2QYSA

Structure of eugenol synthase from ocimum basilicum
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
310
structure length
310
Chain Sequence
GMKSKILIFGGTGYIGNHMVKGSLKLGHPTYVFTRPNSSKTTLLDEFQSLGAIIVKGELDEHEKLVELMKKVDVVISALAFPQILDQFKILEAIKVAGNIKRFLPSDFGVEEDRINALPPFEALIERKRMIRRAIEEANIPYTYVSANCFASYFINYLLRPYDPKDEITVYGTGEAKFAMNYEQDIGLYTIKVATDPRALNRVVIYRPSTNIITQLELISRWEKKIGKKFKKIHVPEEEIVALTKELPEPENIPIAILHCLFIDGATMSYDFKENDVEASTLYPELKFTTIDELLDIFVHDPPPPASAAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Eugenol synthase 1
publication title Structure and reaction mechanism of basil eugenol synthase
pubmed doi rcsb
source organism Ocimum basilicum
molecule tags Plant protein
total genus 113
structure length 310
sequence length 310
chains with identical sequence B
ec nomenclature ec 1.1.1.318: Eugenol synthase.
pdb deposition date 2007-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05368 NmrA NmrA-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2qysA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 2qysA02
1OC2A 4WECA 3G49A 2DVMA 4RV9A 3TOXA 1SOWA 4N7RA 4B4VA 4B3HA 1H9AA 2CVZA 1ADCA 1D3AA 4GI2A 3H7AA 4DRYA 5JC8A 3LU1A 1DJQA 5JXWA 4ZQGA 3NT4A 3MJCA 1DSSG 1WDKA 2ET6A 4D45A 4Z0PA 3NGLA 1P1RA 4FB5A 4YXFA 4RZHA 1LDNA 4CQMD 4WJZA 5G4LA 2D2IA 2X7HA 4MVJP 3OETA 4HKTA 1F0YA 5JCJD 4A0SA 2P91A 2VYNA 2WSBA 4GLOA 3DDNA 2B4TO 5GZ6A 3UCEA 3UKOA 1IYZA 4BQPA 2O23A 1E77A 2DBZA 3PIDA 2AQ8A 2UV8A 1W73A 2WDZA 2BFPA 4ND5A 4B8WA 5CDUA 4MKXA 3RBXA 3ABIA 3KETA 4KZPA 3KSUA 3I6QA 1UJMA 1NVMB 1ZXBA 4BVAA 2H63A 5B1YA 1GZ4A 4P4LA 3NRCA 3D5TA 1L7EA 1XCBA 4NFHA 3WGGA 2DTEA 5AOVA 4YRDA 4DPMA 2Y99A 4CJXA 1G0NA 2IZZA 1K3TA 4CODB 4IS2A 3G1TA 2P5YA 3TJRA 1PQUA 4JN6B 3OMLA 5CDYA 1U4SA 3AOGA 3CXRA 4R4JA 4CMIA 2AG8A 3F47A 4IQ0A 3KLMX 4FJ2A 4XJTA 4CMIB 3H9JA 3MOGA 5IDWA 1V35A 1ZK2A 3L07A 2LDXA 1NNUA 2G76A 3NX4A 2P9GA 5CDGA 1ZFNA 3E9NA 1KETA 3GK3A 3HB4X 3I5MA 1O6ZA 1E7YA 5LCXA 4TZKA 3ZWYA 1GUFA 1PZFA 2C7GA 1DC3A 3EVNA 4CLXA 3IOYA 3JQ8A 1M67A 4L9RA 3ZU3A 4NJOA 5GZ3A 3JQ8B 4CR6A 1AHIA 3GAFA 3ZZNA 2YFQA 5DP1A 1FJHA 2OGUA 3C8MA 4ALLA 2A4KA 1XG5A 1FDTA 1QLJA 3TZKA 2J3JA 3N7UA 3N58A 1Y1PA 2R00C 4QO8A 4GX2A 3PPIA 3QVXA 3GN2A 3DOCA 1P45A 2JCVA 5KIAA 4YT8A 4M55A 1NR1A 2XXJA 1WXDA 4B3IA 3C1TA 2VTEA 3VTZA 4HBGA 4Y6SA 3C24A 5I7SA 1YONA 1PZHA 3AY3A 4KWIA 3DOJA 1MP0A 5BSFA 4JIGA 2EG9A 4BGUA 5JS6A 2FZWA 2VHZA 3ETEA 2CVOA 2Y1CA 3NDIA 3I3OA 1VKNA 2CUKA 1NXQA 4B4WA 4CMBA 4YQYA 3DXFA 4J49A 3IUPA 4CM6A 4FR5A 1A5ZA 1B15A 1PJQA 1EVYA 1Z73A 2GNAA 1B8VA 4CM9D 5HS4A 2AHRA 4W7HA 4QTZA 1V3TA 1IOLA 5GMOA 3WGOA 2NWQA 5ENDA 3EGOA 2EW8A 3WGZA 4H16A 3RFTA 4E5KA 1P31A 2NV6A 2JJYA 3ANMA 2AEMA 5I9MA 4BO2A 4UREA 1JN0A 3LDHA 2LDBA 5CFZA 1HZZA 2OP0A 3O8QA 5THQA 3TWOA 2Y1OA 1EE9A 1GL3A 4RVHA 3O8QB 2O3JA 4PVCA 4BNJA 4XYGA 3JQ9C 2FPPA 4AL4A 4R68A 3IS3A 2GGSA 2PKQP 4BO1A 4J3FA 4GX1A 4FOSA 2O4CA 4BO5A 2X23A 1V3UA 4GWGA 2POQX 3KV3O 1U9JA 2Q99A 4INAA 4KMSA 2D5CA 3WOHA 1XU7A 2I3GA 3DB2A 1ZK1A 4K9DA 5TSDA 4BKPA 4Z6KA 3ANNA 3FF4A 2FMUA 1RPNA 2D1YA 1A72A 4F46A 1HSZA 5JMPA 1SNYA 4BL5A 5DNAA 1L7DA 3QVWA 2I9PA 4IGEA 1EUCA 3K8ZA 3CINA 4K28A 1LLCA 4EUFA 4TVBA 1JDJA 2AMFA 1BXKA 3RASA 4BNVA 5JAQA 1HTBA 3GZ4A 3LZ6A 4XJSA 3EZYA 1P1HA 4DQXA 4Z3DA 4CM4A 4YJHA 1T25A 2CNBA 1WLYA 4YJHB 3RVDA 4RO0A 2W2KA 4RQTA 1LSUA 2W8ZA 2W2KB 4K6FA 1ENYA 1QG6A 4FGWA 2IZ0A 1VPDA 3PJFA 1DAOA 3JQ6A 5LDHA 3ZWNA 1GV1A 1WZEA 2VRCD 1VLLA 4WOJA 4BNKA 4YT2A 5I7EA 1UDCA 3V1UA 3S2EA 3WBBA 1YJQA 3GGOA 2O7QA 4ALNA 4ALKA 3K92A 1ZJYA 1RM0A 2VQ3A 2W4QA 3HNPA 3T4EA 3U49A 4ALJA 3W6ZA 3Q6IA 2FSVA 5FI3A 4J6FA 1DB3A 1KVUA 3JYQA 3OJOA 3SX2A 4RCVA 4MOWA 1B7GO 3KHUA 3P2OA 3GN1A 1F8GA 3QQPA 3R0IA 3SXPA 2J5RA 5A06A 5MDHA 4PLGA 3OHSX 5L9AA 1YQXA 4MVJM 1ZSVA 1ZZEA 1CETA 3S8MA 1ZH8A 3KYBA 2NNLD 1F12A 5EESA 4BB6A 2J5KA 5AXBA 1KVQA 3GH3A 4BOYA 3L6EA 4BNWA 4CMKA 2Y66A 3ULKA 3RIHA 1XYGA 5BSEA 2O4UX 1HYEA 4FOOA 3GDOA 4DIFA 5CG1A 1PGQA 3WSVA 2WWRA 2IYOA 3PQDA 5JY6A 2W98A 5COAA 3U62A 4B8ZA 3DOOA 4FFPA 4W7IA 4AJPA 2X0RA 4ROSA 1A7AA 4PZCA 1NHGA 1ISHA 4XR9A 1HDCA 2IRWA 1MB4A 5ADHA 1W6UA 4EZBA 3ZWXA 2P4QA 4J0EA 4AJKA 4W9NA 4TKLA 4AJJA 2H9IA 3ZW8A 3WS7A 1R16A 5KWEA 5U4QA 2EGGA 4DLBA 2OL4A 3MEQA 4Q3NA 5BNIA 2HAEA 1LRJA 3NKLA 2OP1A 1AXGA 3ASVA 3E1KA 4Q3EA 3WR5A 1GAEO 3SVTA 4K1LA 4LVUA 2V6BA 2NACA 1QLHA 2RIRA 2HQ1A 2SCUA 4DLAA 4RDHA 3ANLA 5KKAA 4TMFA 4AVYA 4WPGA 4RF5A 3OIGA 1DHTA 5L95A 1Y9EA 3GNQA 2CVQA 1UH5A 1B26A 1JAXA 4LMPA 4A7PA 1I10A 1PGJA 4RVFA 4E33A 2PV7A 4B7UA 1T2DA 2D4AA 3LLSA 3VOSA 2PY6A 1E7RA 4AJLA 3PJDA 4XX0A 3RC9A 4X54A 3PI7A 3RBZA 4NK5A 4FQ8A 4M87A 3WNQA 3AOEA 1F17A 3QSGA 4UVDA 1ZK4A 2QG4A 2NTNA 3HDJA 4P38A 3DZGA 3RU9A 4OXKA 1ADBA 5KOIA 1J4AA 1I2CA 1QV6A 4MP6A 4OKIA 3RROA 3WGQA 2AEFA 3D0OA 4JBGA 3NTRA 4CR7A 3ZU5A 5A9RA 4QFDA 5B4VA 3C7AA 1ZUD1 4RPLA 2B69A 2GYYA 4PLTA 4BNGA 3GG2A 1ZKMA 3JQAD 1HF3A 1D7OA 3DBVO 4FFRA 4R41A 3PHJA 2E48A 4E5YA 4YAJA 1N9GB 4YQZA 1PGOA 1PQWA 1LC3A 2GN9A 3BAZA 4LSMA 1YH3A 4YAEA 1MC5A 2I6TA 2PNFA 4IINA 4TQGA 1Y8QA 2EGHA 1U3TA 2HDHA 4YBZA 2WD7B 2X1HA 3VH3A 1Y8QB 3RKRA 1C0KA 1UDBA 2B83A 4CMGA 5HM8A 1RYDA 1YB1A 3A4VA 4H3VA 3WXBA 5KNLA 3H3JA 4AJ4A 1DPGA 3FNGA 3LLVA 3HSKA 4J4TA 4RQUA 3ZHBA 2Y1EA 1EE2A 2Q3EA 1RM5A 1WDMA 3PP8A 2HLPA 3GEGA 3F1KA 3ZH2A 1S7CA 4TRJA 4R1TA 1JLLA 3GMDA 4U6SA 1I01A 5DOZA 2ZYGA 1K5HA 3FR7A 5A9SA 1Y81A 4FBGA 4BNFA 3A1NA 4RPJA 3DAFA 2O7SA 5A9SB 4XYMA 4HFRA 3GGGA 4R3NA 4ZQFA 5JCXA 2I99A 2JL1A 2XF8A 3GFBA 4I5GA 5ER9A 3QW2A 3AJRA 2X0JA 3SJ7A 2GN6A 2GPTA 3BMQA 3CMCO 5COBA 3AFNA 2RH8A 3BMQB 3DONA 4PLCA 4RPKA 1H2HA 2DTXA 2V6GA 1YBAA 4URFA 4IDGA 3WGTA 1X0XA 4I5EA 1VSVA 4DYDA 3SEFA 1N1EA 4KWHA 1DIAA 5IJZA 2X0IA 1ADGA 1C0IA 4S1VA 1DLJA 4PG7A 1H9BA 1T2FA 3JQDA 3JQFA 3WGHA 2PKRA 3ZNPA 3QWHA 2PWZA 4RORA 3PHGA 4IMPA 5DZSA 1WNTA 5EERA 3UHAA 4OAQA 2UAGA 3HWRA 1GPJA 3DZJA 2WEKA 2EWMA 3BA1A 1Y8RA 3VH4A 2DT5A 2YFHA 1C3VA 3AM4A 3B20A 4NR0A 2BGLA 1PL6A 4Z0HO 3CZRA 3DBRB 3UFXA 4A03A 5ILGA 1TB4A 4EW6A 3F3SA 4ESOA 3ZWBA 2G1UA 4BNXA 1EUDA 1IHYA 2NM0A 5KJ6A 1HYHA 1H6DA 1GQYA 4MVJF 2DC1A 3GA0A 1KEUA 4J4HA 5C5IA 4ND2A 1EBUA 2RBEA 2Q2QA 4N5LA 2I5PO 3DZIA 5U9CA 1IULA 1NYTA 1P33A 4XRRA 1PS9A 4BO7A 5KJFA 3QVOA 1WDLA 1MLDA 3HB5X 3U4CA 3GUYA 4D0RA 4J7XA 5JAMA 1UAYA 3K6JA 3DTYA 5EMHA 4IDFA 1R0LA 4CV3A 1VRWA 4AICA 4D7AA 1ZNQO 1PL8A 1KVTA 2PD3A 1E7QA 3ON5A 3GVPA 5TC4A 1TLTA 4J4BA 1XLTA 2E49A 2GD1O 4MVJG 5JLAA 3DTTA 3AU8A 2Q4BA 3RJ5A 3JQBC 1FDUA 4LK3A 4PRLA 3ICPA 4R01A 1JKIA 1HE4A 4ZVVA 3IQDB 1ZIDA 3OA0A 5FEUA 1M2WA 3RFXA 1VJ0A 1MG0A 3PJEA 4WLVA 4CQMA 1YJ8A 3OICA 2PGLA 3P2YA 4MO2A 3VPSA 5THKA 4CQMB 3OM9A 1BRMA 2X0NA 4PG4A 5A03A 2EJVA 4RLHA 1ZBQA 3RKUA 4DYVA 5DBIA 4J2OA 5ER6A 4YT5A 1V9LA 2BI8A 4GVLA 4JQCA 3IJPA 3RJ9A 4FD3A 2ZIZA 1B0AA 4DVJA 4PVDA 4GL4A 3JD2A 5A5FA 1EFLA 4IJUA 5B4UA 4XYBA 4GMFA 4JJIA 3WQQA 4MIEA 1K89A 1T1RA 5L4SA 2AE1A 2Q1TA 5IF3A 2H1SA 1B16A 2WMDA 3RUHA 1DOHA 3TN7A 3OP4A 1VSUA 2VN8A 6LDHA 1EVZA 4D79A 3C1OA 1PGNA 1AUPA 4II3A 4ID9A 4FJ0A 3I4FA 4E2ZA 1NTOA 3AUTA 1EK6A 4RJTA 3IKVA 3ONFA 3ZWVA 5L7WA 1GU7A 4A10A 1ZSYA 1ZJZA 3G3EA 1DC4A 4L4XA 4HFMA 2JD0A 1A9ZA 3NT5A 3PWSA 1E3SA 1ULSA 3V5NA 3RD5A 3E6AA 3GNSA 3OQBA 5HTOA 1Q7GA 2X5OA 4JXKA 2R6JA 2IODA 2Y67A 3KXDA 4OH1A 4JCOA 2Z1MA 4G81A 4D41A 1CYDA 4Q3AA 4RGBA 4ZD6A 3I9JA 3GAZA 2PGDA 3NUGA 3STHA 3ZNNA 1XQ6A 4YT4A 5J23A 4OSOA 3KBOA 4UUNA 3NEPX 1SAYA 4D0SA 2C7VA 1R0KA 4ZJUA 1ISJA 2V6FA 3Q11A 3U4HA 1VM6A 3FPCA 2HMVA 4MDHA 2P2SA 3K2EA 3H9EO 1HYGA 3CE6A 3H5RA 4PG8A 2XAAA 5B12A 3PDJA 5ENVA 3NDRA 4KTVE 4P4NA 3P7MA 1CF2O 2DBQA 3G0OA 4QFCA 2QRJA 4BKOA 4XRGA 2VYVA 2Z5LA 3CKYA 3T7CA 3BMNA 3JTMA 3BMNB 4AJ2A 3K9QO 4JJFA 3FBTA 1JQBA 1SB8A 1XKQA 1R0SA 4WEQA 1U4OA 1GCUA 3BMOA 3PFFA 4DPLA 4OQYA 3LC7O 4IIVA 3BMOB 4HWKA 4MIYA 2VUUA 1U5CA 1SEVA 1NAIA 4YVFA 2BF7A 1ZK0A 3PGXA 4NQZA 3D4NA 4CM9A 4E32A 1I3LA 2JKVA 3GNTA 1TT5A 4YAGA 1H6BA 2P5UA 5CP8A 2B0JA 3AK4A 1BGVA 3TL2A 2GO1A 5JMWA 2HCTA 4GKBA 4AJHA 1IHXA 1NQTA 4ZICA 3NAQA 4NMHA 3UUWA 5K6AA 5EIOA 3S2FA 3AI3A 1MV8A 3C85A 3AUSA 4R1NA 4OXYA 3WGYA 3JYLA 4BV9A 4UUMA 3RWBA 1HXHA 1NWHA 3M2TA 3AY6A 5G0UA 3DMTA 1XGKA 2HKIA 3C7DB 3DC2A 1E3IA 3QIVA 2EIHA 3AUAA 3OJ0A 4NPCA 2NLOA 4DIOA 1DBVO 1KERA 3Q1LA 1OOEA 4DMLA 4NBRA 2Y93A 4D3DA 3L9XA 2C20A 4XDZA 4GMGA 5K9ZA 3EYWA 1YQDA 1D8AA 1SCUA 4PLWA 4UAGA 4UEOA 1ZEJA 2VCYA 4BGIA 2EXXA 3V2HA 1O8CA 1GZ6A 3ZV5A 1I3NA 3KSZO 3Q3CA 4QSMA 1V8BA 4BGVA 1HZJA 1YVEI 4CMEA 1EFKA 4R5HA 2GN4A 3R6DA 1WMAA 1K6XA 3I52A 3K31A 4H7PA 1U8XX 1HEUA 1DHRA 2UUOA 1DIBA 1HRDA 1T4DA 1E7SA 1MXFA 2ZTLA 4Q3BA 3WB9A 3UICA 4XGIA 1LX6A 3IIEA 1LXCA 2IDZA 4W82A 1U5AA 2ILTA 2ZK7A 1I3KA 1HDYA 2QYTA 1U3UA 3DZKA 1QYWA 2JHFA 2PK3A 3RUDA 4O59O 3FI9A 1E7MA 5JFOA 3Q0EA 2VRCA 3QLJA 4JK3A 3WIDA 3DO5A 1IE3A 4FGSA 4WLOA 1E6EA 1IZ0A 1R12A 2C29D 1RKXA 1GD1O 1SC6A 1LDBA 1B3RA 3W4KA 4Y8VA 4DQVA 4E12A 4DWVA 5CEEA 3VKVA 5T67A 1RM3A 2FY8A 1UXGA 3H65A 4GVXA 1NQAO 4L0QA 3WYEA 4AG3A 4CR8A 1GEEA 3RC1A 3HN7A 1ISFA 3L6OO 4DREA 3ADPA 3L6DA 2X8LA 4ZHSA 6ADHA 4TZTA 2PD6A 4J1TA 3H8VA 4UVEA 3CIFA 4GX0A 1X1TA 3X2FA 2UDPA 5ICSA 4N54A 2YJZA 3ST7A 3ORFA 4HY3A 2ZB7A 1EVJA 3S55A 4EITA 1BG6A 4QEDA 3VDQA 3OEYA 5F5NA 1YDEA 3ZHZA 1PWXA 4BNLA 3PHHA 1XU9A 2ZTVA 2GN8A 1MGOA 2QRLA 1SPXA 1BDMA 3GRPA 2VZ8A 1GQQA 2NU6A 2AXQA 3M1AA 3AM5A 4ITUA 4GLLA 2QZZA 3SJUA 1NPTO 2GR9A 3D4PA 1LSOA 4XR4A 5JDIA 3OF2A 3WFJA 3VPFA 4ND4A 1T2AA 4BNZA 3BXXA 1ONPA 4YRBA 3KOUA 3QP9A 4M49A 4C7JA 1QSGA 4IM7A 2VTDA 2PH5A 1Z7EA 1DLIA 2EHDA 3BYZA 3OA2A 2C2YA 3H9UA 3ONDA 2FSSA 5ITWA 5T8KA 3MJ4A 4MP8A 5B37A 5G0SA 1QRRA 1JTVA 3VZPA 4JBHA 4WCFC 4R16A 3H6KA 2WYWA 1NM5A 4GX5A 3FN4A 5TF4A 1LA2A 4HFJA 2WTBA 1KC3A 3M1LA 4IJVA 4O63O 4BO4A 5IDYA 2I3AA 3KEOA 4IJWA 4PZEA 4IDCA 4XCVA 5F1KA 3UCFA 3IUSA 3LYLA 1YB4A 3GEDA 2VNAA 1EDZA 3FSRA 4OYRA 3ZGYA 2BFMA 1DRWA 5F1OA 3I1JA 4IPTA 3DR3A 4FIZA 1C1DA 2NTJA 3E5MA 1C1DB 3VAZA 4NG5A 3C3XA 1U3VA 5G4KA 3RUCA 3UCXA 1NWCA 3L77A 5A3VA 2VOJA 3WQSB 3ZWMA 2UYYA 2ZB3A 3T4XA 2CDAA 2VRBA 4OO3A 1GPDG 1NBOA 3FNFA 4J16A 4DTIA 2J8ZA 4LCEA 4JJGA 5JAIA 3S1LA 2C2XA 1E3JA 3JQAA 3DZBA 2NQTA 3F1LA 4EJ0A 2DFVA 3JQAB 4WUVA 3JYOA 4MVJE 8LDHA 1SEPA 2QX7A 3FWNA 4G5HA 4R1UA 5CPFA 3Q9UA 2JFHA 3EZLA 3RQSA 5I7VA 1CIVA 1JVSA 1TT7A 3CPSA 1XELA 1OBFO 1BTOA 3OQ1A 4LCJA 4CM4B 4E4YA 1SBYA 5LC1A 3ZWPA 3DMYA 3ZWAA 4A2CA 4IDDA 4XQ9A 1Z74A 5KVVA 2CF5A 4D44A 2X9GA 1V6AA 4DBZA 1TVEA 1P1JA 2PZLA 5IXSA 3L0DA 3ROPA 2Q4EA 5L40A 1NPYA 5DN9A 1PEDA 2C07A 2ZB4A 1UXKA 3GMSA 5DF1A 4BNMA 2VWPA 3AU9A 4PGFA 4CM7A 1MA0A 4OGWA 3OSUA 4MKRA 4CQLA 2HMTA 4CQLB 3JYNA 4R1SA 2Y68A 4KDFA 4ZA2A 4E21A 3QVSA 5L7TA 3BMCA 3OECA 4DC1A 3WYCA 2DUWA 1T4BA 1HETA 3BMCB 3B1FA 4YWJA 3GPDG 4NHEA 4TVOA 1HDRA 1IZ9A 1LSSA 3WIEA 4HFNA 3TSCA 1VL6A 2VHVA 4RF3A 1GUZA 1QR6A 3GZNA 5AXDA 1EK5A 1P1FA 2Y0DA 3GZNB 4RPHA 2FWMX 5AYVA 1SMKA 1ZEMA 4NNJA 1PJCA 4MJLA 3PYMA 4KP7A 1NAHA 1B2LA 1ZCJA 4NK4A 3WYBA 2D3TA 3PDUA 4XD2A 3ZDFA 3I6IA 5G0VA 1T24A 4F45A 2RHCA 1QKIA 2Q49A 1P3DA 2O2SA 3L4BA 2EV9A 2YW9A 2H5LA 1RWBA 2GUGA 2YHIA 3DZHA 3LQFA 1K6JA 5H81A 3B1JA 1B14A 1XDWA 1XQ1A 5KVQA 3UVEA 1E3WA 2YHIB 2VHXA 1E3WB 2AQHA 2OO5A 3HFGA 1BSVA 3R1IA 1LU9A 1YWGO 5JC1A 2Y05A 2V7PA 2D0IA 4OQZA 5AXAA 1E1MA 5LDGA 2BI7A 4Z3KA 1ZVMA 2FHSA 1ZMOA 3ADOA 1OI7A 5IZCA 1AN9A 2YDYA 4KUGA 3PQFA 1TXGA 1LEHA 1I2BA 1GYQA 1PJTA 3GGPA 1CRWG 1Z82A 3BTOA 3LSYA 1UZLA 4FFOA 4J90A 4BO0A 3SLGA 1KY4A 1P9LA 3SC6A 1YQGA 2EERA 4YPOA 5ITVA 2PZJA 4UVHA 1RM4A 5TJ9A 4PLYA 4U7WA 1NPDA 1AE1A 4BNYA 3JCZA 2A94A 2DFDA 2JD2A 3ETDA 1MG5A 1JKFA 2VT3A 2Y0CA 2FR0A 4B79A 4WNIA 5FI5A 5COQA 1YKFA 1XSEA 4F6CA 4YYZA 1JAYA 2AW5A 2NVWA 4TRRA 2YV2A 2WD8A 3GLQA 2GASA 3HG7A 4J1NA 4OIMA 3RC7A 3KYDA 3GQVA 4BIIA 2X5JO 4XIYA 3KLPX 1E92A 3MZ0A 1BVRA 1SZJG 3I83A 2BGKA 4NU6A 1ADFA 3DHEA 3W8DA 3B1KA 1LI4A 1IPEA 2BHLA 3IP1A 5CDTA 3H5NA 1NX6A 2G82A 3ZU4A 1JA9A 2NU7A 1HE5A 4TRNA 2VWQA 3DEYX 1PJ2A 2ZQZA 1GR0A 4E5NA 1J5PA 2FZEA 3KYCA 5GZ1A 1YE3A 2RCYA 5KKCA 1YBVA 3KYCB 4E31A 1HDOA 2EP7A 3IMFA 3VC7A 5KJ1A 2H6EA 3DHYA 5EPOA 4M86A 4QO7A 4ZRMA 2EJWA 4HADA 4Y6PA 4OOFA 1KVRA 1XA0A 4L75A 4FS3A 5U1PA 3ZU2A 2ZKLA 1ZK3A 1PIWA 3C1AA 4I8XA 4L74A 4RVSA 4DUPA 1KEVA 3GEMA 3R3SA 2FR8A 5KTKA 4IGFA 1IL0A 1MFZA 4MKZA 4DL9A 4IJKA 4R5MA 3R3JA 2C54A 4DLLA 5K0ZA 1OAAA 4PN3A 2ZB8A 4AJNA 1RJWA 1GEGA 1YL5A 4Q9NA 4CPDA 1NFQA 2AEJA 4UUOA 4NDNE 1X0VA 4PLPA 3H9GA 4CUZA 2R00A 3FWZA 3ZWCA 3V2UA 3TNLA 3TFQA 3D64A 3W6UA 3ZHXA 4NH4A 2X5KO 5EN4A 1DRUA 1XEAA 3GHYA 4J9UE 5CEFA 3MJTA 4WK6A 1GUYA 3BHMA 2QYSA 1N7HA 4RF4A 5DDIP 3VKUA 1Y7TA 2PKQO 5CEJA 3K2BA 3WTCA 3U0BA 4HV4A 3CZMA 1RYEA 5L7YA 3PYLA 3W4JA 1UDAA 4LSWA 3RC2A 1I0ZA 1R4MA 3UXYA 1T2CA 1Y8RB 1PSDA 1R4MB 1YL7A 1BVUA 1KEPA 1LUAA 5DCYA 5CDSA 2CF6A 3F9IA 4PG6A 3BTUA 5H83A 2CD9A 3U4DA 1S6YA 4CUJA 5JAZA 2E37A 2DKNA 2FRDA 1UP4A 1H93A 4OJNA 5I7FA 2HRZA 1PJ3A 5L45A 3H9QA 2BGMA 4OM8A 1A9YA 5TIIA 3TZCA 4R69A 2BH9A 3PQEA 3AWDA 4NFSA 2JFFA 2X6TA 1XIVA 1GDHA 3TDKA 1Y5RA 2VOEA 4FDAA 5A5EA 5F5LA 3O03A 5TLSA 1GADO 4Y6RA 4DPKA 5A02A 1FF9A 3HUDA 3O26A 4U0KA 3JQ9A 1VI2A 4I08A 4B4UA 4II2A 1GQ2A 1I2ZA 4GSLA 4YJGA 4DQUA 4M89A 2RH4A 4HP8A 4YJGB 3EUWA 3FNHA 1YBMA 3I23A 1LDMA 1E6UA 5JW6A 2P9CA 3UGKA 1UR5A 1FDVA 3EVTA 2OMEA 3O4RA 2V6MA 2FOIA 2B35A 2AQIA 4L76A 1HDZA 2QQ5A 5JSFA 3D3EA 1FMCA 1TA4A 4B3JA 4ONEA 4PG5A 3QA9A 3FTNA 3VVCA 3FHLA 5JCJA 4R9RA 3WLEA 1VKOA 1E3EA 2IYPA 2FP4A 3TZQA 1IUKA 3BHIA 3N74A 4OXNA 4B7XA 3IJRA 4PFJA 4JP2A 3RUAA 3DBLA 5EJ2A 4EBFA 4A27A 1Z45A 3DBLB 3EC7A 1VJTA 2BLLA 1E3LA 1ULUA 3SC4A 4PRKA 2QHXA 5CPBA 5DCWA 4BNUA 3EK2A 1EQ2A 4B4OA 4W6ZA 3NJ4A 2Y1DA 3Q9NA 2ZJ0A 3IDSA 2VHYA 4IZIA 2QIOA 4QUKA 3A9WA 3QHAA 2Y0EA 4P22A 4KDEA 3DBHA 3WMWA 2CY0A 3DBHB 4PZDA 1B3BA 2EEZA 5C37A 1ID1A 1KOLA 3CSDA 5G0WA 4CMCA 4XIJA 4E2XA 2PTGA 2ZYDA 3I9MA 2B4RO 1ONNA 1UXHA 4XKJA 3RUIA 1LC0A 3A06A 4JGBA 5CAEA 4O0LA 3OBBA 4K6CA 2BD0A 3ZWWA 1A7KA 2NU9A 4IXTA 4JNKA 4CV1A 4YTEA 2X9VA 1YL6A 5TT0A 1U2DA 5IZ4A 5JBIA 1P0FA 1QYXA 2E82A 2OFPA 1U7HA 1X7GA 1GZ3A 3ASUA 3QV1A 2B5WA 4CLOA 3LVFO 4B7CA 4CLOB 1CQJA 1UXJA 3BTSA 3G79A 5HRUA 2PLAA 5I8WA 2AQKA 3GDFA 1HDXA 1H6CA 2F1KA 4RF2A 4GPD1 3DFZA 3JD4A 4PCVA 1W0CA 2YY7A 4BB5A 5L53A 2D59A 3F4LA 2CZCA 4KUEA 1AXEA 2FPIA 1E7WA 5AXCA 3RFVA 1WWKA 3PXXA 1DIGA 4L73A 5L51A 3JQEA 5A4DA 1T2EA 4QECA 4XGKA 3AW9A 1Z75A 3PZRA 1H5QA 4CMJA 3Q2KA 2RHRA 4ZGWA 3JV7A 1P0CA 1N1GA 1R4NA 1I8TA 2ZYAA 4ZQEA 3VVBA 1VL0A 4E6PA 4J7CA 3U3XA 1R4NB 1FDWA 1E1LA 1P44A 1NASA 1OMOA 3PTZA 4JP3A 3P19A 3IL2A 4XYEA 3KRTA 5JE8A 3OJLA 1QORA 5F21A 3QRWA 2W2LD 3PK0A 3B6ZA 4P4GA 4BMNA 4E30A 4KQWA 4XB2A 5T57A 3ETGA 3W4IA 3L4BC 2BELA 1TT5B 1YDWA 3MJVA 2OBYA 3VPGA 4KQXA 4L4RA 4PLZA 1OFGA 2YDXA 5DP2A 2PFGA 3K30A 3A28A 4W9NC 2JAHA 2DU8A 2HUNA 1O95A 2HU2A 4AJOA 2NU8A 3ZN2A 2UVDA 2P68A 2NVUA 3EDMA 2HO5A 4CL3A 3GHHA 4IDEA 2NVUB 2OZPA 4ZN6A 4J91A 4LW8A 1Z7BA 2NADA 1VC2A 2QRKA 3RAJA 1MX3A 3ROKA 2PGJA 1DEHA 1PJLA 1LLDA 3I9OA 4O6VA 3PIIA 1O9BA 3VTFA 1WVGA 3K96A 5CG2A 1LTHR 3FRJA 3VH1A 4YACA 5DBGA 1Y9AA 3RUEA 4DIBA 5HBRA 4R51A 1Y5MA 3EHEA 4CUKA 1EZ4A 3GVIA 1R15A 4TRMA 5HS6A 4XQCA 4BUCA 3E18A 3AOEC 1GTMA 1T26A 3G1UA 3AI1A 4NI5A 1B8PA 1GV0A 4A73A 1O89A 5HA5A 1QP8A 4LVCA 4GH5A 3FNEA 4FFLA 4UEKA 4ZQBA 1ZW1A 3OJEA 5BT9A 2O48X 1LLUA 1F14A 3NGXA 4DMMA 3WICA 3INTA 1WPQA 4I5FA 5EINA 4GQAA 1XHLA 5CHEA 3QVTA 1PZGA 3WG9A 1LQTA 1NP3A 2GERA 4NBVA 1DDOA 4J2HA 1OC4A 5JO0A 3E9QA 3FTPA 4OKNA 5FYDA 4E0BA 1ISMA 4JX8A 3FCOA 1W4ZA 2A92A 4FSHA 2GLXA 3QWIA 4HNGA 1P74A 3Q2IA 2YV3A 3UH1A 3BZUA 3RCBA 1HT0A 2OHXA 4LRTB 4YRAA 4MVJD 2GZ3A 4NBUA 5AQ1A 3QJ5A 1UZMA 3G17A 2VUTA 3GRKA 3HZZA 4HXYA 4U6QA 1DXYA 3L9WA 4N5MA 5IN4A 1ZXLA 3QWFA 3TFOA 2PH3A 5JNLA 1F06A 4FW8A 1M6WA 1R6DA 1CDOA 3MWEB 3ONEA 3VH2A 1Q7CA 2J6IA 2E6UX 2O3QA 4IXWA 5C7OO 1SB9A 1U1IA 1X1EA 3KEQA 2GCGA 4E5PA 5IXYA 4IS3A 5BSHA 1C0LA 4XZ3A 4LMRA 1LDEA 1D4FA 1U7TA 1ONOA 1HKUA 3L4SO 3JQGA 1GFSA 3JQGB 3LF1A 4BKQA 2Q1UA 1B8UA 1MXHA 2Q45A 1KEWA 1FDSA 3GVCA 4YJDA 1IPFA 3BHJA 2XPCA 3CMMA 3KSDO 4YB8A 2CFCA 2IZ1A 3ITKA 5F3RA 4BKUA 4U8GA 1QMGA 3HN2A 1QXSA 4EYEA 2IXAA 1PS8A 5MGBA 2CDCA 4DGSA 2OUIA 3GR6A 3JQFC 4CV2A 2X4GA 2WYUA 4G2NA 1Z6ZA 4JLWA 4PLVA 3E48A 2GZ1A 1LLQA 1V3VA 1PJBA 4YJFA 2JHGA 4YJFB 2BMAA 1R66A 4NIMA 3OJFA 2NTVA 2TMGA 1UUFA 2VYVD 1UXIA 5FWNA 4NBWA 4BNTA 2E4AA 3EMKA 5JYDA 1VJ1A 2F00A 3MCVA 3PHIA 3DFUA 4CMHA 2VWHA 2Q46A 2I65A 4ZRNA 4CV0A 4CLEA 2IEBA 2D8AA 5TNXA 4J43A 4D43A 3HFSA 1DFGA 4D42A 3QE3A 4CLRA 4UVGA 3FD8A 5TS3A 4CLRB 3JQBA 3TPCA 3CUKA 1ARZA 2I66A 3NJ8A 2FR1A 2BKAA 4RVUA 4DXHA 1BXGA 2HMUA 1A4UA 5ES3A 3OIFA 1BXGB 3MJEA 3WMXA 1N8KA 5A1TA 5TQVA 1M76A 5KJCA 5ILOA 3OH8A 4XGNA 1EBFA 4IUYA 5G4KB 3T7EA 3GVHA 2WYVA 3QY9A 5DBFA 1LJ8A 3KM0A 3WJ7A 5A04A 1N5DA 3TZ6A 5DT9A 5G0TA 1XWFA 5EQDA 1LRKA 4ND1A 1ML3A 1GYPA 5EQFA 2ZCUA 1K2WA 2J5QA 3RBVA 3JD3A 2VYND 3VZRA 3IAHA 1EUZA 4PLHA 3W8EA 4M1QA 4W4TA 2Q1WA 1G6KA 1YO6A 2NUAA 3D4OA 4WE3A 3F46A 1PJ4A 1LNQA 1GYRA 2PD4A 1E6WA 4F6LA 5KVSA 3PGJA 4R9SA 4MINA 3I9NA 4AJ1A 1NFFA 3X2EA 1X7DA 1H94A 3TL3A 3W8FA 1NQOA 2OORA 4ALIA 1KBZA 3F5QA 4BNIA 4EUEA 4MP3A 4UUPA 1AHHA 4NJMA 1M66A 2B36A 3LC2O 4BQRA 1A4IA 4NJMB 3VPHA 3PFWO 2PA3A 1X14A 3E8XA 2FPGA 4C4OA 4PIVA 4BNHA 3IKTA 2DBVO 4IDAA 3GY0A 3BIOA 3D7LA 4TROA 3E9MA 3EAGA 1JWBB 2VZ9A 4Y9DA 5JDCA 1FXSA 4BGEA 4BO8A 3D3WA 3TZHA 1Q7BA 3D3WB 2O3UA 4TSKA 1D1TA 3W1VA 1WZIA 3D1LA 4NFYA 1TEHA 4XB1A 1M6HA 4M54A 1HDGO 1IY8A 2J3HA 4MPDA 3DAGA 3KO8A 1LRLA 4K26A 3TF5A 4P8RA 3TQHA 3WSWA 4HNHA 4GKVA 3HQ4O 4PLFA 1M75A 2EF1A 2Y1FA 1LQUA 5T6BA 1ISIA 1J0XO 3HHPA 4QT0A 4EEZA 3INGA 3WDSA 5C7IO 4ND3A 4UULA 3UOGA 5ICMA 4R54A 2VUSA 1CERA 1O94A 4WOKA 1EVIA 5BNTA 3JYPA 2DPHA 3HDQA 4FC6A 4FJ1A 4BS9A 1ZMTA 2X9NA 2G5CA 2GSDA 1BXZA 1JKJA 3S2GA 1NVGA 1O5IA 4WLEA 3CH6A 5IAAA 1KC1A 3E82A 3I9KA 3E03A 1H0KA 4IZHA 5BNFA 5TT1A 5IG2A 3MTGA 1DIRA 3MOIA 2GRAA 4N18A 4AFNA 1HE3A 4FC7A 1KS9A 3WTBA 4ZU3A 4IQGA 2GF2A 1QYCA 3KZVA 1XR3A 1PQPA 5A3JA 1EDOA 3H2ZA 3ZI0A 3DQPA 3GVXA 3DHNA 4WASA 3ROMA 2HK9A 3GFGA 3GPIA 2EP5A 3MJSA 2VT2A 5JPIA 3WJAA 4EGFA 7MDHA 3WNVA 1P1KA 5BSGA 1DIHA 4J1QA 4DBVO 1C1XA 4FPXA 3V8BA 2QW8A 4Z9FA 4Z9YA 1P1IA 4GAEA 1C1XB 2DAPA 3WBFA 1H6AA 3B70A 3F6YA 1I36A 4LGVA 1PGPA 4Z0TA 3BTVA 3SBOA 3HDHA 3OFSA 2CSUA 2PR2A 4R3WA 2YV1A 3F4BA 1TI7A 3WQRA 1N2SA 2X22A 2IE0A 1UAGA 4ILKA 4WCDA 1PWZA 3DL2A 3I4CA 2NVBA 1DAPA 3GUCA 3KYDB 4I1IA 4E5MA 2QZ9A 1OZAA 5K6AC 4S3MA 1DO8A 1PR9A 1YS4A 1ORRA 3M2PA 4CL8A 4XDYA 1QYVA 1U2GA 4XQEA 2BFOA 2DTDA 1CQIA 2Q1SA 3U4IA 1W8DA 4GGOA 3AY7A 3WLFA 4CM5A 1PZEA 1UZNA 3DMTC 5B4TA 2C0CA 2C82A 2O3SA 4Z9XA 1NR7A 1SO8A 3AI2A 4CLDA 3I9LA 4UVIA 2J3IA 2Z95A 4RLSA 3ZNQA 1WW8A 3LT0A 2V65A 4KOAA 2VZ0A 1BWSA 4WEOA 1X7HA 4KUHA 4RVDA 1BHSA 1G0OA 2DM6A 1PTJA 2O3RA 4YR9A 4UEJA 1NVTA 1WP4A 4J0FA 2Z1NA 1DC5A 2Q2WA 3F5SA 2ZATA 4D3SA 3GC6A 1PL7A 3A14A 3OEWA 2DUUA 2WJPA 2C5EA 1O0SA 5DCUA 3ENNA 4CMEC 4EJMA 1N9GA 4LISA 1X15A 1NQ5A 8ADHA 4LN1A 4YEDA 5EL0A 1DFIA 3VZQA 1R37A 3ITDA 4OMUA 1LDYA 2P9EA 2WD7A 1N92A 3GOHA 5L3ZA 3LC1O 2JAPA 1Q0LA 1E5LA 1LBEA 1CJCA 3H2SA 2OXIA 2WE8A 4QQRA 3HADA 2IXBA 4E2WA 1JWAB 4XQGA 3AM3A 5T5QA 9LDBA 2YHUA 1P77A 3AFMA 3H5AA 1Q1NA 5BQFA 2I76A 3U9LA 3ROQA 3WFIA 4H15A 5IFLA 2R2GA 1WAMA 5I9LA 3U09A 2I67A 1BW9A 2EKLA 2X58A 5IN5A 1GY8A 4BMVA 3PWKA 2GZ2A 4JBIA 1BW9B 1K0UA 4BNNA 3KTDA 4O5OA 4BO3A 1PX0A 1DJNA 4NZ9A 4YAKA 2DLDA 1PU2A 2VNSA 3UN1A 3K73O 1YB5A 1PS0A 4Y98A 3UAGA 1MUUA 3GG9A 2BFAA 4BMSA 2EKQA 1C0PA 4A5OA 2D5AA 1QV7A 3ICCA 1LSJA 5KVCA 1KYQA 3OIDA 3PLRA 4XA8A 4YDRA 4GWKA 3UF0A 1HLPA 3HJAA 1NFRA 1PJSA 3COSA 5HWSA 2HK7A 4Y67A 1E1KA 3PEFA 4IIUA 3NDJA 1Y6JA 3UW3A 1QYDA 1E5QA 3JD0A 2JCXA 4GBJA 1WMBA 3OQ6A 2P4HX 2WE7A 1IB6A 4YA6A 5C7LO 1I32A 5T64A 1FK8A 5DULA 5C3MA 4XEHA 4C7KA 2GDZA 3VDRA 2O3TA 1U3WA 2W90A 3RUFA 3WWYA 3CTMA 3LF2A 5KCZA 3KB6A 1SOVA 2HK8A 3FR8A 4DC0A 1KIFA 1A27A 3TRIA 1UP7A 2VWGA 3WX0A 3EW7A 4E2YA 3PZBA 2Y1GA 3IP3A 5AVOA 4E13A 4NBTA 3DAPA 3WGIA 4FFMA 4L8VA 4U0JA 1BMDA 2O2YA 1GCOA 1H2BA 3D5QA 2W2LA 4EJ6A 5IDXA 1J49A 4I9HA 4WCFA 1Q2XA 1YRLA 1DFHA 4G65A 4WLNA 4WLUA 3DBRA 4WCFB 1V0JA 2OBNA 2B5VA 2DQ4A 3RSHA 4EEXA 2UUPA 3ZNOA 4ALMA 2HSDA 1ENZA 4BO6A 4BO9A 5JDIC 1U8FO 3HDYA 2CDBA 1ZSNA 1I30A 1DRVA 1UP6A 3QWAA 4BHTA 7ADHA 3V2GA 3ZV4A 4FFNA 4IQ8A 3RU7A 4WGGA 1J6UA 4AJEA 4IBOA 1Q0HA 4Q3CA 5T8KC 1AGNA 2JD1A 2NSDA 1YGYA 3JD1A 5BR7A 3PRJA 5JY1A 1F8FA 1HE2A 1EQUA 1JVBA 3K5PA 4JROA 3SLKA 3ZHYA 4YCAA 4ZQHA 2JCYA 4Q39A 4TKMA 4CM1A 2AA3A 2AG5A 4RDIA 1ISGA 2AE2A 4D46A 4CM3A 4OOEA 1N7GA 1PR3A 2C5AA 2A35A 4GGPA 1I3MA 3U5TA 2PZMA 1K6IA 3IC5A 4OL9A 4RZIA 4RVGA 5A05A 5A9TA 2YQ5A 5TJHA 1E0DA 3GT0A 4IDBA 1YOVA 1CWUA 3H3FA 3WWZA 4FN4A 1YOVB 1U28A 2EKPA 1C14A 3P5SA 4A26A 5L4LA 4GSKA 3JSAA 3NTQA 5IDQA 2BRUA 1HWYA 4F3YA 4U5QA 4IMRA 2CMDA 3ENKA 2YYYA 2B37A 3NTOA 4RPGA 5JO9A 1EMDA 3KVOA 3EY4A 4WNCA 4J9VA 1EEHA 1MFPA 4M8SA 4BKRA 3DZFA 5JYEA 1I33A 3QWBA 3RI3A 1A71A 3PLNA 4DA9A 1L1FA 3O38A 9LDTA 2VHWA 2YUTA 3PVZA 5FF9A 2G0TA 2TMDA 3VHRA 4MVJI 2IEDA 5TGDA 2X86A 4Q3DA 3ZW9A 4CM8A 4MVJA 3FPLA 4MIOA 4QX6A 4CM8B 5I9NA 1YXMA 2C59A 1VL8A 3NV9A 4WLFA 4HX5A 1Q0QA 2HMWA 4D3FA 1D1SA 4RL6A 3S2IA 4EDFA 1CEQA 1HL3A 3O9ZA 3V1TC 3KUXA 2WM3A 4NU5A 1NHWA 1HLDA 2G17A 2A9FA 3JQCA 3LT1A 3C7CB 2ZQYA 3PWZA 5GY7A 3NYWA 1LDGA 3ZCXA 5KJEA 4BV8A 2HJSA 4YAIA 5F1PA 2ZJ1A 4L4SA 2Q2VA 3LK7A 3INRA 3AUUA 4TWRA 2HRBA 2YZ7A 3HE3A 5JDCC 2B4QA 1KVSA 2DBRA 4W99A 3ZWOA 3E5RA 3M6IA 3CEAA 2RAFA 3ZV6A 1ZO8A 3DWFA 2NQ8A 2ZTUA 3PHLA 2J3KA 2PZKA 3JQ7A 4J7UA 5TX7A 2ZCVA 5TRTA 4AJIA 3JQ7B 4XYLA 5DOVA 2JFGA 4MVJH 4HUJA 5L4NA 3H4VA 3LT4A 1KY5A 1HSOA 1ENOA 4IY1A 2DPGA 1VE9A 1BDBA 2HJRA 2EW2A 1E1NA 2YQ4A 4OHUA 5FFFA 2HMSA 4EUHA 3FBGA 4N5NA 1I24A 1DC6A 1I5RA 4J1SA 4O1MA 3TOZA 4KTTE 3ZV3A 4CLHA 3PJGA 2XXBA 2XOXA 3PYXA 3VZSA 2FN7A 3VPXA 4QXMA 1JU9A 4WKGA 2O50A 3LT2A 1G1AA 4CMAA 2ZTMA 4LRSB 4E3ZA 1ENPA 3GF4A 4I9UA 3MWDB 3MTJA 5IZCC 1MC4A 2OOSA 2Q50A 4OSPA 1X13A 5G2OA 4I5DA 1JW9B 3GDGA 4XWYA 5I8ZA 3V1YA 4EI2A 4FCCA 1T1SA 5H82A 4I9NA 3NT2A
chains in the Genus database with same CATH superfamily
1OC2A 1SUIA 1XQYA 2Q5OA 1JECA 4QIHA 4YONB 2PWBA 2XUPA 1S3IA 3U39A 3Q7QA 3WP0A 5HR5A 1R9GA 1B6SA 2C2OA 2Z4TA 5C18A 4HLUC 5JC8A 1N5IA 4JWKA 4RM3A 2OGWA 3LU1A 1DJQA 1YOBA 3GWZA 3V8RA 4IDUA 1W35A 1Y5IA 4IIJB 5D5PA 3TJMA 4MK4A 3IFSA 1CEEA 1WKVA 5C52B 4FB5A 1TMYA 1RKVA 2D5BA 3DEZA 3DEFA 3HJTA 5DGHA 3OAAD 3PDIB 4MVJP 3IDQA 3IT0A 4Q19A 4RBNA 1Y89A 2YIJA 3GFFA 4IW3B 1IQPA 3VXKA 5EVCA 1T2NA 3EF1A 1T9DA 5GZ6A 1KBOA 1Z17A 2IPNA 3DE7X 3F6PA 4L8YA 4QUBA 4UTZA 4Y9TA 2O23A 3C43A 1E77A 2DBZA 5FLKA 2UV8A 3JZFA 5TEWA 3RK1A 1Z18A 2BFPA 2CJXA 2FFQA 5CDUA 1OWNA 4MKXA 4KIUA 3GGJA 3KETA 4KZPA 3KSUA 1QTNA 4PYOA 3I6QA 1DUIA 1LVUA 4G85A 3Q3GE 2XWSA 3DZ8A 3EXIA 4V03A 1K7CA 1ZN7A 1XCBA 2W37A 3K53A 4U2DA 1XLUA 3EPHA 3U3MA 2Y99A 2H9YA 1UKAA 2J0VA 1W5SA 2ACEA 3G1TA 3ESDA 4LYGA 1FP4B 1PQUA 2R5FA 4DS3A 3PNYA 3V1MA 1U4SA 3AOGA 3U40A 3RW9A 1TQ6A 3K0FA 1W4BA 2BMFA 2JIZD 4BYMA 3O9VA 2QE7D 3K9WA 3UJ7A 3NM5A 4IQ0A 4JI5B 4D6YA 1CLUA 1BQ3A 2ERXA 2CWWA 2A5LA 3C98A 2I2WA 3H9JA 3MOGA 4O2AA 5HF6A 4EDHA 1GU1A 1BZYA 5A5DA 4X6YA 3T3NA 1X6VA 4M46A 4B74A 1SGWA 4NONA 1AU9A 1NNUA 4JL8A 2PWAA 1GL9B 3N2ZB 1O6ZA 1MRNA 3ZWYA 5CA1B 1GUFA 1AN0A 4TMXA 5AKLA 2ZBVA 1T8PA 1CYEA 1NXXA 2FR8C 3P2KA 4TT3D 4CLXA 3IOYA 4D3ZA 4D99A 2Q7XA 1IIRA 1G4HA 3H8WA 1C30A 4R1QA 3GAFA 2NP7A 1ODJA 1U0NA 2YFQA 1YJXA 3KPWA 4HMQA 3K9LA 1FJHA 3IMCA 3ZE0B 2E5FA 1I6MA 3DCIA 1JHVA 4Y2UA 4QBHA 5JVDB 4QOHA 1SD5A 3FZEA 1Z4JA 2X6RA 4WOBA 5LZ5A 2OCIA 2J3JA 3M6MD 2BEUB 2CC2A 3L0OA 3TZKA 4RD2A 2QJWA 3LKVA 2R6FA 2R00C 6PFKA 4U2KA 2CMKA 2XUKA 3R8XA 1SU4A 4JOCA 4NABA 2XQIA 2H57A 1WZ2A 4GPEA 1FS6A 2MIIA 2QMUA 3DOCA 4P7JA 4JC5A 4DV6B 2A5YB 2LGJA 3RIEA 1G5PA 2EWVA 3QNUA 3TNYA 1N2ZA 2M1ZA 1OYOA 4G23A 5SYNA 4CETA 2WSSA 3KZOA 5AJTA 4B82A 4NBNA 1OJ7A 2V55B 4MS3A 3PXBA 5AHRA 1P62B 4O2LA 3VTZA 3HJHA 3V8QA 1F4PA 4YECA 2CHFA 1TJPB 3GLRA 5JXIA 3NR2A 4F2WA 1H1LB 3NWBA 5TMPA 1YONA 3RNLA 5I4IA 3FB1A 4LKRA 1W5TA 1KSGA 4JIGA 4L72A 2OPBA 3N2KB 2W9XA 2FZWA 3BM5A 2W2VA 3JWJA 4CF7A 2VK8A 3L49A 2GB4A 4YRFA 3ZQJA 2WPDA 1TK3A 3ILXA 3B7PA 2BYTA 1QQ6A 1WCWA 2V7QA 2IBTA 1NXQA 4TSFA 2IUFA 1C2TA 4X64B 2QWXA 1HT3A 5CGQB 1ECFA 4J49A 3IUPA 3CWZA 1AMNA 4V0LA 4ICIA 1A3CA 1B15A 2ZJOA 2GNAA 3LQ4A 4V0SA 1B8VA 1G5QA 4EEKA 1KI2A 5HS4A 5JARA 4HLDA 1E94E 2NPFA 4N5IX 2VHUA 3F8SA 2NPIA 3CEMA 5JS8A 3WGZA 4EPTA 2P35A 3C8DA 4PYIA 1FIUA 1XT6A 4H16A 3O0TA 1P31A 2GHRA 2NV6A 3DT8A 4GPTA 2DKOA 2V7WA 3QXCA 2AEMA 1K97A 1LGYA 1REQA 4FEAA 4KV7A 4IICA 3EXEB 1H23A 4XJVA 4XDHA 5H9VA 3SFZA 4FCVA 2WQZA 3S6JA 3O8QB 1PVDA 1ESZA 2JC3A 2K2WA 1WMDA 2A0KA 4XYGA 3JQ9C 1Q1QA 1ZJWA 4AL4A 3GJXC 4LY0A 2PKQP 4TXHA 1CNEA 4J3FA 3TGPA 1UZUA 1QS0B 3QKRA 2WB2A 4ZCSA 5AJHA 3DV9A 4F5EA 1WETA 2X23A 3LY5A 1C4WA 1V3UA 2HI0A 2POQX 2QI9F 2Z09A 2ZZKA 3BB3A 3KV3O 4BFWA 3HBMA 1XU7A 1SUFA 3PJRA 2A5GA 2RAPA 3QFHA 2AC2A 4BE7B 3RJMA 4BKPA 1ZK1A 4K9DA 1UMCB 2D1YA 1A72A 1T0BA 3LFHA 2BZSA 5BYBA 3P94A 1NDQA 1V5IA 2IZ5A 2Q5CA 4WN9B 2QJTA 4FQ7A 2OCAA 3T52A 5KI6A 5K4HA 3JPYA 1M33A 1JDJA 2D06A 1PFQA 4CF5A 3NUQA 4OYHA 1BXKA 1JZTA 1OH5A 4WFIA 4S0ZA 3BJIC 3QH4A 3SSOA 1JFTA 2DR0A 1L7MA 3GUHA 1CR4A 2FEXA 1LZKA 4TV8B 1R0CA 1XZQA 4BBPA 5F7OA 3LZ6A 2Z6QA 3FYSA 3EZYA 2FPRA 1MGPA 1HBJA 4B2LA 3G6KA 4P83A 4CM4A 4YJHA 3EQ7A 4MH0R 3ZHUA 8ATCA 2ZTHA 5FUYA 1JHOA 5DLEA 4FZVA 2BE7A 2W2KA 1W4LA 3B1WA 4CCYA 3UUGA 1MX9A 2NZVG 4K6FA 1N5MA 2BP7B 2GJ8A 1QG6A 1J9GA 1W2HA 1UBHS 1WV1A 1EP1B 3AXSA 4MARA 2E4VA 5LDHA 3MIZA 5ARBA 3EB9A 4UTXA 3TINA 1VLLA 1U2QA 4WOJA 2BBTA 3V1UA 1OJLA 1BS2A 4ALNA 1RM0A 3EBPA 1USVA 3KB8A 4WJKB 4HWTA 3R0XA 3AEKB 5CLJA 3TS1A 2FYTA 1JYSA 4Y1FA 4ALJA 1X7WB 3MCWA 4ZEOA 4IRMA 3JYQA 1D2HA 3TDMA 3RH0A 1RQXA 3OP1A 5B53A 1YU9A 4EG6A 1YTUA 1XX6A 8ABPA 1CVLA 4N47A 3KHKA 3P2OA 2QRHA 1KMCA 5GONF 4QVGA 5I9TA 2YCBA 3SIPA 4PLGA 3OHSX 4Q4AB 5L9AA 2WU0A 1M6EX 4ZK6A 4RETA 1ZM4A 5K01A 2BKEA 5AVTA 2PCJA 3PXCX 4G5SA 4MVJM 2RGDA 3Q1KA 3NM6B 1T8UA 1FEZA 3QBEA 4GBMA 4PEVA 3HTXA 2WU8A 1O54A 3KYBA 3ROXA 3UT0A 5EWJB 1BIFA 1YZTA 4QDKA 5KCMA 1Z2NX 2ZE6A 3LUCA 3EPKA 3A10A 1ABBA 2AYXA 2Y66A 3G88A 4CMKA 3CH5A 2WG1A 3GLGE 4ZZIA 4QM6A 3PXDA 5AKEA 3S3TA 2O4UX 1HYEA 4MQ4A 3AERB 4WJLA 4EB6B 2QRGA 3FOEC 2R0QC 1AH2A 3NBAA 3WSVA 5FL3A 3VC1A 4B8ZA 1VMDA 1E9FA 2DECA 2IYRA 2LTAA 2VTVA 2X40A 3E3NA 3O3OB 4K87A 4TZ0A 1ISHA 2QN8A 4HRXA 5G3YA 1MB4A 3SEAA 3G68A 1V5FA 4GZ3A 1NQXA 1W6UA 1OYVA 4L8FA 3MTAA 4HTFB 4J0EA 4M8NE 4PO3X 3ZWXA 4B2IA 4EZBA 1FVFA 1KAMA 4TKLA 3VTAA 3ZW8A 1NUHA 3O95A 1KIMA 2HA5A 4O4IB 3TLZA 1YVPA 1VCNA 1XF9A 2XKKA 4DLBA 4MHTA 2HAEA 2B25A 1LRJA 3OLVA 3T4UA 3V34A 1WXFA 2PUHA 4JVOA 3E5NA 4H77A 4Q3EA 1GSAA 4C29A 1KEKA 3SVTA 2VPTA 4LVUA 2PRSA 2NACA 1HFKA 1B41A 5AOCA 3IVAA 4JBXA 3HZRA 2GEDA 3QKUA 4DLAA 4EL0A 1E5TA 3ANLA 5FD8A 4N48A 4TMFA 2SCUB 4RF5A 4U2CA 3EZFA 2HJWA 1UH5A 2YOGA 4QPZA 4EUFA 3UWMA 1QH1B 1TVMA 1YR9A 2HWYA 1GSHA 1I10A 3U19A 1NRJB 3ZY6A 4B7UA 1JHMA 2FVXA 4Q05A 1P2BA 2BM8A 4QJIA 3K7EA 1G7SA 1RQGA 1EFAA 4MCHA 2PY6A 3SXJA 4X3PA 4B17A 3FSGD 1JKMA 3B1YA 3RC9A 2CLHB 3CX3A 3LMKA 1CQIB 2OWDA 3VR4D 1F17A 1QRSA 4UU8A 3I6MA 3FB4A 1TU3A 2G9UA 2A9VA 1Z25A 4F3KA 1WW3A 2FV8A 3KJHA 4OXKA 1X2BA 2A0FA 3HL4A 3NYIA 1XALA 4AROA 1E8NA 2IIVA 3SC2A 5KOIA 2O8DA 1QV6A 4BWFB 4J3JA 3RROA 1KAGA 2YMLA 1T1JA 4BMPB 4JBGA 1FL9A 1G21E 1S2OA 4MULA 4ZALA 2GCPA 5GTDA 2VPQA 3QOXA 2CB0A 3KR1A 3AKDA 4OD0A 1NMXA 3C7AA 1FB5A 1S3SA 3MLAA 3VNRA 2JLVA 2NAPA 4RU1A 4PLTA 5FUWA 3PDHA 1P7YA 2ZT8A 1IAVA 1XD8A 2PVCA 2R1VA 3DBVO 1VZ2A 1S1CA 3CVOA 4R41A 2E48A 2ZIAA 3VSEA 2ODPA 1TADA 2CLSA 4FMCB 5AHKA 1LC3A 1P2FA 3CRNA 3RAPR 3B7WA 5LVAA 1GNVA 8GPBA 2R1UA 2HDHA 1G291 4YPVA 3VH3A 3IKLA 3NVKI 1WS6A 1C0KA 1UDBA 2B83A 2KJQA 2EG5A 3GJRA 5EWLA 2ID7A 3V00A 3ZI4A 4BBZA 3R6GA 3DXYA 3S27A 1FC0A 1UBOS 3KZNA 4D4IA 4RQUA 5TVGA 1ECGA 1L5WA 3AB3A 4Y2YA 1DPFA 2B94A 2UZ3A 1S2GA 4WVLA 4GUAA 1OYWA 1S7CA 3D7NA 4I46A 2YC2C 1V3QE 1OQAA 2W11A 3A0UA 1JLLB 3BSSA 1Y81A 2IF2A 3HCWA 2J7PA 4FBGA 4MQFB 1V43A 4BNFA 2NXWA 2SBTA 1CSEE 4DXHA 4XYMA 5HQ3A 1R5BA 2WW8A 4HFRA 4UQLA 1AC5A 4P7FA 1N6RA 3EGXA 2HPHA 3NPAA 4UBOA 4CDNA 2I1LA 4V0NA 5EYPA 4MS1A 4QJ4A 4E51A 1U0FA 4LTNA 1WBJB 1OFHA 4L02A 4GBED 4AJ9A 2GN6A 1IXSB 1V45E 1OY1A 3CX6A 3GXOA 4HAIA 4F06A 1FYVA 1P2VA 3BMQA 3L41A 2GMWA 5COBA 4MVWA 2XB2A 1UL1X 4A8PA 4K7JA 1E9AA 4QWWA 4ZEVA 1PT8A 2GM4A 2DTXA 3ACBA 3UK6A 2J67A 4LJ7A 3HXQA 3FCSB 4IDGA 3TLKA 3OZSA 4JLJA 4ZFNA 4DJTA 1X0XA 3EEFA 1VSVA 4IILA 4X60A 4KWHA 3TIXB 4JIMA 3CISA 4WINA 5K8IA 1M1XB 3ZCRA 3AYZB 1JS1X 4MGKR 2ZJ2A 5EPEA 2P40A 4YRTA 1T2FA 3SZ3A 3WGHA 1F5NA 2JGAA 4MRSA 3CUEF 1NRIA 3JSXA 2H52A 3QWHA 4RORA 3PHGA 4IMPA 5DZSA 1H4VB 1QIEA 2W83A 5EERA 1OLUA 4UCQA 3UHAA 2UAGA 5C9ZA 1RVV1 1COWD 2I7CA 3DZJA 1E99A 3KJNA 2P2LA 5LBUA 1KJJA 1XVUA 3BA1A 3GLHB 3IKJA 4XIGS 5LA6F 1FMFA 2ZAIA 1C3VA 4ZDIA 3K70B 4NR0A 2XGGA 1JDSA 4E1BA 2BEVA 3KOXA 2JFVA 5HF8A 1TB4A 3F3SA 1UBSB 4ESOA 5K3DA 3PT5A 3IEVA 1Z39A 2D2EA 2OENG 2I4NA 2FSHA 1CBUA 4MVJF 4OLHA 4YLEA 3LM8A 3CUWA 2GEBA 3ECCA 1EBUA 3DEKA 2I5PO 2II6A 3DZIA 1GRVA 2R65A 1W5FA 3EVAA 3FOWA 1NNSA 4OUDB 3L1UA 4B3CA 2C9BA 1F7UA 4R9VA 1K0FA 3QVOA 4ZO6A 3SX4A 4QRIA 1WKCA 5KYYB 1G8AA 1Y82A 2MINB 2ZRBA 3IXLA 1X3SA 3L7NA 4LBVA 5DLQC 5LP6C 3U4CA 3PUZA 1MO4A 4Z4FA 2FI1A 1QONA 3A1CA 3DEJA 1RLTA 1JUDA 1RR6A 4J7XA 2BKLA 5GJCA 3I45A 4B84A 4DA0A 2HA0A 3ROEA 1VMAA 1B0PA 4YJ3F 3UJ9A 3V8MA 3WDLA 2WDPA 2XRMA 4BDTA 4CV3A 5JUWA 1VRWA 4AICA 1VBNA 1NJ8A 1ZNQO 3ENZA 3N8NA 1KVTA 1T13A 3DDOA 2ACWA 4B31A 1QFJA 4AUMA 5TC4A 7GPBA 1JFSA 4J4BA 2E49A 2QUJA 2P7IA 3NEAA 4MVJG 5CLIA 3DTTA 3DMGA 1QKJA 5KMGA 1XZHA 2FXVA 4FGUA 4P81A 3C5VA 3Q12A 3RJ5A 3LDAA 2FEKA 3PEUA 2FQXA 4TN5A 4FW9A 3ICPA 4QZVA 3QEKA 4GKJB 3OPVA 3A3YA 3RYFA 1UMDB 3RHTA 3LOPA 1M2WA 3KJEA 2GCIA 3MRSA 4M1OA 5JV5A 1VJ0A 4ZU6X 5ALVA 3OICA 3P2YA 4ACBA 3ZHVA 2NUTA 5THKA 4CQMB 4PG4A 2WMYA 4ZHQA 1N3BA 2CW5A 2EJVA 3A2NA 3FPSA 1V5WA 4RLHA 1P2SA 1TECE 1NSTA 1JEJA 2FGKA 4P7KA 1RQNA 3W6ZA 4COKA 5HJ5A 3UAZA 1RWKA 3W77A 1UPXA 3HFJA 1TD9A 2NXJA 3GDHA 1N2CA 4IYRA 3A6ZA 1CUUA 1TYCA 1ICEA 2HSGA 2UU9B 4PFSA 2HHLA 2ZBPA 3PFKA 1P0QA 2JGDB 2V7TA 4I1VA 1K4YA 1WJGA 3T5CA 1MV5A 4B3XA 3U6BA 4PYMA 2JBAB 5A5FA 3R24A 1BD4A 1EFLA 1XZNA 4U9HS 2NG1A 3QLVC 3FCAA 4EM6A 3ICOA 4GMFA 1R4ZA 4JJIA 4JI0B 3QU5A 2ECOA 1K89A 2GKGA 4K9MA 4KIGA 4MIEA 1QRAA 1T1RA 5L4SA 4LS3A 1B16A 3HGQA 4OYLA 3ZTWA 4JITA 3OM0A 3OZGA 2RHTA 5AT1A 2YASA 5FHQA 3RHFA 3RSGA 1XJQA 1TYBE 4RMGA 5EIWA 5IX8A 1V2GA 1G19A 1KOJA 3F9CA 2VN8A 2XMBA 4D79A 4YRMA 1RXVA 1PGNA 3WKAA 3RGWS 2BTEA 3I4FA 1UFOA 1G18A 1M54A 2J33A 4AZTA 5JD5A 3HYSA 4I4TB 5AW7A 1VA5A 1GU7A 2RGAA 3AQIA 4A10A 4OVKA 1RFLA 2JGRA 1C8KA 1ODTC 3EW9A 4L4XA 3FGNA 3PFGA 2UYQA 3PWSA 1CEYA 2NIPA 1W96A 4TQUS 3QXHA 1FYWA 3E6AA 3UMVA 5IVDA 1HFEL 1XZLA 1E6LA 2AMLA 4TTAA 1FRQA 2IODA 1NKTA 5K45A 3ZJYA 4G81A 1G16A 3DMDA 2QGZA 2V5UA 2XMRA 3UAWA 3ZX4A 2PH1A 1CYDA 3IAM1 4JQZA 1JIJA 3NKVA 4ZD6A 2C8JA 2C96A 2ZE7A 1Y1QA 4I50B 3AEXA 3ZNNA 3ZVNA 3BQMB 2OO3A 1FQWA 4OQNA 4PRZA 3I9V6 2ZBUA 4RTLA 4OSOA 1E9DA 4LHVA 3NEYA 3O8DA 3TCXB 3D2BA 2VPXA 4TL6A 4CIXA 4DUGD 4EKEA 3HH8A 4D0SA 3P2MA 3IMEA 3KQQA 2CXRA 4UEWA 4IV0A 5FOVA 4IIYA 4KXYA 2PS9A 3GOQA 3U4HA 4D4GA 1DEAA 1L4YA 3QUCA 4IWYA 4OJMX 4LHWA 3UHJA 2JGMA 4DA7A 4AUEA 1YVRA 3OURA 4GOOD 3PDJA 2ZJYA 4RNDB 3NDRA 1K5GA 3T7AA 4LGMA 2DCMA 1B4DA 1QGAA 3D8SA 1CF2O 3L7IA 4LRUA 4A0FA 1TZCA 2JH3A 4BKOA 2B8EA 2UZ0A 5CLLA 1Z3IX 3T0FA 1NBWB 3OZXA 4AO7A 3O31A 4MW7A 3JTMA 3X1MA 1RHUA 1VMEA 5J4VA 5IS2A 3K9QO 4JJFA 3FBTA 4Y18A 4ND8A 5D87A 5LYJA 4RS4A 1XKQA 4UMDA 3UA3A 5EKTA 5HIMA 1T36B 3ILYA 5AKXA 4Q6WA 1K27A 4JUAA 1EHYA 4JSYA 4O2AF 1UKBA 2V0NA 4O4LA 1E2KA 3Q72A 4ARZA 1NAIA 1X1QA 2BF7A 4HC4A 1MU0A 5HG0A 1J42A 4YAGA 3COVA 3IEIA 3VKHA 4JJ7A 5AI6A 1Z9BA 4RIEA 4QUHA 3CF4A 4LBWA 4L57A 4PGMA 3OQOA 2ZKIA 4LEIA 2WZQA 4ZARA 2MWMA 1PFWA 1IHXA 5ARCA 2HWUA 3RT7A 1DUVG 1VJDA 3NAQA 4NMHA 2MSWA 5EIOA 1CY4A 1MV8A 3AI3A 5DKFA 1ZQ9A 4TKZA 4M9ZA 5J2TA 2AWNA 2DWUA 3GJSA 1KP3A 5K3CA 1C7EA 4C7OA 3GRZA 5AVSA 5DLPA 5DISB 3M2TA 3T7IA 5HM6A 1Z2PX 3BGVA 3CS3A 3EEBA 4C1BA 4OBBA 4DQLA 3C7DB 1MC1A 1VG8A 3OJ0A 1I5OA 4LC0A 4NPCA 1DBVO 1KERA 1KQ3A 1E9SA 2VP6A 4XW2A 2RIPA 4RK6A 4NBRA 4YMHA 1FFAA 4MWOA 2XQFA 3A4IA 2PMFA 3FTFA 2CUTA 1Y6RA 5K9ZA 4QARA 4UC0A 4ZEXA 3BEOA 1SCUA 2RG7A 4F92B 1ODSA 2VCYA 3O3NB 3V2HA 1UK7A 4RK7A 4P92A 4B35A 2H1IA 3Q3CA 5TR9A 4ERXA 2H4HA 4OQEA 5KWIA 1U2GC 5AK6A 5DK4A 4CMEA 3Q8KA 4CIBA 1JPJA 3F6SA 1CY7A 2PT6A 2I8CA 1Y98A 3LCJA 1KPHA 1VFNA 4WXMA 3MJFA 1YZQA 1V95A 1PKXA 3DPUA 3FPKA 1U8XX 4UMEA 5D84A 1IZZA 2V3WA 3GFOA 5B3LA 3ZY4A 3I8XA 3FZQA 3WAKA 1MXFA 1GP2A 3B3QA 3FYUC 3PLAE 3UUFA 4CDGA 1F0PA 1SKQA 4W82A 5KHAA 4ETNA 5AM4A 4NEQA 1XKXA 4G84A 2WKWA 3PGKA 4EKDA 2ZK7A 5EZQA 3RR2A 1I3KA 3KEGA 1HDYA 1L8QA 2A5DA 3FNIA 1P2UA 1QFYA 4L50A 1I7SB 1IWBB 5B7PA 3TGLA 3DZKA 1QYWA 3DXZA 4U8HA 2ZS9A 5HCNA 4GS5A 1NV9A 1TMOA 2X1MA 5H3LA 3GBVA 4O59O 3H05A 3U1BA 5CT6A 5DNDA 5JNRA 5JFOA 5T4HA 3ER9A 4ETIA 4DM3A 3GA7A 4KWCA 5JS1A 1H22A 3K16A 1E6EA 2CLCX 3PUWA 2DHCA 1RKXA 2YZGA 5FXMA 4BEVA 5M04A 1SC6A 4WA7A 1VE5A 1LDBA 1QGUB 2OZLA 4AY5A 4LJLA 3B8HA 3N07A 2J41A 1RM3A 2IS6A 1OXSC 2XT0A 5IK2A 2FY8A 2I4TA 3WYEA 1RRCA 3CXUA 5C1BA 3FHJA 1MH1A 1O97D 2V5AA 2VQSA 3L8CA 1SC3A 2ZVPX 1ISFA 4R9UC 3MWYW 2BFFB 2ZSJA 4IVPA 5EP4A 2XMQA 3ADPA 5IC6A 3GYBA 5TE9A 3SHQA 4AIRA 4PSUA 5AK4A 3ZBTA 3SJBA 4MA0A 3ZE8A 2CN1A 4U4AA 1O0BA 4ILEA 1ECLA 2PPVA 4IIBA 1GKUB 1IXKA 4PQEA 2ZG6A 4LV5B 2Q1YA 5CBPB 4D4JA 2F3TA 3ZCPA 2VF8A 3K6RA 1B2RA 1KHHA 2ORYA 2ZIFA 4ZC1A 1KFBB 1PNVA 2CLKB 2HRQA 2OWEA 3AI7A 2AC4A 3EEQA 4K81B 4N54A 1XRRA 2BGIA 2L2QA 1V11B 3ST7A 3SZOA 5A6SA 2ZRIA 4HY3A 4Q00A 2BFCA 1Q17A 1E69A 5IVIA 4MWGA 3GCWA 2V7XA 4FE3A 3RYTC 1N9KA 3UBTA 2NO1A 5ESRA 2CNOA 1U9CA 1YDEA 5A3QA 1H4SA 1RTKA 2C4KA 4TTSA 1FLNA 3E9DA 3TIIA 4JAVC 3EZNA 3K09A 2Y76A 4TQ9A 2QL7A 3QVGA 3DWEX 2R60A 2VDUE 5L6MB 3R7AA 4KFUA 3U7QA 1NPTO 2GR9A 1LSOA 1WDWB 3B13B 3CZ5A 4XUDA 4P33A 4A0GA 4IEEA 2J48A 1V4BA 2Q6KA 5JWOA 1T2AA 4R8SA 3AWIA 1ONPA 1T9BA 2H51A 4YRBA 1NVAA 1XTVA 4CKCA 2VTDA 4P31A 3DE1X 4K86A 1C9YA 4YMUA 4AF8A 1XZKA 1SBIA 3BYZA 3OA2A 5K1ZA 5KTNA 4OLFA 2FSSA 4JLPA 5T8KA 1Z0IA 5IM4A 1F4VA 5B37A 1QRRA 5LZ8A 4ENPA 3T9AA 4NEGA 4H31A 2SICE 3RARA 4CI9A 2PQ2A 2AJ8A 4R16A 3OCXA 3UY4A 4D9GA 3QBJA 3ZVRA 1S0UA 3LV8A 3M1LA 3IHKA 1DNPA 4MQLA 4QFMA 4O63O 1CUHA 1SG0A 2YWFA 1JMKC 1KHTA 5IDYA 4XCVA 4Z7NB 4PZEA 2E1RA 3FPAA 1JDVA 3LYLA 3ORHA 5ITZA 4BQEA 2WA1A 4C03A 4GLJA 4U9UA 1X39A 1XQWA 2HV8A 1XJ5A 3M3PA 4DEVA 3FSRA 3IHWA 4JQYA 4R1PA 5E95A 3ZGYA 5KQRA 3A3KA 5JAPA 1P8JA 5KSWB 1OZFA 3DR3A 3UQZA 2VUIB 2X76A 4M1MA 3WYDA 3NHMA 3PTAA 2D54A 4DKJA 3AIMA 4HWOA 1C1DB 4LNHA 1EFPA 3F7NA 3RUCA 5G4KA 3E53A 2OV3A 4RMHA 2Z2YA 4JI7B 4PC7A 5TPZD 2RHMA 2UYYA 1Y7IA 2P77A 2R8ZA 4MQ6A 4NARA 3R44A 2IV3A 2XQVA 1PJ8A 1YSCA 2A9QA 3FNFA 3PC7A 4OSEA 1GA6A 2J8ZA 3BFJA 3C14C 3L2OB 4HPJB 3ZD6A 4HI0E 4Y1EA 3EXG1 3S1LA 2C2XA 1PO7A 3GLIB 1DUSA 3JQAA 3S0JA 1DCMA 1WY5A 3DZBA 4JJZA 4O2RA 3R8FA 3V4ZA 4E14A 5HOQA 1AOXA 1TU4A 4JUIA 5LUAA 1U8UA 1H8HD 5BVGA 1JQDA 3PDCA 3FWNA 2GVNA 3NBYC 4G5HA 3RU3A 3F96A 4LWPA 4ATNA 4BLTA 2JFHA 3L46A 4IYJA 3FPBA 3T9FA 3TBFA 5IBQA 4IHAA 3OQ1A 3HV0A 4AZ0B 1BTOA 3SQDA 3MBOA 4E4YA 4ZCTA 3VBEA 3SN6A 2P2GA 3I2GA 5LIRA 1JDNA 3D3QA 1SRQA 1C9MA 4FKZA 3OTQA 4G2TA 4A2CA 3O91A 2BRUC 3QG5A 4F9FA 5G02A 4PQFA 4F3TA 3I5AA 4YXWD 2D6FA 1XP5A 4RZQA 3VC3A 3RTGA 3PE3A 5EXPA 3RAFC 4HGRA 2QNRA 1NUQA 4QC2A 2PZLA 5IF3A 1Q0UA 2GCOA 5JYCA 5L40A 2YZ2A 3VUFA 5DN9A 5DF1A 4BNMA 3I58A 4ME6A 1BAPA 4N0EA 3SIWA 2VWPA 3JAMA 1TMGE 5AVJA 4F0JA 4CM7A 1AO3A 2O20A 3QTLA 3A70A 1Q0ZA 2QMHA 2G25A 3OSUA 2OFFA 2AN9A 4MKRA 1W52X 4CQLA 4YQFA 2B4AA 1BRTA 2QQEA 2V4UA 1NOKA 5HK8A 1ZVQA 3TQSA 4ZA2A 4E21A 3QVSA 4OHWA 4I36A 3HYCA 4GQBA 3OECA 4DC1A 4HAVA 3SJZA 3R7SA 3ZTTA 2DUWA 1T4BA 1CCWA 4UCXA 4YWJA 1SU8A 3EUEA 1KPGA 4E2FA 1LSSA 3F7TA 3F6BX 3TSCA 4EJSA 4ZZ3A 2H1FA 1QCCA 1GGMA 2VDPB 3GXBA 4KZKA 1GZVA 3VJMA 1FW6A 1L5ZA 1GUZA 1TYDE 5EWMA 5AXDA 1U5BB 2I7VA 3JWGA 4EYQA 4YIHA 4X6XA 2B1GA 4MCIA 3V8NA 1SMKA 1W34A 4KPFC 3E3OA 3A2KA 3BXOA 3MSXA 4JUBA 5JXGA 1PZMA 4CFYA 4YUZA 3WYBA 3E9ZA 3UMBA 1U7DA 3PDUA 4DA6A 1ZD8A 2AN4A 4C0WA 3SP1A 4F45A 2RHCA 1HMYA 3OHMA 4J1JA 4Z8XA 3ND8A 2O2SA 3P27A 4DCGA 2YZKA 2QR2A 5LLTA 1JEQB 1DDGA 2EV9A 1H42A 3IVCA 2H5LA 3N0TA 3V4RA 1FNBA 4PZ0A 5B4UA 4LDNA 3LQFA 3EOAI 5H81A 1AXRA 5B1YA 5KWVA 4JU8A 1GTL1 1M6VB 1E3WA 2YHIB 3CF0A 3LVBA 5AW8A 2QX6A 3M6WA 3KKQA 1QIKA 1WG8A 1BU8A 2OO5A 3E84A 1FMLA 3KQWA 3PUJA 4ABYA 2XNKA 4K9RA 4C4PA 1TK9A 5JC1A 2QAGB 2Y05A 2OG2A 5K3EA 1KYZA 4OQZA 4E1AA 3SMQA 4OFWA 1E1MA 1SUSA 3OT1B 3RNOA 4BB9A 2R48A 5ALYA 1ZVMA 1U0BB 1Y5LA 2OCPA 3BC1A 4MNTA 4ZREA 3L8ZA 1RWPA 2HNAA 4N39A 3UWSA 4YAOA 3QHPA 3FPFA 1I2BA 1PJTA 2VNJA 3I76A 5BN4A 4J90A 1G2OA 3DG9A 1P9LA 4JH0A 2WY2D 4WNAB 1LX7A 3SKVA 1ZJ5A 1R5JA 1UJ5A 3FWYA 4KYTA 1YZFA 4UQPA 4UVHA 3R7NA 1CS0B 1RM4A 3RTBA 3L1JA 1T0PA 4U7WA 2A94A 2JD2A 3E2MA 5L3SB 4Q02A 1J1UA 4L5IA 3A11A 2FR0A 2QRVA 2WAAA 3OQVA 1OLOA 3WSTA 4CW7A 5D5HA 1CY2A 2ZWAA 4Q12A 2OB2A 1YDMA 5H59A 1RRGA 1JAYA 1N75A 1RJ9B 5E6SA 5IT4A 2FAXA 4NOKA 2D5LA 5IBPA 3GRAA 4TRRA 2QR3A 3S7ZA 2H2WA 1QB7A 2YV2A 4YI5A 5EZSA 3A9RA 2QSJA 4N12A 5C4IA 1UQTA 3AC0A 5EHZA 5KVAA 3WHIA 3VR2D 4Q7EA 1NP7A 2E18A 5I7AA 1KFJB 1B93A 2C99A 1RLJA 3AHDA 5GVRA 1ZONA 4GYJA 1MABB 3MZ0A 4DJ5X 4ZGBA 1W1UA 3IQGX 4UAUA 3QU7A 1KGSA 1TZKA 3LHDA 2DHQA 3OJCA 3OY2A 1CY6A 4H9GA 5FA6A 1MR3F 4GZMA 4DMUB 5KYUB 2CBXA 3GLUA 4QHYA 2REBA 1YFKA 2LCIA 3LYUA 4HVAA 3SR0A 4B45A 4ZCLA 2G82A 3VPDA 4A23A 4TRNA 2VWQA 2DH5A 1QGYA 4I4CA 4H6PA 3JAWB 2C3UA 2XKAA 1GR0A 3PD0A 3PUKA 4HD8A 4TZ6A 1UEIA 1YUBA 4G4JA 4ADSG 2D1SA 7MHTA 2HSWA 3CT4A 1L5MA 1PR4A 1Y63A 2P65A 3KQMA 1OV4A 4GQIA 4HUQB 4L07A 4MXDA 3USES 3OTHA 4AX8A 4DZTA 3CA8A 2VPIA 1C1HA 4D3YA 4Q21A 1V1RA 1NVWQ 4E4RA 1E96A 1JHUA 4OOFA 5JROA 1TDJA 4M0KA 1G17A 1U7ZA 3GEEA 2GWRA 4L3WA 1ZGBA 3ZU2A 1EVQA 2RGEA 1CEXA 2Q27A 2QRPA 3TUIC 3Q88A 4I8XA 4WZ6A 2I2BA 5KSOA 1LS6A 4D9HA 4RTQA 1E2GA 4G41A 2WJ6A 3L7AA 3A32A 2OQVA 3CZ4A 1G8PA 3GEMA 3QPWA 1MVNA 1PT5A 2FE4A 2J85A 4A2PA 3WIBA 1QP7A 2G7MC 2XODA 2ZSEA 4LIPD 2CV0A 4DL9A 2CUZA 4IJKA 4R5MA 1FFEA 3ZGVA 5K0ZA 5ADVA 1P17A 3EOZA 3G9ZA 1RHRA 4KFCA 3HY6A 5K3OA 3LI2A 4Q9NA 1HE1C 3QLUA 3OKCA 2JLXA 2W5UA 1F3OA 2PT5A 3IJEB 4PLPA 4PYRA 4L5JA 1HH4A 1HTTA 2FPKA 4ZHQF 1HY3A 1GGVA 5JSUA 3V2UA 4Z4EA 3TNLA 3G2HA 2PJDA 3CKLA 3U7GA 3W6UA 3ZHXA 4M53A 3TLXA 3LWNA 1PLLA 4GZ6A 2FJ0A 1KZ7B 3G2NA 1COZA 3S2SA 2H06A 3W5VA 5FLYA 1BDIA 4KRGA 3V6LA 5DEOA 5D51S 4NYJR 1N7HA 3PI6A 4Y0VA 1QG4A 4X6UA 1Y7TA 2PKQO 5H8WA 3K2BA 1YB2A 2FSGA 4QGAA 3Q5GA 2ZAYA 1RYEA 5CTJA 5DBHX 5L7YA 4CGYA 4EG7A 4RYLA 4IH9A 4X5OA 1I7LA 2P5SA 3WADA 1CG6A 1SXJA 1ZN8A 2MSKA 1EB9A 4MAFA 2V3CC 1PSDA 1J56A 2GETA 1KEPA 3MT0A 3BE8A 2CXNA 1KH1A 4KPUA 4OREX 5DCYA 3ROGA 3SICE 3V4VB 5CDSA 1BC5A 4PG6A 2RGCA 1NBMD 3BTUA 2QTGA 3NLLA 3WYGA 4CUJA 4MZDA 2Y4NA 3ISTA 2B78A 5F51A 2NXNA 2YWHA 2XVZA 4FEGA 2DKNA 4IDNA 4MB0A 4MUBA 2FRDA 5BUSA 1H93A 1M7HA 3M4XA 4IH1A 3X3HA 1S7GA 5CLHA 1SU7A 1A9YA 3F7OA 2GLTA 3FZNA 1NBHA 1SCQA 5EUQB 4ZANA 1YMQA 5TIIA 2GQ0A 1QK3A 1RW4A 1CDEA 4ZEMA 4KI0A 3IUMA 3PQEA 1M6YA 4MO9A 5HKOA 4MKGA 1R88A 4PE5B 5C8YA 3AVWA 3V7FA 1BEUB 5SY4A 3VU9A 4BQSA 5E6UA 2FSIA 3OKFA 2WHXA 4FDAA 1BE6A 1LB1B 4OATA 1TGYA 2WUFA 3O03A 4AYWA 3FETA 3EPPA 4FFDA 4XOUA 1BHJA 5DK6A 4YRQA 5A02A 5KX5F 2YFYA 3GRVA 3RGGA 4Z49A 1VI2A 4I08A 2VHQA 4ODIA 1I2ZA 4GSLA 5A4FS 2C92A 2OZVA 4M89A 4C6SA 4NKRA 3O90A 2VYCA 2GZAA 2H3HA 4YJGB 5HJEA 3EUWA 4EHFA 2HCJB 4M0MA 1E6UA 1NUSA 1RQ7A 1TF5A 2BR5A 4UHDA 5FBZA 3UGKA 5HRCA 2ZANA 1XD2B 1C3XA 2OMEA 3IDFA 5C34B 1MO2A 1M1YE 1W87A 1AB6A 3KQTA 3LIIA 3O4RA 4RA6A 4UDNA 2B35A 2AQIA 4L76A 1HDZA 3ELYA 2QQ5A 2YS7A 4PWYA 3D3EA 4TVOA 2Z4SA 3QF4B 1K8YB 1TA4A 1ZJ4A 4K6KA 3OAAA 4PCUA 5EE0A 3R9KA 4PG5A 3V42A 5FL7A 3FTNA 3R3UA 1GTZA 2COUA 3HP4A 4R9RA 3DKPA 5KTPA 2QSUA 1HZZC 4A9AA 3DOUA 5BURA 2IYPA 4HZUB 3TZQA 3UHPA 1U90A 3P32A 1M7BA 3FJ1A 3IJRA 4OXNA 1EM6A 4PFJA 4JP2A 4TL7A 1DQPA 4XSGA 3RPEA 4R98A 3K0KA 5EJ2A 3MTBA 1XL0A 4LQLA 4CFSA 3H5WA 1F9EA 4TWZA 1LJUA 2G70A 2GF9A 3OZVA 5I4CA 4TX1A 3VDXA 3WWOA 4B4OA 2B5OA 4W6ZA 3UT5A 3NJ4A 4DWOA 3KJGA 2IYWA 1OLSA 1E89A 2IWHA 3ZGXA 5C1DA 2ZJ0A 4OHFA 1GTJ1 3IDSA 1P5ZB 2QIOA 4QUKA 4ZI2A 3QHAA 4N1AA 5LSAA 3LWZA 4FMDB 4O4LF 2PS0A 1TGVA 2UVPB 4P22A 5F33A 3LGXA 4MRPA 3OKAA 1TL7C 2CY0A 2ZJ3A 3WMWA 4B7AA 1X8LA 4YRNA 1O96B 2EEZA 5EMLA 1R0RE 4GUDA 2ZPTX 1FVXA 4JZYA 1ID1A 3GA5A 1K92A 2QE7A 5ALGA 5G0WA 3HJUA 4RGYA 2OBMA 3AB8A 1RFGE 2PTGA 1JHQA 2QZPA 2E4YA 2AN3A 2BT4A 1W6RA 2P7HA 3O93A 2GI4A 3OD5A 4MMXB 4O0LA 2QLMA 1YMVA 3DUFA 2O8VA 4K6CA 4MX8A 2B92A 2EOAA 4JNKA 2G71A 2CLFB 1ST2A 4P3YA 3EA4A 1X7ZB 2JGNA 1YL6A 3IUJA 1JQKA 3WQBA 5JBIA 3KQUA 1LD3A 4S12A 1JSRA 5DFAA 2OFPA 1U7HA 1X7GA 4KLCA 1NBIA 2WLSA 3ASUA 2BY4A 4TT3A 3WLHA 3C3KA 2XXAA 5F3DA 4CBVA 3H16A 2PLRA 4OKSA 1E59A 1UXJA 4PAGA 5K2OA 2VDWA 3P4UA 5FI1B 1MDBA 3MD9A 1V16A 3W9YA 2PLAA 4RFSB 2YRWA 2D3WA 1HDXA 4K6OA 3WGKA 5BV1A 1UJNA 2PXAA 4X84A 4JYAB 3CLUD 1I4EB 4NYMQ 4GPD1 5JQGB 3W5IA 5G1NA 2XQKA 4BB5A 1UDXA 3DWIA 1KWKA 1RKUA 1AXEA 1Y33E 3T1QA 1ZR2A 4OYYA 5CX1A 2WA2A 4KFSA 5AXCA 4N6GA 4M9UA 3CNHA 4KNYA 3PXXA 1LTQA 1Z62A 2VATA 4EGAA 1XQVA 1XZMA 4S2EA 1G8GA 1M34A 1T2EA 1MOSA 1UJ4A 3JQEA 4RABA 5H02A 1YS1X 1F5SA 4JDUA 4XGKA