5JYCA

Crystal structure of the e153q mutant of the cftr inhibitory factor cif containing the adducted 14,15-eet hydrolysis intermediate
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
297
structure length
297
Chain Sequence
b'AEEFPVPNGFESAYREVDGVKLHYVKGGQGPLVMLVHGFGQTWYEWHQLMPELAKRFTVIAPDLPGLGQSEPPKTGYSGEQVAVYLHKLARQFSPDRPFDLVAHDIGIWNTYPMVVKNQADIARLVYMQAPIPDARIYRFPAFTAQGESLVWHFSFFAADDRLAETLIAGKERFFLEHFIKSHASNTEVFSERLLDLYARSYAKPHSLNASFEYYRALNESVRQNAELAKTRLQMPTMTLAGGGHGGMGTFQLEQMKAYAEDVEGHVLPGCGHWLPEECAAPMNRLVIDFLSRGRHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CFTR inhibitory factor
molecule tags Hydrolase
source organism Pseudomonas aeruginosa (strain ucbpp-pa14)
publication title Pseudomonas aeruginosa sabotages the generation of host proresolving lipid mediators.
pubmed doi rcsb
total genus 109
structure length 297
sequence length 297
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5jycA01
3IDAA 4X6YA 1CQZA 3GFFA 3IA2A 4H7DA 1FJ2A 2ZVDA 5AH0A 1CUDA 3G0BA 1Y7IA 5FV4A 3WKBA 2HM7A 2WJ3A 2WKWA 3U1TA 5A2GA 1MNQA 3L1IA 3ZLUA 2WHPB 4CG2A 2Y2VA 1XRPA 3R3WA 3H2JA 3WMRA 4KE8A 4G9GA 2DFPA 5HK8A 3OG9A 2OCGA 4BP8A 4C4ZA 5AKIA 1AUOA 3CCBA 4OD0A 5HFAA 4H18A 1R50A 5AM0A 4RE5A 4X6UA 4BZWA 1LBTA 5DYTA 2QJRA 3AFIA 3V1KA 2PVSA 2ZYRA 4ZV9A 3L1JA 2HHAA 4FFWA 5EGNA 1YA4A 3H2HA 1HDEA 1UK6A 2ES4A 3C8DA 4J0DA 2Z3WA 1NU6A 5JATA 4G8CA 3M82A 5JALA 2JGEA 3QYJA 3B5EA 1QLWA 4JEIA 4YPVA 1ISPA 1W52X 5ALGA 5A7HA 1W6RA 1CUZA 4Y2YA 4DIUA 1GPKA 5JZSA 1L7QA 5AHXA 2XT0A 5KWIA 2WTNA 2JGKA 3D5EA 3H2IA 2PPLA 4HZGA 1E5TA 5KWJA 1XZAA 1MAHA 1WM1A 2D5LA 4B80A 4Y2TA 5DTJA 1FFDA 5CXUA 1XQXA 5AKGA 5K3FB 5JD6A 4J0JA 4X91A 3OPMA 2WTMA 3LCRA 1TRHA 3LLCA 3C43A 2J3QA 3FYUA 5C7YA 3C87A 5CT9A 2HA5A 3R3ZA 4X95A 1F6WA 3HYSA 4UFPA 5HF6A 4BVJA 3E3AA 3DLTA 3JYHA 4E11A 1MTZA 4MQLA 3V9AA 5ALFA 1RP1A 4AB1A 4OU5A 1MNAA 4ZGBA 1UK7A 1Q84A 3ED1A 4B6GA 4EUSA 5ALIA 1A8QA 4KE6A 4UPDA 4S0XA 3IULA 4E46A 5ALJA 5E2IA 1DU4A 5K3BA 5BWCA 1BCRA 1CUGA 4Q3OA 3WL6A 5FPQA 1EA5A 4GXNA 1M33A 2X8BA 2QUAA 5C8XA 2I3DA 3GELA 1JKMA 2I78A 4TVKA 3BXPA 4RE6A 4J0IA 2QMQA 3QPCA 3FYTA 3MUOA 2GBGA 4W9RA 1ZD2P 3BE8A 2XQKA 1ETHA 4BCCA 4LYEA 1ZI9A 4OB6A 1MPXA 2H9YA 1SCIA 3I2GA 3QPAA 5YASA 3STVA 2WJ6A 3F97A 1VA4A 2ZJ7A 3ESDA 1R4ZA 1JFRA 2JIDA 4LHEA 1TIBA 3O4HA 3B12A 1LPMA 5E4JA 2AJCA 3IIIA 4EY8A 1LZLA 3PFCA 5AJHA 2PL5A 3G7NA 1L7RA 3VKFA 1VA5A 2XQFA 3WZLA 1VE7A 4JNCA 2AJLI 1YSCA 3WWDA 3OM8A 1EB8A 1CUJA 2GYVA 5LKRA 1UOPA 2BGRA 3QVMA 4UBNA 1ORWA 1AZWA 2CUTA 1QFSA 4AO6A 5IVIA 5ALNA 2C0PA 4B83A 4BZZA 5JIBA 4BCBA 1VOTA 2OAGA 1PJAA 3OC0A 4G8DA 5AM5A 3FVTA 1QIKA 2DR0A 4FBLA 3BF8A 4OB7A 4HTAA 1N8SA 4QWMA 4H7EA 3V1LA 3IUMA 3EQ8A 1T2NA 3D59A 3G9UA 3A2MA 5AM1A 2GZRA 2WHPA 1Q0ZA 3SX4A 5JANA 2HU8A 4QE3A 4CIBA 2ECFA 2XUOA 3R3XA 1O6GA 3WKDA 2HADA 5IVDA 5AKHA 2CMFA 2XMBA 4KRXA 1VLQA 3HLKA 1H2YA 2IX9A 4W1QA 5ALWA 3WA7A 3FYUC 4XWGA 4Y2UA 4L3WA 1UKBA 3JWEA 4I3FA 2WFLB 4WY8A 3IURA 3C6BA 4P08A 3QM1A 4GW3A 2C7BA 4MEBA 5DLPA 1SFRA 5AI4A 1E8DA 3KD2A 4X3CA 1IZ7A 1LBSA 3AIOA 1XKLA 4JYMA 3TRDA 3H17A 1XRRA 2OLEA 4P93A 3PICA 2WIDA 4LKOA 2RHTA 4BVLA 5HKBA 4OPMA 5JZBA 2QZPA 4AO7A 2BGNA 1FFBA 2X5XA 3EQ9A 1CUSA 3IBTA 1HKHA 4FHZA 2PSHA 3M81A 1IMJA 1EK1A 3C6XA 2CEKA 1XZIA 3ZLTA 3IUNA 1YS2X 5ALDA 1XKTA 5A7GA 5HF9A 3D0KA 1QZ3A 1XLVA 1FSSA 4YK7A 5CT4A 3W05A 1ZI8A 2G5TA 2WUGA 2ZSHA 5AICA 2HDWA 2XUJA 1TK3A 2VT6A 1MAAA 4KAFA 2VQ6A 1DX4A 1EVQA 5LZ9A 1R9MA 1JU4A 2V97A 4NZZA 4KACA 4ETWA 2HA3A 1XZHA 3I2IA 3C45A 3FSGA 2D0DA 4U2DA 3DL4A 3VJLA 4X97A 1AURA 2J4FA 3I2KA 4J0HA 2JGJA 2WIGA 2VTVA 3G9TA 5JADA 2C5GA 5EHQA 4EZIA 3TEJA 5E4TA 4EHBA 2CB9A 2PSJA 4L9AA 2XUPA 3VJKA 4BAZA 1X70A 2XUDA 1CUWA 4HXFB 1CUBA 3GUUA 5KREA 2OQIA 4QDTA 3ZLVA 3VXKA 5HFNA 2IIVA 3AZOA 2RHWA 1EHYA 3H2KA 2QT9A 2GYWA 4BBZA 5AIAA 4CCYB 1CLEA 2V96A 5CURA 1JJBA 2PBLA 5DNUA 3WK9A 4MXDA 4AZ0A 4MWSA 2YH2A 2QS9A 4EY5A 1DWPA 4WDQA 5EHNA 3DL7A 4G4GA 2JF0A 3W9BA 1QIHA 2O2HA 5AK4A 5EHZA 1DTEA 3N0TA 2H1IA 1UFOA 4MJ3A 2XUAA 4N5HX 2QOEA 4B84A 1XLUA 4BYMA 5K3CA 2RAUA 1GT6A 2RGUA 2FX5A 1MU0A 1BN7A 4WJLA 1YA8A 1OCEA 1N1MA 4JYPA 3SC2A 1CV2A 1IVYA 3H1BA 1S8OA 3ANTA 3E0XA 1G5FA 1F8UA 5ALXA 3AZQA 3CXUA 1J1IA 2Z8XA 4XVCA 2O2GA 4FLMA 3UUEA 3YASA 1WOMA 4AO8A 3D4LA 1XQYA 2B9VA 5EIAA 1GZ7A 3ZI7A 3VISA 3R3VA 4RGYA 2WUEA 2PSFA 2QKYA 2OGTA 5AI6A 2ROQA 2EDAA 1A7UA 4M0MA 1WB5A 5ALHA 4WFKA 2XUHA 2XMSA 1XZJA 3JW8A 4CCWA 3AIKA 2OQVA 4DLNA 4H7FA 2VATA 4WCVA 3WK5A 1WB6A 3D2CA 2WUFA 1EXWA 1H2WA 3ICWA 1ZGCA 2WHRA 1CQWA 1CUVA 4UBKA 1P0QA 3ESBA 4GBGA 1QO9A 1WCYA 3FOBA 4H0CA 3TGLA 1ZJ5A 1XQWA 1FFCA 2ZYSA 3BIWA 2JGIA 4KE9A 1B6GA 1CPYA 2OCIA 4H77A 2P8SA 1QIIA 1BRTA 2DSNA 3DD5A 3DKRA 2OGSA 3I2HA 3QITA 3F9CA 3GROA 1BEEA 5ALLA 1UK9A 4C87A 3TJMA 4V2IA 1U2EA 2HIHA 2BCEA 2HU5A 4Y2JA 4OYLA 4LXHA 3T52A 1WPXA 1TQHA 1XZGA 4PF1A 1IUOA 4C88A 1AKNA 3S8YA 2WFMA 3GA7A 3C70A 3WKAA 1MJ5A 1GPLA 2WM2A 5EIEA 1XLWA 3G0CA 4KYVA 5JYCA 5ESRA 5LLSA 3FWHA 3EF3A 4I4CA 5I7UA 3I28A 1XZDA 1RYYA 4F5ZA 2RI6A 4ZI5A 2HA4A 1U8EA 3STUA 2CZQA 3C6ZA 1W4LA 3VDXA 2ONCA 4JH0A 1PV1A 5JD5A 5AOCA 1CUXA 1JJIA 3FVRA 2DHCA 1Y7HA 4OCZA 1JMKC 2XLCA 4K5QA 3IUJA 2O2IA 4NVRA 5K3DA 3D2BA 2AJ8A 3F98A 2XMZA 2PU5A 2WIJA 3BL8A 2WHQA 4BE9A 4ZWNA 2BUCA 3R3YA 1LPSA 3A70A 3DYIA 3WL8A 4BB0A 2OXEA 2RIPA 3PF9A 3V1NA 2O7VA 4QLAA 1GXSA 2Y1KA 2WU3A 3I1IA 3UUFA 4HXGA 2R11A 2HA6A 3K6KA 1XRLA 3A2NA 4E14A 5AO9A 5FXMA 1IUNA 3BJMA 1MX9A 2JGFA 1XQVA 4KAJA 1VXOA 2E3JA 3W04A 4NS4A 4W1RA 1USWA 5AM2A 5ALUA 3O4JA 3EQ7A 3Q8WA 4INZA 3LP5A 3R3UA 3AIMA 4PSDA 3HC7A 7YASA 2YYSA 4EBBA 3M83A 1CUEA 3E1GA 1TCBA 4PNZA 2ZJFA 4Y9SA 3DEAA 3WJ2A 4UUQA 5JZ9A 1OXMA 1WB4A 4A23A 1DQZA 4U2FA 3AJAA 2LIPA 2I3ZA 2GBFA 1XRMA 3SK0A 4HRXA 3IB3A 3E4DA 2B20A 1UK8A 5HQ3B 3I2JA 1EDBA 4CI9A 4DNPA 2DHDA 1I6WA 4JUIA 3X3HA 4UBLA 4ZXFA 1Q0RA 1C4XA 3O4IA 3MVEA 4K2AA 3DS8A 5K3AA 3FLEA 2OG1A 1YR2A 1ZI6A 4W1SA 5H3HA 5CT8A 2Y2UA 2XUFA 3WK6A 4J0CA 1AMNA 3H0CA 4IQ4A 3WK4A 3F8SA 4FLEA 3WKCA 3WKEA 5LKAA 4B0OA 1THGA 3PE6A 3KOOA 4YASA 5AM4A 5C8ZA 2VSQA 5A71A 5ALPA 4KAAA 5T4HA 1KU0A 2VJCA 5SYMA 1QIEA 4AMZA 4ZRDA 4BC1A 1O6FA 4Q05A 2HA7A 2HFKA 4H7IA 1MT3A 5DJ5A 3G9ZA 4Q1VA 4ARBA 5CH5A 5EHXA 2QTBA 1AC5A 3ESCA 1PFQA 5HCUA 1XZEA 4H7KA 1LZKA 2DCMA 1CUCA 5AK5A 4DMFA 3ILSA 4BTLA 1VZ3A 4LXIA 5IH7A 3NOXA 1FFEA 1XZLA 1HLGA 2XMCA 2XUKA 4EB0A 3F96A 5K3EA 4Q82A 4UHDA 5KBYA 1IZ8A 5EFZA 1NU8A 5SYNA 3V1MA 4H35A 4HS9A 3R0VA 4EY4A 5CBKA 5JAUA 4BCDA 3PUIA 5D3KA 4CG1A 1N5RA 2JGLA 5FDFA 4GLBA 3WWEA 2BUAA 3PDCA 5ISMA 5EI5A 3LIIA 5AK6A 3DDUA 2ORYA 4I19A 2BFNA 1DINA 2J4CA 3CN7A 1A8SA 2PM8A 5ALSA 4MYSA 4GEGA 1EDEA 2EDCA 1XZKA 4G8BA 5AKKA 1CEXA 3QZUA 2JEZA 4BAUA 5JARA 4X6XA 4DGQA 1P0MA 2BUBA 5AK3A 3DCNA 6YASA 1CUFA 4Y2PA 4TPKA 4AMYA 5ALVA 1QFMA 3HABA 4N8EA 3B3QA 3MUNA 1J06A 2X76A 1F0NA 2I03A 4N8DA 5AKYA 5FOQA 2WUDA 1MO2A 3WYDA 5LZ4A 1DT3A 2H7CA 1P0PA 5T4FA 4U2CA 1QE3A 3I2FA 4DSZA 2XDWA 1WPRA 1UT6A 1L7AA 3FCXA 1ZICA 2VJDA 1K6EA 3I1YA 4J3JA 1QJ4A 5C81A 1H22A 2VF2A 5BOVA 2C0QA 1GKKA 1W1IA 3ICVA 3N2ZB 1LPBB 1EVEA 1SCQA 3QH4A 1C7JA 4X00A 5ALQA 3FBWA 5AIBA 1E89A 4A16A 3GBSA 1CIJA 4W63A 4W1PA 5CH8A 4LXGA 2QXTA 3WK7A 3P2MA 5CH3A 3RLIA 3IVMA 2XUGA 4FWBA 1LGYA 4FDMA 1DWOA 4B82A 2HRRA 2VJAA 2WLSA 1QIJA 1GPNA 5ALTA 2VAXA 5AOBA 3KWFA 5IVKA 4PV7A 3O0DA 3T4UA 4C01A 3H19A 1ZIYA 1J07A 5FUMA 2YASA 1ACJA 3GZJA 4BVKA 3WWCA 3WL5A 4B0PA 4J0KA 4DMCA 4C89A 5CXXA 3F67A 2VJBA 1UOOA 3STTA 3CN9A 3WZMA 3WWPA 2OAEA 1JMYA 4BP9A 4N5IX 1XROA 4MWTA 3FYUB 3OTQA 1CRLA 3M3DA 1KEZA 2VA9A 1QIFA 1AQLA 2W22A 2FJ0A 4BDTA 2XQJA 2DQZA 3LS2A 2Q0XA 5FLKA 1EB9A 4FMPA 2HRQA 3S2ZA 4UHCA 3G8YA 4NMWA 3ANSA 5AI5A 5AOAA 2Y6UA 5D6OA 1MX5A 3HZOA 2HA0A 3VVLA 1LNSA 1UWCA 2BJHA 5HK9A 5AI0A 3RK4A 4HVTA 4MYDA 2WG1A 1AGYA 5CMLA 3WI7A 4Y7DA 4AX4A 1CFJA 2HFJA 4F21A 5JAPA 1TCCA 4DTCA 1EI9A 3Q0TA 1WHSA 4H7JA 3C5VA 5HF8A 3OURA 4WDRA 4FLFA 2GYUA 1H2ZA 4FBMA 1QOZA 1UXOA 3QMWA 5LZ2A 2BKLA 1DX6A 1HBJA 1UZAA 5FP0A 4IO0A 4F60A 3KDAA 4G9EA 2QUBA 3FAKA 2XQIA 4UHEA 3PF8A 3I6ZA 5D7BA 1A88A 1E66A 4BC0A 4LYDA 5LYYA 1C7IA 3WIBA 2DQYA 3MGAA 5DYYA 5C8VA 1VE6A 3WJ1A 4UFNA 4Z49A 5ALYA 4PSCA 3W9UA 1K4YA 2QVBA 3HSSA 3V48A 4CFSA 4QEKA 1CUHA 3HJUA 5CTAA 3KSRA 3DJYA 1K5PA 2G4LA 1RWQA 5EIHA 1Q83A 2ACEA 3C6YA 5F4ZA 1LLFA 3D2AA 3AINA 3G0DA 4U2EA 4GHWA 1H23A 1SCKA 5LZ5A 4U2GA 5CT6A 4Q3KA 2UZ0A 4G4IA 4OB8A 4FTWA 5CT5A 5AKXA 4AN0A 5JASA 4X7BA 2QRUA 1BS9A 5AKJA 4HRYA 4BAGA 1QTIA 4DYHA 4UBOA 1BN6A 3RM3A 1Y37A 2XB6A 5IVHA 3HI4A 2XE4A 3D3NA 2ZYHA 3CCCA 3UMJA 4DNQA 4XJVA 2WQZA 1KU6A 2PUJA 2GBCA 4Y2QA 5BWBA 3I6YA 1MX1A 1W76A 4KEAA 1X2EA 4RPCA 2QR5A 1YAHA 3ESAA 2WU4A 3NUZA 4MEAA 5E4YA 2PUHA 4L72A 3WK8A 4IH9A 3WYNA 1QO7A 3H2GA 5A7FA 4BDSA 3OOSA 3STYA 1EH5A 2C4HA 2VAVA 2V98A 4X94A 1FFAA 1EDDA 4Y2XA 4BTVA 5HKAA 2ACKA 3LIPA 2FUKA 2PSDA 4J03A 1G4HA 3WLAA 2HU7A 3DKKA 5I8PA 3DNMA 3H1AA 4TGLA 4DM7A 3G9XA 5LP1A 1DWQA 2IITA 1YB7A 5AKZA 1XZCA 4BE4A 3HACA 4ITVA 1XRQA 2RONA 4X92A 3ZWQA 1K63A 4J7AA 4UFOA 5CRIA 3PFBA 3ZV7A 4GI1A 1TAHA 4GWLA 3C5WP 2R8BA 1XZBA 4B9AA 1E3QA 3D7RA 1SC9A 5T4EA 3C8HA 4WFJA 3FLAA 3WIOA 4DNFA 5J3JA 5DTIA 3ZPXA 4AQDA 1ODSA 4QNNA 1Z68A 3KXPA 4UBMA 4UHFA 3KWJA 4CIAA 2ZSIA 1MN6A 1E8MA 2PKYX 5I9IA 4Q3LA 2QJWA 1XZMA 1CUUA 1DQYA 3K9BA 1OILA 1TKRA 1JI3A 1ZJ4A 4EY7A 3G02A 1UKAA 2V9ZA 4HXEB 2OGZA 2XMDA 4B85A 3O9VA 1BCSA 2C58A 1GGVA 3HRHA 1R88A 4X71A 2Z5GA 4G4JA 3NWOA 4K6HA 1P0IA 2Z3ZA 4WFIA 5JAOA 1LPOA 3I6MA 4BRZA 3IUQA 2J3DA 4KE7A 1T4MA 4EA6A 1QGED 4GDMA 2XMRA 1BE0A 3AILA 3WA6A 1EX9A 2WILA 2H7YA 5DNWA 1U65A 2XMGA 4DMHA 1WHTA 4L0CA 1UOQA 2XUQA 2WJ4A 4X85A 3STXA 1ORVA 2JEYA 3WWOA 1GKLA 5IKXA 4K6GA 5ALZA 4Q34A 2XQGA 5HZGA 4KR0A 5K3FA 2OCLA 4OYYA 4IH4A 4G5XA 4C4YA 4OUKX 1A8UA 3DOHA 1R1DA 3G0GA 2YXPX 5LZ7A 2G5PA 2AJDA 5ALMA 5FPPA 1K8QA 4QDUA 2NW6A 5BV7A 1QIMA 2XI4A 1ACLA 4QLOA 4PO3X 1VKHA 1BROA 1YAJA 1VXRA 2WSLA 3A6ZA 1D07A 4H7HA 2ZYIA 4Y2SA 5JAHA 4UHHA 1J2EA 4N8SA 4DNOA 4RNCA 1CUAA 4P92A 2K2QB 1B41A 5AI9A 4WY5A 4O08A 5A62A 1U4NA 1YB6A 2CJPA 5FKJA 4PSUA 1GQRA 1BU8A 1BEZA 5AKLA 2EEPA 5AI8A 4G1FA 2GZSA 4QA9A 4A5SA 4QDZA 4J0GA 2O7RA 3A2LA 5ALOA 2PSEA 4IHAA 4HAIA 2B61A 4DMKA 4FFVA 3BDIA 1ZD4A 3PUHA 4QZVA 1F0PA 1QIDA 4PQEA 4XIIA 5DWDA 5AM3A 1JJFA 3EBLA 1E8NA 4M0FA 5AP9A 3EIOA 4Y2VA 1TCAA 4K6KA 3FCYA 1H2XA 5AKEA 4C4XA 1EK2A 2PX6A 2XMQA 1CR6A 4F0JA 5A6VA 1AX9A 2ZJ6A 1HL7A 5DNVA 3DYVA 1X2BA 4CG3A 1NX9A 4FKBA 2G63A 1YS1X 4D9JA 4ZREA 3R40A 3VJMA 1HPLA 4ARAA 1R3DA 2JBWA 4GECA 5LIPA 2HA2A 3G0IA 3BIXA 4M0EA 3FNBA 3WQHA 3AUKA 3O4GA 2OCKA 3L1HA 4AN1A 1JT2A 4KRYA 1DT5A 4CCYA 4UHBA 5HQ3A 2JGMA 3QMMA 5HF5A 3O95A 3K2IA 5JD4A 3RARA 1CUYA 4LIPD 3NGMA 2VEOA 1SOMA 4C6HA 4ZV7A 4AXBA 4FOLA 3BWXA 1GQSA 5LZ8A 3O9MA 1CVLA 2B4KA 1ZGBA 1CUIA 1G42A 4OSEA 1THTA 1VJ5A 2HL6A 2FJPA 2PU7A 1ZD5A 3QPDA 1QONA 4BATA 3SWWA 1QTRA 5T4BA 3AZPA 3HXKA 4E15A 2WFLA 2C5FA 2GBIA 3FSGD 1IUPA 1XZFA 1ODCA 2DHEA 4EY6A 4DSAA 4IH1A 2AJBA 3BDVA 3RKSA 1UKCA 3BJRA 5ALRA 2W6CX 1LPNA 4QWWA 2CBGA 5DYWA 1JU3A 2VT7A 4UBIA 4QDXA 3H18A 2QXUA 1N5MA 4AZ3A 4KJXA 1ODTC 3WL7A 2H7XA 4P9NA 1YASA 3W2TA 1W75A 3W06A 2WIKA 3DQZA 4OU4A 1EINA 2WIFA 3STWA 3U0VA 2QM0A 4B7ZA 1ZOIA 1XFDA 2Z8ZA 4X93A 3BF7A 2BAGA 2Y6VA 1VZ2A 1LPPA 3VVMA 1QIGA 5K5EA 1HQDA 2AXEA 3DOIA 3QMVA 5ALEA 1XRNA 4XX1A 4B9EA 3HEAA 2WG0A 4U2BA 1G66A 1ZD3A 4Y2RA 5ALKA 1R9NA 4X90A 4BRSA 1ZIXA 3H04A 4ROTA 2WG2A 3R41A 4PW0A 2XUIA 4FNMA 3PI6A 4UBJA 5CW2A 1YCDA 3QBJA 2CKMA 4B81A 4YX9A 2WFZA 5D3ZA 2OPHA 1LPAB 4FNGA 4MQMA 4QDOA 5FRDA 2XLBA 3FLBA
chains in the Genus database with same CATH superfamily
4E32A 4DPKA 3K1ZA 3OEYA 1YCGA 1GZDA 4HGRA 4HWRA 5IF9A 5CBPB 2C7RA 3BD6A 3I37X 1W0KA 1P5FA 2FI1A 1FJ2A 3A1WA 3JZAA 1X7WB 2O4CA 2I22A 2I4NA 3NHUA 4M55A 1FUYB 1TGYA 1OFVA 3K9CA 4MUEA 5AVXA 5J4YA 5J2UA 2VNSA 4AJPA 4CKEB 3K0CC 4DJDC 4EUEA 3O82A 1Q7CA 2WJ3A 3RSCA 3BD9A 5IZCC 3A4VA 2AXPA 4BECA 2A9RA 5E3JA 2G4CA 2CL6X 3NYRA 3HFRA 3GR6A 2FSGA 4JQCA 1JR3E 1MNQA 3K35A 4A8JB 1ZK2A 3ZLUA 4YXWD 1NASA 3GX1A 1Q1QA 2XHZA 3F7TA 3M1LA 1Z4LA 4FEAA 2DR2A 4P2GA 1TMGE 2V1UA 1A8HA 2XNKA 1H8HA 2QAGB 3FNRA 3VTKA 3GLFB 4CF5A 3GDOA 1NI5A 3U81A 4IHJA 5CHEA 2IUEA 5K0FA 1JEYA 2QRNA 2XX3A 2Y1WA 1YQQA 5HK8A 3OG9A 4Z4IA 3KR1A 5J43A 4G0PA 1C4OA 1IAVA 2AC4A 3FZNA 2FJUA 3AU9A 4DLUA 4KG7A 2B1JA 3GJXC 4RGVA 5AKIA 1JFTA 4BB9A 4M8SA 1I5RA 3B9BA 4DCJA 3I52A 3D3KA 3U60B 1P9RA 3VKGA 3HQ4O 1R50A 5AM0A 5DIZA 1RYNA 2ATVA 1DOHA 1ONNA 3DHVA 3JVDA 4BUZA 3T1QA 2FPGA 2OOSA 4M0LA 4RD4A 1H0KA 1XF9A 3JWGA 1KO5A 1XDZA 3EUEA 3NBQA 1CRQA 4PLWA 4EB6B 2FPSA 1LI7A 2W6ZA 3K0FB 2I3BA 3PFWO 5TY0A 3V1KA 2BMFA 4XB6B 4R8VA 2I8AA 3L1JA 1F8FA 3JAWA 4X84A 4D9KA 4E5SA 2GO7A 3VOTA 3BREA 2C7OA 1GNVA 5EGNA 5FPKA 2A8YA 2ZQZA 3HB5X 2B69A 3LX6A 3QI7A 1P0FA 3BIFA 4NZPA 4C7VA 1SU8A 4CL3A 2W37A 1MDFA 2JKVA 3K53A 4J0DA 1K9SA 4TS4A 5FFFA 3TXYA 5JATA 3VDQA 3WQBA 3BGVA 2JIRA 2B21A 3AHFA 3LWBA 5DHTA 4LS3A 3RUHA 4C29A 4D74A 1P81A 1ZVJA 1QE5A 4MQ6A 1N7IA 3QYJA 4C4OA 2E4AA 4NOMA 3I9KA 1C7RA 4M1OA 1T91A 3FWZA 4HGZA 1GUBA 3V3TA 4ZYZA 3PFFA 3EPPA 1LRKA 1X15A 1J5XA 4EENA 1XPRA 1CUZA 4FCTA 2JI7A 2AVDA 4Z9AA 4YMLA 2FXIA 3OQIA 4XWYA 5JZSA 1ZN8A 2CN1A 1PW5A 3R20A 2B8EA 2RSLA 2A1TR 5D84A 1VCMA 5K0GA 5KIAA 2PUEA 1L7QA 2R4UA 2W2VA 3L0OA 1U1FA 2E1RA 5KTOA 3ROZA 1H93A 4MVJI 8AT1A 2ZOSA 5KWIA 3IAHA 4H4EA 1ECCA 1PQUA 3FUCA 1ECLA 3GPBA 2PRZA 2EHJA 4EMTA 1EFPA 4ISBA 1V5FA 4NEGA 3DO8A 4R1OA 1UR5A 3C1AA 1RJ9A 2AL7A 1O97D 1KK0A 4HZGA 3SBOA 1QR2A 3BT7A 1DDIA 2BKAA 4ER3A 1JDZA 4GZ6A 1C9YA 1MAHA 4M3NA 1WM1A 1JQBA 1OKKD 2D5LA 4KWIA 2R00C 4Y2TA 3WGNA 2FE1A 2BFEA 2VDVE 3WG9A 5J47A 4ZVVA 1SHJA 2IZZA 1BFKA 1N2CE 4RX1A 3HTXA 3UN1A 3QVTA 1XQXA 2Y1GA 4HBGA 1A1SA 3KCNA 1KYXA 1TVCA 3ZHTA 3PUWA 3TD9A 4BKQA 2ECPA 5BR4A 2Q3CA 2ZRIA 3OPMA 4TTPA 4FE3A 1NL3A 2F3SA 4ENUA 4ZYVA 4Q7QA 4TXHA 3EGDA 3Q9LA 1TRHA 3S2SA 2OGWA 5CT9A 1PR5A 7AT1A 2HA5A 2H4WA 2I8LA 1T0HB 2SHKA 2XZTA 3MTEA 3UT5B 4BBPA 2GESA 3AKCA 3UJAA 5FCDA 3M4NA 1HTBA 4IF6A 4BVJA 4NQZA 1PKEA 3DLTA 2Q4TA 3Q3JB 4MK4A 4OQQA 1EM8B 2DLDA 1W1WA 2EOAA 1KC1A 3SQLA 3NVDA 1MTZA 4IIDA 1X1DA 5COQA 4QREA 5KYYB 4BLTA 2P9YA 4LRXA 4AB1A 2FW8A 3CNQS 5C7LO 2IKQA 1UJ2A 1B2LA 5KEIA 3PE4A 3FYSA 2CK3D 3L7MA 4JR1A 1FSZA 4CM4A 3PC4A 4I99A 1Q84A 3ED1A 4B6GA 1I6KA 1N32B 5K7SA 3EDYA 3DZHA 1A2OA 3RT9A 2FLKA 1E6EA 1M0SA 4KE6A 2G0NA 4UPDA 3R7LA 3ZG6A 4UM9B 2AMJA 1M2NA 4NJOA 4E46A 4MGZR 3KQUA 5K3BA 3FKQA 1R0BA 2FGKA 4D9EA 1O9BA 2FLVA 1MA0A 2IZOA 5JECA 1CUGA 4RKRA 1O0BA 4LRSB 1E7WA 5IPFA 1M33A 2HH9A 5T3UA 3K4HA 1ZEJA 4DT1A 1KWKA 3ICQB 4TYWA 2C9DA 1OAAA 3GBVA 4KRFA 5KZMB 4TVKA 1R4AA 5JSHA 5J58A 1R6DA 3BXPA 1P77A 3T9AA 2XOKA 1J0AA 2XR1A 3CH4B 3ROXA 1KI1A 1LSUA 2JFGA 5TMPA 2JLQA 3CVUA 5HW0A 3RTAA 1LFDB 1WDMA 3TI7A 2GBGA 4W9RA 2WRZA 3VHXB 5IYZA 1ZD2P 3KLPX 2I4LA 2R8XA 4BNJA 2XQKA 3H4MA 3CBQA 3RIGA 5KVAA 1E1MA 1WKBA 2IX3A 3AR9A 2W6OA 3ORQA 2Y0DA 4DARA 2DQ4A 4DCMA 2Y92A 5JMPA 2G5CA 2H9YA 3GCXA 1Q7RA 1YJ5A 1RQGA 1NE2A 2QU8A 3ETLA 3I2GA 1SPBS 3B1KA 4J43A 4TLMB 4AYXA 4XRGA 4QARA 3IYLW 4TKZA 1QVRA 2ZJ7A 5H82A 3ESDA 3VZQA 1R4ZA 3LY7A 2JIDA 4AZ3B 3F5QA 4YR7A 5JCJD 5C46F 1TFRA 1E2UA 2YS6A 5IVPA 2C1ZA 3GIDA 4JXJA 5C4MA 4LHEA 3CZ9A 4B6QA 3DPIA 3E48A 3JATB 4K2HA 4PIVA 2AX3A 3W7AA 5JD3A 4AP6A 1EIZA 4EJ0A 3A10A 5FR2A 1LZLA 3PFCA 4FT4A 5AJHA 3ZUGA 2QQFA 4FUTA 5HXAA 2HSWA 3LXXA 3G7NA 2JI9A 3S3TA 3QOYA 2WKSA 2P11A 2VRCA 4BIMA 2XQFA 4FYYA 2PT7A 4PPYA 3OJEA 3WZLA 2F1JA 4UUOA 2AI2A 4BV3A 2C9MA 3GIWA 2VDOB 1T2EA 2QGFA 3AEKB 3GVPA 1UWKA 1ZGJA 1GCIA 4NYMQ 2YVLA 4DUYB 4OHOA 3WP0A 2Q2QA 5JNLA 1T13A 3IXLA 4C2BA 1LH0A 2QB5A 4B73A 2GYVA 4BVGA 2F64A 4UBNA 3BXHA 2G06A 1LA2A 3N74A 1KOJA 3ZKAA 3M33A 2C2MA 4WTOA 1ICIA 2XOXA 4ZD6A 2O9JA 5K3SA 2Z2JA 2XTJA 4YH1A 1GGMA 5BURA 2K4MA 3TIGA 3VKWA 3OBBA 3PYLA 3QIVA 5ALNA 5F35A 1NE7A 5IVIA 5DHUA 4AIRA 2EX1A 1USVA 1NXOA 4BCBA 1VOTA 2Q7OE 5JIBA 1E60A 2OAGA 3AEXA 4FBGA 3VV3A 1TRKA 3FVTA 4FBLA 1OE0A 2BI4A 3MIZA 3TOZA 3NBYC 4F85A 3TLGA 2I2WA 5BOSA 3GZNA 2AF3C 4OG2A 3E9DA 4ZVTA 5KQPA 2H6EA 2O2YA 4QWMA 3UWSA 5K2OA 3UMFA 4N0DA 1Z5VA 3V1LA 2C7PA 1S4QA 3D6JA 2VDWA 4JUCA 3S5JA 3AXSA 1QKJA 1SIBE 3ZOKA 1T2NA 3WGTA 4IV5A 2FHSA 3D59A 3R0JA 1SR8A 3A2MA 3G9UA 3KJQA 3RVOA 5B57C 3NNNA 2FW7A 2V6BA 2GZRA 4C6TA 3DHEA 2WHPA 4IMPA 3S2IA 3UYKA 1X19A 1X7XB 4EAQA 4CIBA 4WESA 3PNVA 1O6GA 3R3XA 4ZO9A 2QSUA 3KJZA 3ODPA 1L4KA 4HB0A 2Z5FA 4JQOA 5AKHA 5JS2A 2H1LA 3GBPA 1OZAA 1DELA 1M8FA 1RWVA 2CMFA 4W6QA 4M1TA 5J5CA 3T1VA 3UAGA 3V1UA 3QOWA 2YJNA 2FKNA 4HNAB 3HLKA 1OH7A 3W5UA 1K6JA 3ONDA 3PSAA 3PK0A 1K4KA 1CVIA 5FUYA 4IMJB 4L2IB 4C0JA 4XWGA 4URHA 4Y2UA 4A2WA 2CVPA 3RF6A 3BBLA 3VH3A 1A7AA 4EZBA 4C7OB 4O1MA 5SZJA 2J6CA 4OHXA 3E3MA 4MPDA 4AU1A 3U7QA 3RI3A 1A5AB 4TT3A 1GNRA 3VVCA 4RIEA 4CR6A 3JWEA 3UNXA 2G67A 3A3NA 1MG5A 1QHFA 1DO8A 4BNTA 3QM1A 4GW3A 2C7BA 3AY6A 4MEBA 4NH4A 5DLPA 4F6CA 1SFRA 3HYLA 4QVGA 1E8DA 4KI0A 5AI4A 5EINA 2PJRA 4PX3A 1K75A 3KD2A 4QHYA 2GSWA 3WB2A 1IZ7A 3KE9A 4G81A 5LU9A 1XKLA 4JYMA 3HH8A 2P5SA 4KREA 1ZNQO 1G18A 3FNIA 3U61B 4TSRA 1XRRA 3JARB 3OM9A 3QFRA 3UWMA 1YE8A 3O9ZA 4EA9A 1XR3A 4CF3A 2XYGA 2IHBA 3JRNA 4J0EA 1G5RA 1SVKA 1RI4A 2WIDA 3ENQA 3HZRA 1U2DA 4LY3A 4LKOA 4JI8B 3QWFA 2J3LA 4BVLA 4DMKA 2A9FA 3C1UA 3R6WA 4OPMA 1Z6ZA 2F8LA 5C18A 3NDBB 4UXHA 1G291 2QTLA 4AKIA 3EHDA 2C2OA 2WI8A 4AL4A 1X39A 2C54A 2RKOA 2X5XA 3BCRA 4AKEA 1EGQA 4YT2A 2HGSA 3D64A 4BB6A 4ZAXA 3V32A 2NO7A 1PGPA 3TFQA 2HJSA 4Y8VA 1ESCA 3QX8A 1B93A 4U7DA 2AYZA 4KGVA 1WMEA 2N46A 3M6FA 5HILA 1M75A 2B9EA 4WOBA 2O8CB 3DEFA 3OPXA 4WECA 1ZOLA 3Q88A 4G3XA 2VWGA 4IY1A 1DTSA 4ND4A 1VGQA 3REQB 2CV1A 1NPDA 1ORHA 2PT6A 4K28A 4WY2A 4IV8A 3UGJA 5TJ9A 5A7GA 2PT5A 1P0CA 1L7VC 2XNDD 5HF9A 3HRKA 3N5KA 3K20A 3M6MD 4JR0A 4E51A 1THZA 1NBHA 1Z06A 3UVEA 5I7HA 5K8LA 3RUCA 3IMEA 2H06A 4RABA 4MW7A 5CM9C 1JI0A 2DZDA 2PZMA 3EAQA 3FNFA 1JR3A 4DDUA 3H2YA 1XLVA 3FWNA 3UK2A 3WFZA 2DFNA 4PANA 3ZGZA 6REQA 5I7EA 4UNRA 3AF6A 3K05A 3PFNA 1GTJ1 3GFSA 3P9RA 4PZCA 1FTNA 5EE3A 3H75A 3ZDFA 3C41J 2R3SA 3K1AB 4X60A 1DKLA 1M0WA 3ROQA 2G5TA 3SQNA 3FWYA 3QKTA 2C5HA 5DDIP 1P4HA 2V3VA 2ZSHA 4Q02A 3VOBA 3LQRA 1PS8A 3WICA 4PCLA 2GFQA 3FGZA 3OE7A 2ZBUA 5IBQA 3TR6A 1JB1A 3FE2A 3DFFA 1U3TA 3RQIA 4L15A 1DX4A 5EZ6B 1Y1KE 1U7DA 2P2GA 5JXGA 2GZ3A 2OXIA 3WIDA 5CG1A 3DFZA 5LZ9A 1IMOA 4OBEA 4FFSA 4G0WA 1M1YB 1HH4A 3BULA 3I58A 1IBKB 2QYTA 1V16A 3N3AC 1Z2AA 3W90A 5IMSA 4GYJA 2HHLA 4NZZA 2R44A 4KACA 5F3DA 1NUHA 1IL0A 3TX2A 5M7EA 4ETWA 4KN5A 2DMRA 2E82A 1B7GO 1Z2DA 3PJEA 4WXPA 1J2UA 3OWXA 1HYBA 3I2IA 3LLVA 4MQEB 4OMFG 3SZOA 2D5CA 1TF5A 3TIIA 3R0IA 3NH9A 3HBAA 1ZH0A 3OZVA 1ZRHA 3FSGA 2ICAA 5EXEA 1MIHA 3CR8A 5DX0A 3DL4A 1W5SA 2NPOA 5DCUA 5I9BA 4D43A 3GRUA 3TQFA 2J4FA 4M46A 2KJQA 3CZPA 2A2ZA 3I2KA 1WXDA 3OUTA 4L7QA 5DI3B 4BMNA 2D2IA 2OORA 3HYCA 4XB1A 1LF0A 1RTTA 1TPZA 3C3XA 4MS4A 2X22A 1H94A 2QJTA 2GTIA 2QE7D 3C48A 2Q5OA 4EZIA 1KZ6A 3UANA 4R41A 2CCGA 2CB9A 5AVWA 2EL9A 2PSJA 2XEDA 2R6CA 4OM8A 3CLRC 3TW0A 2DH6A 3MSXA 1YONA 3QF7A 4J3NA 4F45A 2VT2A 4IQFA 1CQIB 2EARA 3PGKA 1C81A 1NMSA 3DV2A 4LVUA 4GOND 4MRMB 4EMSA 2BP7B 2VPYA 3E18A 3AJ9A 4L16A 1I0ZA 2PV7A 5ITVA 4D8UA 1GARA 3DUFA 1C0IA 2OQIA 2HNAA 4QDTA 3AV0B 3H16A 1E77A 3QBEA 1QZXA 4HCJA 4V2UA 4OMCA 3VXKA 1ZK3A 4NZ9A 5P21A 3A1FA 3LGAA 4M9RA 1L5GB 1OQAA 2H5LA 2WU0A 2AHOA 3IQDB 1VJTA 3O4RA 5BN4A 4CEIA 2BM0A 2RHWA 2PUTA 2QROA 5CJ2A 3GL9A 1ORRA 3SQOA 2BSQA 3ZE2B 2DFDA 3VSAA 4P3YA 3OF3A 5KNCH 4X6LA 1S02A 2V96A 5IMBA 1J8VA 1TMYA 2YWHA 2HRDA 3NHSA 3LDFA 4QO8A 1UEJA 1CHDA 2V7WA 3WK9A 3ZBUA 4E5MA 2HWKA 4MWSA 4OSOA 2LD4A 4ICIA 5DBGA 1JDBB 4EF5A 1LLCA 4DSTA 4FFLA 3CW2A 5CR9A 3H6KA 2XTZA 5JS1A 1SBIA 1YZTA 3EW7A 3ELWA 3JAWB 3DE6X 2OT3B 4OQ4A 4KR7A 2BLLA 2XJ4A 3HB1A 5B58C 5CA0F 4MIEA 1PBNA 4IR7A 3KT6A 1NJFA 4M9XA 5J59A 4BRUA 2VS1A 3LBYA 4C0AC 4CQLB 1NN5A 3ZK7A 3OJLA 3VZRA 5FD8A 1JIKA 3P5BA 3DLPX 4FYPA 5I4BA 1R16A 5CW1A 4KC0A 1Q0PA 1XU9A 2JARA 5AK4A 2W2NA 4ESEA 4DRZA 2VHEA 3U3JA 4YRSA 5EHZA 2C3UA 3TQIA 3W8RA 1J0CA 1UFOA 4JI4B 2IP4A 5JPDA 2Y1XA 1PTKA 4KLCA 4KHZA 4LQCA 4PHTA 1YC2A 3ECSA 5JT1A 1EXNA 3V1TC 4JBLA 1KE1A 3NVKI 2A3RA 3B1JA 4I1PA 1SXQA 1JEQA 3NHBA 2XZPA 3S2EA 4BEVA 4EHKA 5K0TA 1YT5A 3NHYA 1DQPA 1E69A 4KXMA 5TQ2B 4CUKA 5FFMA 1BKDR 3NM6B 1SZJG 2NTEA 4FONA 2FX5A 4D97A 1G6HA 4TYMA 1XXHB 4TKUA 1MU0A 2ZUWA 2CCKA 4Z9FA 3PC6A 3ZWYA 3QU7A 1RLIA 5GONA 1XKXA 3AFMA 2O1SA 2OILA 5MFZA 1C8BA 1K7XB 2ZB3A 4UD6A 3SC2A 4QEZA 4KWTA 1HLPA 4Q0MA 3VH2A 1S89A 3NZEA 4LHSA 4NZNA 1TJNA 3NWPA 2I76A 4PZ9A 5EWLA 3N59A 1KAEA 3CF0A 3CPEA 3FZQA 4N5LA 4KQHA 3ZTTA 4ZYXA 5ARDA 1RNLA 2ZRQA 3EVFA 3VR5A 1G5QA 3KZKA 3RC1A 3E0XA 4DN6A 1G5FA 1YL5A 3P0IA 4X0EA 4P58A 4TQUS 1N2BA 4P7KA 3OPVA 1G19A 1Z4KA 2JIQA 1II8B 1SXIA 3ETNA 3ETEA 3OIUA 1MH1A 4J0FA 4JKIA 4LCEA 2Z8XA 2CVHA 5IEBA 5IJAA 5B12A 5JQGF 2IS2A 4XVCA 4C0KA 4OH1A 4P98A 1E5VA 1M72A 1I3KA 1IHOA 3RVJA 2Q6IA 3EQ6A 3OH8A 1Z7EA 5AW0A 1OAOA 4TVBA 5EMHA 3PXUA 2OQRA 4A8PA 1DMSA 2J09A 4KXLA 3U9LA 5EA2A 1A69A 4ZJPA 1MOPA 3FPHA 4HO1X 3K0AB 4LDPA 1NNLA 2YOGA 3CNNA 3RVPA 1C0KA 5CX4A 1P33A 4KVGA 3RSLA 1R6BX 2PMFA 2WUEA 5LQCA 1R9GA 5A0VA 2AOTB 4KXXA 3KV1A 1I80A 2OGTA 1ARZA 2C5SA 2LNDA 5C37A 2P65A 1NY5A 2A9OA 3L0IB 2Z6QA 1C3XA 1TB4A 1A9YA 4NARA 4MGYR 1UADA 3CXRA 1TMOA 3EXHC 5FR1A 1GL3A 1T6BY 3B36A 4B09A 1NXQA 3FTFA 1CC1S 1R6XA 5JJKA 3NRBA 4WGFA 3ZCUA 1I4TD 1KMHB 5ALHA 2BEVA 1U0EA 4GOKA 2XMSA 4Q4AB 4WWHA 3MJDA 3RGGA 5TC4A 4JC0A 1XCBA 1WUHS 4D02A 2JIZA 3CWZA 3JW8A 1X0VA 2OHHA 3HCFA 4ILEA 5JV5A 3AIKA 4E70A 3M1YA 2OQVA 2P2NA 3G2JA 4EITA 2C7VA 4DLAA 1WB6A 5JZVA 3VPAA 1XMOB 1US8B 2H1WA 2JVIA 3JPYA 3LBHA 3NPAA 3OM0A 5BV8A 3IESA 1L5KA 1WXFA 2OK7A 3ABOB 3D54D 4C30A 4F4FA 2DFTA 2N3ZA 2P27A 5MDHA 1CUVA 4F4DA 3FJOA 2X1MA 4UBKA 3DW1X 1P0QA 2YHAA 3L07A 2WC1A 3ESBA 3LZDA 1OBOA 1BX1A 3C6KA 1ZIPA 4JA2A 4JJEA 1NX6A 2C3OA 3FOBA 5GJWC 2ZI6A 3KYDA 2P9BA 4R8SA 1V43A 2GARA 3VR6A 2JLSA 4OHBA 1RVDA 1DXHA 1FFCA 1QYRA 3M4JA 3ZHCA 4FC6A 1B8VA 3HKDB 2WTEA 4KE9A 3FHCB 3IP8A 4YRKA 3HCWA 1GO2A 1B6GA 2WT4A 2NQTA 4OQPA 1CPYA 2OCIA 5BNIA 5GADl 1PGJA 5DM2A 1P1JA 1QIIA 2ALJA 4F97A 1N6RA 4TVSA 4IGFA 1LQUA 1TQ2A 1OLUA 2AG6A 2DH5A 3TI9A 3VC1A 1KI2A 4ZCPA 1GQOA 4M86A 1JVNA 3QE4A 5FFNA 2X1HA 1U2SA 1G7SA 3I2HA 3JYPA 1ZOOA 1JHOA 3QITA 4FZ5A 4X44A 5AHWA 3GROA 1NMZA 2ECKA 4N5DA 4M88A 4RQTA 4TTJA 5ALLA 4NENA 2OYCA 3R7SA 3Q7PA 3ZGLA 5AXBA 5MFPA 2YV5A 4LZWA 3EHEA 3E9CA 3KSMA 3ZGXA 1SXGA 3LCJA 4QKQA 1U2EA 3DZKA 3GEHA 2NZJA 1W35A 4C4SA 1HQCA 1OKKA 2Y4OA 4HDRA 2EL7A 5DN6D 4LQLA 5CXQA 3O3MB 1MGOA 2RHHA 2V4MA 4GMXA 3SPXA 5TIIA 4FWTA 4MUMA 1FRVA 1D1PA 2CBZA 2ZBEA 3TEMA 1XLTA 2VA8A 4XRRA 4C0XA 3T52A 4DXHA 1CTQA 2Q6KA 4K6CA 1IUOA 1RAGA 2X9VA 4B2IA 4M1QA 3IIKA 3S8YA 2I0FA 2WFMA 2BFDA 1WV0A 4EPTA 2FH5B 2QPTA 1EG2A 4YJHA 3WGQA 3KU4A 1Z0DA 2A88A 4QUAA 4RTNA 2HSDA 2IV3A 3G0CA 4KYVA 4XM0A 4OK3A 5C2JB 3FWHA 3EF3A 3ZW7A 4Y30A 4O2AA 1WCIB 4I4CA 5F1KA 5I7UA 3WBFA 4EI9A 3U4MA 1N2EA 1SK9A 1WETA 2NXEA 4B48A 4L4XA 2FQQA 2YVQA 1L1RA 3D4OA 4W9NC 2BBSA 4O4HB 1USGA 1DRKA 2BYTA 1NLFA 4Q1CA 1H5QA 3MPOA 3V5NA 3TOSA 2JIZD 4GO1A 4QU9A 1E98A 2J0EA 2NZ8A 3EZXA 4FJ0A 2UZ3A 4HLCA 4TV9B 3ZHOA 1ZGAA 1R8QA 2NZ2A 4PHCA 2BR4A 4ZVNA 3RBAA 3MPUA 1A27A 4E13A 1W6UA 2CT8A 5H5JA 5AXCA 1Y1SA 1IBLB 1E5QA 4RJTA 1TU0A 2WAMA 4RJJA 3JWJA 4ZTUB 4C4RA 1Y1QA 3PT9A 2JATA 2RHCA 5BUQA 3HDTA 4TMZA 1CZLA 1WZ2A 1S3GA 2XLCA 4FNAA 3BWEA 4DIMA 4DLLA 5B4TA 4QL3A 2QTMA 1DDGA 2NUAA 2X1LA 5JEEA 3VR4D 3ESQA 2CVQA 3EPRA 1IM2A 5IC6A 4WH0A 5CFNA 3K70D 1R4NB 4JZKA 5K3DA 1JSCA 4B17A 1G7TA 2X0DA 4H6WA 4DR7B 4ZDWA 2FWPA 1G2IA 2D13A 1NOIA 2ECQA 4O5AA 5K6AA 1N92A 2X40A 4L74A 1ZMTA 2WIJA 3BL8A 4L95C 1I4DD 1UUFA 4O6VA 4IVRA 1LTKA 2GQ0A 1WXIA 2UVPB 1NVGA 2G07A 5HUJA 2BKVA 2BUCA 3EDOA 3FYHA 3GLHA 2YWCA 4LJLA 4OHZA 4DUPA 4YTEA 1KPHA 1SU7A 4D5EA 2WYVA 3AU8A 4QD3A 3WL8A 2CZCA 5HIAA 4EFKA 5IXYA 4TKLA 2A5LA 2PGDA 4BNLA 2RIPA 1EBBA 3MJVA 3PF9A 1ODLA 5AVYA 2IHZA 3L9WA 3C3AA 5M5BA 3EEOA 1XEFA 3DDHA 2ZUTA 3HMKA 3UUFA 2JIBA 2LCFA 3OQOA 3L0CA 5EGSA 2V7UA 1OBHA 5I4IA 3T7JA 2JFPA 4FDTA 3HK2A 4EO7A 2ZK7A 4HGYA 2EWWA 2RGCA 2VNAA 3EXIA 2Q4RA 2XRFA 1V8OA 2ZB4A 4E14A 4P3PA 2IEZA 4O2BB 2BGTA 3TL2A 3BJMA 5KU7A 4HF7A 4S1OA 3WTBA 2OCDA 3GGDA 2BEUB 5EPUA 1XQVA 1OZHA 3FFTA 4PZ0A 5EIFA 5ESXA 3M9XA 3HZHA 4IRXA 1X7HA 1WV1A 4MTLA 1ZD9A 3PUXA 5LQKA 1M2VB 3B8EA 3RSFA 1HDOA 4AKTA 1Z0KA 1N33B 1BOOA 2I67A 3OIYA 4HWKA 4JBIA 1PSWA 4NBWA 1R2QA 5AM2A 2O2CA 1P74A 5BQFA 4XSHA 4B40A 5MGBA 2PWBA 4D57A 4BNDA 4EKDA 3BSYA 3OBIA 3WLMA 4RK6A 1IPHA 5EP2A 5J63A 6Q21A 2G8LA 2FE4A 3G7UA 4YS6A 5A6VA 1T8UA 3EQ7A 3B85A 1KPGA 4INZA 5IKEA 1L4UA 2JJQA 4QPZA 3KYBA 2W43A 4GLFA 4LVOA 3AERA 2EEZA 2QTHA 5EE1A 1BD4A 2PXCA 4ZZ1A 3C4QA 2YUIA 1Y9JA 1GHTA 1UZUA 2L0XA 2WDPA 2YYSA 4FX5A 4I2VA 1QLHA 4L9WA 5CYFA 5B1IA 5LWQA 1ZRSA 3IDOA 4CDRA 1SUWA 1JHPA 1M76A 4I5EA 1ZXLA 1R6AA 4F3RA 1JTEA 3TAXA 4DV5B 3VR2D 3C6QA 3ZV5A 1TCBA 5E7MA 3P1JA 1VL0A 3IQHX 1WE2A 1D2NA 5E2BA 5EZSA 5MGNA 1J8QA 2NU8B 1G60A 3DEAA 3WJ2A 1SVOA 4UUQA 3GXOA 2Y0BA 2XGSA 1QPBA 1FZTA 1Y0BA 1GUAA 2P6NA 4G0VA 2R6HA 4AJKA 3UXMA 3UPDA 4Y6SA 1NM5A 4PYKA 3AJAA 4TL9A 3R76A 2LIPA 4I55A 3IKMB 1Y6JA 4TL7A 3TSOA 3W8FA 3NQ41 4H2DA 1M5TA 5EOVA 4ZN6A 2VF5X 1XRMA 2QVCA 2JFHA 4R68A 1CDEA 4BKUA 3FPJA 2J48A 4LVCA 4N41A 3PLNA 2AQHA 1YIOA 3FCUB 4OKIA 1ETUA 3E23A 4R3UC 2GF0A 3SEQA 1EX6A 4RHEA 3V97A 2H65A 4CI9A 5AVKA 2EFJA 4F96A 1R12A 1GY8A 5KINB 2NX2A 1I1HA 4J8PA 2ZIGA 3IHTA 2VHWA 4C0WA 1GZVA 2AFVA 1GTL1 1E99A 1MF7A 3C3BA 4MP6A 4IIGA 2J08A 4M21A 2K6GA 4OQFA 4UBLA 4LYFA 1I10A 1RYMA 1FRFS 1Y1RA 4KNVA 1W2WB 4D4HA 5ED4A 4DAOA 1Y63A 2IZ0A 3O4IA 4BKPA 4ZO7A 2C4NA 4ZU6X 4JBHA 1O94D 4K2AA 5E9JA 1QO0A 1XYGA 1SCUB 1CKEA 2AG1A 2NIPA 2QMZA 4YRRA 4FKZA 3LKZA 1GRNA 1E64A 1YR2A 4XD7A 5JFOA 1MC1A 1UMBA 4KN9S 2PIDA 3DZBA 1NV9A 1GUZA 1UANA 2PO7A 3H0CA 4KQKA 1GRVA 4UUMA 5CNMA 3RRJA 3OLQA 5C7IO 4O4IF 2R65A 4RF4A 2WJPA 5G0WA 3ST7A 3ER9A 2CXUA 2IHTA 3OLVA 4YQZA 2P1DA 1RXSA 1PDWA 1EFRD 2EJVA 5AJWA 4YP9A 3KOOA 1G6OA 1ZUHA 3EY4A 2BZ0A 4YASA 2MYNA 3I1FA 5AM4A 4BLOA 2BJWA 4QGSA 3I1JA 3U2QA 2R2AA 4YBZA 3VYVA 4DYVA 5C8ZA 1P9WA 3PXCX 4YJ2A 3KJEA 1ZRMA 4KTVE 1Z63A 3UTCA 3SJZA 2P78A 3T7RA 5IHXA 4ZHQF 1LD3A 2C07A 4CGYA 4LJ4A 2MTBA 5A1JA 2BHLA 1MT3A 2AFHB 4ND1A 3EJWA 1O58A 1RM5A 4KXQA 2E85A 1VJCA 4KZKA 2BMWA 4ZVQA 3V33A 3KNZA 5EKSA 4KFTA 1P5ZB 1SC6A 2Z4RA 4A03A 1D4FA 1MTOA 4IIUA 1S0UA 2G9VA 4BOYA 4ARBA 4NAUA 2PRJA 3MS7A 1TD1A 1JG4A 1IXKA 4DSUA 1RPTA 3U3XA 3CRQA 5EHXA 1T15A 4MHOA 1B16A 1QH8B 2JANA 1DIBA 3I83A 2SBTA 3WGKA 5KQRA 1ZGHA 3F3MA 4U0JA 1FTGA 1XAIA 3RRNA 4BL5A 5HCUA 4X1YB 2EBHX 2Z0MA 1XOIA 1MZPA 2QP4A 3LAWA 4H7KA 2DCMA 3QHPA 1CUCA 2IE8A 4CODB 2ACVA 2FN7A 3L0DA 1VZ3A 3O90A 3HKCA 3ZHSA 2VXYA 2DC1A 2Y67A 3GGSA 3PR3A 2BMVA 2J6BA 4OHWA 4JZYA 3GFOA 4Q9AA 2W93A 1FU8A 4JLWA 5DU2A 1P72A 3Q3HA 1B4DA 3UMVA 2QTZA 4CFYA 3EQZA 4UPVA 2GLUA 3T1YB 1NBMA 1PVOA 4Q82A 5NULA 1MOZA 5F5NA 1AKUA 1N5IA 3U4GA 5CB4F 1NU8A 1GL7A 3O8OA 3SE0A 2HRZA 3WGGA 3Q9UA 3LO8A 4A73A 4BPRA 4HS9A 4Y6OA 1K88A 3R0VA 1J8DA 3HDYA 1H0RA 4B6SA 3K9LA 1Z7WA 5TS2A 3S6JA 5KX5B 2O8BA 3IB6A 3IP1A 1N4DA 3ZXYA 3R6DA 3K09A 3ZIAD 5KVSA 3D0QA 4MICA 4Y1FA 1TX4B 4ECEA 1SG6A 1GUFA 3NJRA 2Y3IA 4YJGA 1MRZA 3TSWA 3X1JA 2HCTA 3LUFA 1PFUA 2ZRGA 2GD2A 2YNMA 2X2FA 4HZIA 4LY6A 3QEMA 3VO8A 2BL4A 4RF5A 3SMVA 3O2JA 1QHGA 3LDAA 1P2FA 3DDWA 1VFPA 1ZZEA 4L4UA 2RC6A 3PDCA 3AHCA 2IZ6A 5AK6A 5B5SA 1FP4A 5AW7A 3DR5A 4PBTA 3GRRA 3OJFA 1L4BA 1YRHA 3N0XA 4UNQA 4BNVA 5EZYF 1HSZA 5BWMA 2P2ZA 3WBKA 3X1KA 1ZCZA 3SXUA 4YP1A 2DULA 2YMQA 1DV2A 4JU8A 3TLAA 3NP9A 5ITZA 1JS1X 3KL4A 1RPZA 2H9AA 1KXJA 1NT4A 1W0CA 3EVTA 1XZKA 1G9XA 3GLUA 3OZFA 4G8BA 4I1SA 3NIWA 2OFXA 3OIDA 3PGLA 3QZUA 4TRNA 1T3TA 4BAUA 1U04A 2VT3A 1J2YA 5GIPE 2ADFA 3ZWWA 5JARA 2QAGC 4H60A 4LJKA 4I9HA 5TQ2A 4INOA 4DGQA 5KJFA 1JTVA 2OD2A 3WWYA 3IJ5A 4DA6A 2ZI5A 2Q7XA 4TWAA 1T8PA 1U7WA 2BMEA 2QNRA 1E79D 3DCNA 3B6MA 3EYAA 5CDFE 3UXEA 1OAKA 2NZXA 3HGMA 4O3FA 4TPKA 2JGAA 4RPLA 5EUCA 2ODPA 4FFMA 4AMYA 4NH0A 5HQTA 1QFMA 3DMPA 4DR4B 3G59A 4NNOA 2RH8A 3GP3A 1VYVA 5IBPA 3K70B 2RJ3A 2Z04A 1TZBA 1TQ4A 3NBFA 4HBZA 1Z47A 3R4VA 4A7PA 1L4NA 3X1YA 2ZT6A 3DAYA 1N25A 3MAAC 4FILA 3WYCA 4BJHB 1X7WA 3IVRA 1TEVA 5KYKA 4J16C 4JN6B 2YRFA 4LRYA 1TKBA 2FB9A 2P3SA 2RBEA 2UXCB 1GDHA 1QHEA 1TO1E 2X2EA 4K87A 4Q37A 4TZKA 4YXFA 1LFAA 2I03A 5JDIA 1Q74A 4RTSA 2MSDB 4MW1A 1AK9A 3GMIA 5FOQA 1K66A 4EB3A 1T9DA 3I01M 1O6CA 4OI0A 4QGHA 4GLOA 2H7CA 2O48X 2JI6A 3DE5X 4C3VA 2BD0A 2AZTA 3CF4G 2GT1A 2XKKA 3AEQA 4WCFA 3WYGA 1TD9A 2PFSA 4R98A 4JC4A 3G1TA 4J1NA 1UT6A 2ZU6A 1XRJA 2FPPB 3FCXA 1ZICA 3DNPA 5DNDA 4KR3A 1IEQA 1FX1A 2H17A 2D00A 3I1YA 2O2JA 4UM9D 3CV3A 4DBVO 2MMCA 3K1TA 3G8AA 2QRVB 4JI1B 3GPCA 5BSRA 1VLJA 5CDHA 4MNTA 3HA2A 4P4SB 4ZOLA 2OL4A 2EERA 3R0ZA 4INPA 1RZRA 2FDXA 3ORYA 5HPYB 4S1WA 5KKNB 5HKLA 2B98A 1ZSVA 3O1HB 4U1RA 3AL3A 1L5NA 3RRMA 3VV2A 1EVEA 1TECE 2QM8A 3EC2A 1SCQA 1IN6A 1DUVG 4WLNA 4XVRA 1Y5RA 4HSGA 4V0QA 3IH5A 1QR6A 4NEQA 4ZPJA 5HZMA 1C7JA 2E9SA 4F5WA 3ZQJA 3FBWA 2EP8A 3VSCA 1RM4A 2WKQA 1OLXA 3RIXA 3O83A 1W46A 2XAUA 1T2VA 1RPNA 3JTEA 2R7MA 3PCTA 3RKRA 3BSSA 2ECOA 1CIJA 1WXGA 3L7BA 4R5HA 4JGGA 2QPAA 1D9ZA 2MINA 5I47A 3RHTA 4C0HA 4E5KA 2WTAA 2FR8C 4FHEA 1IZ0A 1XAGA 2PZEA 3AFOA 3DFUA 2QXTA 1BFDA 3HN2A 3KQSA 4O33A 4YP6A 1W96A 4ILKA 4ND3A 4RA6A 1J2TA 5FWXB 3TB6A 4JCCA 1G6Q1 3OFND 4JHXA 3RLIA 3TCXB 2H31A 2HSZA 1LGYA 3IMGA 2ZJ5A 4FDMA 4K9PA 4M6WA 1HWYA 2VHZA 3S1AA 4AS3A 4BO7A 4CHGA 4RK7A 5JH7F 1ZO8A 4BS9A 3UC5A 3D81A 2HRRA 4FXPA 1BD3A 2WLSA 2WSSA 3FPCA 3JYLA 1GEEA 1GPNA 3UCXA 5F7XA 4UTZA 3IALA 5ECDA 2VAXA 2GX6A 1FVXA 2INGX 4TKMA 3MAGA 4GM1A 1FVFA 1L3CA 3GA5A 3UAWA 1Z9BA 1JZSA 2B78A 4XD2A 1QGYA 3LBAA 3U7QB 3RNLA 1AKRA 5ER6A 4YJKA 4PAMA 5LDGA 2XWPA 1CSEE 3MQ2A 4M9SA 3LGSA 1ACJA 1RE1A 2VNIA 3HHEA 1XN1A 2Q6VA 4WW0A 1V39A 4I6EA 1PQYA 2AJTA 4E3WA 2CLSA 2A0WA 4HVCA 4LZPA 3EOBI 2DWQA 5CA1A 2OUKA 4J0KA 4DMCA 1RZUA 3TFWA 1N5DA 2EW2A 2VJBA 3CY6A 1AKTA 1NBIA 1KP2A 2ORED 5LQSA 2D1TA 2W83A 4H1TA 3JD0A 1YULA 2FUCA 4L8WB 3WWPA 4BLSA 1JMYA 4XYGA 1M6EX 3RSQA 5IJ9A 4ZCLA 3L6RA 4TN1A 4N5IX 3I04M 2IYPA 2MSCB 3EY9A 1BWRA 4MWTA 2Q1YA 4A6EA 4B4KA 3OTQA 4TV9A 4CLEA 2JJYA 3FG9A 5FNVB 4KGDA 3BB4A 3A4LA 3L3BA 4KBYA 3I0NA 4TXJA 3D31A 4R69A 3IAS6 2ZBGA 1SXJC 1AQLA 2W22A 3RR2A 2GEDA 3KG2A 4BBAA 1A3CA 1KQGA 2RGAA 4GZ3A 3BL6A 1ZCBA 1DEAA 3OETA 3S0JA 2Q0XA 2O1WA 2GKGA 2RBKA 3BERA 1EB9A 4FMPA 2B5OA 5FLKA 2NUAB 3KVYA 5EJ4A 3ZDBA 1IQPA 4CUZA 2E4XA 4DCUA 4DG9A 4GI5A 4HH3C 4UHCA 4N76A 3ND5A 2Q7DA 3WMEA 4HXYA 3QU2A 1K27A 2OCXA 1RE0A 4XI9A 4D8XA 1KA9H 4KVAA 2Q5FA 4PVCA 1U1EA 4WL0A 2PLFA 3HZOA 4LBVA 1REQB 4C4TA 4V0KA 4BNIA 4GPAA 5TEWA 1XCGB 2VNJA 4PR0A 5KNBH 2FEAA 4FFOA 4HVTA 2XITA 2WG1A 3GAZA 4C21A 4PX2A 3SS8A 4IV0A 1O87A 4DW8A 4I66A 1OXTA 1YS9A 3GRYA 3WI7A 3ETHA 1KAOA 2NZUG 4PQFA 1BHQ1 3QHQA 1DJOA 2PVCA 4M89A 5EMNA 4ZGGA 3NHMA 2FFRA 3V8QA 4CMIB 2GPSA 1YK0A 1HYHA 3PEYA 4PPFA 4Q9NA 4CKZA 3UKDA 1VLZA 1EI9A 2PUFA 1CW2B 2Y9MB 3N8DA 2QTNA 2HT1A 2IPMA 3Q72A 1YJAA 1YDWA 3FMPB 5HF8A 4Z1OA 1J0XO 2FR1A 1Z4OA 2DUNA 2QV7A 1F3LA 2R1VB 4QFBA 4TN5A 3I12A 4WDRA 2GFHA 1N3BA 2H1RA 2VYND 3NHFA 1ZH4A 3MILA 2QQ5A 3H8WA 4KO1S 4ODIA 4PGAA 3TGWA 5IANA 1H6DA 5L45A 3EEYA 3UV3A 3OAAD 1GU0A 4HDMA 2BE9A 2DU8A 2IP1A 3ITEA 5AUQA 1H2ZA 3K31A 4KR9A 3JAMA 3ZJVA 4J4BA 3TAUA 4MJLA 3X2EA 1P5RA 1B2RA 2BFOA 1G5PA 1PT7A 5EZ5A 4B3CA 2D0IA 1E1YA 1AN9A 1I9GA 1E61A 1CULC 1F2TA 5DNCA 4QGBA 4HMPA 4UU1A 1L5WA 3B2EA 3G9QA 1NN0A 1DFIA 3NWEA 4GOLD 5E38A 3TB4A 1JAXA 3LL4A 4P32A 3FOCA 3KDAA 4NK5A 5TSDA 3EZ7A 4F9TA 3EWSA 4LK3A 2MYTA 2UZ1A 2PX2A 3NTXA 3SYLA 5A04A 2AHRA 2XQIA 2XZLA 3QFFA 2IYXA 4PN3A 3VPFA 1Q1ZA 5FADA 4DA0A 4D0RA 4X7PA 4G09A 3QK7A 1EAYA 2NV2B 5D7BA 2P9ZA 1A88A 4EJSB 5C8YF 3C3CA 3F5FA 2JEOA 2DQYA 3PUZA 3MGAA 4ZJYA 3ZU2A 1U9JA 5AMXA 1WQ4A 4KNYA 1DX9A 4FD2A 4HNUA 4CIVA 1SBCA 1KBOA 2P91A 4MAFA 4EYOA 3EIQA 4UFNA 1E3WA 1QZTA 4G0NA 4MINA 5HM8A 1J9GA 2BFWA 4FVTA 4J16A 1TJPB 4KQMA 2HV8A 4U9IS 3VMMA 5A6SA 4MEJA 1MHPA 2EXXA 1R8JA 4H1VA 1S7GA 3GH1A 4G89A 1K3TA 1C9DB 1DBVO 4MP3A 1LBHA 4QYMA 2H2DA 2Z6VA 5JOQA 3HJUA 2QD3A 2Q5LA 4X62B 3WRXC 2C59A 2IH5A 1Z38A 3DEYX 2YFYA 8LDHA 1P1IA 3QUTA 2VP9A 3DJYA 2Q2OA 1C2YA 1KEWA 3I32A 1BW9A 2YY5A 5DBOA 5EIHA 3RUIA 5DLYA 3T5PA 3GD5A 4NG4A 5F4ZA 1L4MA 4A0RA 1ZBDA 1K0FA 4CDMA 5IK2D 2P4UA 2KE5A 1P4AA 4BMZA 4GHWA 4EELA 3HDHA 1RYEA 4Q3KA 4FMCF 2UZ0A 5TMEA 5AJUA 2BMJA 5CFOA 3GJ3A 3HUFA 3DOOA 4FTWA 4YMUA 5CT5A 1ENOA 2VPTA 3DW3X 3R5XA 4IXNA 4JJ4A 4LDQA 4LOHA 3U3OA 5AKXA 5JAZA 1RYHA 4AN0A 4KPEC 2ZI3A 1U31A 2W6ID 3MBOA 1L4EA 3QF4B 2IWHA 3JAKB 1B73A 1DOZA 1T6XA 3B6JA 3OOJA 4QO7A 3H8JA 2PT9A 1I36A 1BZYA 1FYXA 4IJKA 3T5DA 1HYGA 4TKVB 4E88A 3OLCX 2X8LA 4HRYA 5EE5B 2BFCB 1QTIA 5A9SA 3N7AA 2EJWA 4XA8A 1YFLA 3DOJA 4QYIB 1KEKA 3B2NA 3RM3A 1SVLA 4IIJA 2CUKA 4WASA 1GZ3A 2XB6A 2X0NA 3HM2A 4E4TA 3MYRA 5IVHA 1YNSA 1UBNA 4PM4A 3D3NA 1ZUWA 2YWRA 4N01A 3TXAA 3IQXA 2QLLA 3DZDA 3OT4A 3ISJA 2PGNA 2ZB7A 5GMOA 3HKEB 4US2R 1X1BA 1XTVA 2FG7C 4FFNA 3LUKA 4J90A 2WQZA 2WZQA 5DNAA 2DM6A 2ZRFA 1ISIA 3H99A 4FFBB 2WB2A 3KIPA 1T6YA 2GBCA 3ZHRA 4QYWA 4AG5A 4B33A 1TIPA 4EHHA 3EXHB 3GP5A 1UKEA 5CDGA 4EMUA 3A9RA 4UVHA 2W8ZA 5E1MA 3V8MA 1KMIY 4KHPB 2W42A 1ZSNA 4F7WA 2OZKA 5BSTA 2C4UA 3C0KA 4CJXA 5TVGA 1XZPA 2QR5A 3FFAA 2A5YB 1R6TA 4MPTA 1PJLA 2G71A 1EFKA 3T0GA 3NUZA 5DN6A 3BCSA 1RBZA 1E4YA 3DDSA 3RTEA 3ZE9A 4IDDA 4MEAA 1LUAA 4L72A 4MI6A 5F2OA 2VSOA 5CG2A 2ZI4A 3PRHA 3INYA 2IUUA 3RF7A 3WYNA 3HNOA 2F43B 2VHUA 3MOGA 5CEFA 1F1BA 3R5FA 1JALA 1MLDA 1D7AA 2ETXA 2O1EA 2NU6A 5DHSA 4DLWA 2PKWA 2Z1DA 3OWOA 1AKQA 2QUZA 1C30B 5FA8A 4ETIA 3A04A 3RAEC 1DRVA 2EAUA 1GEGA 5JFTA 3OOSA 4O0MA 1RIFA 1CHNA 1JB9A 2R6GA 3AJEA 3G2IA 1EH5A 4HJRA 4RULA 4QJ5A 3TCNA 1Z13A 2P9FA 4QDJA 2DVMA 3QBTA 3TS1A 4CF6A 4MB0A 4J4TA 2HI0A 2IE0A 2LR0A 5GTDA 2WAXA 5L4SA 2WWHA 1XV5A 5F1YA 3CC8A 3GNQA 1H4VB 2XTMA 1BDIA 3FVVA 4L4YA 4WA7A 2HU7A 3LECA 2E2WA 3G2PA 4CMKA 1PZGA 4N3GA 2OG2A 3AR4A 3SX2A 1BIFA 2X5OA 4BGUA 4AAYA 1GTMA 2QL9A 1I32A 3G85A 5T67A 5JSZB 4TS9A 3IAS1 1U0FA 4TZ6A 2ZSDA 2XNSA 3VU3A 5IAJA 4Q4AA 3WLKX 1FW6A 1UJNA 1YE5A 3FAZA 5HZKA 4G8JA 4OQDA 4JXZA 3OX2A 1Y3IA 1YVDA 3HACA 3D2LA 4AJOA 5KDDA 5L53A 2UVQA 1HV8A 4KQFA 1XRQA 2RONA 4AUMA 1RC0A 1R0KA 1D03A 3L41A 2X9LA 3LFUA 1XD2B 1QAMA 1QCCA 1Z36A 4RDHA 4S1PA 1NQUA 3ZWQA 5CRIA 1G8FA 1N6IA 1KIFA 1G8AA 2NGRA 1AGNA 2WV9A 3LOQA 3ZU5A 3IQGX 1Z6AA 3PJRA 2VHTA 2Y0EA 4MHSA 1TYBE 3BHMA 3G2LA 4QUGA 1E3QA 4YCJA 1GLVA 1NJ2A 4GQAA 4IZ6A 1WHTB 2H2GA 3GEBA 1O89A 3HJHA 1MKYA 1ZISA 2ONJA 3FLAA 4TLEA 1BE8A 2HMVA 2K87A 2ONKA 2QBYA 1Z8HA 3GLIA 1ENPA 4BMOB 2CMHA 1Z56C 2JFQA 1YMUA 4WGGA 3NOOA 4QJ4A 3G8DA 3ZD8A 5MF6A 3TLKA 4Y7CA 1T3HA 3KXPA 3PEUA 2OZLB 3A05A 4NYJR 4CIAA 2ZSIA 4PHFA 4PLVA 3QQPA 5KOYA 2Z4TA 2JRCA 1NKTA 3IPLA 4F3NA 5AW2A 2HZBA 1FUUA 2QM3A 3TQCA 4MGEA 2TS1A 1RXVA 1RJDA 2EYQA 1DQYA 2WD7A 3I92A 2HCRA 3FOFC 2VZLA 1CNFA 1LY1A 1QHYA 2XUZA 5L7YA 3RUEA 5DI3A 5KTKA 4BO9A 1DHRA 1Y3DE 2V6GA 4EY7A 4C08A 1BAPA 1UKAA 2DP4E 3AERB 3UIEA 4QUEA 6GPBA 1XWWA 4HDCA 4RU1A 3ULKA 2I2AA 4HFMA 1RTKA 4HDKA 1OA0A 3MXTA 1UEIA 1ZM7A 4LPSA 4Y18A 1R88A 2IZ1A 3L8HA 4XZ3A 4OI1A 4X71A 1KTVA 1VPDA 3HFGA 2NQ8A 3NWOA 1YI1A 2CLEB 4ARVA 1PFGA 3KJXA 4AP9A 1CQIA 3B82A 5AFSA 1LPOA 4F6RA 3PA8A 2G17A 1A0OA 2BFDB 5I3CA 4UU8A 2D1SA 3M49A 3VGJA 4BRZA 3VNBA 4J1TA 1OWNA 3QE0A 1GTG1 4Z1MA 1ORTA 3O47A 1T4MA 1BXRB 3QXXA 4QBIA 3W6ZA 3MBIA 4EA6A 4GDMA 3GP8A 1W5FA 3TE6A 1D2MA 3GZTB 2COKA 4MVJF 1SUFA 1F4PA 4YRQA 3QELA 1VYHA 3ZJYA 3NATA 3UEOA 4Z4HA 1IG0A 4CM3A 2Z4SA 1GTVA 5LP6F 1PUJA 3FCSB 1XJQA 3GOHA 4RY9A 3RVLA 4EPXA 2WJAA 5EY5B 2WILA 3DOFA 4FXOA 3WMXA 4YCLA 4LJ9A 1M73E 1P62B 1QX3A 1SC3A 3ZDDA 2RG1A 4BMXA 1JQ3A 1W4RA 3ORSA 1RWMA 5KYWB 1PNTA 3OFSA 5SYAA 4L0CA 4WVLA 2BRUA 4TLLB 2KQUA 1SURA 5EXDA 1ZL2A 2R5NA 2ZUUA 4X85A 4ZVRA 3URMA 2JCXA 4PBRA 2DHRA 4TV8B 3ZK8A 1V1MB 1JDSA 2GJ4A 4RKEA 1ZJZA 2ZB2A 3M4XA 1YE3A 4K6GA 1Q1AA 4NPAA 6ABPA 3E6AA 2RJOA 4X7MA 2BEKA 1XP8A 5HZGA 3A6LA 2EF0A 2OCLA 3PIIA 1ULUA 4P5PA 5LXTA 1SUEA 4HY3A 4OYYA 5C1BA 3OQMA 4TYYA 3U9TA 3NRJA 4OREX 4IH4A 5FUXA 1VLLA 3SX0A 2BGIA 2XBLA 1A8UA 1E7YA 5MN6A 4NBVA 3WL4A 4V0LA 1U0BB 2PX4A 3FVQA 1D4ZA 2ZAIA 1J97A 4MV8A 1U3UA 3RWMB 4FZVA 5IC5A 4NJEA 3SNHA 4NTZA 2AJDA 3DZCA 4OLHA 5AQEA 1QK3A 1Y8AA 4CV3A 3FM9A 2H92A 1R4MA 1K8ZB 5K01A 4DXDA 2GCIA 1NQTA 3DC2A 3H9GA 2OESA 1NG1A 1GKYA 2Z08A 4IDEA 3NT2A 4LXUA 1QRRA 4Q4HB 1UZNA 3IX7A 4QXMA 1P2GA 2HSGA 4QOJA 5FA6A 4J1TC 2XI4A 1HF3A 3CINA 3IKJA 1NUSA 4YMWA 4EF4A 4G2NA 4QLOA 2GRUA 3E0QA 1VKHA 3WISA 2FRDA 2W4IA 4XGRA 3TL3A 3IO3A 3KKEA 3PD0A 4JJGA 1PLLA 1X7GA 5CXSA 3SZ3A 5AQ1A 1BDHA 1L5FA 3HR7A 4NHEA 1O57A 2C2XA 4HRVA 1J2EA 3NX4A 3OCXA 4N8SA 3A9TA 4PC2A 3KCQA 1YFZA 1H5NA 3F3YA 1VHQA 2M32A 1EX1A 3KFLA 3KOYA 4I6GA 4K8OA 2A0FA 4FFDA 2C7GA 2PH5A 1ADFA 2R00A 3FZYA 1L5HB 2AR9A 2GPJA 2VNKA 3GYBA 4HL6A 1TVEA 1B41A 4FE4A 3G49A 4PC1A 4QBFA 4WY5A 3HJRA 4ZOEA 5IEJA 3B13B 1YRYE 1T3LA 3AM3A 5DHRA 2JC3A 5TT0A 7REQA 1YGYA 1W5EA 1H0SA 1GPMA 5LCXA 1U4NA 3TSZA 2YZGA 3S8EA 5DOZA 1UPTA 5FKJA 4PSUA 1Q6YA 1GQRA 1BHSA 1BU8A 5GY7A 1NR1A 1XEXB 3DMDA 4HR7A 3CF4A 4DUGD 4FYIA 3A7DA 1YU6A 5ADWA 1T9ZA 4A5SA 1VG8A 3T5CA 2ZBDA 3FOAA 2H29A 2P3QA 2ZZKA 2QY9A 1ONPA 4J0GA 1BGVA 1AD2A 1GNQA 1YQGA 3HA7A 3A1TA 2HF9A 3T7TA 3K2EA 2BGMA 3IAAA 1AV7A 2PFGA 3KLBA 4BEBA 1ABEA 4HMOA 2ZP1A 1BOFA 1J2JA 4LRWA 3KQYA 2Y66A 3O8OB 3HGTA 4LBWA 4YT5A 4EGCB 2HOQA 3BDIA 4CTJA 5BWLA 4F9FA 4JFAA 3PUHA 3TW4A 4QZVA 1REQA 3SQXA 3UK0A 5F5XA 1JECA 4RLHA 5J40A 4PQEA 3E1SA 3I9NA 3N2EA 4XIIA 2O54A 5DLDA 1JJFA 2GWHA 2Q1TA 3AR3A 3H87A 5CVJA 4C3ZA 2ONZA 2PX8A 5JMTA 1NXPA 3Q12A 5KNCD 3P2IA 4LSZA 4JIMA 3BXFA 4ZU3A 4K6KA 4EB6A 2O1XA 3QVGA 1ABFA 4MDHA 1JLLB 3DEJA 5JHHB 3W77A 5LD2B 3KT8A 3S2YA 5IJXA 3D6UA 4I6JA 5AKEA 4PINA 4IDAA 5SICE 4MUFA 5F9HA 5DM0A 2XMQA 3LZCA 1NONA 4LECA 3E53A 4NEHB 4XWWA 4RZ3A 1AX9A 4ZK6A 1YVUA 2X14A 4U3JB 1XTJA 3K1YA 3MWGA 1HL7A 1GG9A 1GZSA 3NBMA 1P2DA 1CXZA 1TI7A 1V48A 3IT1A 3LCMA 4RTPA 1LDNA 2CHFA 3R8XA 3IOYA 1X2BA 3COWA 4CG3A 4RWZA 3LD9A 3JY6A 4FKBA 1FW8A 1ZD8A 1YDGA 3KSZO 4ZQEA 1X9GA 1SCUA 3O73A 3G8CA 5FWYB 2YY6A 1K98A 4I50A 3S55A 1ZH8A 3FDJA 1SOAA 3QIAA 1E59A 1KRHA 3BH0A 4GGOA 1RLOA 3GLTA 5JBQA 1QOPB 5EJEA 5I7OA 1WMSA 4DQKA 2ZCJA 4Y6PA 1DIGA 4G36A 2JBWA 4FI3C 5LIPA 4EW6A 1T1EA 3PE3A 3BIXA 4IIXA 4Q01A 2UUPA 3D7MA 1DPGA 2P7IA 3WQHA 5TPZA 3ZE0B 1P61B 2MR5A 2OCKA 4QOSA 4YLEA 5E6SB 4YPOA 1BS1A 4ZCIA 2ZE6A 3HCAA 4G5RA 3BQ9A 3BIJA 4PGGA 5HQ3A 2YV1A 4DC0A 4LC9A 1PVVA 4CLRB 4ZEVA 4HDRB 1E5DA 4EJSA 4CG0A 4IP0A 3RARA 2QLTA 2PKRA 1HNNA 1CUYA 1IBSA 3LA6A 4Q4DA 4EA8A 1IXYA 2VXOA 2PD6A 1XQ1A 4FSDA 1WZIA 3AF4A 5I5EA 1XNRB 1DTWB 5G2OA 3KSAC 4YIKA 4UAGA 5K0NA 1Q1GA 1O77A 1WY7A 5DFAA 4A0HA 4C6HA 1SU4A 2IEIA 3COPA 1ESZA 1F2VA 3PUVA 1S2DA 4QU8A 1GQSA 4IWYA 2PEZA 4PXAA 4C78A 3GFPA 5DTEA 3VR3A 1OGJA 2IF0A 4NI5A 2Q4EA 5ESDA 3Q0IA 4MULA 2Q29A 4OHMA 4XR4A 3TL6A 4C2AA 2A14A 2H4HA 2R7AA 3CJQA 2IRWA 4UATA 1QH8A 2PU7A 1RAHA 5CIQA 2IYQA 5EIBD 1RWOA 1FLVA 1OXUA 3ISVA 3ZDQA 2X58A 1QTRA 3PEFA 4DIOA 3SWWA 3COVA 2EYUA 3FLMA 4TVOA 5H68A 5CFZA 3AOEA 3HP4A 2ZR9A 1SUCA 2LE0A 1FYWA 2P6OA 3JZMA 5LJLA 2CYCA 5LQMA 2QD1A 1UBCA 2XGGA 1V47A 3OF5A 5BYAA 1IUPA 3V8NA 1IHYA 3ZY6A 4O3MA 1U5BB 1NXVA 5TARA 4D0SA 2VWHA 1M2EA 2NV0A 2D2VA 1DMRA 2JAOA 1CP3A 3L5KA 4NONA 2WAAA 3X1XA 1A9PA 1WPGA 4A0SA 4AURA 2GM5A 2I6GA 4C9BA 5JCJA 2ZKLA 1FDSA 1TUEA 4P0QB 1NMYA 2XGJA 1EHCA 4MV6A 1WS6A 3GVXA 4RKYA 5A6SB 1U7TA 3RKSA 4UOEA 2I3GA 3TVDA 2WWXA 1U1IA 4UNPA 2W6CX 2GJAA 3IXQA 5C3MA 1TPYA 3VDNB 3ER8A 4F46A 1O03A 3OOWA 2NUPB 5DYWA 1JEDA 2FSVC 3C7AA 4QDXA 3ZDRA 4PPQA 1C7ZA 3TR5A 2PBFA 3R5JA 3V4FA 3C8UA 4MS1A 3CSUA 1GXSB 3P4YA 4KJXA 1FMCA 3HWX1 3ONNA 4NAVA 4ER0A 5B36A 2XOKD 1FXUA 4F3YA 4WK2B 5ILGA 4PTLA 2EATA 3CU5A 4GXTA 4JASB 2H16A 2AD1A 4Z9BA 3ZW8A 2GB4A 1YQXA 3F90A 3IFSA 4AK9A 3VPCA 4Z7NB 3FDFA 5FULA 1WUYA 3U1VA 2X5NA 1ZR2A 1JSXA 4DJEC 4LY9A 4ZT6A 1EWKA 1KMMA 4G0UA 3K15A 4WLVA 3SY8A 1P4SA 2JDID 1NATA 3HY4A 5MN4A 4G01B 1N5OX 2CVOA 3THXA 1Y7TA 1ZOIA 1J25A 3H7AA 4LXXA 1O3YA 4LG1A 1QZUA 2IYOA 4EVIA 1JE0A 2IHUA 3C4VA 3KXLA 1L7BA 3O74A 1D8AA 3KVRA 5DT2A 3UA4A 4TKVA 2W2QA 4II2A 2AOTA 5LVAA 1FRQA 1ZNWA 4RHTA 3J7AC 2ZRPA 2Y6VA 4R1PA 2FK8A 1VZ2A 1FP2A 3AUFA 3DTYA 3H83A 4M7WA 1QIGA 2MOKA 1ISJA 1SEVA 1SG9A 3MCVA 3U3DA 1WB9A 3M0EA 5EMMA 4KH1A 5ALEA 2NO4A 4HFRA 4WN9B 1OWLA 2QRLA 5B3LA 4EW3A 3KSDO 3EX7C 3I04A 1YCFA 3IAEA 1RYZA 1DJNA 2XYQA 4HWOA 4QJIA 2UZ4A 1IK4A 1WNTA 4WKGA 4MS3B 4A82A 3MUEA 2FWIA 2WG0A 1JFFB 3OEEA 4RHFA 3UJ7A 1U11A 3W6PA 1XZQA 2JAPA 1F0KA 4ED9A 1LTHR 4DEVA 2NTJA 4MVXA 2C8LA 4IW3B 2Q8QA 4WBNF 1DGQA 4DKJA 5EQTA 3I53A 4BRSA 1JR4A 5ERYA 1VHLA 4RTLA 1PN3A 4NL4H 5GOTA 1EEHA 4F84A 3UT0A 2FZVA 1RRPA 4ROTA 4YUYA 2FFJA 2DWOA 4X20B 2WVJA 3VZDA 4CU2A 5JSKA 1HMPA 1DQNA 4Q4CA 2E89A 4RZUA 4DEXA 5IT0A 1I2AA 1JYSA 2HHCA 4GMGA 4IG4A 3ZWVA 3V8RA 1CEQA 2W4MA 5CPFA 1GZUA 4WZAA 2HYIC 4AFNA 3TZ6A 3KYDB 4O4JF 5CW2A 1X13A 5IWCA 2NZWA 1WNFA 3EZLA 4B81A 3I8SA 5D3ZA 4K9QA 1SVWA 4WCFB 3R09A 3PFIA 1Z5NA 3CG0A 1N5LA 2RGEA 2BZSA 2NM0A 3K6RA 3D6MA 3RBZA 1FA9A 4F2HA 3OZWA 2HLDD 5J1TB 2CNKA 4RSHA 2R8PA 1KEEA 4QXQA 1YWGO 1XD2A 3FLBA 4M1EA 4YAOA 3RD5A 4NPCA 4F4CA 3WGMA 5FBZA 3IDAA 4EKEA 4M1WA 3W5DA 4CMJA 3WLLA 2QRVA 5I9LA 3GFFA 3SZGA 3IA2A 1DWUA 4H7DA 2GNOA 3E7PA 3PXAA 4EFDA 2ZVDA 1RCFA