2QYSA

Structure of eugenol synthase from ocimum basilicum
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
310
structure length
310
Chain Sequence
GMKSKILIFGGTGYIGNHMVKGSLKLGHPTYVFTRPNSSKTTLLDEFQSLGAIIVKGELDEHEKLVELMKKVDVVISALAFPQILDQFKILEAIKVAGNIKRFLPSDFGVEEDRINALPPFEALIERKRMIRRAIEEANIPYTYVSANCFASYFINYLLRPYDPKDEITVYGTGEAKFAMNYEQDIGLYTIKVATDPRALNRVVIYRPSTNIITQLELISRWEKKIGKKFKKIHVPEEEIVALTKELPEPENIPIAILHCLFIDGATMSYDFKENDVEASTLYPELKFTTIDELLDIFVHDPPPPASAAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Plant protein
molecule keywords Eugenol synthase 1
publication title Structure and reaction mechanism of basil eugenol synthase
pubmed doi rcsb
source organism Ocimum basilicum
total genus 113
structure length 310
sequence length 310
chains with identical sequence B
ec nomenclature ec 1.1.1.318: Eugenol synthase.
pdb deposition date 2007-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05368 NmrA NmrA-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2qysA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 2qysA02
3CMCO 4RF5A 1DJNA 2VOJA 1YH3A 4YB8A 1GZ4A 3GY0A 4WLEA 1I32A 2CVOA 3BMCB 4K9DA 3I9LA 3UVEA 3QVSA 1LDNA 3GG9A 1BXZA 1JAYA 1QRRA 4N54A 3AU8A 5TQVA 4C4OA 2Y1GA 4Z0PA 4A10A 5CDGA 3RKUA 3LT2A 1A27A 1GY8A 4OOEA 3RWBA 4UEJA 3TPCA 1Q2XA 4FFOA 3I6QA 1VI2A 2WDZA 1U9JA 5BNTA 4E0BA 3JQCA 3K5PA 3CKYA 5DCUA 2HRBA 5TF4A 3UH1A 4PLFA 5CDSA 2PY6A 1P1IA 4Z3KA 1BG6A 2DBRA 1ZO8A 3O8QA 2FSSA 1ULSA 3RC1A 1E7WA 4XGIA 4D0RA 3IL2A 1F8GA 4O63O 1EZ4A 2OMEA 4KZPA 3A4VA 1U7TA 1LC3A 3QVOA 1EUCA 3HDHA 5JDIA 2D5AA 3JSAA 2GZ2A 4BNNA 1SOVA 2GGSA 3W4IA 3QWBA 3BMQA 1HKUA 2Q46A 4ALJA 2Y0CA 2AMFA 5A5EA 3EC7A 4HFMA 3PQEA 5ILOA 4PLWA 1EEHA 3KZVA 1HWYA 2GDZA 1WMBA 4ALIA 4FFNA 2XOXA 4S1VA 5CEEA 3W8EA 4TROA 4PG5A 4O1MA 3JD2A 1MFPA 1PGPA 1Y5RA 3ZH2A 2VNAA 2YY7A 3C3XA 4G5HA 3C7CB 3G0OA 3BTUA 1E1LA 1ZEMA 2JL1A 5HRUA 2Y1CA 1BVUA 5ICSA 3WOHA 3SJ7A 3U5TA 1N1GA 3PP8A 4E2ZA 3GMDA 4D3FA 4E5KA 3BTSA 3NJ4A 3DBLA 3BMNA 4IINA 4W9NC 1WXDA 1WDKA 3ULKA 1PQUA 3DXFA 3GPIA 4GVXA 4RZIA 4TWRA 3S1LA 3H6KA 1DOHA 1P45A 2EXXA 4LCJA 1RM0A 3LZ6A 4EDFA 1EVZA 4AJLA 2B69A 4Z3DA 2PR2A 1E92A 2CVQA 1ZH8A 5L4NA 1I0ZA 4ZRNA 3H5AA 3MCVA 4RF3A 4MVJA 5TIIA 1D3AA 5DBIA 3AM3A 4E5MA 3NGLA 4R9SA 3KYCA 5TT1A 1OC4A 1BMDA 3A14A 4IDEA 5K6AA 3I23A 3ITKA 1GU7A 3ANNA 2AEJA 4HFJA 3OM9A 3MJVA 4MVJF 4BQPA 4AFNA 2DVMA 3FRJA 7ADHA 1ZJYA 2P4HX 3CINA 3ZV6A 3PFWO 3OA2A 4PZDA 2BMAA 1X14A 4Z0HO 4YAJA 1ZK1A 3NYWA 1MLDA 3INRA 1VE9A 4CM4B 4PLHA 1MB4A 4UVHA 4ND2A 1S6YA 1PJ3A 1P31A 4NFYA 1JVBA 2CNBA 4YPOA 2G76A 1O94A 3QVTA 4OIMA 4IDBA 3DBHB 4OKIA 3FNEA 2VUSA 1FK8A 4E2YA 2AG8A 3EW7A 1NASA 2IYPA 5T67A 4D79A 1T2AA 2CVZA 1E3IA 5F1KA 4YBZA 5KJFA 1FXSA 1Z6ZA 1HRDA 3SX2A 1Q7CA 5ENVA 3VH1A 3UFXA 5A05A 4D45A 2VHWA 2H5LA 4CMEC 5TRTA 1SB9A 3U9LA 4WCFC 3PWKA 3DOOA 5LC1A 1I24A 1VL6A 3VZQA 2PD4A 3SVTA 5IJZA 4J7CA 1A9YA 2XAAA 2WTBA 5L51A 1EVIA 3GFGA 5CG2A 2O3UA 1V35A 3Q2IA 5HS4A 1UP4A 1C0LA 1E3WB 4EBFA 1JDJA 1NXQA 3ZWOA 2DTDA 4RDIA 2VRBA 4Z9FA 3WFIA 3MWDB 4BO5A 3WS7A 1YXMA 3VTFA 4L76A 2VWGA 4B4VA 3WJAA 1BDBA 1P1KA 2Q99A 5HBRA 1QV6A 2RHRA 1K89A 3BMCA 3I3OA 3LLVA 4CV0A 4DPKA 4WUVA 4K6CA 1HLPA 3NEPX 4OH1A 3WMXA 5KWEA 2EP5A 3GRKA 4KTVE 4BQRA 4TKMA 3ZWVA 2W98A 3RSHA 2GYYA 2J8ZA 3LU1A 4NBRA 4KQXA 3G79A 3PYMA 5JC8A 5T64A 1UDAA 4N5MA 5IF3A 4AG3A 4OM8A 3FSRA 4AJJA 4XEHA 2ZQZA 4HUJA 2D8AA 5A5FA 1LC0A 3E5RA 2HSDA 2UUOA 1P33A 5KVVA 3KSDO 1NFRA 1H94A 4WNIA 3DAPA 5U1PA 3LVFO 1ISGA 2X4GA 4OO3A 3DZKA 3R0IA 4ZA2A 3CXRA 2VYNA 4OAQA 3E9NA 3RUAA 3M1AA 3TDKA 3IKTA 4QQRA 3PEFA 4J9UE 4I8XA 2Q1SA 1NVGA 3E8XA 1N7HA 3GAFA 5KKAA 4BGEA 1NPYA 3K73O 2CZCA 1KC3A 3D0OA 1LSUA 1XHLA 2JFGA 2PD3A 1NR7A 2FY8A 3EZYA 1EE2A 4XZ3A 3MWEB 2TMGA 2IZZA 4I08A 4JLWA 2Z95A 1P77A 4R9RA 4WASA 4IMPA 2DTXA 1ONPA 5JCJA 2BGLA 1B8PA 1E1KA 1PL7A 1XG5A 2O4UX 2AXQA 1A9ZA 1VKOA 2ZCUA 2OP0A 3VOSA 4DMLA 5KTKA 2I9PA 3TFOA 2NU9A 4GX2A 1DXYA 3INGA 4GWKA 4WEQA 3UCFA 3OEWA 1UAYA 1BDMA 4DC1A 3OIDA 2Y05A 5HWSA 1GZ6A 1U5CA 4ZN6A 4BKQA 3NTOA 5THKA 4IBOA 2DBVO 3ANMA 3E03A 1HE5A 3LC7O 1AN9A 3U0BA 4GBJA 3L4BC 3WWZA 3GNSA 1OZAA 1Z82A 1XQ6A 4E30A 4RVHA 3PFFA 2QRKA 1LQTA 1FDTA 3NGXA 3OQ6A 5JCXA 4CMJA 2G17A 2CMDA 1LSJA 3HZZA 2E82A 3TOZA 1J4AA 4R68A 1LLCA 2DU8A 3GK3A 2A9FA 3ZWXA 1GPDG 3QWHA 3ZNOA 5DBFA 2G1UA 5I9LA 4AJ4A 1KVRA 3O9ZA 3L6OO 1NQOA 4NZ9A 4GMFA 5I9NA 1G1AA 4RGBA 1T2DA 2H63A 3T4EA 4BKOA 5CDYA 1YL5A 4JX8A 2JD2A 4I5EA 1H6DA 4TVBA 3DWFA 4UREA 4UVIA 4CV3A 2J5KA 2V6GA 5EJ2A 1BGVA 3NT4A 1BSVA 4AJIA 4CM4A 5TC4A 2V6MA 1HE4A 2X86A 4MIYA 4YDRA 1WVGA 3ZU3A 1H2BA 1NR1A 1DPGA 3C85A 3WWYA 5ICMA 3RC7A 2XF8A 3OJLA 1ENZA 2X5KO 1GCOA 5C5IA 3JQFA 3DBHA 2QW8A 4M86A 2YZ7A 1F14A 2V7PA 3MOGA 3RUEA 4DLBA 4CMIA 4ZQBA 4BGUA 3JQ6A 3QLJA 1SBYA 3CZMA 4IDGA 4LK3A 1IY8A 2XXBA 3OJOA 3WBBA 3ZGYA 5FI3A 1I3KA 2C2XA 3AU9A 3RAJA 3VH2A 1AXEA 3DBRB 2WWRA 1XIVA 1XYGA 1YBMA 1Z7BA 5L40A 1LDYA 1BXGB 2Q45A 1YB1A 2H6EA 3B20A 3ON5A 1QP8A 4Q3BA 1LDEA 2EW2A 1L7EA 2J3JA 3GGOA 1EQUA 1A7KA 3VVBA 1ID1A 3B6ZA 3CMMA 2HMVA 5IZCA 1LRKA 2P5UA 4R1NA 4BKUA 3EHEA 4J3FA 1E3WA 5T5QA 3OFSA 5FEUA 3PHJA 2Y93A 3QWIA 1GYQA 3CUKA 1EDZA 3MTJA 4RVGA 1ML3A 4J0FA 4ND5A 3AWDA 4CPDA 1NQ5A 4XQEA 4CUZA 2WM3A 3HFGA 3UW3A 2HMTA 3VZSA 4JQCA 3AOEC 2UYYA 4LRTB 3H5NA 4PCVA 3WICA 2GASA 2AG5A 2WMDA 4TVOA 2OO5A 3RFVA 4GKVA 4O5OA 4BNGA 4TRNA 2PKQP 2V65A 4Q39A 1ISMA 1P9LA 1LTHR 5BNIA 2YFQA 2GN4A 2DAPA 4KWIA 4BNYA 4XYBA 5EMHA 1UXKA 4FGWA 1GUZA 2PLAA 3KETA 4M87A 4NIMA 4FD3A 5G4LA 3ROKA 3ETDA 3I4CA 3RCBA 3NDIA 1GEEA 4PG4A 2CDAA 2AW5A 2NNLD 3RASA 4TRRA 2GO1A 2ZB3A 4NHEA 4W99A 3AM4A 2O23A 1DLJA 1SCUA 4LMRA 2QHXA 3EUWA 4MINA 3BTOA 4H7PA 5IFLA 5KJ1A 3UKOA 4A5OA 2Q49A 2VRCD 3H5RA 1YBVA 2O3TA 4XDZA 1UZNA 4IJWA 4CM3A 4RQTA 4BOYA 1VC2A 1QLHA 2O7QA 1BTOA 1N5DA 3DHNA 1MV8A 2ET6A 1UDCA 2GN9A 2PKRA 3LC1O 3RBXA 4DBZA 5A03A 3OHSX 5L4LA 2JFFA 1U3UA 4UUMA 1UP6A 1O0SA 4J91A 3UUWA 4M54A 1PX0A 2CDCA 3O26A 4J6FA 4XYLA 1MC4A 2RHCA 1ZSVA 4G81A 5B4VA 4DIFA 4CMAA 4I9HA 3H3FA 3SXPA 1QG6A 3PJGA 3WSWA 3K30A 1QORA 5A02A 2SCUA 4YR9A 1PS0A 1YB5A 3QWAA 3U09A 1WP4A 5IDQA 3RUFA 4HP8A 3KSZO 3B1FA 5KKCA 3L9XA 5JAIA 2NTNA 4B7XA 1KEWA 2AA3A 1HDGO 1MG0A 2IE0A 1MXFA 3GEMA 3KLPX 3HDQA 4YRDA 3V2HA 3LQFA 3WLEA 3W6UA 2P9GA 5C3MA 4U5QA 4DA9A 1DBVO 5TLSA 4Q3NA 1R0LA 1VL8A 4II2A 5A1TA 3PJFA 3LT0A 3PIDA 1PGOA 4R51A 2VHZA 5L9AA 3DC2A 1B15A 4YJDA 4A0SA 5AYVA 1CF2O 1C3VA 4IIVA 4PG6A 3EMKA 1I2CA 3ZNPA 3HDJA 1GADO 3IAHA 4OSPA 1T4BA 4BS9A 2VTDA 3D4PA 4FJ1A 4WLFA 3ROPA 3DOJA 3GDFA 1P3DA 4E3ZA 1XCBA 1OI7A 3GMSA 3MJSA 4BMSA 1SMKA 4BO9A 2O3SA 1NPDA 3IIEA 3FPCA 3FN4A 5L53A 5B4UA 3QY9A 4W9NA 4Z9YA 5CPFA 3ASUA 3TNLA 3JQAA 3G49A 4F46A 1KVQA 4RL6A 1M2WA 1Q1NA 5F1PA 4DREA 3BHJA 5JYDA 3WMWA 1ZIDA 2NQ8A 4BMVA 4PG7A 2Y1EA 4DLLA 2OZPA 2W2LA 4WOJA 1SB8A 4BO7A 2ZTMA 5TX7A 1DSSG 3RC9A 3H9GA 4OQZA 2NU7A 3RFTA 3BHMA 1RM4A 4TQGA 3OBBA 3DBRA 3H8VA 5L7WA 4FFMA 1EVYA 3OETA 3DTTA 3OJFA 1PJ2A 5TNXA 3QQPA 5CP8A 1BXGA 1PZGA 3S2GA 1ZXBA 4JXKA 1I01A 3I5MA 2B4TO 1MGOA 4AL4A 4CLRB 4FB5A 1NBOA 4ZQEA 5BNFA 4DC0A 2YHUA 3FTPA 4D46A 1U8FO 4GWGA 1C1XB 3VC7A 3Q6IA 3VVCA 4HNHA 2P91A 4WECA 3N74A 4MVJI 5CDUA 2B36A 2I66A 4PZCA 1PJQA 2HCTA 4LN1A 2FHSA 4P4NA 4B3IA 4JP2A 1ZJZA 3NT5A 3WQQA 3O38A 1UDBA 2W2KB 3P2OA 3PHHA 4FFLA 3PVZA 1DLIA 5DP2A 1QYVA 2HK8A 8LDHA 3BTVA 3GC6A 4QFCA 1V6AA 4K6FA 4DYVA 1LNQA 2Y1FA 4RPHA 2Q2WA 5JW6A 4R1TA 4GSLA 4BMNA 1YDEA 1NQTA 2PZKA 1W0CA 3GG2A 1GQYA 3HADA 3JQ8B 4IGFA 1CETA 2EWMA 4GQAA 3PDUA 1AHIA 4XQGA 2O2SA 2HQ1A 3INTA 3L6DA 3OMLA 4BO0A 4XRGA 2HK9A 4FIZA 3Q9NA 4L4SA 4B7CA 1YGYA 1Y9AA 3IKVA 4GGPA 2QX7A 1ADCA 5AOVA 2NU8A 2JHGA 5EQDA 2GN8A 1YL7A 4ZQHA 1HDCA 1J6UA 4RLHA 3S2EA 4K26A 1A4IA 3EDMA 4GI2A 5L95A 4NU6A 3N58A 3SBOA 1F06A 2YV1A 2P2SA 4DRYA 1TEHA 1MUUA 1D4FA 4AJ1A 2OL4A 3B70A 4J49A 2GZ3A 5TGDA 2PZMA 2X58A 4NFSA 3ENNA 2D0IA 1OFGA 4CL3A 1CWUA 2OHXA 2Q3EA 1XLTA 2LDBA 3D5TA 2DFDA 2BGKA 3LC2O 3LF1A 4DQVA 1YRLA 4YAEA 3PIIA 4BO8A 4URFA 5KVQA 4P4LA 4DLAA 3OIGA 1H6AA 3S2FA 3GGPA 3COSA 4ONEA 1RKXA 4CQMD 3BYZA 2OBNA 1XEAA 4UVGA 5DBGA 5JAQA 3V5NA 1ULUA 2ZB8A 1R15A 4IDDA 3PGJA 1ZK2A 2D59A 1Y1PA 2O48X 1E5QA 4R4JA 1I36A 2I65A 5DULA 2DFVA 1ENYA 4MVJP 1O6ZA 2EIHA 4A2CA 3WNQA 5LDHA 4QT0A 1ZSNA 2PV7A 1DIRA 3DZHA 2OOSA 1I30A 3I9OA 4J1TA 2VZ9A 1MP0A 4D43A 1E5LA 4GAEA 1U5AA 2Z5LA 5TS3A 3T7CA 2D3TA 1TT5B 3KLMX 2H1SA 2G5CA 1LXCA 1K5HA 3FR8A 3NKLA 2C54A 4TMFA 3WQRA 1ENPA 1Y7TA 2DKNA 4FCCA 4NBVA 4DPLA 4XB2A 3C1AA 4J7UA 3PYLA 2AHRA 4RJTA 3X2FA 3S2IA 3TWOA 4DXHA 5HTOA 2ZB4A 4XX0A 3WJ7A 1K2WA 3PHGA 3C1TA 1J49A 1RYEA 4XIJA 1T1RA 4QUKA 5F3RA 2NTJA 1P0FA 2O7SA 3H65A 1F0YA 2CY0A 5ER9A 1PSDA 1U2GA 3L4BA 2DLDA 4DIOA 1RM3A 1QYXA 5T8KC 4JP3A 3L4SO 4U6SA 3C1OA 3UAGA 3EGOA 3QSGA 4BL5A 1U4OA 1YDWA 4MOWA 4JBIA 5JO0A 2Q1UA 4MVJH 1YVEI 2FR1A 1MX3A 1ORRA 2WD7B 4IQGA 3GZNB 4OYRA 5DZSA 5MGBA 3T7EA 4CLOB 4PRKA 3WFJA 5B1YA 1C1DB 1LX6A 3OQBA 1JW9B 2BF7A 3ORFA 4YT8A 3M2PA 4JJFA 1PJCA 1Z75A 3GZ4A 1C1XA 3G3EA 1B16A 3FBTA 2ZQYA 1N7GA 3KV3O 3CZRA 1ONOA 3RVDA 1JU9A 4J4TA 1N1EA 3ZW8A 4IJVA 3KUXA 1AHHA 4YCAA 4WLNA 4A26A 2BFAA 4ROSA 1YJ8A 2GD1O 3AW9A 5CEJA 1K0UA 4FR5A 2Q4EA 1JKJA 2O3JA 2W2KA 4UUNA 4B4UA 1IE3A 4DGSA 4IZHA 4XR9A 3E9QA 3ZZNA 5ITWA 4S3MA 2CUKA 3ZHZA 4OXNA 3BZUA 3WSVA 1FDVA 4HADA 1EQ2A 1E3SA 1O9BA 2POQX 1JWAB 3CH6A 3GRPA 4Y67A 4RO0A 5I9MA 4R5HA 1SEPA 3JQ8A 5IAAA 4RVDA 5AXCA 2A35A 2X5JO 2R00C 2QYSA 4YWJA 4GLOA 3JYOA 5EN4A 1NQAO 1SAYA 1T2CA 2A4KA 4D3SA 2PFGA 2P4QA 1VJ1A 1YOVA 2BHLA 1R0KA 3QRWA 2A92A 4MJLA 4DUPA 3RU7A 1KYQA 3LYLA 4EJ6A 2B5WA 2WEKA 1FDWA 2X0IA 3CEAA 3D4NA 3DO5A 2FR0A 3C7DB 4M89A 4GL4A 4CM1A 5FWNA 4MIOA 2I6TA 2Y1DA 4NBWA 3TN7A 4IIUA 4DTIA 5L7TA 2BFMA 3GVCA 1HYEA 1PTJA 1JLLA 3AOEA 3P19A 1Q0QA 1V3TA 1KS9A 4L73A 1H5QA 5CDTA 4IJUA 1WDMA 1KERA 1EBUA 2VZ0A 1XU9A 1A72A 3LSYA 1H6BA 1R16A 3NTQA 3Q2KA 5L4SA 1YONA 2IODA 2OORA 1ADGA 1X7GA 1E7SA 4XQCA 4C7JA 1M6HA 3ICPA 4FW8A 4NR0A 2G82A 2DPHA 1VPDA 2EV9A 4Z6KA 1EFKA 1ZVMA 1SNYA 4I9UA 3DEYX 1HDYA 4J0EA 1BRMA 1T24A 1HF3A 4MP6A 2IEDA 5JDCC 1T2FA 2CSUA 2YUTA 2EG9A 3QP9A 4HBGA 2E48A 3WGGA 3RD5A 3B1JA 1P74A 3KHUA 2HMUA 1ZKMA 4RORA 4FDAA 4JGBA 1KVTA 3SJUA 3KYDB 1E7RA 2HU2A 1U7HA 2JCXA 3D3EA 1MA0A 3UN1A 4XA8A 1Q0HA 3PLNA 4LCEA 3D64A 2IXBA 1TB4A 3WX0A 4EI2A 1EK5A 2PNFA 3Q1LA 3ADPA 1TT5A 4FGSA 4XYEA 3I52A 4J90A 3AY3A 1DJQA 3BIOA 2Z1NA 2NVWA 3U4IA 2J3IA 3DONA 3B1KA 1R4MB 1SPXA 2JCVA 3M1LA 3TZCA 1LDGA 5EQFA 3VDRA 2PH3A 1VLLA 3AOGA 1RYDA 4II3A 3GF4A 2I99A 3IUSA 4KDFA 3AM5A 1VL0A 3S8MA 5CPBA 1EBFA 2GR9A 2QRLA 5JC1A 1OBFO 4FQ8A 3WBFA 4AICA 3WIDA 1ADBA 1VKNA 1QYWA 4YT4A 4J1SA 4RDHA 1HZZA 4R3WA 4QFDA 3K31A 2EF1A 3FBGA 3PGXA 1ADFA 2FZWA 2ZKLA 1O8CA 5G0TA 3PRJA 1UZLA 3C24A 4E6PA 4PG8A 2I3GA 5JE8A 1OC2A 5CG1A 1Y5MA 4WNCA 4DIBA 1HDZA 1E0DA 4QO7A 4PZEA 4GGOA 4R69A 4J2HA 1I8TA 1DC5A 3DTYA 3K2EA 2DC1A 2JHFA 4QECA 2X7HA 2WD7A 3VHRA 2VWQA 3GZNA 3UICA 4PN3A 1SO8A 4CLOA 1OAAA 3V1YA 4BNKA 4FS3A 1PEDA 2BH9A 3IP3A 1C1DA 4NMHA 4EJ0A 5T6BA 1E7QA 1I10A 4L4XA 1XELA 2E4AA 1O95A 3H9UA 3GUYA 2VYVD 4IGEA 3QV1A 4R54A 2RBEA 3N7UA 3P7MA 4BO6A 2RCYA 5GY7A 4FOSA 3QW2A 4DVJA 4ZQFA 4R1SA 1P0CA 4BV9A 1PGNA 2GCGA 5IXYA 2X23A 1GYRA 3K92A 5MDHA 1B7GO 1DO8A 3F5QA 4ZICA 5DNAA 3WQSB 4IS2A 2UVDA 1L7DA 2AE2A 1EE9A 4NPCA 3DZGA 1NFFA 3DHEA 4BO3A 3IS3A 5GMOA 4AJKA 2O2YA 3F4BA 2E37A 3TL2A 4PLGA 4RQUA 2CDBA 4EW6A 4TZTA 1XQ1A 1KVUA 2A94A 1P1FA 2B83A 3GVHA 4KUGA 4PFJA 4FOOA 4HKTA 4IXWA 4LRSB 1ENOA 5AXBA 3JYLA 3RBVA 2LDXA 4JROA 4U7WA 2G0TA 1HDOA 1CQJA 1LLDA 1RWBA 1S7CA 3DFZA 2EKQA 4D3DA 4ND1A 1R0SA 1GL3A 3SLGA 3JQ9C 5C37A 3O4RA 1CDOA 1U3TA 3W8DA 1DHTA 1NAIA 1X0XA 3HUDA 1Y8QB 4YXFA 2C29D 3DAGA 4FBGA 4TSKA 3QVXA 1H9AA 5JS6A 4OJNA 1LRLA 4A73A 2Z1MA 4GLLA 2ZYGA 2NUAA 3H2ZA 4JJIA 3I9NA 3R1IA 1YBAA 3U4DA 1T25A 3RJ9A 3ONEA 4Q9NA 3DOCA 4K1LA 4YTEA 2YV3A 1XKQA 5F1OA 4N7RA 3GQVA 5DN9A 4BVAA 2FRDA 3OF2A 5ADHA 1K6JA 1JKFA 2B0JA 3EK2A 1I3LA 2P5YA 4E31A 2I5PO 4XCVA 2ZYAA 3QIVA 4CQLB 1FDSA 1AGNA 2QG4A 1AUPA 2VHXA 3WIEA 2IYOA 2BD0A 4BUCA 2GUGA 1LU9A 4EYEA 3GNTA 3A1NA 1GFSA 9LDTA 2VT2A 5A3VA 2ZTUA 2PGLA 5IZ4A 1D8AA 1YS4A 2VRCA 1Z45A 2GNAA 4Q3AA 2YW9A 2OP1A 3ZWMA 4J2OA 3EY4A 2ILTA 4YACA 4FSHA 4BNLA 3PJEA 4Y6PA 3K96A 5J23A 4J1NA 1T4DA 3GA0A 4HFNA 4LVUA 1RPNA 2UUPA 3G1UA 1B2LA 1WMAA 5AXAA 1RJWA 4BV8A 4RF2A 2YJZA 1VJ0A 4CLXA 4D41A 4F45A 4OGWA 1QSGA 2HRZA 3ITDA 4BNMA 3A28A 4HWKA 5EESA 1JVSA 3WGYA 2JAHA 2VTEA 3H9QA 4WKGA 5JO9A 4CQMB 5G4KB 3WLFA 1ARZA 3L07A 2HMWA 1LA2A 2DTEA 1N2SA 4I9NA 2CF6A 5GZ3A 2DUUA 3AY7A 3ZWNA 1LBEA 3E6AA 5DCWA 2Y1OA 3ZNNA 2X5OA 1ZMTA 5COBA 5FF9A 3CSDA 3A9WA 3ZCXA 4F3YA 1GAEO 4XD2A 3BMOB 1KC1A 4OXYA 2YQ5A 3IOYA 1Z73A 1LUAA 3NDRA 1ONNA 5K9ZA 1H93A 1PL6A 1U3WA 1PZFA 3HN7A 3WTCA 3X2EA 1PR9A 3ADOA 4F6CA 5BSGA 1Y6JA 3E48A 2J5QA 3D4OA 3KRTA 5JLAA 2NWQA 3TZQA 2AQKA 1IPEA 4YRAA 4RVSA 4A7PA 1DRWA 3GEGA 3ZW9A 1CERA 2O3RA 3C7AA 4J9VA 4Q3CA 4H3VA 1Z7EA 2PD6A 3FPLA 3G1TA 4W7IA 4LISA 1K6XA 4D0SA 5IDXA 3TOXA 2WE8A 1PWZA 2EP7A 3OJEA 3Q3CA 3RROA 4D44A 1A5ZA 2HLPA 3DDNA 4PLCA 3ZHXA 1A4UA 2PKQO 1U8XX 2X8LA 4N5NA 4OOFA 3KXDA 3DR3A 4IDAA 3TF5A 4ID9A 3NDJA 3JD4A 5DDIP 1M75A 2B37A 3OP4A 3V2GA 1EDOA 4CJXA 5EIOA 2J3KA 3NX4A 2O3QA 3HWRA 3QJ5A 3C8MA 4WEOA 4I5FA 4QSMA 3UCEA 3IDSA 5T8KA 2YDXA 1JTVA 2D5CA 1B8UA 4P8RA 3EVTA 3JYNA 3TFQA 1IULA 1GDHA 1SEVA 4FJ0A 3WGIA 5TSDA 3W4KA 4OXKA 3IJRA 1EK6A 2YHIB 5DF1A 3JCZA 2B4RO 4ZU3A 4NH4A 4ND4A 2AEMA 1KVSA 1X1EA 2EGHA 5GZ1A 2OGUA 4AVYA 2OBYA 1N8KA 3JQEA 2RAFA 2W90A 1DC3A 5KJ6A 2GPTA 3BA1A 1T1SA 2Q1WA 2NSDA 3GR6A 5IN5A 4OL9A 2ZB7A 5A9RA 3I9JA 4O59O 1UZMA 1WLYA 4CM9D 2DBQA 1DRUA 5CHEA 3LT4A 4NU5A 3ANLA 1Y8QA 4ZQGA 1ZXLA 3ZU4A 3KTDA 3OJ0A 5BT9A 3RU9A 2V6BA 3DHYA 2C7VA 5L45A 3ZV4A 4NFHA 1HZJA 4UUOA 2XXJA 3FI9A 3LK7A 4RV9A 5A04A 1K3TA 4W7HA 3RC2A 1TVEA 5LDGA 1VSVA 3GGGA 2NM0A 3F46A 1P1RA 3D1LA 2PH5A 5JY6A 2BGMA 4ESOA 3JQBC 4JCOA 4A27A 4E2WA 5JYEA 4GH5A 5HS6A 4DL9A 3AJRA 3AFNA 3GN2A 3PYXA 1NAHA 2V6FA 4CQLA 2R00A 1FJHA 5EPOA 4OQYA 4JN6B 3G17A 3LF2A 1ZW1A 4CMGA 1EVJA 2Y99A 5I7SA 4ZD6A 3DBLB 3BMNB 4R3NA 3MOIA 2IZ1A 1LJ8A 4XIYA 2D1YA 5F21A 1HE3A 3ZWCA 1IZ9A 3LT1A 1DHRA 2JKVA 3GN1A 2DM6A 4EITA 3AUAA 2RH8A 2QZZA 4Y8VA 4XR4A 4CM8B 4U0JA 2OUIA 1GEGA 1VM6A 4CLEA 5F5NA 3HN2A 1M76A 4YJFB 2GN6A 3M6IA 3GDGA 4R01A 2H9IA 1QXSA 2VZ8A 1CEQA 1B3BA 5A9SB 1LEHA 3OH8A 3VPSA 1NP3A 4CQMA 4RVUA 3KO8A 5G4KA 3GLQA 4I1IA 2B5VA 2NV6A 3UXYA 1PJLA 4YAGA 3E18A 4BGIA 1TT7A 3DZJA 4K28A 4BGVA 2X22A 4PLTA 2F1KA 4O6VA 2FMUA 5JPIA 2X1HA 4ALLA 1NPTO 3GT0A 4ZGWA 1Q7BA 1HDXA 1QMGA 1BVRA 1VRWA 1UXGA 2EKPA 4XYGA 4ZRMA 1I2BA 1N9GB 1E3EA 4XRRA 4EUEA 4XDYA 5C7OO 4C7KA 6LDHA 4MO2A 4P38A 4BKRA 5JDCA 1IUKA 2Q1TA 3L9WA 5COAA 3BMOA 3W8FA 4GX1A 4M49A 5ES3A 3U4CA 1E6WA 1IHYA 2NTVA 4KUHA 4MP8A 3V2UA 4TRJA 5F5LA 3FNFA 3RI3A 2W4QA 4MVJG 1Y81A 3OA0A 3S55A 4WLOA 1IZ0A 2YDYA 2EKLA 1HXHA 5JMPA 4ZJUA 2ZJ0A 2AE1A 4AJEA 3TQHA 2BI8A 2JD1A 4LGVA 4YRBA 1GV1A 4PLVA 5AXDA 3PQDA 2Q2QA 3ZU2A 4B4OA 3U49A 4YJGB 3AI2A 3DL2A 1DB3A 1XDWA 2HUNA 4EZBA 1PZEA 3WTBA 4A03A 4CR7A 4CM5A 1K6IA 3PI7A 4Z9XA 1YB4A 2QZ9A 3RUIA 1SZJG 3ENKA 4RPLA 3RUDA 3RBZA 2WYVA 1XWFA 1NFQA 3D5QA 3IC5A 7MDHA 1FMCA 2I3AA 3DAFA 3L0DA 2NVUB 1EUDA 4HV4A 1KETA 1PWXA 4UEOA 1NVTA 3NJ8A 4M8SA 1NTOA 4Q3EA 2FR8A 4BNJA 3AUSA 3GDOA 4BO4A 5DOZA 1FF9A 3PHIA 4G2NA 3JD0A 3CIFA 4XKJA 2GRAA 4CL8A 4EJMA 1NWCA 1V3VA 2YHIA 9LDBA 4WOKA 1UR5A 4IDCA 4YT5A 5EL0A 3R3SA 3ZV3A 4FJ2A 1P1JA 4ITUA 1QYCA 3PK0A 5G0SA 3WYBA 2AQIA 5IXSA 3H3JA 2WE7A 1XA0A 3MJ4A 2HDHA 4EGFA 1Q0LA 3CPSA 4P22A 1GQQA 2QRJA 1PS9A 2FN7A 3ETGA 1GCUA 1B8VA 3ABIA 1WPQA 5BSHA 5AVOA 5A9TA 4MKRA 2O4CA 3IUPA 2VN8A 3TZ6A 4F6LA 2X9GA 4XYMA 2EJVA 2C82A 2DBZA 1QLJA 5FYDA 1XR3A 3DMYA 3E1KA 5G0VA 1Y8RB 2IEBA 2IDZA 1GTMA 4EUHA 4CLRA 3KM0A 1DEHA 4KQWA 1DC4A 4J4BA 3JYQA 4LW8A 2R6JA 1R6DA 3ZWWA 4NJMB 3JTMA 1W73A 2HAEA 4IZIA 4IUYA 2JD0A 1JKIA 2PGDA 4BNFA 2E49A 4CMKA 2DQ4A 3DQPA 3L6EA 4P4GA 3WGHA 2Q4BA 2DT5A 2NU6A 4OHUA 2HMSA 4U0KA 1WDLA 5DCYA 4B8WA 1YQXA 4N18A 3ZV5A 5I7EA 1HYGA 5I7FA 4XQ9A 3GEDA 3ZWPA 2IRWA 3F9IA 4W82A 4ALMA 4BNUA 5FI5A 3KSUA 4I5DA 4NK4A 2EHDA 2ZATA 3KBOA 5KNLA 3FNHA 3JQ9A 4INAA 5KJEA 3RJ5A 3WDSA 5JMWA 1IHXA 1WAMA 2HK7A 1L1FA 3U4HA 5IDYA 1DRVA 3K8ZA 5JY1A 2NVBA 4CM8A 2CFCA 4XJTA 1Y9EA 1NYTA 2ZJ1A 4QX6A 5H83A 8ADHA 1UXIA 4MDHA 4KTTE 1G6KA 3F1LA 2FOIA 5G0UA 4NNJA 4YJFA 2PTGA 2C59A 1OMOA 1LDMA 2FSVA 3TZKA 4WLVA 4RF4A 1V0JA 5JXWA 5A9SA 3HDYA 2X0RA 1AE1A 2W8ZA 3DBVO 2EW8A 2I76A 3ZHYA 1TI7A 3ZN2A 2GF2A 3JQGB 3PWSA 4RPJA 2AEFA 1SC6A 3HG7A 4PIVA 3SEFA 4J4HA 4ZHSA 2BELA 2VUUA 1WW8A 3VPGA 1N9GA 1TXGA 2YV2A 1O89A 5HA5A 2Y67A 4BO2A 4E5PA 4XGNA 2NLOA 3I6IA 1YQGA 4IM7A 4PRLA 4YVFA 3P5SA 4TRMA 1GZ3A 4CMBA 4X54A 4MVJD 4NQZA 2HKIA 3U62A 3UOGA 1P1HA 4CMIB 1ZEJA 3NTRA 5AQ1A 3UCXA 2O50A 1XSEA 1KEVA 3WR5A 1PJTA 3T4XA 1EFLA 4GSKA 3VZPA 4HY3A 4DBVO 3H9EO 4EUFA 3RFXA 5L3ZA 4RVFA 3QE3A 2VWPA 1E1MA 4JK3A 4MIEA 2FZEA 4LVCA 1B0AA 2C5AA 4YJGA 4UVDA 2Q2VA 3VAZA 4Y6SA 3FTNA 1HTBA 4HNGA 3W6ZA 4KOAA 2D2IA 1PGQA 3FD8A 1PJSA 2CD9A 3MJTA 4EEXA 3GVIA 4HXYA 4E2XA 3ZU5A 3HNPA 3R6DA 4FPXA 3Q9UA 2Q50A 2BFOA 5ITVA 2PWZA 2YFHA 3I9KA 1E3LA 3V8BA 4IMRA 3HQ4O 1WWKA 1CJCA 4E32A 3D7LA 3HSKA 3ROQA 4DPMA 3JQ7B 1H6CA 1PIWA 3MTGA 2NVUA 1PGJA 1DIBA 2EJWA 4LSWA 1ZNQO 1M67A 2RH4A 4YQYA 4L75A 4BNWA 3O03A 2IXAA 2X0JA 3HHPA 3RIHA 4BNXA 1F12A 4ALKA 5IN4A 4MPDA 4Y98A 1WZIA 3OEYA 4GMGA 2P9EA 4QEDA 3UGKA 3DFUA 5B12A 1E77A 3OSUA 4BNHA 1X1TA 4PVCA 5KCZA 4UUPA 3RUHA 3WGZA 1ZK3A 2VYVA 5B37A 2ZK7A 1IYZA 5TT0A 1YO6A 4R5MA 1VJTA 5ENDA 2EGGA 2GERA 1DIGA 2Y0DA 1LRJA 4IJKA 3QWFA 2C5EA 3WGOA 1ZBQA 3F3SA 3ZDFA 3SC6A 1HSOA 1NX6A 3TZHA 1JQBA 4BNVA 3E82A 3HB4X 3LDHA 4RPGA 1B3RA 1UH5A 4H16A 3SC4A 1A71A 4OMUA 3F6YA 5G2OA 2FPPA 1E7MA 1DAOA 1DDOA 1U1IA 4BIIA 4B3JA 3P2YA 4IPTA 4H15A 4O0LA 1QV7A 1VSUA 1DIHA 1Y8RA 2VQ3A 4IS3A 4E4YA 3K9QO 1D7OA 2ZTVA 3AY6A 4ZVVA 1SOWA 1GUYA 2VHYA 1IB6A 2JCYA 1PS8A 2PZJA 3NUGA 4AJNA 1JN0A 3PXXA 5CAEA 4NJMA 1F8FA 3I83A 5JDIC 4CM7A 1MG5A 1UAGA 1I3MA 1NHWA 2FPGA 4BNIA 5KVCA 1B14A 4BNZA 3QHAA 2VYND 3PPIA 2X9VA 2EEZA 1T26A 1HLDA 3TL3A 1QR6A 1TLTA 5G0WA 2X0NA 3H4VA 3IMFA 4DQXA 3BHIA 5GZ6A 5U4QA 2BFPA 4Z0TA 2QIOA 3WNVA 3WXBA 5BSFA 2QQ5A 4NK5A 3BAZA 1N92A 4CR8A 1R4NB 4N5LA 2J5RA 5BQFA 2BI7A 4PLZA 4J43A 3JYPA 3PJDA 3R3JA 1H0KA 3D3WB 4AJPA 4W6ZA 4KP7A 5HM8A 1X7HA 4AJOA 4OSOA 4MKZA 3GVPA 3FCOA 4DQUA 4GX5A 1DAPA 4J7XA 3VPHA 2ZIZA 5JCJD 2VT3A 1ISFA 3BXXA 4PVDA 1PL8A 1GYPA 5FFFA 4JNKA 3VKVA 2UAGA 3EYWA 5A4DA 2OXIA 2DPGA 2PZLA 1PQWA 1T2EA 3GFBA 3DMTA 3K6JA 4MVJM 3TSCA 5I7VA 1MXHA 5EERA 3JQGA 4U8GA 3JQBA 2IZ0A 2PGJA 2HJSA 2Y0EA 3OICA 1UUFA 3KVOA 1H9BA 1LDBA 4QO8A 4WGGA 3WB9A 5U9CA 4BKPA 1EMDA 3QA9A 5H81A 1NVMB 4WJZA 4CV2A 4R41A 4NBUA 3F1KA 4CODB 4YYZA 3W1VA 1G0OA 1X0VA 4I5GA 2VCYA 3JQAB 1HE2A 4J16A 4FFPA 1PZHA 1LI4A 4B7UA 1LQUA 5K6AC 4NG5A 4IXTA 2ZCVA 4UEKA 5JNLA 1BWSA 4IQ8A 3ZNQA 4JIGA 2B4QA 3NV9A 3PLRA 1R12A 2WYUA 2GZ1A 1TA4A 2UDPA 4E12A 3MJEA 4FC7A 1XU7A 2FWMX 4L0QA 3DB2A 1X13A 4FC6A 2WD8A 4UAGA 5TJHA 4CUKA 2CF5A 5C7LO 4NDNE 4PLYA 1MC5A 3VKUA 4D7AA 3OIFA 1I2ZA 1UP7A 1E6UA 1LLUA 3ONFA 4NI5A 1LSOA 1I33A 4YJHB 2YQ4A 3KYDA 5CFZA 3AK4A 1NNUA 3AI3A 1F17A 1IPFA 3ONDA 3GHYA 1IOLA 2VUTA 3ZHBA 1IL0A 1X15A 2P9CA 1KY4A 3E9MA 3GNQA 3Q11A 3F4LA 3JQ7A 4TZKA 1BXKA 3ZI0A 4E33A 4ILKA 1YQDA 5BR7A 1GV0A 1MFZA 4KMSA 1BHSA 1PJBA 2C7GA 2WYWA 1DFHA 3M2TA 1R4MA 4FFRA 4E13A 4E5NA 1FDUA 4GPD1 5THQA 1YJQA 4BNTA 3RKRA 5DOVA 1GQ2A 1BW9B 4WE3A 4CR6A 1ZK0A 1I3NA 1D1TA 5COQA 4YT2A 1DC6A 1W4ZA 4LMPA 1M66A 1CQIA 2JAPA 2C0CA 4WLUA 3Q0EA 2GLXA 1PJ4A 2JJYA 3W4JA 3TRIA 4WCFB 1V9LA 3V1UA 3PTZA 1R66A 1X7DA 1D1SA 3WG9A 4M1QA 1YL6A 1G0NA 1E6EA 3EZLA 3A06A 4RCVA 1C0PA 3L77A 4CMHA 2FP4A 1C0KA 3ICCA 2I67A 3KEOA 3EAGA 1J5PA 3V1TC 3RUCA 1CIVA 4WPGA 4Y6RA 4KWHA 4B4WA 3FF4A 1PQPA 3F5SA 4NBTA 1RM5A 2OFPA 2XPCA 3KYBA 4RLSA 4UULA 4Y9DA 3VPXA 3PDJA 1YWGO 5DT9A 1OOEA 2D4AA 5A06A 4KDEA 4YAIA 3ASVA 3JV7A 4XB1A 1GPJA 1U28A 2GSDA 4KUEA 4L74A 4L9RA 3MZ0A 4FN4A 2FPIA 1DFIA 4CM9A 4ALNA 2VHVA 5I8WA 1CRWG 1ZSYA 2J3HA 2VWHA 4R1UA 3NT2A 3ZWBA 1GUFA 3H9JA 1CYDA 3KB6A 4ND3A 1Q7GA 1NM5A 4XJSA 5BSEA 3H2SA 1C0IA 3U3XA 4GKBA 3PWZA 4HX5A 4MP3A 1C14A 2AQ8A 1R4NA 5KIAA 4PLPA 4EEZA 1ZUD1 4E5YA 4QXMA 3D3WA 3UF0A 4L4RA 1KBZA 5CEFA 2F00A 3JQDA 3GHHA 5I8ZA 1AXGA 3SLKA 1UXJA 2JFHA 4CMCA 1UJMA 1ZMOA 3CTMA 3FNGA 3QVWA 3O8QB 2E6UX 1GR0A 3ZWAA 3FWNA 1KEUA 4MKXA 3GPDG 1YE3A 2J6IA 4CLDA 1HDRA 1KIFA 2ZTLA 4G65A 4IDFA 4YA6A 4CLHA 4IY1A 4RPKA 3WGQA 4DYDA 4DWVA 2DUWA 1HT0A 5IDWA 3OQ1A 4WCDA 1R37A 3BMQB 3FHLA 3K2BA 1UXHA 2X9NA 1NHGA 5KOIA 1HETA 5TJ9A 1M6WA 1E3JA 3KOUA 4BB6A 1KY5A 4RZHA 3RQSA 3DMTC 3AUUA 1J0XO 3JD1A 4GX0A 4W4TA 2BKAA 4BB5A 1LSSA 3STHA 3NAQA 2BLLA 1H2HA 2X6TA 3DZIA 3CE6A 5B4TA 1YKFA 4UVEA 1B26A 1U2DA 1JWBB 1P44A 4PGFA 2QYTA 1HSZA 5L7YA 3ST7A 4Q3DA 2PA3A 3VH3A 4AJHA 2Y68A 3GOHA 2VNSA 1XGKA 3PQFA 1WZEA 1V3UA 3AUTA 4AJ2A 4B79A 1NWHA 3JQFC 4YJHA 1ZCJA 4HFRA 1O5IA 5K0ZA 3GAZA 1LLQA 3NRCA 4JBHA 3JQAD 4E21A 2B35A 4YEDA 4DMMA 3DZFA 4R16A 4TKLA 4B8ZA 5KJCA 1U3VA 3F47A 4MVJE 3LLSA 2HJRA 2WSBA 3PZRA 2P68A 2RIRA 3DZBA 3JD3A 3VDQA 2W2LD 2R2GA 3KYCB 4WK6A 4M55A 1Z74A 5C7IO 3MJCA 4CUJA 2YYYA 4XWYA 1DFGA 3ETEA 3GH3A 2HO5A 1KEPA 5A3JA 2TMDA 2Y66A 1W6UA 5T57A 4BHTA 2ZYDA 6ADHA 2BRUA 3HFSA 1EUZA 1E1NA 3HE3A 1ISHA 1BW9A 3I9MA 2C07A 1QYDA 5IZCC 1JAXA 3IQDB 4J1QA 4JJGA 1A7AA 3VH4A 2NQTA 4IQ0A 3IP1A 1QKIA 5H82A 3VTZA 3HJAA 4CMEA 3AFMA 5JSFA 5JFOA 4WCFA 4YQZA 5JBIA 3GUCA 2NADA 3GVXA 1YOVB 5ER6A 3WGTA 4BO1A 3E5MA 3WYCA 5JAMA 5KVSA 2C2YA 4D42A 3UHAA 3VPFA 1V8BA 3FWZA 1PU2A 3MEQA 3PZBA 4U6QA 3HB5X 4QTZA 5IG2A 2AQHA 1W8DA 3TJRA 3I4FA 2C20A 2UV8A 3EVNA 1HYHA 3PHLA 1E7YA 4B3HA 5EINA 3FR7A 4LSMA 1ZFNA 1U4SA 4OKNA 1ISJA 1ZZEA 3WYEA 4NJOA 1DIAA 1JA9A 3IJPA 2EERA 3KEQA 1HL3A 2NACA 2PK3A 3OECA 3I1JA 3H7AA 3ROMA 3ZWYA 4CM6A 3AI1A 4XGKA 4JBGA 5LCXA 1WNTA 1ZK4A 3VZRA 5JAZA 2WJPA 1ISIA 4GVLA 1GD1O 5ILGA 2VOEA 5DP1A 1I5RA 4L8VA 4YAKA 1HEUA 1KOLA 4CV1A 1PR3A
chains in the Genus database with same CATH superfamily
3CMCO 3OLQA 1IQ0A 1P18A 2VOJA 1YH3A 1NVVR 3KQYA 4A0RA 4G0PA 1GZ4A 3L18A 4Z53A 1VE1A 2IA5A 3UVEA 2CLEB 3I9LA 3QVSA 2J59A 3RYTC 4CGZA 1JAYA 2V8OA 4WTOA 2I8CA 1RYNA 4O33A 1X7ZB 3PT9A 3GPCA 2QOEA 2HSZA 3D7SA 3QI2A 4QJ5A 2BJWA 3V8VA 1ZGJA 1R0CA 2JGFA 4QPJC 4BLSA 2IELA 1A27A 1GY8A 4EK9A 1M1UA 4YIHA 1YJ5A 4UUBA 1FNBA 4F11A 3DQZA 2XD9A 3RJMA 1U9JA 1W94A 2EX1A 2XQVA 3MD0A 5AKHA 4ZQIA 3D31A 3VGPA 2UZ4A 3K5PA 2X7XA 5TF4A 4F1JA 3ZLBA 4Q7JB 1SWVA 1UEXC 3C97A 4Q9IA 5CDSA 1AC5A 1HQYE 4EQZA 1YFLA 1V5IA 2FSSA 3RC1A 4D0RA 2ONYA 3IL2A 1F8GA 2Y0PA 1ZOIA 2CMFA 4NE7A 5JMTA 1QFSA 3QI7A 4QGGA 2KBEA 5B2ZA 4LF4B 3NYQA 1ZA1A 2YRFA 1I5EA 5JDIA 5JZOA 4LYDA 1XAIA 3B6MA 3L93A 4XCXA 5CT9A 1FSGA 2D5AA 2IZOA 1MABA 2N1MA 1T9AA 3B82A 2GZ2A 3CRNA 5EVJA 2TSYB 3L3BA 3KKQA 1KPHA 3FYSA 3QWBA 4P0TA 1HKUA 4ALJA 1CY6A 1GG8A 1W88B 4QT4A 3EC7A 4OYYA 4IOKA 5DYTA 2I6XA 1H2YA 5DK6A 3TSWA 2WSIA 5ILOA 3K9FC 2QSUA 2AUTA 4PLWA 2G1PA 3P9QA 4UASA 5C1IA 2AI3A 2YKGA 4MWOA 2QW0X 2WUEA 1QGZA 5KTPA 1YA4A 4Q9LA 4K81B 4P4SA 3CNQS 4O1MA 4PG5A 3FMPB 3QEBZ 3LVQE 3ZH2A 1D1PA 2Z08A 1Z4OA 4HDSA 4HEJA 1E1LA 1KAEA 2RAVA 4OAPA 4JI1B 2D2VA 1TZKA 2D1TA 1CUXA 2VDVE 1A8UA 5FP0A 3QITA 3VAYA 4OJTA 1JR3D 1N1GA 4G8CA 3PNKA 1LWNA 3MCWA 3PP8A 4DSOA 4E2ZA 2E3JA 3OZVA 1OAOC 2OC4A 1UC5B 4WRRA 1U0FA 3NU1A 1IJFA 2AYYA 3URKA 1K4YA 2ORVA 3QLUC 4GVXA 3SYKA 2PBZA 1ULAA 5LNK1 4TMWA 3ZI7A 1GKLA 3G1WA 3H6KA 4REQA 3H9CA 2LCQA 4FHDA 4LCJA 3IQFA 1WP9A 4AJLA 1SA0B 1RBZA 4KQEA 1V45E 4L3VA 4HWOA 2CVQA 1LBHA 4LZNA 5E6SA 5BOSA 4JI7B 3CEJA 2UYHA 5SV2A 3X44A 1N2OA 2RK6A 1JFFA 2QW1A 3OTWA 3ZV7A 4MVJA 5LYJB 2BDTA 2WAAA 5L3QB 2J9RA 5DBIA 2X9LA 3V4PB 5FIUA 3VYVA 4R9SA 2NO7A 3VVMA 3T41A 3SP1A 5ETJA 3GUVA 4IF4A 3OCXA 5JW6A 1GGHA 2PEZA 3TBHA 4B44A 3C16C 1XRJA 3ITKA 4IDNA 4ZAWA 2AEJA 2UKDA 2X77A 5C80A 4WXHA 3MFQA 1TU3A 3OZXA 4BQPA 4AFNA 2DVMA 3V4ZA 1I80A 3EUFA 4KXVA 5HJ2A 3ZDEA 2JI4A 2G25A 3P2IA 5HQJA 2KBFA 3ZV6A 4F56A 3QBDA 4JWTA 4IIBA 1RE0A 2IP4A 3WRYC 4TXMA 4CT5A 4QYIA 4QM7A 4YAJA 4Y2GA 1ZK1A 3B60A 2FW6A 1MLDA 1F8UA 3INRA 1VE9A 4OMDA 1SVNA 1QS0B 4PLHA 3D2AA 2QUIA 1GPWB 2WB2A 4ND2A 4YUYA 5FOQA 4P80A 3WLKX 4LVNA 1A1SA 3EODA 4A6EA 3V6MA 2BM0A 5IARA 3EYAA 1L8QA 1Y5IA 2VH1A 3QVTA 4N1AA 1SVWA 4OIMA 4IDBA 2C8VA 2HU8A 2QP3A 2IWRA 2VUSA 3VOBA 1YTLA 3OF5A 2IHBA 3K70B 1WXEA 1DJLA 3AEZA 4J1JA 4KGVA 3W5VA 2IYPA 4ZVMA 3AKYA 5IWAB 1QH1A 1T2AA 4U9IS 4B40A 1E3IA 5F1KA 2A0WA 5EMKA 3IT0A 4YBZA 4EYGA 1SBTA 3WB0A 4L6AA 2C9MA 2CGEA 2VZLA 4CHTA 4BPBA 1YBFA 3DFIA 5A6SB 1TAHA 1M8KA 3W2GA 3UFXA 5DFAA 4D45A 2Z30A 5IVIA 4HLDA 3ORHA 3IRUA 1SB9A 3SMQA 2V96A 4IGKA 3DOOA 2WTUA 2VG8A 2GPWA 2B2CA 3SVTA 4HRYA 1ID8A 1U0GA 2DHRA 3H1GA 4H60A 1L7MA 1CVLA 4DLPA 3DUFA 4HDRB 4NS1A 2OCYC 3Q2IA 4XUEA 4G1EB 4MCJA 1UP4A 1C0LA 1E3WB 4KXYA 4ARUA 1JDJA 4KE9A 1EHIA 4LI3X 1MPXA 4Q7KA 4XQ0A 4BO5A 1L5YA 4MICA 4P7GA 4U2KA 4C03A 5K4GA 1JQ5A 1KJQA 4MUFA 1BDBA 2QPAA 2MSNA 2RHRA 1NUHA 2R2AA 3BMCA 1GQOA 4Q3KA 4CV0A 4WUVA 4YCLA 3W5AA 1HLPA 4GZMA 1CY4A 5LUBA 5KWEA 2EP5A 3GRKA 5BQXA 1WXFA 5BN5B 3VPDA 3Q7QA 3RYCA 1N75A 2BBWA 2J8ZA 4ER5A 4A6PA 5P8WA 4EKDA 5E9QA 4BP1A 5T64A 1GSIA 1Z2CA 3AXTA 1K98A 2CV0A 1H9CA 1XL1A 2Z98A 3FTCA 1H5NA 4OM8A 4TYQA 3FSRA 3NFRA 1GLVA 4AJJA 2XHZA 1AZLA 1WCWA 2H4WA 2PKXA 3HJCA 3O3NB 3UUGA 4IIYA 1P33A 1BE6A 1G8HA 5KVVA 5KPDA 4PPFA 4RSHA 1NFRA 3FSJX 3EW9A 2EBHX 1RLIA 2LKDA 2CL6X 1WUKS 2PMBA 3USES 3VC2A 1VMAA 3LVFO 4ZA2A 3AV3A 4RZSA 2W2XA 4OAQA 1AQ6A 3LCVB 1BCRB 3I04A 5I5GA 2ZB2A 4AK9A 4QQRA 4BFWA 3A36A 1JSXA 3MFYA 3PEFA 4ZEXA 1RQGA 4PO8A 1NXWA 1NVGA 5JZVA 4D4LA 2DSTA 1J2UA 1N6KA 2QTRA 4YJKA 5SYAA 2HN9A 1JJFA 5TE9A 4KN9S 3IP6A 3K73O 1YQUA 2CZCA 5K7SA 2BSQA 2VSQA 3BFPA 3D0OA 5CLIA 3S81A 4BMXA 1NR7A 4HDQB 4K1XA 3A9SA 1ABBA 1Z8DA 5EEHA 1CUIA 1KBQA 1XXHA 5HMLA 2BBSA 1U8CB 2IZZA 2RH5A 4JLWA 1FNDA 2EWVA 5KNDD 3U7EB 1XZGA 1YB2A 3IPYA 4Y0NA 1W2GA 4WASA 5C46F 3E0QA 2ZWOA 1GNQA 2ZR8A 3OTHA 2BGLA 1B8PA 3SU8A 2O4UX 1XG5A 3LPLA 3P2EA 3RRYA 3NNDA 1BWRA 4KE6A 4UTNA 4M88A 3U13A 3TFOA 1CUUA 3TKYA 2H1HA 2C9DA 5I9SA 4D9IA 1UBCA 1R1DA 5EJ5A 1BDMA 5AVXA 1WTAA 2D5IA 1CDDA 3OQPA 5KYXA 1U5CA 3K1JA 1T3TA 4BKQA 3NTOA 4DA7A 2GM3A 3A0UA 3G2HA 5KX5A 4UHHA 1I1NA 1KEEB 5FT9A 4JI2B 1HE5A 3W5DA 1AN9A 2OILA 4MWCA 4OXRA 4ZFNA 4GBJA 2J6CA 1VCHA 4U00A 4D4GA 3VJLA 1OZAA 1Z82A 5CVUA 1XQ6A 1EGMB 4RVHA 4TLMB 4LF8B 3PFFA 2ZW9A 4K6KA 3BXEA 4KODA 1LQTA 3NGXA 4FDLA 4IIDA 4MMZB 4CMJA 4Z5XA 3V1NA 3A6LA 1E64A 2DQSA 3VSAA 4JVLA 3M82A 3DWIA 4OQMA 4F9EA 1KZ7B 1QHSA 2E82A 3WLNA 5AO9A 1M2EA 4KXQA 3S99A 1IN1A 4IMJB 4I1RA 2HXSA 1STOA 3SN6A 3QEAZ 1JKXA 2OQRA 2WA1A 2GHQA 3THRA 2G9RA 2TS1A 2XGGA 1MW8X 4AJ4A 5KWVA 5K2OA 1RU3A 2IEYA 3CS3A 4NZ9A 4D0GA 4O4HF 3HP7A 4J0JA 1N5LA 4RMNA 4G23A 3T52A 4N8SA 3MC1A 3SQWA 1JDVA 2XQKA 2V5UA 2QN9A 3B3GA 4E4TA 1H6DA 1VYUA 4UREA 3FDFA 1SOUA 5FBQB 2P6UA 4HPXB 3IDOA 3ER8A 1X2EA 1CUZA 4PHHA 4EY7A 1BH2A 5EJ2A 5ARBA 3D02A 3GRRA 2N42A 2P41A 3NT4A 4FCTA 3TUJC 4CM4A 2ROQA 3BK7A 4AU1A 4Y0AA 5EXSA 3R7WA 1GKKA 2C3YA 2R1VB 4QXOA 1FMJA 1PI3A 3UB2A 3WO0A 4I0WB 3G0HA 3ZR4B 4AZTA 5F77A 4YDRA 1RAEA 4DXDA 5DI3A 3PPVA 3DVLA 2XGSA 1H2BA 2QL5A 1REQB 3AO0B 1J0CA 3C3AA 1X19A 4IDHA 1KK3A 4L6IA 4L4UA 3OJLA 1ENZA 3QJGA 1BYUA 2PQMA 1F14A 4IL5A 4L57A 2PLFA 3FMGA 1MGPA 3N2KB 1Q50A 3QLJA 2HA5A 2O8VA 5JQWA 3CZMA 2C31A 2E4WA 4NYJQ 1GAJA 4LK3A 6REQB 1RXEA 1YMVA 2EATA 4C7VA 1BCSA 1U0OC 3HK2A 3KJNA 2QRNA 3DBRB 1NP7A 3UGJA 3IBCA 4EUKA 1VG8A 4OH7A 2IDJA 1USVA 4JMPA 1XYGA 1Z7BA 3ESQA 3T99A 1W2WB 4NYIR 3EQ7A 3F8SA 4UTRA 3GLIA 1RIIA 4KPUA 2Q45A 1HFJA 1RIFA 1HT2E 1TIBA 2OHFA 2VT7A 4RZ2A 3ECCA 3GJ7A 5TPZA 5CTJA 3TPZA 4AP5A 1L7XA 2BH2A 2CWWA 4Q3BA 2O5RA 2QQEA 1N8SA 2WHYA 2J3JA 1I7NA 1QRDA 3N2GB 2AN4A 5EJ6A 5KINB 3K32A 1M5UA 2JJ1D 3KLNA 2P5UA 2UUAB 2PX0A 4MKFA 2H4XA 1X7YB 3H4IA 3TBKA 1OBCA 1L5SA 2C84A 2HBRA 3CUKA 3RRBA 1C7JA 5D2CA 1ML3A 3SS9X 1XVAA 4YBRA 5BN5A 5C5CA 2NAPA 2UZ0A 1EDBA 1UODA 4ZZ1A 2QBYB 5JJBA 2E21A 4XQEA 2O8EA 2XOEA 4M46A 4HG2A 1JXQA 3UW3A 3K70D 4NZYA 2VLBA 4B4DA 1T6NA 2WKSA 3AOEC 3OOJA 4KVFA 4ED9A 4NAUA 1G8FA 3IEKA 2MIIA 3BSFA 4PCVA 4RA6A 3LUDA 2AG5A 2GN2A 3RFVA 4ER0A 4GKVA 1TZ2A 1YQTA 3O8RA 2V65A 3BKXA 1ISMA 1P9LA 1W76A 3OPQA 1LV8A 4CEJA 3GARA 5E4YA 1L6IA 3VNUA 3PC2A 5JSHA 4LJRA 4FGWA 4URYR 2YR0A 1F0NA 2J5XA 2PLAA 2HREA 2GN0A 3O8OB 1J24A 2WVJA 4I6EA 4M87A 3RWMB 2AFVA 3ROKA 1KZ1A 3GGJA 5K3DA 2GUWA 3ZJ5A 4AQDA 3RCBA 3NDIA 4R8KA 1JZQA 1C3OA 4PX9A 2NNLD 1G19A 5TXGA 1A9TA 1Z4MA 3DE2X 3JRXA 3AM4A 1DLJA 4LMRA 4XWOA 2JIDA 1D03A 3TQFA 1H66A 3M6WA 5A0VA 5F2OA 3BTOA 3FYTA 5JH7A 1SUBA 1OY1A 2HU7A 5IFLA 1OH8A 4O4IF 3JS5A 5DNDA 4MGZR 4FR0A 3WLPA 1W5SA 1YBVA 5IDVA 4XDZA 3M4ZA 2JZNA 3MMSA 4Q6BA 1P0MA 4PIPA 4E46A 3MWEA 1QIDA 3ZDZB 2JB9A 4RQTA 4FM9A 2PLNA 1VC2A 4G4GA 4JB3A 4FEGA 3DHNA 1HV8A 1N5DA 1R8YA 3TXAA 5AOCA 3JR3A 1ZOOA 2IOQA 5L4LA 4DBZA 3NBZC 3UTCA 3QM1A 3ZDDA 1CUGA 4F06A 1W6RA 4H4EA 5DT2A 4UUMA 3SIXA 2W37A 5JANA 1KMNA 4FYHA 4I8IA 4XOUA 1WD7A 3HUFA 3O26A 3ACBA 4YCNA 5E9JA 2CYAA 4YP5A 2DLNA 4GI5A 3C3MA 4JUBA 3H3FA 4FEYA 2X1LA 4HVTA 4QUJA 3WJ2A 2O5CA 3PC6A 3PJGA 3QSYA 1GSAA 3K30A 1QORA 5FTKA 2SCUA 3N6VA 4OVKA 3AONB 2M1ZA 4K9RA 3TLZA 4YR9A 5A02A 1YB5A 1KKLA 1TZJA 2DR3A 3QWAA 4OX9B 5IDQA 3IAEA 3CKMA 4YDHB 4A8JC 1B41A 3IUBA 1HZZC 4JS0A 3TSYA 5H3LA 3FZGA 4FI3C 5KKCA 5JAIA 1RMYA 3LY8A 1KEWA 1XZ8A 4YC7A 1F3LA 1WUHS 2IIVA 3LWZA 3MXOA 1CHDA 3LQFA 3R7FA 1KL7A 4FFVA 4CZ2A 2XUKA 2JEZA 2C5LA 3NDPA 3DCYA 3DPUA 1R0LA 2PAFA 4Q3NA 3MWKA 4GUDA 4RMGA 3OIVA 2E5LB 3ENZA 1PGOA 3MMPA 4TMVA 1JNYA 1A95A 4K0KB 3V42A 4YJDA 1RC1A 4A0SA 3V8MA 5B7GA 5H8WA 1EUDB 2G3YA 1YQEA 2ZDQA 4IIVA 1X7WB 5BW8A 1ZGGA 2FWRA 4LOLA 3P9YA 3R24A 4G07A 2HWWA 3IAHA 4FMDF 5JZSA 3O4VA 2HHCA 3FOAA 1P3JA 4LQDA 4MYSA 3K8YA 3GDFA 3WKBA 4E3ZA 2NNWB 1QE5A 1GN9A 3BL5A 1ZRHA 1CJMA 5AICA 1SMKA 2O3SA 1NPDA 3F3KA 5AHXA 2H2WA 3C48A 2X4LA 1IM5A 2R1UA 3H97A 1KZ6A 5IT9A 2IXDA 3HU2A 1JPUA 4DKXA 4E5VA 2GBLC 5B4UA 4BMCA 3QY9A 4W9NA 2ZOSA 1M3SA 4JKYA 4Z9YA 3ZS9A 1HMPA 1SBHA 2FQWA 3I45A 2P11A 3G49A 5J2UF 1KVQA 1ETUA 1F20A 2C9ZA 3BSWA 4N4AA 4E08A 4RTOA 1Q1NA 2VRNA 2HPVA 3RSQA 5JYDA 1GA1A 3OJCA 3GLHE 4WH0A 2W2LA 4BO7A 2B7BA 3BCHA 2WYOA 4NTZA 3RC9A 4OQZA 3C4VA 4KXWA 4GLBA 3N0VA 1BE0A 1KDOA 2BCJQ 3HYCA 4PWYA 5IJ0B 3P45A 3OZEA 5C53B 4FZ5A 3AVWA 2H1OA 2XVZA 3PL1A 2ODQA 2RK3A 3TK1A 2HA6A 2XNSA 3GFQA 4X20A 4OF4A 2AFHB 3DTTA 3RTEA 5TNXA 2Q5LA 4M2LA 4U2CA 3S2GA 4GKAA 1M73E 1XYYA 4QGHA 1I01A 3KELA 4OLJA 3PCXA 4FB5A 3GUZA 5JRZA 4ZQEA 4OQNA 2VNHA 2AZ4A 1B74A 3H2HA 3PHCA 1XNGA 4L2IA 5EJ9A 4D46A 1U1CA 1R64A 2EQ5A 4Q66C 3Q98A 1SXJC 1UWKA 4AZ3B 4EQ6A 2XLCA 5A3JA 1N78A 1D4OA 1TKBA 4GWGA 1G8AA 2I7DA 1QC5A 3VC7A 3HY3A 3OU6A 2B94A 4MRPA 4UBMA 5FD8A 3UMSA 3LQQA 3A6JA 1CUDA 3CF6R 3ZKWB 1XQWA 4JGIA 4UEQA 2QVZX 3KQVA 2VJDA 3KOYA 3A27A 2IHVA 4JENA 2FHSA 3LBYA 4P4NA 2HHHB 1U98A 3AF1A 4JP2A 4Y6QA 3O38A 4FFLA 4PQYA 1T9CA 2VJPA 3VR6D 3Q7EA 4C22A 4IH9A 5HG0A 5B1EA 3OLVA 4MKHA 2JK1A 4I4NA 3AYXB 4R6WA 3EXHA 2DSNA 2W0MA 3X3HA 4HJRA 4F12A 3BRCA 1SOMA 4IDQA 3UHFA 2PMWB 4HMOA 2ACEA 1O57A 4UFPA 2BR4A 3JAKA 1CV2A 4X3CA 3VSBA 4IGFA 1DUVG 1KJIA 2HWYA 4AMGA 3EY9A 5FLEX 4XQGA 2O2SA 2DUJA 3EPPA 5KYGA 3EVDA 3L6DA 3F71A 2PL3A 3MK31 1YZ3A 3M7IA 2IXGA 4L95C 5J4HA 2OWEA 4YFYA 4XRGA 5KYWB 3V48A 1YZNA 3C7TA 3R5XA 1TK9A 2W6CX 5GONB 3C0KA 2JI7A 2P9BA 4TL7A 2O8DA 5F7JA 2WLSA 2PKCA 2PH1A 3WLAA 3A1UA 4DLXA 4EW2A 1QRAA 2UU9B 2FVXA 2RGGA 2QQGA 3I58A 4JJ7A 1ZH0A 3GDWA 1ZIXA 1AS3A 1HDCA 4KU4A 3TVTA 3OOYA 4K26A 3S2EA 5CA1A 4GI2A 4X95A 4NU6A 3N58A 2JAUA 2ZBRA 1S8AA 2YV1A 3HR7A 4MA0A 3UGTA 1MUUA 2OL4A 3B70A 4J49A 1QVRA 2JHCA 4AWXA 5K0LA 5TGDA 4QGSA 2X58A 4NFSA 5AUOB 1V9SA 1V8OA 2D0IA 3MRSA 2JI9A 4EHBA 3AHIA 1QP4A 2E6KA 4P08A 3X1KA 2Q3EA 5GIPE 4J0KA 2D3WA 2HLDD 2HSJA 2GFQA 1EIZA 1YRLA 3OE4A 1Z2NX 4BE4A 5K4HA 3ABZA 2IBTA 4DLAA 5DTRA 3NC1C 3O75A 4NU0A 4PYMA 2ZVQX 3S2FA 3WAGA 1RAIA 1US8A 4QWMA 4M9QA 1KI6B 2UUCB 4RGQA 3DL4A 2WF9A 4ONEA 1ZCBA 4WKNA 3SIWA 3USZA 5LU8A 5E6RA 4CQMD 1A7JA 2P0EA 2DJ5A 5DBGA 1C0EA 3R5FA 2ZB8A 2VK4A 1R15A 3NBFA 3NO4A 2R1TA 4IDDA 5FPSA 3V5NA 2D59A 4L9SA 5K8IA 1Y1PA 2X8JA 2BZ1A 1JSCA 2A58A 2KPOA 3DLTA 4W5NA 3TTUA 1Q44A 2FEKA 2CEAA 3EMVA 4MAMA 4RZ3A 4TKUA 3TB6A 4ZO4A 1QTNA 4YRJA 1GGVA 3TR5A 4MVYA 4A2CA 2VK2A 4IHJF 2ZBPA 2CXSA 2P2LA 3AVQA 4PC1A 1ZSNA 3ND8A 4L78A 1R9MA 4IWYA 1CZLA 1I30A 2OKGA 2OOSA 4J1TA 3L4KA 2NUTA 3DOFA 1E5LA 2XBUA 4FYKA 1WXIA 3CWCA 3EQ8A 4OAOA 4AIRA 4C9BA 1OZ0A 3UA3A 5TS3A 3T7CA 2D3TA 3HKCA 1H2XA 1WETA 5HIAA 4WIAA 2IEGA 4HTAA 4CKCB 4LTMA 2XCIA 3K5IA 5IC5A 1VXOA 1ENPA 2DKNA 4GC5A 4NBVA 2K4MA 1WLSA 3I72A 3TL6A 1L7AA 2ZJ8A 4F3CA 3C1AA 4H9GA 2PZBA 1YDMA 2HCJB 2Y71A 1N0IA 4EFMA 3RG2A 1UF9A 3MOSA 4DXHA 5HTOA 4ATNA 3LKBA 1W35A 1SC4A 1XJCA 1K2WA 4XX0A 3U7RA 1NBMA 3COPA 3GLGE 1J49A 3G89A 3KK0A 1MO6A 1T1RA 3LXMA 4HX2A 5HK9A 1A7UA 3EZXA 2G9UA 3Q7IA 3PXCX 2F1HA 4HDNA 1F0YA 2CY0A 3TMAA 4H7JA 5ER9A 4A8JB 4EHNA 4RIFA 5B58T 3L4BA 3RAGA 3IKLA 4GW3A 3FIJA 3R6TA 1QYXA 2VS1A 5TGTA 4JP3A 2ECQA 3J7AC 4FLEA 1YUMA 1UCFA 3X1DA 1V8ZA 3G2MA 1J7JA 1NBEA 1A9SA 1TRKA 4A8HA 2VPYA 1YDWA 2ZWPA 5TB5A 3S5UA 1JLSA 5C18A 4KLNA 2XTNA 4HGYA 1Z6AA 1YVEI 4YQEA 3VYUB 2QT0A 1MX3A 1I9CA 4DV4B 3IBGA 2JANA 3GZNB 3EVZA 5DZSA 1R6UA 4JB8A 4ZVRA 3T7EA 4CLOB 1LZLA 4MRVA 4YP0A 4X65B 3K9WA 1AKWA 1FS4A 3LL4A 3WRXC 3H04A 3WFJA 4CIAA 1C1DB 3FZQA 5FR1A 3N28A 4I4LA 3RSGA 3N8GA 1YR7A 2BF7A 2CWDA 3ZCUA 3JQRA 1PJCA 3BAFA 1IXZA 1E6KA 4ZHQF 2VJLA 2O8CA 4ZAGA 5KU1A 3L5OA 5BXYA 1C1XA 4MS1B 4HN9A 2ZQYA 4LDNA 3EJWA 3VR5H 2WQ6A 3CZRA 2DF8A 1JU9A 3I92A 3NTXA 4IJVA 1P5ZB 1ABFA 4MWBA 3P0EA 2VJQA 1JQLB 4F6RA 1AHHA 8AT1A 4UAJA 4WLNA 1A0OA 1SH7A 4BFTA 2IEAA 2P9ZA 2PMFA 3B7GA 3W04A 4D8YA 5CEJA 3FRIA 1DADA 2DT8A 4H6VA 1WQ3A 2BSAA 1T0BA 2O3JA 1LWOA 4DGSA 3BJEA 4XR9A 5ITWA 1AS2A 2ZI7A 3JXEA 1AV6A 1EJ2A 4QSHA 2CUKA 3X1ZA 4KYVA 5EZ6B 1NVEA 1NOJA 1EQ2A 1JGTA 3A6ZA 1E3SA 2D54A 2POQX 1JWAB 1NSYA 3AEKB 5LP6A 3G2PA 4ZOLF 1UJBA 1RD4A 4E07A 1VE6A 4V0ME 5EJFA 2PGIA 2QM0A 4X5OA 4WBNB 1XQYA 2WHPB 2X5JO 3OG9A 4GKJB 3OO1A 4IF6A 4HQ0A 3UKDA 3HB7A 3GBVA 4JXJA 2WDPA 3FCYA 1XZMA 4KIFA 3UOAB 1KH3A 4D3SA 5TVKA 2P4QA 2O2DA 4JYBA 4Q03A 3VHXA 2OBMA 4LY0A 4O5AA 3ZLJA 1CY2A 1QKKA 1SXJB 1H3EA 1XCOA 4MJLA 1QFYA 4DUPA 1JLKA 4WN3A 2P90A 3LYLA 4W8HA 2B5WA 4LGCA 2FMKA 3IJ5A 5IU6A 4DADA 3DO5A 3RM3A 3TQTA 2P7HA 1VGVA 2EJCA 1NRJB 3LG2A 4XSGA 2WJHA 2TECE 1BVHA 4DTIA 5L7TA 2ZM6B 3GVCA 1HYEA 3D81A 4KRFA 1K7EB 1L3IA 1H1LB 4K46A 4JHLA 3UT5B 1CUVA 5BVGB 3R40A 1GT6A 2WILA 4BCCA 3ZDCA 5E1MA 3RPEA 4ZZ3A 1EWRA 1L1RA 1H5QA 3FCXA 3MSCA 4PQEA 2GWHA 2BGGA 2VZ0A 4TMYA 4DZTA 1JL3A 1H6BA 2ISSD 1MTZA 3LSYA 3NTQA 3X2FA 5IVDA 3STXA 3AG6A 1X7GA 1CSEE 3DJFA 4JR1A 4XQCA 4PFSA 5HK8A 3RH0A 4C7JA 3T3NA 1W44A 3QELB 1SFRA 4D02A 4KLCA 3A1CA 4YR7A 4PYRA 1ZCAA 2EV9A 3FFBA 4IIFA 4X8HA 4FBLA 5B7PA 3DEYX 2OMKA 1UJ2A 2X0KA 4HNAB 1BRMA 4MP6A 5ALMA 1E5TA 2W8BA 1T5SA 4HBGA 3QP9A 3BBPA 2E48A 4HAZA 4NONA 5DHQA 2V9ZA 2NT3A 4F3KA 3QG5A 4O2BA 4ZARA 2B9VA 1KPIA 1ZKMA 2XITA 3OWXA 3KQPA 3PNQA 1R0YA 1UKEA 4FDAA 4KO3S 1SG6A 4EUNA 2AF4C 1XLTC 5TV2A 4UOZA 1PG0A 4RXMA 1J39A 1BX1A 1E7RA 4NC9A 2ZJ5A 4LJKA 4YALA 4OXIA 1SJ9A 3PLNA 4AS1A 4UDXX 2WOJA 1TB4A 4GYYA 3WX0A 1EK5A 3Q1LA 4XD7D 1TT5A 2B0CA 2BJVA 1KMHA 4YAOA 4A5SA 2LWIA 1DIOB 4XYEA 1XZHA 4YCJA 1YZUA 3TUIC 2X40A 3I52A 1GZDA 4Z1OA 3T9AA 4QARA 2ONZA 4GP9A 1DEAA 5KB3A 2ZVDA 3LDUA 4QPCA 3SC2B 5B7QA 4C3ZA 3G9QA 2QSZA 3M1LA 1KSHA 1LDGA 1RWXA 2PH3A 3AOGA 1P4RA 1W25A 2NUBA 1RYDA 2HCFA 5FNVB 2AKEA 2I99A 2IHUA 4ZOEA 3R3VA 2XDQB 4YLEA 5JSYA 2YNMD 3IIKA 1O96B 4NULA 3V4VB 1MHPA 3PR3A 1AHPA 4RH0A 4WESA 2GR9A 4XVCA 2PRJA 1NYRA 2AFIB 4F5DA 1ILEA 4LIPD 4C0SA 2J0VA 1ADBA 3F5FA 3HJTA 3ZTWA 1VKNA 2OT3B 1CR2A 2C00A 2XA2A 4EX6A 1SXIA 2H4JA 1BC5A 2J30A 3EIEA 4ZOQI 4HC4A 1LI7A 4QFDA 4TTTS 3THYB 3FBGA 3PGXA 3D6VA 1TTHA 4BMZA 1W1WA 4CF3A 5TEVA 2FR8C 1JPNA 3MJHA 1XRQA 1UT5A 3C24A 4X7MA 4N47A 2BKEA 2NO4A 3IQWA 4P4TA 4WKPA 4MQ4A 5D6OA 1RHMA 3ZWQA 4KWCA 1AY0A 1L1EA 1ZD1A 3E3MA 3W5IA 4O2RA 1H2RS 1NVDA 3ESRA 1I8TA 5HQ3B 3DTYA 2P6RA 4V2IA 3VHRA 4RWEA 5HRCA 4PN3A 5B7NA 1OZGA 4QIHA 1OAAA 4BNKA 2ZIVB 5GM1A 3IP3A 3LP8A 4OHYA 1E7QA 2KI5A 2XGMA 1XELA 4L4XA 4MA5A 5BT8A 1NU6A 3ZD7A 4JC4A 1LPNA 1V48A 2ZXFA 3GUYA 3H9UA 3WOVA 4HZUA 1KZ9A 1WTCA 4Y1RB 2WHXA 2BKUA 3OOSA 2RBEA 5CXSA 2Z9DA 1OXVA 3N7UA 4KXUA 2UXCB 4Q4LA 3EDQA 5B58C 3ROEA 2CHGA 4CG2A 2EG5A 1O3YA 2Y9PB 3WYAA 3QW2A 2ZAYA 4DVJA 4R1SA 4BRZA 1P0CA 5BPHA 1QTIA 4BV9A 4N3NA 4RLFA 1C30B 1JHQA 3HGTA 2WJWA 3P26A 5ALVA 5FLXA 1GYRA 5MDHA 4XX1A 3CR3C 3CZCA 3RSFA 5DNAA 3C8ZA 3BREA 2YHAA 2W2VA 4TWJA 4JLSA 1RWWA 2FE1A 3ACCA 5AKJA 3RJTA 5HBGA 2I7CA 4NPCA 4Q37A 4NAHA 3IS3A 3NXSA 2CUZA 4BVLA 3VMMA 1E5VA 2R6FA 1ZMXA 2BBOA 3TL2A 2CDBA 3A6FA 4EW6A 1U8EA 2ZDHA 4PW0A 1NMEA 1OBOA 1P1FA 2O0MA 3GVHA 3EIUA 4TVKA 2MYTA 2B8JA 4M9ZA 1TUBB 3REGA 1PYDA 5DBEX 2JFZA 4MI1A 5C1OA 3RBVA 3HJNA 1ZLXA 4EI7A 1GCGA 3DAYA 1H3FA 2G0TA 2IYRA 4I1SA 1RWBA 3IHWA 2J9YB 4RTNA 2FFQA 4W63A 4LFAB 4XGQA 2AZDA 3QUTA 5H1YA 5HIMA 1HT3A 5C37A 3O4RA 2FK8A 5JTUA 3DEJA 2E2WA 2ZIEA 3BJIC 2VP5A 5FXMA 1N0UA 4JBYA 2JIZA 2O1XA 1XMPA 1H9AA 5JS6A 2PZEA 1LRLA 2Z0MA 4A73A 4TV8F 3M33A 3QVUA 1XZIA 4KK3A 2I4LA 3L1HA 3OZUA 1UKZA 2NUAA 1SUEA 3DE6X 3H2ZA 3LUGA 1PL0A 2FEOA 1YBAA 1DKUA 1RBYA 4PM4A 5AKKA 1CUAA 3EF1A 1T25A 2G80A 1TF2A 1G5QA 1NVFA 2VAVA 3C3CA 2Q6KA 1XX6A 1U3CA 2OBLA 3IMKA 3MINB 4KE7A 4K9OA 4ECAA 5CB8A 1XEXB 5IDWA 3HB9A 1FQKA 1T9DA 2YV3A 2F43A 3EZGA 4K1LA 1KAGA 2IP2A 2P2GA 3SYTA 1ZZGA 4BVAA 2I4TA 1PBTA 4RTLA 1C3EA 2FRDA 5ADHA 3VMFA 2PT6A 1Z25A 2B0JA 3GRCA 3OZRA 4B5LA 1DBRA 3EK2A 2P5YA 3AKDA 4E31A 3QMWA 5BW6B 1ZIOA 1FDSA 3PITA 3SAJA 3TW6A 3NHJA 2HDOA 5FV7A 3K6SB 4BFZA 4EYEA 4HMPA 2O7VA 5JCZA 1RRKA 1AB5A 3O1JC 1W4AA 3CB2A 2FTKE 2PMDA 4BXOB 3QBVA 4JYCA 1RBMA 4ZOAA 4ZVNA 3ZKAA 3SX0A 4MQFA 3EY4A 2ILTA 4QOJA 4YGYA 5LM3A 4BNLA 1FL9A 1NQWA 1MX1A 3K96A 4B85A 4NBNA 4J1NA 2BFEB 4LVUA 2B6NA 1RPNA 4HAVA 1IRXA 1M83A 3G1UA 3H75A 3L7DA 4XVQA 2JA1A 1ZM7A 5SYMA 3IT3A 1WMAA 1NULA 3R5TA 1I1HA 1Z6GA 3E7XA 2PGAA 4V39A 1UT8A 3W06A 1N2CB 2G67A 4D41A 4F8JA 4F45A 1YSCA 3KQWA 1Z38A 2YZNA 2D62A 1PX2A 5FWXB 5J4LA 1QSGA 1T1GA 2W2QA 3EGVA 2M6SA 4LGMA 4DDVA 3A28A 5EESA 1K1EA 2AN3A 5BWLA 5J2TF 4P58A 4WKGA 3PA8A 5LP1A 4KFRA 4HMQA 4FKMA 4YCMA 4HHEA 1ARZA 3L07A 1Y48E 1ND6A 1UPBA 2Y1LA 2ZLBA 4IFBA 4MKGA 5ISMA 1PCXA 3Q7SA 5LQRA 4DRXB 3KUCA 3AY7A 3H18A 4FEEA 3ZWNA 4WUTA 3ANTA 1NJ1A 4K2HA 4C76A 3SSMA 5JSQA 3UMYA 4YGXB 3B9QA 5NLLA 3PEYA 1YMUA 2X5OA 2HV9A 2DFPA 5COBA 5JEDA 1OXSC 4LY3A 5FF9A 2V9PA 3ZCXA 2JGNA 3AR9A 3EGXB 2W6ID 3ZDYB 3MS2A 4B43A 1G2QA 2QLMA 1R6BX 4B5KA 3GJXC 3RAEC 5K9ZA 1MJFA 3CO5A 3AHHA 1PL6A 3HN7A 5EI5A 3GO4A 1AK2A 4LOHA 5HE8A 4AMVA 2IBSA 3E48A 3UWKA 3EF3A 2J5QA 2IIPA 3KRTA 5JLAA 3TZQA 1SRRA 4BHHB 4PNPA 4RVSA 4EI8A 4A0QA 1ECCA 2GI4A 4PZ0A 1MB9A 1VJDA 4HQFA 3FDJA 1CERA 2O3RA 3C7AA 4ETIA 2AD1A 2DWCA 2W83A 4LOJA 5FBRB 2XQFA 2H9YA 1PQYA 4D0SA 3FPLA 5EGNA 4BWGA 3OPXA 1K6XA 4LISA 2FKNA 2ON6A 4B6JA 3RROA 4PX5A 1ZVKA 5LQMA 1SVSA 4YAUA 2R44A 1L7RA 3LHIA 1KFCB 2YWCA 3SZRA 3VA7A 3DDNA 3AR6A 3ZGNA 4NVRA 3AC0A 2VYCA 5KBYA 4U7GA 1U8XX 4OOFA 2BTQB 4N5NA 1DAFA 5DM4A 3KXDA 3ASZA 4Y2TA 5DNCA 2CLKB 2IYXA 3DR3A 4IDAA 1YRBA 1D9XA 2QR2A 3GCXA 4HDCA 3H9BA 4LNUB 4R2JA 3JD4A 1JZSA 2JAXA 2ZUCA 3UEOA 3P96A 3W34A 1T8WA 2Q6TA 3AZQA 4BDTA 4OQLA 3NX4A 2O3QA 3HWRA 1J9ZA 4FGLA 3E4CA 3URMA 4I5FA 3UCEA 4FNGA 3C3JA 3BIWA 4EL5A 3MPUA 3F7TA 3K9HA 5LXTA 4HQ6A 1B8UA 3EJ6A 1IONA 5FBKA 3WIOA 3TFQA 2OM6A 3WGIA 3ND9A 3VU9B 4PE5B 4NV0A 1E1QD 3P1JA 2QAIA 4OXKA 1GSOA 1ADYA 1EK6A 2YHIB 4Y2PA 5KYKA 4QOFA 4ZT5A 2X6RA 3CCCA 1QIFA 2VRWA 4O2AA 4AVYA 2OBYA 3AB7A 5E9WA 1O6BA 5KSWB 3PVSA 1L0BA 2RAFA 4FFBA 5AP9A 1YQQA 5EWJA 2ENWA 2GPBA 3RRMA 3S27A 3VJMA 1ZGAA 2GPTA 5A7FA 3HVRA 5A1JA 3R9WA 2Q1WA 2BM8A 4ENRA 1SU7A 3VUEA 3AI7A 3QVVA 1ZHHA 1V9CA 3U17A 4YP7A 4CM9D 2H9AA 1JBQA 3ZVRA 1I1OA 4Z4EA 2ENUA 4L08A 4L5JA 5CHEA 3V97A 1SKAA 1DAKA 1T34A 3ANLA 2JK0A 1ZXLA 4E7OA 1G55A 3LPCA 3GJ8A 3DE5X 1GA6A 3I37X 3SXUB 2G1AA 2GTHA 2V6BA 3DHYA 4UE2A 5L45A 1XTIA 3IDQA 4GVPA 5CR9A 1IZZA 3ZV4A 5BW5A 1P1CA 1O1YA 2ZE5A 4NFHA 1UJ6A 2ZI5A 4R8MA 2ZRMA 4UUOA 4ZPJA 3U40A 3KALA 3IT1A 1X70A 2IUEA 2IITA 1ZM4A 4HRVA 1ST2A 4W7HA 3VSEA 2G5TA 3K71B 1VSVA 2C4MA 2D00A 1EFVB 2X7JA 2YL2A 3ELWA 2RE8A 3ZGZA 3F46A 2RI0A 3HA5A 1GGFA 3KAKA 3A1EA 4HNSA 1M1NB 2IU4A 3SBEA 2COUA 2MR5A 3DMPA 4LYYA 2A33A 3DB1A 3OCYA 4IIXA 4AT1A 5HS6A 5B6PA 5JYEA 3AFNA 3GN2A 3PYXA 4CQLA 1WE2A 1VCNA 5EPOA 3UM9A 3CVWA 4OQYA 4JN6B 4RYLA 3T06B 3JALB 5FLKA 1RFGE 4AD8A 4CMGA 1EVJA 2NU6B 4EH1A 1A9XB 3AKZA 5A6VA 4F84A 3LQKA 5I48A 5GINE 4NICA 2G6BA 3SSNA 2GJ8A 3TIVA 5AM2A 4XIYA 4TTPA 4BCDA 1ZR2A 1RJEA 3UKJA 3MXTA 1DHRA 3Q5EA 2FH5B 5LSAA 3OZ7A 4GS5A 3LY7A 2EF0A 1QANA 3DS8A 2YBEA 3O4HA 4EITA 3AUAA 5E6SB 4A8TA 4AW9A 4CM8B 1KH2A 1YGPA 3R20A 4B4KA 2XOKA 3GRUA 5BSTA 1GILA 3BK2A 2D2EA 3NUZA 3HKBA 4H1HA 2OAEA 4BAZA 1T6YA 3HN2A 1O0BA 3G9TA 3VV3A 5AVRA 1AO0A 3M6IA 3D7MA 4IWNA 2H9IA 1R6XA 2A9JA 1CEXA 1GZ7A 3RUPA 1C80A 4INJA 5B55A 2AMVA 5AR1A 1H0HA 5CT8A 2AW3A 1KOFA 3DBOB 4RKYA 3GLQA 4RVUA 5G4KA 3WC4A 3A8TA 2Q9BA 3O8BA 4NARA 5DW3A 1DV1A 1TT7A 4C7OA 1G5TA 3WLTA 4M7PA 4GEKA 3IEPA 4PLTA 1VLJA 2C7BA 2IH5A 1IQPA 1XWIA 3OJWA 1VRWA 2EKPA 4HRAA 1UFRA 1I6MA 1JVNA 3FIUA 1CTQA 1XNHA 3CLSC 1JEJA 3QVGB