2QYSA

Structure of eugenol synthase from ocimum basilicum
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
310
structure length
310
Chain Sequence
b'GMKSKILIFGGTGYIGNHMVKGSLKLGHPTYVFTRPNSSKTTLLDEFQSLGAIIVKGELDEHEKLVELMKKVDVVISALAFPQILDQFKILEAIKVAGNIKRFLPSDFGVEEDRINALPPFEALIERKRMIRRAIEEANIPYTYVSANCFASYFINYLLRPYDPKDEITVYGTGEAKFAMNYEQDIGLYTIKVATDPRALNRVVIYRPSTNIITQLELISRWEKKIGKKFKKIHVPEEEIVALTKELPEPENIPIAILHCLFIDGATMSYDFKENDVEASTLYPELKFTTIDELLDIFVHDPPPPASAAF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Eugenol synthase 1
publication title Structure and reaction mechanism of basil eugenol synthase
pubmed doi rcsb
source organism Ocimum basilicum
molecule tags Plant protein
total genus 113
structure length 310
sequence length 310
chains with identical sequence B
ec nomenclature ec 1.1.1.318: Eugenol synthase.
pdb deposition date 2007-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05368 NmrA NmrA-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2qysA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 2qysA02
2W2KA 2NADA 4TVOA 1H93A 1T1RA 2YW9A 3WICA 1BXGB 1CEQA 2HKIA 3ZI0A 1HKUA 1VPDA 2VYVD 1GEGA 3TRIA 4KQWA 2EEZA 2WD7B 4K9DA 3JQ9A 1DBVO 3G49A 3OA2A 1CIVA 3VKUA 4HY3A 5F21A 1NQ5A 4H7PA 4BNMA 4L4SA 1UDCA 5B12A 1C0LA 1X0XA 4W99A 2GZ3A 4ROSA 3HFGA 2AXQA 1IZ9A 2QZZA 4NDNE 5F5NA 4E6PA 4WLVA 1UXHA 3IKVA 3INRA 5CDYA 3ONEA 4A27A 4CM3A 3L6DA 1W73A 3ROQA 4FB5A 4NBWA 1JAXA 4LGVA 1J49A 1ISIA 1PJ2A 4JIGA 5DOVA 5I8ZA 3RFVA 1U8XX 4BGIA 5K6AC 4CV1A 4YXFA 1KYQA 1U5CA 3RWBA 1M76A 4DIBA 4BO3A 2RBEA 4PZDA 2VWPA 3WYBA 4JNKA 4R41A 3JD4A 2B36A 3R1IA 3SLGA 1WMBA 3DTTA 3WGHA 4N54A 2BLLA 1T26A 3EC7A 4GX5A 2DVMA 4MKXA 3JQ6A 3JQCA 4PLTA 1GADO 1DIGA 1Y9EA 1IHYA 3GVXA 4TRRA 4PLVA 4EUHA 4MOWA 1GCUA 5KKAA 3UCXA 1Y6JA 5CP8A 4YT8A 3TL3A 2I65A 2JKVA 4PGFA 4RVGA 3WXBA 1Q7GA 2WD8A 3CH6A 4UUMA 4EEZA 4CLOB 2J3JA 1E7MA 4ZRMA 2VQ3A 4WCFA 4O0LA 1YDWA 1O6ZA 4XYEA 3T4XA 3GQVA 2AA3A 4XDZA 3U3XA 4CLHA 4XR9A 1J4AA 4LMPA 2EP7A 3GDFA 4HADA 2Y99A 3FCOA 3RC9A 4BB5A 4G81A 5DBIA 1JDJA 5BNTA 1LU9A 1PWZA 1U2DA 3BMQB 1U3TA 1ZK4A 3FI9A 4FOOA 2JFHA 4IJWA 5ES3A 3LT1A 3VPSA 2DFDA 3GVIA 2CZCA 3BYZA 1FDWA 3HG7A 1O9BA 4H15A 5G0VA 2O3TA 2GRAA 1ZNQO 3I4FA 4D3SA 3PRJA 1NVMB 5H82A 3V2HA 4WLFA 2NVUB 2NUAA 4FDAA 2DPGA 8LDHA 1PX0A 4KDFA 4WUVA 3TFQA 2H63A 5TNXA 4UEOA 4D41A 3GNTA 4DQUA 1IY8A 3HB4X 5L3ZA 1GV1A 1O89A 4BNGA 1ISJA 3WGZA 3B1FA 2QRJA 3NGXA 2CUKA 4RV9A 3BHJA 5C3MA 3HADA 5BSFA 2OL4A 1F8FA 3AFNA 1EQUA 2V7PA 4YJHA 4B4VA 4X54A 5L53A 3PZBA 2AMFA 3OMLA 2O50A 5MDHA 1J0XO 4U6SA 1DXYA 3F47A 4B7UA 4AJIA 5A3VA 1B7GO 3AM4A 3C7AA 1BWSA 2FZEA 2P2SA 4WK6A 1PL7A 5TRTA 2AQ8A 1QYXA 4CV3A 3QIVA 4U8GA 5ICSA 1B8PA 1LLDA 4MIYA 2VZ0A 3PXXA 4L4XA 3H3FA 5KKCA 3Q6IA 4TRJA 3JD2A 1NP3A 3CUKA 3DONA 3U4HA 4FBGA 1N7HA 4W9NC 3UXYA 2QYSA 1FK8A 4A26A 1H6AA 1Y8RA 1QKIA 2A92A 4K6CA 4J0EA 5H81A 4JJIA 1ZEMA 3ZHXA 1HZJA 4II3A 1PJ3A 4R9RA 4R01A 5KJFA 1SBYA 1YS4A 4ID9A 5KTKA 1YB5A 2VUSA 5JAQA 4A73A 3JQ7A 1RWBA 1VKNA 4YEDA 3ITKA 5IF3A 3K96A 4MVJE 2ZQYA 2ILTA 1A7AA 2ZYGA 4QFCA 5G0UA 4CMHA 4IY1A 2AQHA 3GAZA 4RPKA 2HK7A 4IPTA 3QQPA 4QSMA 4NK4A 2Q3EA 3NDIA 1QYCA 5DBFA 3DDNA 3S55A 4YAGA 3HN2A 3QA9A 4I5FA 4RDIA 4XB2A 5JSFA 5AOVA 4FFMA 2E49A 3U0BA 3NGLA 2ZJ1A 4KWIA 3WYCA 1P9LA 4HKTA 5T5QA 3HUDA 1BG6A 3KSZO 3B20A 4Q9NA 2FR0A 5FI5A 3JQGA 4BL5A 2BFPA 2PWZA 2W2KB 5TF4A 4ZQEA 3WJAA 1MFZA 4XB1A 4CM7A 3ITDA 2P4HX 2C5EA 5G4KA 2BGKA 2BFMA 3KZVA 3LC7O 3VVCA 1EK6A 4UEKA 3MTGA 5F5LA 4O5OA 2NU8A 2HO5A 2J5RA 3QWAA 3QVOA 2I99A 4MVJI 4AJKA 4GX2A 1U5AA 4B4UA 4YJFB 2Y0CA 3OF2A 3MTJA 4BNTA 1P45A 4B3IA 1LLCA 4BNYA 1BDMA 1QYWA 3AOGA 3NT5A 1PSDA 2C29D 4UUOA 1LSJA 3VPFA 4CM9D 2O3RA 1AXGA 4XWYA 2VYVA 1ZFNA 3AM5A 4U0KA 2FR1A 2P4QA 5EN4A 2FPGA 2HU2A 4DMMA 2AEFA 3I3OA 4E2WA 4DYVA 5TIIA 3WSVA 4DC1A 3ZV5A 3PPIA 4YR9A 3PWKA 4YACA 2CDBA 3PWSA 5JAZA 4UREA 3FHLA 3RD5A 3E9NA 4QEDA 3PIIA 4FCCA 1GZ6A 1I0ZA 4ZU3A 3U9LA 3OEWA 2IYOA 4FFOA 3RIHA 5I7VA 1PGOA 1DEHA 2IE0A 4NZ9A 5KVCA 4OSPA 4ZQFA 2AG8A 3VH1A 1PJCA 3EZYA 1DC6A 4TZKA 1HLDA 4Z0TA 4HV4A 4FQ8A 5GZ3A 1P1HA 3MCVA 1B15A 1R16A 1SCUA 4BNLA 3WIDA 2B69A 4EW6A 2QYTA 3PYXA 5TQVA 1D1TA 5FYDA 1L1FA 1EUDA 3C1OA 1S6YA 2Y1GA 2UV8A 3PWZA 4GAEA 4WCFB 3NKLA 1WDKA 2EJVA 4Y98A 4WOKA 1EUCA 5EPOA 3DBRA 4DTIA 4UUPA 4UVGA 1K0UA 1X13A 2W4QA 4BKUA 4AJ2A 1JQBA 4IBOA 4WLNA 3GC6A 4BNJA 3ZV3A 3OM9A 1C14A 3KRTA 5T8KC 1H6DA 5C7LO 1DLIA 4EJMA 4L76A 4WEQA 1U7TA 2D8AA 1A27A 4AFNA 4OOEA 4DUPA 1P77A 1A5ZA 3GT0A 2VRBA 4KUGA 4M1QA 4BS9A 1VL6A 4CM4A 3ZWVA 3AOEC 4XKJA 4BV9A 2FPPA 4WKGA 2NU6A 4B3JA 5I7EA 1FDTA 4DLLA 4FN4A 1Y81A 2IZ1A 3I52A 1DRVA 1ZK3A 2ZJ0A 4QO8A 2VNSA 3NT2A 2Z95A 1OFGA 3VTZA 2EERA 2Y05A 2GUGA 4PVCA 3HSKA 3L0DA 3E03A 1E7RA 4D46A 4YJHB 2XPCA 4PRLA 3ZV4A 2H6EA 3ZHBA 4GVLA 3K2EA 2O48X 3EZLA 5CPFA 3HN7A 3H9UA 5FWNA 5IN4A 2UUPA 4D3FA 3VDQA 1MXHA 4WGGA 1Q1NA 1XQ1A 4ONEA 3F4LA 1ZXBA 4IXWA 3BMNA 1LBEA 3CEAA 1LSSA 5BT9A 4D7AA 1BHSA 1HF3A 5DBGA 1Z7EA 1NQOA 4CR6A 3H8VA 3I23A 4RLHA 2D5CA 4OQYA 2CNBA 1E77A 5CEJA 3N58A 2EF1A 2J3KA 2JHGA 3WLEA 4RO0A 2QX7A 4B7XA 1E6EA 3WG9A 3FWZA 3RSHA 5DP1A 2GNAA 1PQUA 3JQ9C 4M86A 1M75A 4N5MA 1F17A 3W6ZA 3L4BA 3H9JA 5AVOA 3MJSA 4ND5A 1FDVA 1XG5A 1PEDA 2UAGA 5A9TA 3JQ7B 1Z45A 3G1TA 3MZ0A 1YBVA 4WOJA 2VCYA 2I76A 2OFPA 2P5UA 4UULA 3UN1A 3L6OO 4J9UE 4GLOA 4Z3KA 1R37A 3FNEA 3PQFA 5BSHA 4Y9DA 4YRDA 1K89A 3DHNA 5LCXA 2Y67A 4PG4A 4WNIA 1K6XA 3LF2A 4J1QA 1PZFA 1P74A 1P1JA 3OICA 4AJ4A 4TKMA 4ZRNA 4DREA 1NPYA 2RH8A 5JFOA 2ZYDA 4GPD1 3E18A 1JKFA 3JD0A 1XGKA 2YQ5A 2GR9A 2V65A 1EVJA 2BMAA 5G4KB 4JROA 4B8WA 5A4DA 2BD0A 4FFPA 2JCXA 4PN3A 2Q50A 5GZ6A 1VJ0A 2EGHA 2VZ9A 3RUIA 3ZNQA 2P9GA 1YL5A 1I33A 5CEEA 3ZN2A 3GA0A 1VJ1A 1UUFA 1RM4A 1KOLA 1UDAA 1NHGA 3C1AA 4UVHA 1PQPA 1VSUA 4WE3A 4S1VA 1HLPA 4QXMA 3ADPA 1OZAA 4DGSA 3L9XA 4RL6A 2E82A 1HYEA 4WCFC 3LQFA 1WZIA 4E2YA 2CF5A 3RBZA 2X1HA 2F00A 1PS9A 1CDOA 4ALLA 3RBXA 1C3VA 1HYGA 3PLNA 1YOVA 2OO5A 2BGMA 2OGUA 4KUHA 3BMOB 3RFXA 1Q7CA 3IC5A 3BHMA 3W4IA 3L77A 5T67A 5HM8A 5L7WA 3KXDA 4I8XA 1X15A 3NTOA 1A72A 1HL3A 2OORA 4RVUA 1MXFA 2OBNA 5C7IO 5JNLA 5AYVA 3F3SA 2H9IA 3D3EA 1J6UA 4OO3A 3IJRA 2P9EA 5COAA 1X7DA 2AG5A 4ESOA 1NAHA 3OA0A 4MIEA 5L9AA 4RPHA 1WW8A 3S1LA 3IL2A 4LRSB 5FF9A 1C1XB 2G17A 3ANNA 2JHFA 3UCFA 3TFOA 1GYQA 1NPDA 4RPGA 4CM9A 1WLYA 1FJHA 2EW2A 2JD2A 4PLGA 1QP8A 3HDQA 4PIVA 3IS3A 2V6BA 1NWCA 4TRNA 3FF4A 4YJGA 5IDXA 3ICPA 2DUWA 1GEEA 5DULA 5A1TA 4RLSA 3ZCXA 2NQTA 4OL9A 3RUCA 2PV7A 1R4MB 3JV7A 3AM3A 1T2DA 5B4TA 2J3IA 2VHWA 2YFHA 4FC6A 4B8ZA 1XYGA 3ZWBA 4DIFA 4DYDA 1W6UA 5I8WA 1KIFA 4D3DA 2DTDA 2GO1A 4A10A 4XDYA 1MB4A 4FFLA 3SXPA 1B0AA 3GLQA 3DBRB 1T1SA 4K28A 1LC3A 4NIMA 3D5TA 1E92A 3ASVA 4E5KA 3PHHA 2YZ7A 1JKJA 6LDHA 1B8VA 1GPJA 3S2FA 1PJTA 3ZHYA 2X7HA 4E32A 1DAPA 4CMCA 3I9NA 4N18A 2VWGA 1ZMTA 3TSCA 3OBBA 1K2WA 4XR4A 1CYDA 4GX0A 4GGPA 3VZQA 1G1AA 1ZSYA 3NT4A 1ML3A 1PJBA 4M89A 2Q45A 3VVBA 4CM4B 3GY0A 5ER9A 1YQDA 3FTPA 2PFGA 3E9MA 1KEPA 3D7LA 3RFTA 1Y8QA 4BGVA 4XYMA 5JC8A 2HCTA 2NQ8A 4I5EA 3QRWA 3VPXA 3QE3A 4R5HA 4DPMA 3GFGA 3JSAA 1WPQA 4OMUA 1MUUA 2HMTA 1N9GA 3KYCA 4RF5A 1VJTA 3CINA 1RM5A 3AUUA 4CL8A 2DC1A 2BRUA 1ZUD1 1H2HA 1FMCA 3OIDA 1CF2O 5G0TA 4IDFA 4BQPA 3ZWMA 4DL9A 1YL7A 2HMVA 2VRCA 1E7YA 2NNLD 5DCUA 4JLWA 5L95A 2XAAA 5HRUA 2OBYA 3VZPA 4RORA 1DRWA 1MC4A 2YJZA 3LC1O 2PA3A 3LT4A 4NPCA 1EVZA 3K92A 1T2AA 4OQZA 1KEVA 1M66A 2GN8A 3V5NA 1VC2A 3BMNB 4J4BA 1IUKA 4FW8A 3DZIA 4NJOA 1KERA 2X9VA 3UCEA 2EP5A 2PD3A 3WGTA 1N8KA 4PRKA 1QYDA 3X2EA 2X9GA 4IMRA 3Q9NA 3TZKA 4IJVA 1T2FA 3K6JA 1GU7A 2J3HA 4EZBA 2CF6A 5TC4A 2YHIA 5A02A 1UXGA 4H3VA 1TXGA 4WLUA 1PWXA 1YBAA 2I9PA 4LSMA 4ZA2A 1Q0QA 5BQFA 3V2GA 5L40A 2E6UX 3BTVA 2X0IA 3I6QA 5JPIA 5CAEA 3GK3A 1IPFA 2G76A 3C85A 5CDSA 1O5IA 3ZHZA 3OJEA 5HWSA 2GD1O 3FNFA 3ETDA 1KC1A 1C0PA 1X1EA 2DM6A 3MEQA 3Q2KA 4CUJA 4DWVA 4L8VA 4J16A 1XR3A 3PFWO 3NV9A 4LN1A 4QECA 2CDAA 2WWRA 3D5QA 4YVFA 4EI2A 5KNLA 1LTHR 5LDGA 1ZK1A 1E3WA 3DZJA 2P91A 3RU7A 5F1PA 2QIOA 4CLDA 2HJRA 3I4CA 3WBBA 1R0LA 1B3RA 5FEUA 1HEUA 3WGYA 2UVDA 5JY6A 3JYOA 4UAGA 3SC4A 4MVJH 3O9ZA 1LX6A 1YB4A 2JJYA 1ZCJA 3FR8A 1A9ZA 1GUFA 5EESA 3D0OA 4MVJF 4XGIA 4PFJA 4TKLA 3VKVA 2BELA 4EUFA 1QORA 1LDEA 3DBHA 1HT0A 1XQ6A 4Q3DA 1KETA 2PZLA 2JAHA 1W8DA 3GEGA 4NH4A 3IP1A 3PHJA 3W6UA 3MJVA 1DHRA 3QWBA 1NAIA 2BHLA 2IXBA 3LZ6A 4DIOA 1HRDA 1W0CA 1NQTA 3GGGA 2C2YA 2E4AA 4GX1A 3PZRA 1SO8A 3S2GA 4D43A 5JAMA 3TOZA 4EEXA 2ZKLA 1EFKA 3GH3A 4QUKA 3GNSA 1GL3A 3JQDA 1F06A 2Q2WA 4CM8A 3HHPA 4RJTA 1TA4A 3V1TC 5CDTA 2X22A 3RC7A 4CUKA 3TWOA 3Q2IA 4CM5A 1YOVB 1T4BA 3NAQA 1PR9A 3UKOA 4OKIA 4ZQBA 3DHYA 2VHVA 3HB5X 3PTZA 3UUWA 2C7VA 2I67A 4CM6A 1P31A 3WLFA 1AHIA 4CMBA 1WVGA 2ZB7A 4IMPA 2BGLA 1OOEA 3EYWA 3TOXA 5JXWA 3NJ4A 4DMLA 2O3SA 4OXKA 4CLRA 2RH4A 4W7IA 4R3NA 4IDGA 2R00A 4O63O 1HE3A 1DO8A 1WP4A 1I3LA 3EDMA 1LQUA 1SC6A 1B2LA 4G2NA 1XIVA 5IG2A 3P19A 2Q2VA 1PJ4A 2X0NA 2HAEA 3OIGA 5B4UA 3D64A 3TNLA 4AJHA 1PZHA 4BNZA 4HUJA 4BO0A 3OIFA 4QTZA 3I9JA 1KBZA 5I7SA 1PZEA 3VOSA 1NTOA 4I9HA 4JJFA 4BNVA 4DBZA 1DHTA 1QR6A 3DAPA 3PHIA 5KOIA 5THKA 3NTRA 2J5KA 1H0KA 1UH5A 1Y5RA 3QVWA 3TN7A 2DPHA 3WGQA 2C54A 4CMAA 3ADOA 5IXYA 2G5CA 1LC0A 1KS9A 4YBZA 5B4VA 5L4LA 4D45A 1F0YA 3IP3A 3JQ8A 4BQRA 5L45A 3INGA 3BHIA 4RCVA 4I08A 1DFGA 5JLAA 3ZZNA 1E5QA 2O2YA 2DQ4A 4B3HA 1LSUA 4BHTA 5JE8A 3A28A 3A4VA 1TEHA 3O4RA 4UVEA 2Z1NA 4R16A 2CD9A 1YB1A 3KEQA 3R0IA 1PS8A 4J9VA 4L74A 2Q1UA 4IXTA 3WBFA 1U3UA 1R66A 5G0WA 4Y6PA 1Y8QB 4E30A 3L4BC 4RF2A 4WJZA 1ENZA 1ZK0A 2RIRA 3ZH2A 2XOXA 3B1JA 2HQ1A 1N9GB 3KYCB 1XU9A 3ANMA 3Q11A 2Y68A 3C24A 3GGOA 1UJMA 4BNWA 1PZGA 3KYBA 3QWFA 5MGBA 1UP6A 1JA9A 1P44A 1P1IA 4XRRA 1ZVMA 4IS2A 1ADBA 3UGKA 3JTMA 3G79A 1RM3A 2OP0A 4EITA 1MGOA 2Q1TA 3JYQA 4E2XA 3WSWA 4BMVA 4BKRA 2X5KO 1M67A 3OQ6A 1WNTA 1QRRA 4MKRA 1VSVA 5ITWA 5IZCA 2ZIZA 4XIJA 3HDJA 3UHAA 4G65A 2X4GA 4UVDA 3TL2A 3DXFA 4RZHA 4PG8A 1JKIA 1WAMA 4J6FA 2C0CA 3DZKA 4GVXA 1NPTO 4NBRA 3RASA 1GYPA 2FY8A 3GMDA 4PLWA 2IEBA 3DL2A 1OBFO 2YHIB 1SZJG 1R12A 4J7XA 5BR7A 3PJFA 5I9MA 3HFSA 4XZ3A 5IXSA 1H6CA 2PTGA 4OXNA 1XWFA 1MFPA 1GV0A 4GKVA 3QWIA 3ZW9A 1ZSVA 4B79A 4NHEA 5K0ZA 5A05A 3DFUA 2OUIA 3O03A 2JCVA 2OP1A 3WIEA 4MP8A 1YDEA 2GCGA 2O4UX 2Y1FA 2VTEA 4EJ6A 3PP8A 2WE7A 3F5SA 2O3UA 3CMCO 1YJQA 2GSDA 2Y1EA 1E1MA 3BMCA 4BNXA 3FWNA 1CQIA 3QV1A 3DBVO 1UZMA 3K73O 4XA8A 1KVTA 2HMSA 2Y93A 2A35A 5DCYA 4HFNA 3Q9UA 2P9CA 2HK8A 3PLRA 3OHSX 3GUCA 5F1KA 4ALKA 4CQLA 1HDXA 1PR3A 3F1KA 2R2GA 4ZJUA 4EBFA 4AJLA 2VT2A 3BTUA 3ONDA 1PL8A 1V9LA 5DT9A 1YGYA 1ZKMA 3L4SO 1FDUA 2DBVO 1TLTA 4B4WA 1YO6A 4BB6A 4BNKA 3RVDA 2Q4BA 4CMKA 1V6AA 2X0JA 3VZSA 1DIAA 1PJLA 3F1LA 3DBHB 3SJ7A 1DFHA 1RYDA 5F3RA 1CQJA 5IAAA 3NTQA 4J4TA 3FNGA 3DMYA 1PQWA 3FRJA 3DFZA 4FR5A 4IQGA 1K3TA 3PEFA 4ITUA 1EVYA 1N1EA 2VYND 4WCDA 2UUOA 5T6BA 3STHA 3WQRA 4AJEA 3VDRA 5IDQA 3A9WA 2FPIA 4AJOA 1XSEA 2FRDA 3F6YA 4BO7A 3ZU5A 3SLKA 1U4OA 4LMRA 2PLAA 4PZCA 3PYLA 5ENDA 3GF4A 3ZWAA 4CM8B 1G0OA 2QW8A 4A03A 5HA5A 3ROKA 4GKBA 5GZ1A 4RDHA 1LLUA 4OM8A 4XYGA 1NYTA 4Z9FA 5THQA 4BO2A 3U4CA 4FS3A 4P4NA 4HWKA 2YV3A 4RPLA 3E5MA 3ORFA 1HDOA 3JQBA 2NV6A 5JS6A 1X14A 3ANLA 1UAGA 1MA0A 1X7GA 2AHRA 3CE6A 3IIEA 1LDGA 3MJTA 4R68A 3F9IA 5JW6A 1ENOA 2IDZA 1U3VA 4CV0A 4IDCA 3M6IA 4CLRB 4XD2A 5LDHA 1YWGO 1RKXA 3PHGA 3AI2A 3A1NA 3D4NA 4KQXA 4CMGA 4IM7A 1GAEO 4IIVA 4XEHA 4AL4A 2D1YA 3OETA 4J7CA 3CPSA 1IYZA 1H2BA 3M1AA 1O95A 4D0RA 1KVRA 4YQZA 4NFYA 2AQKA 1Q0LA 4OKNA 4GGOA 2W90A 1GPDG 3DZFA 1JLLA 3DHEA 1ID1A 3MOGA 3V2UA 1KY5A 9LDTA 1BVRA 3KETA 2PGDA 3PJGA 2I5PO 5CEFA 1QYVA 5CHEA 3C3XA 1DAOA 2X5OA 3KB6A 4WLOA 1I30A 3VC7A 3GN2A 3W4JA 4DLAA 1FF9A 2VRCD 3HWRA 1D4FA 1UXIA 1SAYA 3BTSA 1UXKA 3WDSA 5JDCA 3SVTA 2ZB8A 4F45A 4BIIA 4GLLA 3JQ8B 2B0JA 2WYVA 2VZ8A 3KTDA 3QW2A 4Y8VA 2QZ9A 3OJFA 3MJEA 5I9LA 1QSGA 3VTFA 2VHZA 4J4HA 1PJQA 1I10A 4IDAA 3ZV6A 1VL8A 5TT0A 1ULUA 4DXHA 5IFLA 2NTNA 3N7UA 3EHEA 1E6UA 3E82A 5G2OA 3UOGA 3ETGA 3WR5A 2EWMA 4YQYA 4XYLA 3AUSA 4DPKA 3AU9A 4B4OA 4BO4A 4EDFA 3DBLA 3W8EA 1GZ4A 4HBGA 4FC7A 3H2ZA 4INAA 3DZHA 4R1UA 1E1LA 3KHUA 3WNQA 1LDNA 1KEUA 5A9RA 1U3WA 4ND1A 2Q49A 2FZWA 2GN9A 4XYBA 3ZU2A 1ONNA 4D79A 5A9SA 1I3MA 1LDYA 5BSGA 1RM0A 1ZZEA 3U4IA 3GMSA 2CSUA 3RROA 1YXMA 3A14A 2DAPA 4IDBA 5JYDA 1NXQA 2OHXA 3RI3A 1AE1A 2DUUA 3KV3O 2FSVA 3GGPA 4GQAA 4S3MA 4PLCA 4RVSA 4YDRA 1Y8RB 4D44A 3W8DA 3H65A 5ITVA 4HX5A 1NFFA 3WJ7A 1QXSA 3TZCA 1WDLA 4RF3A 4J2HA 3X2FA 1PGJA 1CERA 2PH5A 3H9EO 5JCJA 5AXAA 3DB2A 1WDMA 2PD6A 3U62A 4BNHA 2QQ5A 2X58A 4BO9A 1U9JA 1TT7A 4MKZA 3U5TA 2GPTA 4MVJA 5IDWA 1ZBQA 4PLHA 1QLHA 4NBVA 3R3SA 4W6ZA 1N1GA 3H4VA 2JD0A 4KOAA 3NRCA 3H9GA 3LT2A 1QV6A 5IJZA 5JDIA 3P2OA 1QV7A 1WWKA 2BF7A 3FTNA 4ND3A 1PS0A 4J91A 2EKPA 1I5RA 3HDYA 4J0FA 1C0IA 5JCXA 3PJDA 3LU1A 3VH2A 1ONOA 1LUAA 2P68A 1V8BA 3SBOA 1H94A 1YBMA 2B4QA 3JQGB 4YPOA 1U2GA 1E3IA 1NNUA 4FSHA 4OXYA 1XHLA 4CQLB 4LSWA 1GFSA 1EZ4A 1HDCA 5DDIP 1NASA 2I6TA 2E37A 3C8MA 5DOZA 1LI4A 4RF4A 1E7QA 4LRTB 4IJKA 3K8ZA 5CPBA 2B35A 3OQ1A 4OYRA 4QQRA 4BKOA 2VNAA 1ZK2A 4MVJM 3HE3A 2R00C 3PI7A 5BNFA 2YFQA 4MP6A 2FN7A 4M54A 4U5QA 1JVSA 4GWGA 1JN0A 2X0RA 5KJCA 1RPNA 3V8BA 4ILKA 1AUPA 4GMGA 3ZWPA 4FJ0A 4CQMA 3LF1A 3KBOA 1YH3A 4O59O 1UZLA 3AI1A 1YQXA 4Q39A 3OJLA 3WTCA 4YA6A 2Z1MA 1E0DA 3QVSA 3UH1A 4QT0A 2ZQZA 2W8ZA 4M87A 1GZ3A 3IUPA 1V3UA 1EEHA 1UZNA 1Y9AA 4Z9YA 1WZEA 3AUTA 3D3WA 1ZIDA 3B70A 4RVHA 2BH9A 2VTDA 3RUDA 1NVGA 3DZBA 2YDYA 4IUYA 4LVCA 1EVIA 3E8XA 2VYNA 4A0SA 2HUNA 1H9BA 2DLDA 4DC0A 4GI2A 5JO9A 3JYPA 4GSKA 1HTBA 1PGNA 2XXBA 2ZK7A 3KLPX 4Q3AA 4Z3DA 3ZWNA 2VHYA 3HJAA 1KEWA 1E7SA 2HRBA 4CMIA 2W2LA 4WECA 3DTYA 1KVQA 4JN6B 1GUZA 4Q3EA 3V1YA 5EERA 3IDSA 4W82A 3ZU4A 4I1IA 4IQ8A 1WMAA 2YUTA 4PLZA 3TQHA 4ALNA 2D5AA 2RHCA 1T4DA 3DMTA 3IAHA 1BTOA 3OQBA 2G0TA 1ISGA 1YKFA 5L7YA 3W1VA 5IZ4A 3Q1LA 1NHWA 1ULSA 2A4KA 2QG4A 4W4TA 2BFAA 5TX7A 3ZWYA 4YAJA 1BXKA 4JJGA 2RHRA 1MP0A 7ADHA 4FFNA 4R54A 2RAFA 2FR8A 5AQ1A 3PIDA 1YVEI 2GN6A 2C59A 4Q3CA 3PGJA 5IZCC 4BO1A 1ADCA 1V35A 1MG0A 3WQSB 3KLMX 4TQGA 1E3LA 4EYEA 5JAIA 2IODA 1GY8A 1CETA 3BMQA 2JD1A 3DC2A 3JQFA 4N7RA 4XRGA 3P2YA 1SMKA 4BO8A 4HNGA 2HDHA 1VRWA 5KVSA 4UEJA 3F4BA 1ADGA 1TB4A 4E4YA 1E5LA 1OC2A 4YAEA 5A3JA 4CMJA 3CZMA 3OECA 1DIHA 3AY3A 3WB9A 1LLQA 2YY7A 1Z74A 3FR7A 4GSLA 4OAQA 3JCZA 2WTBA 1BRMA 3LSYA 3JYLA 3AY7A 4YYZA 1UXJA 3BZUA 4YWJA 2HJSA 3K9QO 2D59A 2X5JO 2P5YA 3DBLB 4KDEA 1JVBA 5C7OO 3EMKA 3QY9A 5KJ6A 4HFRA 4BNNA 2H1SA 4I9UA 2OXIA 1IULA 1ZMOA 4Q3BA 1ZH8A 4XQ9A 2C5AA 3IUSA 1UR5A 4DA9A 1DJNA 4R5MA 1F8GA 1SOWA 4J1NA 1LNQA 3GN1A 1YQGA 1Y1PA 3CMMA 4E5MA 3HNPA 3GVCA 4TVBA 3SX2A 3DQPA 2WDZA 3QSGA 1XU7A 3KUXA 3QWHA 4IDEA 3ZU3A 4H16A 5A9SB 2JFGA 3CIFA 3DR3A 2I3GA 2O3QA 2RCYA 4GMFA 3GDOA 1DLJA 2POQX 2EKLA 1E1KA 1PGQA 1ENYA 3PDUA 4P4LA 1YRLA 5I9NA 5IDYA 4BGUA 4CR7A 4IZIA 4M49A 3H3JA 2WJPA 5EINA 2DTEA 3FPCA 3V1UA 3CTMA 4XJTA 3JD1A 4MDHA 1I32A 4RVFA 3E1KA 4J2OA 2AE1A 3AI3A 2NSDA 4BOYA 3W8FA 4PLPA 3RKUA 5TT1A 2HK9A 3EUWA 2O7SA 4II2A 4YJDA 3DEYX 4E5YA 4JK3A 2Q46A 3KSDO 3GPIA 3VAZA 3FD8A 5EJ2A 4R1SA 4NNJA 3EK2A 4LVUA 2NVBA 3I83A 4N5LA 1N7GA 2H5LA 4PVDA 3RC1A 4NI5A 4DLBA 1K6JA 4QFDA 2G1UA 2B4TO 3BAZA 4HFJA 5G4LA 5DF1A 3EY4A 2ZB4A 1MG5A 3KEOA 4BO5A 2FOIA 2ZTVA 1V0JA 1I01A 4J1TA 2NVWA 5HBRA 3JQBC 2AE2A 2EIHA 2EV9A 1DIBA 4PG7A 1B14A 4KUEA 1DOHA 4E12A 1HYHA 1MC5A 5L7TA 4YT5A 3TZ6A 5J23A 1DRUA 1X0VA 2BKAA 3COSA 2R6JA 2J5QA 3MOIA 4LCJA 5ILGA 1GQ2A 5GMOA 1EQ2A 1BXZA 2PNFA 3O8QA 3EAGA 4FIZA 3GDGA 2O3JA 4RZIA 4TSKA 4XQEA 2NU9A 4DQXA 3RC2A 4E21A 1GTMA 3IMFA 5B37A 2QRKA 2WMDA 1JWAB 1P1KA 2B4RO 2NM0A 3QHAA 4CLXA 2AEMA 4PG5A 5CDGA 3LDHA 4CQMB 4YJFA 1I2BA 4Y67A 3ZWXA 3AY6A 3LK7A 4KMSA 2EKQA 3GVPA 1S7CA 3H5RA 3INTA 5ENVA 4P22A 1YL6A 3G0OA 4CMEA 4DQVA 4YCAA 1T2CA 2A9FA 2FHSA 4CM1A 3H9QA 3ZW8A 3T7CA 3D1LA 3F5QA 3QVXA 4XX0A 1ADFA 1UP4A 4I5GA 4R9SA 3SEFA 3RCBA 3VH3A 5JDCC 3L6EA 1LDMA 2CDCA 4FFRA 4TZTA 4Z0PA 3D3WB 3H6KA 5CG1A 4ALJA 2PZKA 3T4EA 2PKQP 1N5DA 4L9RA 2I66A 1HDGO 1JTVA 2ZCVA 3RUAA 4JXKA 1HXHA 1H9AA 4JBIA 1HE5A 3JYNA 5H83A 4DVJA 4LK3A 1LRLA 2C07A 2HRZA 5DNAA 5CFZA 4BNIA 3ABIA 3QVTA 1N92A 4YJGB 3PQEA 3GVHA 2B5VA 4RVDA 6ADHA 4CMIB 4JBGA 5TJHA 4MP3A 1U4SA 4BGEA 5AXDA 3NDRA 3PHLA 4E5NA 2FWMX 1XKQA 4FGSA 4GL4A 3PVZA 1I24A 1L7DA 2IYPA 2PKQO 4HP8A 3WGOA 1XEAA 3K5PA 3TZQA 4YAIA 3NJ8A 2YYYA 1DJQA 4JQCA 2D2IA 5U1PA 1D8AA 4WASA 4IQ0A 4Y6RA 4OHUA 2JAPA 4ZD6A 4A2CA 2HLPA 3ASUA 3KYDA 4IGEA 4NR0A 1VE9A 4W7HA 3VH4A 2EHDA 1R4NA 5JMPA 2VN8A 4WPGA 3K31A 2ZB3A 4CR8A 3GFBA 1XCBA 3I1JA 3UF0A 3H7AA 3PFFA 4ZGWA 2X9NA 5COBA 4A5OA 5U4QA 5B1YA 5JMWA 3OEYA 3LLSA 1P0FA 5A06A 1OAAA 4J49A 1SB8A 1B26A 1AN9A 2JL1A 3JQAA 2G82A 4KZPA 5C37A 1OI7A 4JX8A 4YRAA 3VPHA 1JWBB 3AK4A 1U8FO 3GHYA 5TLSA 4ZHSA 4N5NA 3OSUA 4O1MA 4OGWA 3BA1A 3RQSA 1MLDA 4E13A 1UAYA 1WXDA 4L0QA 1I8TA 1EDOA 2D4AA 3CXRA 4CODB 1DSSG 3IOYA 3NEPX 4L4RA 5JDIC 5JCJD 3QP9A 1Q7BA 3MJCA 4ZICA 1ZSNA 4J3FA 2Y1DA 3Q0EA 2W98A 4MVJD 4P38A 2B5WA 1KC3A 2UDPA 3WWYA 1GCOA 4IIUA 5DP2A 1VI2A 2GYYA 1N2SA 3WQQA 2IXAA 3Q3CA 4PLYA 3TZHA 1E7WA 4WLEA 1YE3A 2YQ4A 3NX4A 4YT4A 2B83A 1E3JA 4U6QA 3M2PA 1IHXA 2AW5A 5KVQA 1LA2A 3UAGA 2BI8A 3VPGA 3OJ0A 4D0SA 3CSDA 1NBOA 4URFA 1L7EA 4HXYA 1MX3A 1BMDA 4J43A 1R0KA 3AW9A 4J1SA 4BUCA 4JP3A 2PH3A 2LDBA 3B6ZA 4TROA 3NYWA 4NBUA 3IJPA 1HSZA 4JP2A 2PGLA 1B16A 3DWFA 1A4UA 1GR0A 1PGPA 2CVZA 1PIWA 1V3VA 2Q1SA 4KTTE 4O6VA 3DOCA 4MIOA 4M55A 4R3WA 4DBVO 3QLJA 4P4GA 5L4SA 5TS3A 1H5QA 3RKRA 4KTVE 2HMUA 2YV2A 4LISA 1M6HA 1Y5MA 2HMWA 4NMHA 1DC3A 4CLEA 3SC6A 2OMEA 1EMDA 1I36A 5FI3A 3AWDA 1H6BA 3WS7A 5JYEA 3AFMA 1ZEJA 2JCYA 3LVFO 1F12A 3DAGA 3ZWWA 4CUZA 1Z82A 1T24A 1G6KA 5FFFA 1I3KA 1E3WB 8ADHA 3I5MA 1PL6A 3KO8A 2C7GA 4RGBA 2SCUA 4BKQA 3BIOA 5CG2A 4C7KA 1JU9A 1ARZA 4I9NA 4TWRA 1KVUA 4TRMA 1SPXA 1QMGA 1Y7TA 2NU7A 4OOFA 4IDDA 4CQMD 4ZQGA 3WGGA 2PK3A 5JO0A 3WMWA 3JD3A 3RAJA 3RJ5A 1ISMA 2ZTLA 3EGOA 3R3JA 2VOJA 2ZCUA 3ZGYA 3DAFA 4CJXA 1GUYA 4FPXA 4EUEA 1A4IA 1R15A 2Y0DA 4YB8A 3GZ4A 2CY0A 3WGIA 4AJPA 1IB6A 2GZ1A 3O8QB 1IOLA 1HDZA 4Y6SA 2F1KA 1PJSA 4F46A 3DMTC 3K30A 1K5HA 1SB9A 1QLJA 4XGNA 3ONFA 5ADHA 3UVEA 1O94A 1LJ8A 4JCOA 4EJ0A 2Y0EA 4RQTA 4Z9XA 4E33A 3ZDFA 2W2LD 5DCWA 1FDSA 5ILOA 2IRWA 1XDWA 1LQTA 3EW7A 4KP7A 2V6FA 4I5DA 1QG6A 1XA0A 1PU2A 4WNCA 3WFJA 4BNUA 4ZVVA 4BMSA 3TF5A 1ZW1A 5JY1A 5AXCA 5EMHA 1C0KA 3ULKA 3UICA 2B37A 1J5PA 3SJUA 1LRKA 2PKRA 1NQAO 3I9KA 3BMOA 3KM0A 3RUFA 2Q1WA 4NJMA 3S2EA 3JQFC 5GY7A 2AEJA 1TT5A 2JFFA 3WNVA 1ISFA 4AICA 3IKTA 4AJ1A 3UFXA 5A5FA 4FJ2A 2X6TA 3PQDA 3OFSA 4OJNA 4ALMA 2VWHA 3L9WA 1VKOA 1EUZA 3WTBA 1MV8A 5C5IA 5T57A 4L75A 1LEHA 2IZ0A 1Z7BA 1C1XA 3ROPA 1CWUA 2EW8A 3W4KA 2X8LA 2OOSA 4A7PA 1EE2A 4IINA 1ISHA 2D0IA 3P7MA 3GEDA 3C7CB 1IPEA 4R1TA 1EBUA 1DPGA 3E48A 4IZHA 4U7WA 2NTJA 5K9ZA 1NVTA 1AXEA 2CVOA 1R4MA 2GLXA 5BSEA 2DBQA 5HTOA 3ST7A 3H5NA 4U0JA 1E6WA 3WMXA 9LDBA 5K6AA 5L51A 3KYDB 2FP4A 4NU6A 2CFCA 1R4NB 4Z6KA 2OZPA 1IL0A 1AHHA 4OSOA 3GZNA 3ROMA 5TGDA 3GUYA 4XCVA 3U49A 4XJSA 1ZXLA 3PK0A 2IEDA 1YJ8A 2WM3A 3ZNNA 3ZWCA 2YDXA 1I2ZA 2X86A 3RUHA 3GG2A 3JQAB 3I9MA 4C7JA 3D4PA 4CV2A 3F46A 3GRPA 5KIAA 4DPLA 3A06A 1I2CA 2IZZA 1X7HA 4NG5A 3B1KA 1LSOA 1UP7A 3DZGA 1HSOA 5F1OA 3H2SA 1C1DA 1DFIA 1X1TA 2Z5LA 2CVQA 5A03A 3C7DB 4QX6A 4NFSA 2VUTA 3CKYA 2PZMA 2DFVA 1EK5A 3BTOA 4XIYA 1Q2XA 2NWQA 2I3AA 5T64A 1A71A 1ENPA 4RQUA 1IZ0A 1DC4A 4EGFA 4UUNA 1RJWA 2EGGA 3OH8A 1Z73A 1A7KA 3PYMA 3G17A 2J6IA 5EQDA 3IQDB 3ZNOA 5KWEA 3ZNPA 4FGWA 5COQA 1TI7A 1I3NA 3D4OA 1DB3A 5AXBA 2J8ZA 1OC4A 1PTJA 1ZJYA 3LYLA 4GWKA 4NK5A 4J90A 3HZZA 2VWQA 5G0SA 5KJ1A 1Q0HA 1NFQA 1V3TA 3S2IA 5HS6A 5A5EA 3EVTA 1T2EA 2D3TA 3AJRA 1BVUA 3FBGA 3GNQA 3FPLA 1VLLA 3N74A 3NDJA 2V6MA 3KVOA 2YHUA 3BMCB 5I7FA 1ONPA 2GN4A 4D42A 4YRBA 1RYEA 1XLTA 2A94A 2PD4A 1O8CA 3RBVA 4ND2A 2EG9A 4CMEC 3HQ4O 3R6DA 4PLFA 2O4CA 3WWZA 3MJ4A 3I6IA 1B3BA 1HZZA 2HSDA 1P1FA 1F14A 1BW9A 4MJLA 4NBTA 2TMDA 1EBFA 4K1LA 1EFLA 4BNFA 3FBTA 1YONA 4KWHA 3KOUA 1E3SA 3ON5A 3M1LA 3ICCA 1NX6A 4PG6A 4Q3NA 3GPDG 1K6IA 1UDBA 2BFOA 1BXGA 3E9QA 3PGXA 4W9NA 1GDHA 2X23A 5BNIA 2DBZA 2EXXA 2NLOA 2WD7A 3GOHA 2Y1OA 2C82A 5L4NA 3K2BA 4K6FA 4MVJG 2Q4EA 1FXSA 1IE3A 4BVAA 3I9LA 3LT0A 3RJ9A 1DDOA 1EE9A 4ND4A 1NFRA 3OP4A 2DBRA 1Z75A 2O23A 4FJ1A 1LXCA 4FOSA 2C20A 1O0SA 4R69A 2ZTMA 1D3AA 3DOJA 4MO2A 4YT2A 3BXXA 3GAFA 5A04A 5TSDA 3EVNA 1U7HA 4P8RA 4YTEA 5KVVA 2ZTUA 1D1SA 4CL3A 1OMOA 3MWEB 2VUUA 4M8SA 3DO5A 2PR2A 2O2SA 2WYUA 2PY6A 1AGNA 4OH1A 4RPJA 1M2WA 1NM5A 4R1NA 3GR6A 3QJ5A 4PZEA 4J7UA 1VL0A 2GF2A 4NFHA 1BGVA 4FD3A 4NJMB 4E0BA 3C1TA 1TT5B 1P1RA 2AQIA 4TMFA 4HFMA 5IN5A 2GASA 1LDBA 4ZQHA 4R4JA 2QHXA 1VM6A 2EJWA 4Z0HO 3LC2O 1GYRA 1TVEA 3WFIA 4PCVA 3KSUA 3FSRA 2PGJA 4OIMA 3CZRA 2XXJA 3UW3A 3JQAD 1DC5A 3VZRA 4CLOA 5LC1A 2WE8A 3WYEA 4E3ZA 5KJEA 4G5HA 5JBIA 5JC1A 3O38A 2DU8A 4YAKA 1G0NA 1U28A 5TJ9A 2FSSA 2ZATA 4NU5A 1HWYA 1NWHA 1P33A 1HE4A 2O7QA 1P0CA 2ET6A 4MPDA 2WYWA 4BKPA 3O26A 1EDZA 4QO7A 5HS4A 3GZNB 3E5RA 5DN9A 4R51A 3NUGA 3FN4A 1BSVA 3ETEA 5DZSA 2PZJA 4JGBA 2GZ2A 3AUAA 4HNHA 4F6LA 1CJCA 1DIRA 2DTXA 3G1UA 2GERA 5EIOA 3E6AA 2NVUA 1HDRA 3PDJA 2VT3A 4IS3A 4WEOA 4BV8A 2CMDA 3RUEA 1R0SA 4F6CA 5ICMA 1A9YA 4GBJA 4XGKA 3P5SA 3RU9A 4F3YA 3ENKA 1SNYA 3AU8A 4IGFA 3JQEA 2Q99A 1Z6ZA 4DRYA 4E2ZA 1JAYA 1C1DB 1NR7A 4BO6A 1ZO8A 4ALIA 4L73A 5KCZA 3GEMA 4UVIA 1E1NA 4K26A 2VHXA 4XQGA 1GQYA 5U9CA 2VOEA 4GH5A 7MDHA 3GRKA 3T7EA 2NACA 1GQQA 3LLVA 4LCEA 3WX0A 1E3EA 2YV1A 3FNHA 3S8MA 5T8KA 2LDXA 3PJEA 4AJNA 2Y66A 1P3DA 2UYYA 4B7CA 1HDYA 1B8UA 1NR1A 4AVYA 2NTVA 3TPCA 4LW8A 1LRJA 1ZJZA 2ZYAA 1KY4A 4E5PA 2C2XA 3WOHA 2GDZA 3TJRA 3U4DA 3AOEA 5ER6A 4BMNA 3TDKA 2E48A 4CPDA 3GG9A 4AJJA 1BDBA 3M2TA 2TMGA 4IJUA 2Y1CA 2XF8A 3ENNA 1HE2A 1T25A 3L07A 1CRWG 2DT5A 3I9OA 1KVSA 4MVJP 3MWDB 2WSBA 4AG3A 1U1IA 1SEVA 4NQZA 3ZWOA 1R6DA 5EQFA 2WEKA 5EL0A 3G3EA 3GHHA 1ORRA 1JW9B 3DOOA 4ZN6A 3OJOA 2Q2QA 4XQCA 4C4OA 2QRLA 4MINA 3VHRA 3H5AA 3HDHA 3U09A 1HETA 5CDUA 2FMUA 1SOVA 4E31A 2V6GA 1GD1O 1W4ZA 4JBHA 1SEPA 2BI7A 2DKNA 1BW9B 1M6WA 2GGSA 1D7OA 1XELA
chains in the Genus database with same CATH superfamily
4NONA 5LKRA 1C41A 1H93A 1EHYA 2KMLA 2RB5A 4DSOA 1XWWA 4PC1A 4MDFA 1KJNA 3QKIA 4MXDA 1CUDA 4UCWA 4GOJA 3M49A 3RJTA 4WXHA 3TRIA 3U56A 4KQWA 1FU4A 1YR9A 2WD7B 1GGJA 4K9DA 2CW5A 1V4NA 1VJCA 2RKOA 3RNLA 2XMDA 8MHTA 2QA5A 4PRYA 3VKUA 2WC1A 4WV3A 1LTQA 4JH0A 4RPCA 3UT6A 1TVKB 2Q62A 2V55B 1QIEA 1Y4SA 4W99A 1R27A 2GZ3A 4AY4A 1RRVA 3DV0A 3HFGA 5F5NA 4AQ7A 4WLVA 3GFOA 2BTQB 2YZMA 2ZJ2A 1DEAA 1RXUA 3ANTA 1VGRA 3CN9A 3IKVA 4LVNA 2J0UB 5CDYA 1GHTA 4J1JA 3ONEA 3TFWA 3C3JA 3HJNA 2AYYA 4B2IA 4JA0A 5A4JA 4D99A 2IY8A 4LBWA 1ISIA 4JIGA 5DOVA 1FDOA 1G6OA 5FFNA 1U8XX 5I8ZA 3LIPA 3PRYA 5EP3A 1F4VA 4M9RA 4KH0A 2YHSA 1P6UA 2X6RA 3AEXA 3AJEA 1BJKA 3X2SA 5C31A 3N0XA 3D8HA 2XYGA 4BO3A 4OHYA 2DMRA 2RMKA 4KKVA 3T4PA 2IYUA 3JAKA 1KRHA 2GPJA 3TSZA 4PGHA 2P2DA 3RVQA 3R1IA 3SLGA 1R50A 1OWMA 2X3YA 1M9NA 3CBQA 3PITA 4P0TA 2ONJA 5DHFA 2XMCA 2G5PA 4MR8B 4FI3F 4D97A 2WSSD 1T26A 3MB5A 3MM4A 1N6IA 3QLVC 4DIKA 1LFDB 1VLMA 3JQ6A 1GADO 5P21A 1IHYA 4TRRA 1NW6A 1E3QA 1KH3A 2E21A 5I51A 2JG3A 1P7ZA 2WUFA 4C2BA 1CEYA 1YT5A 1Y6JA 3MERA 1A5AB 2AJLI 3AC0A 4W5OA 4YT8A 1J8VA 2Q6VA 1QLWA 1RJGA 4XIFA 2JKVA 5TEWA 4ASUD 5LIRA 1B42A 2VF7A 3U7JA 4TQ9A 5ADWA 2FSPA 1ZLXA 3MS2A 4OYHA 3WXBA 2F8TA 3IFSA 3WNBA 4UTXA 3CH6A 1CR2A 3OZFA 3PPXA 4UUMA 4WSOA 3ML1A 4JLSA 2ADFA 2WT8A 1C1HA 1XRRA 3K1AA 1MJ5A 3KSRA 3PFIA 3U3XA 1FRNA 4XDZA 1DI0A 4TS9A 3VPBA 2Q9CA 3I5AA 5EE9A 3TTUA 4RYLA 5ARBA 3I58A 2HN9A 2QMZA 3GDFA 4HADA 1QH8B 1K3UB 3K0BA 3RC9A 4FDUA 2RFLA 2P2GA 4OJKA 4PANA 5TGZA 5A4MS 3L3BA 3M3PA 1U2DA 3BMQB 4MR9B 1OZFA 3PVCA 1BC5A 1QTQA 2P2ZA 2BMEA 3LT1A 2PFSA 3GVIA 4TL8A 4NZYA 1TDJA 2O1XA 4G4SO 3TQQA 4BMPB 3STTA 2O3TA 1KSJA 3KQVA 4EJSC 1ITZA 4L5BA 4HBZA 4G6ZA 4QQKA 3EMBA 5GJWC 2DY1A 4PZ0A 1KU6A 3AF1A 3IPRA 1D4ZA 1I51A 1N3IA 1T4CB 4PX2A 2XSZA 1K7EB 3PQ2A 1NVMB 5H82A 5IVIA 1FLAA 2WNSA 4MRNA 4O4LA 3RSQA 4E51A 4ETNA 5KO2A 4KFUA 2O1EA 2C7RA 4Z7OB 8LDHA 2GJ9A 4KDFA 4Q3KA 3TFQA 4YONB 1PTJC 1JR3A 3MMXA 5L3ZA 1O89A 1M83A 1G9XA 2WIKA 5AKKA 4S04A 1MMFB 3WV5A 4G0QA 2VKTA 2PWAA 4JASB 4PC3A 1YKGA 1H4TA 1U5BB 2M1XA 3KZKA 3OESA 5BSFA 3VHQA 5L53A 2Q1XA 4X54A 1RTKA 3PZBA 2AMFA 4F9FA 1V1RB 4M98A 2XKKA 3C3WA 2PUAA 2I7CA 5A3VA 5CLFA 4H1UA 4NDZA 3AM4A 1WXHA 2FZEA 5AW2A 5TRTA 2QS9A 3NHPA 2AQ8A 3K9GA 4MQBA 5BWBA 2G77B 1KR5A 1WE2A 4C6RA 3M9XA 3TTTA 3ETCA 1E66A 1LLDA 5B6PA 4YRZA 5IX8A 2UZAA 3H3FA 1CJUC 4O08A 2IGBA 3ROEA 4J0HA 3Q6IA 5JRZA 2OPBA 4JBLA 2IPOA 1NJ8A 3DONA 4A8PA 3U4HA 4PWZA 2EFYA 2HWWA 4DYHA 5MN6A 3UXYA 1B41A 3HP1A 4C6TB 1DXHA 4QZVA 2QYSA 3OFJA 4EG5A 1H6AA 2X8AA 4K6CA 1N2HA 2OY0A 3CRW1 1Y42X 3E5NA 4J0EA 5JSYA 3UAXA 3H83A 4ITRC 3TTYA 1ZEMA 5I3CA 1G9TA 1TQDA 4F11A 5KJFA 5KAPA 3DE4X 2HW8A 4ZQCB 1YS4A 2WAXA 4LMBA 3D54D 4ZO4A 1V37A 1RLMA 1PV4A 3ETLA 1VYTA 3NEJA 3QXJA 1DUIA 1SR8A 3OZXA 4A73A 4MROA 4MMYB 4LYAA 5JS1A 1D07A 4JYBA 1UK7A 2I4MA 3D6VA 4Q4AB 5IF3A 2WFZA 4MVJE 2ILTA 1KDYA 4QFCA 3WZ2A 2AQHA 2HTEA 1S2NA 2QVLA 3GAZA 1H2RS 3HXKA 4Y2YA 3A8TA 5K45A 3QQPA 4OXXA 1TMYA 5K8CA 1Y8AA 2D1RA 1QYCA 5LQMA 1FTWA 3DDNA 4F5YA 2JBWA 4OAPA 1EHIA 4XB2A 3MB8A 4F71A 1XFAA 2WJHA 1YQEA 3U0BA 4ENTA 4KWIA 2ZJ1A 2ZSUA 2GM4A 1FXWA 2HBYA 3YASA 2L19A 3HUDA 1XZDA 1NZDA 1NW3A 1O3YA 2JJ1D 2Q6IA 3B20A 3UXHA 3CZ5A 3I5XA 2Q0SA 1OGYA 2GEVA 2WIAA 4FILA 3BJRA 3TB4A 4G5QA 1E1RA 3WJAA 3WV4A 3W1EA 5FAXA 4D5EA 1O97D 2IS2A 4DKJA 3ITDA 5G4KA 2C5EA 4ZVPA 2BFMA 1RTTA 3GFFA 4G5FA 2YJ3A 3P2EA 3QOFA 1G3RA 1J8FA 3COZA 4JI2B 4JR2A 3MTGA 4UEKA 2HL6A 3B12A 3VKGA 3P0RA 4CKXA 1K27A 3QVOA 1VL2A 2I99A 2Q5EA 3S99A 3VM6A 4QOGA 4K8OA 4MVJI 1I9CA 3SM9A 4AKHA 1NW5A 2XW6A 3QEJA 1EWQA 3QELA 4C7BA 1SRRA 1ZGZA 5EOVA 1NF8A 2WQZA 1E1CB 2Z2KA 4Q19A 3TLCA 2I8AA 3TPFA 1UXOA 4KX3A 1YDFA 4LXIA 4WZAB 3VR2A 1QYWA 1VIMA 1W8IA 3FCAA 3MPOA 4LWZA 4OTZA 4Y1EA 1HGXA 3NM5A 4K05A 3S8YA 3GCWA 1AIPA 5IUKC 4JCCA 4YRTA 3AESA 3UM9A 2W42A 4U0KA 2XCQA 3AF4A 3DAYA 3SQNA 3Q7PA 2RBKA 4G9BA 5KKNB 5AJXA 5EN4A 2FPGA 4M0PA 4ND6A 5ESRA 4KXNA 2QTGA 3Q5DA 3L8MA 4LQDA 4MWBA 4E2WA 3A36A 2ZE8A 4EVRA 3URMA 2HNAA 3LQ2A 4MYHA 1NUAA 2FZGA 2B6NA 2O0HA 2VP0A 2WFLA 3GI1A 1LV8A 3MYRA 4TSFA 4YACA 2CDBA 4WFKA 4ZI2A 5IS2A 1ODKA 3FHLA 3BJIC 1OJLA 3RD5A 2X3FA 2OYRA 4IILA 4JLNA 3R5FA 3NXSA 4X1IA 2IYOA 2RJOA 4FFOA 5HUHA 1PW7A 3BOSA 1DINA 1DEHA 2XUIA 3K1YA 4ZWNA 3KUUA 4OSPA 4WWHA 1Y33E 2AG8A 3EXAA 3EZYA 3W3AA 2IHTA 4R9NA 4Z0TA 2IYRA 2CVPA 4FQ8A 4KC0A 1P1HA 2I87A 3LX8A 3LZDA 3QF4A 4UZFA 1X8KA 1WPXA 5CXUA 1C7ZA 1VGVA 3LOPA 4EPRA 1Z4PX 2GBLC 3EXEB 4B46A 2B69A 3R7BA 4EW6A 9ATCA 1M5RA 2QYTA 4HEA1 5KNCA 2OXFA 3PYXA 3AFOA 3IPCA 2JVJA 1UKBA 1GKLA 2ODEA 3RSZA 1EUDA 3IR6A 3HLTA 1NTRA 1WDKA 2EJVA 2VSFA 5E6SB 1YR1A 1DDGA 4KR2A 1COWA 1RRGA 3F5FA 3FOWA 4Q01A 4XWAA 5TQJA 1K0UA 2W4QA 1GU0A 4E2FA 4INOA 1EWTA 4TKUB 1W36D 3JASB 4AJ2A 4ZMBA 1HUQA 4G1FA 4CEIA 5FQOA 4FHDA 5JIBA 3E15A 2QUIA 3ZV3A 2JBHA 2RI6A 5EUBA 4BNJA 1TFRA 4I50A 4LOJA 3UNXA 4UOZA 3H8WA 5C7LO 1DLIA 4HWSA 3R9XA 3CZCA 3G8BA 2H1IA 4EAQA 4EJMA 4L76A 1D8TA 4EPXA 1MVLA 2YXPX 2RGBA 1U4NA 1PAUA 2EZUA 4AFNA 1ZD3A 3FPJA 4DUPA 4TKZA 2PSFA 2RGNC 3FPEA 4M1QA 4UDOA 4BS9A 1XQXA 1QYRA 3N2EA 4XKJA 3TIIA 4P98A 4BV9A 1OQAA 1R0ZA 2FCAA 4WKGA 4L4ZA 3ZXYA 4CFSA 4HI0E 4HLUA 1N5RA 4DLLA 1RQLA 1X94A 1Y81A 2IZ1A 3L0IB 3QVGA 4LXGA 4O2AB 4JI0B 1Y3DE 4KGDA 4WD3A 5JD5A 1NKTA 3T1HB 1XZCA 2F90A 3H4IA 1IBCA 1N1MA 1OFGA 2E5WA 2Y05A 5FUMA 3AJ8A 5JZBA 4Z9FA 3GCZA 4PVCA 4MGKR 4EY6A 1JU4A 2OCLA 3IEVA 3E03A 1ZUIA 3KKNA 5K0BA 5I8PA 1ODFA 5K0EA 5J2TB 3KR9A 4D46A 4PRLA 2H6EA 5KAMA 2TECE 1DQNA 3D5EA 2WNIA 4Q24A 1N7JA 3TKLA 2QD3A 2B1GA 3IBCA 4H4CA 4D3FA 4DCJA 3U7QA 1OLSA 1NV8A 1XKXA 1RC0A 1Z8NA 5H02A 2CXXA 3Q72A 4OHZA 5AVWA 4KK4A 4YHHB 1ZXBA 4IXWA 4AWXA 4BTLA 1Z0FA 4KITB 2PJZA 2H1WA 4BGDA 5EJ9A 1RAFA 4QNRA 4B76A 3ERCA 1RQ7A 1LSSA 3L1HA 5K3SA 2XUKA 1AV6A 2GK6A 4TL6A 4RLHA 2QMUA 1LNZA 4R7GA 1W5FA 1E77A 4WY8A 2C04A 4JNGA 3N58A 1XAJA 5FBRB 2YZNA 3HB7A 1E89A 5KI6A 4QNMA 1C0EA 1NBIA 3HUFA 2QXTA 1KDRA 1PDOA 2QUHA 4DCTA 3V7WA 1OTYA 1PQUA 3NHBA 4N5MA 2XCRB 2FAXA 3GFTA 3G1WA 2WJIA 1F17A 2FLKA 3L4BA 3MJSA 3CF2A 2D2XA 2AKYA 3FZGA 1M1YB 3I0MA 1QCYA 3I2GA 1ZM7A 3OEED 4HDKA 2XT9A 4PFQA 4F5WA 4KLAA 4OU5A 2UAGA 2V3VA 5KTSA 5EKXA 3FCXA 1ZAKA 2L82A 3SC3A 4ZZ1A 4PYMA 3KOYA 1XPJA 5B53A 1CNFA 3G1TA 1YBVA 2FWNA 3SICE 2J7PD 4C06A 5ITZB 3G9TA 1S8OA 3R3HA 2JEYA 2I76A 2P5UA 3MGAA 1GPLA 2B4KA 1DNPA 3HHEA 3IUJA 4LRYA 2ZYSA 3V4LA 3L6OO 4UW9A 3Q7EA 3TQTA 2QX9A 4PCUA 4RAQA 4Z3KA 3SMQA 3BCHA 1Y1RA 1YI0A 5BVHB 2IP4A 4MX8A 3DHNA 2Y67A 4WNIA 1K6XA 3LF2A 1E94E 5ALKA 2ORVA 4FZJA 1P1JA 5T3YA 4AJ4A 3K16A 3LRXA 4AXXA 1UC5B 1FPQA 2AN5A 1P9NA 2XOEA 2AKEA 3DMRA 4DREA 5EJAA 4DT1B 2C9DA 2D4HA 5JFOA 2EX0A 4GPD1 3E18A 4QGFA 3JD0A 2PSJA 3AF3A 1RWWA 2GR9A 2RHDA 2CXTA 2VEDA 5CFOA 1E2GA 1HDIA 5FWDA 3VKHA 3GJ7A 4DCUA 5CLQA 2MWMA 5C5CA 4FFVA 3T52A 1XQ9A 1X7ZB 1X38A 4B8WA 2AIRA 2CBGA 3ZNQA 2VZ9A 1HC7A 3LFHA 3LX6A 4C0QC 2P9GA 5EJMA 4LZOA 4EHKA 1BFUA 3TOCA 3GA0A 5CEEA 1ZOIA 3FDXA 2J6CA 3EMVA 4EF4A 1XZFA 1H66A 2XNDA 4IRUB 5JPCA 1VSUA 3W7VA 4YAUA 1CV2A 1XMIA 3ADPA 2YRFA 3VSCA 2EL7A 1EXDA 3N0TA 1K6MA 1U0OC 5UKDA 1U7XA 3ZDXB 3PXGA 3BG5A 1QIHA 2FPOA 2XBLA 3KQQA 5A3QA 4TPKA 1FUUA 6PFKA 2X1HA 5DM0A 4XDHA 2F00A 3WK8A 4XXHA 2P40A 2P69A 3E3MA 4ZOQI 1HYGA 1WSWA 1B6SA 4A1FA 1JDBC 2EX1A 1QFSA 1A2BA 2OGUA 2CDNA 2OO5A 2EZTA 4CDGA 4D8WA 2R66A 4HV4A 4HTAA 1MENA 4HNAA 4M9ZA 4PYQA 4HDNA 4YCBA 3VNBA 5G1NA 3L77A 2ATVA 2J6HA 3PNPA 3W4IA 5L7WA 4ARSA 1AS3A 2IIVA 4OGFA 1U6JA 1RXWA 5JNLA 3HNRA 1GNQA 4DDKA 2AFRA 1MNQA 2JIZD 4M8NE 3UV3A 3HEMA 1O87A 1WEKA 1NAHA 4ARZA 1Z8DA 1MTZA 2WJAA 1M6NA 3EVGA 1XL1A 3PUWA 3S1LA 3V4SA 5L9AA 3KT6A 3HCEA 1C1XB 3ANNA 3RK0A 1J23A 3TXAA 4HQKA 3EQ6A 2RD2A 1N9ZA 4RPGA 2VJLA 5KYYB 3X1JA 2EW2A 3ODPA 1V95A 2X8JA 1QP8A 5J5VA 3HDQA 1C7RA 1HQKA 2V6BA 3UW1A 2QRHA 4FQ5A 1NWCA 4YJGA 1OASA 2YMQA 2DUWA 4ZCMA 1B43A 3IBGA 5DULA 2NX2A 4GO1A 1L8OA 4HZUB 1R18A 2PXAA 2X13A 3KV1A 3VO2A 1O58A 3W5SA 2J3IA 3JR3A 4B8ZA 2A88A 4DB2A 3F96A 1W6UA 1N2CA 1QF9A 2VATA 2ZTHA 4N47A 4I4TA 5LP6B 2DTDA 1SHTX 4A10A 4XDYA 4BRUA 1MB4A 1DT3A 1U2PA 1EUCB 2YWBA 4DCNA 1XMVA 2QPLA 3FLBA 3K5HA 4OFZA 2IX3A 3UHPA 5JMTA 2VQDA 4NOKA 1L9KA 3II6X 1KFJB 3NOVA 5E9AA 4DMFA 1QHIA 2BSAA 1CVLA 2IELA 5TPZD 1PJTA 3ZHYA 1Z0IA 3F6EX 1T6XA 4IMJB 4B3RB 1JXOA 2P2CA 3I9NA 4EHBA 2MT9A 1ZMTA 2FNAA 5LOVF 4GX0A 3EFBA 4RIFA 4KFSA 1Z18A 3BAFA 1ZSYA 3BWMA 4ZGGA 2WF5A 4W1RA 2XGMA 4BVGA 5F2NA 2WU4A 3HB0A 2UYQA 1Y48E 5JAHA 2P3QA 3G8DA 1YFZA 1E6LA 4HMQA 4QARA 1ESCA 1O5TA 3BE4A 4MQUA 1NUTA 1JU3A 3A2KA 3VVBA 4MRRA 1T9HA 3OLWA 5ER9A 3FTPA 3WJ2A 5LQDA 3KJHA 4W6QA 4POAA 4XYMA 2H7XA 3SN6A 1U0HC 4BGVA 3DCNA 4FCTA 4OB7A 4LJ9A 3D0KA 4R5HA 3GFGA 3JSAA 1UK9A 2VSNA 1MUUA 3EEQA 4XGQA 1N9GA 4FKZA 4F9EA 1G8GA 3AR8A 4RF5A 1J9ZA 4CL8A 4DY4A 1ZNXA 2BRUA 4W1QA 1RD4A 4FXPA 3VYVA 3OO1A 4X1KB 1FMCA 3OIDA 4KQFA 3IIIA 4DLPA 4YPVA 4OLFA 4CT5A 1XNGA 2OCKA 3OZSA 4A15A 2VRCA 2W6ZA 1VJ5A 3FDIA 4XE5A 5DCUA 1ODJA 1SZDA 4N49A 1OV6A 2V7EA 3RYIA 1Q21A 4RORA 1DRWA 1MC4A 1H22A 1I2AA 2YJZA 3KLNA 3NAGA 4I3GA 4Z86A 2ZYRA 3K92A 5K0JA 4OQZA 3WMRA 4KKXB 3BCRA 3O95A 3WIUA 1M66A 1Y7LA 3QXHA 5EZYB 3EPRA 2ZT7A 3PLAE 1ZDMA 3A9SA 3BMNB 3WBJA 4FW8A 4RADA 4GPZA 4MLDA 5EPEA 4AW9A 4YRNA 2EP5A 1R6AA 2HJWA 4UBOA 4CIWA 3PTAA 1KAQA 2F8SA 5C1PA 2PFKA 3Q9NA 5BN3A 2GCIA 1US8B 2BSQA 1IJEA 3KKOA 1JQLB 1T2FA 4IJVA 4RHXA 4F38A 2FKAA 3WRVA 2VUIB 2ZIXA 2YHIA 3GIDA 3Q8WA 1Z47A 1UXGA 4H3VA 4ZKEA 1TXGA 3TZHA 1GTSA 4XGRA 3P4YA 4W5NA 4TV9A 1V1MB 3CX4A 1Q0QA 4O4IF 5BP7A 2JFUA 5GADl 2HT1A 2PT6A 4ME6A 5BQFA 4DAOA 1XXLA 1AGRA 2HRQA 3M1IA 1VYVA 2BZ0A 3BTVA 5CVEA 2J5BA 3U44A 3QEAZ 1XALA 4G8CA 2G76A 3OZBA 5CDSA 1W35A 3ZHZA 1QDUA 3JVUA 1Y3IA 1YF3A 2B7BA 5E7IA 5SYNA 2TRSB 2B4YA 1EP3B 3FUVA 4JBXA 3GJ5A 3AETA 4QU9A 1T15A 3ETDA 1KC1A 5H0IA 1C8VB 2H1VA 1XPRA 1PJRA 1X1EA 1Y1QA 3CF6R 3MEQA 5GM2A 2FE1A 3M6FA 3L6RA 4KK3A 4L8VA 3BERA 4JOQA 4MKFA 3T95A 5K20A 3PFWO 1WTCA 1RZRA 1KI8A 1IIBA 3BORA 3NV9A 3D5QA 2FZVA 2V74B 4KYUA 3SZGA 4CTJA 4Q3OA 1LTHR 1G8SA 2NZ8A 3EGXA 2WSIA 3QFRA 4E11A 5KB3A 1BO6A 5FI0B 1E3WA 3GP5A 2P91A 3OE1A 1L4NA 1YIAA 1M2KA 2QIOA 4RE5A 3ZQJA 5JRDS 2WV7A 2HJRA 1GVHA 2ZJBA 1GLGA 4QD3A 1WG8A 4IEFB 5DHSA 5ALFA 5AJZA 3UFBA 3BKXA 1UBRS 4XX1A 3WBBA 4F12A 5IMBA 1JXQA 1B3RA 5FEUA 3LMKA 1KMIY 1IUNA 3FM9A 4B43A 2ISQA 3DVQX 3JYOA 2YVQA 1M34B 4MVJH 1LX6A 1YB4A 1WD5A 1ZCJA 2BMVA 3K6SB 2R6FA 3UK1A 1GUFA 2JZNA 5I9BA 2P67A 3KYIB 4MVJF 4R1LA 4M8LA 1RPTA 2BELA 2A1UB 2D5IA 3DBHA 4Q3DA 7MHTA 2F4VB 1A9XB 1RHMA 1KETA 2PZLA 2GPBA 3PDIB 5A4FS 5C2JB 3OU7A 5DIZA 2GETA 2W6ID 4LG1A 4RHUA 5B3AA 1HT2E 3MJVA 3NWOA 2RGDA 2F8MA 1QX3A 2C2YA 4UU8A 4GX1A 3MN1A 5FORA 1SO8A 1XA3A 1E5XA 4ZT3A 3TOZA 4LXTA 2XODA 2FQQA 1ZNZA 3E22A 3LNTA 1E1QA 1VB3A 2JEOA 4BNDB 3SF8A 3PCTA 3JQDA 1F06A 2Q2WA 4QPNA 4IP0A 5I4CA 3GUZA 5BUQA 3PR3A 3U3ZA 3V1KA 1V16A 3V1TC 4ZZIA 2R79A 4HEA6 4R2KA 3W90A 5ECGC 2G9RA 1BDHA 4CUKA 4FHCA 3TWOA 4GG1A 5AJYA 1PR9A 3OFKA 4OKIA 3UKOA 2OBFA 4ZQBA 3MS7A 3DHYA 4WZZA 4F5EA 5AI5A 5FOUA 4MV9A 3STXA 4LCBA 1J2UA 4DMCA 2PVSA 2DP4E 1FOEB 2EIXA 3JWHA 1XX6A 4IJ6A 3ZJYA 3C2QA 3DM5A 4UE6A 4D4GA 1WVGA 2ZB7A 4IMPA 2BGLA 4LRQA 4LNAA 2PUJA 4ZO7A 4DGQA 3CR8A 4BEJA 2RHTA 4OXKA 1MBZA 3NUQA 1W4BA 1OLUA 2X2PA 3CF4A 2WNHA 3ND6A 2OAP1 2R00A 2VH5R 3PV0A 4IDGA 1DWPA 4M9SA 4Y9UA 3O4VA 4UMEA 1KDVA 2JVKA 2CJWA 2EQ5A 3BB4A 4ZALA 1JV2B 2X5NA 5FOVA 1KDZA 5LMNB 1MKYA 1IZZA 2BLNA 3I8OA 2GEUA 4K3UA 2E4VA 2P9FA 1XP8A 1RZ3A 3LX5A 2CSXA 1CVIA 4PNEA 4C04A 2WVAA 3D64A 1FRFS 3TD6A 3CFYA 3QFTA 1XTVA 4BNZA 3BK1A 3G2OA 4BO0A 5CIYA 1KH2A 3FPFA 3OIFA 1KBZA 1RKUA 5I7SA 3TLGA 4DBZA 2WTAA 4S1OA 1QR6A 1GZSA 3B52X 3KPYA 5KOIA 1PG5A 4EO9A 1ZMRA 2DWCA 3D0QA 4HVLA 4L9SA 4AECA 1MAVA 2PL1A 3FLAA 3LIIA 721PA 2IV3A 2BKEA 3BMXA 3NTRA 1TF7A 5JBNA 1SOUA 3I05A 5MHTA 2P11A 4QGBA 2DPHA 5LLTA 4WW0A 4B71A 1E9AA 4UHCA 1A2OA 1RKQA 3ADOA 1RBQA 1J0DA 3PA6A 1LC0A 1PRYA 3BF7A 4RZ3A 1GR1A 4HH3C 4YBZA 5IXYA 3N39C 1F0YA 2WIJA 2XT6A 5E3HA 2QL9A 1E0AA 4BQRA 3MUEA 1G17A 4MEJA 2B8WA 3G2QA 1NQXA 3INGA 5AR1A 3HMKA 5C8DA 3ZZNA 3RF7A 2FSUA 2HLHA 4DA0A 5JE8A 1IWPB 1E79A 3O4RA 1E1YA 2Q8QA 1YB1A 2P4SA 1GG8A 3DCYA 4FMBB 1TW3A 3BZWA 3N53A 1WXGA 4L74A 1YJBA 1NATA 4KMMA 5KYWA 2P8JA 1CHDA 1CY6A 1LF0A 4MVWA 3AHJA 5ALVA 5BMOA 1WKCA 2Q6TA 1JAIA 1Y8QB 3PE6A 3RGGA 3D1VA 1Q7TA 2I2AA 2QUZA 3ETJA 1ZK0A 1QIDA 2DUJA 1MB3A 2EYUA 1IXZA 3ICOA 4IHJB 3ZH2A 1VCHA 1W4LA 2XVZA 2HQ1A 3B1JA 3H87A 4EEKA 1MW8X 4F97A 2ZSAA 3KYCB 1XJ5A 1NLUA 4M1YA 1SCJA 1SCIA 4D57A 2CJFA 3ZBPA 2H1OA 3IB3A 1Q44A 1FU7A 3FFXA 3R5XA 5JLJA 1AZTA 1ZNYA 3TGWA 3WHPA 1UKAA 3FOFC 1UP6A 1BE0A 1P44A 2D7CA 4PTZA 3W7AA 2H0AA 1EEXB 1KPGA 4YRFA 5AM1A 3WKDA 1KK2A 3GLGA 1H9CA 2P77A 1CULC 1Q7EA 3G79A 4XIGS 2D62A 5BPFA 1WMEA 1FA9A 3JYQA 5HOEA 1RABA 3EH1A 5LB4A 4ZHQA 1XTTA 1WNTA 1JG2A 4FHFA 4UBLA 3SC2B 1M1XB 1QRRA 2ZR7A 1VSVA 4YR7A 5ITWA 4G0YA 3UMFA 3HDJA 2X4GA 4UVDA 4JLAA 1L7VC 2XF2A 1U02A 5F73A 3N0VA 3TL2A 4X64B 5IVKA 1JKIA 4JJEA 2HTFA 2VJMB 3A6GA 3KTOA 4NE9A 4QDTA 5A2QA 2XTAA 4EMTA 4NBRA 3OCYA 1GTZA 1DKLA 1QVZA 2L42A 2QDKA 4NE2A 2JFBA 1TZBA 4F1JA 2MYNA 3ICEA 1YB7A 2Z2YA 2PBFA 4FI3C 3TJMA 4EGQA 5EXTA 4QUAA 4WFIA 2GPAA 3RAGA 1NUQA 4OXNA 1WCIA 1UJ2A 2X1VA 1X70A 2QKYA 4PTYA 4TLBA 4YIKA 1ZSVA 4OHOA 1NRXA 1ZWLA 4FHZA 4HN4B 1G5HA 4NHEA 1IZ8A 1WHTB 4REOA 5CAEB 4R98A 5KYTA 2JCVA 2MSWA 2LKCA 2AMYA 2FPMA 3KWFA 3AX6A 4OGLA 2GCGA 2FPKA 3P9ZA 4X8MA 3N86A 4L9AA 4AKEA 1XAIA 3IXLA 1Q77A 5DEOA 3F5SA 2CLMB 2O3UA 1YJQA 1KNQA 1J2YA 4JT2A 3VR6D 1HT1E 3OPVA 4LHWA 1M0EA 2AD1A 1ATZA 3DBVO 5FBKA 3R2JA 1ZOLA 4XA8A 4OA8A 3PD0A 4HFNA 1SQ5A 4V0NA 5BVHA 1KKMA 2HK8A 1Y7IA 1T1JA 2YVAA 3PLRA 5IJXA 2JFQA 3GUCA 4GLJA 4CQLA 3ZZ1A 3F1KA 1XJQA 2BEVA 1K88A 3THOA 1LVHA 2POCA 3UG7A 2B30A 2GK3A 4EBFA 3BTUA 3RUPA 3EA0A 1PL8A 2I6GA 2XJ4A 3L4SO 4EMBA 3CWCA 4M1WA 2WSLA 3ELWA 3KKLA 1AMOA 1ODLA 3G0CA 1V48A 3HO6A 1ZU4A 4ARVA 4Q0MA 3UIEA 2HRDA 2XR1A 3ICVA 4JEMA 521PA 1V6AA 4CMKA 4YJKA 4ZOEA 5C4MA 1SELA 2L17A 3KPVA 1PJLA 1EWVA 4DIEA 1R7RA 5H9WA 3ECCA 3G6WA 1BWPA 5F3RA 3FDZA 1IDN1 5G1OA 3DMYA 3FRJA 3M4YA 4FR5A 4WINA 4TLEA 1JIUA 1RKBA 2KBFA 3WLLA 1L7BA 5JOQA 3C3AA 4AO6A 5LZ8A 1A5BB 2BMDA 3VDRA 4AJEA 3PQ4A 1XE3A 2FRDA 3RTDA 3CUTA 1NMYA 1R4AA 4FGZA 2PRYA 3GF4A 1STOA 4DN6A 2QW8A 5KSYA 1P60A 4MWTA 1DKUA 2MSDB 4LV6A 1WX1A 1N75A 4GSYA 2CLEB 3AEKA 4WNAA 1LLUA 2V96A 4JNCA 3RVJA 4XYGA 1SXJB 4AT1A 2N47A 5I3ZA 2QW0X 1CUUA 4IWXA 3E9DA 3ANSA 3DKKA 4NHOA 2YV3A 4JA2A 4OQLA 4RPLA 4YV0A 3JQBA 2HQSA 2UXBB 3EFHA 2O2GA 3VHXB 2QQ0A 5AVTA 5L3VA 2AH5A 3ANLA 4N76A 4B31A 1TYZA 4GU5A 4ADSG 4N8EA 1LDGA 2R44A 3RDPA 3V4OA 2AX3A 3IUQA 2JH8A 4ZP1A 2Z9CA 2IDZA 4XFKA 5ICCA 4CLRB 5HG0A 2I2CA 2BFEB 3DDHA 5CFNA 3WL6A 4KQXA 2ATCA 2JNWA 1RHRA 4V2IA 4EUSA 4PS0A 4XASA 2DH5A 2D1YA 2Y6VA 3VI3B 4YP1A 3TMYA 4YDQA 4UAVA 4DJAA 5CH5A 1ZS9A 4D0RA 3M89A 1KVRA 3GYBA 5JVDA 3GAAA 4IJSA 1M2GA 4HGZA 4LZZA 3DZFA 2PUWA 3N8KA 1VSBA 1RRPA 2O9JA 4M0FA 1N57A 1ID1A 4OUDA 4A8JC 3OQNA 1KY5A 3D3JA 2ARKA 9LDTA 1BVRA 3ND5A 4NEGA 1J25A 3KETA 2A0WA 5BMVB 5JD6A 5CHEA 3MA0A 4DV3B 1A5TA 1CUHA 4QFBA 4YGXB 2VHUA 4AYXA 1DWUA 1I30A 5D1NA 3DEZA 1KIAA 3W4JA 3R5JA 3M5PA 3B3FA 4W9RA 3LXXA 3HWRA 3SVTA 1UXIA 3BTSA 2W70A 4QBGB 1L5KA 4F45A 4FUTA 4NAUA 2BFNA 4HGRA 3QW2A 3KTDA 1ZUHA 2CK3A 1XA4A 2ZI5A 1F8XA 3BIXA 3MJEA 2VTVA 1XCMA 5HIIA 3RYCB 3KZNA 1QC5A 3VTFA 2VHZA 4J4HA 2PJUA 4UU7A 1I10A 3WFZA 3ZV6A 1VL8A 4EO7A 1RI3A 1V7PC 2ZDQA 4LXQA 3T3PB 2IHVA 1Z0UA 3LBNA 1FYXA 1E6UA 1PT7A 5JYCA 4K2AA 2AOVA 4C0AC 2MR6A 1GKYA 3H2HA 4UXJA 1KO7A 2IEYA 3N7TA 2XB6A 5IRCD 5IT9A 1CS0B 4XWOA 1W76A 4WBXC 3VC1A 4HWGA 1E1LA 5LQRA 3K5IA 3DLAA 3DOIA 4J16C 4BWYA 2BEUB 4EFDA 1TA9A 5IASA 1ZH4A 2ZFUA 1CLUA 1K97A 2B6HA 1BROA 1L7QA 4CG0A 1B0UA 1ZKDA 3A6LA 5A9SA 1S2DA 1P2BA 1VHTA 3ILVA 4AMBA 2BR3A 4IFTA 4YXWA 1IBLB 3A4NA 2QGFA 4H7DA 3K1JA 4GPIB 3UJPA 4Q9AA 3I2HA 1CIPA 2CYBA 4PYNA 2X0KA 1NXQA 3OP1A 4U63A 3M3HA 1SBQA 2DUUA 2JI7A 5E9JA 4BZQA 4DLZA 2FW8A 3GGPA 2YJ4A 4GQAA 4PHHA 4LYEA 1O0BA 3PDWA 5JSZA 1S8AA 4TLDA 3WB1A 4GEGA 2QD5A 4F93B 4JJKA 3OC0A 2ECQA 3PPYA 1NFFA 5JJ5A 4U02A 4RF3A 1MB0A 3G2LA 4FGKA 3X2FA 4BMOB 4I99A 5DTJA 4KXLA 4UHEA 5AXAA 3DB2A 2PD6A 3IUBA 4RW0A 3WGVA 1NXWA 3PF8A 1TT7A 5DO9A 2GPTA 4MPJA 2VRWA 1RHUA 2XYVA 5IDWA 1QLHA 2JGDB 2WP0A 2GPSA 2HJGA 3M6XA 2WUGA 2KBEA 3GRVA 4QOSA 3CH5A 4W6ZA 4G8JA 3JWPA 1EVLA 3CG4A 3H9GA 3LT2A 4PNHA 3EG9B 4GR9A 5IJZA 3CVYA 2PG3A 5EQTA 4K6OA 3UXEA 2R25B 3DKRA 3ZE7A 3QK7A 4L6IA 1Z06A 3Q7SA 4BB9A 1IQUA 3LPAA 3HDYA 2AXPA 4NATA 1K3FA 2W2XA 3LU1A 3OPMA 5DYTA 2P8SA 1ONOA 2W4IA 1YKSA 1OLOA 1LUAA 1DKPA 4Q7MB 1C9EA 1H94A 1WXIA 1RACA 4KPFC 3K32A 3NPAA 4OXYA 4FSHA 4PZ9A 3CCFA 3KPJA 2ZVJA 2QBYB 1DAIA 3L5OA 2CB9A 3AR4A 4UM7A 3ECAA 1NASA 3FX2A 3R4VA 4A4DA 3F8TA 2PUBA 2H3HA 4Y2QA 1E7QA 3I34X 4N6GA 3R0VA 1MOPA 3QPVA 1DV2A 3KKMA 3KIPA 4LZLA 4QQRA 4TMVA 3D7SA 5DI3B 5EMLA 4BKOA 4H3HB 1Y4AE 3HE3A 2CLHB 4DV0B 2FN7A 3QELB 3IRUA 1RPNA 2X3UA 2OFWA 4MKGA 1ODCA 1UPXA 1JL3A 3VPCA 3V8BA 4LZNA 1AUPA 4BP3A 5GJVC 5AI8A 4PZUA 1JEOA 5LZ2A 1GL9B 2WTNA 1YDGA 2GF9A 2O0MA 1RCFA 7AT1A 2PZFA 4Y9TA 4AWAA 1BRTA 1QVVA 4MA0A 1W25A 1NX9A 1UOPA 1XTSA 3KBOA 5EZ6B 4ZVTA 3VKWA 3AI1A 4Q39A 3WLHA 5BV1A 1DVRA 3JATA 3SIWA 3J81k 4KYIB 2C84A 2PDAA 3L8EA 1NVKA 1C8KA 2WUEA 4A23A 2W8ZA 4WZAE 3EZ9A 3OOWA 3CO0S 3H1FA 4PTLA 1L4EA 2JBAB 3C7KA 1OI4A 2PLFA 4R05A 3T0IA 3UC5A 4BLPA 1V3UA 2PBLA 1UZNA 2VDWA 2G4CA 3D3WA 3S1AA 4GI1A 1V2GA 2XGGA 1D6NA 4W8HA 2A33A 2V7XA 1N3YA 3B3JA 4CIDA 5C8YF 2ORIA 4GBGA 4X1IB 3V33A 1YOBA 3V7UA 3EVFA 3VOTA 4GOXA 1M2OA 1J0EA 2FW9A 4QQNA 2OHGA 3IBTA 4UTRA 4TX1A 2PT7A 1ZGAA 2XUPA 4NOJA 5L3QA 3GH1A 3KLPX 1ZD2P 2XXBA 2ZROA 4Q3AA 2IPAB 4KLCA 4HDSA 1JP7A 1UADA 4JLBA 2VHYA 3MW8A 4W5JA 1UODA 2W2LA 4WECA 3DTYA 1EAYA 1W1IA 5D5PA 4E22A 1ZCZA 2LVBA 3NBXX 1QDLB 4HCJA 1N4DA 4IQ8A 1WMAA 3TLBA 3TQHA 1XD2A 3BGSA 2D5AA 2RHCA 3STWA 3CUSA 4K6HA 1ISGA 1DG9A 4H0NA 5EWJA 5L7YA 3P9NA 2F3UA 2H5EA 1TECE 3HGMA 4WXEA 4G01B 5AKHA 1BVHA 1JLLB 2HXYA 4D9CA 5AI4A 1OTXA 3RS9A 4YCNA 2P6RA 3HVKA 1MP0A 4MV5A 4I50B 2VDLB 3HXMA 5BRAA 4TTVA 4EMSA 1IEXA 3FY4A 4QXAA 4BYGA 3K53A 3EPJA 4Q3CA 1A9RA 4MS1A 2FWJA 1DO2A 3FIUA 4BO1A 1V35A 2HIHA 1E58A 5IT0A 3PC8A 4KPYA 3RW9A 1GTRA 3C97A 1M5TA 1GY8A 4EG7A 4UCQA 2C9CA 5CB0A 3DHVA 2QEQA 3EIHA 1Q1EA 5A4AA 1I7DA 3DC2A 4N7RA 3A32A 1BKDR 3C5CA 3N5KA 1VJRA 4HNGA 9MHTA 1FW8A 1Z5NA 2C4NA 4TN1A 4UEJA 4UXHA 3V8MA 4EYGA 4R8LA 3GGDA 1JT9A 4E4YA 4IZ6A 4YAEA 2P2NA 3MMPA 3CZMA 3DZCA 3PXCX 5G53C 2I78A 1PFQA 3F3YA 1DIHA 3WL5A 2ZRQA 4Z49A 3U2QA 3R5SA 4ZDJA 3I9V1 4E7PA 5BW5A 3AY7A 4P34A 4UE2A 3KT8A 4JI1B 1T5SA 1UXJA 3BZUA 3WLMA 4YYZA 1NDUA 2FMIA 4L07A 4MKIA 2HJSA 5H70A 3K9QO 2DR0A 3PWTA 2ZUUA 4WBNF 4CDRA 2X5JO 3GP8A 3DBLB 3NOOA 1JVBA 1SGWA 4BRZA 3EMKA 4RY9A 5JJBA 4HFRA 4Q16A 2YIJA 1XKLA 2H1SA 4I9UA 2OXIA 1EZ1A 2JAUA 3MJHA 1UR5A 2WYIA 4YCDA 4DA9A 1SVWA 2ATEA 4J1NA 3FWHA 2IF2A 1WXQA 2NIPA 3NS7A 5LYYA 3QZUA 3VR1A 1LNQA 3GN1A 1YQGA 2GM3A 2N1MA 3CMMA 4TVBA 1KY3A 4BXOB 1YZNA 2CNNA 4I1VA 4OBEA 4EFNA 4CG3A 2JFGA 4ARUA 2P75A 3BIWA 3W2FA 3R23A 5HX7A 2OZEA 2AJ8A 5LUAA 2I3GA 3D4BA 4YASA 3ZY3A 2P78A 4A2WA 4HVCA 5EJEA 5EEGA 1T36B 4JUAA 3T99A 3UB3A 4GDMA 5EUCA 1JIJA 3OLCX 4RDCA 2Q2NA 3A6FA 4R2XA 4QDOA 4MCAA 1XRPA 1OVGA 5TS2A 5JJCA 4I4LA 1Y5LA 5KYUA 2PMWB 4OHBA 4F86A 4JC0A 5JPDA 2FF5A 2IXGA 2WJPA 3WHLA 4MS4A 1EPUA 5A6SB 3CTPA 2BGWA