5C34B

Constitutively active sin recombinase cataltyic domain - i100t/q115r
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
124
structure length
115
Chain Sequence
MIIGYARVSSLDQNLERQLENLKTFGAEKIFTEKPILQKALNFVEMGDRFIVESIDRLGRNYNEVIHTVNYLKDKEVQLMITSLPMMNEVTGNPLLDKFMKDLIIRILAMVSEQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Putative transposon Tn552 DNA-invertase bin3
publication title Snapshots of a molecular swivel in action
doi rcsb
source organism Staphylococcus aureus
total genus 33
structure length 115
sequence length 124
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5c34B00
3UJ3X 5C35A 1ZR4A 5C32A 2MHCA 1HX7A 3LHFA 2GM5A 3LHKA 5C31A 2R0QC 1GDTA 3BVPA 2GM4A 5C34B 3G13A 4BQQA 1ZR2A 3ILXA 3PKZA 1GHTA 3GUVA 2RSLA
chains in the Genus database with same CATH superfamily
4CKWB 3SHFA 1M1ZA 3FIUA 1DAFA 1N7JA 2IUEA 2QENA 4YDSA 1NVXQ 1W1IA 2IXDA 2IUFA 3BWMA 5JO9A 3ZYZA 4MUKA 1ZN2A 3A6JA 3GCGA 3LK6A 2C07A 1G5QA 3LA8A 5ERGB 2RH5A 3PDIA 3QYFA 5KSWB 1WMFA 2Y2VA 1QKKA 1WVMA 3AHGA 4HS9A 3UW3A 1EMDA 1THGA 2JRLA 2ZB3A 3OF2A 4FGZA 4KJXA 4PZLA 2J32A 4Y9SA 1E7YA 2BGRA 3PVZA 4DA4A 1YL6A 3EX7C 1EIZA 4II3A 3FR7A 2P7IA 1ZVVA 1JAXA 2G36A 4CW7A 5ES4B 3AR5A 1FRQA 1R4NA 5ALGA 2HMUA 2XZOA 2EGGA 4TQUS 4Q7LA 3I3SR 1KL7A 4AW9A 1K8ZB 4RY9A 2MIIA 1DL5A 3WL7A 3GL9A 5K6AC 1ZN8A 5FEMA 2XWQA 4LGYA 4KXWA 3OZCA 3IPLA 4M1WA 3F1LA 1YI0A 1Y7HA 3F5FA 2W7TA 4DM4A 1IEWA 4LJSA 3NAQA 3TLGA 2D13A 1LSSA 2X7JA 4RJTA 1ZM3A 1T5BA 5B2ZA 1HE8B 3IEVA 2CMKA 4MAFA 1C9EA 3LVFO 3TW8A 1J07A 1X7GA 3JQFC 2H1CA 2HC9A 4M8SA 4HF7A 3FYSA 1M6EX 4GO1A 2I2WA 1L5SA 5FTLA 4UXJA 1O58A 2ERCA 3KQLA 3DDSA 4EGCB 2AI1A 1QFJA 2H59A 3IIJA 3QH4A 4KOEC 3LUHA 2OPHA 3O8OB 1GL3A 2X0RA 3HE3A 1C30B 1SKAA 4OIFA 1SHJA 2FXVA 1DQRA 2WAXA 3EVZA 2DPHA 2DT8A 1P2SA 1SM4A 3CX4A 2ID8A 4KPGA 1N6OA 4OQYA 3ZY5A 1BWRA 1IH8A 2R47A 1WX1A 2MT9A 1QK5A 3NRJA 3QKWA 3INGA 3QX7A 3VPDA 4MW4A 2FN4A 5AHWA 4DDKA 3E9ZA 4EEKA 5K3FA 3QUAA 4QJ5A 1Y34E 3UH0A 1IIBA 4URYR 4EOGA 1E3EA 1HNWB 3CTPA 1JLLB 3OZBA 4RPHA 5G4KA 1U3VA 3TPCA 4Q4HB 1F6BA 2JJ1D 4OL9A 3W6PA 2WWHA 2HADA 3HR7A 2WD9A 1JWAB 5B2EA 3UF0A 3HCRA 1P3Y1 3SQXA 1Z5WA 2CHVA 1OKKD 3FPBA 1GL6A 3LDAA 5JASA 4QOIA 3BSSA 2WMDA 3D4NA 2QRVB 1JQ5A 3MZ0A 4PC7A 4K9MA 5T67A 2YY6A 3EQ7A 2REBA 2FYTA 4S0XA 3ZU3A 1X2EA 2Q9BA 4L9AA 1OYWA 1U2ZA 5ILOA 1LI4A 4OK3A 4G56A 3LGXA 3GZNA 4OQZA 2VPWA 3NORA 3FIJA 5EZSA 1GUZA 1C41A 1NQ5A 2B3DA 3KYCA 3T4EA 1KA9H 4KSCA 4U39A 3GLHB 5D2CA 2R7LA 5CD9A 4EPXA 1TW3A 1VG0B 3TM4A 4TKUB 4IHJF 2ERYA 3EVAA 4B6EA 5CLLA 3TLBA 5BUZA 1RYNA 1Y63A 4QSMA 1LD3A 2NU6A 3HB7A 5G0TA 1KWKA 3VQTA 2GS9A 1K88A 1QG4A 1W1UA 5E6SA 5EYPA 4BC0A 4EZBA 4BVKA 3QPWA 3CIFA 4YECA 4NZPA 3K8OE 2GCNA 5DM1A 2I80A 1R9MA 2QK4A 1PK9A 5CG1A 5J5AA 2P3SA 2C97A 3ZTYA 1V1RB 2ZI3A 4MUXA 4WJLA 2GPSA 1B2LA 2ZRAA 3BA6A 4IR7A 1JHDA 4KPUA 5BVHA 3QE3A 4NV1A 4PFJA 2IOYA 2WUDA 2ASVA 4R6WA 1OWMA 1VHQA 4XIYA 3HSKA 3GNLA 1ZMOA 1RLOA 1DC8A 1ZBQA 1DBIA 2PD3A 1IXSB 5IM4A 1G60A 1GZ7A 5AVRA 2YJZA 3M2PA 2F9LA 4A92A 3BORA 5SY9A 2FLKA 1G98A 4NARA 1Y48E 4QUDA 4XDHA 5HFNA 1PKXA 1XK7A 2A2ZA 3E1GA 3RR2A 3H19A 2PR7A 3H2IA 4IVNA 3U4AA 2YWHA 1E9EA 1RRGA 1YDFA 2O7RA 2OZLB 5DPMA 3UH1A 1P3JA 3B60A 4ACBA 4GWKA 4ADSG 1TKRA 1EX6A 3P0RA 5EJAA 4JXZA 3QXSA 1PNTA 3UXYA 3PX2A 1HH4A 2UZIR 4DQ0A 2Q9AA 2FPIB 5B3JA 4QPPA 1UBLS 3NH9A 2IHNA 3ZCPA 4LQCA 5A9SB 1KZ6A 3M4ZA 2I87A 4GBMA 3FOWA 4OL0A 1YR7A 4RKEA 4DC0A 1X7ZA 4Y6LA 3DDOA 4BFZA 3D4PA 1Q2UA 2DPGA 1PGQA 2FSIA 2W8BB 1Z08A 1R18A 16PKA 3I23A 3SHTA 1XZCA 1CLEA 3RS7A 4D3SA 1XQVA 1R64A 4C5BA 3BM5A 3DMTC 3MFQA 3N74A 3WGKA 4WACA 5IJ0A 1BMDA 2VP4A 5T4HA 4BKMA 1Z4NA 3DDNA 2J3JA 5J63A 5J4HA 3K09A 4XXHA 2BPOA 3EXFA 1OLUB 1A9TA 4LTDA 3VHQA 4OX9B 3HBNA 4KQ1A 3E2PA 2JHCA 2TMYA 3WGNA 1MLDA 3GG2A 2QJOA 3RIEA 4MQLA 1DAOA 4M1ZA 4UMDA 2OY0A 2YZKA 3RHFA 3WGJA 6YASA 4A1OA 2IH5A 3FWPA 1U0EA 2CMHA 3TTXA 1W5AA 1SVKA 1W47A 5JBQA 4DRZA 2BFCB 4DLVA 4PX5A 3I34X 5D3QA 3VU9A 3AR2A 4TLCA 3V6MA 2Z43A 5EE9A 3LVBA 3W06A 1WZUA 1YR1A 5BSVA 4NYIR 2ZUFA 4LSWA 1GG8A 1Z2EA 3GFPA 1EUZA 1L1QA 1G38A 1L8LA 3A28A 2YIJA 4L15A 1KC3A 2DSNA 3ZZUA 2P68A 2PS0A 4HEA6 5FPKA 1Y8RB 5IAEA 3SSOA 1BQ4A 1F8YA 1AH2A 1KPHA 1VGRA 1DCKA 4UHHA 1PBNA 4J4BA 4LUCA 4JOQA 5DLPA 5EHIA 4UBOA 3TR0A 1Y3HA 4JJ8A 5JZOA 3RYCA 1TZMA 1KYIA 3OD1A 1CU1A 4RF4A 4DZZA 3ZWQA 3ENNA 2J3HA 4G5SA 2ZVPX 4XW2A 3NM6B 4PVDA 4WZ6A 3MNFA 5YASA 4B4OA 4D6XA 3QE9Y 1IBRA 2ZT8A 5B2FA 5GAJA 3H8SA 3A25A 3JZAA 4M9CA 5HM6A 2IT1A 2GF9A 3JVIA 3NBZC 4PYRA 3SHQA 3IJEB 1E6KA 1V16B 2CDRA 5K0ZA 4W4TA 2O8VA 2C4TA 2VL7A 1L4EA 2O9JA 5JATA 3ANTA 2G9NA 4LYGA 5CBKA 1QGOA 2J9FA 2YOFA 5ITZB 4AIRA 1JKFA 2CXNA 3EGOA 3HKCA 5ALKA 5HCUA 2OD9A 1UADA 4U7TB 1EAMA 4TMVA 3R23A 3WKAA 3ZXXA 4DOMA 5FQOA 4CV0A 3IVXA 1TPZA 3LLUA 3QEBZ 4MV7A 4MVWA 1L5OA 1EFCA 4IIYA 4QHTA 3K1YA 4XIIA 2QMHA 3GROA 4GE0A 4NYIQ 4P3PA 1Y9DA 2P8JA 1QZZA 2PXAA 1VSVA 3NDBB 3ONDA 5A7FA 1U5CA 1AMOA 3FWYA 3FGOA 3JPYA 5DWVA 4NMHA 5HFJA 2UKDA 4L8WB 5BW4A 4WCFB 3UT5B 2EF0A 1R27A 4MP6A 2WJ6A 3WGGA 2HIGA 1P9OA 4G63A 1NF2A 4UZSA 3SI7A 3ZXSA 5LM3A 4XX1A 3CZRA 2H9AA 2XEXA 4BNZA 1G2IA 3DBRA 5BV2P 3OWHA 3SFZA 2ZYRA 5K8VA 1H66A 5FOXA 2X5OA 5HJ5A 1QIDA 3SJUA 2FPWA 2VHXA 2LPMA 1DAIA 4LDPA 5EI5A 3WL3A 3V5NA 3DYBA 3M89A 4QUEA 3PPVA 3JZFA 3B6IA 1UMDB 3P97A 3RVDA 1T6BY 3WGLA 1F5NA 4ER5A 1R0ZA 4ZMRA 1IM5A 1DKRA 3AB8A 3AF0A 1PZGA 2OCPA 2WKWA 3CEMA 3UWOA 3I04A 2A5YB 3H6KA 3WMFA 3CCCA 3O74A 3KYDA 4Q5IA 4H1HA 3SN6A 3AHIA 4HPWA 3DEFA 2P5UA 1HOXA 2WFLB 3C6QA 2EERA 3ITNA 2OV1A 4FGWA 3FZGA 2GN8A 1I2DA 3IP5A 1EX7A 2NUPB 1K7FB 3NDRA 4MUAA 4WK0B 4B83A 1UCFA 2ADMA 1XXLA 3SZRA 3NNDA 2WD8A 3D0QA 2J6HA 2IVZA 2ECFA 2YFQA 3AH8A 3NHBA 3PNYA 2CLIB 4Q4LA 4ZZ2A 2QD3A 3T9FA 1C3OB 1M0SA 4BNWA 2E4UA 3A1NA 2IF2A 1W8DA 2LWIA 3TSWA 2RGGA 3O7WA 1F8XA 4D3FA 4ZGWA 1BFKA 5T57A 3HLTA 1I14A 3FHOA 2AH5A 3BJIC 1S3FA 3KKPA 4KQ9A 4KNWA 3OFKA 3MLAA 4GHWA 3SKYA 3L4JA 5FAKA 1Z47A 1F48A 4RZUA 2G9QA 4DDWA 2J31A 3QUCA 3T41A 4HQ6A 1MO3A 3TOCA 4OXKA 2B7LA 1NUUA 1PQUA 1GTVA 1OXUA 1AVTA 1Y82A 4N0QA 2PGAA 1CE8B 4DZTA 5B36A 2PMBA 1JEDA 2GHTA 3LO8A 3AZOA 1N2BA 1C8VB 1DEXA 1ULAA 4A23A 4DY6A 2QRZA 5JWRA 2CV1A 5ITSA 1ZK1A 3W2FA 4EG0A 3L1JA 5DNEA 3ZCSA 1QH0A 2ILTA 1EXNA 3TS1A 1PJLA 4C4RA 1M8FA 2BHLA 3BD7A 5DBFA 4BNJA 3AR7A 3DAPA 3IAS6 3GJSA 3PWZA 3ER9A 2PSDA 2QUIA 1PJAA 1QF6A 5CRIA 1G64A 1OV4A 2J4DA 3CLUC 1R66A 3IBCA 2BIFA 4J0KA 5K2MA 3RVJA 3PXUA 1RE1A 2FMFA 3WGIA 5CDFA 3ETNA 1U9IC 3LT2A 2GBCA 4S0ZA 4HZGA 4E30A 3B53X 4WFJA 4K0KB 3CYFA 2RJ3A 2A1UA 3RNLA 4PFKA 1JEQA 4ENQA 5C7OO 4L5BA 5J3JA 5TPZA 3EIUA 4KYIB 1E8NA 1NULA 4PSUA 1JSLA 4U6SA 3X3HA 4OMFG 4BFXA 1RRVA 3TNFA 4PR0A 3KT6A 1SBNE 3P4XA 3BIFA 4IIJA 1V9LA 4TKVB 2OSBA 4CJXA 1IY0A 4W7HA 1YHZA 1EGQA 3R5JA 3FFBA 2CFRA 4LWOA 4AJIA 1Z74A 5LP6B 5FWXA 2CWWA 4DEVA 1X92A 3G2QA 3TR5A 3GIWA 4XGKA 3ZVMA 1DCFA 1MC1A 1TKCA 2YWEA 4OQXA 3MELA 3NW9A 4L6IA 4TVOA 2JD2A 3OLYA 1G5RA 3KTDA 4LYEA 1QTRA 2VDPB 5FWDA 1F12A 4FMDF 1G1MA 3CFYA 3EMDA 1G21A 3MA0A 4Q3KA 3FGPA 1I4DD 5C31A 4OOEA 2VK2A 4YT5A 2OSVA 3GN1A 3OM1A 2GM4A 2R6JA 3RIHA 3M5CA 4FXOA 2J07A 2ET6A 1RWPA 3NI2A 4DDUA 2FZVA 3WRXC 2VZLA 2UVDA 2FMUA 2Q3DA 2DHCA 2WKPA 3SNHA 4FKZA 4MVJI 4C9BA 4BVGA 5TEVA 4FBGA 2IA5A 4POOA 4UREA 2FVXA 3VA7A 3VYVA 4A8PA 1YRQA 2PIAA 4IJQA 5FT9A 1YS2X 1CV2A 1XMPA 4E5MA 1TPYA 3EG5A 1JQBA 2O2DA 2VXOA 2ZSBA 3H17A 5EWMA 2NLOA 4MIKA 1CKEA 2VCYA 2Q49A 3N2GA 3D6FA 5JSQA 3BDVA 2COKA 2JJ2D 3AIIA 1MH9A 1QRSA 2PWZA 1J24A 1G66A 1MAAA 1SBZA 2PAAA 3C48A 2W6PA 3PQCA 5FV7A 5F9FA 4GQIA 4B43A 3E9DA 3PPWA 2VP5A 4FJ2A 3GRVA 1OX4B 2QSJA 2ZEJA 1VJRA 2IYNA 2NWQA 1QLWA 4WLNA 1DIOB 1XNGA 5DGDA 3RH0A 1UMKA 1VMEA 1GRRA 1BMQA 4QNRA 1X3SA 1P6XA 2GKSA 1BCRB 2VXBA 4BNVA 3O83A 2QLBA 5DFAA 3OOWA 2YNMC 3ZQJA 4EAQA 4U6NA 4GICA 3RHZA 1RJ9B 4R7TA 3DBHB 4JN6B 3NAGA 5DYNA 5CHEA 3U4CA 4Y1RA 3ZHUA 4C0JA 5JDCA 3VYTB 2ZG6A 1JAZA 1ZESA 4UD2A 1R6BX 3OJOA 3RABA 1B1AA 1KMMA 1NJ6A 1RAEA 2W11A 3SQDA 1WDTA 1PFYA 2ZYDA 4JBYA 4B33A 3KJZA 3FYTA 3GUHA 1KIFA 5IULC 1U0JA 3DOIA 4C4XA 5TS3A 3Q72A 4NAHA 2G3YA 1FW8A 3FNGA 1GADO 3I09A 3B9PA 4TVBA 4QDXA 4ZVRA 3RJ5A 4FHGA 4WV3A 4G8JA 1ONNA 5C32A 1VIDA 2GF2A 5P21A 3VZDA 1HX7A 5A3QA 4XPIA 3SJCA 1C7EA 4C7VA 4MRPA 5KC8A 1HDEA 1RBZA 1XWFA 3U81A 3DDWA 4I50B 2Q1YA 1VG8A 2HGZA 4XQEA 4BE7B 1YR9A 4LDJA 5WRFA 3ZBQA 3PS9A 4UFPA 2CXTA 2H4YA 1Y9JA 3OFVA 1EHYA 3TOXA 3LK7A 1Y3FE 3QVXA 2TS1A 1YR6A 2XUIA 1L9KA 2V4MA 1ZRHA 3IOEA 1II8A 1JPUA 5IK2A 3UAVA 5HQTA 2BGTA 1JBKA 3QP9A 2ZVJA 4HC4A 1FU7A 2C5AA 1F2DA 2R751 1ZG3A 3KCNA 1NVWQ 3HK2A 2BGLA 1P74A 2VHYA 4MHTA 1LVUA 3COYA 1YBMA 5MFPA 3L01A 3BILA 8AT1A 3JTMA 2XWSA 4RKRA 1RXEA 3VTFA 3FJ1A 1EK1A 1VZ3A 5ICGA 1VRCA 2QUHA 5KTNA 4CLOA 3ZPXA 4R2XA 2VRBA 4LDQA 2ZFUA 4O29A 3RJZA 1TJ4A 2JK1A 4MYDA 3NHSA 3E70C 2RGNA 2XMQA 2ZGVA 3ETGA 3IVGA 4KH0A 4BNKA 3GJ8A 3IRUA 1ULSA 3HFGA 4J1TA 2IPAB 1RXSA 3TSAA 1FUEA 1CBUA 1D7OA 1O97C 1R5OA 1WDLA 3EVNA 4P7JA 5J5VA 3TX6A 4IGFA 4K87A 1YH3A 1QIGA 2JI8A 2R85A 3A1DA 1FS4A 3PF9A 1K8XB 4LBWA 3C0KA 3OQJA 4MR8A 3RFTA 2UUCB 1BO6A 2ZR7A 2BISA 4I4LA 4RSRA 2G7ZA 1TMKA 3FPEA 5IP5A 3HN7A 4UJ3A 3L4BA 3RGGA 5KTSA 3L7OA 5DU2A 1UXHA 1HWYA 1VPVA 2PQMA 4G67A 4YASA 2V8BA 2QQ5A 3SC2B 2IEDA 4HNAB 4DT1B 5IS2A 2WIJA 1ZM9A 3OY7A 3PPIA 3W2EA 4ECAA 2WJ3A 4KO4S 2CXSA 1DB3A 4F2PA 3GEEA 2LDXA 1GPUA 4ZRNA 2EQBA 1IFXA 2X0KA 2Z98A 3R41A 3EFOB 4ZQFA 2RGCA 3OA0A 4IZ6A 5KYXB 4A36A 5DYIA 2GN9A 4DQLA 5KEIA 4MQEB 1JR6A 4X6LA 5B6PA 3K9LA 1U1FA 1BE8A 2F9MA 2SECE 2C78A 1RJGA 2V03A 4U5XA 1XNJA 1Y1QA 4JELA 2L19A 3T5PA 4J0CA 4JMPA 4QGAA 3GNTA 3H6HA 3MGKA 1F60A 4Q9JA 3S81A 4R69A 5I4CA 3VAYA 1NBMD 2HU2A 3ZH2A 3W1WA 1OYVA 1J8VA 2A6PA 4CLRA 1U0FA 3LHFA 3MPOA 3OJWA 3GLKA 5CLQA 1QU3A 4B7XA 4A7PA 3KETA 1UXGA 2FU5C 5AHKA 2X0EA 2A5DA 2W0MA 4LK3A 2Y0PA 1K5GA 2ROQA 5IYZB 1BW9A 3FNHA 1RWOA 2WQ6A 4JSRA 4FWTA 1JA9A 4EGFA 1XNQB 2PPVA 3N28A 1ZH8A 2ZREA 4OKNA 5JOQA 3Q6IA 1PR5A 1QFYA 2Y1OA 5CFOA 1YACA 5H80A 2BH2A 2NU7A 1QDUA 1TLLA 2O2JA 2YUIA 3CG4A 1GU1A 1O77A 4UOZA 4XJVA 2JK0A 3DFKA 1LX7A 1DZ3A 1FFXB 2X13A 3CNQS 4L0MA 4PM4A 2BELA 1W36C 5EJ4A 4PTZA 2O0KA 4J6FA 5TVKA 1RIFA 3A27A 2M98A 1E32A 2VCHA 4I6GA 1OFHA 2GCPA 5JUWA 4GMKA 1D9ZA 2EGHA 2QVLA 5EPUA 4EHKA 1C9YA 1GEGA 1RMTA 3AKEA 2WSLA 3FW1A 4OHMA 4G2NA 3ZHOA 7GPBA 1QVWA 4PVCA 4CTNA 4D4GA 1XGKA 3ZI4A 1ESCA 2G5GX 4X20B 2GB4A 1DT3A 1GSIA 2A78A 1XA0A 1U28C 1RKXA 5IT4A 2CK3D 1WS6A 1SHTX 4IIUA 4KQHA 4YEDA 5G3ZA 3BDIA 2AR7A 2RGWA 2BKLA 5JC8A 1VPWA 1EFPB 1ORHA 3ITDA 1A76A 1RZ3A 4NNOA 4G5OA 5DNWA 5JAIA 5JCJD 2Z6UA 1VE9A 4S04A 1LRKA 1BA3A 1OFUX 3AP3A 2WJVA 3SXJA 4A10A 2XB6A 4KQCA 3TF5A 2ZUDA 4Y9RA 4L9RA 2CHFA 3N70A 4Q1FA 1K3FA 2QTWB 3OJEA 3CURA 5CCXA 5U1PA 1SG0A 2XWPA 3F3SA 3JAKB 1EVLA 2JAQA 4CCYA 3F7TA 4D02A 1ST2A 1E2GA 2P9TA 4FWIB 4PGMA 4ZEVA 5AHXA 4DV1B 1O6CA 3V4RA 4OLAA 4W1SA 1Y6QA 1F8FA 3JX9A 2VTVA 3SF8A 2Y8EA 1FFDA 2DPYA 3TEMA 1C9MA 3EPLA 1ZK2A 1FFEA 4PWZA 4C4YA 3KAPA 2K4MA 4AVYA 1CUEA 2NO9A 1G3IA 3VO2A 2CUNA 4U4AA 3H5RA 3D4OA 3BN3A 5CX4A 3UBTA 3TRJA 1LC3A 5CEJA 1D2NA 1US8A 5KQLA 2IXBA 1E5QA 2LZ0A 1LLUA 4FR2A 4LGCA 3U26A 1YOVA 4J0EA 2ODWA 4CI9A 3EF1A 4OHBA 4ZJUA 4LF7B 3JQEA 1GA4A 1GPH1 3WP0A 1PV4A 1LPMA 3MERA 3FKQA 2AKYA 1QH8B 3R7SA 3P9XA 1B7GO 2E89A 2AQKA 4MW7A 4JP3A 4KFRA 2NUTB 1M1UA 2PGDA 3IVCA 4JJEA 4WN9B 3LX8A 1U0OC 4YFVA 5KVVA 4IV0A 2P40A 1IN1A 2O07A 3TCNA 1FVHA 1GUYA 2G83A 3TNJA 1OIVA 2ZRMA 4GI2A 1EP2B 2BMVA 3Q8WA 4MHSA 3CBGA 4U7JA 4V03A 4CLHA 1SC9A 1WW8A 2BDEA 2XNJA 2BH9A 2K7ZA 3BAFA 5AESA 3THXA 5F2OA 3PYXA 3OG9A 4BE4A 4KREA 5B6JA 1NP6A 2HUPA 2VP6A 3BH7A 3FWNA 4BZQA 1ZD4A 5IUJC 5KNCH 1N6HA 2IDKA 3ECAA 4LVNA 4LYDA 1L6IA 1U6IA 2CSXA 5AI6A 3HUTA 4XWWA 1X9GA 2IDJA 5ALXA 5IJWA 4ND3A 2FQWA 1ZKDA 2ZBQA 3BK2A 3FMVA 2RAUA 4DWOA 5GWXA 2H4XA 4G5HA 1E2DA 3M3DA 4CVNA 5JANA 3DD1A 1Q83A 4RK4A 3BREA 4HDNA 1D04A 3FB4A 3QENA 2ZS7A 4OFXA 4ZMSA 3OTHA 1OD6A 3TB4A 1K66A 3V8NA 4LFAB 1NW5A 1B93A 1RS0A 3L8DA 1NX6A 5EUCA 3I73A 1S5PA 4J1SA 4XASA 5BUQA 4CEJA 1U63A 4FGKA 3W8EA 1DBVO 3LGSA 3WQHA 4R1MA 3A05A 2ZRIA 4LWPA 2XUPA 1FL9A 4MJXA 2XMDA 1IC6A 2QX8A 1QLHA 4EQZA 3VC1A 1P31A 2W2LA 1N8NA 1NFFA 1G20B 2VLBA 4JI4B 3OOHA 4ZTUB 1WZNA 2J9YB 3ZWOA 3AKYA 4FOSA 3RSGA 2D8AA 2CE7A 1YB6A 3PKZA 4MVJA 3RAEC 5FNVB 2Z2XA 4X3OA 2P5TB 3QBTA 5CJ2A 1KDPA 5CVJA 2QD2A 2WJYA 1GKUB 4KMSA 1SKUA 2QZPA 4BLVA 3QRWA 1EUCB 2R8ZA 2HH9A 3JRWA 2R8OA 4LHSA 5I7AA 1ODCA 2AIRA 2FX5A 3ENVA 1R9NA 3E8SA 3DZ8A 3GGGA 3DR3A 2YWJA 2YXEA 4OUDA 4X0EA 1JG1A 4YCJA 3DBLA 1N6RA 3OSZA 4GOMD 4QBGB 5EAIA 2MYNA 4KGVA 4LZAA 1GVHA 1E6EA 5ED4A 1ZD9A 3X1ZA 2FW6A 5K05A 3RS3A 5H4HA 2FPUA 3CZQA 1DLIA 1DRUA 4GOJA 3SWWA 1VL6A 2BFWA 2AG6A 1D2MA 1GNTA 3DEKA 3S2ZA 5KQMA 2JI9A 1N5DA 3V4SA 3JZDA 4JLWA 3KSMA 4RTJA 2J3LA 1GTL1 4D9NA 4I8XA 2ZSHA 3I9KA 4TS4A 3AQ4A 3AUYA 3QLVC 3DXZA 5ERXA 3MEQA 2W83A 4XR9A 4QJ4A 3OT5A 3A4LA 4P93A 5L9AA 2CUKA 4GYYA 2OD2A 3OQIB 1NT2A 4GEGA 4X1OA 1TZ2A 4N9WA 5EMHA 1WB9A 4ED9A 2UVQA 5TEWA 1X7WA 2RGAA 1EGVB 4J0DA 3O5AA 4V0KA 3TMAA 2PVPA 3T15A 3BE5A 4NEGA 4XOIA 4Y2XA 3BICA 3HR8A 2PS1A 4F21A 4JL6A 2HJWA 2AC7A 2GCOB 3HCEA 4ZTBA 3W5DA 4TQGA 1UMBB 2DX7A 2FPPB 2QTMA 5EOVA 3HM2A 2OUKA 1LBQA 1ZKMA 2IYAA 3O03A 4Y2VA 1FB5A 4Q4CA 3VZBA 4ZV4A 4J0HA 2RB4A 3KOWA 4DCJA 3M6AA 2JI6A 4BKRA 4Y9UA 1QH1B 1NN0A 1DQNA 5DBHX 1ES9A 1XXHA 2PWAA 4UBJA 2F3UA 1MX5A 2AI3A 3A14A 4I55B 5DNDA 3AK4A 2ZJZA 3L7NA 1OROA 2H1IA 3IILA 1UZAA 1Z0UA 1ZVKA 4PHCA 4NXMB 3SFVA 4IH4A 5K1ZA 4H7PA 5MN4A 3Q5EA 3TPZA 4HAOA 4IDNA 3L0DA 2QTLA 1WUIS 4WW0A 1X3LA 3TOSA 4DJEC 4Z4FA 1VHTA 2X8AA 3NWOA 4Y0NA 1U6KA 2C8VA 1RRPA 2O8DB 4CQJA 3DXXA 4EWLA 3D4BA 4DUGD 4WX2B 3RUCA 3OC6A 4FHFA 3I1JA 1BWPA 1XROA 1CNFA 2E4ZA 2GPAA 2QP4A 4D3XA 4IVRA 2UYCA 1WHTA 1CB0A 2XUJA 1VPDA 5LA6F 5FL3A 1IOZA 4Q3BA 4FXPA 2QAGA 4K81B 2CHEA 2IYWA 1J20A 2C1EA 4KQ2A 3L84A 2IHZA 3E35A 3JRXA 3L7KA 3NUQA 4FBMA 3RRBA 4CIDA 4DWVA 4Q00A 3IYLW 1KOFA 3EQ9A 5C8YF 2O05A 2ZIWB 3DAHA 3IE0A 2QT9A 2RHTA 5KUTA 3BHMA 1RM4A 4WY5A 4BO1A 1N1MA 3FJOA 4NBSA 3SBDA 3F2IA 4RHUA 4U7FA 4DSUA 2OCYC 3OZWA 3KSAC 2RGYA 3PEWA 3LDFA 5FTJA 3ZE8A 1WXGA 2XADA 4IF4A 4N5LA 3K92A 1NIJA 4ZVSA 5BQPA 2YHSA 1B14A 3EMKA 5JYCA 4C0HA 1NYLA 2PS9A 4KX5A 2WUFA 4YPOA 4D81A 3Q3JB 2MSNA 2WIGA 4AY4A 3PR3A 1GRVA 3L0OA 4EI7A 4X84A 1H8EA 5KOIA 1QX3A 3ZGYA 1AQ6A 1I01A 1O3YA 5FPHA 6REQB 5JJLA 1FLAA 4MIEA 3CTMA 4RXMA 4X7PA 5DT2A 2OV6A 4O1IA 1Y81A 3FWZA 3P0IA 4GMXA 4H4CA 4ZVPA 2VHTA 1DIGA 1LVGA 3AIOA 4DCSA 2IGTA 4BX9A 4OQLA 4RTOA 2ZYVX 3OCWA 2O3UA 3P9ZA 1UFVA 2YFKA 4QBKA 3OEHD 1OH6A 2D06A 4I9NA 5DNUA 3NRCA 4GOND 5B1DA 1ZPDA 2X6QA 3SHVA 3VTAA 1M73E 1Y6RA 2G82A 4WBSA 1COWD 2ZZMA 4UM7A 2O59A 2WSIA 4RA9B 4HUJA 2X1LA 1KH2A 1EXMA 2IYUA 5G0UA 4URFA 4MQ5A 1ZU5A 2BGJA 1BS2A 4IM7A 1ZJJA 3BF7A 1U04A 4U8HA 4CM8A 1PLLA 5CB4A 3FNQA 4YRMA 3DOFA 3R0JA 3CPEA 5HVNA 1IPEA 2H4FA 1BE1A 2QMOA 1KEEB 2FW7A 3BCRA 1AXEA 3A4VA 1YQUA 3ACCA 1XAIA 3R8CA 5SYAA 1OZFA 1YZGA 3HUFA 4MWOA 3VVLA 2R6FA 2IX9A 2XYHA 2IS2A 2W2KB 4G0OA 5F5XA 1Z39A 1TVKA 2AXPA 3UK1A 5GV8A 2VI5A 3U7HB 3ADDA 1XZLA 2BP7B 3DFIA 5LD2B 3LQFA 2BKAA 4P7GA 5D87A 4FZ5A 5ENVA 3NC4A 1FC0A 1U94A 1EQ2A 1Z36A 3VR5A 5BNWA 1BX1A 1ZD1A 5JC1A 2X8WA 1ZK3A 2PMKA 1OJ7A 2YR0A 4RQBA 3PGVA 3UAXA 3ICOA 2Q3EA 1VE1A 5ERYA 4BXOA 3CF4G 3SE7A 3EUAA 4FTWA 1A9OA 1JT2A 1E2NA 1IN4A 1E5XA 3DE7X 1OHHA 1DE0A 3PL5A 1U9CA 4JNKA 6CHYA 2J9RA 2Q5JA 2V5VA 3EYWA 1RHUA 3LUBA 2NTJA 4C0KA 4OXRA 4C7KA 1X94A 1XJWA 1I1QB 1SK8A 5LIRA 5H3HA 4YCMA 1NQXA 5B4UA 4W63A 4JHLA 3ZK8A 3R9XA 3COZA 1POWA 3ZQ4A 1E2KA 2QKYA 3K70B 4QBIA 1EXWA 1XMVA 4ESEA 3CN7A 4IEEA 1IBSA 2A88A 3IPAA 3MBOA 3N3AC 1AV7A 2ZYHA 1P72A 1YWGO 3GH1A 3RIGA 4KIJA 4BVHA 5ALTA 5C80A 3FMPB 2BFEA 4JB3A 3LWDA 5EHQA 1GUFA 3WDLA 4DJAA 4MA4A 2NSHA 2ODBA 4V0ME 4KFUA 1DMSA 3RYHB 1KTIA 1XT6A 2W98A 1BXGB 2EWWA 1VKHA 1VL0A 1ZITA 4PYQA 1WA5A 2YXLA 3K0FB 1UC5B 3Q3VA 4PYMA 5ALWA 5KHAA 3ZYCA 4DQKA 4KTVE 1TEVA 3NHZA 5FV4A 2GN6A 1EWTA 2HKIA 3GVHA 4H0CA 2BEWB 1GZHB 4BX2A 1QRUA 2J3DA 4LRTB 3KG2A 1JIUA 1QE3A 3LKDA 2PXCA 3WQSB 3DDUA 2OQVA 2H7YA 1I2AA 3F3KA 1GPMA 1SD1A 1K4KA 3AFHA 4RY2A 3L7CA 4WFQA 4ZCSA 1L4MA 5LZ5A 3RRXA 4LC0A 4BZZA 1GLNA 1HSOA 1LBTA 3G23A 3O84A 4IGAA 1H1LB 4FW9A 4TTAA 4RTRA 2WYUA 5J1SB 2I03A 3ET5A 4MW5A 1KQPA 1RWQA 1WIWA 3AHEA 4GI7A 1F9EA 4J76A 4IH9A 2QX6A 4ZJYA 3J81A 4YT8A 2Z56A 1L3BA 2WE7A 3A4IA 1HZJA 4L2IB 3P32A 5KVQA 2G6TA 4EB8A 3IULA 4A6XA 3SP1A 1KPIA 4CCWA 3SIPA 1Z9BA 1E2EA 1HFEL 2VHWA 1A2QA 3PK0A 4EI8A 2VDRB 3A3YA 3ONWA 4O2AF 1EQAA 1EXVA 1JQJC 1NJ5A 1PFWA 2C1XA 2XUFA 1ESZA 4P38A 2HM7A 5DRTA 1LSJA 1EGHA 4BS9A 2AOVA 3UUFA 1N0HA 1Y9EA 3TMYA 4UBIA 4JC5A 5GZ1A 3V7NA 1LPPA 3CLUD 4G4SO 5EXEA 1JTEA 2WVHA 1UXIA 1VCOA 3RAGA 2EZTA 1B15A 3HRHA 3ZHYA 1OASA 2F7SA 1JR3E 2HO5A 3BMCA 3LNCA 1XHEA 4G37A 1YJXA 3K5IA 4KV9A 4UDOA 4JBWA 3TE7A 4B2YA 4OGFA 2HJHA 3IB3A 4KRFA 4JQOA 4O4JF 4TWIA 3VNVA 4PS1A 2WIAA 4D8TA 2FFJA 1VL8A 1SUPA 5A04A 4R1LA 1B6RA 1FUIA 5FL7D 1GTZA 3HY4A 1LPAB 1K86A 1KU6A 1NVMB 1TMOA 3AXTA 3KZMA 3LSTA 4JUIA 1GHTA 3D4LA 3SQNA 4RCVA 1JAYA 4PRLA 1XN4A 3HP4A 3WLPA 4AK9A 4HUQA 5CAEA 3BSWA 4F72A 1DNPA 4Z7OB 3EXEB 8GPBA 2GEFA 1G291 3LDHA 1BKDR 4AKTA 1TW2A 4EFKA 2Q1XA 3B70A 3IE1A 1YS9A 3BPSA 4DQDA 2H5IA 4OSEA 2AN3A 1EFKA 1EFAA 1PVDA 4NJEB 5IW8A 4O63O 4BJ3A 4WY8A 5JW6A 1MRNA 1U7PA 5AMXA 1QQ5A 4ZI7F 3DHEA 4EG4A 1B0PA 1LCIA 3CE6A 1RJWA 3WRVA 1KY4A 4GYKA 2QL7A 1O96B 1OBFO 4B1FA 2NYVA 1B8UA 5EZ6B 5JSZB 3W4KA 4F6RA 3D4IA 5BVGA 3EARA 4PLHA 5HZGA 3W5UA 4BBZA 2I7DA 4V0OA 3FTNA 2WSMA 1A9XA 2HHHB 1HO3A 1T9GS 4DJFC 3D3JA 4W82A 3G8CA 1O6GA 2WC1A 5TQVA 2OFXA 3E2MA 4L07A 5PNTA 1P73A 2FLWA 2V3WA 2MYTA 4QYWA 5EKDA 1ZYUA 5FPQA 1TM7E 5K8JB 3PUWA 1I13A 4P3XA 3W5IA 1PX2A 4MP8A 3TLMA 3RAPR 1VJ0A 4BKOA 2O5CA 4BN0A 1SIUA 5KNBA 4FJ1A 3VSEA 2EQAA 2HHCA 3SBXA 1HURA 4BEVA 1FBNA 1SZDA 1FY2A 3HWSA 3CZMA 4DFDA 1GR1A 2DYKA 2HJSA 2BEUB 3AHFA 4KLRA 2QRKA 4CPDA 1WCIA 2XYQA 4DBLC 4UHKA 4FI3C 2J9GA 3LC1O 1BU8A 4WRRA 4P8RA 2PJUA 5ESDA 4JDUA 4QRDA 5LL6P 2J5QA 2ZWIA 3ILHA 3SIXA 3ZU4A 2QBYB 1FQWA 2OBBA 3H5NA 4LZOA 2HMVA 4FZ3A 3V32A 2YL2A 3KJNA 4B6GA 3O38A 5EJ7A 2WM2A 3BFXA 3FGNA 3TWOA 2YNMD 3MOSA 3UMGA 1WD5A 3WYCA 3ZV3A 4KNYA 4N03A 2QRLA 1JXQA 5IDQA 3O7MA 3GVCA 4BP8A 4LF8B 1LTKA 2DFVA 2P0YA 2VJYA 4DPMA 5KKNB 2PUVA 2X40A 1AZWA 1NU8A 1Z16A 2X9VA 3CA8A 1TAHA 2OECA 2XTMA 3MMNA 4P5DA 1SCUB 2DPMA 3ZWNA 3D2AA 1E7RA 2JL1A 4NONA 4XCQA 2QLFA 1CULC 4R71A 3PRKE 2PUJA 3OD5A 3A9VA 3KQQA 3DDHA 1UIRA 3IP6A 3OESA 3PWSA 4BFWA 2IIPA 1P17A 4HGNA 1Z0KA 4KQ6A 4DY4A 5HPYB 1ZOSA 1MJHA 1NW4A 3QU2A 4HH3C 4QOEA 2FPGB 5JCPA 4O4HA 3BXXA 3COJA 2C98A 3HY3A 2Q3HA 1KZ7B 1NDHA 2IYQA 4BLTA 1BSVA 2GK3A 2IL1A 3SLKA 1USUA 2LW7A 1G0OA 3SYKA 5KYWB 1E6WA 2H51A 2UVPB 1GQ2A 4M1EA 4MPPA 3OQOA 3T3MB 3JARB 2BUCA 3QFFA 1P9NA 4P92A 4PRYA 3R7WA 2ASEA 2HI0A 1HC7A 4ZT5A 4N47A 2BCJQ 3RQSA 1PNOA 1RCTE 1YRYE 4B0OA 4WY2A 5DN6D 5IBCA 2VSOA 3FHCB 4ALMA 9LDBA 3ASYA 5FR2A 3FDXA 3AEUB 3HADA 4FDVA 4QTUB 5IN5A 1W93A 3ZDBA 1QFXA 3DT9A 1N3IA 2H1WA 3R5FA 1FDOA 2XXAA 2GXSA 4UEOA 5AM1A 3V8QA 2R11A 1Z0SA 4X6XA 4RXUA 4RKFA 1U2DC 4YJ2F 1Z5NA 4A91A 2BHSA 1PAUA 2GHRA 2VHQA 3BMQA 3PWTA 1YB7A 1XQXA 4L22A 4KLNA 2I54A 1AZTA 3P0FA 1O97D 3BJZA 2NP7A 3FNFA 4O2RA 1H0SA 4C87A 1FS5A 2BM1A 4BU1A 5TX7A 4RE6A 4KXUA 3ONVA 1BS9A 1W87A 2NACA 3M4YA 4CFYA 1P5ZB 1Q7BA 1THMA 1A5SB 2PD4A 3IQGX 3P26A 3I1FA 1FXWF 3JWJA 3VMMA 5IWAB 3PZRA 2IS6A 1HDIA 1ISGA 4X6UA 3DL0A 3JQCA 3VR6D 3BWEA 3MIZA 2OHFA 4MS3A 5KYTA 1X19A 4RF2A 3TXYA 2JGDA 4Y3UA 1ZBDA 2H63A 2I4LA 2W6CX 5I9LA 5M29A 1DX9A 2WW8A 4RV4A 5J2UF 4AI6A 3C3MA 2B34A 3MPUA 1IOWA 2AJ8A 2FUKA 5LUBA 4UU0A 3K6KA 3WOVA 1N2CA 4AC9A 2O7SA 3O93A 2EFDB 2M1XA 5FWYB 1A5TA 4KQEA 2RGEA 4E07A 4XEHA 5KBYA 1ZJZA 1USWA 1CUZA 3DAFA 2XCTB 1UBUS 2O6HA 3F5SA 4RVCA 3MCUA 4CIXA 2OLKA 1YVUA 3N2ZB 4IINA 5D84A 5C1DA 2ZJAA 3PV0A 3WISA 4ESOA 4L0DA 1DKQA 4PY2A 2XE4A 3U9SA 4A2PA 2PD6A 5JQWA 4DAOA 3I2HA 2HF2A 4YI3A 2IP4A 3PJGA 2D1YA 2MMCA 4IWNA 2WWGA 3PG5A 4P4UA 1N8SA 1JDBB 1QANA 3U0VA 2AEFA 3T7SA 5JZBA 4HAXA 1OAAA 3SAJA 4EKEA 5L3QB 4JITA 2DETA 2C92A 2VYFA 1DWUA 4NBUA 5KCZA 1N9GA 3O0DA 5ARDA 1OLOA 3UANA 2DH6A 2FFHA 1FSSA 3JD3A 1UJMA 2H85A 2MOKA 2DHDA 1JYFA 1RBYA 3E3NA 3BEOA 1XTVA 1QFZA 2BGIA 3C74A 3LAWA 1U7OA 3MTBA 2I2XB 4QVKA 3TQFA 3W5BA 3AFIA 5F1KA 1BXRA 4O1HA 3U44A 2CNNA 3JQ7A 3T7EA 4EG3A 1I1OA 2VJDA 1H69A 3QVGB 4JFRA 3ROMA 1CHNA 1HFKA 1S8NA 5NULA 1JW9B 1H5QA 2P4HX 1W36D 2FEAA 4TSRA 1YJ8A 3DLTA 1GNLA 4B31A 4EB3A 5JJBA 1CUUA 1BE6A 2QLMA 3IUBA 1IL0A 4DNPA 5J4LA 4AM8A 3VR5D 5CDUA 4ETNA 5L7TA 2V7EA 3BJEA 1MX1A 4OPMA 1JBQA 2WRZA 3VMFA 5BR4A 4X94A 2CLFB 3P2KA 3PNKA 4NAUA 4Q6WA 3I8OA 4GRDA 1M7BA 2YMPA 4YRFA 1N4AA 2GXAA 4PZYA 4CNBA 1HLFA 3TUIC 5SZHB 1FYXA 5ITWA 2AD1A 3F5QA 2OZVA 3IUSA 4PICA 1WQ3A 3B3FA 3LP8A 4HDSA 4DCPA 5T8KA 1EA7A 5C35A 5K8LA 5LUAA 2XVYA 3WLFA 1VKOA 1W35A 1BCSB 2X9QA 3KQWA 3T5DA 4DL9A 3T4UA 2ANCA 1XZMA 3CKMA 3KB8A 1XEFA 3EJ6A 4LYFA 3TIFA 2NXWA 3R8XA 3TIGA 3NBAA 2IP1A 4BUZA 2NSDA 2BJHA 3Q7RA 5L51A 4BQSA 3K2IA 3CO0S 2BMJA 1DJPA 4OAOA 4OMCA 2AA3A 2AOTB 3RS8A 2WHYA 5FI3A 4I4TB 3F1KA 1JLMA 3I4LA 4MARA 3AGQA 1A5BB 5DB4A 1FBTA 3LCJA 1BD3A 3PQEA 4UCQA 2F8LA 5EJFA 5FBRB 3HA3A 3OCZA 4ZV7A 3REFA 3VZQA 5DNCA 3G8YA 3RT9A 2YC2C 5KJ1A 3IOBA 4UMEA 2NTNA 2QR2A 2QL5A 1H2RS 4KIGA 3A9UA 5BN3B 1XTJA 2WFZA 1YFKA 1QP7A 4HQKA 1TCAA 1YV9A 1JDUA 1E7SA 1OC2A 2C3OA 2Q29A 1FDSA 2QV0A 1AC5A 2RC6A 3B1FA 4KI7A 3GLFE 1YZ3A 3MAJA 1OXBB 1K7CA 2ETXA 2LDBA 3I0ZA 3MCWA 1XQ1A 4BIIA 4CETA 5H68A 1ORIA 1URPA 1Q44A 4E12A 1I33A 3DHYA 4MYHA 3WKEA 4FHDA 2HRRA 3QKTA 5HP4A 4A0HA 1Q21A 4IMJB 1DU4A 4JLUA 2FE4A 5TPWA 4EF4A 1LPOA 3PDIB 3BCHA 2CB0A 2QLTA 4Q1DA 3B7PA 2DGDA 2EZ8A 1PYDA 2JGKA 3R7AA 4CHGA 3TFQA 5JPCA 3IBGA 3AKZA 1WCXA 3NGLA 3AKDA 3VBEA 1SZCA 4Z7JA 2WE8A 5K6AA 1QK4A 4GVPA 1OXKB 4ROTA 1HG0A 5ENZA 2O48X 3O8QB 2IU0A 3GO4A 3LE8A 5LSAA 1XDSA 1GTSA 3ESAA 4EO4A 1PR3A 3MTIA 4R6XA 1R4NB 4CM7A 4MWDA 3R6WA 2BFDA 1M5RA 10MHA 3IDAA 2KE5A 1V26A 3QI2A 3Q98A 1USGA 1WF6A 3H9UA 3FPHA 3PJEA 4M7OA 3EWSA 4JI3B 3PRYA 1XTQA 1ZIOA 2F67A 2I7VA 4TN1A 3WKDA 1QPZA 2Z5LA 1XAJA 3L05A 3OFSA 4JJZA 2XRYA 4DCNA 5T4EA 4MEBA 4MKHA 3FVVA 4M9XA 4BN5A 1ACLA 1XZGA 2QN3A 3CH4B 1V41E 1D03A 4XD7A 3TW8B 3WZMA 5JDIC 1ESMA 4V0QA 4C6RA 1WZIA 5CYFA 1DOZA 2PS3A 1Z6PA 3HB4X 1SPXA 1XCMA 3CLKA 3FCCA 4JBGA 2DZDA 4L5YA 4UNPA 4HFNA 3W3AH 4URZR 1CDZA 3UV3A 1Y1TA 2NW6A 1PD1A 3MWEB 3AVUA 2RBKA 1BDJA 1PG5A 4R1OA 2OTCA 3GRYA 4NMMA 3MGCA 2WFAA 4Z1MD 1EFVA 2C0CA 4U2GA 4U2FA 5AW2A 3LXRA 4TYMA 4ZU6X 1SBQA 3EXG2 2PGLA 2FHSA 3I6ZA 1X0VA 3LFHA 5JXJA 4C7JA 2MCFA 4JYZA 2BTOA 2QB5A 1XI2A 3H5TA 3KKNA 1XAGA 2FK8A 3NUZA 1VJ1A 3ZGVA 4DV3B 5DULA 3JQ8B 4CRWB 1JU9A 2LNDA 2WIBA 2HSZA 2MINB 3KHSA 3RC7A 5K45A 3FHTA 4K9SA 2QN2A 5DI3A 1SVSA 1VKZA 2YCLA 3GRAA 3R7NA 4U7DA 4NMXB 2OCAA 4PO1A 4TKZA 1M8GA 2WD7B 5CNIA 4GUDA 3VTZA 1UOPA 2CHGA 5K01A 4GMDA 4E3ZA 1QNLA 1L7PA 2Q5QA 4GPBA 3DO8A 2H5EA 2XR1A 4J07A 2PWYA 3VSBA 3WVNA 4BFVA 1AKWA 3HZOA 3V3KA 3CPHA 3BCSA 1FX0A 1T8TA 3TI9A 4RMHA 3GAFA 4EVSA 3FBTA 3I30X 4K1XA 2BFPA 1I6LA 5SY6A 5JAZA 1CVLA 1KEWA 1L7BA 1WZEA 2IX3A 4ABTA 3C5WP 1KMQA 3T6KA 1AMUA 3GRPA 3MRSA 4GF5A 1KVTA 4GMHA 5BPFA 2OC9A 3H1GA 1N6KA 4IG4A 1YHYA 3A0RB 3LWBA 4TMKA 3SNKA 4FKBA 1P1HA 2P41A 4I8IA 1EWRA 1M34A 1OMOA 1V6CA 2E48A 3MOIA 3PHBE 2VOJA 2X42A 3HPQA 2J5XA 3OZGA 1A3CA 5A9TA 4HYTA 1EG7A 5KNDD 1PS9A 1XPJA 2B1RA 2P90A 1GPYA 1XCPA 3AL3A 3KKOA 3MGBA 1O6BA 5EYPB 2J4CA 4ZMBA 1E1RA 5D3MB 3LA6A 3AR8A 3ND6A 4KQKA 3QHPA 3R6LA 2XOKD 4JH0A 2C54A 5I8ZA 1U31A 3CVVA 1WLSA 3T5TA 1DHRA 3C1OA 2A67A 3FHLA 4JVMA 1Z4PX 2Z1NA 3JYOA 1EQUA 3TZHA 4EJ0A 4M7WA 3HEAA 1N0VC 1CQJB 1QKJA 4H6XA 4YX9A 4FYJA 2XCRB 2YVUA 2WR8A 2VF8A 3NTRA 4QVIA 1SKYB 4JU8A 5AKIA 4EYEA 3C3JA 5IKOA 2PZKA 1MXHA 1Q3HA 1D4AA 4MA5A 3LG2A 5MGNA 3WJ1A 2LV8A 4U2EA 1T0JB 1A98A 3QYJA 4DLBA 1L9XA 4DLUA 1J1ZA 4KE8A 2KPOA 4PLZA 1ZSYA 1YFJA 4MV9A 1SXJC 1T3GA 3GLRA 2CYBA 1KVRA 4RNCA 5LNK1 1ORDA 1R5BA 4FYVA 4XAQA 3MSCA 3R7BA 2OM2A 1TLFA 3V8EA 4ZI3A 4U00A 2XAAA 4KB5A 1XWWA 2ATIA 3AJ9A 2DC1A 3R6DA 2PAFA 1QQ7A 1FLDA 3MBKA 2JLRA 3NNSA 1X7ZB 4PG7A 2G76A 1OY1A 1D4FA 4RVOA 4WDQA 2NPIA 5IH3A 4BMPB 4W9NA 4CN8A 5C9ZA 3NEYA 4AZ0A 3MCZA 3W2GA 2AFIA 4L8YA 1TD9A 3INYA 3LTNC 1C81A 4MQBA 5IJ0B 5L45A 4ARUA 4QELA 4CKBB 1KSHA 1DJOA 3P8ZA 3K1AA 2WK1A 5LBUA 4D5GA 3EXFB 3U40A 4BRUA 1SQ0A 2VZ9A 3ZHQA 4ZYZA 3TOZA 4CV3A 3DCYA 3K8YA 2DHEA 4N4AA 4DIFA 5ADVA 5TIIA 5DYTA 3E48A 3DYVA 2XE7A 2ZRHA 1FSGA 1RQPA 1YUBA 3LYAA 3OEHA 4Q47A 3JQ9C 3W3ZB 1H0HA 1EAYA 1K27A 3O1JC 2FMTA 3VU9B 4NABA 4RTLA 4GQAA 1N1EA 2NU9A 1IUNA 1P0IA 3AJ8A 1RBQA 2NG1A 4GXTA 5EUBA 3BRCA 4Z99A 3H6GA 3SJBA 2DVMA 5TSDA 3HZZA 2X0NA 4R9SA 5EWJA 5LA6A 4QYTA 4MWBA 1U5BA 4JOBA 3G3EA 1P7CA 2VHEA 2CBXA 1EE1A 1KEUA 1N34B 1RD4A 2D4HA 1L8QA 3G2LA 5L7YA 3AU8A 1MOZA 5IDYA 1GAJA 2DOKA 3RS0A 4OJMX 3RYCB 1E9AA 4G0MA 2CC2A 5GV7A 1G59A 1ARZA 5KYUB 2XT6A 4QM7A 2HA4A 2N42A 5GJVC 1YB5A 3DKRA 4OLBA 1KI1A 2GPNA 3AC0A 3BWXA 5HKBA 1JKIA 1W0CA 2C4UA 1M6NA 2LCQA 4C76A 4PHTA 1GGHA 4Y2RA 4PQRA 2ZBRA 3G8BA 1ZC3A 1I32A 2LGJA 2NSYA 2QW1A 3D7MA 5IC5A 5TXGA 4EB6A 2GKOA 3PNSA 4CF4A 2J9FB 3TTYA 1ANKA 2WJAA 3AG6A 3GDHA 3I2KA 1UC8A 2AG8A 1CW2B 1MHPA 2WHRA 3HKCB 4GPZA 2EKBA 3ZHBA 1VLVA 5TC4A 3S40A 4YRNA 4YY3B 2HRQA 4KLZA 2GA8A 1FW6A 1UDCA 3OHSX 4DR4B 3O4GA 4R8LA 2EEZA 5JS1A 2J5BA 3ZDZB 5CVUA 5D00A 1VIMA 1YRHA 2NZUG 4UFNA 1T24A 3OMXA 4MGKR 3DP9A 4B3HA 1H4QA 1X39A 1QAOA 1MDBA 1OZ0A 1TTTA 4EY4A 1WPRA 3ESYA 3U7EB 4KO1S 2G88A 1IEQA 3EA0A 2AG1A 4YQFA 1QG0A 3DZDA 2HBYA 4HYEA 4EJ6A 2X7XA 3K70C 1LF0A 4H0FA 3PUVA 1VLMA 1R3DA 1Y5IA 1T2CA 5ENDA 2HQSA 1KJ9A 2B94A 1CUDA 3HXTA 3LO5A 2G17A 2XDWA 4QBHA 1WZ2A 1D2GA 1X7HA 2GPYA 3H5IA 4FFLA 4H3KB 2VSNA 1X1EA 3FYUA 3JWGA 3T4XA 2Z1MA 4EJ2A 3DBRB 1CQXA 3HXPA 3GOQA 3NZEA 4Z6KA 3MJTA 4WI1A 1O5TA 1K7XB 4F12A 4U3JA 4J2OA 1T9AA 2Z30A 4NEHB 1FMLA 1DIRA 1LNZA 4WKPA 4BLWA 1LW7A 2PKWA 3L7AA 3M6IA 5IVDA 4LV8B 1U7TA 5C0OE 1FFYA 4ETWA 4L3WA 5ER9A 1UJ4A 4RLFA 4Z51A 2IITA 3KT3A 1SMKA 3IA2A 3IVMA 2C4WA 1J90A 1XP5A 3DE2X 3V7WA 2FF7A 1FE8A 4YHBA 3GLIE 3RK0A 3AUAA 3T0FA 2JHGA 3HC7A 1FUYB 4BCCA 4C1NA 1R4MA 2C7PA 2QMYA 2F43A 1LNSA 2QGZA 3MMZA 4BFLA 1KIMA 1W59A 2YJGA 2ZW9A 3A10A 1KMHA 1SB9A 3MWDA 2XA9A 4JHXA 4RDXA 1NUSA 3FDZA 4NG5A 3SR0A 1XMJA 1JXAA 1S8FA 5L3RA 2HA2A 2NN3C 2B37A 3QBDA 4UPVA 1FDRA 3LZCA 2B69A 3AF5A 1P77A 3NHPA 1ZNQO 4ZC1A 3WS7A 5ALJA 1GCUA 1Z0IA 4EW1A 4L50A 3BXGA 1RAIA 3DZBA 3N5CA 1ZM2A 2RFLA 5KKCA 4Y8VA 1RABA 4MYTA 4ITUA 3QPBA 5EJIA 4UPEA 1RJFA 3HKDB 4X44A 4X7RA 4DHWA 4DMLA 3SEZA 2QIPA 5REQA 4E51A 1Z15A 1Y5LA 2A1TS 2DQSA 1NT4A 4BPRA 1E3SA 1E8DA 1JEJA 3K1ZA 4F60A 3G0IA 1ZR2A 1AU9A 4XX0B 3TSOA 3WKCA 2JA1A 3TLEA 5A5FA 4POAA 2Z83A 4YMVA 3PD7A 3EPPA 5GZ6A 4U7GA 2YY7A 3S6JA 2BM8A 5DE3A 2XA2A 4FNOA 1T5SA 4K9NA 2IY7A 3PC7A 1K9SA 4RFVA 3VX3A 3OIDA 4UE6A 2VP2A 1T13A 4ZAVA 1HDXA 1CY0A 4ND2A 1N2IA 2Q4DA 3RSOA 3WL6A 5A03A 4V1CI 2YW2A 2QW8A 1DGQA 2X4IA 3EEIA 4H6VA 4CCAA 3DVRX 1SD2A 4YMWA 2ATCA 2DQYA 4QQKA 4DNFA 3OKCA 2GK4A 1GNSA 2FK7A 2NSLA 1HA3A 1CIPA 2BUBA 3N6VA 3NKLA 1AK1A 4X61A 4ANFA 1F7VA 2ZKIA 3KOMA 1SXPA 3OE7D 2A1UB 3MYYA 4QPNA 3OHMA 5HQ3A 1JEQB 4TL7A 3WHPA 2JGEA 3K05A 4AN1A 4DRXA 2SNIE 4M1TA 1XKTA 3AERB 1SQSA 2OKCA 2R48A 4IIJB 4Y2TA 1SA0A 2AW3A 1NRJB 2WDZA 2YXPX 3RKRA 4UVEA 2J8ZA 3VYRB 1YASA 5EHZA 1QHGA 1CEXA 4QOSA 1HDGO 5FWXB 1UBSB 1H9AA 4FONA 4BFSA 2QN1A 2BR3A 4MDFA 3S2GA 4D45A 1NLMA 5EIBD 5TB5A 1A0OA 3OSUA 4B45A 4PBTA 3AETB 3OMLA 4LWZA 3OLQA 4N5DA 4R2HA 1JSZA 2HXGA 3K1JA 2DFNA 4P98A 2H1SA 4PZDA 4OHXA 1S96A 4J0QA 5J43A 2EW2A 4C04A 5E3IA 1P2GA 3ZY4A 4OHWA 2PZEA 2FZWA 1ZRMA 3RFXA 1RHQA 4I66A 2JVIA 2PUWA 4KN8A 1OXMA 1O95C 3U3MA 2FMHA 2BRUA 2P2CA 3E81A 3DS8A 5K0LA 1FEZA 1UFKA 3IUPA 4L27A 1VFNA 4AECA 4DXHA 2PY6A 4ON9A 3R8FA 2P9YA 4G8CA 1NSYA 1A8UA 2XMZA 4OXNA 1V1MB 1KK3A 3AU9A 1RMYA 4O4JA 5DX0A 5AICA 1IXRC 2GN0A 5JCZA 3T1HB 1RACA 4G81A 2EJWA 1O94C 4AICA 1NBAA 4MQ4A 3L79A 3ZD9A 2Y68A 3NB0A 1UZMA 2ZQYA 2Q21A 5GM2A 2D7CA 4BJHB 3I83A 1ZOOA 3GARA 2FETA 4RZHA 1L4KA 4Q12A 4UMFA 4EG1A 2H9IA 5JY6A 4M1OA 2XNKA 3VC2A 3KEMA 3U6KA 4BMSA 1X8KA 5F7OA 1O8BA 2WJ4A 3PLAE 4RX1A 1MO5A 3DXYA 3PC2A 3HGTA 1F5SA 4KP7A 3QJYA 1PWZA 1Y33E 1R0RE 3EH2A 1GFSA 3OZDA 3P9KA 2QLNA 3UICA 1JFVA 4PIPA 3CISA 3IKJA 3QLTA 2ZVQX 4M37A 2C3YA 3D59A 4UNSA 3E7XA 1PTJC 5CNKA 4DVGA 3VKHA 1U02A 1YZQA 3CVYA 5DTIA 2Y0DA 1SUDA 1T3HA 4URHA 3BFJA 4LX0A 5IF3A 2ONJA 2I2BA 4N49A 1UDBA 3QMMA 3IHKA 3MUEA 2N1BA 2RC5A 4QFBA 3X1YA 1M2JA 2H2GA 4RHXA 1EFTA 2DPLA 1XYVA 2XBLA 4EB0A 2X5NA 4IWYA 2PH3A 5K8CA 5HIKA 1K2VN 3NFRA 4MGIR 1M8KA 1P8JA 1FNSA 2I62A 3ZOZA 4MITA 1ZI6A 4RCZA 4M76B 3E6AA 3PEFA 4DVJA 1TUGA 1XKXA 3VKFA 5T6MA 1O87A 2YYAA 5IN4A 2QPAA 3K5PA 3L8FA 3IBTA 3NOOA 3F7OA 2XE8A 1YO6A 3ZY6A 4BFCA 2XQGA 2IU4A 3BXOA 4UVIA 3T99A 4ZO9A 1PZMA 2GD2A 1QSGA 4BX8A 5K03A 1QP0A 1UPAA 2EG9A 1UR5A 2FHPA 4K9RA 4DTCA 2B6HA 1C1DA 1P2DA 2CT8A 4GWGA 3N59A 3QFTA 4BMXA 4OLJA 4AJNA 4TTJA 1VHDA 2I7XA 4GQBA 3O9MA 5AW0A 2JAOA 2VJLA 2NAFA 5JALA 5CVTA 3EW7A 4D1YA 3DMPA 1UDWA 4G65A 2IIQA 4OXYA 1J00A 2QTFA 3TQOA 2FEXA 1TO1E 1SCIA 4O33A 3W5CA 1NE2A 1X0XA 1NBEA 3OQ6A 4KLAA 1II8B 3KT0A 1U8AA 2GZ1A 2UYOA 4HWPA 3R3XA 2JJ8A 1SC3A 2ES4A 2G7MC 2XQVA 1P45A 3CV3A 3MW8A 5DN9A 5H7XA 3UWKA 5KDOA 1M2FA 3CKYA 4ZQGA 3SYMA 1YZUA 1CJMA 3IIKA 4Q1VA 2QORA 3HZRA 3B6MA 2CNBA 3D2LA 4WXRA 4NBLA 2GBGA 3HP1A 1XMXA 4ZYWA 4RLQA 4UXIA 3X43A 1ISIA 3H2SA 3IUQA 3PE3A 1AGYA 3QWIA 2R8XA 3T3EA 5KMGA 3ROGA 1WXWA 5D01A 3ICQB 3VJLA 5HRAA 2ZSFA 4PAQA 4FZRA 5I01A 5JS7A 2A92A 3GMSA 2GR9A 1LRLA 1QIKA 1U7UA 4ZCLA 1SUSA 3W8RA 1P39A 2G1UA 2R84A 4L78A 4MR8B 4FHEA 1NJFA 5ICFA 5I9SA 1JLKA 1TF2A 1TYBE 2CFIA 4C06A 2UXCB 1LLFA 3DTVB 1WVGA 4S12A 5D51S 1INLA 2I3ZA 1TX4B 4YROA 1YS1X 1Z22A 2PWPA 3PENA 1YL5A 4LIPD 4RPLA 1GPAA 3WB9A 3V8MA 3B1WA 3C87A 4PZ9A 1KKLA 4CQLB 3SYNA 1QCYA 2WJIA 1CUFA 2X3YA 4Y0AA 4I1SA 1X1DA 4YP6A 2VDUE 2LCIA 2HTFA 4XDZA 4BASA 1TB4A 3GIDA 3B12A 2R4UA 5B12A 3KUXA 3ORRA 4OMUA 2RB5A 5EMJA 1VP3A 2CMFA 3M8KA 3OC0A 3N2IA 1IY8A 3WYBA 3QU9A 2PX2A 4EKDA 1P44A 2FV8A 3EGCA 4GPAA 4YJHB 1UJCA 3TEJA 4D3ZA 5CG2A 3UMFA 9ABPA 1UANA 4ZVTA 3DONA 1E5VA 4NCHA 4PPQA 3QWHA 3BQNB 5AW3A 5JQGA 3I2FA 3N8IA 1IPHA 1H4TA 4W6QA 1EJBA 5CM8B 4JJAA 1NXVA 2GAOA 2Y6UA 4CLRB 1V1JA 2QX7A 3PUXA 3EMVA 3WLLA 2WAAA 4JUAA 1ZIDA 4ZALA 5LR6A 2QQ0A 4MZDA 4TMXA 4WFIA 3B8HA 2HU5A 3C3YA 5A3RA 2OXFA 4RMJA 5KTKA 2A4KA 2I6XA 2ZJ8A 3DM9B 5EERA 4CM9D 1AXGA 1VMIA 3UK7A 1WTAA 4MV1A 2WWVD 4O4LA 3SZOA 5A6SA 5EZYF 3J81k 2NU7B 4KN9S 1W34A 1NPYA 3JALA 3UKOA 4Z0NA 3S2FA 5JMOA 2I65A 4OQNA 3I6BA 4WLOA 1QIHA 1IM2A 1M8PA 3RVNA 3AB7A 2BMFA 3A37A 4DILA 3L0BA 2XRMA 1P9RA 3VU3A 2B4RO 5AVQA 2Q4OA 2PEYA 3KWFA 1A1SA 1T35A 1FFSA 5M5BA 2IFTA 4TT3D 2PTHA 2EJVA 3BVPA 2VHUA 2DBZA 4FSXA 3DZFA 4X5OA 3PDWA 5EGSA 4KIWA 2WHXA 3LYLA 3MB5A 4FVTA 4RD0A 3TIXB 5ADHA 3A1UA 1A9PA 2ZXEA 3H2KA 4ZO8A 5LLSA 3P2OA 2ZXUA 3A3NA 3AY7A 4ARIA 2OHXA 4KI0A 3M1IA 4DCVA 5G0SA 5F78A 1E1QA 2PRIA 4E2XA 1H6CA 1ZJYA 2YXNA 4YUZA 4ZYXA 3QITA 1KZ1A 1YRWA 3GFBA 1IXKA 3HBFA 2J0VA 4UD6A 2O57A 3KPUA 5THQA 4ZK6A 1J8FA 4FM9A 1G4AE 1UPCA 3TGWA 4B3MB 5ALOA 3Q9SA 3H8VA 4FDLA 1D5WA 3NONA 3U5TA 2VUSA 1KI7A 1ORWA 3WV4A 2VNAA 4BNXA 1HZZC 4FE3A 4FMBB 5LQSA 3PZBA 4UBKA 1L5ZA 1KI6A 4CKWA 3V55A 1C9DB 4G0UA 4IDOA 4TLMB 2G07A 2H3EA 4L7QA 1PEYA 4N12A 3SF8B 2HMWA 4ASUD 4L4ZA 3OT4A 3UN1A 3ULKA 1XTRA 1KHHA 2VPXA 1P7PA 2RMKA 4OGWA 3RLFA 5LU9A 4WCVA 1J8MF 3MT0A 4US0R 3RJTA 4ZDWA 2XV1A 4TLEA 1E99A 1T9ZA 4NU5A 5BP7A 2D00A 1ORTA 1ZCJA 5EVJA 3K32A 1GT91 1LS1A 3IUMA 1US8B 4JUFA 4XTCS 2D7DA 2B2NA 4IKOA 3CMMA 3D9QX 1RYBA 1W25A 2HCTA 1H2BA 2UUOA 2VF4X 4ZGBA 4EIWA 3FDFA 1Q7CA 1KOGA 3Q8LA 1KJWA 2J08A 4LSZA 5A4MS 2HO4A 1SR8A 1AKRA 3JVDA 3SJZA 2ZTSA 2AOXA 4HGQA 1FOEB 2P2LA 3Q9LA 1F17A 3RSHA 4Y0VA 1XTZA 3CR8A 3I52A 2CYAA 4QDKA 5IVPA 1ABBA 3NCHA 1F3LA 1SHLA 3G02A 4EQ6A 3A6DA 2NXNA 4BAUA 2NTYC 3B3GA 3D64A 3STWA 2JHPA 4YLGA 4YMIA 1YF3A 5LOVF 4DLPA 3EC1A 2BYTA 5AOVA 2FWPA 5AKEA 4V1CA 4KSBA 5CFLA 4LCBA 3PJRA 3WA6A 5AVVA 5A9RA 2DTDA 4E03A 3X2SA 4L72A 4O4IB 3RSZA 3HGMA 1FSPA 4EW3A 4Z4QA 2P78A 2IW3A 5IEBA 1V5EA 4PZPA 4RWEA 5DJ5A 4GL4A 1NKSA 4CWAA 3RWOA 1TTQB 2XPCA 5ELXA 4K8OA 2YV4A 5BW5A 4R05A 5DBIA 3U31A 2Q6LA 4P1ZA 1C30A 5A5VA 3W8DA 4PZZA 5BRJA 1KBOA 1G3RA 1RXIA 3OIUA 4US1R 2FG6C 4F85A 2XT0A 4ZZIA 5HXAA 2RHJA 4QU0A 5ILQA 4B85A 5FA8A 1TNDA 1CIJA 4HDNB 1PUIA 3FBWA 4B6OA 4OFZA 2I34A 2BJVA 3NDPA 2XIQA 1T3TA 4CUZA 3D5EA 4F3CA 3S1SA 3KQHA 1JLLA 2HWYA 2IEYA 3SSMA 4Q4HA 3UHOA 1LXCA 3FROA 4CEJB 3CW8X 3KZKA 3MCTA 1LBIA 4RW0A 5H0IA 1TM1E 4E1VA 4ZJPA 5JYBA 2Z2YA 4CIVA 3F9IA 1EVZA 1JHPA 1PFQA 1SKBA 4P7KA 3STXA 3NDJA 3OM0A 4GVXA 4JYBA 3N07A 2IGBA 3WRWA 5JRDS 3TRIA 5T4BA 1EB8A 3AVOA 3KPJA 4JEMA 4QUKA 4X54A 3UCEA 3W4JA 1DS6A 1AGNA 1NW8A 5A7HA 5BWOA 5AVYA 4U2BA 1AZLA 4UEJA 3Q7IA 2VHVA 4M7PA 4O1MA 5CGZA 4N6GA 4EMTA 3ROPA 3G0BA 3H2YA 1BWQA 3GLHA 2VDWA 1ZEMA 3DWFA 3S55A 1OLXA 2G8NA 4CR7A 3L1KA 1PU2A 3GELA 3IMEA 4ZAZA 3W5SA 2IEBA 4E2WA 1E20A 5DM60 5GJCA 1K6EA 2ONYA 4FUTA 3F78A 2M6LA 4FOTA 1Z29A 4EPTA 1T9KA 5CT4A 1XCGB 3T54A 1MW9X 1TJYA 4LRYA 2CY0A 4V02A 4D4KA 2IIBA 4P22A 5JD5A 3C7DB 3SMQA 2HCBA 3RARA 3BE6A 5BYKA 3WC4A 1ODKA 1U8XX 3LCMA 2NPFA 5EJ6A 1L4LA 4BTVA 5EP2A 1WJGA 1UWVA 3CLHA 1EP9A 1TA9A 3C16C 4DE5A 5B58C 3NT2A 1TEZA 3M49A 1BVRA 3L6UA 4BLSA 2JCBA 2EKLA 5KOHB 1CEYA 3C39A 4FC7A 1DBWA 1M83A 1Q0PA 1SVWA 2RG7A 2HA5A 1M2OB 2VHZA 3ADOA 4RHFA 5CT5A 1RYYA 3RJ9A 4L74A 5FOQA 1CRLA 4N3AA 3E15A 1ZQ9A 4BDTA 4JI0B 4J3NA 3GT7A 5CEFA 1W4ZA 1T5TA 2ZB8A 5BW6B 1KEZA 5CXUA 2FRDA 3JYPA 2ZAGA 1SU4A 1AKUA 1MIOA 1TADA 3F97A 1X7WB 3LTEA 3LKBA 4CDMA 2LE0A 1U0HC 1D8AA 1P7VA 3QA3E 3TNDA 2PUCA 4JKYA 5HGXA 2HF8A 2I3AA 3AEZA 4QSHA 1Z25A 1ZOLA 5L8VA 2XKBA 4WZBE 3ASVA 1AQJA 5CDGA 2ANBA 2EJTA 4QT0A 1JHVA 2GZRA 1KKUA 3GRRA 3HDHA 4WGFA 4KKVA 1W30A 4KXXA 1C9NA 4R2LA 4YRZA 2K5UA 4WERA 4KYVA 5A9SA 2H2AA 3H2GA 3ZCVA 4PLYA 3AJEA 3ANXA 3NQ41 2JFOA 1KP3A 1ZOIA 3L7DA 3RTBA 2QX9A 2M32A 3NOQA 2UYGA 5B3JC 3SXUB 1RWVA 3IAM6 1HE4A 1XIVA 4J75A 1FP4A 4G4GA 2IOQA 2G9UA 2H08A 3O73A 1QLJA 4B84A 4IGKA 4AP6A 3VHRA 5KINB 1LK5A 2X4DA 1A8PA 7ABPA 1WVIA 4IVQA 4IOJA 1P4GA 5TF0A 3S1LA 4BYMA 3MTJA 4K7JA 3S44A 2XGJA 1FF9A 1UM9A 3DZHA 2Q6KA 2CLSA 4GX1A 1SCNE 4WLFA 4I99A 3JZMA 3ORHA 4FFBA 2ETVA 4ZQBA 5JMWA 2IE8A 2BFCA 4EUHA 3I2YX 5CFQA 3FAZA 4ZAYA 2OGSA 3ICPA 3HSYA 1TGVA 6ABPA 4DHEA 1G8YA 4RE5A 1GJRA 2DHRA 2HHJA 2OBXA 1ADCA 1R2QA 4INZA 5FD8A 4EHDA 2IYRA 2PUDA 2Q46A 1NQUA 3DEZA 5ALZA 1W0JA 5A1JA 1O0SA 5KU7A 1U0BB 2CDCA 4JLKA 3ROZA 1L7NA 2E5LB 2FPLA 3U48A 3PR1A 1C0PA 2QAGB 1N2ZA 5D8DA 1QYRA 4CKCA 1EX1A 4F97A 1QR6A 3COSA 2Q5HA 5CX1A 3FE2A 1X2BA 4U1RA 3ZG6A 1Y7IA 4PLPA 3TQHA 3ZXYA 5G0WA 3PQFA 5E9QA 2FB9A 4CGYA 1ZA1A 1MEOA 3T9DA 1Q92A 1UBNA 2HCRA 1NC1A 4TMWA 1B4DA 1V16A 4B6QA 4QJBA 3WGTA 1DC3A 1CS0B 4E22A 1NVGA 3PYLA 1MOSA 4RVUA 2X0FA 3EK2A 4WFKA 3WB0A 1ZN7A 2IU3A 1N8TA 3PUKA 2FZEA 3ZCTA 1LGYA 2OXIA 3ZIAA 4C7OB 3UUGA 2ZU6A 1GZUA 3PD1A 4ES6A 2EEPA 3DT6A 1JFSA 4LRUA 1T6ZA 3J7TA 3H5LA 4LQLA 1RZUA 4I2VA 1EX9A 1WG8A 2QU7A 2UZAA 3HNRA 4FN5A 5B1IA 1PUJA 2WB2A 3GJQA 4P4LA 4RFSA 2Y4OA 5LMCA 2KJQA 1NLYA 2HFJA 4H17A 1YR2A 2POQX 5HHTA 2W2QA 1IHXA 3MHTA 1JFTA 3GDFA 1ZJWA 3LBFA 2B2CA 2W6JD 1DINA 4FU0A 2PO7A 3FTDA 1XVAA 4WCFA 5E4FA 1Z2AA 3S27A 1M10A 1ZXXA 2YYYA 3RG8A 5JG7A 2AX4A 2EP7A 1RW4A 3WY9A 4RDHA 2QVCA 1EGAA 3UGQA 1U3FA 2B7BA 4CEHA 4KK4A 2JAHA 2J45A 3BGSA 2WNIA 4FIDA 3FZNA 2JDID 5DRYA 5HFAA 5CB4B 2FR0A 4FMCB 4WKNA 4TRRA 2WYWA 5EUMA 521PA 4FDMA 2G25A 1XX6A 1XZJA 2NO1A 3EBPA 4ZO4A 1J33A 4GKBA 3AF6A 1MC4A 2WFLA 2X2EA 2QNRA 3ZLBA 1EVIA 1HDOA 1IQUA 1VCMA 1PGNA 4LZJA 3SKVA 2NUPA 2CCKA 4M54A 1QGDA 3ETDA 1XRNA 3KXIA 4D8XA 3UJHA 3IMFA 1Z2CA 4O8CA 5GJWC 1CYEA 3WYDA 4F2DA 3QV1A 2ZP1A 1C3OA 1JB1A 4DIBA 3G68A 4JIMA 1A7KA 4HGOA 2X1HA 1G6KA 2VTDA 1CUJA 5U9CA 2GPBA 5FUQA 3NBXX 3FLBA 3VXKA 2DCMA 4KBFA 3U5ZB 4V3CA 4BO4A 4BUJA 5C37A 4DV5B 3AVTA 3K70D 4D3YA 3A4NA 1JSCA 4AS1A 2R1VA 5EHXA 3R9XB 2POCA 2ZTVA 4IIBA 5H16A 1E1MA 1T2FA 3HKEB 5AJXA 3DZKA 3UB4A 4V0SA 3ETEA 5AM2A 3SZUA 1DBPA 3F6RA 5K0JA 5LN1A 4ENTA 1BDMA 1JN0A 2QPTA 2IH4A 2BFEB 3JQGB 4RVNA 4AWBA 1BMFA 2I6SA 4AMVA 1W5FA 2VT2A 3W04A 4MICA 2D5LA 4R5MA 4C4SA 2FP3A 2NX2A 2Q07A 4DNXA 5FLKA 2ZU0C 1WSBA 3CVJA 3WIUA 3F3MA 3UFXB 1U9YA 1T1GA 2EKDA 4PGFA 3AY0A 4L73A 5C5EA 1RLMA 2E4WA 4LVUA 4AG6A 2AW5A 3HO1A 3TM5A 1DADA 1DEKA 3E9RA 4KAJA 1WAMA 3DZGA 2WHPA 2CVQA 1ZU4A 5HF5A 3KSBC 2HA6A 3I01M 1E9BA 2FUG1 1Q0LA 1WF3A 2TRSB 3GYBA 3IT3A 4NZMA 3SLRA 4ALIA 1FJGB 1IN6A 4GGOA 4OQPA 4Q9DA 1GUBA 1YS6A 3WK8A 1V8ZA 1Z5VA 4JLSA 5DSZA 2NVWA 1PJ8A 1P0CA 1SUWA 3C98A 3OE7A 4URVR 3WO1A 3HJTA 4D92A 1U4NA 1NURA 1OXTA 5LP6A 1CWUA 3TQCA 2B4QA 1AO0A 1WBBA 2VZ0A 3ZV4A 5E7JA 1W7AA 3MWKA 1TM5E 1HQCA 1KYZA 2ONCA 3ICVA 5JY1A 2B9VA 4DV6B 4C5CA 2IZ1A 1DO2A 3SX2A 1REQB 2HSEA 4LK2A 2XZTA 4MS4B 4OBEA 6ADHA 1TAQA 5AI4A 4A73A 2C61A 3AOEC 4FYMA 4TLAA 5C5CA 3R3SA 1WKCA 2CJWB 2ZR8A 3CF0A 4C2TA 1JEEA 2BZ0A 3RK1A 3DC2A 3DF7A 4CEIB 4O8ZA 4B7AA 4PPFA 5L95A 3ND5A 3IP8A 3PVCA 3K0KA 4WWHA 5A4FS 5I5GA 1G6HA 1MT3A 1RPTA 1T5IA 4I1RA 3DOEA 4RMNA 2DFKB 2JASA 1IHOA 3F3YA 4OIMA 5K9ZA 2JIOA 2PXHA 4CM6A 1V6AA 3B1XA 3PHHA 3OEED 1ZCAA 2VUIB 3A4MA 3H87A 2C5SA 3LYUA 1ZAYA 2JCYA 1PS0A 4DNQA 5AW1A 5JBNA 3MJ4A 4JC4A 3TAHA 3O8NA 3X44A 3QWBA 4GDMA 4YTEA 5AKGA 3IKTA 1J99A 4P5PA 2W9XA 1E89A 4A9AA 3E1SA 4J2HA 4I3HA 3EPJA 1B6TA 3KJHA 4D0SA 5JMTA 3QK7A 2QG9A 2XIJA 4MDHA 4GBED 4Y7DA 4TWBA 1LZLA 1QHIA 1GNQA 1OXXK 1W2GA 2RHOA 3TDNA 3H0EA 5LPNA 2ACVA 4HUQB 5CAEB 3PQ4A 2RKOA 4D4JA 1CFJA 3K6SA 3M1LA 4LYHA 1Z73A 4JB2A 4WZAA 5UKDA 3TGPA 3OIWA 3FCUB 2YJTD 4X92A 4YRIA 5BSKA 4TWJA 1MAVA 5TVGA 2OESA 3GLGE 4M0LA 1CUXA 1XJ0A 1S8AA 2ON6A 2I4NA 2YOGA 1TZBA 3UAGA 2P6MA 3F6PA 4LKRA 4DLXA 1QZTA 2BAGA 1BCRA 3FCEA 4MTCA 2YCBA 1OT3A 4YK7A 3UVEA 2GXQA 5CLJA 2XDQA 5EMLA 2PU5A 4BV8A 4YAGA 4JZYA 3PGMA 3R9IA 1XMSA 1H2YA 5TARA 3DBHA 4J4TA 2PKRA 1G5HA 3DD5A 5BN5A 2H9YA 1T9GR 5EG5A 3NP7A 1A9XB 4CBVA 3BGDA 4B46A 3NH6A 1YCGA 1O95D 3SDZA 3GLQA 1JG6A 1I3NA 1Z7GA 1W5TA 4FMDB 4B3IA 1XD8A 4DMCA 3T5MA 2B8TA 3W6OA 3H8WA 1SUIA 3GVIA 1VBMA 1I6WA 1Q0QA 5JDCC 3K9HA 5FJIA 1HG1A 1XCBA 1E6LA 5CPBA 1CUVA 1XXHE 1Y4ZA 5MHTA 1P18A 4X41A 3ICCA 1O94D 4IDBA 3BUSA 1X86B 1PDVA 3ZNPA 3LBHA 3N39C 3T3HA 1D2RA 1EM8B 4ENRA 4Z2YA 1UAYA 4JJKA 3G0HA 3ZJTA 1SC1A 1SC6A 2KYRA 2N0SA 4PCLA 3EZ2A 4YGYA 5C1PA 2VSQA 1Q7TA 3G9QA 1WCIB 4I50A 4XLZA 2HQBA 3WBKA 5J9FA 3WMEA 2W43A 4DMRA 3LUJA 3ROTA 1GNPA 1R8SA 1D07A 4MW1A 3UJ9A 5DNVA 4NDAA 3RASA 5EQTA 3ENQA 4GX2A 4D2IA 2VBFA 1HLGA 3ADKA 4NOLA 3ZU6A 4PYJA 2X0DA 1CDOA 1Z68A 2P6UA 2WJGA 1NNLA 2O52A 2P0EA 1VDMA 3LQ4A 3REGA 4MUIA 3LPNA 5MDHA 4C2AA 4QTYA 2G1PA 1ILWA 4D9MA 1PT9A 1JG4A 3OCXA 3RC2A 5LQDA 2O0HA 1T9DA 2OV4A 3EUFA 5FBHA 4BB9A 1EGMB 3C5VA 3TDKA 3ILYA 3OZXA 3QLUA 2YWBA 4HKTA 3L07A 2FQXA 2MYUA 2I3GA 4TL8A 5GINE 1FXUA 2Q6IA 2V55B 2P79A 3WKBA 3RUEA 3W1VA 2Q0XA 4JS0A 3TN7A 4BGVA 2OV3A 4BO8A 4GRAA 4EUNA 4LF4B 2OQIA 3AZPA 1C7FA 2IODA 1F38A 1IDN1 3NOVA 3W1EA 2WEKA 2ZAYA 4JLDA 2OV8A 4BDSA 1NVUQ 1FPMA 1N2OA 4RADA 2RGNC 2V7VA 4ZU1X 3ZTWA 1GKYA 1FRNA 4FS3A 5K0TA 4J1TC 2OO3A 1WXQA 2NYUA 2GZSA 1AT1A 2OV2A 1G8HA 3H4VA 4GP7A 4DMFA 2I1VB 3Q8MA 3JSAA 2NM0A 2CF6A 4TVSA 4F9FA 3SEFA 1GKLA 3R7WB 3SC2A 4CMKA 2F3QA 3E1KA 3NM5A 4PZUA 3RT7A 3UGJA 2VQDA 5B1YA 3L4BC 1ZR4A 3RTGA 5CFRA 2ZJ5A 1PGOA 2WP0A 2XTJA 2V59A 3QF4A 3GBVA 1JQAA 1E7MA 1XU4A 1KFBB 2YDXA 4NZYA 3R6GA 3RDPA 4JGBA 1KMCA 2Q8PA 4B2PA 1ZFNA 3ZEAA 5JRJA 1CY2A 1NSFA 2XXAB 3ZTTA 1NOIA 1YZLA 5JISA 2VUTA 1R6AA 2BFAA 1MU0A 3HVKA 1TIPA 5EC8A 3GJXC 4BZWA 4GVLA 3UMBA 4L7VA 3WFZA 5I9MA 1A2KC 3EUWA 4I4IA 1B26A 2V7QA 2EZ4A 2WZQA 3BMQB 3GEGA 5COAA 3WHIA 1SWWA 4C88A 1JIKA 3GNQA 2P9GA 1FSZA 3R1IA 1HT1E 2HJRA 2RK6A 1P4RA 2WWFA 3AM5A 3GWZA 2C2BA 4PAWA 1NJ1A 5AKZA 5J2TA 3CN9A 4NESA 2HMTA 3UXHA 3TCXB 4CR8A 4HMPA 1K8RA 4OJYA 3WL8A 1QUFA 4EX6A 1P2VA 3CX3A 4B2IA 1J0AA 2FW0A 2WTNA 2X6RA 1CR2A 3RYFB 2D0OB 4HGYA 3LP5A 3KLOA 4R98A 4EY8A 3V4ZA 4A1FA 1V9SA 5ABPA 3C3PA 4QECA 3QJGA 3I5MA 4EDHA 1Y4AE 4MQUA 5FAXA 4CM9A 3GEIA 1RQ7A 3M5WA 1CX9B 2ZI4A 3IVRA 3P2EA 4KRGA 6PFKA 3B9RA 1FFXA 3MLBA 5BQ5A 1E9DA 2PX8A 4DCUA 5K3DA 2IYXA 1R8JA 4JY7A 4MULA 4QPCA 4TMZA 2JGDB 4HUTA 1PZEA 1R0LA 2P77A 4BMDA 5KAMA 4QUIA 3IT1A 4ZAWA 1CUYA 1YJ5A 2XH8A 1TIBA 3BYZA 3D02A 4I1VA 5KC9A 4P5EA 2F55A 2PWBA 1TXGA 1L7MA 4U0JA 1N2CB 1PFKA 3CGWA 5B3AA 2YXBA 2F00A 3QMVA 2J59A 3PEVA 4KE6A 3RANA 3TL3A 3A6ZA 3VH2A 2XGSA 1X14A 4N76A 4QQ8A 8ABPA 4J49A 3NHMA 4EUEA 5HCNA 3VH3A 2IK8A 1DG1G 2Z4TA 2GBIA 2QUBA 4E2FA 5IDWA 1WV1A 4WXMA 1J9ZA 3I9LA 3PYMA 2NO7A 1YE3A 3P71T 1YC5A 3WK6A 3K53A 2C96A 4XTRA 1JE0A 2VRCD 3D8SA 1L5VA 2I8AA 2ZVDA 1VC2A 2EW8A 4KXYA 4AZ3B 2P9ZA 4RVFA 2YXDA 3ZHRA 2GJ9A 1PWEA 1NQAO 1Z2DA 1X1TA 4LJLA 2ZRGA 4PXAA 3RFFA 5FO1A 3RVRA 3DFZA 3TLAA 2X23A 4ZC8A 4OHPA 2AUTA 4RM3A 4A8HA 3EYAA 5HIJA 3JAKA 2P1RA 4MVJH 4B0PA 4EZEA 2IBMA 4KXMA 3ABZA 1L8AA 2O8EA 1OZGA 2C9ZA 2WWIA 1PV2A 1NOJA 4NJOA 4PLFA 4X90A 1YK0A 3UK2A 1BXRB 3U44B 2I7TA 3JQ7B 1KDOA 4C7MA 2ZUUA 3KJQA