53A 1M54A 2QR3A 1MA3A 4ISCA 2JKZA 4I5FA 1XMIA 3Q7PA 2VZLA 3NU1A 3DMRA 2W90A 1J2TA 3E3LA 4X90A 1ZM2A 3HXPA 5DX8A 2D4AA 3L7MA 4MLZA 2OPHA 3ZQ6A 2X8JA 3PG5A 1FLDA 1YRHA 3LP5A 4O6VA 2JGAA 3WYGA 1RKQA 1HQCA 1CDZA 1P9RA 3SE7A 4CMHA 5JXHA 1QB7A 1U0FA 4OQXA 5CX1B 2XUDA 3VPDA 1SCKA 2OT3B 3DAGA 1EVZA 2PH1A 1IVNA 2UAGA 3CZ5A 4H7KA 4HAOA 5KJ1A 4NENB 5A4FS 1AQUA 4ZIRB 5KCZA 5KTNA 2YJ3A 4RLFA 3SQWA 5DTRA 1DC3A 2RK3A 3KCNA 1W4AA 3I34X 4ZCQA 5KJFA 1EAMA 1FDRA 4URWR 1DT3A 1E2LA 1K4YA 4ALNA 3UPUA 4QPNA 2NU7A 2PJUA 1L7OA 2E3JA 4KIUA 4K0KB 1GLNA 2HCJB 4KQJA 1Y3FE 2A1TS 3AL2A 3EF3A 4ZOCA 1IN7A 1N6LA 2PMFA 2PMEA 3PPXA 4MV9A 4GKKB 2X8WA 3AR7A 1VP9A 1IONA 2YZ2A 4RF2A 1JH9A 3LY7A 2NZ8A 2GJAA 1XTZA 1J0CA 2G5PA 3AQIA 3EFBA 2PX0A 2Z2ZA 3C39A 4PX5A 1KDRA 1M33A 3IDAA 4IV8A 4NECA 1BVRA 4OFZA 3RQSA 3FNIA 3O91A 1O08A 1PFKA 1L1RA 3A1UA 2Z4SA 5EWMA 2W71A 2WDPA 3TJRA 4IXMA 1H6BA 3T9DA 3LLSA 3UYLA 3U5TA 1KK1A 3HGQA 3ZVLA 3QEBZ 3D7LA 1MB0A 2WYHA 1NXWA 2BMDA 2Y0DA 3K8YA 4RKYA 3T5DA 4GWKA 5JE8A 1USKA 4BEJA 5JTUA 1AHNA 3DR3A 5IZCC 1K86A 4NMXB 4ESEA 3Q7RA 2C57A 3COWA 3TTXA 4E88A 5JJLA 4BDTA 4MUFA 2SKCA 4GIBA 1EFCA 4F5WA 2PKXA 1CY4A 2HO4A 2HK7A 4EJSB 5BN4A 3B2NA 2ZOSA 3V80A 3W5SA 1PG0A 2KB0A 4IGEA 2ZUCA 4NBRA 1XLVA 4YR9A 3FVTA 1PI3A 1P7YA 4KRGA 1D1TA 5EYPB 2ENWA 3DE2X 4H3HB 5MDHA 4N41A 4UNRA 1UXHA 1NW5A 2VYVA 1QHHB 4TT3D 3IQFA 4BFWA 1Q0LA 3F1KA 1F1JA 1N1EA 4X60A 1E3TA 3MWKA 4D9BA 1RWMA 3R6LA 3O5AA 1E4EB 1N75A 4N47A 1L6IA 4C0LA 3PEWA 1QCZA 2PEZA 1AJEA 4OL9A 3OM8A 2MCFA 3TQRA 1Y4AE 1LS6A 1GZSA 1RYDA 2RJNA 1M7HA 3LVQE 4WA7A 3KZXA 5AKLA 1GG5A 5A02A 1NVWQ 1V3UA 4I55B 3ICQB 3KYCA 2GLXA 3QH4A 4Y30A 3GCZA 3Q9LA 3S5JA 3UBMA 3UV7A 4AZ0A 4EHNA 5HYVA 1XN4A 2B1RA 2UUPA 1FCJA 5CG1A 2WAOA 1QV9A 4LTDA 4U6NA 4NEGA 5I9LA 3GL9A 3GVPA 4RD4A 4ZAXA 1BXZA 4QDJA 4Y1RA 1LS1A 3BWXA 2ECKA 3IE2A 5C81A 5JNUA 4YRSA 2VR1A 4Y3UA 2BR5A 4NG5A 2G77B 4H2DA 5F5NA 3IQIX 4RFVA 1P9LA 4CIXA 2ZTVA 4U9UA 4ZVQA 2OO7A 3TLEA 1LWNA 4D79A 1TD9A 2I8AA 5AQ1A 3NW9A 4KE6A 2QTBA 2J3MA 3C8DA 2ZB8A 4FT4A 5AVKA 3RVRA 4JSRA 3WJAA 1QP0A 5EJ5A 1SH7A 1SRQA 3N2YA 5DN6A 4AMYA 1L4GA 2O0KA 2C94A 3VZRA 2BTQB 3G13A 4YAWA 2JD2A 4UJ5A 2AF3C 2CKMA 3IIIA 3IP5A 4IP0A 3EISA 4URUR 5IAKA 1WVGA 2EJCA 5ILGA 3G17A 4KNVA 1H22A 4PYRA 4D97A 1E92A 4KX3A 4DRXB 1U6KA 2BFFA 3FTNA 3R41A 4PQRA 2X1LA 1WXEA 2H9AA 4RVCA 4ZAYA 5IULC 3CIOA 3B9RA 1SOUA 4CIWA 3EIHA 3I6ZA 3UMJA 4OHWA 2AOWA 4FR2A 3OEEA 2FP3A 2LNDA 3T8YA 4IJWA 1L8LA 3ML1A 3BMCA 3EQ6A 1CD5A 2IUUA 4NMHA 3U3ZA 1AT1A 3IULA 5E3IA 4DPKA 2Y1XA 5MN4A 1CZUA 1JL3A 3N0RA 3UUWA 3S4YA 4MGZR 2VJCA 2XT6A 2QTHA 4IVRA 4EMSA 3LHSA 4V38A 5GAJA 4V0QA 3EA4A 1GCGA 2JI8A 1W52X 1NQTA 2CNKA 2YZ7A 3SEFA 1SG6A 1IM8A 1OU4A 4L5JA 4HLDA 3VPFA 2RI1A 5ENVA 3TL3A 1ZVVA 4BN5A 2WNIA 3HCNA 3EZXA 3OF5A 4I9UA 5LSAA 1TKAA 4OJNA 1J1IA 4J1TC 2IT1A 3HS3A 3EBPA 2BDUA 1H05A 3BG5A 4HEA6 5BT9A 1P5HA 4YS6A 3ZK8A 1IC6A 4OHFA 1A1SA 3H1EA 4MJXA 3NIDB 4ABTA 1NBME 4WZAB 5LB4A 1NBOA 3RJ5A 4UATA 4A10A 3DZDA 2ZTLA 2I9KA 3OQNA 1EVEA 1IAQA 1R15A 2GESA 1G66A 5FTLA 1GEEA 1RAEA 4J3NA 1YZHA 1MXFA 1FSFA 2JFQA 4HN4B 3BRWD 1N9GA 4LVOA 4NYJR 4ZU3A 5FL3A 3ZPXA 5BNZA 4BMVA 3CVYA 2NV6A 2DY1A 3W2HA 4WZBE 2B4QA 2PT5A 2VATA 2WE7A 2I4OA 3G0BA 4G63A 4GUAA 1NNUA 5C3UA 2P3LA 5BR7A 4D74A 3OF2A 3M89A 4L7VA 3RKUA 1KDOA 1TK2A 5T4EA 1HMPA 3QMVA 2YVLA 2BE9A 2CVFA 4HTFB 5E6SB 3T3HA 4ROSA 4Z7JA 5BMVA 1ISMA 4U5XA 3WNZA 2O19A 1GPNA 3H9GA 3LHIA 4MCHA 4L9WA 4V0ME 1WW2A 4DA9A 4QRDA 5ITSA 1WDWB 1LDGA 1A9YA 5A6VA 3GP8A 4AAYA 4BWYA 721PA 1BX3A 3L6OO 3DLTA 4O0MA 3W4KA 3OX4A 1CQJA 2BEUB 1JHPA 2LWIA 2OK7A 1RPNA 3BM5A 3MQ4A 1Z6AA 4L2IA 4YGYA 4TXJA 1S01A 4MS4B 5F2OA 2UZ1A 3V42A 5ALUA 2NP6A 3C3PA 5LP6C 2A1IA 3G1TA 4JP8A 2QNIA 5FHRA 5JSHA 3F5DA 1SGWA 1U31A 1Z73A 3RBAA 4BNXA 4QYIB 3A9RA 3PWSA 2M1ZA 4J94A 3RIYA 4DJ5X 3SF8A 5LKAA 2WW8A 3EAFA 3P9ZA 4M1OA 3RABA 5SYNA 1ZYUA 1IBMB 1O0BA 1Y33E 5BO5A 1QYXA 1JRLA 1M67A 2W2TA 2W6ID 3H7AA 1XVTA 1OX4A 1ZL2A 3EE6A 4QOGA 2PS0A 1RC0A 2YVUA 4H4CA 1XOIA 4UDXX 3TRFA 4JQSA 3D6UA 4JEMA 3OQOA 4WV3A 5A4KA 1VJTA 2GETA 3PK0A 5CB4A 4DSOA 2ACKA 2BI8A 5K05A 2CFIA 5ES4B 1G20E 4G89A 2W8BA 4HNRA 3HDQA 4OKNA 3TF5A 4JUDX 1GAEO 1A4XA 2EOAA 2Y1LA 4RJ2A 1E20A 4P3OA 1Y8RA 2GN4A 5DE3A 1JPVA 1NV8A 3MS7A 2QYHA 3R0XA 4DMFA 1O94D 4AMVA 3RHTA 1Y5MA 4NDAA 2FWBA 4ZT6A 1UT6A 3ENQA 5D84A 4N82A 3OQIA 1E1QD 1PU2A 2AJBA 1F2DA 3RODA 1DAKA 1Y48E 2CHEA 2RG1A 4WOJA 1XA3A 2A67A 1N8KA 3M49A 1CWUA 1I6WA 3LUJA 2C92A 2VT2A 3UEOA 3DAFA 3ME5A 2AYYA 3IDSA 1JEOA 2HIMA 4Z9BA 3WK5A 5JPIA 1OZ0A 1PJQA 2R47A 1W85A 3TG8A 4OOFA 4X45A 4BO6A 2CV1A 1TZ2A 5BN4B 3O90A 2WWYA 1JIIA 1AQYA 2P0AA 4AQ7A 4E13A 1ZK1A 3F71A 4BX8A 2FDXA 5AW8A 1BJRE 3TGLA 4UE3S 4RA9A 1LPPA 3I6MA 4UQPA 1GG8A 3DMNA 5DHTA 3OEWA 1XKQA 4CF4A 1V1JA 1E7QA 4DUZB 2AR7A 1RQ7A 2GARA 2RGUA 3CCFA 2XVZA 5HDBB 3W8NA 3ADKA 4XB6B 3VRHA 1F2TA 1KBOA 3JD3A 4KAXA 4B6FA 1CC1S 2KHZA 3O47A 4KQWA 1TJ4A 4F60A 1BMFA 1USIA 2MJLA 2X9LA 4MQBA 1LNQA 1LPMA 1PZXA 3RFCA 1RVV1 2IYTA 1CR6A 2II6A 3BK2A 1PJ8A 3O94A 3I53A 3QF7A 5FNZA 3U60B 5EEHA 1P1CA 1QFYA 3NT2A 3QKWA 4OB7A 1JAZA 4HAYA 1ZLYA 3BULA 1NRIA 2GZDA 2H9IA 2WIKA 2Q0HA 3F6PA 2JIQA 4LHVA 1KMHB 4RQTA 1GTVA 3Q87B 2JBHA 3LDAA 3QK7A 4X85A 1V3QE 3BYZA 4GLJA 3KJZA 2J48A 1EH5A 4Y1RB 1EIZA 2VYVD 3PS9A 1UZNA 4H77A 4ZOLA 4DJFC 4HYYA 2PZGA 1JV2B 1ZNYA 4BMPB 1F06A 4PSUA 1JQJC 2HRZA 4QYTA 1LGYA 5H59A 1T8WA 4DHWA 3AJRA 4HL6A 2QUAA 3R24A 4YO8A 5E7IA 5FI0B 2IYRA 3IA7A 3BCRA 4V1CB 1X70A 3QLTA 1NFFA 2X1VA 4GQAA 4A8PA 3ZUGA 4WKCA 4BRZA 2PEYA 2LCFA 1OXUA 1D6SA 2XUZA 3BL6A 4R9UC 3I6QA 4EA6A 5I4IA 2P90A 3JQ7A 3ZE8A 2JIRA 2R62A 3OA0A 1VCMA 3UGKA 5KOIA 1TJPB 2V55B 1IEQA 2OZLA 1CR4A 4Y2JA 1YR2A 3EC7A 4OBXA 5LCXA 4Z51A 2YMQA 1JHUA 1BA3A 1DV1A 2YHAA 3CJRA 4EJ2A 1TEXA 2XE8A 3QSGA 4DNXA 3I62A 1SXJE 5BRNA 5MN6A 2NN3C 4L57A 5IDWA 4AF8A 1YONA 3DYBA 1YHZA 2ZYGA 2CD7A 1GSIA 1JTEA 3QIVA 2HO5A 5ADUS 4EGQA 1DAMA 4YH1A 5KWVA 1GQOA 2PCJA 4MR7A 1Y37A 1XTQA 3A4MA 2QENA 4QC2A 4QPJC 4C5CA 2J0SA 4RF3A 1QG6A 5WRFA 3UKOA 4WBNA 4FFVA 1AGNA 4Q01A 5BW5A 5FF9A 1JKJA 1PBNA 3UG6A 4ODIA 3FOFC 1H0KA 3MTAA 3Q7SA 5CBPA 3F6EX 1JFFB 2P78A 3UHOA 4RMIA 4G37A 3WZMA 4DMLA 4S1OA 5EPUA 6LDHA 3AF2A 1BKYA 2C7OA 1F0YA 4AUMA 1WOMA 2B2NA 1U2PA 1FUEA 1N0UA 2EX1A 2XUHA 3A6KA 1JHVA 3F8TA 4G8CA 4RNDB 3TOZA 2H1VA 1U1IA 3EC1A 4RTKA 1CYDA 1BE1A 4HFRA 5EVCA 5HJEA 1Z88A 3QE4A 3ZKWA 1KZ1A 1RLTA 4MKFA 3SCZA 2GA9A 5FOVA 5TMBA 4IVPA 3PGA1 4MRNA 1EGAA 2FVYA 5E9JA 1I6MA 2PUJA 3QQ5A 3NTUA 4OD0A 1FXWF 2WTEA 4ZOQI 1SHTX 4WZ6A 4TT8A 5D3MB 3KSMA 2H92A 1IG3A 5ALPA 3PB3A 2IYYA 2OCGA 3DOUA 1Q0HA 3FBTA 4CQLB 4EY8A 5CYFA 3U9LA 1W0JA 1SD2A 4LY3A 5CJPA 4I9GA 2ICAA 5EMKA 2B61A 2KW5A 5KNCD 1D2RA 2AJCA 2G25A 2WJAA 3LRPA 4A0QA 3K9QO 4QG7A 5DBGA 4I3FA 1NI4B 4H27A 2RAPA 2GBLA 4JSYA 4TSFA 1E3DA 3U81A 1BFUA 4Z3DA 3FLMA 2DH5A 4OJTA 3LPNA 5BW6B 3T0GA 2A7XA 3GEPA 2IU0A 1YVEI 3EGXB 2AZTA 1ZD8A 3SE0A 1I6KA 2IE0A 1H93A 3AP1A 1QZXA 4LX0A 5A5FA 3E27A 3E5RA 3OH8A 3CFYA 3W5BA 2XCRB 3CC8A 1LI7A 5I01A 4MVJE 3OTHA 1XE3A 4XM2A 3KETA 4I1VA 1X7WA 2QVXX 3GVCA 1UC4B 2WILA 521PA 3UJ3X 3MBKA 4JYMA 2QG9A 4IJMA 4C5BA 4ZHSA 4HZGA 4JB3A 5AKGA 4RORA 4PXSA 1Z6YA 1M8GA 1Y1QA 7ADHA 4N9QA 1L4BA 5JAIA 4ANFA 3T9AA 4BV3A 4FS3A 3G5UA 3HI6A 4INOA 1CY6A 2WSMA 2GEVA 3QOWA 4PFJA 2XD4A 2XTMA 1O87A 3ANMA 5GV8A 4KWHA 1I5EA 3I64A 2ZRNA 1XZIA 1E9AA 2XQJA 4O4IA 1PYGA 1J2EA 1TPZA 1MC4A 2A9PA 2UZ1B 3WO1A 5LDHA 5E7JA 1AMNA 2XY4A 2WPNA 5JVDA 3WK6A 4RQAA 1SCJA 2OMEA 1Y5IA 1TA0A 4IIUA 3TOCA 2Y4NA 5DZSA 1ZH0A 1O5TA 1F3OA 4UUPA 4DLRA 1DG1G 4X6LA 1AKEA 1XD9A 1U2DC 1ZEMA 2E85A 4B4VA 2O8EB 2O52A 2N42A 3F3YA 1CFJA 4TRJA 3OO0A 2V7TA 4NJEB 2DBZA 2W2NA 1GDTA 4RENA 1R3UA 3RFXA 2NX2A 2QRMA 4B3MB 3UWMA 2AHRA 2Z8XA 5HOEA 2R1TA 4YB8A 4C4OA 4P8RA 4IIEA 3SVTA 5IS2A 5KYGA 4NYJQ 1D07A 3OE7A 1V5FA 4K7JA 2XKKA 4LYHA 2WB2A 3NDJA 3V1YA 4XH9B 4NBVA 4YONB 3ENWA 5B57C 1SVOA 4JROA 1Q0UA 1XB2A 2ORIA 3E9RA 3PXEA 3OTIA 4UHFA 3KT0A 4A2WA 4D6YA 4EKEA 3EWAA 3CISA 5FWYB 2QJRA 2MSCB 4BBJA 1L4KA 1M6EX 2R8BA 5CFZA 2JLXA 2YWXA 1T9ZA 1VZ3A 3FPBA 4NU0A 5F1YA 3JVDA 3MYRA 4GQIA 3PHIA 3UBTA 4GI2A 5ULLA 2NTJA 3ZHQA 2EKLA 1KQPA 5AH0A 2YWBA 2GAOA 2X7HA 4YJFB 3T34A 1XMQB 2J9FB 3BILA 4ZVVA 2W2XA 3BRSA 3AEKB 2J9ZB 5ADHA 2J1LA 4LXUA 3RUAA 3WRXC 5CB4F 3FFXA 2F3RA 1MOZA 1E6EA 2XD9A 1AK9A 4KVFA 3Q5EA 2HYIC 1S02A 4WKOA 3SXUA 1ZBQA 5K51A 1CY8A 1YAJA 1QV6A 4LZOA 2Q4OA 3N2KA 2IOFA 4JSTA 2LCQA 1KJZA 4RD3A 2NG1A 3KZOA 3A14A 1XJCA 5BV0A 2YNMC 3LT1A 2IYNA 2NT3A 3OZAA 3UJ6A 1SC4A 5CAEA 2F1HA 3KLPX 1M1YE 1MA0A 3Q12A 1VFPA 2I6FA 3ACCA 4LRWA 4MS3A 5ABPA 1ZGHA 1UP4A 2I6UA 3F9IA 1UPTA 2QQEA 3K8ZA 4M89A 4MR8A 4FN5A 1Q17A 3T94A 2IBMA 2IYWA 1NBIA 4EB8A 3BSFA 4XSHA 3RF6A 2QWXA 2F2TA 2YIVX 4V0RA 1TQ4A 4NCAA 1FYWA 1EUZA 3LGSA 1OBHA 3VO8A 2I66A 1QFXA 4A92A 2P75A 5KCMA 1BS9A 1FP6A 1HNNA 2DWOA 4LECA 5AW1A 4KHPB 4YXWA 3WL7A 4FJ0A 4Z86A 4LF8B 2I6QA 2NQTA 1ESCA 1Z0AA 3C4QA 4QQFA 1XPUA 2X4GA 2PUTA 3M1LA 3AHIA 1H8HD 5A5VA 3SOZA 3DH0A 3UJ9A 1PGOA 4A26A 3T3GA 4HGRA 4HH3C 1Y6ZA 2VG8A 1BC5A 1M34E 1UZMA 4JLAA 2F4NA 2D0DA 4OXIA 2W6JD 1BMTA 1QE0A 4Y6SA 3V34A 4NESA 1CYEA 1CZKA 1QH8B 1TJ3A 1XF9A 1XEWY 2ASEA 3NM5A 3ZTWA 4OLHA 4D4JA 1XIVA 5B58T 5M3BA 1G3RA 1ZI8A 4RVDA 2H52A 2XUJA 4KXVA 3WC4A 4LE0A 3JQ7B 2GEBA 1SC9A 3CSDA 5KYYA 3UMYA 1KHTA 2GTIA 4UBNA 4G0NA 1FFBA 5HRCA 3L0DA 3GLFA 1YDGA 3KTAA 4LJAA 2XB4A 2Q3LA 1CRPA 4WCFB 5L3SA 4U7DA 1Y8CA 1PZFA 3M1YA 1WBJB 1IZYA 4EUNA 2HA4A 3A6JA 3DGEC 1W1UA 4EG7A 1TVCA 1UAGA 3THSA 4LYJA 4DCTA 4ZOLF 2CJYA 3RM3A 3S2ZA 4RS3A 3WGMA 1ZN9A 1SXJC 2QQGA 4JITA 4CLRA 5MFPA 3TCXB 3WLJA 1FQKA 3F0TA 5F1PA 1NJ1A 2P7IA 2VDMB 2W6CX 2RHHA 4R1UA 1TKCA 1PSWA 5IJ9B 2JAPA 2L18A 1DAHA 1S2NA 3IV6A 2ZQ5A 1L7PA 2OCPA 1COWD 3R9KA 1KAMA 1W88A 2BOVA 5JJ5A 4GC5A 4UVDA 1F48A 2CL0X 4WLVA 5B58C 3A1FA 5JAHA 1J49A 1G291 2I7XA 4HP8A 3ZW7A 2CDCA 3F96A 5I9MA 3SQNA 1BHO1 3RFVA 2OORA 3RSQA 1SNYA 1A9RA 2O2GA 1FB5A 3H42B 1BWPA 2O0JA 3DL0A 4HUQA 3KOXA 4M22A 3WJ7A 4RAOA 3Q3HA 3L7KA 3GCDA 4YRTA 2FTKE 2OCIA 2VJDA 2C0QA 1ECJA 1BJKA 3K32A 3R5JA 3VKFA 3ZHOA 3ADCA 4J0FA 3O3NB 2HNAA 4X3CA 5LBTA 4RADA 4BAGA 3EXEA 2M1XA 2VKTA 2N75A 5AQEA 2WJZB 3AJDA 3X43A 4JHXA 1SPXA 4WBNF 3KSAC 3AGQA 4MYHA 4TN1A 3BD6A 5DF1A 1DX6A 2R1VB 1K89A 4KDFA 1KERA 1XCJA 2WIJA 1JA0A 1CUAA 1GVHA 5DHUA 4ZEWA 2VPTA 2FZKA 5FULA 3KQNA 4G0YA 2WVAA 4NV3A 2Y92A 3Q7QA 4F97A 1KORA 2NADA 2G07A 4Q9KA 3I30X 5JG7A 2GHRA 3RLIA 2JFHA 5AM0A 2NQ8A 3MINA 4QPCA 4QDUA 4U7HA 1Z45A 4ENTA 1FW6A 1YZ3A 2NV0A 2RHRA 2WDZA 3KAKA 2I7CA 2Z2KA 3QBVA 1EZ4A 5AD1A 3C5HA 5FH9A 2NNLD 3DOFA 1GYPA 1L7EA 3HEAA 1X7WB 4XR4A 5JS7A 1P1HA 2VJOA 5IJ0A 5KREA 4RAQA 3MELA 4BNYA 1XDGA 4A15A 1VBMA 3EGEA 4AW9A 1NQAO 2IYPA 2NU6A 4HR7A 5AIBA 2IITA 2NXEA 4XWGA 1Z4JA 2IKQA 4TMFA 2HWYA 2BKLA 4XWTA 5LYJA 5HTOA 1P3DA 4AF6A 1VMEA 3HCBA 3WFJA 1XA0A 4A73A 3P9XA 2IDJA 1U3GA 3W4IA 2XNDD 4ER5A 2Z3ZA 3T4XA 3K0AB 3O8QB 2BH2A 1DBIA 2F43A 5FUVA 2CXXA 2J08A 4R8MA 4RMHA 4LTNA 4DXHA 4Z7OB 3AQ4A 4N40A 4WUVA 5K3FA 2JJ8A 4HWRA 1EU1A 3I3SR 3ISVA 5JVDB 4ZVRA 4YRAA 1HRKA 4EJ0A 1CJSA 1DUVG 4F2PA 2WA1A 2ZT7A 5JD6A 1FP4A 2F59A 1PZGA 1Z08A 1RM3A 3GFGA 1Y4UA 1U2SA 3PWZA 3MJCA 3UKDA 4OGFA 4WLOA 3GFOA 5EQJB 4WJLA 1ND6A 3E1KA 4EGJA 1MNAA 1V8FA 3R5KA 1XEAA 4C4XA 4C7VA 2C8JA 4H35A 4JH0A 4OP3A 2XT9A 2VK1A 5IASA 3GT0A 1AKVA 3WNCA 3PZBA 1UUFA 3OETA 5AK6A 2YWFA 2EHJA 3OA2A 2V1XA 1JIUA 4KAFA 5E1BA 1S8NA 2JANA 3M6IA 2J4FA 1KAHA 1JLLB 4HDOB 3EEIA 1X19A 2UVPA 1K88A 3WWOA 5FPTA 3VPXA 1C7RA 1KXJA 2W6PA 4O4IF 2ADFA 3GX1A 4GLFA 3IUJA 1WEHA 1E6CA 3E84A 4PC1A 5IEBA 5BVHB 2Z4RA 3URKA 1XSEA 2Q6VA 1XNGA 1G5HA 3KUCA 4QUBA 4YLEA 1DBRA 3WB0A 4CMIA 5JVDF 3UK0A 3KWFA 3NQ41 4YP7A 3FOZA 1TTTA 3FLAA 3CZCA 3RROA 3MUEA 4Q1DA 2EL7A 1ZSNA 3AO0B 3I0MA 3QFSA 4MUXA 5JDIA 4FM9A 4EOGA 1PEAA 4IYJA 3VVMA 4QGSA 2WZBA 1G5RA 2GK4A 3JR7A 1M6VB 3O26A 5L7YA 1RJ9A 2WVHA 4MMXB 3GLUA 4FDLA 4D9MA 5LB2A 5AJHA 1AGPA 3MMSA 3DZJA 1L7XA 4PLFA 3ETHA 1ZG3A 4ABYA 1EVKA 2XVXA 4KPYA 1J24A 1YFZA 4YDSA 1OZGA 1O96A 3KZNA 4B6SA 4RXMA 4YUZA 4L5BA 5CEJA 1JB1A 1FJHA 2PU5A 3I05A 3PEEA 4EEZA 3N8IA 2YJ4A 5J4VA 5D86A 3QVGB 4XCVA 1XR3A 4NWIA 4BN0A 2AHOA 2ZI6A 3ICPA 1NF3A 2QL9A 2OXIA 2NZYA 2HLDD 3ND9A 4LPSA 1TTPB 5TS3A 3PC2A 3VNRA 1XNRB 4H9GA 4P36A 4MA4A 2GZ3A 2DMRA 4V0OA 3HUEA 1XD2B 1WHSA 4P32A 2GLUA 2DRIA 1FFAA 4PY2A 1WTCA 4NK5A 4O1HA 4MS3B 4LX8A 4WGFA 3HVRA 4CF3A 2O3SA 2YN0A 4MR8B 4NLLA 5JBNA 4BNVA 2PQMA 4MIOA 3UA3A 3RKSA 2WZQA 3PICA 4DLBA 3IP7A 5PNTA 4MMYB 4I36A 3VR3D 2OV4A 1RAGA 4XSVA 1ISHA 1JQKA 1PR3A 3JALA 4J76A 3MJFA 3GYGA 3OM0A 3PT9A 4LJ4A 3L1KA 4CHTA 4BO2A 1ONSA 1Z4IA 3F8WA 4M9ZA 3T5MA 1PQYA 3S1AA 2Q0QA 2QW8A 4B34A 2H2AA 5KYWA 2F1OA 2WEKA 4MUKA 1UKCA 4TLEA 3WYBA 1KIMA 1LPAB 1UK6A 1VHDA 2PSFA 2WR8A 4GOLD 5ALXA 1CUDA 2BKVA 4ON9A 4TMVA 3U19A 3EH2A 4ZC8A 2AW5A 1WKVA 3VNQA 2E4VA 3G2QA 3G9QA 4ZAZA 4KR9A 3HRHA 3SGLA 5B1HA 1RWQA 1NLZA 1T2DA 3LHDA 5FKJA 3VR5A 2X1MA 1QR6A 2XUFA 1C8LA 3ZWBA 3H86A 4BKOA 1M76A 1N25A 2P6NA 4IRXA 1MIHA 3JATB 4H0NA 4O5OA 1NSYA 2FWNA 2GXQA 1WV1A 3DS8A 4MQMA 2YQ4A 2R44A 1MB9A 3IOCA 1VHQA 3K35A 3LU1A 3Q41A 2C83A 2QF7A 3LO5A 4JJ8A 2P9CA 4ND7A 3F47A 1NMYA 4II3A 4CVNA 1FXUA 2ZZMA 2ID8A 5I9BA 1AS2A 2W22A 2Y1GA 3R3YA 3UC9A 2NUPA 4WKBA 1HT0A 5BURA 3G2LA 2OV8A 3PHBE 2YW2A 1LDMA 3AKZA 1TAHA 2AE2A 3VOSA 1HC7A 3S3TA 1UPUA 2Q4RA 3RRBA 4U2FA 4DNOA 5DM70 4ED9A 5LQSA 4CLRB 1J9ZA 2XYHA 2ZBQA 2IXAA 3NAMA 2CUNA 4BO9A 5JZBA 5KNBH 1Y5LA 4P84A 1S3FA 5B1SA 4YRNA 1MHTA 2ZPTX 3PQ3A 4DILA 1MH1A 2FP4B 3KKQA 3CLUC 2NPIA 4FC7A 4NL4H 3HJHA 3IAM6 2A35A 1KKMA 4FQ8A 3GEBA 5A7HA 1A72A 1CCWA 1J0AA 1UC8A 1YRYE 1PS8A 1L5FA 2H7XA 1ZJYA 4MW6A 5TPZA 3NIWA 3UT5A 3CKLA 3HYSA 5C1BA 3UHPA 4QUHA 1QP8A 2P2DA 3I12A 4UBJA 5F2EA 5IHPA 1ADCA 1T2CA 2ROQA 2OHFA 4MW0A 3HA2A 2WC1A 1YB6A 1M9NA 1UP7A 4FEAA 5I4KA 3I37X 2PYIA 1DLJA 3D8TA 1K98A 4C21A 4O02B 4QLBA 4G8JA 4R8VA 1R3DA 4MCJA 4UASA 2OOKA 2VTDA 2JFBA 4MLCA 4MKHA 4HDQB 1MOPA 1ND5A 2EBUA 4KK4A 2QRPA 4AIRA 1RJWA 4TMYA 4UAJA 4HMQA 2YC2C 3MK31 3LL4A 4QRIA 1YR3A 1ID8A 3EVEA 2BFEB 1UBGA 1MG5A 3AR2A 3EGWA 3V8NA 2YY6A 1F7UA 4ZWNA 2AE1A 4OU4A 4QPPA 3I2JA 4JJEA 2O3UA 3RWMB 4Q03A 1DQPA 3BMQB 3ETGA 3UB2A 4KGDA 4HGZA 2B6HA 1A76A 2VQEB 3CWQA 1XWFA 3FM9A 1IWBB 3R7AA 3SD7A 4D9JA 3W5HA 3O9MA 2RHGB 1EP3B 4NAUA 4PG6A 3RVSA 3UAVA 3UJCA 2FPKA 5KOYA 2GHTA 2DQZA 2I99A 1GYQA 2PSHA 3OWHA 1CUSA 2Q8NA 3RKRA 1XTPA 1MO5A 1T2VA 4IXNA 4K9DA 2KQUA 2P65A 4A8JA 1SK9A 3HADA 1ZKMA 1YD7A 3FTPA 2ECOA 1ZU4A 3FNHA 3DEAA 5AJXA 4R4JA 3OLWA 1X7YA 5IN5A 2OA0A 4N0MA 2I8LA 5LYJB 1JDVA 1FS5A 1TM1E 2NUTA 2R6ZA 1GOTA 2FPPA 1ENPA 3TBHA 3VR4H 2DBYA 4JT2A 2GGSA 4TYYA 2LKCA 1NKSA 3TIIA 1JHQA 1M0WA 1XRQA 3FVRA 5J43A 5IBPA 3BX1A 4MW4A 2PGDA 3K5IA 2JG3A 4E2ZA 2VHZA 3HCEA 2JH3A 4LOKA 5T4BA 4D9KA 4PHCA 4IH4A 2BJHA 2P2YA 2VPXA 3TLBA 3IXLA 3GRVA 1YF3A 5HKKD 3BWDD 1PVDA 3CINA 5GONB 5JISA 1F6WA 2A9OA 4PGAA 1R16A 2A9KA 4KPGA 2HL6A 3PL1A 2GPSA 3AUFA 3HV0A 3PXDA 3S8YA 2RJOA 4KIGA 2PL3A 5LYJF 2WKWA 8LDHA 4FYKA 5K0NA 1WULS 4BZQA 1OLUA 3G7SA 4EELA 3EIUA 3GDFA 1IU9A 1KJJA 1QQ5A 1ZJZA 1E6LA 3HRIA 4JJAA 2ETVA 4M54A 2PGLA 2AL7A 4RJJA 1AX9A 5DK4A 1Z2OX 4OHYA 4OQDA 1OXSC 3GFTA 2C7PA 2C29D 5F77A 1ZXLA 3LK6A 4LFBB 5EJGA 2D5LA 4NQRA 1HR0B 1PWYE 1JEEA 3PYXA 2CXNA 3UJPA 4AO8A 4CMIB 5JHGB 4CCWA 4B31A 1F9EA 3EFOB 1Y9DA 4HJRA 2HV8A 3ZV5A 4IWYA 3A1CA 4DJEC 5J4LA 4W7SA 1I9GA 4P0TA 1I2AA 1P2VA 3EVZA 4GOXA 3A05A 2WJ3A 4RHTA 2BMJA 4ZO7A 1ZUNB 3DWFA 4RKQA 1KYVA 3K1AA 2E82A 1SHKA 3FI0A 4M9XA 5G1PA 3L1JA 5BSTA 1E8DA 2AG0A 4QL3A 4MPTA 2VHEA 1CR2A 1AKTA 1EVIA 4B6GA 4U3JB 1NTOA 3F9RA 3ACBA 3VH1A 2P9YA 4E0BA 1VLHA 1OAOC 1QIFA 2GWRA 1ZO8A 3H5WA 4DKXA 4PAWA 4QHYA 4BUJA 4CG0A 3KU4A 1ZN8A 2PO5A 4D44A 5AVUA 1CUBA 2QAIA 1CK4A 5FA8A 3GRAA 4CL8A 4D41A 3PHCA 5KDOA 2VCHA 2F9LA 3L07A 1O95D 8ATCA 1J2UA 2K87A 2R66A 5HBRA 1HTTA 2ZREA 3GZ4A 4H1VA 3GCXA 3PI7A 4FFBB 1F8GA 4FD2A 1NVXQ 2FI1A 2HC9A 2OBMA 5EZ5A 4TWAA 5FUWA 3STXA 1MEOA 1NMQA 1YO6A 2P2SA 2ONJA 1HETA 4C2TA 4ZGBA 2Z56A 2C5AA 2O1SA 2Z9CA 5EFZA 3AY3A 2ONZA 2L0XA 3DEZA 1A98A 4YP9A 1GPKA 2V7WA 1LDYA 1C1DA 1DOZA 1JEAA 4FBMA 3PNPA 4BV9A 1P0IA 1RKVA 3BXOA 2GVZC 3NBYC 2QTZA 4JA0A 3RCBA 2FCAA 1PFQA 3L0YA 2WF5A 3IAS1 4Y1GA 4C4SA 1BXGA 2VH2A 3GFRA 2PUAA 4ZOAA 4Z4IA 5FPHA 3LFHA 2BHTA 2IUFA 1U3WA 2Z83A 3E22B 3TD2A 3E03A 2P30A 2FX2A 1E3IA 3VISA 5ALMA 2VEOA 1ATZA 4M86A 2G09A 4EW6A 4IS2A 3MGKA 2CDAA 3FNBA 1RHRA 2IK8A 4PZCA 1I3OA 4N7MA 2GR9A 4MEJA 4R8SA 3UHFA 2D8AA 4BFUA 3COPA 4DR5B 4P0PB 1N3LA 3KWMA 4ND5A 1YTUA 3U3XA 2JGDA 1L8XA 1GGMA 1Q2UA 4TKZA 1LC0A 1XN1A 1GKKA 2XDQA 1X2EA 3O4FA 2B9VA 1IG0A 4BVJA 2VAXA 3NEJA 1AKRA 4HOYA 4RE5A 2IPAB 4OHMA 4RTLA 2QV7A 1I3CA 3G0CA 1J21A 3ZU3A 4BNIA 4XOIA 4R6XA 3UAGA 3WNBA 2DE0X 4M99A 2RONA 3G9TA 3KOZA 3SEZA 3T1OA 1KOFA 3A31A 3HJRA 2OXRA 2FE4A 4QTZA 3TNLA 4E5DA 2QRGA 5C0OE 1RM4A 3A6HA 1SR8A 3MTGA 4N5MA 5LD2B 3U7HB 2BF4A 3LTEA 4LMAA 2P79A 1GITA 1VPLA 3IDQA 2R7MA 1MFZA 3CUEF 4M8NE 1MIOA 2FEPA 1KJWA 1SWWA 3ON5A 3UT5B 1KR5A 3CZPA 1I7NA 3KTOA 4U7FA 1F0KA 3ZK9A 1GG2A 1PDWA 1Z34A 2GD2A 1IN5A 3WV5A 3RUCA 1VMAA 3OZDA 3N0XA 3LZDA 5KU7A 2XBLA 4DGQA 2IS4A 4UTZA 4RIHA 1IB0A 1TK3A 1TM2A 2DVMA 4GX1A 4UD2A 3WO0A 3T5CA 1NTRA 1XDZA 2AX3A 1EWTA 1GGVA 3FYUC 1BMDA 1F0NA 1ZMBA 3GJZA 3HLKA 4KVZA 4L5CA 4TMXA 5HIJA 3R0JA 3ZNQA 1JWLA 3DDWA 1UBHS 3EOBI 1YZVA 2C4UA 4KITB 3NCTA 4O4LA 6GPBA 1BS2A 1YDMA 1ODLA 1JT2A 4EEKA 1Z7EA 4I3HA 3ZXXA 3WJ1A 1DINA 3DAHA 4JLSA 1UMKA 3W3AH 3FWZA 5AJVB 2A14A 1I1NA 1L5YA 3KSDO 1QX3A 1Z15A 2XF2A 4K9LA 2QD5A 2BBOA 2YJNA 4GPD1 1DQSA 1NFQA 3PX2A 3R0ZA 5JH7F 1B41A 4KLRA 5JNTA 3JARB 2IYXA 1BU5A 1YR8A 3FMFA 4H7JA 1JJVA 1IHYA 1A69A 1ZA1A 2WWFA 3HNOA 3K9GA 3P19A 3E05A 4MIKA 4WXPA 1YJAA 3KO8A 1EE2A 2AQIA 5AKEA 3ZEIA 2Q2QA 3GFPA 1R8XA 4Y6OA 3LF2A 2A3RA 2B98A 1NOJA 1MGPA 3EY4A 1MABA 4KQCA 2Z0MA 1KPHA 2X13A 1KAEA 1UBSB 3C43A 4WXMA 1AVTA 4MDHA 4D25A 3JAWA 5G2OA 2YFQA 1THZA 1ULUA 1EVQA 4LXGA 3WYDA 3HSSA 3RRMA 3SYNA 5JPCA 1A8QA 5JCOC 4XQCA 3LT2A 1FTSA 1L4YA 2BUCA 1KJIA 1HEIA 3LUBA 3VDNB 3E3AA 5D1HA 4ZVLA 1EP2B 4L74A 1O54A 4EAQA 4X8LA 1BE8A 2FPPB 1JQ3A 1GWNA 2RH4A 2G08A 3PUHA 2VHUA 1SBQA 4HEJA 3S2YA 3T06B 1NUTA 4EITA 7REQB 3I23A 1PUJA 5IAOA 5AI0A 4YMUA 4RD1A 3NONA 2OVBA 1K9VF 5BR1A 3RYCB 1P60A 4FVTA 4F06A 5G0VA 2WJHA 3L7LA 3ZGYA 3DNMA 1IL0A 4RGQA 16PKA 1N2IA 3W5UA 4GKVA 4D0SA 1Y3DE 4JWTA 3CPHA 4B3IA 1YKSA 4EJMA 1DAOA 2CV0A 2IYEA 3QKSB 3C6BA 2GVDC 2V4MA 2Y8EA 2ILVA 2PFSA 3FCSB 5I7AA 5FTNA 1HFEL 1B8VA 4EO4A 1S2OA 3MRSA 3A4YA 4ZFNA 2NVUB 3NRBA 1T0JB 3NHFA 3AFIA 2OFXA 4W1PA 2ZRIA 2GAJA 2PFKA 4JC5A 2IZZA 4Q6BA 4LJ9A 4LMRA 5JFGA 1SKYE 2J7KA 2OQ2A 2QM3A 2WUEA 4M6WB 2O0LA 3UJHA 4O2AA 3G6KA 5IM4A 4ZQHA 1R64A 2R5WA 3UUEA 3H87A 3PC8C 4BRUA 4HUJA 3MT9A 4UHJA 5F4BA 3CRZA 4J2TA 2Y9MB 5ALEA 4N54A 4L0QA 2IU4A 4LS3A 3WRWA 2ARKA 4DOMA 5JSFA 5FX2A 5JSYA 3TLGB 4BECA 2H16A 2W11A 1DG3A 3IA2A 2JIOA 2FAXA 2H7CA 4Y2QA 1U2EA 1AGXA 2AC7A 4QOHA 3T9BA 4QUDA 3BSSA 2QAGA 3GDWA 1GT6A 2C3YA 1NE2A 3K09C 4AZVA 5ARCA 1V5IA 2IHBA 1HZZC 4BASA 5I8WA 5J4YA 2WA2A 4QM6A 4CV2A 1O4VA 1KY3A 4E3ZA 2FMIA 4KVGA 3NS7A 1WX1A 2ATVA 3TMAA 4CEIB 4HXGA 2JAQA 1LEHA 1GAJA 1X42A 2XV1A 1Z07A 3EC2A 4MVJH 1WXWA 4DB4A 3IAAA 2R6JA 3MWDA 3TZCA 4LBWA 1AS3A 1GGEA 2ZITA 3AJEA 3FVQA 3L1UA 4GWLA 3C3CA 4UQOA 4GAEA 2QJTA 1UM9B 3KXKA 3N2NA 1PS9A 1W0KD 2GF2A 1NKVA 5AOCA 1ZWKA 3BT7A 5E6RB 4KXMA 5BQ3A 3TVTA 3M4YA 1EIWA 1BNCA 3K5HA 2BGLA 1T3ZA 2G71A 1OC4A 5HF5A 1Y42X 2C61A 1L7MA 3PEVA 4RWZA 1A27A 2H07A 3FNRA 5H4HA 2NU8A 1S2MA 2ZJ8A 1GCUA 1XQ1A 3DFUA 4I3GA 2WJPA 4CKCA 1ICIA 2FU5C 4NCKA 4PYKA 4MV5A 4N6OA 1K5GA 2V74B 4X20A 3PRKE 4B8WA 4P2GA 4CTMA 2ATCA 1SVNA 1X80B 1Y3AA 2P9GA 3EMDA 3NKLA 4LRSB 3OWXA 5FLXA 1JBKA 1TQ6A 4FUTA 4CL3A 1ADJA 3EUFA 3VO1A 3M9XA 1X7HA 4M0CA 4AKTA 5JDCA 3KHKA 4K86A 1E2HA 4KP7A 3W8DA 2BEKA 3VPHA 2ZIVB 1IULA 1X0XA 1YRBA 1F60A 1TMKA 2FHPA 3C7DB 3BCSA 3H1PA 4UU8A 5HZGA 4ZCSA 3DLHA 1GQSA 2ONCA 3GNLA 5TNXA 1NBHA 4Q3AA 1COZA 1SU7A 1VSQA 2Q5EA 2B20A 1FA9A 2G1UA 2Q4DA 2EKPA 2PM8A 3BMOB 3GRKA 4JR2A 1UJBA 3QYFA 3QBTA 5DW0A 5BXQC 1G9TA 3IILA 1S3IA 4YIKA 1JKMA 4OOEA 2HIAA 2Q62A 3EEBA 4GSYA 4ZN6A 5J9FA 1YL6A 2H2GA 4D4IA 3REOA 3IVRA 3VZCA 4RZSA 4Z5XA 1ZH4A 2VXYA 4GT1A 3WWEA 5HQ3B 3AKCA 4EWLA 5GY7A 3TVYA 4AJ4A 1G42A 1RLUA 2O8NA 3FMVA 3C3DA 3KB6A 2FOXA 5J2UB 1JIQA 1DBSA 5A04A 1PQ4A 3RARA 3O82A 4BGIA 2XMGA 3QELA 4D9GA 4M76B 1GYRA 1UINA 2TS1A 2OKGA 3CJTA 4ZVKA 1E2UA 2ALJA 1N8TA 4JI7B 2QROA 2YH2A 3AHDA 5FJIA 4YRJA 3R74A 1QIIA 3U7QB 1V9LA 2VH1A 5IX8A 3KE9A 4GBMA 5A9TA 3GPIA 2Q3CA 3OZBA 2AZMA 2GA8A 4Y9TA 2K2WA 1RWBA 5DOVA 3ZDRA 3N2IA 2YYZA 4P7JA 3SYMA 1ADGA 2HSEA 3DNPA 5TVKA 4RF5A 5G1OA 3ZJYA 1ECCA 4DTIA 2P9FA 4KGVA 1XDBA 4I19A 5F9HA 2XIQA 3GNSA 4BDSA 1ZQ1A 4PHTA 4UU0A 1AURA 4UARA 4Y6GB 1XTSA 2XRYA 3AJ9A 3N0TA 2V58A 4EPRA 3GFQA 2V3VA 4DC0A 4QU5A 4X64B 2Z2XA 3LE8A 3PIDA 1QPZA 2Q5QA 2NYUA 5H9VA 3TMYA 1DRUA 4YRPA 3NHJA 2I4NA 4LRXA 3IT2A 1CVIA 1W44A 2ADOA 2FZLA 3N39C 3AEZA 4JOSA 1P61B 4CMEA 5C5DA 1QHNA 3NFYA 1KMNA 5F52A 3R8FA 1PL7A 5D1NA 1YFKA 2R00C 3KQUA 1P74A 2HEGA 5KWIA 1U1CA 3EPLA 3DMPA 3D4BA 4D99A 2LR0A 3OCCA 1MABB 3H11A 2VHCA 2FEXA 1WU8A 3MLBA 2FPSA 3TIFA 2O8DA 1Z33A 3G88A 1JU9A 3T9FA 2XVYA 4A0SA 4AKIA 3I9V6 1GUDA 1YV9A 2QMYA 3CA8A 4UD6A 1I4WA 1HBJA 5C7YA 3MYYA 3UFXB 5KJ6A 4O4LF 1EEHA 3ZV6A 3DZKA 4ID3A 1OXMA 3IP8A 2XCOA 1VJ1A 3JQAB 1WHTB 1IUOA 4O2BB 1EHYA 3RLFA 4LGMA 4YMWA 1II8A 1GU1A 2FG5A 2HAEA 2VA8A 3HUUA 4XI9A 5K6AA 1MQAA 4OHOA 4Q3OA 1GXSA 1VTKA 2JEZA 3C3EA 2MSDB 4AG5A 4AY6A 3W9SA 4QLAA 1J8MF 1ODJA 1QLWA 2NZ2A 2NAFA 4F1KA 1OX6A 1U0OC 3CNBA 4EF6A 1EVJA 3U49A 1G5QA 3EPKA 2SNIE 2BSAA 2QW0X 4POAA 2DKNA 5E2IA 2WWHA 4PZLA 2CJPA 4H6WA 3V7NA 1NX9A 3JD2A 3M2TA 3E5MA 3QLVC 3RYTC 1SB9A 3LF1A 3ZV3A 2OYSA 2ZZNA 1Y34E 4PX3A 4JI1B 1GAWA 2PVPA 1JI3A 1LU9A 4YRFA 3CUYA 1HURA 3HWX1 3MWGA 4R1NA 2PQ2A 2FN3A 3WK9A 3ZWOA 3JD4A 2OEPA 2QD2A 4NTZA 1A71A 4GGPA 1OLSA 5CHEA 2X0NA 3IBYA 5TDHA 2NM0A 5DJ5A 5ESDA 3VPGA 3F5FA 1WEKA 4PG5A 4QTUB 4G0ZA 4BV2A 1FBTA 1JI0A 1ISJA 2W0MA 1C0PA 4PIPA 5FUYA 4D0NA 3D3QA 3DLIA 2WD9A 5E7MA 3ZDAA 2FFJA 3WGJA 4QBTA 3O8NA 2PLFA 3T7TA 1QE5A 4M1SA 3R77A 4C08A 4RPGA 5E9QA 3F2IA 2KBEA 2XNJA 2I2XB 2FEWB 2NO1A 3LVRE 2YJGA 4GPAA 1XXHA 3PTZA 1C3VA 1V1RA 5JWOA 2C59A 3ADDA 3FRHA 2B7LA 3OFJA 1IPFA 1ABEA 1MPXA 3JR3A 4XTRA 1JLHA 4Z7QB 1QIEA 1RZRA 4BMOB 3EIQA 2ZT5A 1H66A 4I0WB 1PWZA 2Z1MA 3PNOA 4L4YA 5JZOA 5G0TA 1SUEA 2G0NA 3LVBA 2GJ8A 4O2AF 1PIWA 1HKHA 3ECSA 5IM4F 4YFVA 1O9BA 1R12A 3K1TA 2R2GA 4QZVA 1HLPA 4XX0B 1UDBA 1MAWA 1TNDA 2JJ1D 4O4JA 4IJ5A 3TM4A 4XX1A 1TQDA 4CF7A 4Q4AB 5IDXA 4LZPA 3EG5A 3BGWA 4JLNA 1NWHA 3DE1X 4R8RA 4AS2A 2A9JA 4MPJA 3HYLA 3MXTA 2PWPA 3ZI7A 2ZIFA 4OI2A 1M0TA 5B6PA 2J33A 1O89A 1I1QB 4C6TB 3FTEA 3N53A 3GJRA 1GZDA 3BDIA 4R71A 4KRXA 4QM7A 1J5EB 4TWZA 1QP4A 3QLUA 3CH6A 4M83A 3WR5A 4YBZA 4MCIA 1LKZA 1C9NA 1E6MA 3EGOA 3O84A 4DDMA 4DCCA 2QX8A 3KQMA 1FUIA 1MEJA 1YOBA 2F8LA 4X20B 4XQEA 4PYQA 3X1MA 2JGJA 2DPLA 2FWPA 2OV6A 4INAA 4O0LA 4ZRMA 1MAHA 4JBLA 1YJCA 2J0UB 3EIFA 4YJHA 4UM9B 4G84A 2IEYA 2E5FA 3RU2A 2JGLA 6PFKA 2H06A 3WYEA 1PJBA 3AEUA 3LWDA 1EFVB 4PVCA 5IYZB 2ZB7A 2QIOA 5TX7A 4AZWA 2G9ZA 3I2KA 1XZGA 3C14C 4L6IA 4O1IA 2O7RA 3IDZA 4Q4HB 3WGKA 4MCAA 3S2FA 2VDKB 5CPBA 1UBLS 4GH5A 4D4KA 4EDFA 3DDOA 1PWXA 3PC7A 2WJ6A 4I4LA 4ZOEA 4EEXA 4MUIA 4YT2A 1PNRA 1W75A 4OQ4A 1I3LA 4MJ3A 3FNQA 1RU3A 3IEIA 5FBZA 4DM3A 2W42A 4RA6B 3RU9A 3U3RA 3FGZA 3NEAA 3K9WA 2CMGA 2J3LA