5C34B

Constitutively active sin recombinase cataltyic domain - i100t/q115r
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
124
structure length
115
Chain Sequence
MIIGYARVSSLDQNLERQLENLKTFGAEKIFTEKPILQKALNFVEMGDRFIVESIDRLGRNYNEVIHTVNYLKDKEVQLMITSLPMMNEVTGNPLLDKFMKDLIIRILAMVSEQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative transposon Tn552 DNA-invertase bin3
publication title Snapshots of a molecular swivel in action
doi rcsb
source organism Staphylococcus aureus
molecule tags Dna binding protein
total genus 33
structure length 115
sequence length 124
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5c34B00
3GUVA 2RSLA 2GM4A 1HX7A 1ZR2A 2GM5A 1GHTA 3LHKA 5C34B 5C35A 4BQQA 3G13A 5C32A 1ZR4A 2R0QC 3BVPA 5C31A 3ILXA 3UJ3X 1GDTA 3LHFA 2MHCA 3PKZA
chains in the Genus database with same CATH superfamily
1XNGA 1XZNA 5AXCA 5C81A 1EXWA 3FUUA 4DUYB 4ZMSA 2HT6A 4XSGA 2QU7A 2BFDB 3C8UA 4XUCA 2CVPA 1SHJA 3NU1A 4NZYA 3W2HA 1EUQA 4MR7A 3O3MB 2GPYA 5EUBA 4C7KA 1M2HA 1U1IA 3QLUC 4ZU6X 4TLCA 5E38A 1PF7E 3TUJC 3V32A 3X1DA 5D8DA 1KP9A 4AROA 4CKCB 4YJGA 5FPKA 1ZR4A 2WHPA 3NVMB 4C0WA 2GZRA 1GKKA 4MAAA 1EG7A 1F3OA 3BVPA 3T3OA 1BZYA 5E1BA 1FUEA 1OZGA 4L1KA 5AHWA 2I8AA 1VLQA 2PSHA 4LX8A 4CF7A 1KYIA 4RBNA 1WP9A 1CQIA 2X8AA 5I45A 4UEOA 2XLBA 4EKIA 5JSZB 4J8PA 2HO4A 4JS0A 1IXKA 3D8HA 1I8TA 3C14C 2GA8A 4P53A 4L5YA 3SNHA 5IT5A 2D1QA 3K9BA 4FUTA 5HWSA 2I0FA 1K9VF 1YZLA 4A5OA 3EC7A 4NY1A 4YAGA 2RB4A 1CDEA 2HSEA 1DUVG 3JALA 1ZVJA 3H9JA 3JWHA 4PLVA 5JD4A 4UD2A 1ZJ4A 1Z63A 4N65A 1S96A 3OJOA 3PNQA 4N8SA 4CCYA 3A37A 1AHIA 1BN7A 1PJAA 2QNRA 4KDRA 2W58A 4YTEA 5IAEA 4ZAXA 1NRWA 4D96A 3FJYA 5K45A 3P0JA 3IDSA 1GG2A 3DW3X 3OZRA 2I6FA 2GUGA 3H4TA 1HDIA 1M7HA 4ZV9A 1AGRA 5J47A 3TZ6A 3GFPA 3AF5A 4L4ZA 3NIDB 5U4QA 4FS8A 4AZSA 4K6KA 3NUQA 3QJ5A 4ERXA 1GCGA 3UJDA 2I03A 2QS9A 4YYEA 5I7WA 5LN1A 9MHTA 4IQ8A 1T4CB 2VHWA 2K87A 2PX0A 3GFFA 4UOEA 5EIBD 5C4IA 3G2HA 2IUUA 3IP5A 3ZW9A 1WCYA 4JJZA 1P4AA 1GU1A 4B4WA 3C97A 5TEVA 3D7KA 3GYGA 5LQAA 3B9BA 2GEBA 2GSDA 4QM6A 3VR2D 3FYUC 1YHNA 2OZLB 4ZGGA 1OLUA 3G59A 4RHTA 2J0EA 3E81A 3OOSA 4CG1A 3OQIB 3RAEC 1NWHA 1G2OA 1YDFA 2CHEA 2FR1A 2V6BA 3EXHC 3KYCB 4R2LA 1ZZGA 4YFVA 5J58A 5K09A 2B98A 1T1SA 3ZHVA 3ZDYB 1M5TA 2WA2A 7MDHA 4YEDA 5KOJA 2GEKA 2KWIA 3N39C 4DNOA 1WD7A 3RUDA 3BULA 1J5EB 4G0VA 2WYOA 1Z3CA 4GF5A 4GGOA 4FGSA 1E61A 3TLAA 5JANA 4N0MA 2FFRA 5SZKB 2ISCA 2RONA 5DYTA 1OJ7A 1G55A 3ESAA 4R7GA 4F5YA 3JQ8A 3KLBA 4Z0TA 2G8NA 1C0LA 3DO5A 2V4ZA 4JLDA 2WJWA 4OI0A 4K46A 1CLUA 2ISSD 2IT1A 3ZXYA 4EJMA 3ZD9A 1GUZA 4QUAA 3DTVA 3TAHA 4BO4A 4KBYA 1T3GA 3ITNA 3RJMA 2XDQB 4FBLA 1VPDA 3MOGA 3SZRA 4EB3A 4DW8A 4LYGA 3K32A 1FTYA 3TIVA 4PXYA 1CR2A 3PRHA 4F5ZA 5HX7A 1TD1A 3LZDA 1M2NA 2EW2A 3EVFA 4E7OA 1TJNA 3G0HA 1NHGA 3LHFA 2F67A 3Q1KA 3RUAA 3T3PB 1AXEA 1Y1PA 1GNVA 3ZTYA 4R83A 5LKRA 3HJGA 2H1SA 4XJTA 1I4DD 4BNGA 2BFWA 5BWNA 1P2BA 5AI8A 1C1XB 4UREA 1L5KA 3L4JA 3CEMA 3RIYA 2I6SA 1EHIA 1O77A 2WSMA 3C87A 3HDJA 4Q4HA 4UM5A 1K8ZB 5EUMA 1DKQA 1VE5A 2B5VA 1ZD2P 3BZUA 4YAJA 1N3IA 5GAJA 2DFKB 3UK1A 2QZPA 3LNCA 5EIBC 1UJNA 2GILA 2QTHA 4PG8A 5IJAA 5AVSA 1P4SA 1CXZA 3E3OA 4P82A 1PGPA 1C4OA 2DBVO 2D4AA 3KL4A 4P22A 4R98A 4BU0A 2CL7X 4EGAA 4DV6B 4B6RA 1EFKA 1TRHA 3UOGA 2PXXA 2N3ZA 3DL7A 4KXQA 4FN5A 1UWCA 3AHGA 1UIRA 2POQX 2Y6UA 4H17A 3I45A 4RZSA 5D86A 2XCUA 1GRVA 2VF7A 3QTTA 4IJMA 2OYCA 3DNMA 4ZANA 3ULKA 1E18A 1D4FA 3LHDA 5BUZA 4PQGA 5CK4A 1CETA 4PPNA 3T7RA 1TCAA 4UW9A 3ET4A 4J2TA 4LQCA 3USZA 2FX2A 2XB8A 1FJHA 4IEFB 3HYRA 1F2TA 16PKA 2JJQA 2O0JA 4G5GA 1FTQA 4NK4A 4WCFC 1WDLA 4XWOA 2E87A 4EECA 2O48X 4MYSA 4RX1A 2YQ5A 3H2JA 2YRFA 1ZK3A 2FRDC 3MG9A 1QYWA 2QVZX 2QE7D 4RZQA 4Q4LA 1M2VB 3UA4A 3I9KA 3TKYA 5JJ5A 1NVWQ 3D6JA 3WLFA 3KT6A 2V3WA 3OKFA 1U8UA 2HK9A 3HPQA 1WMBA 3A1FA 2FEOA 1PVOA 3EIXA 3NJ4A 4JL8A 4UU0A 3CT4A 2WZBA 4PX5A 4DCGA 5C5CA 2FJUA 3N75A 1RLOA 3KOYA 2DAPA 4FR5A 4RFVA 2HIMA 3SLKA 1O6ZA 3D4LA 3VPFA 5E1OA 5KNCH 2RGRA 1UWVA 2V3VA 1GNLA 2NNWB 4EG1A 4KHPB 1YJXA 2V59A 3D4NA 3PHHA 3K9HA 1WUHS 5TGDA 3U3RA 3JAKA 5IHPA 3RWMB 3GGJA 4MQFB 1FJ2A 2D3TA 2FEPA 2WU0A 3NVAA 3T3DA 1LBEA 1WKBA 1JQEA 1W0CA 4I1SA 3ZPXA 2Y1EA 3AKZA 4E1BA 4RV5A 3IT2A 3UT5B 3ZJ4A 3GN2A 5K3AA 2BFPA 2PUJA 2WICA 1K5PA 4MA4A 2Y1FA 1AKNA 3O7WA 4FEYA 1R0WA 3BB1A 1K7FB 4PSKA 5TPZD 3LC1O 1AB5A 2ZI9A 3G8AA 4DDTA 3DVQX 4PO9A 2IL1A 1VLJA 4PAQA 4EY3A 4ZDKA 2IYTA 2DPGA 1UAYA 2FQQA 4MTCA 4OMDA 1W5FA 4LG1A 4FCWA 3ADPA 1N57A 5REQA 1VLMA 1JP7A 2O06A 1HT0A 2WF8A 2QY6A 5BYJA 1RHMA 4HFMA 4PYKA 2XNJA 1ZOLA 3F6BX 3HN6A 1R3UA 3NV7A 2A92A 4RY2A 4WZBE 5BNWA 1C7IA 1TMGE 1JR6A 2Q5LA 4F3YA 5HJ7A 2I67A 4R1PA 1XCMA 4CKCA 3T15A 3HN7A 4KH1A 5EZQA 1N6LA 2ZJYA 5JR3A 3QF4A 1T25A 3H1TA 4ZJYA 3DUWA 2CXRA 2HH9A 3RC8A 2Z8YM 3I2JA 2BM8A 4PLCA 2YHAA 5KYXA 1RAEA 5IF9A 4IFEA 1KQGA 3BAFA 1VHDA 5DBHX 1CV2A 3ZLVA 1NMEA 1FX0A 1NNI1 1VPWA 5FHQA 1YU9A 1Y80A 4DL9A 1XD2A 1FMCA 1FRZA 2BMFA 5L95A 4PG7A 4S1NA 1A69A 1J1ZA 4NG5A 4GPIB 4REQA 1X39A 3LV8A 5D1HA 5G0UA 5TSDA 4NNOA 5DCLA 1PEYA 2HMUA 1FYEA 3LWNA 4Z9FA 1NUQA 4DDUA 2CSXA 3HFJA 1RE1A 3LKVA 1O87A 2LR0A 2IC5A 2LW7A 5GJVC 4QPNA 2HHLA 3I72A 4K6CA 2XD9A 3UBMA 4EPTA 3LKDA 5H1YA 3ZBPA 2SCUA 2HRZA 2NYAA 2D5AA 2VCHA 3SSOA 1V11B 1XJ5A 2BP7B 3QELB 5KUTA 2J5QA 1AV6A 1Z8DA 4RGYA 4OXQA 5BWMA 3TZLA 4BXOB 2GJ4A 3NTLA 1EBFA 2TMKA 4RD6A 3KLPX 3W2GA 4KQCA 1XDGA 2Q7OE 4DFDA 5HGJA 4LVCA 1NQTA 1Y5NA 4C7JA 2SICE 4IX1A 5F9HA 2EP5A 3GEMA 3HA7A 4UU7A 2FMFA 5LLSA 3UYLA 3BXXA 3AHIA 2Q99A 1WEHA 1B6GA 5LBUA 2GRAA 2DULA 1N5RA 5FBKA 3RVNA 5EJIA 4I50A 3W5UA 5DGDA 3NBZC 1QV7A 1SQSA 3NJ8A 1KZ4A 5IBPA 3NIGB 3C6MA 1J2YA 3T7EA 4I4CA 3UAZA 4MUAA 1KS9A 4O5OA 4ZVTA 4DIDA 4RVHA 2PZKA 2XUKA 1GLGA 5AJTA 1II8B 1UKCA 3HL4A 4N54A 2A0KA 1ZCZA 2V4MA 3QPVA 4BFTA 4ESOA 2CE2X 3JVUA 2QUZA 2HT1A 4UHHA 2VP9A 3OP4A 1I33A 4BO7A 4ESHA 4YRGA 4HQ0A 5JLJA 3EGIA 2HZ7A 5C18A 1ODFA 3GPDG 3E2PA 2H2HA 2CCKA 3N74A 3R0JA 3AIMA 4WFJA 3WSVA 1H22A 1NL3A 1LCIA 1VECA 4U7FA 1DWPA 2C92A 2HCFA 3H4IA 1W5SA 3B9QA 4YACA 3WMRA 3VKVA 1U6IA 1TPYA 1VBFA 2R1VB 3LO5A 4DDVA 3H0CA 1MH1A 2WLTA 2C99A 1WXFA 5FA6A 1UH5A 4LRSB 2RIRA 1GGKA 3JD2A 3O9VA 1U2PA 1LPNA 4IIFA 4BZPA 5F21A 3HKBB 1G38A 1XG5A 4GZMA 3DBIA 3NHUA 3OG9A 4DWVA 3RSFA 1TUIA 2AC7A 2JAQA 1JU3A 1AVTA 4BO9A 1DEHA 3RYIB 4YV1A 4Y2TA 2Z6QA 1YQEA 1LLCA 4TKUA 3UHFA 4N8DA 1OREA 3DMTA 3L1UA 2XX3A 3BQNB 1L5NA 2JGDB 4C43A 4Q4JB 5B55A 1LH0A 2CC2A 3FKSD 3S2FA 3DTYA 5JYBA 8ATCA 1J25A 1URPA 1N4AA 4Y1GA 3E18A 2L82A 4X97A 1A7AA 5BYBA 2P9CA 3ZN2A 3U5TA 1HFEL 5AVRA 5K2OA 3KKKA 1D1TA 1HXHA 3MQ4A 3SNKA 1Y6QA 4U7TB 5T5QA 1O9HA 1D2HA 1I2BA 3I6QA 1K5GA 4WXRA 1ZU4A 4B7UA 3C3WA 1K1EA 1Q6YA 1XTRA 1YCHA 3H1AA 4KWIA 4L28A 5H70A 4NDAA 4D9EA 4DCSA 3S1SA 3CSDA 3F4BA 2ZRDA 2NUPB 1Y3BE 2QSJA 2W4MA 1TQ6A 3DP9A 2YNMD 5BQOA 2XODA 1DZ3A 3Q40A 2FQ1A 4BN5A 4IIUA 3ZLUA 3NVDA 4PWZA 4QEDA 2OKCA 3I05A 3EXG1 1T2NA 4PLHA 2IZ0A 4QXQA 2VH5R 3FBTA 3I6MA 1T2CA 1ULSA 4XUGB 4YRPA 5DHAA 1CNFA 2ON6A 1PGOA 5FV7A 4Z1MA 1WM1A 4HO1X 1SXJC 3H6HA 2A0WA 3N0WA 3PLRA 2OD9A 2P2LA 2QENA 2BKVA 2IXFA 3BXGA 4AIRA 1JFRA 3FIJA 4HNSA 4I8XA 3UB4A 1ZAKA 3W6PA 1OH8A 1XZPA 1TZBA 5FLEX 3WV4A 4PRKA 2R1ZA 2RGGA 4Q9JA 4DANA 1E9DA 2XZLA 2IH5A 1K7EB 1Y1SA 1IK4A 3PYLA 4HX9A 3TE7A 3RGGA 3E4DA 3GNTA 4IH4A 4ND7A 3IAAA 1M54A 2IYSA 1U2QA 4M1MA 1IMJA 3WZLA 1E6MA 4DLSA 1UK6A 2PYZA 3KT3A 4CM1A 4CQJA 4HDAA 1JKIA 4GI5A 2YOFA 4IV5A 5SZHB 2H7CA 4A4DA 2JAPA 3CNEA 5HCIA 4C9BA 5ED4A 1WDTA 4YO8A 1TNDA 2BT4A 2P2ZA 1XLVA 4DEYA 2VCYA 2ZTUA 3FOCA 3R3SA 4UZEA 4YXWA 1XU4A 4TQAA 5FKJA 4GKJB 4EG5A 4ENWA 3O26A 4PWYA 1B6SA 3L0SA 3OCXA 1A50B 3DB1A 2CB0A 2EFDB 2VA8A 1XKQA 1NLUA 1TL7C 2X77A 2YQZA 3FX2A 3G1TA 4WZZA 2OXIA 4HAZA 5DXFA 3M4NA 4UHDA 4CEJB 3GAMA 1SBZA 3IKMB 2OAGA 3K92A 5L40A 3I9OA 4W7SA 1HSOA 1G8FA 4PCLA 5AM0A 1KO1A 3RVRA 2O20A 1ZLYA 3GDWA 3WHKA 4YDRA 2MR5A 3OLCX 2EQ5A 3QENA 3VO2A 3EDOA 1Z7EA 2NPOA 3BRSA 3D7MA 1MIOB 2AMFA 4D3XA 3HA3A 4QAQA 3RYFB 3JVDA 2R8RA 4RD4A 5AVOA 1NYLA 2YNMC 2G9RA 2JEZA 4QOFA 4MPJA 3PWTA 1KDZA 2OV2A 3ORRA 1MAHA 2XYQA 3FDZA 3MGCA 3O75A 4JEUA 3ZXUB 1MHTA 4QPCA 3TE6A 3GUHA 1EUDB 5AJWA 4ZC1A 1UODA 1TIBA 5DFAA 2VDWA 2JL1A 4DCJA 4NBRA 4FNMA 1EGVB 1PYOA 4Z3KA 2EL7A 2VJYA 2DHCA 3QLJA 4FX5A 3T7TA 1EE9A 2C8LA 1KI1A 3O8QA 1R10A 4DB2A 4DV5B 2ECPA 4FYYA 1IB0A 3ACCA 4A6DA 2PMFA 1FQKA 2W6OA 1SCIA 4KQKA 3K09A 2Y1LA 3HJNA 5FI5A 4MSUA 4BU1A 2IA5A 1DRJA 4C06A 2YKGA 1ZLXA 4MS3B 1B42A 3K0AA 3KOUA 3N58A 4UVIA 4RY0A 5CLJA 1H2RS 1JJFA 5CLIA 4QM7A 4WXPA 3TJRA 5JD3A 2RH5A 3GA0A 3EZ6A 4IRUB 4QJBA 2XKKA 1R27A 3U3ZA 4QATA 1YRAA 2C9CA 5KSOA 3QU4A 1A2OA 1DRWA 1XEWY 5T67A 2NYUA 2G88A 1UFVA 1E7QA 1JHZA 1Q7RA 2OHJA 4TT8A 2QMEA 3EGXA 4YQFA 3I73A 1WZUA 2EZ4A 1Q2UA 1PZGA 1T8WA 2GM5A 2VQ6A 1B43A 2JD1A 2M6SA 1UMCA 3GU3A 2R96A 4N3NA 1J90A 4U6NA 4D9KA 1RHRA 3KG2A 3V34A 4KEAA 1PJBA 1UT6A 1RACA 3V2IA 3W1EA 1R6TA 2Q3JA 2RD2A 5HFJA 2AFIB 4LCBA 3GLSA 1E8MA 1Q2XA 3C6XA 4AMUA 1M7BA 1MC8A 3OHMA 1U0EA 4OI4A 1Q44A 3GZNA 1CRZA 1XTJA 5AM1A 5EC8A 2QVGA 1BEUB 1XYVA 2D8AA 2GGSA 1XRSB 2Q2WA 4KSYA 4J1NA 1RWVA 4P54A 3RKRA 3E7PA 2BGJA 4BWFB 5BV1A 2QMZA 3U1BA 4RTSA 2JFWA 2ZREA 5JQGA 2FPGB 2GJKA 1N2CB 1AKMA 2YUTA 3U26A 1ATZA 1XZAA 2OV4A 3L1KA 2VKQA 3GRYA 5HIMA 2YJ5A 2H4ZA 4CT0A 1JT2A 3L0BA 3DDZX 1NKTA 1QIJA 4RYDA 3SDZA 3L0CA 1OFUA 1XTUA 2XVYA 1T9ZA 4NP6A 2FWPA 3GVCA 1XHLA 3KB1A 1H2WA 2JJ2D 1QGYA 3WE7A 4F3NA 3U49A 2B92A 2FAXA 4MGKR 1UQTA 4J1QA 2IZ5A 4JGIA 4ND4A 5IC4A 3FVWA 5JCZA 3LFHA 1WWKA 2B30A 1XEXA 1H5QA 2QLTA 4OKIA 5COBA 4WNAA 4EHFA 5FWYA 5I7HA 4L22A 5CJPA 1WDMA 3RASA 3OT1B 4Y1FA 1YKGA 4ENTA 5ITSA 2COKA 1RYHA 4OUDA 5DYYA 3DOUA 3QNUA 2PKQO 3GMSA 4HPJB 2IH4A 2ZJOA 4NXMB 3UV3A 2GJ8A 4L8YA 1L5MA 5H4HA 2Z2JA 1NW3A 3QHPA 1SG6A 1EIWA 2P27A 1NX9A 4CGZA 1I5EA 3RC7A 2XEXA 4GP6A 3TW6A 1NBME 1J20A 3W7AA 3NRCA 2AV6A 3QXCA 4YJ2A 4LJ4A 3IVXA 4HOYA 1KRWA 4LF6B 2QR3A 3V97A 1ONBA 2Z9DA 5HFAA 2YMPA 1S8AA 4EZEA 3IP8A 4JXJA 4EZIA 2OMKA 2ODWA 1TECE 5EESA 4WK6A 1L8LA 1T91A 1WMSA 1I4EB 1G5TA 5IVDA 4WBNF 3PQEA 4HH4A 4BV8A 1B8PA 3HKCB 2XNDA 4M7RA 1TYDE 2B8WA 2PSSA 2WJ4A 2R00A 2WJZB 1I3CA 3L49A 3NCTA 1W85A 1EFPA 1TIKA 3DS8A 3PCTA 3HB4X 4V2UA 4AWXA 2ZSJA 3VR5D 3QFSA 4WACA 2CXHA 1CRLA 4R16A 1Z2OX 5J40A 4K9RA 3UZUA 4AMBA 4BZQA 4XUDA 4PFSA 1QG2A 2ORED 1SKMA 2JAUA 4GMHA 4KAFA 4LWZA 1BQ4A 4C0LA 1L7EA 2FI1A 5DTEA 1KTIA 4BQIA 2R68A 3T4UA 3MWYW 1KWKA 4URVR 3H1EA 4FS3A 3S5JA 2VWGA 1FFCA 2VHCA 3G2NA 3JQQA 2Q9UA 2NTNA 4N18A 2AXNA 3WQBA 1QDEA 1QE0A 3I9NA 5DHSA 2YN4A 1E98A 2FPPA 2YYAA 1A27A 1WQ3A 5AXAA 3OP1A 4RXTA 4HRAA 3JQ7B 2AC4A 3VOTA 1U8FO 3KT0A 4V0LA 4X66B 4Q16A 2XBMA 4KXXA 1M0EA 2H1RA 2ONCA 1WAMA 5KINB 5LQDA 3WLRA 5FB3A 2X0FA 4M98A 5AVZA 1BFUA 2P41A 4WNYA 4OX9B 3BMCA 4PQFA 4JB3A 1N3YA 2VXOA 4RJJA 3EAGA 1CZKA 1P73A 1UR5A 3KL2A 4L6IA 4P3XA 5T64A 1TQ2A 5TV2A 3UG7A 2D6FA 2Q7DA 3TVTA 1FZTA 4OQZA 1ZRSA 3V42A 1TAHA 2BZSA 2UVQA 2VAWA 4WBNB 2CSUA 2R6ZA 3MRVA 1D1SA 3QFFA 2VYQA 3HBNA 1O97D 2C2XA 4GZLA 2CXNA 4Q3KA 4L4XA 2J31A 4W5TA 4JLSA 1OLSA 3EPHA 1ND5A 4RDHA 5IP5A 1AMOA 4LVNA 4V1CB 3TRFA 1J7JA 2NIPA 4H4CA 3CNNA 1WXDA 4B74A 2I4LA 2WE7A 2XLCA 3CT6A 5AIBA 4CE6A 3QX3A 1YR3A 3BBPA 1JEAA 2VDVE 2G6BA 4BUCA 3HJHA 5CNIA 3VHXB 3D6VA 3ESQA 4RWEA 1A1SA 2Q8NA 2JIRA 1YB5A 2QE6A 4N82A 1OWNA 4Q39A 3LXRA 5KCZA 1Z0KA 1CR4A 2OFFA 4MI1A 3M1AA 1ZN7A 4R40A 4OAOA 4BUZA 1ZJ5A 1W0JA 1DCTA 3WYGA 1O95C 4MW7A 4BO2A 3PGJA 5ALZA 2OSBA 3ZQJA 5JS6A 1T10A 1UXHA 4DV2B 3ZD7A 3K15A 4FEAA 4DNFA 3G9ZA 5DTIA 3UJ9A 4X3CA 2FEKA 4Y9RA 2D2VA 1IM2A 3AYZB 4ZVKA 1M3SA 1AO3A 4F4DA 1RM4A 2JFQA 1MIHA 1BH6A 4EHIA 3IC5A 3W8EA 4Q9HA 4ADSG 1GARA 5BPFA 5IMBA 1UOOA 2AXQA 2GWHA 3EXEA 3H7AA 4HGNA 4WNCA 1KSJA 4DLYA 4YB8A 4URHA 4CLEA 3U4DA 3K30A 2BFBA 3ESRA 3RGWS 3UUFA 2PAFA 2YVUA 2VP6A 3OCJA 4GMXA 4XDYA 3ROZA 1W9MA 5BR1A 3MLAA 4WERA 4F04A 1XZKA 3LQQA 3E05A 3A4VA 4AFNA 4H6PA 5JUWA 1DDIA 1FK8A 3B48A 1MX5A 3AONB 5ICEA 2WT8A 4Q9IA 3TQHA 1YI0A 2BN4A 3TOVA 1Q57A 3KRTA 3VKHA 2I62A 1CUZA 5KQSA 4E4RA 2XADA 3IJRA 4UDXX 3AYXB 1MD9A 1CC1S 1O97C 4NV0A 3SYTA 1ECLA 4JBIA 1H1LA 5GPBA 1OUMA 1C8BA 1R5OA 3N70A 1P0CA 1A9ZA 4J1TA 5F35A 3U3OA 3NORA 5BW4A 4DM4A 2HMVA 1QQ7A 4KN8A 1AQYA 2P6NA 1U2ZA 4HAYA 3FZNA 4MARA 2VTEA 4OQNA 1YULA 3PPVA 4AP9A 4BBPA 2GO1A 4RGVA 4KOAA 5CG1A 1VLLA 1Z12A 5KYUA 1O5TA 1WL8A 3GFQA 2QWXA 2VZ0A 3BE8A 2XYGA 2ZU6A 3ZQKA 1FRQA 1R0KA 3GJ7A 1IB6A 1PJTA 3GJTA 2DTDA 5CM2Z 2H63A 2R8XA 5JCOC 1NASA 2POCA 3IP9A 4ESVA 3VGPA 1D5WA 4AS1A 5GP1A 5HEKA 2YY7A 1C81A 1BDIA 1ZH6A 1R8JA 3SHTA 1LUAA 2YWHA 4X84A 2Y8EA 3VV2A 4EITA 3BPSA 3SQOA 4GWLA 4IJUA 4AICA 1A9SA 3MRXA 5BOVA 3SC2B 4EG0A 5K7SA 3O47A 4CMKA 1NJGA 1XD8A 2GM9A 3SN6A 2BSAA 3OT5A 1Y4DE 4CQLB 4AK9A 2CWDA 1SFRA 1ZDMA 5FXMA 4CXMA 2H29A 4UC0A 1M2OA 4XB6B 3STHA 5A62A 3IXMA 3OPNA 4HV4A 3A36A 1Z0JA 4XRGA 5CFMA 1L5FA 1PKXA 2ENWA 4GGPA 1Q91A 5KQPA 5KOHB 2NLOA 3AR7A 3FMVA 1VHQA 4R05A 5EJ9A 2JFZA 3SIXA 4TQGA 3ONEA 4CG3A 1YDEA 2CVZA 3VAAA 5DRYA 3AUAA 1B3BA 4OK3A 2XNDD 1P1KA 4TQ9A 3DQQA 3TLXA 2Z3WA 5AK6A 2Y4OA 4LE1A 4WMLA 1TIPA 2GHTA 4YCAA 3EZYA 3TSWA 1JTFA 1N7GA 5LOVF 3NX4A 2G0TA 1AKUA 1NZFA 4B4VA 4WKPA 5A6SA 4Q66C 3WB2A 5JJBA 1T8RA 3KLOA 4TMKA 3HCDA 1SA0B 4J29A 5BQPA 2RAFA 2VPYA 3U60B 2BMJA 2VHUA 1REQA 2YWBA 1G20E 4ES6A 4GBJA 2E5LB 2PX4A 2QZJA 3Q0TA 1FLVA 1XDWA 5G0WA 4KQ1A 1H5UA 5L3QB 4MW4A 2JLYA 2SECE 3A1WA 4O1IA 4O4JA 2V4UA 3P8ZA 2GTHA 2AVDA 2RI0A 2H0RA 1IXRC 4MRPA 3I6BA 4WUVA 1Y6FA 2DBYA 2OB2A 1KO5A 2A0FA 3A14A 1IXZA 2AGVA 2ONZA 1MUUA 1JHMA 3IPXA 3MGKA 3EFEA 3ZWAA 4MRMA 1EDOA 4P3OA 1WHTA 4BPBA 2DECA 2RHJA 1MEJA 3E03A 5LSAA 5MGNA 3GLHA 2FMKA 1W1IA 3L8MA 2UU9B 1PT8A 2OGSA 3RU3A 3ER9A 4DXAA 2ZS8A 3CW9A 2Q62A 2X58A 2CVFA 4PG5A 3STTA 5B7NA 4LFBB 2B2NA 3PB3A 3BA1A 2EZ8A 1T3LA 2KHZA 2IPNA 1UJ4A 1E1NA 5EIFA 4YCDA 1SO8A 3OX1A 3BT7A 2ERYA 2PLFA 3SS7X 1BKYA 1U0NA 1WE2A 3NANA 4J0FA 3W8FA 4DWJA 1XQXA 5BP7A 1HE8B 1CJVC 3L7BA 3O1LA 1IPEA 4TS4A 1JIVA 4ZICA 1RPNA 2OBYA 5CLQA 1KNQA 3PGMA 2DQKA 4GSLA 4Z8YA 4D80A 4HNVA 3ZWPA 3PFIA 4WE3A 2WTBA 4QKQA 1NV8A 4ZN6A 4XAQA 2RKWA 3JVIA 3ETNA 4MJ3A 2H9IA 4HVTA 2JJMA 1PBTA 3FDJA 4ZFNA 5LOVB 5GIPE 1XALA 2R7KA 4MB0A 4EKEA 4XE5A 2W11A 1DMSA 3ZYZA 4RU1A 4M1ZA 3NAMA 4BQSA 5DW0A 1XRMA 1UZMA 2GRJA 4YECA 3BH0A 4F9GA 1C2YA 1ZGCA 5D1NA 3GLGB 1ZOPA 2I4OA 3P4UA 4IDQA 5G1OA 3R7FA 3VQTA 3LUPA 5J1TB 3EFBA 2NW6A 2ASEA 5B2FA 1UJ6A 4ZKDA 2HJWA 1NQVA 3OJLA 2PLNA 3CPJB 2IHTA 2QM8A 5JASA 1NXWA 1TYAE 1SHZA 2GTPA 3CKKA 4RNCA 5AXDA 4CIXA 1GPJA 3PA6A 3V1LA 4E08A 1YJBA 2WK1A 3MJDA 2GZDA 3NUGA 2R3SA 2HQRA 1ZMBA 3TOZA 3V3TA 3LIPA 1Y8CA 1ATIA 1KSHA 1Y7IA 1ZGAA 4K6HA 3DEIA 1MG5A 3FLEA 3K1AB 3WS7A 1CDZA 3ZX4A 3LXXA 3ONDA 4GL4A 1DEKA 1NF2A 1VMDA 1NPDA 1XXHE 1XZFA 3FNQA 3Q4GA 3WRVA 1XK6A 5EE5B 2G3YA 2PGOA 4HZIA 4Z99A 1SCKA 4LE0A 2ZT8A 1EXNA 4D4IA 2ORYA 2GD0A 1PLLA 2RGUA 5B2EA 1VJRA 4PPFA 3LCRA 4Z5XA 3ZG6A 1DT5A 5J2UA 3IHLA 4IMJB 4HWRA 5AJYA 3KWJA 4WAUA 4H7EA 2VZ8A 2G5GX 1XE3A 2RH9B 3A10A 3PDUA 2JZCA 1L3BA 1M8KA 2X3YA 4WZ6A 4K0KB 5G0SA 2M6LA 4H7PA 4YRKA 2JGKA 3PT9A 3RTEA 4B3HA 1U3FA 4K7JA 3NM5A 1K8YB 3DE7X 4PAOA 2B9EA 1P72A 4M54A 4TYQA 1H8EA 1R4NB 2HSJA 3F2VA 2XW6A 3I9FA 3VPXA 5TJHA 1E66A 2HHAA 3OECA 1WQ1R 3EUFA 4R1OA 2K7FA 5J2TA 2IYZA 3GW8A 3VJKA 2W2TA 3KK0A 2EYUA 3L92A 2BKEA 2WP0A 4RHCA 4S3MA 1N34B 2ZSEA 3PXXA 1NURA 4RLFA 1GXSB 5CPFA 3UFXA 2HBQA 1PFWA 2GMWA 4J03A 4OLFA 4UTPA 2HFJA 4MUXA 4C01A 3PX2A 2F8TA 3ORHA 4AKTA 1P5JA 3RSHA 1VSVA 3ZLBA 3EUAA 3QIVA 2Z2YA 1EWTA 1QHNA 2O23A 4P58A 1CZUA 3ZDQA 5MDHA 4MLCA 1XIVA 2AXEA 4XSHA 2BBSA 4E13A 4C0BA 1U31A 1W5AA 2F1OA 2JLSA 4TVOA 3PKZA 3QX9A 3AETB 1SVOA 1IEQA 1W2WB 1PTKA 1ZIXA 3GOQA 2I5PO 4W9MC 5L8VA 1WMFA 2FQWA 4O4HA 5TT0A 3KZKA 2R2AA 3H5WA 4RHXA 1UMBA 4AO6A 1KWGA 1UPFA 4K5QA 4LVUA 1N1EA 1R4MA 2DF8A 1C3EA 3CB2A 3KJZA 3A26A 3B78A 5CH5A 2FCRA 1ZUD1 4U4AA 5AUOB 1I4WA 5EXSA 1DTEA 2OGWA 4C1BA 3ABSB 4DMKA 2RHOA 1H4SA 3RBXA 4HZGA 1NUAA 5EKDA 1L3IA 5HILA 2SKCA 1CZRA 4XH9B 4X6UA 5EZYF 2CKDA 2A9VA 4L9SA 1M73E 3OX2A 4L3WA 5IYZF 1W75A 4LOIA 4OYLA 4CL2A 3CYFA 4LRWA 1L4KA 3FLMA 4NBUA 4QLBA 2X2FA 1XNJA 3LGAA 3PIRA 2O1SA 2HA2A 1GGNA 3KU1A 2V8BA 5EPOA 4KW7A 3KDSE 4NEQA 1RRVA 1FYWA 1O5OA 5GJWC 4DZTA 5LPNA 3C1UA 3TD2A 1K5HA 1PAUA 2RHBA 3QHQA 4C1NA 1B0PA 2E2WA 2FPRA 1S1MA 3KYBA 1OXUA 3WNVA 1L6RA 1RKBA 1S7CA 4B3IA 1VZ3A 2EJBA 2X6RA 4WLVA 3CVUA 3TMAA 4IJKA 1D4OA 4OKSA 5LWQA 4NECA 2EX0A 2OSVA 5E7MA 3W04A 8GPBA 3H0EA 5DBFA 4G9EA 3CUTA 2ZBUA 2FH5B 4JUDX 4WK0B 4FR2A 4AMGA 5A3JA 4ISCA 3SMVA 1O96B 3ASZA 2V7GA 3KHKA 5EXPA 1MZPA 2A8YA 4PYOA 1KFBB 4HX5A 3HU2A 5HIJA 1HMPA 2BEUA 4IJ5A 5ALMA 3DCIA 3E8XA 1BH2A 1IJKA 2CFCA 2RHDA 5IVKA 3QQ5A 3RFCA 1RXCA 3L84A 4XFDA 4GG1A 4R1UA 4WCVA 4Z0HO 5AUNB 1KMHB 4LZZA 4WTOA 4RAOA 2W2KB 3FPLA 4N7MA 2OYSA 3NFYA 4KPYA 1E1DA 3VVCA 2FLWA 4AW9A 3AW9A 3G0IA 1Y7TA 4V3CA 4QL3A 3ZOZA 4B2IA 1DBIA 4RLSA 1OLXA 4HGRA 5EZYB 1DX4A 5BNFA 4LYYA 3QKRA 2DPLA 4MR9A 2LBPA 4DC9A 5IYZB 1NXVA 2LCIA 2R7NA 3OTWA 2G5PA 1RDFA 4RSRA 1AS0A 4P4NA 2NZWA 3EG9A 2G36A 4IKPA 4MV1A 4TKLA 2X3UA 3DE5X 1UBJS 5C5DA 2AX4A 5MFPA 1P9WA 1EFUA 4IQ4A 1OWMA 1X1CA 4B2YA 3D54D 2C5EA 3T5PA 2DR2A 3GGGA 5FDFA 2H57A 1P1IA 5FFNA 3C7KA 1N6RA 4POAA 4RADA 4BLTA 3PX3A 4LS3A 2WW8A 4NFYA 3IOYA 3RT1A 4CIBA 3GELA 4FSXA 4LZWA 3SBOA 1F8XA 1P2FA 4EG4A 5A6VA 1JIUA 1SD1A 1D2GA 1JA0A 3A2KA 2J8ZA 3I6YA 4DLRA 3NATA 1DKUA 3CRRA 4BEVA 5ITVA 3CF6R 1OBFO 1MB4A 2J5RA 3IDZA 2GOYA 1LX6A 2YQ4A 2ZULA 5IDQA 3EZ7A 2NPFA 4AUEA 1Y82A 3ZU3A 2ZSAA 4JL6A 3ZDFA 1KL7A 3BXHA 4YJDA 2JHGA 3BE4A 3ILHA 3M49A 4P3KA 1UPTA 1T6NA 2WWWA 1JJVA 3ZU2A 2Y0PA 2CB9A 2DHQA 4F21A 1NDHA 2RC6A 4JT2A 1NNEA 1JALA 2JJ1A 2LCFA 2C5BA 2KJQA 1CZOA 2BRUA 1QH8A 1O57A 1LPBB 1NJ1A 2J3KA 3PIDA 3S68A 3ZHQA 3F9CA 3M7IA 4JOSA 1JSZA 4JWKA 3BWYA 2CEAA 2SKEA 2DFDA 4LXHA 5KVSA 1E64A 4GR4A 4M0FA 4UHJA 1UPUA 2W37A 4TRNA 4GE0A 3IKLA 1RC1A 5HRCA 1B0UA 3E48A 3OJWA 1WUTA 1ADJA 3P52A 2FZ5A 3GT0A 2BKXA 2G0NA 3NO4A 5DCWA 2VJPA 4P4SB 2FFAA 3TI9A 2R66A 2UKDA 3DB2A 1RM5A 3FTPA 4NOJA 1MEEA 5IC6A 4XD7A 3VHQA 3UICA 3ZV3A 2WYHA 2FQYA 2DUWA 4R0NA 1FPMA 1TLFA 3EW7A 4BNDB 4EI2A 4JEMA 4MS4B 2DG2A 2GCPA 4TTQA 2IUFA 3O21A 4XEHA 1HEIA 5CYPA 4F11A 1PGQA 1QANA 1A97A 4KITB 1FU8A 1L8AA 4QXRA 4Z53A 3HGQA 2ZE6A 5EEHA 3H6KA 3K1ZA 5DNUA 4DIKA 2HDOA 1BA3A 5DMHA 1PQ4A 3UMYA 1A4RA 2NU8A 3K7EA 1VKRA 1JIXA 5IJ9A 2GO7A 2OZEA 4YJ3F 5B64A 1Z68A 4KO8A 4NAUA 4NESA 2QTRA 5TQ2B 1ZVQA 2WIKA 4QG7A 4DSTA 4MHSA 1N5KA 1YAJA 2VF8A 2O8NA 5BSEA 4OP2A 1KYTA 3NW9A 4EMTA 1TCCA 3AR2A 3GO4A 2BGIA 4MUFA 2PT9A 3OX4A 3I04M 2VRCD 3KR0A 4JT4A 3L8FA 1TUEA 4OHFA 4LDNA 3WLJA 1WXHA 4AS2A 4QT0A 2QAJA 3BSWA 5KAPA 2WA1A 4I9NA 2PS0A 1MJHA 2B1JA 3R0ZA 2I80A 1QC5B 3IQDB 3AF3A 4AWBA 3ZJ5A 1Z6TA 4AB1A 1ODIA 1LK0A 2IYWA 5IKPA 4CKEB 3DTTA 1TO6A 3IB3A 4X64B 1YZGA 2D8MA 1Z6GA 3GT3A 4JKIA 2H5JA 1QMPA 1USVA 3TDMA 5DYNA 4JJEA 3RRFA 5CVTA 4ZAFA 3QUSA 1RRCA 4O8ZA 4ZEWA 5HGXA 2H1FA 3TQTA 3L79A 1XZDA 2QPOA 1EWQA 3ZQUA 2FSIA 1G64A 2O0MA 2ZYVX 4EUHA 1E2LA 4HH3C 4OJMX 5BN3B 4G36A 2QN3A 1XTKA 2NU7B 1THMA 3BN3A 3DAPA 3E3MA 3WVNA 3ZK7A 4HMQA 4N47A 1KDPA 5CURA 4ZALA 1JZQA 4FZ5A 4I1VA 3UJBA 4EK9A 4HWPA 2FSVC 4R51A 3V9PA 3IHTA 2ATXA 4B85A 4CKZA 4JEIA 2O7QA 2G5TA 3DWIA 4KR7A 3ZK8A 3K31A 1TM7E 3KVOA 1B41A 1T9GS 4YJ3B 5BQFA 4N0EA 3RV3A 1ZW1A 4S2UA 2O50A 4MS1B 3NT2A 2A78A 1C3OB 5BSKA 3H8SA 3GB9A 4DBZA 5JY6A 4NHOA 2F90A 4FYPA 3C70A 1QUEA 3HDTA 2FCAA 4R8MA 4BVLA 4KFCA 2VXCA 3Q9UA 2HIHA 2HF7A 5K3EA 4ZYTA 4MV5A 5F76A 2JANA 1X1QA 1X7WA 3KJIA 5IVIA 2JI4A 4U6SA 4D0GA 2W5UA 4NDNE 4FC7A 2RHMA 2A5DA 2QMQA 2WD7A 1NXPA 3R6TA 4RZ2A 3DJYA 1ORIA 4J0JA 5K0TA 3PHJA 3DDHA 2P1DA 4DLVA 3UYKA 1NBMA 4FX2A 4JA0A 4ZO9A 1RR6A 4Q4AA 1IIBA 4Y6QA 5HFNA 4BGVA 2P7HA 1COWA 3CTPA 3PWZA 4KZPA 3HR8A 1D6NA 1H5NA 1TGYA 4YRQA 2FPMA 3I2HA 5G1PA 2X0DA 3WL7A 1F8FA 4AJJA 1TTHA 3ZCRA 3QVOA 2GK4A 1RBYA 2G8LA 3EZNA 3W90A 3DT8A 3GLFA 3OEHD 5LUBA 4AY5A 2OO5C 1P0PA 3DFUA 4C2TA 5JBNA 2PX5A 3TUIC 4O2LA 4PZUA 4CMEA 1C80A 1CF9A 3GLVA 4ZHQF 4OYYA 4BX9A 4EBBA 3F46A 1AF4A 3LUFA 3U09A 1JFFA 4NTZA 5C7YA 1F4PA 1E4EB 2ZE8A 4NH4A 4BNXA 4WESA 3DOCA 3D6UA 3KOZA 1NG9A 1B8OA 1E3LA 3TINA 3W1WA 1KMCA 3SXUA 2V7UA 3OZ7A 3ZGZA 4JKOA 1GPWB 2ZDQA 3IOMA 5DP2A 1P3Y1 1KSFX 1WSBA 3Q6IA 2BEVB 2AOTB 4ND5A 4UUPA 2VT2A 3FHOA 3IIKA 3D0RA 2IKQA 4P33A 1SK8A 2GXSA 3EIQA 1ZINA 1A5TA 2PT6A 1TOAA 3AEKA 3DEFA 2X4IA 1OBVA 3V2HA 2PUFA 2H5LA 4JLNA 4XEUA 2M98A 5AVKA 3UV7A 4FP9A 1Z36A 1FFYA 2XCQA 2Z2KA 3LOPA 4DKXA 4ETNA 4P7GA 2D0OB 2P9JA 3NTUA 3PNOA 2QUHA 2FMHA 5FBWB 2GBCA 2GPAA 3BERA 3LQRA 1BU8A 2WEKA 1OVGA 2WT9A 4FZ3A 1GG8A 4M2LA 1SN7A 1JRLA 4R1QA 3QE9Y 3VKFA 3T9CA 3ZY6A 1Z35A 4HN2A 3TLKA 3WIUA 1U90A 1YB4A 1SBIA 4OB7A 1JLHA 1WLSA 2JEOA 3U7EB 1LJUA 3BTVA 1X7XA 4MUNA 5KWSA 1QHYA 2EC5A 4COKA 4G0WA 2P0YA 1ZH8A 4PX9A 5HTOA 1C14A 1HL3A 2RBKA 1BSVA 3BGIA 3LT0A 3MM4A 2O8EA 2NQTA 1P91A 5JARA 5HS6A 4WOKA 4JLKA 1GZUA 2H1VA 4ZHQB 1J6UA 4QO8A 3FYTA 1CKEA 1K7XB 5KSWB 3GCGA 5AJVB 3RS8A 5CG2A 1YVEI 5LZ2A 1J42A 2IS2A 2JHAA 3M8KA 3HA5A 1E6CA 4XX0B 3O4VA 4IQ0A 4DR7B 1UJMA 5B3JC 2QD2A 4G26A 5IPFA 4ZTZB 4B3GA 4DCNA 3OA0A 2D00A 5LQCA 3RSQA 4RHYA 4RTNA 4J3JA 1E7YA 3AVVA 3LVBA 2JIOA 1HYEA 1TUBB 2BFNA 2RCYA 1EWRA 2GF0A 1O6CA 1NMQA 2E4WA 2QYTA 2EARA 4Q1VA 4C21A 4EI7A 5I7UA 1AXRA 3IESA 1EP1B 1GRCA 4B47A 1T6XA 3FD8A 1DJLA 4ND6A 2QHXA 3M81A 2F4VB 2AYXA 2OOKA 1G21E 1B6RA 1YHZA 4C0XA 1H3NA 2C7OA 4UTRA 3BMOB 3ELWA 2ZBGA 3SD7A 1MFPA 2C9BA 4ND8B 4AECA 4HEQA 4BKOA 1PTJC 4LOLA 2FG7C 3CTMA 1E63A 1EFRD 1P2SA 1YONA 2AKYA 4V24A 4RJLA 5C34B 3ZHOA 5I7FA 2NWQA 4ITVA 1ULBA 1MB2A 4JLOA 4PC2A 4D3SA 5F3WB 1NSFA 4YRLA 3FRIA 4AIIA 5C1PA 5IX8A 1OQAA 4BMOB 1AQNA 1E0DA 1NXSA 2HBRA 3EAQA 1FNMA 1K2VN 3IR6A 4A1OA 3JWIA 4DXHA 3Q7RA 2P9HA 2F9MA 4IZHA 1KVTA 4O6VA 2VPQA 2XITA 1U1CA 4ITUA 3UAGA 1Y4UA 4RVFA 1U5BB 3DM9B 3EY9A 4UBLA 1A9XA 3UMBA 1OXTA 3G2PA 4FU0A 1PSWA 4L76A 5J59A 1PD1A 2I29A 4RMIA 4K05A 4NMLA 4TMFA 3U3MA 3DLAA 2QRGA 2QTWB 1V4NA 3OICA 2FE4A 4IDFA 3KELA 2ZKLA 1EBUA 4XQ9A 1PUJA 1Z4NA 2PVPA 5EGSA 4TLBA 4B81A 5KQMA 1DJNA 5A1TA 3CFYA 2ZRLA 3EODA 4KCGA 1CY0A 4RENA 2C9OA 3ZVLA 3ENZA 1LBSA 1YR8A 3DMNA 1ORRA 2JI6A 4CL0A 1H2HA 1TI7A 3P97A 3H1FA 4KN6A 4PNPA 1WS6A 2ARKA 3P0IA 4KXVA 4Q3CA 3ODGA 4Y7CA 1GJRA 2NU6B 4JYMA 3R7NA 1EE1A 1TCVA 1W0KA 1VQ1A 2ZSKA 4NZPA 2IRWA 4PGAA 5AIAA 2O2SA 2XBUA 3GRKA 4O4LA 3I42A 3ECCA 1Q0PA 3K0CA 5ESRA 2ZRKA 5KTOA 1EFVA 1DTWA 2JFHA 1CB7A 4X65B 4R31A 4E5PA 2Q3MA 4J7XA 1O6GA 1J2TA 2P2DA 2YVQA 5DK4A 4D8YA 1Q3KA 2COUA 4ZIRB 2IDZA 4JJKA 4RZHA 2AE2A 4KRXA 2V6MA 5JPDA 2GBGA 4H3VA 5A3QA 5HKAA 1N1DA 4XYMA 4XVRA 4QXAA 2XCRB 1C8KA 1I4TD 2QL6A 3LPAA 3TTWA 5BW8A 2BJVA 1P17A 1GCUA 3GDFA 1EX1A 2HB6A 2C2MA 2HEIA 4RFSA 4UATA 1E9VA 4I6GA 4JX9A 3ETDA 5NULA 4HQ6A 4M1KA 3AP3A 4PLYA 2J09A 2PVCA 3HUEA 4DLXA 4MQ4A 1XBTA 3HNPA 3FHLA 3OTGA 4CM9D 1NBMD 3DKVA 1YA6A 5DTJA 4CUZA 4QBIA 2PQ6A 3NBXX 1E2QA 1RZUA 4L8GA 4TN5A 1QQ6A 3BB4A 2OM2A 3AQIA 4Q05A 4RZUA 3BGOS 1XL1A 5KPDA 2ID9A 4EY6A 4AKGA 3E9CA 4BLOA 2NGRA 3CR7A 4IDHA 4PBTA 4CLRB 3K70B 1C9YA 2YIMA 3UVEA 1QZUA 2FQXA 4MO2A 3FJOA 1JYEA 4IFIA 1QO7A 3W9YA 3X43A 3GF4A 1KJJA 1Q50A 2PKEA 2ZYAA 1WBDA 1M6VA 4A2QA 4GI3A 2OQ2A 1RBMA 2Q0HA 1EX7A 3M6AA 1L1QA 1Y9AA 1J2UA 5AW1A 3BUSA 4M0DA 3BJRA 4I1UA 2ODBA 4BO6A 3GLKA 5ERGB 1QP0A 3ZUPA 2ZYDA 2A84A 1VKNA 1ZD1A 2GM4A 1J7KA 1JFVA 4MV3A 1OVMA 4KFSA 2CFRA 2P9TA 4MROA 2CXTA 3B1FA 1ZCFA 1V6AA 2ORWA 3QYFA 1NVVR 5K3FA 2YH2A 5A9RA 2VC2B 4QDUA 4TMYA 5F4ZA 1E6UA 4XTRA 2CLFB 3MJFA 4EPRA 4MR7B 2XXAA 1DQNA 2NX2A 3AEUA 2Q6TA 1OF1A 1X1AA 3IUJA 2NUAB 1E99A 2L17A 2G06A 3CGGA 4CDRA 4DJFC 5AM2A 4YJGB 3DE3X 2X13A 2WHPB 1F48A 3OZEA 3NM6B 3ZI0A 2DERA 3VU0A 2QPAA 4C04A 1NI5A 3NT4A 5I9IA 1WBBA 4RORA 1CQIB 1JR3E 1ULZA 3FVVA 4AXBA 3NHPA 5K0FA 3G9XA 1V7ZA 3A7EA 3C45A 3QLEA 3S4YA 1R8SA 2PZLA 3NGLA 4M99A 2O5RA 1G8HA 2J9FA 3C3JA 4GR9A 1HTBA 4PFJA 2QD1A 4M8LA 4AT1A 1Z07A 1QIEA 2O2DA 2VZ9A 3NDBB 4R9VA 4GOJA 2ZDGA 5THXA 4DPKA 2RK3A 5DN9A 2GH1A 1DO8A 1CIJA 1UQRA 3ETLA 1FP1D 3H1GA 1XEAA 1CUDA 3JALB 3OOJA 4DQVA 5JFGA 2IX3A 2E3JA 2RG7A 1NZDA 4HUJA 1JI0A 1PJ8A 1G5RA 1OR8A 2V7QD 3AY3A 3KALA 4JA2A 4CCYB 2LWIA 3ENWA 1OTHA 4B5LA 4YAOA 3RS4A 4E12A 4EJSA 1GNSA 2BZGA 1JBEA 2EQBA 1OKKD 2CJXA 1DBVO 1WF6A 1QPBA 1KEWA 2XR1A 1JLLA 3C3XA 3G85A 3JQCA 1EK0A 2HJSA 4Y1RA 4ZJZA 2DHRA 4LBVA 2CFTA 3QY9A 4A73A 1W76A 2XCSB 3ZCSA 2X9LA 4A6PA 1AG9A 1QCYA 3OUUA 2QRHA 2R6CA 1GO2A 2F64A 4CIWA 2Y05A 4QU5A 5JTTA 3AVYA 1M8FA 3BGVA 4R8SA 4ZO8A 4DR1B 4LE2A 2QBYA 1A4XA 3ADKA 3OIWA 4B32A 3AB3A 2YICA 4MCJA 1ISRA 1JXAA 4WXYB 3I39X 2CLEB 4JCCA 1R9GA 4LHXA 4BASA 2NO9A 1OLUB 4W5WA 4CNBA 2DLCX 1PR4A 2MT9A 5F7ZA 2Y6VA 5FOSA 2CD7A 2GN8A 4XGRA 1HYGA 3AC0A 1KEZA 3RTAA 1GA4A 3AUUA 2BPOA 3YASA 1L7MA 4CN9A 2E5FA 5LP6A 5KOJB 3TK1A 1Z8NA 2CBZA 4BRSA 3AX6A 4L27A 4I9HA 1ID1A 1BWQA 3WDKA 1UPAA 1E2IA 4JYZA 4BYMA 5KB3A 3A6PC 1U99A 2PMCA 4M1OA 4QREA 5AOVA 1M76A 2VO1A 5KYWB 5TEWA 2DSNA 2RAPA 4ZGWA 4NH0A 3H8WA 5GIOE 3JQ8B 4IXWA 4EAQA 3NKLA 1N32B 4XXHA 2VJQA 3KAKA 1SU4A 3FWHA 4UZSA 4EF6A 4FI3C 3DTVB 2B61A 4REOA 3ELDA 1B76A 5EJ4A 3KJQA 4WA7A 1ICEA 1KK3A 3LQFA 2XMDA 3CWQA 3A1UA 4NAVA 3FROA 3ENVA 2PX2A 2H4WA 2JCGA 1YZQA 5E7QA 3TX6A 1PQUA 4KIWA 4G1CA 4O25A 4Z2AA 5LLDA 5AVJA 3HU3A 4AJKA 2PXHA 3IEUA 5JC8A 3P0FA 5AI5A 5F52A 2KB0A 3VVLA 4MWGA 5J23A 4J0DA 1PJZA 4IJQA 2YJTD 2YBDA 1N7IA 1XKXA 4NHEA 1N0VC 4NOLA 4OF4A 5EIHA 4OSOA 3UXMA 3IBTA 4C2AA 4NPCA 1P61B 2GI4A 3QA9A 4Q4HB 4DLUA 3HY3A 3SZGA 2HU5A 1XP5A 4MUMA 5DM1A 5EVJA 4BVFA 3LQYA 4KGZA 3A4NA 4LIPD 1SU6A 1WB9A 2JZOA 5SYMA 3ER8A 4FGWA 4X7PA 4A9AA 1U2RA 1LGYA 4RKQA 3TECE 3QXGA 1IONA 2CXOA 3SFZA 1ZRMA 4K9QA 2R1UA 1ZH0A 4D6XA 1T3ZA 4E30A 5EOVA 1J99A 3AVQA 4BNYA 2BI8A 4INOA 1OX4A 1PFQA 1U2DC 1FL9A 2OFWA 2RGYA 4MV8A 4YUVA 3PQ6A 4ASUA 4E5KA 5M29A 3TUZC 5EZ6B 2PU7A 1VLVA 5TR9A 3F7NA 3G8BA 4J9UE 3H9QA 4B6EA 5B1DA 3V55A 4S05A 4ER5A 1N2OA 4HNAA 1QP4A 2IP4A 4D44A 3CURA 4MP6A 1O4WA 1YRYE 4BNIA 2DFTA 2JJ8A 1DT3A 1AX9A 1L8XA 2WZQA 3TZBA 5T8KC 1VB5A 4BAUA 3D7NA 3TCXB 1F2TB 2ZS7A 5BQ3A 4WW0A 2QXYA 1CS0A 4UVHA 1KJ9A 2VXBA 4G81A 3S0JA 2D5IA 3N2KA 2ZSDA 1EK6A 1FFAA 4D26A 2NO0A 3X1YA 4DCPA 4MP3A 1BHQ1 1XCJA 4ZZ1A 1ZISA 2B34A 1VMAA 4NNJA 4WFQA 4HQFA 1NUUA 5TQ0A 4UEKA 3RJ5A 1D0VA 4PTYA 5ESXA 4FK8A 1F4LA 2L19A 3X1KA 1S8NA 4B6QA 4Q9AA 1LRLA 2QW8A 3H5TA 1XFAA 1LC0A 4EUEA 3SQDA 3H0KA 2HQOA 2UV8A 3UHAA 2BR5A 5A04A 5FAXA 1JQ3A 3ZVNA 5JNVA 1HNXB 1E2HA 4DVGA 2H1LA 2RH4A 2NV0A 2NZ2A 3CS3A 2HW8A 2C5LA 2OCAA 1LJ8A 1FNNA 1OXMA 3JAKB 3U7GA 4FN4A 1J70A 1G8MA 3PG5A 2QRKA 5AQEA 5DHFA 2O3UA 3VOSA 3W4KA 3QU2A 2EBHX 3IE1A 4OBEA 1OOEA 3BMQA 1FP2A 2ZANA 4OAQA 2OKGA 3DLHA 4IMIB 1TEXA 2BD0A 4BV2A 2CNWA 4U3JB 4UCXA 4RANA 3SYLA 4O2AA 1DINA 2VJDA 2JFXA 1C5KA 1M7GA 3PNKA 2P9ZA 3BL8A 3AHFA 4YONB 1KVQA 5DHRA 2P77A 4JI5B 4RS4A 1J2EA 2VWHA 3MTJA 4NU5A 2GN0A 3G2MA 2PMEA 3UCEA 2VDJA 3HJUA 2GHQA 4UU8A 2JIDA 4OIFA 5LZ4A 1MT3A 1Y3FE 1ESEA 1UBUS 2ANBA 1ODSA 4EVSA 5REQB 3Q1LA 4M0PA 3REGA 3LLCA 4LV5B 2A9OA 1F5NA 5JISA 4S1TA 1A96A 1YS7A 3K4PA 3KHTA 3PT5A 3QYJA 4LBYA 4C7VA 3DHVA 4IVRA 2G1PA 1OHHA 3O4GA 3A06A 1JJAA 1ZD8A 4AJ1A 4JC5A 4E3ZA 2J3IA 5DM60 2D0PB 4EEXA 1YWGO 1SULA 3ONFA 4C4PA 5B30A 3QF4B 2B5WA 5IUNC 5H68A 3A6ZA 3TL6A 2O8FA 5CA0A 3HWSA 2R62A 2B37A 4GM4A 4ZDWA 3RVSA 4I50F 4DJDC 4QTZA 3MHPA 3GWGA 2QJFA 3N6XA 2O59A 3L93A 1NYTA 5KYXB 1XZGA 1YIOA 5AK3A 2I3GA 3L7NA 2IZ6A 1QTRA 2IUTA 4FZRA 4JVSB 1AA9A 1UDAA 2ADFA 3WHIA 2Q6VA 3K0EA 3V1MA 1QZTA 3U16A 4B3TB 1Y34E 3DDNA 1FX0B 3C3EA 3DAFA 1P75A 2FFQA 4NBVA 2VA9A 2REXB 5FUXA 5KYGA 3O9ZA 1XD2B 5BR4A 1MAWA 3WLHA 5JNTA 1AZWA 3A28A 2ZAIA 1YQTA 4CCWA 3Q7TA 4REQB 4MYTA 2TMDA 2WTEA 2J4FA 2ZIAA 3L4BA 1WV1A 3N8HA 4F85A 4PLPA 2QSZA 3H13A 1TE2A 1HDCA 5HMMA 5C7OO 5CFQA 3PNPA 1JH8A 5AJUA 4FWIB 1ZD4A 3PNSA 4C78A 1X1SA 3L0YA 1BMFA 3UW3A 1HI9A 2D7JA 5H82A 5D6OA 2D5CA 3BDVA 3QOYA 4U2CA 4OHWA 2CLMB 2SCUB 2V5AA 3DP7A 4FE3A 1WG8A 3GEGA 1THZA 4KYTA 4BO0A 2Z4SA 4UQLA 3ZH2A 2Q4BA 2ACWA 2W2OA 3RUIA 4KGVA 5E4JA 2Y0CA 2BBWA 3T5GA 4CTJA 1K0UA 2AF3C 3OLZA 1S2DA 4KIUA 3B3QA 4JWTA 3R0IA 1HPLA 3PWSA 1CVLA 1JQDA 3F3SA 3LQ2A 1KI2A 1JG4A 2A88A 5EI5A 3ZV4A 5A03A 2IUSA 2P2SA 3MC1A 5E9JA 5C8DA 1IHPA 1LB1B 5LMUB 4WJZA 3RS9A 3AP1A 3AUKA 2OQVA 1FMLA 1L6IA 5KYTA 3K9NA 2IXTA 5FUQA 1ZONA 3IXQA 2R65A 3COVA 4HB2A 2P1ZA 1Z5ZA 2P5SA 3FNRA 4V0ME 4KVZA 4WECA 4MO9A 2PCLA 2C7QA 4I50B 2DPXA 2JAWA 1CY2A 2JCYA 4MW2A 1YMUA 1KPGA 3W0LB 1X7YA 3P94A 3SHWA 1E2KA 4EYOA 2YJNA 4J3FA 5K3DA 2FPIB 2J59A 2GHIA 3CJTA 2WIFA 3IAS1 4OMFG 4X54A 3VJLA 1NFFA 3P1JA 1M8PA 4BS9A 4PZZA 3MS2A 4L74A 4YA6A 4MZXA 3P9YA 3BFPA 4BFSA 5HZHA 3I64A 3Q7SA 5CDYA 4F2GA 1PL6A 1ZO8A 3R7LA 1JVSA 3EDMA 2GTIA 3C39A 3SLGA 3MLEA 1IN7A 3K1JA 4NC9A 3DLTA 4L7QA 2PV0A 3WIDA 2B4YA 3A3KA 2W6IA 1DXYA 3L7OA 4HY3A 2FSGA 5FOTA 3T8YA 2FSFA 2INGX 4QUGA 4Y0NA 1BHO1 3A1DA 4PANA 2ZJAA 2BE9A 4F6CA 3N0TA 4PHFA 2B4RO 3C3CA 3HI4A 4MGZR 2JC3A 4OI1A 3SGLA 1IOLA 2QRJA 2VH2A 1VIMA 5ELMA 2H2AA 2MMCA 5FR2A 3A3YA 5J5VA 3DWFA 2F3UA 2EYQA 3ZZ0A 1G3MA 1TB4A 2ZR9A 3CLHA 3L0ZA 4DCOA 4Y6SA 5FHRA 4LF7B 1R66A 3VZPA 1VYVA 6REQA 3GLIE 4EI9A 2BSXA 2MSCB 1CUWA 5FOQA 4RZ3A 3OU6A 1E5TA 5HIKA 2H0AA 1UAGA 2P4HX 4JT9A 4AN1A 4J90A 4ZCQA 3ELUA 4XDZA 1GVHA 1K68A 4OJTA 2TS1A 5E7JA 1TLLA 4HEA1 3ANYB 3E1KA 1BOFA 1FDIA 3MJSA 4XR9A 1DQYA 4QUJA 4HS9A 1UZLA 4KE9A 4TKUB 4X8OA 4XWYA 4AQYB 2G1JA 4PVCA 5JJKA 4UULA 2O5CA 2RGBA 1C1HA 4MKFA 1Q0UA 2ZE5A 1MVLA 3A3PA 3H9UA 4RWZA 4WGGA 1OW3B 4DGQA 2XTAA 4HDOB 3ZE9A 1ZM3A 3DR3A 4MAMA 1ZMXA 5IAAA 2O8DA 1GUAA 3PU6A 3OOHA 5JSKA 5CNKA 3OC0A 1C7FA 1KO7A 2VDPB 4RA6A 3IAS6 1V8ZA 1HO3A 3OU7A 4WHMA 4MKHA 3S1AA 3WLEA 4ENPA 3OE5A 2CDAA 4WLOA 2ISQA 2YMMA 1B14A 4PAGA 3WQQA 1X8XA 4LTDA 2CJWA 3PENA 3B6JA 5IUKC 2FZEA 1D6MA 1YAHA 3H86A 3OLWA 4JBXA 4KIJA 3RG2A 4AZ0A 3U4CA 1RM3A 1AC5A 1VL2A 1XPJA 2AH5A 2CE7A 2YWXA 2VUSA 3K9CA 5LNK1 3RKSA 2KE5A 4WK2B 2A5LA 3RV4A 5A4DA 4B3SB 3O2JA 2H48A 3G2QA 1NW6A 2X5OA 3H5AA 3LPNA 3R9IA 3PQ4A 4EA9A 4F9FA 3KYCA 2VTKA 3M2TA 3REFA 4CDMA 1MFZA 1P7YA 2BDEA 2ZIGA 5DLPA 2ZTSA 3BH7A 3T4EA 3ZHSA 3WBJA 3PE3A 5L53A 1H66A 1U8EA 2CNWD 2O3TA 1T9CA 3V1NA 4LNUB 3PRYA 4UQPA 1PL8A 1I51A 3LIIA 4Z9YA 3H17A 3RUEA 3CE9A 3QVGA 3TEFA 4JQOA 1T2VA 2CYAA 1MDFA 2ZBRA 1C3JA 1PZNA 2JDID 2OK7A 4L6AA 4JI6B 2D0DA 1IZZA 4JLVA 1BXRA 1Z0AA 4CN8A 2R7LA 1N8KA 3CLRD 4IUYA 1YR2A 5CT8A 5F3RA 1SURA 4IG4A 4DR6B 2WJ3A 2X2PA 3QOXA 4I1YA 2CN1A 4L0QA 3HVIA 1QNFA 2JK0A 4GWKA 4TTJA 1GIAA 3AUJB 3RYTC 2QSYA 2MSKA 4HTAA 1JG6A 2BONA 3AO0B 4U6QA 2J0QA 4ZU1X 1VE3A 4BE7B 4QZVA 1V5FA 1F4VA 2EKZA 3DC7A 1BS9A 3HCAA 2PBLA 3OPYI 4UM9D 1KSGA 1STOA 2C7BA 4R2HA 3T0IA 2H3HA 4I9FA 4LF9B 4QUKA 1LFDB 4DBVO 1I3MA 3R4VA 4BPRA 2O2HA 2XZPA 4KYUA 5EWLB 4U39A 2H85A 1HLGA 1UANA 3HE3A 2GZAA 4YRMA 4I3FA 4WK4B 1TFUA 2GAJA 1A0OA 1Q1QA 3MXTA 2RHCA 2FLVA 1P1HA 3AERA 2HWUA 2GJAA 1NJSA 3GA5A 3UWDA 4W8GA 4INJA 1ZFNA 4G4JA 2OXTA 4YPVA 2VQDA 1XX6A 3JQAA 5DOZA 1GQSA 3R5HA 5ALJA 3CWZA 4L5BA 2GN4A 2YY5A 1X1TA 3HRKA 1V6SA 4H9GA 4Y9SA 4NZ9A 2AKEA 4Q7LA 4FFPA 1K0FA 4HYYA 1BMFD 3GNSA 4V1CI 4CQMA 5CIQA 1MU0A 1JDSA 3F5FA 4L0DA 5ELXA 3KOXA 3DBVO 1UQUA 4RIIA 4L8WB 3UPDA 2RHLA 3FDZB 3R0XA 3BCSA 2QVBA 2AEEA 2PO7A 3PXUA 4D8XA 3DV2A 1JKFA 1NW4A 3GQBB 4KI0A 1RRPA 4RMHA 1QV9A 2JFBA 2VDWB 4RMGA 3VR6D 4XJXA 4GC5A 1E8DA 4ZVRA 1IBMB 1TQ4A 2VHZA 3KPVA 3R2JA 3P9RA 1Q17A 1O94D 2ODAA 2OHIA 3F6PA 1VOTA 4KR0A 4TYMA 5KQRA 3O8QB 3U0BA 3VYWA 4A23A 1BN6A 3CLRC 3EMDA 2D2FA 3EXFA 3KNZA 2PGIA 3AGQA 4HS4A 2X1HA 3DH0A 4M9CA 3ZDCA 3LP6A 1S2LA 4XLTA 2PY6A 5EJMA 3C5WP 1NVAA 2PZJA 1DJQA 3C7DB 1ZPDA 1OXXK 2P1RA 1NMXA 3DDOA 4RY8A 4L5AA 1ILEA 5JWOA 1Y6GA 3ZTTA 1L5QA 2F59A 2XQFA 3K0AB 1H1TA 4OQ4A 1H4TA 1SCBA 2FZLA 1FDVA 4IUBS 2I7TA 5ICFA 4TMZA 3LCCA 4HP8A 5CTAA 4AJOA 2D13A 3DT6A 2Y67A 2JH9A 4O63O 1U98A 4PZDA 1GPDG 2IV2X 3RS3A 2OR3A 3W77A 1DIBA 4FBMA 4LQ4A 1IEWA 3JYQA 3B89A 2AFHE 1SPXA 3F96A 4WASA 3SQLA 3VR0A 3EGXB 3PEEA 4IIGA 5J1SB 2LZ0A 3F98A 1NLYA 1FRFS 1RBZA 2W6ID 3BF8A 2BF4A 1ADGA 4B09A 1ISJA 3UWKA 3GQVA 1ZNZA 3WWYA 3B1VA 5EXXA 2XB9A 1JKMA 2XUIA 4DEXA 1J1IA 3VXKA 1RI3A 2P8JA 2LDBA 4IX9A 4YJ2F 4RSMA 1J1UA 1ZC3A 3NBYC 4W1QA 3GC6A 1U9ZA 1ZM9A 4PYLA 3GZNB 3NHZA 4Q9LA 4LRYA 4DSOA 5BN4B 1C0PA 1M72A 3BTUA 4KNWA 3CCFA 3GNQA 1PEKE 3M2PA 4MVJE 1GFWA 2QZ9A 2H52A 3JYLA 1KXZA 5FUBA 2AJLI 5CITA 5CM8B 2XDAA 5T41A 1HRKA 3PGXA 1W4CA 2WUWE 2ANCA 4M9QA 5SYAA 4H18A 3UC9A 2I4IA 4Y2PA 5L3VA 4G4GA 4QOHA 3CLSC 3NHSA 1DWUA 1GT91 4RS3A 3V2GA 1RHUA 3ACDA 3OIGA 5CMLA 4IWYA 3SKVA 1H0RA 1ID8A 3C48A 2BOVA 1UEIA 4BQOA 1CUHA 1R4ZA 2CXPA 1XJ0A 3UMJA 4ZCMA 4C0SA 3M6IA 4U7WA 4OGKA 3ELBA 4FKZA 1XCOA 3SR0A 1MHPA 2PL3A 3RUFA 1PX0A 4UDOA 1T5OA 1O94C 2PX8A 4QNMA 1XEXB 4WNAB 5CW1A 1GRQA 2BMVA 2GKOA 5FWYB 1G4AE 3OJXA 3QPDA 2A30A 4ARVA 3HUDA 4OUDB 4JK3A 1KRHA 4K1LA 4MQUA 4XVHA 5L7YA 3G0GA 2P5TB 5K5EA 3L7YA 3VA7A 4AX4A 2J6CA 4UE3S 4QU0A 5D5QA 5B2ZA 3MHTA 4B7ZA 3BF7A 4Y2YA 5FTLA 1ES9A 5T6MA 1JG7A 1R18A 2KS6A 3T12A 3W2FA 2G40A 3FKJA 2IYNA 3P96A 3GJ3A 3VTKA 5JWRA 3ZBTA 821PA 2D54A 5KNCA 2MDTA 1LLDA 3I30X 3W05A 3AKCA 2J4DA 4NE9A 4YJ2B 1QHSA 3KD2A 3WJ2A 4DC0A 1R8YA 4RJKA 2GJ9A 1T36B 3EY4A 4B73A 3OWOA 1VCHA 5TVKA 3D2CA 4PHGA 1WDWB 5ALIA 1JB1A 3ZYCA 3FLAA 3BSSA 2QY9A 4E21A 1T0BA 1CW2B 2G09A 1YD7A 4BXOA 3WK4A 2R86A 1SIUA 2VYVA 1GZDA 4IUCS 3QVTA 2C9DA 3INRA 5KWIA 4XYEA 3FTDA 2O2ZA 4PCUA 3N0RA 3E9MA 4W9NA 1YI8A 1SXGA 4BKRA 1MW8X 3QTBA 1G9TA 1IATA 1P18A 3CF2A 1U0OC 3E9NA 4I3HA 3U48A 1QB8A 2WAYA 4XARA 1KEEB 2IEBA 3DAHA 1W85B 1EFPB 1WLYA 2BLLA 3C8ZA 3ZV7A 3DO8A 3PBKA 4BEJA 1DC8A 2ZRGA 2HN9A 3BHMA 4OREX 4F8JA 2B78A 1B2RA 3K6RA 1PN3A 4HFRA 2AZTA 1PW5A 1B2LA 2Y99A 3ISTA 1D2AA 2NSLA 4IVPA 4RH3A 3FOAA 3JQFA 2J3QA 3B8EA 1IQUA 1PKEA 3HSKA 5COQA 3VVMA 2X41A 3B3AA 1CEQA 1OIXA 3NRBA 1E9FA 1U7UA 2GAAA 4H15A 4C6HA 1A5AB 3O3OB 4R2XA 4O0MA 1SKUA 4PO1A 5LIRA 2FPPB 1T5LA 1O0CA 3CU5A 4BKPA 3M5DA 4RHUA 2NP6A 2Z2IA 4ARAA 3PS9A 1DKOA 1UXGA 5K4AA 4QUBA 1IULA 4QGFA 3EEOA 2IVZA 2K6GA 1Y1KE 4AWAA 2UYQA 2WPDD 4RL4A 5AJHA 3V4ZA 2N42A 4OEHA 1ZI9A 2EF0A 3BMCB 1JG3A 2HQBA 2XT6A 1GRRA 2CHVA 3FSGD 3L1HA 5DJ5A 2PQ2A 5TB5A 3K6KA 4Y7DA 3WTCA 1MKYA 3QFRA 1V9CA 3A8TA 2KW5A 3KYDA 4FHFA 3JQAD 1JQAA 4MQ5A 1WKCA 3FPSA 3BHIA 4LJYA 2NXEA 1ZN9A 2VJBA 4B3DA 4FHGA 1OB5A 4ACAA 2WKPA 1HFJA 5EHXA 1G60A 3D7SA 1OLSB 3IP3A 2FPSA 3DYBA 1DXOA 3GDGA 1RFGE 3LCMA 4KQIA 1FTGA 2PR7A 4GMGA 4EKYA 2XD4A 3L8HA 4I8DA 3UOWA 2FUKA 3KR2A 2P4QA 4R6WA 3B5EA 4JP8A 3IAM6 3UKJA 1I7NA 1J56A 1VJ0A 1XAIA 2C4HA 2Q9AA 2AW5A 3A7DA 1Z18A 3OMLA 4K86A 1YZYA 3PNBA 2AN4A 1NQAO 2EQAA 2N75A 2OORC 1OTXA 3M6UA 4RPJA 1RVV1 2XHZA 5F51A 1UPCA 5JS7A 3QYPA 5ARDA 3R5SA 2VYFA 2MCFA 1F7UA 2G80A 1P2UA 1RYMA 3OLYA 3CPEA 3PFWO 2Q1UA 4JQCA 4LC0A 4BNWA 4QQKA 1LV7A 4EGSA 1FFBA 4CMBA 2H06A 3A4MA 1G0OA 3IA2A 4KAXA 5E1DA 2H07A 2ZAOA 3V4SA 1Y5MA 4FLFA 4JJIA 3NPMA 1TCBA 3G13A 2LRHA 2R00C 2RHTA 1BS2A 3MCZA 4TUYF 3SJUA 4ZAZA 4CIDA 3FB4A 4YMGA 5BNZA 4YBZA 5K8IA 5K0GA 2X0RA 4HNGA 4ILKA 4WKCA 7MHTA 2P2YA 2OE2A 5AMXA 3LUDA 1X9GA 3EXEB 4QASA 5I8ZA 5FNZA 4LQLA 3HUTA 1BRMA 1JKJA 4YMLA 4DG8A 4J6EA 2BFBB 1GQYA 4MWDA 5K6AA 3I2KA 1N5IA 4IVNA 2JFGA 4C4TA 4FFLA 1I94B 5JCJD 3MUEA 2XUZA 4BQEA 5E9WA 5IWAB 1JHVA 3QW2A 5K6AC 1L4EA 4HK4A 4MKIA 4DABA 1RYEA 2QTAA 1A9TA 2MSLA 3AKYA 3CEPB 3QE2A 3QVUA 2VDRB 5KTMA 4L5IA 4Y0VA 3BJZA 1RXEA 4W7HA 2BZ1A 4L5JA 2BJHA 4C2UA 4MHTA 1CEEA 1LW6E 3E1SA 4OQFA 3ICOA 3ZWKA 4CEHA 5AVQA 3EQ7A 5LLTA 3ZWMA 1N1MA 4I6JA 4M9UA 2YFHA 2FXIA 1H1LB 2JKYA 3FIUA 3KSZO 1AUOA 2Q3FA 3KEQA 1VB3A 4K8OA 3MIZA 3HNRA 1QOZA 3OHSX 3P4YA 4OHVA 4R9UC 4Q1CA 1G5HA 4CKWA 3JU3A 4TV9A 4Q37A 4G3XA 3V8VA 1SKAA 4GGMX 2ZWAA 1ODLA 1KMNA 1USWA 1K63A 1NR5A 3HLTA 4IM7A 3L18A 4PCAA 4LGYA 5KYUB 2R84A 3R5JA 4NMHA 3A9UA 2CF5A 4TUYB 10MHA 3L9WA 2HPZA 2F8SA 2BEKA 3M70A 3WNBA 4HT3B 3EVDA 5I7EA 4Y2VA 4ENVA 4JHLA 5IC5A 5TXGA 2ZCVA 3AIIA 4NX2A 1E3EA 2ZB3A 3ZWOA 1W2HA 1VRCA 4YASA 4ZV7A 1W36B 3A25A 4QC2A 4O4JF 5F12A 5HKBA 2V7PA 3IE2A 1V37A 4E1VA 2F1IA 1DRUA 5FTJA 3BMNA 4DB4A 2C94A 4GP7A 1AKQA 4PYMA 2WJIA 3MAGA 3ZHUA 1FLAA 1MQSA 4KUGA 4CV1A 3NV9A 4LGVA 2VF2A 3R5KA 2W2XA 4OGLA 2QN1A 3AJEA 1KJ8A 3LLSA 3NPAA 4RPCA 4D43A 1C7EA 2PX6A 4D4GA 1EEXB 1M2OB 2G4LA 4ENSA 3ZJTA 4WY2A 1KZGB 1TC2A 3CWCA 2BW0A 1D6JA 2QUIA 3GH3A 3M1LA 3F5QA 1DG9A 1RWKA 4L50A 1W59A 4HQKA 1BKSB 1ZVMA 2IYRA 3NLLA 4IKEA 4GZ5A 3OBIA 4DIOA 3OO1A 4E4TA 2Q1TA 1WKVA 2VQSA 2AQKA 3FA2A 2L18A 3IAXA 1RXUA 3JTMA 3LDUA 4CKXA 1ZJWA 1I7DA 4BKUA 2CZGA 5DX0A 3NWOA 3RFVA 1RC8A 3GBVA 3H3FA 1WUKS 2XYRA 3CIFA 3ZZMA 1XCPA 4MQEA 4IY1A 4II3A 1ZUNA 1RZVA 4DQKA 1E6KA 2XNHA 5A6SB 2QLJA 4YQEA 5EQTA 1SQ5A 3FMPB 3LYUA 1RRFA 5BV2P 1J06A 1FNDA 4NE7A 3A6HA 5ILGA 4AY6A 2X76A 1REQB 3F1KA 3GJ8A 1U3GA 3GP5A 1NDQA 1CQZA 2QL9A 1RMTA 3L6UA 5D01A 4MDFA 2IOFA 4BQFA 2FZKA 4GI1A 4CODB 3ED5A 2HXYA 4O4JB 3B6KA 2A0UA 5BORA 3QEKA 5D3QA 4ZAYA 2IYEA 1GZ5A 5GWXA 1OT5A 1RP7A 1SVUA 2BGUA 4LOAA 2QQFA 1EK1A 3FTEA 3CINA 2CL0X 1XZMA 3VMFA 1GN8A 3S1LA 5HQTA 4MRMB 5HUQA 1PU2A 1FB5A 1WHTB 2J30A 2BC9A 3WK8A 4GX0A 1T5DX 2HU2A 2YW9A 3ESZA 4IHQA 3GLHB 3AF6A 1LRJA 4M0UA 1DWOA 5JXHA 2JBAA 2XE8A 4HFJA 4LY3A 1QHXA 4F4CA 4B3RB 3VVBA 3IMGA 2W2LA 1V48A 3O7MA 4HI0E 1JQJC 1P0IA 4WVLA 3T1QA 3WV5A 3HXOA 1LS6A 2DB3A 1F1JA 2EJCA 1RADA 2Z9CA 3U7QA 1CQXA 4KQ2A 4Z0PA 4IXNA 3SYKA 2DTXA 2C5AA 4E2WA 5J2UF 1JR3D 2BGMA 5L3ZA 4H0CA 1M66A 1FDWA 2QLNA 4PGHA 1KJIA 4UTZA 1I4OA 3BWEA 3INYA 5B1SA 4ZI5A 5KVAA 1PJRA 1T24A 4CKWB 1EUCA 3MJEA 1M2KA 3O38A 4QYWA 1AS3A 3F9RA 3VAZA 3I61A 4JIMA 4KLCA 2HA6A 3AHEA 4FEGA 4GFDA 4ZYUA 1UKAA 3O0DA 1NAIA 2G76A 1LV8A 1G8JA 2FW8A 2FN8A 1V47A 4IW3B 1EB9A 3TYXA 5IABA 5J2TF 4NU0A 3LLMA 3MGAA 3T4XA 3GVXA 1EXDA 1CYDA 3ABRB 1RSZA 1G8AA 1I1QB 1XAHA 2E85A 5K0ZA 2DKFA 5KTRA 4BVEA 1U7XA 3WXBA 2B8TA 4YMSA 4BNKA 3LNTA 1SG0A 1T6YA 1Z2CA 3H8JA 4O1MA 5FBZA 3HZOA 4A8PA 3NBMA 3GIWA 2XOEA 5CP8A 3PGLA 4FB5A 2Y0BA 4HN4B 1KTVA 3OAAD 2FOXA 3A2LA 4DMLA 3D8RA 1DAFA 4BLWA 3HLKA 1WX1A 5JDCA 2I2XB 2Q3BA 5ICSA 1YS4A 3CY6A 1Z5VA 3TF5A 3NQ41 3A32A 3F4LA 4S12A 2JAXA 1HLFA 3RSOA 2VWQA 5DN6D 5J2UB 4RKFA 1NQ5A 2V74B 1MF7A 4V0SA 1CUSA 1CQWA 3WLOA 3SVLA 3DZKA 1U7PA 3B8HA 3V2UA 1VLHA 2C78A 2UZAA 4YUYA 2VOEA 1DBRA 5C4MA 4JBHA 4BKQA 5AKZA 2WIJA 3DHYA 4IKOA 3TIGA 1K08A 2VJAA 5LQSA 3TNJA 4DUGD 2VDQB 5CT9A 1UWKA 1JEEA 3PGVA 4GPAA 2Q2VA 4B45A 1HDEA 3FJ1A 5D85A 5FBLB 4QU9A 5LXTA 4V0MA 4PS1A 5J2TB 1KA9H 1SC9A 4QXOA 1KZ7B 1BFDA 1MVNA 3NZEA 3TDNA 3F67A 4N41A 2P67A 5J4KA 1YZFA 1LBHA 4MW1A 3M6FA 1IG0A 3GH1A 3UFXB 4CM5A 3KR9A 3LPLA 1E4VA 1QM5A 2PTGA 5F1OA 3ZS9A 2H2FA 2WOJA 5JFTA 2H5IA 1MG0A 1J00A 3W3AA 4GQBA 4HDCA 4CMIA 3BFVA 1SUFA 4FQ7A 3C41J 2Q2OA 3D3WA 3OPYA 4IIJA 1KIAA 4KDEA 4N01A 4MRRA 4DZRA 4Z1OA 1GL6A 2DOKA 4ER6A 1L4LA 4NXNB 3T7SA 3IHKA 1T0HB 3JWPA 3LVQE 4M1TA 4KTTE 3C0KA 5EMHA 1AN0A 1L1EA 4L4YA 4R9RA 3WGLA 5TPWA 4DV1B 4IDDA 1YH3A 2Q49A 3TLEA 3T3NA 4O4HB 1KZHA 1YZVA 4WQMA 3QOWA 2GNPA 4AG3A 5BY2A 1WNFA 1XO1A 1AUXA 1WU8A 2I7VA 1UMBB 4MUEA 2ZM6B 3FOEC 2VTBA 4WLFA 4C05A 4HKTA 2HU8A 1R4MB 3EW9A 4EY4A 3HYCA 5H3LA 1FS4A 1RPAA 1WA5A 4OK6A 4MYUA 2C5GA 4BO1A 4ND2A 2X0KA 2YN2A 2H31A 2WV7A 5ALRA 2Z2ZA 2QNIA 4MDHA 4OHMA 4RF5A 1F51E 3N0VA 4W7IA 2X40A 4WADA 5BN1A 4TZ0A 1YB7A 4FYJA 4QYXA 3GWZA 1DFGA 3SJ7A 2R6GA 4Q00A 2YHBA 4H60A 4ICIA 4TRJA 1P6UA 6LDHA 1E79D 5KTSA 3WHPA 1C2TA 1YA8A 3MXOA 2PGNA 5DSXA 5AR1A 3GOHA 4RSHA 3UNXA 4JMLA 1GD1O 3Q7QA 1JDBB 4E6EA 1IMOA 1THTA 2PUTA 4DDHA 1OLOA 5E95A 3DG9A 2P90A 3BGDA 1C7ZA 4EHDA 4L8LA 1PDWA 2BTOA 4R3NA 3P7MA 1SWVA 3WYCA 4LHVA 121PA 1EVZA 1ULTA 5BURA 3KXIA 3OHPA 4US2R 1XMXA 4LY6A 5KNBD 4FGZA 4AXXA 4IHJA 2I9KA 2B4TO 5DNWA 2NO1A 3T95A 1ZQ9A 3GGPA 4R1LA 1EKXA 2YDYA 3VPCA 3L01A 4ON9A 2OB1A 3K6JA 1C7RA 1PZHA 4RIFA 3TBHA 1N7JA 3ORYA 2BI7A 1Z08A 3HGMA 4NKRA 1HH4A 2Q6OA 5ALVA 5AKXA 2BEUB 2IQ5A 3DMRA 1VE1A 5E4TA 4R2MA 4DEVA 3AUTA 5I8PA 1QG4A 3KWLA 2OBNA 5JT1A 4YGYA 4IS2A 5H83A 4A6EA 3V80A 4UUMA 5IVHA 1EI9A 2QVLA 3TQIA 2FZCA 1R0YA 3NDIA 4ALLA 4E5SA 5KTNA 4MUYA 1Z2PX 1HDRA 1O2DA 4MUIA 1OLXB 3WMGA 4MCAA 3EULA 4AJEA 3RT9A 1ZGBA 3QKRB 2PUDA 1JF8A 3A1CA 2I22A 4MR9B 3FOZA 2Y2VA 4ARBA 4ZZIA 1C1YA 1AMNA 1JWAB 3TG8A 1E7WA 2RMKA 4NS1A 3EG9B 3OBBA 2Z5VA 3BJIC 4BZZA 4FOPA 3SS8A 5ITZA 2YTZA 2ZQZA 3DQZA 4C6SA 3PNMA 4NI5A 4NG4A 1NY5A 1N2EA 1Z8FA 2DX7A 2FMUA 4V2IA 3A4TA 4P92A 4PHCA 4I1PA 3PHBE 1QNLA 2VDNB 3ZCUA 1S2MA 1SKYB 5CYFA 1TPZA 3KUXA 3L0IB 4L3VA 2FUNB 4DQUA 1MQAA 3D1JA 1Z75A 4HFNA 3OQHA 3FKQA 2W9XA 3K8ZA 3NTOA 5D84A 1ZEJA 2FDXA 3HC7A 2J9YB 3AOEC 1BJKA 3DVAA 4KGXA 4Q03A 4NYMQ 1H0HA 1Q0HA 3LOQA 4KI7A 5FJJA 1P7ZA 1H0SA 1NT2A 1DBSA 2OO3A 1NMSA 1SD2A 2WM8A 1SUWA 1LSSA 3E23A 3L46A 2WYIA 4AS3A 2Z8XA 2PRSA 4QPDA 3VH1A 4WI1A 4P0TA 5CNMA 4YRZA 1YK1A 1L7OA 3B9PA 3C3BA 3TM5A 1KFJB 3V4RA 1JDBC 1JAIA 1BCRA 1PVDA 3WRYC 5BQXA 4GR5A 5GOZA 2ZJZA 3OE7D 3OOEA 2YXEA 5ECGC 1RYDA 1QH8B 3U4QA 4EARA 1FSSA 2P6RA 2EGUA 2ET6A 3HGTA 4FFNA 3R0QA 1BWPA 4P9NA 4YHBA 3UMMA 1EVLA 2B1RA 4FTWA 3WNCA 1XK7A 4OI2A 2R751 3VR4D 1T1GA 1JYFA 2ZETA 1D6SA 4FDVA 1EFDN 4CF3A 5EHZA 2EFJA 3WL5A 1RLUA 1MMFB 2FRXA 2HNAA 1CJSA 5SICE 1I6WA 4MMZB 1FZQA 1Q1GA 2FSHA 1ETUA 2H8KA 2XI4A 1P74A 2Z3ZA 3EE6A 2IKSA 5JXIA 3NHJA 4HVCA 1W94A 1QHFA 1V39A