2QYSA

Structure of eugenol synthase from ocimum basilicum
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
310
structure length
310
Chain Sequence
GMKSKILIFGGTGYIGNHMVKGSLKLGHPTYVFTRPNSSKTTLLDEFQSLGAIIVKGELDEHEKLVELMKKVDVVISALAFPQILDQFKILEAIKVAGNIKRFLPSDFGVEEDRINALPPFEALIERKRMIRRAIEEANIPYTYVSANCFASYFINYLLRPYDPKDEITVYGTGEAKFAMNYEQDIGLYTIKVATDPRALNRVVIYRPSTNIITQLELISRWEKKIGKKFKKIHVPEEEIVALTKELPEPENIPIAILHCLFIDGATMSYDFKENDVEASTLYPELKFTTIDELLDIFVHDPPPPASAAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and reaction mechanism of basil eugenol synthase
pubmed doi rcsb
source organism Ocimum basilicum
molecule tags Plant protein
molecule keywords Eugenol synthase 1
total genus 113
structure length 310
sequence length 310
chains with identical sequence B
ec nomenclature ec 1.1.1.318: Eugenol synthase.
pdb deposition date 2007-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05368 NmrA NmrA-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2qysA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 2qysA02
3GPDG 4YACA 4FGSA 1HE5A 3RFXA 3UFXA 2RH4A 4LMRA 1NQ5A 4BNJA 1ZEMA 5IDXA 1LSSA 3WX0A 3B1JA 3MWEB 4OM8A 1KETA 4IXWA 3DBHA 4UVHA 1F8FA 3Q3CA 4KDEA 4BO0A 4URFA 1K6XA 3WB9A 1HETA 2AEJA 5ENDA 3N7UA 1I3LA 2CSUA 1O5IA 2V65A 3GGPA 4A26A 1KS9A 2W98A 3I9NA 1UR5A 5HRUA 5GZ6A 1V3TA 1NPYA 4PLHA 4D41A 4TRMA 1R0LA 1PL8A 5B37A 2E49A 1ZJYA 2Q1UA 3UGKA 3FBTA 3GDFA 5KVCA 1JWAB 3FNFA 2OUIA 3AUTA 3FHLA 1HYEA 1P1KA 4RVGA 3OIDA 1XEAA 3H2SA 2W90A 1HLDA 1BG6A 1X1TA 1EZ4A 4DBVO 2GD1O 2D59A 3PHJA 4ALIA 4FD3A 3TZ6A 3PFFA 4AJ2A 3OIGA 1BDMA 1SO8A 5CDUA 4BNTA 3BHJA 3W8EA 5BQFA 3EHEA 2EHDA 3L9WA 1WNTA 1GEEA 5ILOA 3GH3A 2VWHA 4CM1A 3H6KA 1XR3A 4FJ0A 3LC2O 1Z75A 3U4DA 3ZHBA 3WSWA 4J7CA 5F3RA 1X7GA 3BMCB 3W6ZA 2GNAA 5CAEA 5HM8A 3LLSA 3L4BA 1Q7BA 4YJFB 1F06A 3D0OA 1C14A 1PTJA 2BFAA 4QO7A 2Q46A 4WOKA 4CUKA 1GFSA 4LCEA 3KB6A 4UUOA 1HE4A 4CR6A 4PN3A 2NWQA 3BYZA 3G49A 1QYXA 3ONFA 1WDMA 3JQ6A 2NTJA 3PLNA 4U6SA 2FSSA 5EPOA 1Y9AA 4YT8A 1HTBA 1V0JA 3CINA 4MVJF 1TEHA 2X9VA 4WECA 1Y81A 1GUYA 1P33A 4TRNA 4BNGA 2GGSA 3DZBA 3JQFC 3T7EA 3U0BA 3WQRA 4O0LA 4ZQHA 4P8RA 1E7RA 2XOXA 1RYDA 2RIRA 3R3SA 1M6WA 1Y5RA 1ZSYA 1LEHA 1D3AA 4Z3DA 4B4VA 1IULA 5JO9A 3UUWA 2PD4A 2JD1A 2Q49A 4OQYA 3JYLA 4MDHA 2DQ4A 1Q1NA 1UUFA 4RPKA 1BSVA 1GYRA 1ISJA 1P1JA 3EVTA 3R0IA 4XYGA 4DUPA 1IPFA 4YBZA 2C82A 3ZWBA 1AHIA 2BRUA 2CMDA 2CVQA 5IXSA 4CV3A 1NFRA 4EZBA 4AJOA 2Q4BA 2Q1WA 2X5KO 2I99A 2GUGA 2Q3EA 3DBRA 3WIDA 4M49A 3KBOA 1ORRA 4BKOA 4DL9A 3D5QA 3IMFA 3DOCA 4QX6A 3KRTA 3F9IA 3NKLA 5DBFA 1HDOA 4Z9XA 1N2SA 1DIGA 1ZCJA 3LU1A 2J3HA 4UEKA 5F5NA 4J0EA 1V9LA 2GN6A 1ZIDA 2UV8A 2HCTA 1YONA 1P74A 2ZYDA 1C1XA 3BTSA 3WBBA 2NTNA 2E48A 1EBFA 3FBGA 2D3TA 1PJBA 1VPDA 1G0NA 1MV8A 2WD7B 2IZZA 1NQAO 3HSKA 3V2UA 4BOYA 3AI3A 4R9RA 1ZUD1 1I36A 3HB4X 1NHWA 3NV9A 4MIEA 5U1PA 1ZBQA 5L53A 2J3KA 2CVOA 4L75A 4BHTA 2PGDA 2ZJ1A 2HK9A 1OC2A 4IJWA 3DOOA 1EMDA 5L4LA 3WFJA 2VT2A 1KVQA 2P68A 1JN0A 5CDYA 1EVJA 4RPHA 3WR5A 4CLDA 3NX4A 3BMQB 4WEOA 1XSEA 3DBVO 2POQX 2ZTMA 4W82A 1MC4A 3ANMA 2WD7A 4MJLA 2ZB8A 1IUKA 1D8AA 1U5AA 2W2KA 4OAQA 4WCFC 5IN4A 1NPDA 4CR7A 4ZRNA 4M86A 4ND5A 5I9NA 2IODA 2QG4A 5G0SA 3MTGA 1EVZA 1VLLA 5JW6A 5JY6A 4ALJA 2F1KA 3R6DA 4BMNA 7ADHA 4R69A 1EDOA 3B6ZA 4NR0A 4YWJA 1YQDA 1A7KA 2O3JA 5G0WA 2CDCA 2V6MA 2AHRA 3I52A 1PSDA 4CM9A 3E9MA 3ETGA 1M6HA 3KO8A 3VZQA 3WOHA 4DIFA 4E2YA 3FTNA 3TZQA 4J1TA 3JQAD 1MFZA 4XEHA 3W4IA 4YB8A 4H3VA 5ES3A 4BIIA 4JIGA 4FBGA 4XX0A 4D43A 3D5TA 4XDZA 3GVXA 2WE7A 3OBBA 2Y93A 3HDJA 1GR0A 1KEPA 4BO2A 3HWRA 3TZCA 2HK7A 1B14A 1WLYA 3FSRA 2YZ7A 3L6OO 3UH1A 2X0JA 4YRDA 3MJTA 3RBZA 4TZKA 3KTDA 3V1YA 3PP8A 3LF2A 4UREA 3GGOA 4CMBA 2H9IA 1HKUA 4D44A 3H9JA 2C5AA 2DLDA 2BF7A 3VAZA 3PDUA 1T1SA 2DFDA 2GZ3A 1O89A 5CPBA 3RU7A 4LVCA 1ZJZA 4D3FA 5BNTA 4DYVA 2HU2A 1PGQA 4CMGA 3D3WA 4K6FA 4TMFA 2JAPA 3JD2A 3WYCA 4L4RA 4ALNA 3HJAA 3Q2KA 4QUKA 2PV7A 2G5CA 4A0SA 2OBNA 3F46A 3PWZA 3LT1A 3U4HA 1YL7A 1PZEA 1Y7TA 4RDHA 2WDZA 3UOGA 1ADGA 3N58A 1HSZA 2EJWA 4MPDA 1LRJA 1T26A 1I3KA 1TXGA 3ZU4A 4BGEA 4R5MA 1QMGA 4PCVA 4R01A 2NV6A 3INRA 5IDQA 3RUDA 3V2GA 2CY0A 3GOHA 4K26A 4CODB 1L7DA 4BNIA 1BDBA 3P2YA 4JX8A 5DCUA 1ISGA 9LDTA 1OC4A 1XYGA 4N5MA 1WW8A 3VH2A 1IE3A 2TMGA 4A73A 4XYEA 2EGGA 5BNFA 5THKA 3ZNOA 2VTDA 1LDEA 4B8WA 2NU8A 1HDXA 5KIAA 5KNLA 1M67A 1PWXA 1N9GA 2NNLD 1T25A 1I8TA 4OYRA 1H94A 4FB5A 1EUCA 2AE1A 5FFFA 5U9CA 3AM5A 2BFPA 4IJUA 1A4IA 1HE3A 3LC1O 1Q7CA 1E3JA 4E12A 1V3VA 2PA3A 1JAXA 1R0KA 1TA4A 3IIEA 1KVTA 5A05A 2GZ2A 4NG5A 4ZICA 3EGOA 3P19A 1CRWG 2PZLA 2PGLA 3D1LA 4QTZA 5A9TA 5TGDA 3NAQA 3KYCB 1WZIA 1ZH8A 3INTA 4J0FA 2PH3A 5JCJD 5IZCA 2DKNA 5AQ1A 3LSYA 4GSLA 5A9RA 1Z7EA 4U5QA 4IQ8A 2ILTA 5FWNA 1BWSA 4RLHA 3JV7A 1GL3A 4LGVA 3SC4A 4JJGA 3RBVA 3TFQA 3GLQA 1H2HA 1PL6A 4J1NA 4UVEA 1SC6A 4J90A 2WYUA 2PZJA 5L7TA 3WDSA 5A3JA 3VPXA 1ISIA 4OSPA 2VRCD 1LDYA 2UYYA 4BKQA 3S2FA 2HRBA 1JKIA 3X2EA 2D8AA 1AHHA 5ICSA 3AK4A 3JSAA 2DBRA 2RH8A 4NMHA 1NP3A 5HS4A 5AXBA 1VJ1A 3IS3A 3KLPX 2X86A 3JQBA 2DBZA 3GR6A 4XR9A 3D64A 2WEKA 3GRPA 1I2BA 4XQ9A 4II2A 4Y67A 1DHTA 1PJQA 4RJTA 5DT9A 1X0XA 4NU6A 4PLTA 2PGJA 1XU7A 3R3JA 4ZQGA 3N74A 3F4BA 2NVWA 3PTZA 4ZHSA 1GQYA 1GYPA 5F5LA 1X7HA 2P9GA 3MJVA 2A94A 5T8KA 2PKQO 2VZ9A 1I24A 1AN9A 2ET6A 3CXRA 4BNXA 4CLXA 3WBFA 1MLDA 3QA9A 5DOZA 9LDBA 4IDBA 3WGZA 1Q0QA 2B4TO 4CLOA 6ADHA 1N7GA 3KUXA 4JCOA 3W8FA 2AEFA 4XYBA 3BAZA 3GVCA 2HLPA 3AI1A 5TJ9A 4E5NA 1SMKA 3PGJA 4Q39A 3I83A 2NSDA 4NI5A 4E4YA 1R4MA 2B36A 4OSOA 1CEQA 1U8XX 3G3EA 1HDGO 2Y0EA 4XD2A 4Z3KA 1MGOA 3UF0A 3DDNA 1CYDA 4E5YA 3KEQA 3PI7A 4R1NA 3QLJA 1YOVB 3RC7A 4DC1A 3I6IA 3GHYA 3QWAA 4MO2A 3ST7A 1LSJA 2RHRA 2JCVA 1E77A 2F00A 4RDIA 5JDCC 4I5EA 1VL8A 4WCDA 4J6FA 4GPD1 1N1EA 5ER9A 3WJ7A 4EUEA 3RJ9A 3MZ0A 3ZWOA 1P1FA 5L40A 2X0NA 1G6KA 4OL9A 1J6UA 2P5UA 3RJ5A 3ZU5A 4IGEA 2HMSA 3KYDB 2CDBA 4LW8A 2HJRA 3UHAA 3H2ZA 1Z74A 1YVEI 3LK7A 4R51A 4RQTA 2UUOA 1UXGA 4KQWA 4EGFA 1LA2A 5JS6A 1E7WA 4TQGA 4E3ZA 2OO5A 2HUNA 1Y9EA 3E1KA 4NFYA 2I66A 1U3TA 1JKJA 2J3IA 2J8ZA 1VSVA 4MVJM 4W9NA 3E82A 1PQWA 1MG5A 3P2OA 5G4LA 3EYWA 4CLRB 5KJCA 3F1LA 3C3XA 2NU7A 1HEUA 1X0VA 2GO1A 1H6AA 2EW2A 3DWFA 3TNLA 2CZCA 4PLWA 3AY6A 3H5RA 3ROKA 5JSFA 3EUWA 4MP3A 3H3FA 1QYVA 5TT0A 3IKTA 3ZWXA 2JJYA 3K6JA 2PWZA 1Z73A 2FPGA 1VM6A 2AQHA 3DXFA 1IOLA 2QRKA 4G2NA 4PG7A 4A03A 1NXQA 4CM5A 4Y8VA 3Q9UA 1M66A 2GYYA 4J9VA 2X0RA 3ITKA 3RUFA 3E9NA 4Q3CA 4AJKA 2BI7A 5KJEA 2OHXA 3LYLA 5T8KC 4D45A 1P9LA 4BKPA 4EUHA 2E4AA 3IJRA 4HKTA 4DREA 1NVGA 1PGNA 2Q1TA 1JVSA 5L95A 1DXYA 2C07A 2G1UA 2VQ3A 1V8BA 3PK0A 2NVBA 4WPGA 3QHAA 3AJRA 4IMRA 3RBXA 1E6WA 3NTOA 4CJXA 4OXKA 3W8DA 4O1MA 5DBGA 1YBMA 4AFNA 1ONPA 5TT1A 3ZU3A 2HMTA 1HSOA 3GNTA 5C5IA 4JK3A 1JAYA 1LC0A 2IXAA 4TSKA 1NAHA 2GN9A 2BKAA 1PS8A 5IZCC 1UDCA 1ULUA 1ZMTA 3ICPA 4XGKA 4E0BA 4OQZA 1HLPA 1UXKA 1KYQA 1RYEA 3GMSA 3RC2A 2A4KA 1HZJA 2CUKA 3GUCA 2FPIA 4PG8A 4XB2A 2R6JA 5L51A 1I3MA 2I6TA 3O4RA 3ZH2A 5A02A 4WLVA 3M1LA 1GV1A 3QE3A 2YV1A 3MJCA 3K9QO 4RF4A 1WMBA 2X7HA 1Z6ZA 1Z45A 1LC3A 4ND3A 2PY6A 2EG9A 1UAGA 2SCUA 3OICA 4XRGA 2BELA 4JQCA 4LSMA 5MGBA 3TF5A 3AOEC 1EQUA 3SXPA 3PYXA 4C7JA 2G82A 2VHWA 1F14A 3DFUA 4J16A 3VDRA 4J91A 3IAHA 1DO8A 4E5KA 5A06A 3H9QA 4W7HA 5L4NA 1AUPA 4F6LA 3AFNA 4HXYA 4NHEA 5CP8A 4NBVA 2Z95A 3PQEA 2D2IA 3ANLA 1LQTA 3L6DA 5JDIA 4YRAA 3D4PA 3H9GA 2BD0A 1H6BA 3JQAA 1E0DA 1H2BA 2VOJA 1GAEO 2JCXA 2BHLA 3PHHA 5KWEA 3I1JA 1GY8A 4B7UA 1HZZA 2P2SA 3ZI0A 3PYMA 2NU9A 1D1SA 2DC1A 2EP5A 1U2GA 2ZTLA 4YXFA 3HFGA 3TQHA 4BV9A 3GZNB 3C8MA 4E31A 4IDCA 3WMXA 5TSDA 2JD0A 3U3XA 2EXXA 2EF1A 1B3BA 5L4SA 3NJ8A 1A71A 3PWSA 2O2YA 1I10A 4KTTE 3BMNA 1PGOA 4S1VA 5LC1A 4B4WA 4A2CA 4CM7A 1IYZA 1HWYA 5DCWA 1YDWA 4J4HA 3WWYA 1H5QA 2XPCA 4HWKA 5JYDA 4IIVA 4BNKA 4QO8A 1BW9A 4YAJA 1Y6JA 4DQVA 3WLFA 2GCGA 4BKRA 3GEDA 4HP8A 3E9QA 2A35A 4QSMA 3I9MA 5I8ZA 4CV0A 1Q2XA 1U3WA 3RKUA 4CMAA 4RLSA 4PLGA 1ID1A 3GA0A 3HDQA 3EZYA 3KM0A 6LDHA 1QV6A 4FC6A 1DC5A 1ISFA 3DFZA 1XDWA 2BGMA 3JTMA 1YB1A 4HV4A 3FNGA 1BW9B 1EUZA 2I9PA 3DOJA 3PPIA 3JQDA 1A9ZA 2Q2QA 3UXYA 3BA1A 4RZHA 4ILKA 1C0PA 3VH1A 4ZJUA 2PKRA 3RUHA 2NVUA 3PQDA 1LU9A 2X4GA 4ZD6A 2X5OA 3D3EA 5JYEA 1U7TA 3SJUA 3WIEA 5T6BA 2DBQA 1JA9A 1U9JA 2VYVD 5C37A 3CUKA 3RD5A 2G0TA 3IUSA 4QEDA 3PIIA 1XELA 1B16A 2EGHA 2BI8A 5H82A 4DGSA 5BSGA 1HDZA 4YJDA 4XB1A 1X15A 1E92A 1GD1O 3NGXA 2DVMA 1NM5A 4JN6B 1LLQA 2EWMA 4Z6KA 5CFZA 2G76A 5C7OO 5KVSA 1YXMA 4JP3A 1U28A 1GTMA 5EL0A 2FHSA 5DNAA 4GGOA 4FPXA 4CQLB 4NDNE 3EZLA 1F8GA 3NTQA 4YRBA 4Q3AA 5I7SA 4RPJA 1ADCA 2WTBA 4XQCA 2GF2A 2QZZA 2R2GA 1IY8A 4D42A 4U7WA 3S2IA 2Q50A 3CTMA 5HBRA 2C0CA 1J5PA 1NR1A 3ETEA 1L7EA 4K1LA 2BGKA 3NGLA 3SEFA 1SZJG 1UP4A 3OECA 3ROQA 1HL3A 1FDWA 4BO9A 3O9ZA 3BTUA 4YTEA 3MOGA 4QFDA 2GPTA 1SCUA 1U8FO 3M2PA 4GKVA 4PVDA 2RHCA 3HDYA 3JQ9A 5THQA 4CV2A 5JY1A 3BHMA 1DFIA 3BHIA 4YDRA 1GUZA 3JQ7A 4PFJA 3V8BA 4O63O 3W1VA 5JO0A 4AJIA 2WE8A 1N1GA 3ULKA 4BO1A 5DP1A 2ZTVA 4J7UA 5JFOA 3GG2A 1GYQA 2VRCA 1T2FA 3DHYA 4C7KA 2AEMA 3GEMA 5CG1A 4L4XA 3ZWCA 4E32A 4U8GA 2QZ9A 3FPLA 2WWRA 1FMCA 5TQVA 3WFIA 3A4VA 3WGIA 1ZXBA 2GDZA 5B4TA 4IS3A 1DFGA 3VHRA 4CM6A 5TC4A 3WGYA 1IHYA 3OJLA 3UW3A 4EBFA 2OMEA 3AI2A 1RJWA 5CPFA 3QVOA 4L9RA 2WYWA 3W4KA 1NQTA 1SBYA 1ZK3A 5FYDA 2AE2A 1P3DA 5CDSA 1ISMA 1WDLA 3HN7A 1I30A 4MIYA 3OIFA 3NEPX 1ARZA 3B70A 4NZ9A 2AG5A 3VZSA 4W6ZA 4CM8A 1WXDA 4W99A 3V2HA 4D0RA 3I3OA 4WEQA 4WNCA 3S8MA 1NTOA 3OJEA 2Y1DA 1R16A 2PD3A 3ZW9A 4CM4A 3TL2A 2DFVA 5JDIC 3JYOA 1U4SA 1SEVA 5L3ZA 1TB4A 3I6QA 3JQCA 3TOXA 2YQ5A 4BVAA 4FIZA 1P31A 4NH4A 1CQJA 4MKRA 2YFQA 4RVFA 4ZA2A 4HNGA 3PEFA 4Z0TA 1DOHA 5JE8A 4R54A 4HADA 3AUAA 2HMWA 4YQZA 2XAAA 3GNSA 1PZGA 3FR7A 3A9WA 3L77A 2O48X 4FOOA 1AXEA 3QWFA 1UP6A 2GASA 2PFGA 5HTOA 1E6UA 3QSGA 3QJ5A 2EKQA 5F1OA 5KVVA 2B5VA 3GFBA 3ZV4A 4KTVE 1BGVA 2EKLA 3HE3A 1PS0A 5GMOA 3WLEA 4EJ0A 4FFNA 1LRKA 3JYPA 3QWIA 3Q2IA 5G4KB 5CEJA 3VZRA 1E7QA 1FDSA 2Y99A 1N7HA 3F5QA 3ZGYA 4YEDA 1IB6A 1ZMOA 1U3UA 4G81A 4Q3DA 3EVNA 3U4IA 1MXFA 1PX0A 5GZ1A 4ALLA 3MCVA 5T67A 5IAAA 3MOIA 2D4AA 1B8PA 4Y6SA 4NFSA 3ASUA 4CMKA 3JQFA 2OL4A 1YB5A 5HWSA 1XHLA 1N92A 3AY7A 1WZEA 3CH6A 3PYLA 5AXDA 4I08A 4B3JA 1ADFA 3C7AA 3A28A 2O3TA 4PRLA 5G4KA 1FDUA 1IHXA 5C7LO 2NQ8A 4BNLA 3HFSA 4UEOA 5MDHA 3KSZO 4JLWA 4R9SA 1PEDA 2BGLA 3JYQA 4IDDA 4J4BA 1B8VA 1XQ6A 3ZV3A 1Z82A 1GCUA 3UKOA 1W6UA 4X54A 4HX5A 3ZHXA 3STHA 1LLCA 5CDTA 3IP1A 3VTFA 3ANNA 1IL0A 1PGPA 3P7MA 2VHVA 1DJQA 1T4DA 4GI2A 2BH9A 1G0OA 3JQGA 3WXBA 4II3A 3BIOA 2Y0CA 4FW8A 2CDAA 4NFHA 5FEUA 3KVOA 3ADPA 1SNYA 4CLRA 3RIHA 1U5CA 1NAIA 3RFTA 3ZV5A 5HS6A 4YAGA 4ALKA 2W8ZA 4Q3EA 5A04A 1HYGA 2C29D 4H15A 1E1KA 3OF2A 1P0FA 4WLUA 4CQMD 4YVFA 2FOIA 4DVJA 3PWKA 1I3NA 4MKZA 5COBA 3F47A 3NTRA 4Q3BA 2CFCA 4PRKA 4OXNA 4PLVA 2YYYA 5B4UA 4DYDA 3ROMA 4UULA 2HJSA 3L4BC 5AOVA 2Q2WA 1H6DA 1DSSG 4KWIA 1IZ0A 1ULSA 2PK3A 4EI2A 5BSHA 5H81A 3RSHA 4NNJA 3OHSX 4DIOA 2FSVA 1B0AA 2JFGA 3EDMA 4XDYA 4F6CA 1YGYA 3DTYA 3WICA 2EP7A 4PLFA 1PJ3A 1PJ2A 1BMDA 3WMWA 1WAMA 2ZYGA 2R00C 4AJLA 3DO5A 3GN1A 3E18A 2HO5A 3JQAB 1K0UA 1ZK4A 4GAEA 1E7YA 2UDPA 3IOYA 4DPKA 1PJLA 1ZSVA 3KYBA 3RFVA 3B1KA 3TJRA 1ZNQO 2J5RA 4M1QA 1P44A 1V35A 4RVUA 5F1KA 2A9FA 1BRMA 1PGJA 2VN8A 3EK2A 3PZRA 4IPTA 5DDIP 3PVZA 3MJEA 4MP6A 3WS7A 1KY4A 3GEGA 4AJPA 5I8WA 1VKNA 1MXHA 2GSDA 3GGGA 1C0LA 5FF9A 4FC7A 2GZ1A 2FZEA 2HSDA 3ZZNA 2VUTA 4XYMA 5FI5A 2WYVA 3JQ9C 3HQ4O 3DMTA 2VYVA 3NT2A 3BMNB 4EYEA 5ICMA 4J1QA 1DC3A 1T1RA 4B4UA 2YW9A 4GMGA 4YT5A 1ENOA 1P77A 1TT7A 3GAFA 4YJHB 1X13A 4BNFA 4LVUA 3ON5A 3BMQA 4F46A 4NJMA 4GLLA 1ZO8A 2YQ4A 1L1FA 4DXHA 2DUUA 1LDNA 1KERA 1YE3A 4CUJA 3FD8A 3KEOA 3SLGA 1BHSA 4AG3A 3D4NA 3PRJA 1GCOA 1ZZEA 4NBTA 3S1LA 3UICA 4AJJA 3RI3A 4ND4A 1NR7A 4FN4A 2PLAA 4Q3NA 3NT5A 1GQ2A 1WP4A 4J2OA 3GFGA 4IQGA 4JJFA 4XR4A 2Q4EA 3CKYA 4EEXA 1S7CA 1JVBA 1ONNA 3M6IA 4BO5A 3GUYA 4GVLA 5K6AC 5KKCA 4PIVA 2X0IA 1LJ8A 2O3SA 2C7VA 2O3RA 1NFQA 4RVHA 2B37A 1R12A 3GVHA 3LT0A 1HT0A 3QWHA 3UCEA 3WGOA 4E5MA 1LLUA 1GDHA 4CMJA 2EJVA 1LI4A 1DRUA 4IIUA 4CQMA 3U49A 3O38A 4L74A 2EEZA 4IJVA 3ASVA 5CHEA 3WTCA 2VZ8A 2ZJ0A 3PQFA 1LX6A 1EDZA 4TRRA 1KBZA 2IE0A 4XGNA 3GNQA 5AYVA 3CE6A 3AFMA 4XGIA 3COSA 4CQLA 4GQAA 4DTIA 3AOGA 3AU9A 2QRJA 1ZKMA 1V3UA 2YDYA 1H9BA 3C1TA 5I9LA 3KETA 4Z9YA 2CNBA 4TVBA 3DONA 1DFHA 1E7SA 3LQFA 1M2WA 1CIVA 1DJNA 2IYOA 3K2BA 3GDOA 2DU8A 4O5OA 1GADO 4R16A 4TKMA 3KOUA 2FN7A 4UAGA 5I9MA 1BXKA 3DAGA 1T2CA 3E8XA 5A1TA 3ZWVA 3MTJA 3RASA 1PJTA 2ZCVA 2QQ5A 4YT4A 4P4LA 1A4UA 4TKLA 4B79A 5LCXA 3IP3A 3PIDA 1E1NA 3I9KA 1I0ZA 4WNIA 4OIMA 1X14A 3CIFA 1DIHA 3H7AA 1QLJA 3E5MA 4MVJH 4P38A 2V6GA 3GDGA 3KXDA 3WYEA 3QRWA 5BSEA 4I5DA 4BNYA 4CLHA 1VI2A 1BXGB 4L76A 4UUNA 3G1TA 3X2FA 1ENPA 4NQZA 5KTKA 4JXKA 5DBIA 4K28A 4AJEA 4PZDA 4XZ3A 3FNHA 5EINA 4DPMA 2RBEA 5DULA 1K6JA 3NRCA 3P5SA 2JAHA 1OBFO 1N5DA 1A9YA 4OO3A 5K0ZA 5BT9A 1AE1A 4AJ4A 1F12A 4XCVA 4F3YA 4LRTB 4WOJA 5L7WA 4Z9FA 1RM5A 1U4OA 1VL6A 4XIYA 1CF2O 3HNPA 2WJPA 4BO4A 3BTVA 2QYSA 2W2LA 1HDCA 5F21A 2P4QA 4BNHA 4FFLA 1NBOA 2D5AA 3PJEA 5L45A 4QXMA 3ZN2A 2YHIA 2FWMX 5FI3A 4CM8B 5ADHA 3H9EO 1VC2A 3G1UA 4D7AA 3HDHA 4BB5A 4H7PA 5K9ZA 4UVGA 2V6BA 3ENKA 3EAGA 3O8QB 4MVJG 1QKIA 4CM4B 3ENNA 4WE3A 1FDVA 1WVGA 4ND1A 3KYCA 2NLOA 1YDEA 4UEJA 4E2WA 1D1TA 4IUYA 2CD9A 4BNVA 4ZN6A 4G65A 4E33A 4KUEA 4RVSA 4WCFB 2OBYA 3VZPA 3OFSA 3WYBA 1K6IA 3C1AA 5IFLA 4RO0A 1YL6A 3OA0A 3K96A 3ZNNA 1I2ZA 4HFJA 2H63A 2ZCUA 2D5CA 2P91A 4CMEA 3H65A 4CPDA 2ZKLA 4RF3A 1E7MA 2Q45A 5JCJA 3KLMX 3VPHA 2ZQYA 1JTVA 2O23A 3DAFA 2WMDA 3U9LA 4IBOA 1WMAA 3DMTC 1KC1A 1HYHA 1PWZA 1K3TA 4FSHA 3MJSA 3Q11A 1RM4A 1C3VA 1WDKA 1VL0A 2J5QA 4P22A 3ZCXA 4QQRA 2HQ1A 4PG5A 3KSDO 3UCFA 5CDGA 3FCOA 3QVSA 2VCYA 3T4XA 5A03A 3CPSA 3RU9A 3C1OA 4MKXA 4R41A 5DN9A 1NVTA 4I5FA 3VDQA 3C7CB 3PGXA 3OJ0A 4FQ8A 4G5HA 5I7VA 5KJ6A 1YWGO 3L9XA 4GX1A 2FR8A 2QHXA 1E6EA 4GVXA 4DIBA 3SJ7A 4CM3A 1KIFA 2JHFA 1B3RA 3CZRA 1LTHR 4J7XA 2C7GA 1GZ4A 3PHLA 3DB2A 3KHUA 4IZIA 3ZWYA 4CLOB 1E3WB 1HF3A 1U2DA 4MINA 4FFMA 4A27A 4DBZA 1A72A 3C24A 2Z1NA 5CEFA 4RL6A 2D1YA 5IG2A 2Y05A 3LT4A 3Q1LA 1R66A 1TT5B 1Y8RB 5DCYA 4WUVA 3QY9A 3LT2A 1O94A 1NYTA 2X9NA 3ONDA 3LZ6A 4BO6A 1OFGA 1JW9B 2VRBA 1I01A 5L9AA 3JQBC 5TX7A 5AVOA 4IXTA 1H93A 1CWUA 2GN8A 4YT2A 4I8XA 2Y1FA 3WSVA 5JC1A 4XQGA 4KDFA 4ID9A 2XXJA 2JD2A 2YV2A 5C3MA 5IF3A 1PZFA 2EERA 4WK6A 1H0KA 4BMVA 1Y8RA 3A06A 4D46A 3QVWA 5G0VA 1FJHA 4NJOA 2Y67A 3HN2A 5DOVA 1KY5A 3VPSA 3F4LA 1PJSA 4PGFA 4N18A 4TRJA 4BKUA 3CSDA 3VKVA 3DZIA 3QVXA 5J23A 4CM9D 4RZIA 5ITWA 4OKNA 1J4AA 2ZB4A 1J49A 2Y1OA 5JDCA 2B69A 1DC4A 5H83A 2AMFA 3SX2A 2IEBA 4FFPA 3TFOA 4WASA 1K5HA 3S55A 1O0SA 4Z0PA 3BMCA 4NBUA 2DT5A 2VT3A 1EEHA 4BGUA 4NK5A 4B4OA 5A3VA 2B0JA 3LVFO 2GN4A 1KEVA 3G79A 1VJ0A 2X6TA 1I32A 1KVSA 2C54A 4OHUA 4OXYA 3GK3A 4IDEA 3F6YA 2CF6A 3ROPA 3V1TC 3LLVA 1MC5A 5JPIA 5U4QA 5L7YA 1DPGA 3MEQA 2IYPA 2BFOA 4ZU3A 3ZDFA 4IS2A 3AU8A 1OI7A 4AL4A 3ZW8A 3PJFA 1DEHA 3WWZA 3RUAA 3SLKA 4BUCA 2P4HX 4R1SA 2BFMA 1MA0A 3NYWA 1B15A 1DC6A 2O7QA 4PLZA 2CVZA 3JQEA 1W4ZA 3TZHA 4KMSA 4BL5A 1ENYA 4YJGB 1LSUA 1QYCA 3RQSA 3I23A 1DB3A 1Y1PA 4YJHA 4BNWA 3CEAA 2Z5LA 1E3EA 3TZKA 1KVRA 3DAPA 3DMYA 1ZVMA 1YQGA 7MDHA 2HMVA 1R0SA 4O59O 1DRWA 2OOSA 1EK6A 1SEPA 3DZFA 4NJMB 2OXIA 2IZ0A 3L0DA 5T64A 3OQ6A 2C2XA 4IY1A 4Y6PA 4Z0HO 5AXCA 5KCZA 3U62A 1A7AA 1ZFNA 3F1KA 3GG9A 3WGHA 1FDTA 3U4CA 3V5NA 3HUDA 4LCJA 2P9CA 4TWRA 4RORA 1CQIA 3K73O 4ZQEA 4GX0A 1V6AA 1M76A 4K9DA 1GUFA 2DPHA 4R3WA 1YJQA 1C1XB 3AM3A 3IL2A 2NTVA 3K31A 1XWFA 4R1UA 3A14A 2RCYA 3TWOA 3AUUA 3FN4A 3TSCA 4EDFA 2DBVO 3AUSA 1EQ2A 2DUWA 1E1MA 4ONEA 3ICCA 2B4QA 4GL4A 3WQQA 5EQFA 3C7DB 4P4GA 5G0UA 3JD0A 4FS3A 4DA9A 5G2OA 4YAKA 3TDKA 1RM3A 2GRAA 3BTOA 2W4QA 2R00A 2BMAA 5ITVA 1PJCA 4J4TA 3B1FA 3DTTA 4K6CA 4KP7A 3C85A 1YKFA 3VTZA 1LRLA 2O50A 3D7LA 2PZKA 4DQXA 1LBEA 1AGNA 4E21A 2E37A 5JCXA 1LQUA 2W2KB 2WSBA 2JHGA 5COAA 1C1DB 3KSUA 4ZQFA 4IJKA 1UZMA 4KUHA 1ML3A 2FRDA 2C5EA 4BO7A 1ONOA 1Q7GA 3ADOA 3T7CA 3Q6IA 2OP0A 4OKIA 4DLBA 4IDAA 3GHHA 4BGVA 2B35A 1UDBA 3DEYX 1YO6A 4RCVA 5BR7A 1ZSNA 1EFLA 3U5TA 4S3MA 1MFPA 3LDHA 4E2XA 1NWHA 2VHZA 1TI7A 1ZK1A 4L0QA 3Q9NA 4XIJA 1GV0A 2HK8A 1O8CA 1U1IA 2O3QA 3DZHA 5EERA 4M55A 1VE9A 3WGQA 3JD3A 1PL7A 3GPIA 2P5YA 3M1AA 4BGIA 3GF4A 5IZ4A 2IXBA 1QG6A 1UZNA 4XKJA 4N7RA 1ZEJA 4FCCA 3WTBA 4YA6A 4ALMA 1BXGA 2I5PO 5A5EA 3ONEA 4HBGA 1LDGA 3OA2A 5IN5A 5T5QA 4LISA 1QORA 1HRDA 4A7PA 1RWBA 1UH5A 4KZPA 4BO8A 4EJ6A 2WD8A 3RAJA 4Y9DA 4ESOA 2X1HA 5JMPA 1ISHA 5K6AA 5TJHA 4FJ1A 5I7EA 2UAGA 1DLJA 4OH1A 4I5GA 4WLEA 1YB4A 4CQMB 1R37A 3UVEA 2YV3A 1UP7A 1YRLA 3BMOA 3PJGA 3RUCA 1SPXA 1WWKA 2ZIZA 3CMMA 1LUAA 2XF8A 2NVUB 3D3WB 1XU9A 3PZBA 1CJCA 3WGGA 2PH5A 2YHIB 3F5SA 1JKFA 1ZW1A 2Q2VA 3OETA 3ZWNA 3VOSA 4CMEC 2C20A 1FK8A 4HFMA 1XCBA 4PG6A 1NFFA 3ETDA 3FWZA 4RF5A 2WM3A 4IDGA 2J5KA 3K8ZA 3NT4A 3PDJA 3Q0EA 5ENVA 3VH4A 1XKQA 3O8QA 4RVDA 1XA0A 1LDBA 4EEZA 2H1SA 5JC8A 1LNQA 3ZWMA 1O9BA 3WJAA 1W8DA 5EESA 4Y6RA 1R4NB 1HDYA 4MVJP 4R5HA 2O4CA 3FI9A 2IEDA 2YHUA 4GX5A 4IGFA 2ZTUA 3H4VA 2VHYA 4LMPA 2V6FA 4FFOA 2JCYA 3SBOA 4P4NA 4BNNA 2IDZA 4Y98A 5IJZA 4MOWA 2X22A 3EY4A 5KJFA 4EUFA 3I9JA 1S6YA 4CUZA 2VWPA 2IRWA 3OH8A 1QXSA 5DZSA 1VRWA 3QP9A 3W4JA 3H8VA 2QRLA 1PQUA 2V7PA 3DBLB 1ZK0A 3K2EA 3RUIA 1UZLA 1EBUA 3JQ7B 3SC6A 4DLAA 2FMUA 1UXJA 2HAEA 1A5ZA 4I9NA 1I2CA 4J2HA 4ZVVA 4A5OA 4RQUA 4LSWA 1YQXA 3JQ8B 3WNQA 5G0TA 1Z7BA 5TF4A 4WLNA 4CMIA 4YR9A 1EE9A 2AA3A 1IZ9A 2I65A 4IDFA 1J0XO 1BTOA 1QLHA 1NX6A 4NBRA 3TRIA 2FR0A 2HKIA 1SB8A 1QYDA 4B7XA 1LDMA 1GQQA 4BO3A 1AXGA 2Y66A 2QW8A 3DBLA 3H9UA 3M2TA 4GMFA 1B8UA 1LSOA 4YYZA 4OOEA 1U3VA 4R1TA 3OQ1A 4PG4A 3DZGA 3JQ8A 3RC1A 3HHPA 2Y1GA 4ND2A 1T2EA 1TT5A 3JD1A 2P9EA 4XYLA 5JMWA 3FR8A 2Y68A 4OMUA 2HDHA 4N5LA 4GH5A 4PLYA 4EW6A 4MP8A 4NPCA 4ZQBA 3F3SA 1NVMB 5EN4A 1KEUA 2IZ1A 1E1LA 3GQVA 5IXYA 1PZHA 3ZHYA 4TZTA 3QW2A 2AQ8A 4FOSA 1JQBA 3LF1A 3RVDA 1UDAA 1I5RA 2C2YA 4XA8A 4QFCA 3DBHB 5DF1A 5KOIA 1MUUA 4TVOA 4WJZA 4B8ZA 2JFHA 3I5MA 3VVCA 1MB4A 3GVPA 1E3LA 1GEGA 5JAMA 2I3GA 4HUJA 1P45A 2OP1A 5B1YA 1N8KA 4BNUA 3NJ4A 4YAIA 4E6PA 1DHRA 1PU2A 3O26A 1EUDA 4NK4A 4IQ0A 4QECA 2FZWA 3PFWO 3IUPA 4GWKA 1GPJA 2J3JA 1ZXLA 3I9LA 2JKVA 4RPGA 3OP4A 3QQPA 2FPPA 1GZ6A 4UUPA 2AG8A 2I3AA 2E6UX 3HG7A 5A9SB 4DLLA 5ILGA 4AICA 4E30A 1E3WA 5F1PA 3FF4A 2NUAA 4EITA 4DMMA 4BV8A 3JYNA 2Q99A 4RPLA 5IDWA 4H16A 3GVIA 3KZVA 1Q0HA 3QWBA 4XJTA 2RAFA 3UAGA 1QSGA 3KYDA 4GLOA 1I33A 4GBJA 4WLOA 3CMCO 1LLDA 1Q0LA 4JBHA 3EMKA 1DIAA 3S2GA 2LDXA 4FDAA 3FNEA 3AM4A 4YJFA 1HE2A 1Y5MA 3VPGA 1H6CA 2UVDA 3PLRA 3ABIA 5EMHA 1PQPA 1HXHA 3G0OA 4J9UE 4B7CA 3GY0A 3JCZA 5JAIA 3TOZA 3GRKA 1C0KA 4I9HA 3T4EA 3EW7A 1YJ8A 1H9AA 8ADHA 4L4SA 4D3DA 5EQDA 3NDIA 4JGBA 4E5PA 3QVTA 4DPLA 1E5LA 3WG9A 1ENZA 3G17A 2UUPA 5B12A 2Z1MA 4GSKA 5JAZA 4DWVA 1XGKA 3PJDA 4BNZA 3JQGB 4J3FA 4JBIA 4HFNA 4C4OA 2VWQA 4AVYA 4NBWA 2C59A 1T2DA 2G17A 4U0KA 3VPFA 1F17A 5DP2A 3L4SO 3OJFA 1BVUA 4I1IA 4XJSA 4WLFA 1XLTA 5EJ2A 1VJTA 5B4VA 4FFRA 1DLIA 4BS9A 3ZU2A 1RKXA 5A5FA 3DBRB 1E5QA 1F0YA 1W73A 4EJMA 1JLLA 1MX3A 2ZYAA 3OM9A 1NWCA 4CL3A 3DL2A 1X1EA 1KC3A 2VYNA 2VUUA 4O6VA 1DBVO 3EC7A 1B2LA 2JFFA 2O4UX 3IDSA 1KOLA 1FF9A 3NDJA 1TLTA 1SOVA 2NADA 3L6EA 4IMPA 1T4BA 2LDBA 3H5NA 1SB9A 2VHXA 3AW9A 2CF5A 4I9UA 1GPDG 3B20A 4ZGWA 4INAA 4IZHA 2Q1SA 4KQXA 3ZNPA 1NNUA 1A27A 2PKQP 2D0IA 3ZNQA 5JLAA 4ITUA 3VC7A 1QV7A 2W2LD 3ZWAA 4M8SA 3TN7A 3ZHZA 1R6DA 3NUGA 1U7HA 4YJGA 1EE2A 1VSUA 4CLEA 4ROSA 1MG0A 1UXHA 2PZMA 2X9GA 1RPNA 3L07A 4MVJD 3RC9A 4PLPA 5JXWA 3ZWWA 1CETA 2EKPA 2X58A 1X7DA 2E82A 3DHEA 2JL1A 2O3UA 3GMDA 3OSUA 4QT0A 1K89A 1SOWA 4CMHA 3K5PA 2DTDA 2X8LA 1B7GO 4D0SA 3IC5A 3WQSB 4L73A 2DM6A 4XQEA 3ITDA 4GWGA 1Y8QB 5ER6A 3DC2A 1DIBA 3VH3A 4DMLA 3PXXA 3MJ4A 3IKVA 1ADBA 1YS4A 4CL8A 1QRRA 3W6UA 3K92A 4D79A 1UAYA 4GX2A 4UVIA 2HMUA 3FPCA 4XRRA 3OMLA 1ZK2A 5KVQA 5TS3A 3VVBA 1BVRA 2HRZA 4ZRMA 4L8VA 3GAZA 2VZ0A 5JNLA 1PS9A 1NQOA 2AQKA 1W0CA 3IJPA 4OOFA 3FRJA 1XQ1A 5A4DA 4CV1A 3I9OA 4AJNA 4J43A 3OEWA 4N54A 3GZNA 2A92A 4GGPA 1OOEA 1K2WA 1Y8QA 3INGA 1KEWA 3ZV6A 3HB5X 2NU6A 1O95A 3LC7O 4E13A 3JD4A 1C0IA 1R15A 4NU5A 1HDRA 1C1DA 1PIWA 3CZMA 5AXAA 5JAQA 3DZJA 3S2EA 5CG2A 3NDRA 4IM7A 1FXSA 4R4JA 1SAYA 2AQIA 2NACA 2ZK7A 1T2AA 3DHNA 4JNKA 2PNFA 1JDJA 4J1SA 3E6AA 1LXCA 1GZ3A 3A1NA 1UXIA 1QR6A 1CERA 3VKUA 1E3IA 3AOEA 2H6EA 2NQTA 4J49A 4CMCA 5BNIA 4FJ2A 5GY7A 4D3SA 3K30A 1R4NA 4PVCA 4YPOA 3ZWPA 3IQDB 4UVDA 4A10A 2VYND 1QP8A 3GN2A 1NHGA 2VNAA 4U0JA 4CR8A 1D4FA 3DQPA 4KOAA 1MP0A 5LDHA 1GU7A 3RKRA 4KUGA 4JBGA 3HADA 1OZAA 4OGWA 2DAPA 1EK5A 5JBIA 2GLXA 3KV3O 4WGGA 4AJHA 4F45A 5C7IO 3GZ4A 4JROA 2XXBA 3OQBA 4W9NC 1T24A 3ORFA 1QYWA 1IPEA 1WPQA 4PLCA 4DC0A 5TIIA 4R68A 4HNHA 4BQRA 3SVTA 1P1IA 5BSFA 1P1HA 3I4CA 1OMOA 2VTEA 5I7FA 3U09A 4B3IA 3PHGA 2YUTA 1YBVA 2FR1A 4MVJA 3QIVA 4HFRA 1DIRA 2ZQZA 4MVJI 4OJNA 3BMOB 4JP2A 2PR2A 4BMSA 4CMIB 5COQA 3FTPA 1N9GB 3QV1A 3H5AA 1M75A 4LK3A 2GERA 4LN1A 2VWGA 4M54A 4BQPA 1OAAA 3UCXA 2VOEA 4HY3A 2TMDA 2X23A 1EVYA 3WGTA 3O03A 2AXQA 1PJ4A 1YH3A 2DTXA 4B3HA 3AY3A 2EV9A 2YJZA 1P1RA 2O2SA 4R3NA 2YY7A 1CDOA 3TPCA 2FP4A 2VUSA 3R1IA 4RV9A 4AJ1A 2VNSA 2I67A 1JU9A 2OZPA 3TL3A 2Y1CA 1PR3A 4N5NA 5LDGA 2PD6A 1YBAA 4YQYA 4E2ZA 4BB6A 4NIMA 1DRVA 1VKOA 4JJIA 2Y1EA 2ZB7A 5CEEA 2EW8A 4KWHA 1KVUA 4DRYA 2QX7A 1TVEA 4GKBA 2BLLA 1UJMA 4XWYA 1DDOA 2DPGA 3WNVA 5KKAA 3E48A 1NASA 4MIOA 3MWDB 2YDXA 5KJ1A 4LRSB 1O6ZA 1PR9A 3RROA 1YL5A 4WCFA 4YCAA 2J6IA 2OGUA 4W7IA 1DAPA 1DAOA 2B5WA 2ZB3A 2H5LA 4DQUA 3FWNA 3I4FA 4UUMA 3E03A 1P0CA 4M89A 1BXZA 1D7OA 4Q9NA 4FR5A 4TROA 3V1UA 5TNXA 2ZATA 2OFPA 5GZ3A 5TRTA 1XG5A 3H3JA 2YFHA 2Y0DA 3GT0A 5TLSA 1EVIA 2EIHA 1JWBB 2FY8A 3HZZA 4IINA 4PZEA 4YAEA 2AW5A 2OORA 8LDHA 1XIVA 2B4RO 3RWBA 5HA5A 3OJOA 2PTGA 4BNMA 2GR9A 2DTEA 3OEYA 2X5JO 3BZUA 5EIOA 3E5RA 3BXXA 5A9SA 4RF2A 4WKGA 1G1AA 4W4TA 5IDYA 3PHIA 4RGBA 3RUEA 2QYTA 3DR3A 2NM0A 3DZKA 1R4MB 3D4OA 4M87A 3AWDA 2I76A 2QIOA 2B83A 4MVJE 3GC6A 1E3SA 1EFKA 1YOVA 2O7SA 4PZCA 5T57A 1B26A 1NPTO 4U6QA 3UN1A 4FGWA 1RM0A 3RCBA
chains in the Genus database with same CATH superfamily
2XGOA 3LG2A 2R11A 5HJ2A 5JV5A 2RH4A 3UXHA 4O8ZA 3GRFA 1JDTA 3B36A 3OLYA 1KJQA 1CP3A 3HKBB 4S1TA 4WZ6A 5IUNC 4WV3A 1C1YA 5KTYA 5IT0A 1CF4A 1ZMRA 1ZEMA 2ZS9A 2WUDA 3B3JA 1LSSA 2OECA 1I7SB 2UKDA 2ZJ3A 2FZLA 3B1JA 5JH7B 5JXHA 5HZMA 1CHDA 1F8FA 3ORHA 1SUDA 1G291 4NAHA 3RSOA 3N5KA 2B34A 4CKCA 3K6SA 1IDN1 4TLDA 4GR5A 2ILVA 1Z4PX 1K27A 2HUPA 2IOQA 4OUKX 4FYVA 2UZ4A 1KYTA 1JQ3A 1FRQA 1M0SA 4PONA 2GWHA 3CLVA 1P2TA 1Y9DA 3AJ8A 1FXUA 3TW6A 4ZALA 3RS3A 2X0FA 5LU9A 1NPYA 4PLHA 1GTSA 2GHTA 1PL8A 1U28C 2QMUA 5B37A 2E49A 2Q1UA 1AT1A 4G36A 1FFDA 3UY4A 2J0SA 2YZGA 5AFSA 3K9HA 4BVFA 3P0EA 2XDYA 3IR7A 4INJA 3QGMA 4L7VA 4QYSA 1XEAA 3H2SA 3ZPXA 4E7PA 1GGJA 2VXBA 2W90A 4X97A 3SEZA 4A0GA 4HVCA 1ZVJA 3HO1A 1SUSA 4DBVO 2ATVA 2D59A 2EKZA 3KWFA 3TLXA 3PHJA 1XF1A 2CSXA 1K4KA 3QPDA 4FD3A 1K7CA 1HK7A 1E9SA 3M9WA 1U2DC 2AC2A 5CDUA 3W8EA 3EHEA 2H3EA 4ZMSA 1DJLA 3L9WA 2CVPA 4KAAA 4Q9AA 3RYHA 3SYNA 2DFLA 2VWHA 2HQRA 3CSSA 2OA0A 4FJ0A 5CLQA 2BEKA 3LC2O 5ARBA 1Y3CE 1ZGAA 2QRQA 4LOIA 3U4DA 3CVXA 2CYBA 2Q7XA 3WSWA 4DLRA 1JX6A 4D97A 2NUPB 1FFXA 2B7LA 1LGYA 4JXXA 4JLJA 4EI7A 2H08A 1ONSA 3LLSA 4BX2A 1JSLA 1NMSA 1L4NA 4MPJA 3D0OA 4EJFA 2I7TA 2JGAA 2PPLA 2XTAA 5TY0A 1VL1A 1YVPA 1A77A 3KB6A 3OCYA 5EXPA 4CR6A 3BYZA 2WW8A 3ND6A 2VLIA 4KW7A 3T12A 4DANA 1Q11A 3ONFA 1OX6A 1WDMA 1MO3A 3AHIA 4HDNA 2GAOA 4CI0B 4PAQA 1Y9AA 5EPOA 4RDCA 3QFRA 4M6WA 5EZYF 3VR4D 3HYRA 4MVJF 3PUJA 5CD9A 5K0GA 4XUCA 1G9XA 3TW8A 3KZOA 5DX1A 1QJCA 1P33A 1VG8A 3JQFC 1XJ0A 3U0BA 3TKYA 4BNGA 4OVKA 3EXEB 4BP9A 2GFQA 4KN8A 1QWSA 2AKAB 3C6QA 1P6QA 1PK8A 2I78A 1DU4A 1FP4B 1RYDA 2JJ1D 2WAOA 1A95A 2XMDA 5BQ3A 1M6WA 4OHFA 4F85A 1Y5RA 4Z3DA 1LEHA 2ZZKA 3PLAE 1AS2A 2EFGA 4X5OA 1IULA 4N6GA 5JO9A 1KU6A 2PD4A 3UUWA 5L3QB 5GONB 4OQYA 3LBNA 2DQ4A 1EH5A 1WL8A 4LNAA 1HFEL 1BSVA 4DUPA 3R0IA 4XYGA 1YJXA 4O0MA 1V1RB 3HWSA 1VRCA 1AHIA 1MCZA 1RQXA 1ZI6A 2CVQA 4B3FX 2FDCA 3UC9A 1CT9A 4G01B 4LNUA 2Q4BA 5IT9A 2Q1WA 2Z9DA 4FR0A 5IVPA 4M49A 3BFXA 4B4DA 4PSKA 1F1BA 5BT8A 5HZHA 3IMFA 3DOCA 4QX6A 3F9IA 2B4KA 2Z56A 2WBLC 2WSSA 2IZ6A 1Z2AA 3WWPA 1DIGA 2RHLA 5ADVA 4YQFA 3HCOA 3QSYA 1FYWA 2ATIA 2LV8A 3HL0A 3PFBA 1V9LA 2GN6A 4PY2A 4TTRA 4OHBA 3TG2A 2Z57A 1ZIDA 3FYSA 2UV8A 4W5QA 1E3QA 1YONA 1C9EA 5LSAA 3GBVA 1YCHA 4PZYA 4IWXA 3I5AA 3G0BA 3DZ8A 2D3TA 1BQEA 2OSVA 3IT3A 4WAUA 1S0UA 1G0NA 1YR2A 4YASA 2GN0A 1JA0A 1M2GA 3AB3A 2BEJA 1J0CA 1KP2A 2AYZA 4MUJA 4R9RA 5DWVA 1JG3A 1NHWA 4MIEA 5U1PA 1EUQA 1ZBQA 4HG2A 3A4YA 1U8CB 2BPOA 1JJIA 2NZWA 4IV5A 4L75A 4Y2XA 4V0ME 4FEEA 2BT4A 1F1JA 3L2OB 4FFDA 3U3DA 3WLRA 2QS9A 3O31A 3CTPA 2ZJ1A 1AZSC 1C3EA 3BWEA 3T3OA 2VT2A 2YJTD 5JI2E 2YS6A 2ZJZA 3EQ2A 4J29A 4U3JB 1EVJA 1GGEA 2J9RA 3HXQA 3NX4A 4LJ7A 1J9GA 3L43A 1JHYA 2R1VB 2VL7A 4W82A 3KU4A 3BIFA 3L5OA 2B8EA 5D7BA 1U0BB 1IUKA 1SXJB 2I2WA 2ZB8A 3QBJA 4HB4A 5LA6F 5DTQA 1NPDA 1T9HA 3SI7A 5E0OA 4BWFB 3AHFA 3B85A 5J5CA 1DXQA 5A5DA 4ZRNA 4M86A 4ENTA 3JTEA 3PE3A 2KE5A 3MIZA 3FM9A 1EVZA 3B51X 5BOVA 1GNLA 1Q1EA 1EB8A 2XMGA 4ZHQA 5KYNA 7ADHA 1GCGA 4IL5A 1LBQA 4TS4A 3CVJA 3B6ZA 4ZT5A 3SEAA 1BAPA 3KALA 4U2CA 4R9VA 4MUAA 1FLVA 4XPIA 3UJHA 2BE7A 4QODA 4BAZA 5HDQA 1WBJB 2CDCA 2Q21A 2AHRA 2V6MA 3ZHUA 1ABBA 3NBFA 4EG7A 3KWMA 5BXYA 3UZUA 3BERA 3TZQA 2P4SA 3ZCTA 1COZA 5JJLA 4FMCF 4QOGA 4H3VA 2ZGVA 2PUEA 4AC9A 1HG0A 3ND5A 2PL5A 3ROTA 5K09A 1SQ5A 4JIGA 5C3UA 3IEKA 4FBGA 5F98A 2VXOA 4F91B 3E2PA 4G0PA 5SZHB 4YRJA 5BQ5A 2MU1A 2H1HA 1FIUA 2P9HA 3ZWQA 1GKUB 4WXEA 3KQUA 3VYUB 4UCFA 2Y93A 3HDJA 3P2IA 3A2LA 5DBEX 1GR0A 2V8OA 3ER6A 4OFZA 1Q3TA 5F5XA 3HWRA 3TZCA 4U8HA 2VQFB 4JC4A 3GU3A 3FSRA 3L6OO 1I6MA 4LXXA 3IBSA 2QI9C 2JCBA 2UZIR 1XXHB 1R2QA 4N4AA 4MKFA 5E7QA 2OHHA 1IG3A 4OAPA 3ACBA 4A0QA 3VR1A 2P35A 2DLCX 4S0ZA 3D0RA 4CMBA 4JUIA 4BEWA 1GAXA 3DPUA 4M3NA 3MTEA 3MFQA 5NLLA 4BQIA 3OWHA 1EFDN 1YDHA 4J0KA 4IILA 3PDUA 3TOSA 1UKYA 2DFDA 3GJ8A 5CPBA 3VMFA 2NUTB 4RS3A 3SQOA 4AROA 4L8YA 2R6FA 4LXUA 3AIMA 3SVZA 1BYIA 4D9IA 3D9QX 2C8VA 5BNTA 2QQGA 3FPEA 3HR7A 3VDMA 1RCUA 4DYVA 2ZDGA 1D03A 3G9ZA 4PXSA 4DG8A 2QRZA 1NQVA 4TMFA 1SD1A 3EXHA 1U7DA 2JAPA 5ALQA 3VR6H 2HBQA 2P78A 4L4RA 2WIBA 4A0SA 4QKQA 3NBYC 3P20A 5F2NA 2Z3VA 4LGCA 5CT6A 5E2AA 3FTQA 3ASYA 4UAVA 4M1OA 3W2TA 5BW4A 2VH1A 4QUJA 2O8BA 2JNWA 4JJ4A 4BV2A 1LB1B 3AEKB 3C3CA 4M38A 4RDHA 3UOGA 4DCTA 1IJBA 4X1OA 3PSAA 4MPDA 2FX2A 3EMVA 4C29A 3FOBA 4DCOA 1KY3A 1I3KA 2D06A 2WKRA 3DBIA 3TCKA 3KQKA 1KARA 3QPWA 2XR1A 3E23A 5FLKA 2I8LA 3NNDA 4RTLA 3NHPA 3DCIA 4MSUA 3ZV7A 3LC0A 2B5OA 4HS9A 3IQWA 4C05A 3GW8A 2FYTA 3NR2A 1VIMA 3WY9A 2GSWA 5C34B 1L7DA 2WNSA 3S6JA 4BNIA 4CODB 3BDVA 3HXKA 3IAFA 3P2YA 4FHFA 3AQ4A 3LUDA 1XYGA 2L2QA 2YWJA 1XNJA 3VH2A 1IY9A 1CLEA 1WW8A 1XLTC 3FF1A 1IE3A 1B23P 2FKNA 2TMGA 2J33A 2JGJA 4XYEA 1TO2E 3ZE8A 4LAFA 3ZNOA 4IHJB 4B8WA 1VPVA 3AFIA 1HDXA 3R5SA 4EFKA 2NSHA 2N1MA 2R1TA 3H5TA 4HGPA 3DM9B 4MRAA 1QGOA 4DRZA 4DB4A 4EI9A 1SVOA 1KAHA 1EVQA 2PUHA 5CFOA 3JZDA 4L9WA 4BATA 1W4BA 1Q91A 1ZRMA 3Q3EA 4IHJF 1N6OA 1RBMA 3ODPA 4EF5A 2BFPA 5C1BA 1A4IA 1RYHA 1T1EA 4TXJA 2W6CX 1ESCA 3SQMA 1E3JA 1JG6A 4XSGA 2BRUC 3HN6A 1V3VA 2I7VA 2PA3A 2AX3A 2XUFA 3PFCA 3RKSA 1KVTA 3DDUA 4YCSA 1XD2A 4RKFA 1RIFA 2Y1LA 4ZICA 4BLTA 4JI6B 3SC2B 3TQCA 1DKUA 4QTZA 3RV3A 1JIQA 1LPPA 3KYCB 3PQ8A 4PTZA 1WZIA 4DLTA 1ZH8A 3INTA 4ZVLA 2Z5GA 1DQNA 2PH3A 5IZCA 1SURA 3FWHA 5FH9A 4DCJA 4GDFA 1ZR4A 2IE8A 3KOWA 4EKNB 1DQZA 4H60A 5AQ1A 4GSLA 4BQEA 4U5QA 2C00A 3WL6A 4IQ8A 2WV7A 4HDSA 4WY2A 3ANYB 1V8ZA 2EC5A 2QPTA 3SYTA 1GZUA 3HPRA 5CHYA 4D98A 3QKIA 4JJGA 5MFZA 5ALMA 2DT8A 3A1VA 3TFQA 4E09A 2AZDA 2J3DA 4BQSA 3HXPA 1MC1A 5L7TA 1CFJA 2HWKA 4OMCA 3UJDA 3VPXA 3KT3A 4EZIA 4TXMA 4EG0A 1LDYA 2UYYA 4MLZA 4N0DA 4QXAA 3GQBB 4ZAZA 3S2FA 4BKQA 1JKIA 1X39A 3E9DA 3AF1A 4RC9A 1DAGA 3GEHA 3SIPA 2RH8A 5HS4A 2PTHA 4MYHA 5A6SB 2GPAA 2XZLA 4NCNA 1EBBA 1VYVA 2DBZA 4H4EA 4IDHA 2X1LA 4XR9A 5J1TB 4MI1A 3SIRA 2QN2A 1ZLXA 1V43A 4S1PA 4Y67A 5TMDA 4AY5A 4UFPA 4RJTA 3ACDA 1BU8A 3C1UA 4JJAA 2ZR7A 2G9ZA 3QTLA 1H2FA 4O2BA 1G60A 4CT5A 4BX0A 3IT0A 5C80A 4ZCSA 1IATA 1EHCA 4R0MA 3O9VA 5B1EA 3ZBTA 4A8JC 1GQYA 4FSXA 4HUQA 1VSTA 1X7HA 4M1EA 4WSOA 4DA8A 2F55A 2I6XA 2IXEA 4RHUA 2A94A 4LRYA 2H18A 4CKWA 1KMHA 3OZIA 4JQZA 1DBQA 4NOJA 1Q0TA 4R3UC 1O77A 3RIGA 4QU5A 2RK4A 1WHTB 4CLOA 1E9CA 4TM7A 1B0ZA 3AONB 3KJHA 4RMJA 2O8FA 3COPA 5LA6A 1BA3A 3LHKA 4YQEA 2HLPA 2WUWE 2CE2X 4FFSA 4LZNA 4DJTA 1ZL2A 4QLBA 4P80A 1SMKA 4ARAA 2AFVA 3RS7A 2V55B 4NI5A 4DS3A 4BVLA 3T9EA 2P0AA 3G3EA 2XA9A 4Z3KA 2VHEA 2Y0EA 5H1YA 3UTCA 1D4OA 3B2QA 3DDNA 3DMHA 4MDYA 4ZANA 2AIRA 3KKOA 5DYIA 2C4NA 2PS9A 3EFBA 3JPWA 3WGVA 4DC1A 7REQB 3I6IA 4MO2A 4ZO6A 2VTBA 1GRVA 1D09A 4JVNA 2QGFA 3RRMA 4EVQA 4P2GA 4C4AA 3BSFA 2JCVA 2F00A 1ZGGA 1ZR2A 2DSNA 2D6FA 1P80A 2JAWA 4KYIB 5DM1A 4WCDA 4GPD1 5P8WA 3WJ7A 4FOTA 3RJ9A 2IV3A 4DJFC 1ZOSA 4OYHA 3MZ0A 1M0WA 1F5SA 2B82A 2G67A 3A6JA 3FAZA 3PNLA 2P9FA 4GP9A 4GYKA 5EE1A 4I7EA 2QAGB 2OO5C 3ET4A 5FL7A 3MSCA 3QX7A 4OKSA 3RJ5A 1C3LA 4PIMA 3UHAA 1DEAA 1RWWA 1V45E 3KD3A 1ZRSA 4FYKA 4XCXA 2ID8A 1GJRA 2I4TA 2VCEA 1LA2A 4MI6A 4TQGA 4Z8XA 5CM2Z 1KFCB 3ICQB 4LK2A 1C80A 4AMGA 1Y9EA 5ENZA 4E07A 1KK0A 5J2TB 3Q0TA 4PYRA 2WG0A 3VJLA 5KSOA 4JA0A 1KHTA 3CT4A 3RYFB 2QGZA 5SZKB 4C0AC 2VUIB 3AVQA 1W5AA 5EUQB 3KKPA 4QASA 3OOYA 3NEAA 2EU8A 2Z5VA 5G4LA 1L8QA 5FAXA 3TIGA 4QTXA 1F8UA 2NU7A 5KTOA 1X0VA 3MERA 1FU7A 4QYXA 1JS1X 5B3KA 2W8BA 1SKAA 1SCAA 4B40A 3PNYA 4CW7A 4RXTA 4ZYTA 5BMVA 2P6NA 3H5RA 5JSFA 3CUUA 3EUWA 4MP3A 2OZLA 1JJBA 4H6XA 5A0VA 1QB8A 3IXMA 3ZWXA 2RBKA 4ZVSA 2FPGA 2AQHA 1MORA 3LWBA 4XM0A 1S3SA 3WLTA 1KZ6A 3ZS8A 3DKRA 2AF3C 2CKDA 5LD2C 2QTNA 2OZVA 3K09C 1IUNA 1ICEA 1MQ8B 4PG7A 4A03A 4Q7QA 4C1NA 4CM5A 2ODQA 2AR0A 3E7FA 1BJKA 2X0RA 3ITKA 3RUFA 3C8UA 1SXJE 2HPAA 2RGDA 4EEKA 3FKQA 2ONCA 3J7TA 1BROA 4Q3CA 5HF9A 1A1VA 3H2GA 3IKLA 1P2FA 3DEFA 4FHDA 1BH6A 3WNCA 2PQ2A 5JMOA 1Q5PA 2CXXA 2E4AA 3OQHA 4G56A 1KQPA 1Y33E 1JVSA 1E59A 5L95A 3ROXA 3A7EA 2BUBA 1SC1A 2BH2A 1Q15A 2Z4SA 3S70A 3LX4A 4IMRA 2FSUA 1E6WA 3CJTA 4OXKA 5SYNA 4UAJA 3SFVA 4O1MA 5DBGA 3ZKAA 4M6WB 5KYGA 1ONPA 2QMEA 3GJRA 4KKXB 3E53A 4MPPA 1ZM7A 1XL0A 2HLHA 2WG2A 3ZU3A 4PX3A 1EFCA 3GNTA 2YWCA 3DO6A 4A2PA 4X8OA 5K0JA 4TKVA 1LK7A 2IXAA 2WVAA 2P4EA 4MULA 4JJ8A 1NG9A 1EX6A 1NATA 2GDJA 1PS8A 1PWHA 5GOZA 1M6VA 3IAEA 2IU0A 4ARSA 5IZCC 2PJRA 4F93B 4LV5B 1EVEA 4XGKA 2HDWA 3F7MA 1YF3A 3OQPA 5KPDA 1RJ9A 3PT5A 4R2MA 2A5YB 2JW5A 3H2IA 2YW2A 2XGSA 4B3BA 1J07A 3RC2A 3B3AA 1DOAA 3CR3C 3AMVA 2BDUA 4ZOEA 3U80A 5IVKA 2FPIA 3HCEA 3N6XA 4XB2A 2E4WA 5TMBA 4DCGA 5L51A 2I6TA 2ECPA 2OOKA 2IYRA 2DFNA 5IBRA 5A02A 1GV1A 3QE3A 1QHSA 1KFJB 1R18A 2DSTA 4OB7A 3MJCA 1YFLA 1GLVA 2IIBA 4HNQA 4RF4A 4GOOD 2XYRA 3G82C 4NECA 3Q1KA 4JC0A 1Z45A 2D1SA 4ND3A 2SCUA 3AV3A 1D4AA 1K08A 5KOHB 4V1CA 2YQZA 3EODA 1ATIA 4LSMA 2HMYB 3HXLA 3VSBA 1KU0A 1YRAA 2V6JA 3ESYA 3MLBA 4GEKA 3V1NA 5CB8A 5HFNA 4E3WA 1E2BA 3M4JA 2HLNA 1E2QA 3FOEC 4RW0A 4QWMA 3VDRA 1NVUQ 2H1OA 1UMBA 3CZ9A 4DZZA 5UKDA 3H9QA 1I9GA 4FB4A 5CP8A 4BZQA 4MWCA 4C9BA 2BHNA 3QFFA 3HBMA 5JIBA 2GS9A 4OX9B 2NO4A 3SOZA 1E9FA 2D2IA 3A3PA 5JRJA 4KGXA 2PV0A 1BS1A 4H1TA 3D4PA 1WB9A 1IQUA 3L7BA 2VDMB 5IJ0B 2ONZA 5K5EA 1H2BA 1EDEA 2DR0A 2VOJA 4FYIA 3OJWA 5K0TA 3PVCA 3I1JA 3QJYA 1GY8A 3U3JA 3ZI0A 4ZO9A 3MS2A 1D1SA 1I4DD 5J9FA 5KX5F 3HFGA 4IEFB 1WKBA 2FWIA 3WRWA 3IMCA 1UL1X 3L06A 1XALA 4A3SA 4BV9A 1G21B 1AY0A 1MHTA 4IDCA 1UC5B 4FHZA 3OLCX 4IOMA 4PZAA 2RHWA 2EF1A 3OJCA 4AI6A 1A97A 1M7BA 1Q20A 3IAAA 3MWLA 3HJUA 3NVMB 3NJ8A 2Z58A 3QBVA 3MSXA 4HCJA 3STTA 4RTMA 5ALTA 4LV8B 4MGYR 5HZKA 1I10A 1TYAE 1XD8A 1TK9A 2Z6VA 2KX7A 1OE0A 4S1VA 3I42A 3B2EA 4NPAA 2V9ZA 1J7KA 2XPCA 3C70A 3K32A 5JYDA 4IIVA 5A3RA 5DCLA 2P2NA 4F84A 4YAJA 3UQYS 3PWTA 3SBOA 2VYQA 3IPYA 3NXSA 4Q7MB 1J0EA 4BKRA 3IAXA 1YZYA 3CZQA 1KAEA 3IO3A 3GEDA 4HP8A 3E9QA 1AUQA 2A35A 1XHEA 1Z25A 5I8ZA 1FC0A 3ECAA 4HH4A 1Q2XA 4YWHA 1NT4A 1WJGA 2I80A 1IAQA 4C0BA 3GA0A 3HDQA 3TGLA 3M7IA 5MF6A 4YALA 3V00A 1CV2A 4ZU1X 3C16C 2PBLA 3K0SA 3LCRA 1JQAA 1HUQA 2D7DA 4FC6A 1YUBA 4N3GA 3M49A 3JTMA 4MJ7A 3SJCA 1YB1A 4MWBA 3WMRA 4LTDA 4C4YA 1XAGA 1TU3A 1EUZA 1VIDA 3TI7A 1MVNA 2P9YA 4LF4B 1JIJA 4AU1A 4QXPA 3T7DA 4RY0A 1NUPA 2X76A 5FAKA 2NVUA 3HO6A 4ZOCA 2GRUA 4EMUA 5BW8A 4ZD6A 4J3NA 3IKMB 5ALWA 5BSRA 1U8AA 1TW3A 3AWIA 3GJYA 3LY5A 5K6RA 2RHBA 1NIPA 1ORTA 2YRWA 4JLOA 3UJAA 2VJKA 2GK7A 1YRWA 4EHLA 5AQEA 1YQTA 3AR2A 3H75A 3ZZ1A 4P7KA 3DLIA 3LPCA 4R05A 1HDZA 4OK3A 1X15A 3UFBA 1E92A 3QYJA 1GD1O 1W581 3NGXA 2DVMA 4JN6B 1EU1A 3BRCA 1KTVA 4YCLA 1E9EA 2ZWPA 4QDUA 4K88A 1S1CA 3SQLA 3A0RB 2O8EB 3HB1A 1GTMA 2ZBFA 2PBZA 4M9QA 1CUGA 4GGOA 5DNAA 3RLIA 3UV7A 3W78A 1E4EB 5EVJA 1MOPA 4B73A 3NTQA 4YRBA 4HGOA 1NM5C 4Q3AA 3WO0A 4C0KA 4ZVPA 4P3PA 1C1HA 4RGQA 2QZZA 3SYMA 1EP3B 1DBWA 1R9NA 2C99A 2NX2A 3CRMA 5KWVA 4AXXA 1ZC3A 2Q50A 3VGPA 2OSBA 3UAVA 3OESA 3BXPA 4OQEA 1L7EA 2FQYA 4K1LA 2BGKA 3D0QA 3BJRA 3NGLA 1EINA 2FMKA 2X13A 5F2OA 3IQHX 3ZCRA 2ZWOA 1HT1E 4YTEA 1X92A 3MOGA 1PZXA 2O6HA 1U8FO 3QKSB 4TLBA 3CS3A 3KKNA 5JJBA 2QR5A 3BGVA 4CF7A 5JAOA 3K3PA 4U2KA 5CLFA 3M3HA 4LJRA 4BQNA 1QIIA 4CV2A 1TRKA 2WJZB 3AVUA 4BWYA 3E61A 1DFIA 3RIXA 4N8EA 3OZWA 4YUYA 1WB4A 1GUZA 3JQ7A 4YPVA 1NN0A 3M6MD 5CFNA 4AJIA 1ZN8A 3DMPA 1YDMA 4IIBA 2C57A 4NCBA 1GL6A 1VKJA 2NQ2C 4Y2JA 4FDUA 1N1GA 1WZUA 1RBQA 2POCA 1N2CB 1EXVA 4ZOLA 2IC5A 5DLPA 3REQA 1FTWA 2P7HA 4LPSA 4J7UA 2NYAA 3IH5A 5F76A 5KI6A 3LRXA 1I4LD 2DOKA 5FL7D 1TNDA 1T2FA 3DHYA 3T1YB 4C3UA 4QVKA 4PPNA 2IHYA 1COWA 2IOHA 2JVJA 2NIPA 3EZ7A 1ZGCA 3TBKA 3TYXA 4AY6A 1BIFA 2WWRA 3P9RA 1F9EA 1LV7A 3PDHA 2JARA 2VAMA 3V4SA 3LDGA 2J41A 3CX8A 3H1TA 1X2BA 3RPEA 3RARA 3ZOKA 5B4TA 1UODA 2ESRA 3H87A 4CM6A 2JVIA 4C6TA 3PCRB 3TK1A 4D82A 4N6OA 4Y18A 4EBFA 1NE2A 3SC2A 3EMBA 4TMWA 2ZJ5A 1TAGA 1QYRA 3S7ZA 4EHFA 1PD1A 4I46A 4L9RA 1PV4A 2HYIC 2H1RA 3IIKA 5AT1A 2IIQA 3W2FA 1QIKA 4N01A 4UHEA 2O1XA 1SBYA 2V7QA 3NFYA 1ZK3A 2YMQA 2X3UA 2AE2A 4HSGA 4L0MA 1ISMA 4IOJA 2WWGA 3UT6A 4DCPA 4F3CA 3HN7A 2D0DA 1CEYA 2P5TB 4TV8F 1U7WA 2D5BA 3B70A 1XTBA 2AG5A 4L8GA 3VZSA 2X9QA 2CMFA 2REBA 4JDUA 5G3ZA 2WWIA 5CNIA 2WI8A 3QM1A 4X91A 3O8LA 3WGJA 3GDWA 4WNCA 3FOWA 2YN0A 1TC1A 3LHDA 3K70B 2ZXUA 5B5SA 2OLKA 3SHQA 3OJEA 2RE8A 2FSIA 3O73A 1OWMA 3JVUA 2PD3A 4PEVA 1T8PA 2DFVA 2PXXA 4QICA 2O8NA 1X1QA 5BV8A 3BC1A 4QYTA 1SEVA 1ZY2A 2H1LA 3D02A 5IRCD 2OXEA 3JQCA 1FW6A 4F8JA 1WCXA 3ZE6A 1Z63A 1CKEA 5A7HA 4HDMA 4EH1A 3EWAA 5FHQA 5I3CA 2YFQA 2XBMA 3MUNA 1C9NA 3GZTB 3MA0A 3PEFA 4ND8A 1MOSA 5BYJA 1OKKA 3AUAA 4HRXA 2WU3A 2C2KA 2HMWA 4Q4LA 1AS3A 4QHTA 5C32A 1X8KA 3CW9A 2VCHA 3C6MA 4NP6A 4GU5A 5CYPA 3VR6D 3A9WA 1BCRA 1U6KA 2G04A 3QENA 3NHUA 5KX5B 1MOQA 4B3DA 1N0IA 4WDQA 1W93A 2CXUA 3HGMA 4IWYA 2Q4TA 1GG9A 4DEYA 1KP3A 4YMHA 1I94B 2GASA 1US8B 1TU0A 3G6WA 4OBWA 5HTOA 5EIXA 1I7DA 3UJ8A 5ESXA 4YONB 1C9DB 1XVAA 1RXVA 4YRNA 4CKCB 1V8PA 5DEOA 5D01A 1NP7A 2QSYA 3PFGA 1BGVA 2EKLA 4IIJF 1P5HA 4KTVE 5DWDA 1E1RD 2G88A 4I99A 3USCS 2COEA 3JYPA 3Q2IA 3UJBA 3G6KA 4X1IB 5CEJA 2PH1A 1WVMA 3H1FA 1TUGA 2JHPA 3C3EA 1OGIA 3UB4A 1FDSA 4L3WA 5CVTA 2HEIA 3P9CA 5EGSA 1IB6A 4W5TA 1MAAA 4M46A 3EVNA 3T52A 4AECA 1AF4A 5BYKA 2DHEA 4OUDA 1I2DA 2OILA 3MCVA 5IAAA 1FUYB 2JGDA 1IJKA 4EAQA 3V4PB 1T5SA 2BHTA 3FPBA 1HM5A 2FJPA 3MILA 3RS9A 1UZAA 1WZEA 3LDAA 1KH1A 4QOIA 1JFFA 1GA6A 1TTHA 4I08A 5AXDA 3T54A 3AF3A 3DS8A 1E63A 3W5UA 4TWIA 4G5YA 4U2EA 2ECKA 3K70D 3HHEA 3B7PA 1A7UA 1IHXA 4HEJA 5C7LO 3KQNA 1KI6A 2G63A 3JATA 5BO5A 4IHKA 4TT3A 3BSYA 4OGFA 2ZJ8A 3G2QA 4FNMA 4J4BA 1B8VA 2DHCA 4F2HA 3LCJA 5C52B 1Z82A 2GK6A 4EY8A 1GCUA 3UKOA 3QKRA 4R2WA 4HX5A 4P81A 3EA5A 3RH0A 3VSEA 1O87A 4RM2A 3MMSA 1VCIA 1ZGHA 2EIXA 3UAYA 3NWJA 3PRKE 1WTAA 4DM7A 1NRJB 3ANNA 1M1NB 3K0CA 3M70A 5AP9A 2IOYA 4U39A 4R9NA 3ESAA 1PG5A 1R0ZA 1QYIA 2VHVA 4KRGA 3I30X 5J2TA 3U17A 5HQ3B 4YCDA 1RFLA 2BH9A 3ISVA 4JB8A 1YS9A 1B74A 5K0BA 4II3A 4K6KA 3U61B 1CJVC 2GAFA 3BIOA 3FUVA 3I2YX 1CNEA 1I2AA 1IY0A 1ZC4A 3A3KA 5FEUA 3FG9A 1IN8A 1R0WA 3ADPA 1SNYA 1J09A 3RIHA 4G25A 4OCZA 2ZE5A 4REQB 3H2KA 2LP4Y 1KH3A 5FBVB 4W6QA 4W5JA 4YAGA 1X9HA 1AC5A 2BHRA 2VDWB 3T5CA 5ALLA 3W3AH 3PUWA 5BMVB 2LIVA 3F9RA 4RK6A 3CVWA 2OZLB 1E1KA 3OF2A 3EJWA 3UWPA 3QHQA 4B48A 2B9VA 1I5EA 2FOIA 2QUJA 1VXRA 3PBKA 3PWKA 5C5CA 1QTIA 4OH7A 4Y2RA 3F2VA 4MKZA 4CIWA 4FGKA 4ARVA 4OXXA 3AR8A 2CFCA 2WT8A 5GP1A 4L8LA 4MO9A 1FP4A 1T29A 5EVCA 4CNQA 1NC1A 2Z5FA 5KQPA 4DYDA 1ABFA 4YUZA 3HKEB 4UULA 3ROMA 2HJSA 1TQHA 2YXEA 1OXUA 2QNBA 4O29A 1X9GA 1QH9A 1P2GA 1T2VA 1RRFA 2AJTA 1G5RA 3RSHA 3OHSX 2HA4A 4HWSA 1TF2A 3RBAA 1RYYA 1ULBA 3IMEA 1ZJWA 5AVSA 1RYNA 3DTYA 4D3ZA 2O8FB 4K7JA 4NCIA 4JUAA 3I8XA 4IMJB 1Q0UA 5DNVA 2G06A 1XQVA 2HA5A 2VJBA 1EFVB 3Q7IA 4QEZA 5EY5B 4AJLA 3GN1A 2V0GA 2Y1KA 3JQAB 5FBQB 1K0UA 1SG0A 4GAEA 3W5HA 4YHHB 4JL8A 3TL6A 1PJLA 3KYBA 1ZH6A 3DXXA 3B1KA 3RFVA 4D4IA 1E5DA 1P44A 2ZXEA 3CN7A 3GJSA 3R5XA 4M4SA 2PKEA 5LN1A 4RVUA 2IY9A 2QORA 3MD9A 1PGJA 3BD7A 4KGVA 2WAMA 1RRKA 4ZI7B 3WS7A 3MJEA 1KWGA 1XN1A 3GEGA 4KACA 4YRMA 1VKNA 1Z13A 3NNSA 1AJEA 5SYAA 1E1QD 1R4AA 4FC7A 4ZKEA 1WXQA 3OUUA 4DUZB 3TUZC 5B3LA 3WK4A 1AX9A 2GM4A 3HU5A 3M89A 1E79D 3Q5GA 5ALFA 3I2GA 2E4YA 3COVA 3BF8A 1EWQA 2RARA 4YCNA 4PQEA 1F2UA 2VYVA 3O8DA 1RR6A 3TUJC 4N3BA 3RGWS 4INPA 2PRYA 5ICMA 2C2MA 3DWGA 4ES6A 3EDYA 2AN5A 4B4UA 1C7ZA 4GMGA 4R84A 3AC0A 1U9ZA 1KSHA 3ZK8A 1PTKA 2I7DA 3EG9A 1V71A 4I36A 2XKKA 1M9NA 1Y1KE 2QLFA 3PC4A 4M8LA 1H5UA 3NKVA 3ON5A 1FUEA 3PR3A 2XQIA 3F3MA 4KN6A 1P6UA 1JJ7A 3OT1B 3PXUA 3WWDA 1DAFA 4QGAA 1PAUA 2QRHA 3WRYA 2SCUB 4M0CA 4B6OA 1BHSA 3OZXA 3TXYA 3UGTA 5GADl 1JGTA 4YRLA 3ZKWA 4B2YA 2Z09A 2QX6A 2COUA 5DTJA 5FI0B 4D9EA 4ND4A 1YJ5A 4JHLA 2PLAA 2ONJA 3V80A 2J4CA 2WZCA 3NT5A 3GCZA 2PWAA 2JKZA 3GFGA 3PNMA 5AR1A 4ERNA 4IQGA 1T5OA 3K15A 4XR4A 4D92A 5BN3B 1GGFA 5ICEA 3SZLA 4LXTA 4R98A 1JVBA 1ONNA 2OXFA 4BO5A 2FMIA 5CFQA 4GVLA 3BWXA 3P9YA 2X0IA 3IHLA 5EUBA 3DA8A 3LUGA 4MR7B 2XCSB 1L5FA 1XZKA 1VLVA 2C4KA 5FDFA 2HCBA 3JQQA 3OE1A 4ZCPA 2HA3A 3IP9A 4G8CA 2B37A 1H4QA 3UCEA 4Q1VA 3CPEA 2DFTA 4Z1OA 1CZUA 4OEHA 1GDHA 5DBOA 2NXNA 4IIUA 1SA0B 2N46A 2ORVA 2WFAA 3AKEA 3EN0A 3PC8A 4F5YA 3O38A 1MEEA 1G5IA 2YWHA 2BEVA 2EKDA 3FB1A 4JLMA 3T0GA 3WTCA 4R9UC 4D9HA 1IMJA 1SUIA 5EMJA 4ZIRA 3BXEA 1B8NA 5EIFA 5AIBA 5AYVA 5JJIA 2L0XA 1SHJA 1Z0AA 3AFMA 2G70A 3LLUA 3COSA 4MMXB 5HJ7A 3G68A 4QXRA 4QLOA 4ZO7A 1GU1A 3OE5A 2VDJA 2RGNC 2X15A 1P29A 2IDJA 4CF6A 4L6IA 1QKKA 2ZBEA 2VP9A 4FDTA 5FPHA 5KYUA 3SD7A 3UJCA 2QN7A 4L0CA 3PB3A 1HT2E 5LQSA 3DONA 3FVQA 1DFHA 1E7SA 4KR7A 1J70A 3I0NA 3O7MA 3QVGB 2HRRA 5F51A 1CIVA 2IYOA 1MT3A 2Q2OA 4P34A 5BURA 1U7PA 4O5OA 4AJ2A 1YAHA 3EB9A 3TJMA 5A1TA 1T2CA 2GBGA 3E8XA 3LUHA 1W0KA 1GFWA 2GILA 1TK3A 4N8DA 1PJTA 4UU7A 2J09A 3RASA 3WA7A 3BT7A 4LDZA 4P3NA 3ZTWA 1OTYA 1OLSA 1YASA 4PGMA 4QPZA 1DBRA 4TKLA 1P8JA 4PANA 2ZYRA 1OCEA 5LCXA 4TV9A 3ZGZA 3CIFA 4ZCTA 2QSZA 4F21A 4ER0A 1QLJA 4P38A 1P6XA 3T35A 4OI0A 3GDGA 4DKXA 5I5GA 2DE0X 2QA5A 2VPZA 3QRWA 5ARCA 3SF8A 3VNQA 5BSEA 4I5DA 4BNYA 2I4RA 1OZFA 1VI2A 4CLHA 1BXGB 1RI2A 1VTKA 4UUNA 4U02A 3G1TA 1R74A 4D9KA 2C2BA 2XT0A 5EYPA 1K5PA 3RVPA 1NUSA 3PT9A 3KOZA 3IELA 2QU8A 5CLGA 3RK0A 2ASVA 1DAKA 1H2EA 3E7XA 4YP0A 3VHLB 3KOYA 2F8SA 1N5DA 4J1JA 1G6HA 2X4DA 1MJFA 2OBLA 3MTAA 4HAOA 1JNXX 5REQA 5K0ZA 3LP8A 4FGUA 4YJ2A 1N5JA 3N2IA 4KN5A 5B2ZA 3CLSD 1HBJA 4F3YA 1HL7A 4FCWA 3KG2A 4URHA 1FFEA 1UZUA 1RWKA 2PZ8A 5JD3A 1RM5A 4XIYA 2R1TB 5F7OA 2OG1A 4E31A 1KR5A 3OU7A 5JCOA 2JPDA 3I01A 1GA1A 2WJPA 4BO4A 2W2LA 4L8WB 5AVXA 4BNHA 4Z49A 1I0LA 4UARA 2V3CC 1E99A 1UJ2A 1B6RA 2O07A 3WYAA 4M1KA 2ZRMA 1E2IA 4GDMA 4KDCA 3KFLA 1AO0A 4HBZA 3ICEA 1VC2A 1VI6A 2DBYA 3UWMA 4QG3A 1X77A 4D7AA 2AR9A 1B93A 4ZK2A 1Z5ZA 5FLYA 5K9ZA 3KTAB 3PKJA 1EJ6A 2V6BA 3ENKA 3O8QB 1RLJA 4LPKA 1ZUNB 1QKIA 4X9XA 4CM4B 1QP4A 4KXFB 2RCNA 3KYCA 3L0PA 1W4AA 5BSTA 3P9NA 4FI3F 4TTAA 5CT4A 3UMRA 5MN4A 4ZN6A 4XARA 3H4IA 3WBJA 3KPWA 1PR2A 3SQNA 3TINA 2OYCA 4WCFB 1RAAA 4L95C 5TXGA 3DXZA 2HHHB 3WYBA 3K70C 2Q9CA 3ZD6A 3ZVNA 3C1AA 5CIWA 3CV3A 1YL6A 3ORQA 4HDSB 1UMDB 1SVSA 1JMYA 3HEAA 2AFIA 2IKSA 3IUEA 4NV3A 4XOIA 2W4MA 3LKVA 4HFJA 2WA1A 1L7AA 2P91A 3HYTA 3H65A 4KSBA 3QUQA 4CPDA 3V4OA 3EE6A 4IR7A 3AXSA 1IRXA 3ESCA 3FMIA 5JCJA 4ZI7F 3N8GA 4L5AA 4FM9A 3QF4A 4UNQA 3VPHA 1W19A 2HBZA 4GUDA 4OLJA 4Q1DA 4B84A 4PF1A 5KTMA 1KMNA 3LFUA 2OAGA 4X65B 4IBOA 2PSFA 4LYFA 3TQOA 1SCBA 5LOVF 2BGGA 1RACA 2ZREA 5EKSA 3X1ZA 4HNVA 4L9AA 4PZ9A 1SG9A 3A0UA 2VHCA 4NENA 3OE4A 4P22A 1QUFA 1P4SA 1VMEA 4Z1MA 3DLPX 2D0OB 1Y1TA 4PSVA 1BGWA 3M82A 4L16A 4UTVA 2V5VA 3CNQS 1U0SY 2WQ6A 4YRKA 3CEMA 3T4XA 4B6FA 1U2PA 4YRZA 5A03A 3PX3A 4RKQA 5CFRA 4MKXA 5DMHA 3NHMA 1KS2A 1YAJA 4YRGA 2ZZNA 1NVTA 1UBFA 1IEWA 4JSRA 4I3FA 4ZJZA 5I7VA 1Z5GA 4FQ8A 3VX3A 3TSAA 4LY9A 1YWGO 1K7YA 2FWPA 2EFEB 2FR8A 2HF2A 5FPQA 4HNRA 2J9XB 3B6MA 3WIUA 3IAS1 2VSQA 4GVXA 1RZVA 2QLTA 3GP3A 2PX6A 2ZG6A 1KIFA 1QGUA 4W1SA 4CM3A 1Y48E 1LTHR 1XZDA 2CXHA 3KQMA 3ZD9A 3U6KA 1QO7A 4QGSA 1XRQA 4CU5A 1WHTA 3DB2A 4IZIA 4CLOB 5HXAA 1GT91 1ODKA 2Q6IA 4WVFA 1XC7A 3MBKA 4MRPA 4A27A 3LUBA 1FRNA 1IHPA 4PIPA 5CYFA 4RIFA 4Z4IA 4NYMR 4DJDC 2VDKB 2G0AA 3EFEA 2Y05A 3LBFA 3LT4A 1R66A 1TT5B 3KUDA 4AKGA 1QZTA 4WUVA 4NZZA 4KQMA 3OUZA 1SVKA 2MSLA 3ZY3A 2ZIGA 4WKBA 3OEHD 2BGNA 3O4JA 4G41A 3WLQA 3RG2A 5AI0A 3RAPR 2VRBA 2FN3A 4U7FA 3KJQA 3B52X 5BN1A 5AVOA 1FMJA 3ML1A 2VYCA 4IKOA 3WSTA 1B41A 1TIPA 1TQDA 3ROEA 3V48A 4HS4A 5JPCA 1Z62A 4R2HA 3I8OA 4KO8A