2QYSA

Structure of eugenol synthase from ocimum basilicum
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
310
structure length
310
Chain Sequence
GMKSKILIFGGTGYIGNHMVKGSLKLGHPTYVFTRPNSSKTTLLDEFQSLGAIIVKGELDEHEKLVELMKKVDVVISALAFPQILDQFKILEAIKVAGNIKRFLPSDFGVEEDRINALPPFEALIERKRMIRRAIEEANIPYTYVSANCFASYFINYLLRPYDPKDEITVYGTGEAKFAMNYEQDIGLYTIKVATDPRALNRVVIYRPSTNIITQLELISRWEKKIGKKFKKIHVPEEEIVALTKELPEPENIPIAILHCLFIDGATMSYDFKENDVEASTLYPELKFTTIDELLDIFVHDPPPPASAAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and reaction mechanism of basil eugenol synthase
pubmed doi rcsb
source organism Ocimum basilicum
molecule tags Plant protein
molecule keywords Eugenol synthase 1
total genus 113
structure length 310
sequence length 310
chains with identical sequence B
ec nomenclature ec 1.1.1.318: Eugenol synthase.
pdb deposition date 2007-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05368 NmrA NmrA-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2qysA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 2qysA02
1PIWA 4DXHA 2OO5A 4FFNA 1ZUD1 1C1DA 3AWDA 4TWRA 1ISIA 2PR2A 3DBLB 2JL1A 2X6TA 4IIVA 1VRWA 3ETDA 3K5PA 3NAQA 1EVZA 1T2AA 1U2DA 1PZEA 1T2CA 3G17A 3LC1O 5JCJA 4BQRA 1ZMTA 1OFGA 3EK2A 4FJ0A 4AJ1A 1M76A 2WSBA 3JQBA 3QRWA 2IODA 2Y0CA 4YAKA 1MFZA 4R51A 3U0BA 3ICPA 3M2TA 4CV2A 5CHEA 1V35A 4CMJA 2O3UA 3UF0A 5HA5A 2GLXA 3LF2A 2CSUA 4D0RA 4I5FA 4IMPA 2DKNA 1IY8A 5KVQA 1E6WA 3GZ4A 5FI5A 1E7SA 1VL0A 4BHTA 1PQUA 1O0SA 3CUKA 4IQ0A 1HRDA 2X9VA 4MP8A 2IXBA 4QXMA 4CODB 2BLLA 1WW8A 3GGOA 4NJOA 4CMBA 1SEVA 5JO9A 4UVIA 3F5QA 4KWHA 4DPKA 1GPDG 5IZ4A 4J16A 3DEYX 2YZ7A 2ZCVA 3SXPA 3T7CA 1D1SA 3BHJA 1LQTA 1ONOA 3FPCA 3ITDA 3L6OO 1QP8A 3AUSA 5ICSA 3PQDA 5U9CA 5A06A 1P9LA 2B36A 1TT5A 2IZ1A 3QA9A 3WYEA 4CV1A 9LDTA 5EESA 5IN5A 5A5EA 4GGPA 2Q1SA 4RVUA 4CMIB 3FR7A 3L6DA 2Y67A 3F46A 1H94A 4XYMA 1AHHA 3QSGA 4GGOA 4BNVA 2BFPA 4D0SA 1JU9A 4D7AA 3JTMA 1PGQA 3DOJA 2OXIA 4BO8A 1HF3A 3F4BA 4BMNA 4RVDA 2AMFA 2X86A 2FWMX 1IHYA 1Y9AA 4NFYA 1D8AA 2O4UX 3I4CA 4LISA 1KC3A 3GN2A 4WK6A 3D3EA 3E9QA 3OJEA 5IJZA 3JQFC 3FWNA 1ISHA 1UP4A 1YOVA 2J5RA 2OBNA 2PZLA 4GKVA 2LDXA 4I5DA 2PD6A 1DRVA 1P0CA 2C7GA 2ZB3A 4BNMA 1OC4A 3IDSA 4MP3A 2HCTA 1EBUA 3ENNA 3I6QA 3NT4A 5BQFA 3FSRA 3V5NA 4ALMA 3WS7A 4P8RA 3ONDA 4CLRB 4J9UE 2CMDA 4ND4A 1NQAO 4PG7A 2Q49A 5G0UA 1V0JA 3AUTA 1LDBA 2X0RA 4CLXA 1E3IA 4OJNA 4BO7A 3WTCA 4Y8VA 1E3JA 5KJEA 2D2IA 1GV0A 1TT7A 4ILKA 3X2FA 4E0BA 1FJHA 2UVDA 2RIRA 1AGNA 4EJ0A 5CFZA 2VRBA 3QV1A 1EVIA 2OP0A 5IDWA 5KVSA 4YRDA 3ZV5A 1PGJA 3K96A 2NU9A 4D44A 4D42A 1XG5A 1EQUA 1JKFA 4MVJP 3H3JA 4HY3A 4WNIA 4I5GA 1P1RA 2IRWA 3DQPA 2WD7A 4DQXA 2PD4A 5C7LO 3V2UA 4AJHA 1H93A 2EV9A 4E13A 4N18A 4XRGA 4KUEA 1E6UA 2VRCA 3E82A 4HKTA 4EYEA 4PLYA 4E2YA 1GAEO 1TT5B 4K1LA 4NQZA 3ZU4A 4TRJA 4Y6PA 1SC6A 2G0TA 3ZCXA 3GGPA 1B8UA 1WWKA 4RPLA 2JCVA 4LGVA 1PGNA 2J6IA 3PHJA 5L51A 1FK8A 1VL8A 4TKLA 1PSDA 5GY7A 2D3TA 2X5KO 1YS4A 4IZHA 5AQ1A 3FWZA 1ZK0A 2OHXA 1MX3A 4G65A 1KVRA 2HAEA 4CR7A 3BMCB 3DO5A 1ISFA 1H6CA 1HYEA 5IFLA 2I5PO 4CMEA 2VHVA 3ZZNA 3UUWA 3HHPA 3GPDG 1YXMA 2GR9A 4D3FA 4WCFB 4HADA 3E03A 3KEQA 4K26A 4CM5A 5HS4A 1U4SA 3DMTC 5FFFA 4BNNA 1AXEA 2FP4A 4CQLA 4MDHA 4UVHA 1ZSNA 5L4SA 5JC8A 1WDKA 3JD2A 5G0VA 5DOVA 4BKQA 4R1UA 1DJNA 4E6PA 1RJWA 3ZW8A 1B26A 1HE2A 3RUCA 1OAAA 3FNGA 4CLOB 5JAQA 2P9GA 2J5QA 1OBFO 5T8KA 1L1FA 1LNQA 3MWEB 3NX4A 5H81A 1HSOA 4IS3A 2C7VA 1O5IA 4XGNA 3GGGA 3ZHBA 1LU9A 4BO2A 4WLVA 3R3JA 2XF8A 2VUTA 4WEOA 5T6BA 3Q6IA 4XQ9A 1ADCA 1R16A 3PZBA 4GLLA 3HE3A 4MVJA 1J5PA 1EZ4A 1K89A 4OH1A 3GDOA 3QY9A 1I2BA 3GEMA 3ZV6A 1T2DA 4ZGWA 3DDNA 4J90A 3T7EA 2Q50A 1UP6A 4O5OA 1KEVA 1EDOA 1Z7EA 3OHSX 3C3XA 4XYGA 5EMHA 4IDBA 3SX2A 4YXFA 5A03A 1F14A 2GUGA 2O3RA 3VTFA 3GNSA 4ID9A 4E30A 4D45A 4TRRA 3DAFA 1M6HA 4ZQGA 1C0LA 4URFA 1QKIA 4B7CA 3SC4A 3G49A 1H9AA 3CTMA 4FBGA 1A9ZA 4B4WA 2Y1EA 2QRKA 2DBRA 5L40A 2X58A 2I3GA 5DDIP 4XA8A 1AXGA 2VTEA 3V2HA 4II2A 1GZ4A 3IMFA 4HX5A 2OGUA 2Y66A 2D59A 3L4BC 3PGJA 4R16A 2B0JA 2X5JO 2BGLA 3E9MA 3NYWA 3TNLA 1NNUA 1DOHA 1DRWA 1N2SA 2DU8A 2O3JA 1I36A 5GZ3A 3RC2A 1C1DB 1R12A 3LT4A 3VPHA 7ADHA 4R68A 1B8PA 2JKVA 2VWQA 4QX6A 1GD1O 4EI2A 2AQHA 4I08A 4JGBA 5JAIA 3GEGA 4J1TA 2Q1UA 4E3ZA 4RL6A 1WMAA 3DHYA 1YO6A 2NQTA 4DIBA 1HDRA 1X1TA 5GZ1A 4D3SA 1I33A 1K6XA 3RBVA 3HDQA 4XYBA 1HLDA 3BMQA 3TZHA 3VVBA 4A27A 3W1VA 5DBFA 3VKUA 4O0LA 1ONNA 4RDHA 1K2WA 2OL4A 1N7HA 4PLWA 3D5QA 1E1LA 2NVUA 1TLTA 2HK9A 2VT3A 1Z7BA 3FNHA 1X7GA 4TVBA 1NBOA 1ONPA 4JBIA 3WIDA 4TVOA 4XYLA 5JSFA 1R4MA 3RUDA 1F12A 1G6KA 3VDRA 4PLFA 1VC2A 1KS9A 2GSDA 2R6JA 2E37A 3BIOA 4YAEA 2EERA 5BNTA 3E48A 1BTOA 1QLHA 1NX6A 1DC4A 2NTVA 3GH3A 4E5MA 2AEMA 4IXTA 4E5KA 4CMCA 1J4AA 1IPFA 3OQ1A 3NGLA 3HSKA 4NU5A 1VI2A 1LRLA 2YW9A 4XQEA 3SVTA 4CQMD 3KB6A 3INRA 5JMWA 2LDBA 1JKIA 3RKRA 3ZNQA 3TZKA 4IXWA 1VE9A 4B4OA 2JFGA 3PIDA 4EUEA 4BNXA 1NWHA 3OQ6A 2PK3A 4QFDA 4EBFA 3VH1A 3ROQA 3GVPA 1NXQA 3ASUA 1UXJA 3C7AA 4KUHA 2FSSA 2B35A 1EUDA 3Q9UA 4MP6A 3HB5X 3HB4X 1HE4A 3WWYA 4Z3KA 2JAPA 3LT2A 3OA0A 3VZPA 2W2KB 5EIOA 3FN4A 3GFBA 3RBXA 4EGFA 4PVCA 2GD1O 5CG2A 1Q1NA 3ZU2A 3T4XA 2VWPA 1I3KA 4M86A 4MIOA 3ZHYA 4BNYA 3JD3A 3ZWPA 2QG4A 3PJEA 4LW8A 5IDYA 3DBHB 4BMSA 3KV3O 2GN9A 3VPXA 4U7WA 1RPNA 1KVQA 3MOIA 4ONEA 1YB5A 4L8VA 2C07A 2EEZA 3F3SA 1FDSA 2CF6A 1D7OA 4LMRA 4OXYA 4TRNA 2I99A 3M1AA 3IKVA 1I32A 1AUPA 2Q45A 3PWZA 3B1JA 1VSUA 3HUDA 3TJRA 1XLTA 4YEDA 1IE3A 3GMSA 5JO0A 4E2XA 1PGPA 3QVSA 3NT5A 5I7EA 5COBA 2QRJA 1BVRA 3PGXA 4PN3A 2AE2A 3S1LA 4RPKA 2XPCA 2IEBA 3LQFA 3V1YA 1YBMA 4OHUA 2NACA 2YFQA 1NPTO 3U5TA 5T57A 4QO7A 3LF1A 3LSYA 5JDCA 4MVJI 3DZJA 3ZWNA 4BS9A 4GKBA 5JDIA 4GL4A 4Q3DA 4YRAA 1G0NA 3BA1A 1IL0A 3LYLA 1CQJA 1Y8QA 3RUEA 4L76A 4JQCA 2FHSA 3KYDB 1NHWA 1LDMA 3PYXA 4AJLA 5BSEA 3SJ7A 1B3BA 2GDZA 3QE3A 4W9NA 4BNUA 2BELA 1JVSA 2BHLA 3VH2A 4RF4A 1WDLA 1XU7A 5TSDA 3AI3A 3PDJA 4GLOA 3GT0A 3UAGA 2G82A 4ZA2A 4XKJA 3WXBA 3I6IA 1FXSA 3L9WA 3U4IA 1ZEMA 3GMDA 2AEJA 3H3FA 3ANLA 4NK5A 2DTXA 3C7DB 3CSDA 1I3MA 4DTIA 5KVVA 5HTOA 2A92A 1LX6A 3DTYA 4YJDA 1HLPA 1L7EA 4IY1A 5DZSA 2VOEA 3E9NA 4CV3A 1U8XX 2EW2A 5TF4A 2ZB8A 3U4DA 5F1OA 1YQDA 4IS2A 2J3HA 2X23A 4R4JA 4D43A 1CQIA 4EUHA 1KVUA 3OSUA 4A73A 2VHYA 4GX2A 3JYQA 1DIAA 2ZB4A 3NJ4A 3HDYA 4PZEA 1RM3A 5CPBA 1UDCA 5IG2A 2NWQA 1LA2A 4Q3AA 5AOVA 2IDZA 5JNLA 2GN8A 2EF1A 5DP2A 1RYEA 1PGOA 4M49A 1P1FA 3ROMA 1HEUA 4RPHA 4I1IA 1EUCA 2DBVO 4Z9YA 5ICMA 1MFPA 3OETA 5JPIA 1GUFA 4PVDA 5G4KB 2FPPA 2GN6A 3VZQA 4OYRA 1O8CA 1QSGA 3CINA 3JSAA 4DMLA 2ZIZA 3FI9A 4RF3A 5DF1A 1YDEA 1I24A 1ZJZA 3G1UA 3KYCB 4BO1A 1U4OA 1IHXA 3R1IA 1F8FA 3GY0A 2CDBA 4YAJA 3WBFA 2NV6A 2PWZA 4TROA 3ANNA 4ZICA 1QYDA 4N7RA 2CD9A 5T64A 3ZV4A 4KDEA 3Q2IA 1P44A 1YBVA 3TL2A 2H6EA 1M2WA 2HJRA 3U49A 2AG5A 3GG9A 1W6UA 1XSEA 2YV3A 1FDWA 1E3WB 3MOGA 4LVUA 4RVGA 1MC5A 4LCJA 5GMOA 4CMKA 5ADHA 9LDBA 3E8XA 2ZJ0A 2VYVD 4M89A 1SOWA 2DM6A 4UUOA 5A02A 3DBLA 1QR6A 3KSDO 4YT2A 2X4GA 1TB4A 1HZJA 1B15A 5T8KC 3P2OA 1Z74A 1LC3A 1U3VA 3H9EO 4DREA 3KZVA 1HWYA 3HNPA 4DPMA 1YRLA 4KOAA 4R01A 3ADOA 3QHAA 1UAGA 2E82A 3DB2A 1IUKA 2D8AA 1HDOA 1UJMA 4J4HA 2FPGA 4IDEA 4ZQFA 3WBBA 4RVHA 3DWFA 5CDYA 1U1IA 4ALLA 3S8MA 4BB6A 5F1KA 2UUPA 1Z6ZA 4PG8A 4B3IA 5EPOA 1OI7A 4NFHA 1ID1A 1PR9A 1SNYA 1C0IA 2OP1A 4E21A 3FNFA 5IDQA 2YJZA 2HMUA 2Q2VA 3K31A 2DUWA 3DBVO 2Y93A 3JCZA 1VM6A 1UXHA 2A35A 5F5NA 4Q3NA 4WNCA 3GNTA 3VTZA 3A28A 2X8LA 4MKRA 1G0OA 4J1NA 4L4RA 4FJ1A 1O95A 4YT8A 4I9HA 1QXSA 1LJ8A 1VPDA 1HYGA 4HNHA 2AA3A 1A4IA 1M75A 1F17A 2GF2A 2HMTA 3H6KA 3PFFA 4G5HA 3I4FA 4EITA 5BSHA 3D1LA 1NVMB 2HK7A 3IS3A 3PIIA 3LC2O 3TQHA 1UP7A 1HYHA 1YL6A 3L4BA 3EY4A 3QVWA 1I3LA 4CMAA 3TOXA 2Y68A 4FFOA 4XGIA 3GNQA 2JCYA 3I9LA 3SC6A 3DZBA 3ZN2A 4MVJM 5A9SB 2V6FA 1C3VA 4MVJH 1VSVA 2HK8A 2PGJA 5DULA 5I8ZA 2PNFA 4D46A 1N1EA 3WGTA 1MLDA 4J4TA 1H6DA 5B4VA 4GVLA 4QO8A 2EG9A 1JAXA 1DPGA 1HDGO 3ANMA 4FGWA 3GVCA 1LSUA 5LCXA 1PJSA 1TEHA 3ULKA 5J23A 4IUYA 1ENZA 1T1SA 5TLSA 1JWAB 2TMGA 4YJHB 1E6EA 2RBEA 4WLUA 3EZLA 3VVCA 2A94A 5K6AA 4W99A 2VQ3A 1OOEA 4G2NA 2FZWA 3K30A 3AY7A 4IJWA 1HTBA 4NBWA 4E32A 3U4HA 2HJSA 1K5HA 1BW9B 4PG6A 3ZU3A 2BGKA 5T67A 2X1HA 3H9JA 1UZMA 1V3UA 1XU9A 2P9EA 1XQ6A 2W4QA 1BDMA 2O3TA 4GWKA 4Y6RA 4LRTB 3WGOA 4ESOA 3KETA 5L4LA 3WQSB 2V65A 3IL2A 4XR9A 3RSHA 2P4QA 3ZNPA 3ZHXA 5JC1A 4IJKA 1XA0A 3N58A 4OIMA 2AE1A 3W8DA 1DC5A 1BVUA 4GX0A 2OMEA 1PZGA 4GX5A 4CQMA 2WTBA 3HFSA 2I65A 3KLPX 1A71A 1ZBQA 1LBEA 1T4DA 1V3VA 2F1KA 2JHFA 4P38A 2RCYA 3GOHA 3JQ7A 4FIZA 5ER6A 3CMCO 5AXDA 4FB5A 1WVGA 3QWIA 4W82A 2IZZA 4CMGA 1I3NA 4Z0HO 3E18A 3HFGA 3I9JA 3KEOA 1HDZA 4B8WA 4Z3DA 3GLQA 4CM6A 1HT0A 1TVEA 4JXKA 1U7TA 1ZSYA 4FQ8A 1YBAA 4E12A 3AFMA 4YJGA 5KJFA 1N9GA 5TRTA 3K2BA 4FD3A 1V8BA 4O59O 3LDHA 1DC6A 5KJCA 2VUUA 1R6DA 1T2FA 1U3WA 2PKRA 1O89A 2A9FA 4AJ4A 4H3VA 3T4EA 3IUSA 4PG4A 5JYDA 4QT0A 1E3EA 1P1IA 3KO8A 3PFWO 2EKLA 4J9VA 2CVOA 2VNAA 4NZ9A 4OSOA 1NQOA 5A3VA 1I2ZA 3DTTA 5DCUA 3B1FA 1I10A 4QQRA 1E7QA 4U5QA 1VLLA 1WZEA 4FFPA 3PHIA 2P4HX 4AJ2A 4O6VA 1T4BA 3DFUA 2HRBA 3GPIA 4FFMA 3MJVA 5KKAA 1NFFA 4IINA 4KDFA 4J7CA 4YR9A 4E5NA 4RPGA 4WCFA 3TDKA 3WNVA 1A9YA 1GQYA 3F6YA 3ABIA 3UW3A 5CAEA 1HDXA 4M8SA 4BNHA 5JAMA 3PHLA 1EUZA 1U3TA 1Q7GA 2OUIA 2P68A 3EMKA 3N7UA 1IPEA 3INTA 2I66A 2PZJA 3PRJA 2IYOA 4P4LA 1SMKA 1EVYA 1W73A 2Q99A 4MIEA 5AXCA 5TS3A 1Z73A 3NDRA 2NSDA 2BMAA 2Q2WA 2BGMA 1B8VA 1PU2A 3KSUA 3L77A 2EJVA 3QWAA 4Z0TA 5DOZA 4L73A 2D0IA 4PLPA 3EAGA 3ZGYA 2CDCA 1PJ3A 3I23A 4L4SA 4PZDA 1C1XB 2Y0DA 5KJ6A 1IYZA 1X7DA 4Z9XA 1ML3A 3S2GA 4BO6A 2GPTA 3FCOA 4D3DA 1Y81A 1ORRA 2W2LD 4E2ZA 4RV9A 3WMWA 3LLSA 3O03A 2PKQP 1NPYA 3ENKA 3IIEA 4CM9D 2RHCA 4EDFA 1KY5A 3JQ6A 5KOIA 3STHA 2C54A 3C7CB 1YL5A 4IDGA 1U5CA 3AW9A 1ENPA 5FWNA 1U5AA 3C24A 4RVSA 1CERA 4WLFA 4FR5A 2V7PA 4ITUA 1NQ5A 4RJTA 3F9IA 3R0IA 2NQ8A 4MKZA 1ZJYA 2GN4A 2ZQYA 1PTJA 4XYEA 3HDHA 1SO8A 3L07A 3I9MA 3JQ9A 1QORA 2VZ0A 1O9BA 1WMBA 2ZCUA 4MVJG 4WLOA 1UUFA 2Y99A 2HMSA 4J1SA 3GN1A 3E6AA 3HWRA 1KEWA 4L9RA 4YT5A 5IAAA 1EDZA 2BFMA 2Q4EA 1RM5A 3GDFA 3I1JA 6ADHA 4CLRA 4BVAA 3F5SA 5BNFA 1OZAA 2JCXA 4J2OA 4CM9A 3VOSA 1P31A 3OBBA 5A9TA 1ZEJA 4OAQA 1R4MB 3JQEA 4HFRA 4II3A 2PY6A 2E4AA 3OM9A 4DLAA 5JXWA 3EVTA 4KMSA 5U1PA 2PH5A 4U0JA 1D3AA 2O4CA 3VAZA 1E5QA 4XDYA 4FOSA 4CM1A 3FF4A 4NIMA 5KNLA 3ICCA 6LDHA 3PXXA 4IJVA 4OKIA 5CDSA 3WGZA 5THKA 4FPXA 2UUOA 1BSVA 2VWGA 4E5PA 4B4VA 4B7UA 1G1AA 2FZEA 1CF2O 1VJ1A 3FPLA 4PLVA 1E3SA 4HV4A 1KOLA 5JCJD 1QYWA 2PD3A 3NDJA 2BD0A 4JBGA 2AQKA 3JQCA 2NU6A 5L7YA 4NBRA 3L6EA 3TPCA 4WOJA 4MVJE 5AVOA 1O94A 3NRCA 1R0KA 2ZTLA 1HSZA 1R66A 4CL3A 3PPIA 3IKTA 1PJCA 3O26A 2BKAA 3BHMA 1NAIA 1SAYA 2YDXA 3WFIA 5CG1A 3MZ0A 1KC1A 3VDQA 4YAGA 3B20A 3FHLA 3QWFA 1NM5A 4NK4A 3SBOA 1GYRA 3DBHA 3UICA 5EL0A 3W6ZA 1PJTA 4N5LA 4OMUA 3NGXA 4QSMA 3ZU5A 3NT2A 4DLLA 2DT5A 3PJFA 1LSSA 2VYNA 4XRRA 1KIFA 1Y7TA 3X2EA 1EMDA 3E5MA 2CY0A 3AI1A 1YH3A 2O48X 1SBYA 4XB1A 4EJ6A 2Y1FA 1CYDA 3RI3A 2AQ8A 1HZZA 4XR4A 1NR1A 5JDCC 5DCYA 4RGBA 3RROA 3JQAA 3ZHZA 4RQTA 1Y9EA 3MEQA 3PWKA 4HFNA 2WYWA 2I67A 1DIRA 1W0CA 2FOIA 4XGKA 1Y8QB 1Q0HA 2Z1MA 3PDUA 3K92A 4AJEA 1Q0QA 1MG5A 3AOEA 3PHGA 2Q2QA 4JJGA 5H83A 1NAHA 4E2WA 2DUUA 1UXGA 1Y8RA 3LZ6A 1VKNA 2YY7A 1PWZA 1LQUA 1HL3A 3B70A 5I7SA 1J0XO 3RU9A 2Q4BA 5ILOA 3NKLA 2RAFA 1XHLA 4XCVA 3C1AA 3F4LA 1X1EA 3JD0A 4JJFA 3Q0EA 3Q11A 3HG7A 2PTGA 3WLFA 4E4YA 2Y1DA 1Q0LA 2Y1GA 3KHUA 2DFVA 3EUWA 4ZHSA 3M1LA 4DMMA 1ADBA 2PGLA 2B5WA 3ZDFA 3RUHA 1T24A 3AM4A 5JFOA 2GZ1A 4F6LA 3WGGA 4Q39A 1I5RA 1JQBA 2J3IA 4IGEA 1EK6A 5FYDA 2X0JA 4LVCA 2B37A 2X0IA 3S2FA 3M6IA 1BXZA 1XKQA 1A27A 2P9CA 1ZK2A 3KXDA 1H2HA 2I6TA 1P45A 4J6FA 4BNIA 5JW6A 4INAA 4FGSA 4BO3A 4EJMA 5JS6A 1AN9A 2P2SA 1JA9A 2VUSA 5KWEA 4DBVO 3EYWA 3WQQA 4CM4A 1PL6A 2OOSA 5B4UA 3DAGA 4B4UA 4BNTA 3GK3A 4BL5A 3GAFA 3DZGA 3MWDB 1OMOA 1YKFA 4ALIA 5CDGA 3DZKA 1YOVB 4ND2A 2HU2A 4Y98A 3JQAD 5ES3A 3ZWBA 4CV0A 1ZKMA 2VYND 4YQYA 1GUYA 1CRWG 1P33A 4J7XA 4RDIA 1KVTA 4AL4A 3OF2A 4KTVE 4AJIA 4FN4A 1B7GO 4R5HA 1P1JA 1WLYA 1E1KA 4CR8A 2WYVA 1BXKA 2ILTA 5TT1A 1WXDA 4OKNA 1LSOA 3VKVA 1P74A 1M67A 2PKQO 2VZ9A 1A4UA 1YB1A 4ZQEA 4GSLA 4YJGB 2PLAA 3CZRA 1C0PA 4YQZA 3HQ4O 3A1NA 1ZMOA 2B4TO 2CF5A 3C1OA 4OSPA 1EK5A 4A2CA 4DC1A 3TOZA 4ND5A 1ZH8A 3A06A 3QWBA 8LDHA 1NHGA 1MGOA 4S3MA 4R54A 3C8MA 2BF7A 2RH8A 3DOOA 2QQ5A 3G0OA 4H16A 3AOEC 2PZMA 3F1LA 4KZPA 4A26A 5CEEA 5TQVA 1PJ4A 1Q2XA 3COSA 4BO5A 4R3WA 5EERA 2G17A 2I9PA 1X0VA 3JQ9C 3D5TA 2F00A 1N1GA 2X5OA 4DIOA 4R41A 3VHRA 4LK3A 2EGHA 3LVFO 4BMVA 3FBGA 5IF3A 1NQTA 1F06A 2FR1A 2DLDA 1YJQA 1UDAA 1MA0A 4OQZA 2Q3EA 3D4NA 3R6DA 4FSHA 5FEUA 1TA4A 3VH4A 2WWRA 1LDEA 1ISGA 1DFHA 2H5LA 3ITKA 4B3JA 3TFOA 1LTHR 4Q3EA 4W7HA 3ZWCA 1DEHA 2C5EA 1UZLA 4ZJUA 5C37A 1NFRA 1P1HA 3CPSA 4HP8A 2I76A 3JQ8A 4BOYA 3WICA 3GZNB 2ZB7A 2YHUA 3EHEA 3PLNA 1PL7A 3DZIA 4M54A 3AUUA 4C4OA 3F1KA 5BR7A 2QZZA 1QYVA 1LUAA 4OGWA 4DVJA 3PYLA 4YT4A 3VZSA 4XB2A 1VJ0A 3CZMA 3A14A 2HRZA 2A4KA 1GQ2A 2C2YA 2D5AA 3GHHA 3A9WA 4UUMA 3PP8A 2VYVA 4GH5A 3TFQA 2I3AA 4MIYA 3EVNA 1SEPA 1TXGA 3IP1A 4DQUA 3PI7A 4XD2A 1SZJG 4YACA 5IDXA 4RLSA 3ZWMA 1ADGA 5L7TA 2OFPA 5DT9A 5I9NA 4AJKA 5CDUA 4BQPA 3IC5A 1EE2A 3A4VA 4ROSA 4LRSB 4YB8A 2JFFA 1DRUA 3W8EA 3EZYA 5K6AC 4RF2A 3JYOA 4A5OA 3VPFA 2W2LA 2VHWA 1O6ZA 3WJ7A 2NU8A 1JN0A 4LN1A 5CDTA 3AI2A 1ZZEA 3JQDA 1MV8A 2O2YA 4IGFA 4WPGA 5IXSA 4CLDA 1PJLA 1PS9A 4GMFA 5I9MA 1LDGA 2V6BA 1QYXA 5I7FA 3BXXA 2P5YA 1U8FO 3OECA 3FTNA 2NTNA 4PZCA 2VHZA 1JTVA 4J43A 3UKOA 2ZQZA 2DC1A 3RFTA 3RFVA 4UEJA 5H82A 3DXFA 4TMFA 4CUJA 2D5CA 1WZIA 3DZFA 3H8VA 1JKJA 3WLEA 3S55A 1DDOA 1DFGA 4BKRA 5JDIC 4BNKA 3D4OA 2C5AA 4WCDA 1BHSA 3O4RA 2HSDA 1QV6A 5L53A 2TMDA 2X7HA 2R00A 3GHYA 3ZWWA 1QMGA 3OEYA 1GL3A 1HE5A 2ZTUA 4R9SA 4MINA 2NVUB 4NNJA 2NTJA 3JYLA 3TZQA 4CL8A 4DPLA 1Y1PA 3VZRA 4I9UA 3DOCA 1X14A 5LDGA 5TNXA 1R0SA 4G81A 5JE8A 3ZH2A 1VL6A 3NJ8A 1BGVA 1DC3A 1MP0A 3GDGA 3MJ4A 1B0AA 4GAEA 5B12A 5HS6A 7MDHA 1Q7BA 3WX0A 2VN8A 1KYQA 1ZW1A 2GGSA 4MVJF 3QJ5A 2BI7A 1A7AA 1DAPA 1P3DA 2CVZA 4HXYA 3GRKA 1F0YA 5HWSA 5L95A 3TF5A 4JIGA 1KEUA 4WECA 3ZV3A 2UDPA 1DHRA 1PQWA 1HE3A 4OOFA 3S2EA 3PEFA 2QHXA 1CDOA 2GERA 1A5ZA 1E1MA 3LU1A 4R69A 4PIVA 5TC4A 3ZWVA 5DP1A 3TSCA 1LLDA 1XGKA 2H1SA 5AYVA 1B16A 2NVWA 5LDHA 1BRMA 3H9UA 1E3WA 1ZNQO 2J5KA 2O50A 1JW9B 3MTGA 3SLKA 2YQ5A 1RKXA 3OFSA 3B6ZA 2G5CA 4F6CA 1GCOA 4XDZA 2C20A 4FCCA 3BMNB 3RVDA 4NJMB 3D7LA 3H7AA 3GQVA 3RUAA 3RFXA 3JD1A 1XELA 3JQGA 1KY4A 4Y6SA 1B14A 2IXAA 5G2OA 2WD7B 2UAGA 1E7WA 1GU7A 4XQGA 4YVFA 3UFXA 4YTEA 2EGGA 1I2CA 3WOHA 3O8QA 4RORA 2UYYA 4EW6A 4BKUA 4ZU3A 1LC0A 4NJMA 4XEHA 2FR0A 1KVSA 2NADA 3PJDA 1ADFA 2O3QA 4J7UA 2V6GA 2IYPA 3BAZA 5KJ1A 1YVEI 3WQRA 4AJOA 5L45A 2CUKA 2NM0A 3DBRA 4WJZA 5G0WA 3RC7A 3RJ5A 2DFDA 3MTJA 4C7KA 3WG9A 5FF9A 3MJSA 3UVEA 2Y1CA 1V3TA 3BTSA 4K6FA 2GNAA 3NV9A 2DBZA 2GRAA 4FOOA 4N54A 4YBZA 1R4NB 4UVDA 1ZK1A 4RZHA 4QUKA 3BHIA 4OM8A 1PEDA 1KEPA 2IZ0A 1ULSA 1HKUA 1N9GB 3IQDB 5CEFA 2JD2A 5I9LA 3WGQA 5A04A 3QVOA 4PLZA 1JWBB 4GBJA 5ENDA 3U09A 1PL8A 4XWYA 1I0ZA 4IDDA 1IZ9A 4YWJA 4FS3A 3GAZA 4OXNA 4ALNA 3RIHA 3FR8A 3S2IA 1P77A 1B2LA 2VT2A 1GUZA 2WMDA 1YQXA 2AW5A 3L4SO 2O23A 1DO8A 1F8GA 3KYDA 1P1KA 3AU8A 4BNGA 2J3KA 4HBGA 3BMQB 3IJPA 4U6SA 4J91A 5ITVA 4C7JA 4FFLA 3V2GA 4YCAA 2WYUA 3GR6A 1FF9A 4CPDA 1NVGA 1ZFNA 2W2KA 3GF4A 2EKQA 3H65A 3TZ6A 2E48A 1WPQA 3GVHA 2BFOA 1BWSA 4Q3CA 3GVXA 1NVTA 3OMLA 4JBHA 5TX7A 4CR6A 4R5MA 5FI3A 4A03A 1R37A 2VRCD 2VHXA 5C3MA 2NVBA 2HQ1A 2WM3A 4FW8A 3RKUA 5L4NA 4RLHA 1ZO8A 1ZXLA 3LT1A 4BB5A 3AFNA 5DCWA 4E33A 4HNGA 3AJRA 4GWGA 1CJCA 5MDHA 3DHNA 3LC7O 3WR5A 3DBRB 2G1UA 4J0EA 3VPGA 3H9QA 4ZQHA 3AUAA 3I3OA 4PCVA 3GUCA 4Y9DA 4U8GA 2PH3A 3DC2A 1C0KA 4OXKA 1WNTA 1K6JA 3CH6A 3JYNA 3JQBC 3WSVA 4B79A 3D0OA 1X15A 2FY8A 1DIBA 4IDFA 2DPHA 4DA9A 3FNEA 4MO2A 4EEZA 5A9SA 4DRYA 3AY3A 3DHEA 4UULA 1CETA 1XYGA 3H9GA 4B7XA 1LRKA 3E5RA 3BMNA 2HO5A 2YHIA 4PFJA 4UEOA 4IIUA 4N5MA 1H0KA 4L0QA 3UN1A 2E49A 4MKXA 3ZWXA 1MXFA 4YYZA 2UV8A 4LSWA 3OIDA 4N5NA 1J49A 5L3ZA 4Q9NA 2DBQA 2Y05A 3RC9A 1GEGA 1D4FA 1XIVA 2EJWA 1FDTA 1PR3A 4GX1A 3JQFA 3UCFA 4J1QA 4LCEA 4NHEA 4CMEC 4F3YA 4AICA 3G1TA 4HFJA 2AXQA 4JLWA 4QTZA 4RO0A 2YV2A 3UGKA 4WEQA 3GC6A 4EZBA 3RUFA 1AHIA 1PZFA 3OA2A 2C2XA 1GDHA 4YPOA 2W90A 1XR3A 2CVQA 4TKMA 2EHDA 3U4CA 1W8DA 4J2HA 4NBTA 4IQ8A 1JLLA 1Z82A 1U28A 3L9XA 3I83A 1ZXBA 2ZKLA 4NMHA 4TQGA 3TL3A 4GSKA 1MB4A 1RWBA 3H5RA 1XDWA 3F47A 4YAIA 4JROA 5EQDA 3JV7A 3P2YA 2CDAA 4CUZA 2XXBA 4GVXA 4E31A 3OJ0A 1X13A 3ZW9A 4LMPA 2OBYA 2WDZA 3I5MA 1IOLA 2YQ4A 1XCBA 4DBZA 4R9RA 4DC0A 4JNKA 4YJFB 3GEDA 2O2SA 4JP3A 2Y0EA 1JAYA 3LT0A 4W9NC 4YDRA 4I5EA 4CM4B 5U4QA 2JHGA 4CJXA 5B1YA 3E1KA 3OJOA 4ALJA 3OIGA 5TT0A 3WB9A 2XAAA 4BGUA 4CUKA 1ZCJA 2FRDA 2BI8A 1K3TA 2J3JA 5COAA 3WYBA 4ZRNA 3DR3A 5G0TA 3KBOA 1QRRA 4GPD1 1GY8A 2AG8A 5JY6A 4NH4A 2J8ZA 5BNIA 1J6UA 4RCVA 1WAMA 4BGVA 4UAGA 2BFAA 2WEKA 4L74A 3UH1A 1WP4A 5CPFA 4JCOA 1NASA 1LEHA 2ZYAA 1AE1A 3DMYA 4OO3A 4L75A 5KIAA 1T26A 2D4AA 2WJPA 5TGDA 4BO4A 5JY1A 3OQBA 4BV9A 1DLIA 1YB4A 2H9IA 3ONEA 4PLTA 3PWSA 1PS0A 1YE3A 4UEKA 1JVBA 2B4QA 2IEDA 3KYCA 3ASVA 2VZ8A 2AHRA 5A9RA 2EIHA 3HDJA 2HDHA 4F46A 5HBRA 2FR8A 4W4TA 3I9KA 3KM0A 1JDJA 3LK7A 3HN7A 1LRJA 4U0KA 4YRBA 1LLCA 8ADHA 3OICA 4E5YA 1DHTA 4WE3A 4WGGA 4MOWA 1CWUA 2C0CA 5AXBA 3IJRA 1QLJA 4WUVA 5F1PA 1DB3A 1ISMA 3GA0A 3V1TC 4J4BA 5THQA 1N7GA 3HJAA 5C7OO 2ZATA 4KQWA 2X9GA 1EE9A 1GYPA 2DVMA 2DPGA 1PWXA 2VWHA 3NDIA 4JJIA 5EN4A 3QW2A 1RM0A 1PX0A 4IZIA 1X0XA 3CIFA 2JD0A 4A7PA 5A4DA 3I52A 1V9LA 3OIFA 1RYDA 4CMIA 2OORA 2Q1TA 1ISJA 3IP3A 2DTEA 4OOEA 4PLCA 1EFLA 2QX7A 2W98A 3I9NA 1EEHA 2DQ4A 1E5LA 4DLBA 5IN4A 4IPTA 5JYEA 1PJ2A 1GEEA 2BH9A 4XIJA 4P4NA 4Q3BA 2O3SA 1V6AA 3D3WB 4RF5A 1UXIA 4CM7A 3WGIA 4YJFA 2FSVA 2ZTVA 4PRKA 4Z0PA 1N5DA 4EUFA 1C14A 3U62A 1M66A 3NUGA 3QVXA 1NYTA 3EW7A 2CFCA 4FJ2A 3JQAB 3GG2A 3OH8A 2YFHA 3TRIA 3TWOA 1D1TA 2WD8A 5EINA 5JLAA 3VH3A 2QYSA 4P4GA 1DIHA 1LLUA 3B1KA 3K9QO 3INGA 4JN6B 2R2GA 4CQMB 2VTDA 3PQEA 4GI2A 4L4XA 1LSJA 4MPDA 2GCGA 3K2EA 1KBZA 4ZN6A 2P5UA 1E92A 3TZCA 5EJ2A 3DAPA 3BTOA 4BKPA 5AXAA 3K6JA 3WSWA 4QECA 1B3RA 1MXHA 3V1UA 5A3JA 2DTDA 3ROKA 2Y1OA 1E77A 1PQPA 3RU7A 3R3SA 1ZSVA 5HRUA 5C5IA 3WWZA 1R15A 1GZ3A 2QW8A 1E7YA 1ULUA 3AM3A 1E0DA 1E7RA 3BMOB 1ZIDA 4H15A 2NLOA 1IB6A 2ZYDA 3PVZA 1ZVMA 4GQAA 1YONA 4XX0A 1I8TA 2Z5LA 3EDMA 3MJEA 4CQLB 4BNWA 1ARZA 2E6UX 3GRPA 2RHRA 1SCUA 4M1QA 4JX8A 2RH4A 2QRLA 1S7CA 2C59A 1GCUA 5A1TA 4IM7A 2VNSA 4A0SA 1NTOA 5DBIA 3WNQA 4F45A 5DNAA 3JYPA 1KERA 3BMCA 4PGFA 2EWMA 3QP9A 2EXXA 4QEDA 4R1NA 4WKGA 3UCXA 4S1VA 5BSGA 1YGYA 3RCBA 1FDVA 3FBTA 2AQIA 3UXYA 1EFKA 3BMOA 4BGIA 1KETA 2JFHA 4DIFA 5L7WA 2XOXA 1DIGA 1GV1A 3PTZA 5A05A 1T2EA 3NTOA 4AJPA 2EKPA 1LDNA 4YJHA 3SLGA 4AVYA 5KKCA 1SOVA 1U7HA 3VPSA 1Y5MA 1DLJA 4J49A 1Z45A 1IZ0A 4JP2A 4AJNA 2YHIB 5DBGA 2OZPA 1H9BA 1C1XA 3NEPX 1I01A 3WMXA 1YJ8A 3BTVA 3MJCA 5G4LA 1GADO 1PZHA 3WTBA 1W4ZA 3CEAA 3H2ZA 1Z75A 3AM5A 4FDAA 5A5FA 1DJQA 2ZK7A 4M55A 4CLOA 1L7DA 3UOGA 5B4TA 4BO0A 3H5NA 3P7MA 2EP7A 5G4KA 4P22A 2VOJA 1Y6JA 4HFMA 5IZCA 1U9JA 4NI5A 5JMPA 4Z6KA 1YWGO 1GQQA 3P5SA 4BO9A 2XXJA 4WLEA 4NR0A 5COQA 4BNZA 3LLVA 4IJUA 3GFGA 3GUYA 4B3HA 3Q1LA 4NDNE 2CNBA 3O38A 1NR7A 1YDWA 3ONFA 4ZQBA 5DN9A 2Z1NA 5GZ6A 2G76A 3GVIA 1N8KA 1YQGA 4BIIA 1QV7A 4BGEA 1BMDA 3HZZA 3RC1A 5LC1A 3TN7A 4DYVA 4BNFA 2ZTMA 3WYCA 2C29D 1P0FA 3Q2KA 4KWIA 4PLGA 3KTDA 4TZKA 3V8BA 5TJHA 4ALKA 2B5VA 2FMUA 1YL7A 1LDYA 4K6CA 1GZ6A 5G0SA 5JCXA 5K0ZA 4NBVA 1NWCA 2ZYGA 1PJQA 4R3NA 2FPIA 5ITWA 5KVCA 4AJJA 3H4VA 3D4PA 4O1MA 5T5QA 3PHHA 3WFJA 4DGSA 3MCVA 3K73O 3P19A 3ETGA 5IXYA 3ROPA 1XWFA 3VC7A 1U2GA 4MVJD 3RUIA 1QG6A 4DUPA 2V6MA 5L9AA 1ZK4A 1N92A 3DONA 3GZNA 4CLHA 5BSFA 2GZ3A 2HKIA 3H2SA 4AG3A 3W8FA 4NFSA 4D41A 1MC4A 4TRMA 3G3EA 1PJBA 3UCEA 3H5AA 3ON5A 3PJGA 1NPDA 3OP4A 3WIEA 1A72A 1VKOA 4UVEA 1BXGA 2SCUA 5C7IO 1UAYA 3AU9A 1RM4A 2GYYA 1FDUA 2GZ2A 3RASA 4I8XA 4OL9A 2W8ZA 4CM3A 4IBOA 1LLQA 1ZK3A 1Y8RB 4K28A 1QYCA 3G79A 2NNLD 2PZKA 3IAHA 2VCYA 1H5QA 3W4KA 1Y5RA 3CMMA 1PS8A 1BXGB 1BDBA 2AEFA 2O7QA 5F21A 3SEFA 5TIIA 1DBVO 4KUGA 3RBZA 1U3UA 2ZJ1A 5JBIA 4WOKA 1BW9A 4BNLA 1SB9A 3RD5A 3NTQA 1UDBA 5TJ9A 4QFCA 3QIVA 4XIYA 3IUPA 4Z9FA 3W4IA 2O7SA 1FMCA 3WGHA 3I9OA 4PLHA 4NG5A 4NBUA 4XJTA 2YDYA 3ZWOA 2POQX 4B8ZA 3ZNOA 2R00C 1K0UA 4R1TA 2QZ9A 3QVTA 4UUNA 3RAJA 4GMGA 4KP7A 5B37A 1EQ2A 4WASA 3CE6A 3OJFA 4IDCA 1LXCA 1UH5A 2PV7A 2GASA 3RJ9A 4H7PA 3L0DA 4X54A 4BKOA 3Q9NA 3ADPA 4U6QA 4LSMA 1GPJA 1HDCA 1HXHA 1TI7A 1S6YA 1SPXA 2EW8A 2GO1A 4HWKA 4TZTA 4D79A 5ER9A 3RQSA 1R4NA 4ZD6A 5CP8A 1UZNA 4EEXA 2HUNA 2PA3A 3QLJA 5KCZA 4RPJA 3AK4A 3PLRA 2JD1A 2EP5A 3FD8A 1EVJA 3IOYA 1H6AA 1R0LA 1X7HA 3BYZA 1H6BA 4W6ZA 3KLMX 3SJUA 1DSSG 4XJSA 1MG0A 1XEAA 2FN7A 2X22A 3DMTA 4IDAA 4IMRA 3ZNNA 3D64A 4FC7A 3O8QB 2HMVA 1NFQA 3D3WA 3PQFA 1IULA 1HETA 4UVGA 5CEJA 2JJYA 4CM8A 2C82A 3JQGB 1T1RA 3ST7A 3U3XA 1M6WA 5I7VA 4WLNA 3W6UA 3CKYA 2Z95A 1DAOA 2CZCA 1CIVA 3FRJA 3K8ZA 1NP3A 4PG5A 3KSZO 3ORFA 3DZHA 3ZI0A 4XZ3A 3EC7A 3PZRA 4KQXA 3RWBA 5HM8A 1E1NA 1A7KA 4O63O 1T25A 5KTKA 1K6IA 5EQFA 1GFSA 2YV1A 1GR0A 4CMHA 2PGDA 3W4JA 3JD4A 2YYYA 1E7MA 2QYTA 1ENOA 3UHAA 2WE8A 4I9NA 4DWVA 1XQ1A 4ZVVA 2QIOA 2JAHA 2B83A 3KYBA 4CLEA 3DFZA 1I30A 2PFGA 2P91A 4FFRA 4CM8B 3U9LA 3C85A 3WDSA 4DL9A 3AY6A 4J3FA 1EBFA 1VJTA 1CEQA 3QQPA 3PYMA 1LI4A 3QWHA 3BZUA 4IQGA 1UXKA 1MUUA 2DAPA 3JQ7B 3ZWAA 4Y67A 1Q7CA 3O9ZA 1ENYA 3FTPA 1DXYA 4HUJA 2NU7A 4PRLA 1SB8A 4R1SA 2X0NA 5ILGA 2HLPA 3BTUA 3JQ8B 4OQYA 5BT9A 5JAZA 4A10A 4BUCA 4ZRMA 2H63A 1BG6A 2B69A 5MGBA 1H2BA 1OC2A 2D1YA 5K9ZA 4DQVA 1WDMA 3PK0A 2NUAA 3OJLA 3MJTA 1DFIA 4BV8A 2BRUA 2WE7A 1GTMA 3KRTA 4NU6A 4RZIA 4W7IA 5F5LA 3DL2A 4TSKA 3M2PA 4ND1A 4ND3A 2B4RO 4DYDA 2YUTA 3N74A 2Q46A 4M87A 4K9DA 3EGOA 4MJLA 3AOGA 4JK3A 1HDYA 2X9NA 3HADA 3Q3CA 3HN2A 4WCFC 2ET6A 5ENVA 1E3LA 3OEWA 4J0FA 5I8WA 5IZCC 1UR5A 2Q1WA 2HMWA 4RQUA 4UUPA 4RVFA 3CXRA 4KTTE 4UREA 3KVOA 4NPCA 3ZWYA 4XQCA 4BNJA 3ETEA 3KOUA 4AFNA 3WGYA 1GYQA 2IE0A 5F3RA 3WJAA 4YA6A 3KUXA 3C1TA 4FC6A 3NTRA
chains in the Genus database with same CATH superfamily
5HUQA 4RK6A 2VHUA 4JJAA 1Z2EA 1K75A 3HSSA 3IP9A 1U11A 4NEGA 4PYRA 3PXDA 4IIVA 4DA0A 3ETDA 4YV7A 3R77A 4TKUA 1RNLA 3THRA 5G41A 1BDHA 1U2DA 2V5AA 2GHQA 2E6KA 2PLFA 3CNHA 3QG5A 4PAGA 1ZMTA 1OFGA 1LY1A 2RGWA 5JCJA 4W5WA 3NHAA 1A95A 2ZXFA 2BKUA 1P91A 1M76A 1FJGB 2Q4TA 3JQBA 4E1AA 3EUFA 4EHHA 3PPXA 1GWNA 1ODTC 1PR5A 3QRWA 1GRNA 4MYUA 2Y0CA 4NL4H 3BA6A 3FPJA 4YAKA 3VPBA 1JMYA 1IM8A 1MFZA 2ATCA 2WJ4A 3AF1A 1PVOA 1JA0A 4N40A 2OZEA 4GBED 4CETA 2BHNA 2ZG6A 1Z4LA 3QF4A 2W2PA 3K6RA 5F7XA 1JEQB 1KF0A 1M10A 2FPWA 1ZMRA 4MVXA 3WK9A 5HA5A 4HTFB 1ACMA 3LF2A 2CSUA 2X9QA 2P0EA 4D0NA 3VNUA 3BUSA 2V4MA 4FYHA 3M5PA 3WGLA 3CURA 4PYMA 1XTTA 4QDTA 4JT8A 3REQB 1E6WA 3CH4B 3AERA 4TPKA 5BYAA 4YECA 1UBGA 4X8LA 4DJJA 3PQCA 1O0SA 1KL7A 3CUKA 3ND8A 1RBZA 4MP8A 1NBME 1XRPA 2IXBA 4QXMA 3FWPA 4NJOA 3ZHTA 2FMKA 5CB4B 1EP1B 4MV3A 1SEVA 1TTPB 4CMBA 1WBJB 4IWXA 3T54A 2OQVA 4PQYA 2ZSFA 1UT8A 2I33A 4KQHA 1I7DA 4KYVA 3UWKA 1D1SA 1Y8ZA 1D2MA 3JPYA 3FPCA 4LOHA 2H29A 4KVFA 1QJ4A 4UJ3A 1ZD3A 4WK4B 4MEJA 1LWOA 2W83A 4S1WA 5ITZA 1P9LA 1D4OA 2EKBA 2B36A 2IZ1A 3WYEA 1VE3A 5DYNA 3FTDA 1YNOA 2YC4C 5KO2A 1TUEA 1RAAA 1XZNA 2Q1SA 2HWYA 2VJDA 4E6EA 1X7YB 3FR7A 1EVLA 2Y67A 3PGA1 1W0KD 1AHHA 1OXVA 3K4HA 1VGVA 3QSGA 4M8IA 5CM2Z 1G60A 2BFPA 1RKUA 2IEGA 4WD3A 5ALGA 2V45A 1PGQA 2K5UA 2OXIA 2IPOA 2PANA 3ND7A 3F4BA 4BMNA 4RVDA 2AMFA 5J1SB 4R05A 3O4IA 4NFYA 4E5UA 3I4CA 2IS1A 1WCWA 4MS3B 3UMBA 2XCOA 4DLZA 4DR1B 1CPYA 1WXEA 1ISHA 1UP4A 1YOVA 3SY8A 1MO3A 4GKVA 3GIDA 1J8DA 3ZX5A 2ZM6B 2N47A 4QGGA 3F7TA 2ZB3A 3DZDA 4DT1B 4MPRA 4PNHA 5TVKA 2HEGA 4I55A 5CMLA 3ZE7A 4BRZA 4B80A 5JBQA 1P39A 2R87A 3ENNA 4OJQA 2R8ZA 2IOHA 5FV4A 1M1YE 5H8WA 3V4LA 4YLYA 1QVAA 1WCIB 1L5OA 2YNMC 2ZUSA 5HKKD 1QYIA 1VIAA 1X70A 2CMDA 5JQWA 2PZBA 1MNQA 1PDVA 3OTOB 2CUNA 2P40A 1UJCA 2PLRA 3NFRA 5ES4B 3WIBA 1TK9A 3GLUA 1NIJA 3IP6A 5KREA 3MCAA 1Y1QA 1E3IA 4EKYA 4OJNA 2JJ2D 4POOA 5HFJA 1XA4A 2J7PA 2VP6A 3M6VA 1AS2A 1E3JA 5KJEA 1KOGA 2IYLD 5K01A 3X2FA 2GTIA 4UOEA 1OZGA 4ZO7A 2YBDA 1AGNA 4F84A 3GRUA 4Q7KA 2VJQA 5CFZA 1DKMA 3EG9A 2PX6A 2VRBA 3QV1A 1EFPA 4HL6A 1XMQB 1EVIA 1KNXA 1QOZA 2C9DA 1PWHA 4X1IB 1ZIPA 1JIUA 5ECGC 3RH0A 4NXNB 4BP3A 1TMKA 4DCPA 3OZWA 1SUIA 1BN6A 2QUAA 3O4HA 3UQZA 5B1HA 3S2YA 4DM7A 1PGJA 2NU9A 2Q0QA 1XG5A 1H42A 4YV0A 2AX4A 1WR8A 2OY0A 5FLXA 1FNNA 4WNIA 4BB9A 2IRWA 1MDBA 1RPTA 2IHBA 3EFEA 5FQNA 3WYGA 3H83A 3OZUA 1KZ6A 2Y4NA 3E5NA 4IMIB 5JD6A 2EVWX 5K8CA 1KWKA 1KZ9A 2KLBA 1E6UA 1D1PA 2VRCA 2VK2A 1P2DA 3E82A 4MQLA 3ESXA 3KKZA 1GAEO 4D5GA 3IAAA 1ZL2A 4JLMA 1G7CA 4NQZA 3H1TA 1FNDA 4Y6PA 2FSUA 1Q6ZA 3V2IA 2ZRFA 2BEVB 3WL4A 1XRNA 2VEDA 1WWKA 3I1YA 4KN6A 4RUKA 4TTAA 4LGVA 1PGNA 4D97A 4YUYA 3WAKA 2M98A 2EQAA 2QUBA 1FK8A 2D3TA 2R66A 3LP6A 4MEBA 2AC7A 4A4DA 1CUBA 1W75A 5AI8A 1VKJA 3IESA 1CDZA 4ND8B 4ZHQB 3PQ4A 1C3JA 3DO5A 2V7XA 1G6Q1 3EUAA 1T3HA 4CMEA 4UPDA 1FE8A 3UUWA 4H60A 3H1EA 3TRJA 2X0DA 4QXAA 4D3FA 1M5TA 2UVPA 3DDZX 3PGLA 1CZKA 1NXWA 3QBDA 1GNLA 3TFWA 5JT1A 3K9FC 4LAFA 4QG3A 1E2PA 3A31A 1LI7A 2B99A 5L6MB 1SHJA 3A1WA 2GF9A 1Y3CE 4Y7CA 4MQFA 4BNNA 1AXEA 4PYLA 4QC2A 3TLGA 3RS9A 2VTBB 3UPUA 2FP4A 2IYVA 1F6BA 4DWWA 1NRXA 4DILA 4FX2A 4K5QA 4M1MA 3BB1A 5JC8A 1GSAA 2PUVA 3LUBA 3ZJTA 4DCTA 5JXHA 2EKZA 3EPRA 3T9FA 3PEWA 3D6TB 5BUQA 2PFKA 2CK3A 3GRAA 4RLFA 2KMLA 1NI3A 3CB4A 3M89A 4CLOB 1E89A 4OHYA 5JAQA 5DBEX 3T94A 1PBTA 2J5QA 1CDDA 1WMEA 4OL0A 5T8KA 3NX4A 1TYZA 1AXRA 1E94E 5H81A 3RK1A 1TMOA 4QU5A 2C7VA 3DCNA 1E4EB 1OFIA 3LTEA 4BEVA 1XJQA 5MHTA 1ECGA 2RI0A 3BXPA 3RYTC 3GGGA 3RHZA 2VTKA 1LU9A 3TNYA 1TYEB 4GMXA 4UE2A 2G5GX 4ZT3A 2G6TA 5BPFA 3Q6IA 1RBYA 2JLUA 1UMBB 5DK6A 4MVJA 1KSFX 5DHRA 5IH3A 3L7NA 5DWQA 3X2SA 2PM8A 3RRZA 5CCEA 1KK0A 1EZ4A 3U19A 3LXUX 1NVFA 4RDXA 1DTSA 2F48A 4AZTA 5IM4F 2HK6A 3GDOA 4RCZA 1I2BA 2GJ4A 3GEMA 3RRXA 4CNQA 2JGLA 3P5BA 2WSSA 3FM9A 7MHTA 1MVOA 3VHXA 3X1ZA 1V5IA 3I2GA 3UK1A 4BQFA 3LYHA 1Z08A 3KS9A 4HI0E 4QVGA 1EDOA 3OHSX 5EMHA 4IDBA 4TWJA 1F14A 3NHJA 4ZJZA 2HRRA 2C3YA 3I0NA 4CKBB 2I8AA 1KMMA 2HBQA 5AW1A 4HN2A 1J99A 3K35A 4UCWA 2HR1A 3LQYA 1P5JA 1Z68A 3DAYA 4RJIA 2CB0A 3IMKA 3IAUA 2CFIA 5C8YA 4ZQGA 1C0LA 4URFA 1QKIA 4YGYA 2O19A 3Q12A 1FNBA 1H9AA 2OXEA 5JASA 1A9ZA 2EZ4A 5H3HA 3I37X 2QRKA 2I55A 1R0CA 4RD3A 2O14A 2X58A 2HX1A 4P82A 4R7TA 1JHOA 2XUJA 1KZYC 2I3GA 2PIAA 5E9AA 4B81A 3BG5A 1TEZA 1HURA 2G8NA 3K1AB 1DXQA 1TJ5A 3NM4A 2FPGB 4HX5A 4II2A 4JI6B 3SHTA 3FFBA 1C7RA 3L4BC 3PGJA 3V8PA 3NTLA 1X77A 2AJ8A 2ZSAA 4BAZA 2FB9A 1C4KA 1Z8NA 2Y71A 2BGLA 3GLRA 2EQBA 3IUNA 2A9JA 2R25B 3E9MA 3BKWA 3QA3E 1Z0SA 2G07A 4HWPA 1DOHA 4KN5A 1MB3A 3TCKA 4CT5A 2VH2A 1U5BB 1R27A 4OU4A 3UMFA 5JVDA 2O3JA 5GZ3A 5HK9A 5E6RA 5IHXA 1C1DB 4L95C 3O3OB 1C4OA 4UC0A 2VWQA 2JKVA 4IVPA 5JQGA 1TOAA 2VSFA 2XECA 3HCNA 4EMUA 2ACKA 4OHKA 4N8EA 4F2PA 1TUBB 1HX7A 4E3ZA 3QE0A 2NQTA 1OAKA 2V59A 4Q9KA 1X1TA 2GJSA 2AXNA 2RKWA 3A2LA 3KYJB 3WL5A 2IU6A 4MYHA 3I53A 4BX3A 1GPWB 2FKAA 3PQ5A 1U3CA 3TZHA 3IAFA 1XB2A 4FUQA 4A27A 2JKYA 2DECA 3W1VA 1DCFA 2BBWA 3D81A 4HDKA 2TS1A 1KYTA 3VKUA 3DE1X 4O0LA 3ZQ6A 3ROFA 4FGUA 2OL4A 4RDHA 3WYAA 2PG3A 3D5QA 1E1LA 1MOPA 1TLTA 2C9MA 3BWDD 2EAUA 3CR8A 3FNHA 1UEXC 4JLDA 3I58A 4KFSA 4P7KA 4TVBA 1JFFA 4JBIA 3QV2A 4TVOA 3DDOA 2C0PA 3VX3A 3TW4A 1R4MA 3VDRA 1G6KA 5ALSA 2QMEA 1Z4IA 3K16A 4IRXA 5FUXA 4EZEA 3H8JA 1XVIA 1XMOB 4QTXA 4Y1RB 2PYDA 1OLUB 4YAEA 2W2XA 2CFRA 5FHQA 5SV2A 4JS0A 4A2PA 1E2UA 5BNTA 1Y1KE 5IW8A 4LRUA 1BTOA 2GT1A 2NZJA 2NTVA 4PQRA 2AEMA 1G2OA 2F43A 2I7DA 4B6SA 3OQOA 2Q21A 4EYKA 1B42A 3OKAA 4LCBA 1P4JA 1XLTC 2HPAA 1E2NA 1EH5A 3EULA 1R8YA 4PR0A 5T41A 3RK4A 5JAIA 3HY6A 3FPEA 2YL2A 5F35A 5FUYA 1EFRA 2HT1A 4P5PA 3WKAA 3MQ2A 1BA3A 3N2GB 2QPOA 4NU5A 4GNKA 2GYWA 1LRLA 2HWXA 4XQEA 1II8B 1W49A 4CQMD 1E32A 2FX5A 3B6EA 1HFWA 3EIFA 3PC8A 4M1TA 1J5EB 3INRA 5CVCA 3ZTTA 7REQB 2LDBA 1GTZA 4ROTA 1DKUA 4DJ5X 1ZICA 3QPVA 4DLXA 5LBTA 3QKSB 2EL7A 4QJ3A 2FEPA 5LZ9A 3AIIA 1WSWA 2GPWA 4Z7QB 1MOSA 2X2OA 2G88A 5JJLA 1LB1B 4MQ5A 4QFDA 3CXUA 2QRPA 2AOVA 1SIWA 1JH9A 4F72A 3N59A 5JS8A 1G8FA 3KVVA 1QZXA 3HB5X 3HB4X 3QVKA 4AKEA 1ZOIA 3WWYA 2ZRNA 3SSOA 5IJ0A 3ZEAA 1JE1A 2GPBA 1QIJA 3LT2A 4KRYA 4S2EA 4AXXA 3BE6A 3CF4G 3FMFA 2FE4A 1TAQA 3RF6A 3VZPA 2W2KB 4YNBA 5EIOA 4TN5A 2D0OB 4PVCA 4YRIA 2C57A 3R2JA 1IEVA 2MIIA 3BSSA 4ON9A 3ZU2A 2PZFA 5CG2A 4ABTA 3RSZA 1DAGA 2QG4A 3PJEA 4DUYB 4JJ8A 3LRTA 2Q6IA 4O8ZA 3IT2A 3KV3O 5CGQB 4BMSA 5FUWA 4U7WA 1PR6A 2M32A 2OCKA 3OAAA 3M3PA 4YRKA 1NNEA 3AVWA 1XNJA 2C92A 1A2BA 1FLNA 1ODFA 1PKXA 1U7OA 1YB5A 2EEZA 4D4KA 1ZD9A 1J39A 1EFPB 4LMRA 3RS4A 4C6SA 4B3SB 3M1AA 1DAIA 3WOVA 3CR3C 1RMQA 1SIOA 1G2QA 3PWZA 1P2TA 3B1JA 4Q4AA 4G1FA 4YMTA 1MQAA 4RJ2A 2F8LA 4TYMA 3TJRA 4F38A 4EY4A 2Z6UA 3GMSA 4DZRA 1JDZA 1PGPA 2CHVA 3C3DA 1CX9B 5I7EA 2OVFA 2QRJA 1MRSA 4MICA 2EEPA 4BYGA 2IS2A 4C0AC 3D6NB 2OCAA 1EGQA 1SQ6A 3REGA 2AE2A 2ZAGA 4L7VA 4PN3A 2XPCA 2IEBA 3VNRA 1RWKA 3UZUA 1YBMA 4OHUA 4R1QA 4ZVTA 5A4MS 2QAGC 3U5TA 1GTJ1 1CIPA 4OGLA 4DR7B 2N0SA 1EP3B 2QQEA 3LSYA 1SU4A 4OA8A 4U7TB 3ENQA 1Q1ZA 1DBIA 4Q9HA 1UAAA 5JJCA 4BS9A 4GKBA 5K4AA 3AP3A 3T5DA 3UXMA 1E63A 4LWPA 5C4IA 1IL0A 2PUFA 3NIGB 1NA5A 2G70A 2WV7A 3E2PA 1P8JA 4R1LA 4GOXA 3RUEA 5BR1A 5I45A 3N0TA 1JDBC 4YCBA 1KQNA 2ZJFA 2FHSA 2X19A 3QPCA 3HI4A 1X8LA 4JQYA 5G02A 1LDMA 3RS7A 4QU0A 3VR6H 3SJ7A 5THXA 1TJNA 5BSEA 3OD5A 3QE3A 4W9NA 2GXSA 2BHLA 2O52A 4LZOA 1ZRHA 1USIA 1XU7A 1XTSA 2ZU0C 3PDJA 5AJWA 3SYTA 3WK5A 5HOEA 1J33A 4HATA 5CYFA 2G82A 4JMLA 3UAGA 4LHWA 4DDKA 8AT1A 1KARA 1WUKS 5IHPA 3CKKA 3A6KA 5I48A 1YA6A 3L43A 2R6ZA 3S1AA 4JYZA 5K4GA 3E9ZA 1IJKA 2RGXA 2FSHA 3HGQA 3CSDA 2CT8A 1ZRNA 1IEQA 4EI8A 4K1XA 3F96A 5HTOA 1GU1A 3LKDA 4YCJA 1N6HA 4IY1A 5JPCA 1Q92A 5ALLA 4X63A 1U98A 3NHUA 1U8XX 1QQ5A 2YWGA 4P2GA 4OP3A 1CF4A 3U4DA 1KRWA 2P65A 3DV2A 5SY9A 4YMSA 2J5XA 3NBXX 4MV1A 4Q7MB 5IUNC 2I22A 4IS2A 2J3HA 4LHVA 4UAVA 1ODKA 4V39A 5AKJA 5DHAA 3IQZA 1KIAA 4DOMA 2X15A 3VYTB 1G5QA 2R85A 2ZVQX 2PZAA 3OSUA 3RIMA 4A73A 1DIAA 2FEOA 2ZB4A 5BY2A 3HO1A 3IBTA 2QE6A 1Z0ZA 2BDUA 3L93A 1UDCA 3RE1A 4FE4A 3R9XA 1IB0A 1FC0A 3LNCA 4GM1A 4KXMA 4KWTA 5E3IA 2IDZA 5AOVA 4ZU1X 4ZK2A 4K3VA 4L2IB 5B2ZA 1RYEA 4M22A 3OTQA 3ZUGA 3G7UA 2HPZA 5EZYF 2GFHA 3U60B 4M49A 1P1FA 5KSYA 1VYVA 1OA0A 3SSNA 1OYVA 5BXYA 3IIMA 5EJEA 1EUCA 4N3CA 2Q6TA 4Z9YA 3ZBQA 4HDQB 1Q95A 1R18A 2IX9A 5JPIA 3O73A 2ATXA 3VZQA 1QSGA 2R1TA 3JSAA 4MR8B 4OI1A 3FI9A 3IAS1 4RF3A 2XLCA 1N4DA 2W37A 3GLIA 5DF1A 4E1BA 2BE9A 2WDPA 2HNKA 1I24A 3IP7A 4HWOA 4HNAA 4ZWNA 3RW9A 4PCUA 2P9TA 1U4OA 3GY0A 2CDBA 2NZYA 3I2IA 4FEEA 1YF3A 2A0XA 1N3YA 3JZDA 2J0UA 3G59A 3GMTA 5EKXA 5T64A 4KDEA 4CE6A 1P44A 1E9CA 1M2WA 2H6EA 3CNNA 3ZXYA 2W93A 3U49A 3UPTA 3T52A 1M7BA 1XSEA 4MW7A 4FYIA 3UMGA 1FP7A 1JLHA 4RVGA 4X6YA 3UATA 2BEWB 2GXUA 3EGXA 5FOQA 1T5SA 2C7RA 3KJZA 2CLEB 5GMOA 4IQ4A 1WS6A 3PQ7A 2A9QA 3E8XA 4BJHB 3WA7A 1I0LA 4MGIR 3MYRA 3KZNA 5A02A 1WSAA 4Z7OB 1QR6A 3VQTA 1JS1X 3QHQA 2HI0A 1X7XB 2X4GA 4UE3S 4XVQA 5HIJA 1R4ZA 1R8XA 3TO5A 5T8KC 5FLKA 1B15A 4BNDB 1NJGA 2VYQA 3OEEA 3I34X 1Z74A 3H9EO 5DI3B 4BRSA 4DREA 1UMDA 1HWYA 4WKCA 4DPMA 1GTL1 1Q11A 3EVAA 4D9BA 1V26A 4HLNA 2D5LA 5AIBA 4OMDA 2IOFK 3ADOA 2IQIA 3QHAA 3UW1A 1XZIA 1FY2A 2QL9A 3D43A 4CI9A 4F9TA 4I4TB 2YASA 4ILEA 3AGQA 1KI3A 3BWMA 4QFMA 4MHTA 1Y6ZA 3S3TA 1XDDA 1JG2A 2I6FA 1EDBA 3GUVA 2VRNA 3DPIA 1DQZA 1U1IA 2IYYA 4Q93A 4OP2A 4ALLA 2CZQA 1OCEA 4DDUA 1GAXA 1G8HA 2P77A 2Q7XA 4H1UA 4L6IA 4C4SA 3COVA 3SQWA 1AV6A 1Q74A 2YWXA 3HN6A 4I14A 4LBVA 1P5FA 4LTMA 4MUFA 2Y8EA 1C0IA 3PD1A 5L3RA 4E21A 2EDAA 2QJWA 3FNFA 1SOMA 3VZCA 3K31A 2Q2VA 3S99A 1KZHA 2ZAYA 4OLHA 2F3PA 2A35A 4XE5A 2VJLA 1G8AA 4PFQA 4YRZA 3VTZA 2IHNA 1EUDB 3SIXA 2O2HA 1F6WA 4MKRA 2WKRA 5H0IA 2GZRA 2XUFA 3OLWA 5B2EA 1GILA 2A33A 2O05A 3F6BX 4DUGD 1H5UA 2BBSA 3SAJA 7ABPA 1M5RA 4I9HA 1QXSA 5JR3A 1EFDN 3U7EB 1N2EA 3IUYA 4NJEA 2A4MA 4YDHB 3OZ7A 1E2FA 1J06A 2GPNA 1PEAA 3PFFA 5KAPA 3UANA 3I4FA 4BB0A 2ECPA 4DMHA 4ZOCA 4AMYA 4MWOA 1NVMB 4EITA 5IKMA 3DCJA 3S5JA 2EZ8A 3PIIA 3GJRA 3TQHA 5LKAA 1BEZA 4BC1A 1IBMB 1JI3A 3DCIA 4KXXA 1HYHA 3EIXA 3EXG1 3L7BA 4YUVA 1W93A 3IEKA 3ER8A 3KC2A 2DQKA 3QVWA 1E8MA 2JGAA 1U8AA 3DWIA 4H7HA 4PCLA 3QLEA 3T15A 3DO6A 3WL6A 2NU6B 1X19A 3SSAA 1FW6A 4BQIA 1PDOA 2XWQA 4ZYVA 4AZ0A 4FFOA 3VJMA 4XGIA 3LYUA 4KREA 1JG7A 1NBMD 2E18A 1TIBA 3DZBA 3SC6A 3V1MA 2UXDB 1G21B 4MVJM 2B61A 5A9SB 1F0NA 1V5EA 1KYYA 5BQPA 4UM8B 3E9YA 1C3VA 2FPUA 1JJFA 2HK8A 4FFVA 4UUAA 2J41A 1LQ2A 4HMQA 5C5CA 2XYGA 2GHRA 1X2BA 2B7BA 3CB2A 3KZCA 2P6RA 2ZZNA 3LUKA 1I5OA 3A3NA 2AFIA 3K1TA 4DQ0A 2HB6A 2ENWA 1JAXA 1JIJA 2EC5A 1FNMA 1R0WA 1QGED 3NBUA 4FGWA 1G2PA 2YHAA 1H9CA 3MAGA 4FTWA 1PJSA 2VP4A 4FGKA 5LCXA 5DN6A 4JJEA 2L17A 1LK5A 1WXQA 4XAQA 1LBSA 1ENZA 1KQ3A 4Y2QA 3UV3A 5IUJC 4YJHB 3HJFA 2D1FA 4WLUA 3HVIA 2A94A 2VQ3A 1QH8B 2DWCA 3FOAA 3ITEA 4LDRA 3K0CA 4DW8A 1GA4A 1EGMB 3K30A 3V3KA 2HW8A 2A67A 2XMCA 3I8XA 3VVMA 3WGKA 4NBWA 5KX5A 2IXEA 3KE8A 3ZU3A 1U2PA 1TYAE 2IPLA 2QA5A 4R40A 4KGZA 3I6BA 5KSWB 4QPPA 4F04A 1XU9A 3K70C 1OH6A 3EQ7A 4U7JA 1BDMA 1J8VA 4LRTB 3KETA 2OCDA 5L4LA 4FFBA 4CYMA 1XALA 3HK2A 1Q57A 1BYUA 1WXGA 3HNOA 3PXAA 2RB5A 1A9SA 1H1LA 1AQIA 1P17A 4OXXA 5JC1A 5JALA 1XA0A 5DO9A 4OIMA 4FGJA 5IARA 4MQ4A 3RGGA 1JDVA 1E2JA 2V0CA 4YCCA 4I1RA 3PFHA 2YN4A 1ZQ1A 2IHKA 4I1UA 3KLPX 3NFYA 1EU1A 3AUXA 4OHBA 1Y7PA 3MA0A 3F2VA 3VHXB 1V3VA 3NHRA 3QELA 1EB9A 3NIDB 2DFPA 3FG9A 4DQKA 1RLMA 3JQ7A 4FIZA 4KVZA 4YJ2B 4Z0NA 8ABPA 2I1VB 5BRNA 2HXGA 2C9YA 3BAFA 5KDOA 2EFYA 2QMHA 4XM1A 4ZZ2A 4IEFB 4K6HA 2LIVA 4LOIA 3A37A 2FG6C 2VAVA 621PA 3QWIA 4W82A 5CGZA 2FPLA 2IZZA 3A27A 3HA2A 1E2BA 4GWLA 1RXSA 4MUJA 3BXZA 1YI8A 1TZ2A 5BYJA 3G82C 3IFSA 1ZH4A 5EKTA 4B8WA 5HR5A 3QKTA 4CM6A 2BCJQ 2H1WA 4N6OA 4BPBA 1GITA 5BSRA 3K0FB 1U7TA 4AF7A 4YJ3F 2OQRA 2FN9A 3AR7A 3AFMA 4HPWA 3HZRA 1YKGA 3TQFA 3K2BA 3EVEA 2QORA 1V8BA 5H3LA 4JGIA 5EUMA 4OFWA 1OTHA 4UW9A 2I6GA 3FNQA 1A4RA 5ETJA 1PJZA 2VUUA 3OZDA 4PGAA 1GM5A 3U3KA 2PKRA 4YJKA 3T4EA 3NO4A 4U39A 2NSJA 2QQGA 5E0OA 2RGEA 4QT0A 3KQLA 4KGDA 3KO8A 1G41A 1CQXA 1W581 1YA8A 2B8WA 1S01A 3F74A 2GBFA 2H07A 2X3UA 1UCFA 5IKPA 2WHXA 4NG4A 3ETHA 4KLCA 3TRKA 5JI3E 3DTTA 3DTVB 5DCUA 3ZBPA 2N9UA 4KH0A 1CE8A 1OXXK 3DVQX 1E7QA 3CVJA 1VLLA 1WZEA 1TADA 2ACWA 2CNWD 5GV8A 5CNIA 3WBKA 1T4BA 2JFZA 4MQBA 1YGPA 1O95D 3DC7A 3TS1A 3GYBA 3MJVA 5KKAA 1KZ1A 4ZCIA 3DZCA 2ASEA 2GNOA 4YR9A 4E5NA 3W34A 2YIDA 4G0MA 2DCUA 2XR1A 1YFJA 1H0SA 2AZMA 5KKNB 3FHJA 3F6YA 2NU9B 2VQ6A 5IXJA 2O8DA 4QPNA 3L8GA 4OBBA 1Z6XA 3TI7A 5JAMA 1NI4B 1UJ6A 2WIDA 1G2IA 2OUIA 2P68A 4P5EA 5E9WA 4EO4A 3HYLA 1IPEA 3INTA 2OXRA 4XX1A 2RKOA 1BWRA 1XTQA 1G7SA 1H23A 1Z25A 5EHIA 5TS3A 2ODQA 4F12A 5JEEA 1F4PA 1OLSB 2WQ6A 1RZVA 3FLBA 2QAGA 3CPJB 1PU2A 3C5VA 4I8IA 3W3AA 4L08A 3TCXB 2XUAA 3NHLA 4QBHA 1WCXA 1KTIA 3I5UA 2D0IA 3E22A 2WJHA 1L5YA 2L18A 1PJ3A 2PRJA 4PZDA 1TFRA 5KJ6A 1JVNA 1IYZA 3FCCA 3PKZA 3NW9A 2BKEA 3FSEA 5KYXB 3NOQA 1RWWA 2H2GA 2HJ9A 2PTHA 4AY4A 5H9WA 1ORRA 3EAFA 1QNFA 2HA6A 1T6YA 2PKQP 2IBSA 5G1OA 3LHSA 4XUGB 4UTVA 3LBNA 4X1OA 5EIBD 4OK3A 3H16A 2RK4A 1U0LA 3HS3A 2OGZA 5KOIA 1GTSA 2FPKA 2WWGA 1E5DA 2RSLA 4ARUA 1YL5A 4QKQA 5FWNA 3EDQA 1N6OA 3N07A 3O6VA 1U5AA 2HV8A 2JAWA 2GK4A 3GU3A 3C24A 3C0KA 1OLXA 4RVSA 1WXXA 2SNIE 5DEIA 1O4WA 2QN6A 4KIWA 1NQ5A 3SNKA 1TRHA 4Q02A 3F9IA 3BMXA 3SQNA 2GLUA 4PPNA 4LFBB 2NQ8A 3GRRA 5G3ZA 2GN4A 2BKVA 3JR3A 2H7VA 2OILA 2ZQYA 3K20A 3VYRB 4BLTA 4R0MA 1QP0A 3ADCA 2A9KA 4AS2A 3L07A 4Z7NB 1L4FA 3JQ9A 4DB4A 2VZ0A 1O9BA 2VF2A 4JR2A 4O25A 1OHHD 3L7JA 4J1SA 3GN1A 1JXAA 3HWRA 4YT5A 4HYYA 3IVGA 3JAMA 1NV8A 1U1GA 5C4GB 2CLHB 3M9XA 4OG2A 2O8BA 4J7AA 5B58T 2H0AA 3IJ5A 4PSKA 3RTBA 1RM5A 4H27A 3I1JA 1CUJA 2LPMA 4BQSA 4F4HA 2PLNA 4KQ1A 3V9AA 4QNRA 4BVAA 4QAQA 1L8XA 1MEOA 1ZJJA 4NYJQ 2WFZA 5GONB 3VR3D 4DEYA 1OZAA 3C39A 5JNUA 4J2OA 3VOSA 3OBBA 3P27A 2XB2A 5BOSB 2WAOA 2IFTA 4LNAA 2OGWA 2Y76A 4OK6A 4N48A 2IDKA 2ZJ5A 1UFRA 3LKZA 4M0PA 4OI2A 4ETIA 1FSPA 2PS1A 4FI3C 3FCYA 4FMDF 2QENA 2PEYA 3BE5A 1D3AA 2O4CA 1JAHA 1IAQA 1E5QA 2EJUA 3IELA 4GP7A 2QL7A 3VOAA 5BUCA 2QRQA 4LOKA 4P3NA 4QPZA 3BIWA 1WXFA 3K70B 1TO2E 4NPHA 5KNLA 3K70D 3KQPA 1IN8A 3FYCA 1YCDA 4IJVA 2Z09A 5EXPA 1EQAA 4BLPA 4HDCA 3RSSA 2Q27A 3U31A 1UJ5A 4FPXA 3MB5A 1G66A 1TO1E 1R0XA 2VWGA 3PPYA 4TKZA 5HF8A 5BWLA 4FDVA 4B7UA 2FZEA 1CF2O 1M34B 2PXXA 3FPLA 4P7GA 5ERXA 2JLYA 3QU9A 4OF4A 3L6RA 4KNYA 1QYWA 2PD3A 2BISA 3DMRA 1P7YA 3OE1A 3W3AH 5IM5A 4KO8A 3HVKA 1QS0A 3TVYA 5BURA 3L6EA 2PMEA 3TPCA 4LHEA 4F56A 2OWDA 1HSZA 3D7NA 1UXOA 1JIKA 4CL3A 3JAKB 4P2BA 1WV1A 1PT5A 5EHNA 4LSZA 2BKAA 3UT0A 1NAIA 3VR4D 4ZMSA 4HCJA 5A0FA 5GTDA 1FFAA 4Q1EA 1E3DA 2BEVA 4G4IA 4KQ2A 1WUTA 3RKSA 2JGDA 2KQUA 1Z28A 3HJTA 4NMLA 2ZVJA 1PHPA 3IMEA 1NM5A 2FFHA 2FWJA 4NK4A 1W88B 3SBOA 3ZD6A 4GKJB 3HJRA 2ZJ8A 3UICA 1BCSA 1EAYA 1JB1A 4QWMA 1DCTA 3CZCA 4AY3A 1IOZA 1PJTA 3PS9A 3T12A 2ZBVA 3HU2A 1ZM3A 3QNMA 3NT2A 3OCUA 5DXJA 4DLLA 2UXBB 1YS1X 3CNQS 2DWPA 2VYNA 3CF2A 5IVIA 1B2RA 5EQTA 4C3UA 2OV2A 1KIFA 3FPHA 2JPDA 1EMDA 2F2TA 3SD7A 3U40A 3AI1A 1YH3A 4YFVA 3D5EA 2CUTA 1IVYA 2ZULA 3OPQA 4EENA 3KVRA 2XTNA 1T9GS 3KALA 2Y1FA 1CYDA 4FYKA 5JH7F 4LXIA 2R11A 2YZGA 4RQBA 4XR4A 1NR1A 5DCYA 1Z6GA 3QUQA 4RQTA 3VMFA 3LPLA 1NMYA 2G1AA 3KCNA 1DV1A 3NC4A 4B46A 4DA6A 2WYWA 1FZQA 2P6UA 1CNEA 1W0CA 3OKFA 4XGKA 1Y8QB 1O9GA 5FTJA 3KWLA 2Q2QA 3DVRX 1RXYA 4WKBA 3RSCA 3NHKA 5DBHX 2EWWA 2GI4A 1VKNA 4UXHA 2NG1A 4BFUA 3RBAA 2H48A 3B70A 3KJXA 3E4CA 3FDZA 4FCWA 5I7SA 4GRIA 3V4RA 3P96A 3RU9A 2VDMB 2W2QA 3NKLA 5IABA 3IYLW 3LBAA 4Q19A 3M6FA 4XUCA 3H0CA 1I14A 1QZ3A 1GL6A 1Q0UA 2JK0A 4JJFA 4A8JB 3O8CA 2W11A 2QMUA 4UTOA 3HG7A 2ZYRA 2TSYB 4M9QA 4JXXA 2IS6A 1BH2A 2VC2B 1XXHB 3AINA 3C6QA 1UEJA 1J0AA 2QRZA 1SC9A 1FFYA 3EUWA 2OYSA 5IKXA 2OV3A 2LP4Y 2PGLA 2BFFB 1CULC 4R83A 1FYWA 4RW0A 1F8YA 1T24A 2GZ1A 4IJ6A 2OHHA 4F6LA 3HTXA 4MKHA 3V8MA 1YVRA 3ZQ4A 2HCRA 1TPZA 4Q39A 1QDEA 4B4VA 4DSOA 3WAGA 3L5OA 2OAQ1 2V1UA 1QU2A 2XVAA 3S2FA 4M88A 1BXZA 3R7AA 5C3UA 4DDHA 2P9CA 3KXDA 3BICA 2GX6A 2CJYA 1H2HA 4MCJA 2I6TA 3SK0A 3H19A 1J90A 1FXWA 1HPLA 3QEMB 2P2SA 5KWEA 1JA9A 5FJJA 1T0IA 2F9FA 2OMKA 1N2GA 1FEZA 3GGCA 4TM8A 3WQQA 2EYQA 4HX2A 4YMIA 1E6CA 3JYHA 1SUSA 4UCQA 4FLFA 5CX1A 4PC2A 3WWDA 4BRWA 3G85A 5HQTA 1Y1RA 2GKGA 2ATIA 4GOOD 3VI4B 1YUNA 2CNDA 1FSFA 3HEAA 1OMOA 1IBRA 3KTAA 4KLAA 3ZW7A 4Y9TA 1CHNA 2JIDA 1YOVB 3E9EA 4ND2A 4Y98A 3I61A 1ZKMA 2VYND 4YQYA 3EXHB 1P6QA 2AS0A 2Z3ZA 4J7XA 3OF2A 2RGBA 1HORA 3EC2A 4AJIA 1OBOA 3LHIA 4L5BA 4PQEA 4R5HA 1WLYA 1YB2A 2YHSA 4CR8A 4UAUA 1Q19A 2ILTA 4KKXB 1F5SA 1ZZGA 3COJA 5IJ9B 5BQOA 5FLEX 1P74A 4IOKA 1M67A 4MDYA 3FSGD 3A58B 4MARA 4MI9A 5AKZA 2WF8A 3QLVC 1A4UA 4O4LF 5FV7A 2PE5A 1P2SA 1YU9A 1CIJA 4N4AA 2PT7A 3CZRA 2QNIA 3OJWA 5CJ2A 3C1OA 4XASA 4RHEA 1U8UA 3H3XA 2FWAA 4GXTA 5P8WA 4DC1A 4DHEA 5A5GA 3QLVA 1ZH8A 3TB6A 1II9A 3TNJA 5CA0A 2X7JA 1E79D 2QMZA 3B7GA 1JEQA 1W4RA 2BF7A 3AHFA 3GLHA 2QQ5A 3IURA 4N6GA 3G0OA 1PR1A 3AOEC 4RA6A 3LH5A 1LF0A 4KRXA 4OAOA 3TVTA 5H59A 4O29A 1TAGA 1UK7A 5TQVA 3RPEA 4LF9B 2VKTA 4UNQA 3COSA 3A6LA 4OJYA 3G2KA 5EERA 2JIPA 3G8CA 1RJDA 2FAXA 1ZINA 3KT3A 1MZVA 5DLPA 5HCIA 2OPHA 5KQMA 5GINE 1D5CA 1B6GA 2VT7A 2HFJA 1VMAA 2QY9A 1KZ4A 3BFJA 3D5TA 4JI5B 3A1TA 2X5OA 2GDJA 1QVVA 1S8FA 3CX3A 4TWAA 5D8DA 5J1TB 4B6PA 4TUYA 5BP7A 5J59A 1Q91A 3RS3A 1JJBA 3EOAI 4D4JA 3TG8A 2GPSA 3OG9A 4YWHA 1PX2A 3MCUA 3GBVA 2A30A 4Q7JB 1XTKA 5H68A 3WGUA 2QBYA 4G2TA 1Z36A 2XY4A 2Q3EA 4GYWA 1E9DA 3D4NA 4IV8A 3PEYA 1FVOA 5DM1A 4F60A 2WFLA 1XZQA 2VBFA 3PA6A 3N70A 1ISGA 2H5LA 2JEYA 3UKJA 2HCJB 1E3MA 4OATA 2GZHA 3TX6A 4NU8X 2RC5A 4BEWA 1DEHA 1NRJB 2QZSA 2XYRA 1P1HA 1E2DA 3LL4A 4D9KA 2I76A 1BS1A 1S89A 5JSUA 2WF6A 2ZB7A 3T0GA 4GMKA 2XTZA 1CSEE 3EHEA 1OXSC 2ZVDA 3NHPA 1A9QA 4KDCA 3TSZA 3ZHOA 3GFFA 4EH1A 4ZMRA 2PPVA 2SKEA 2B6HA 2QNRA 2PQ2A 3MS2A 1VJ0A 2A4KA 4UZFA 4DMFA 5JU6A 4GYKA 3PP8A 4FYMA 3BD6A 2JFUA 3QX8A 2RHHA 2C9OA 3IDQA 3LG2A 4WBXC 2J87A 4DM4A 1YSCA 2XCTB 3WADA 3PI7A 5AD1A 5BVGA 3O8NA 4MW2A 3ZWMA 1JR3D 1SBCA 4L8YA 1IEXA 4DZTA 3PFGA 2OFPA 3CW8X 4LRYA 5I9NA 4NOLA 2ZYTX 5CDUA 2K7ZA 1XDZA 3AHEA 3HH8A 3NS7A 5E7JA 3IE1A 3A4VA 2V9ZA 3AF2A 2WAYA 1QQ7A 4LWZA 1PYDA 2R96A 1Y4SA 1EUCB 2C9CA 4GFDA 4PGMA 1DRUA 5SICE 4O4LA 3WIVA 2Y77A 4QBGB 2V97A 5K6AC 1DUIA 2FSVC 3JZIA 4OGKA 1AURA 5CJPA 3L0ZA 1Y0BA 4FINA 4W6QA 1UJBA 2A6PA 3EB9A 4DBLE 3W8NA 5FAKA 1TZBA 1JN0A 2YY6A 4FR2A 5F2EA 1NUPA 2ST1A 3GJ5A 3GT7A 2F1HA 2INGX 4M37A 3WRYA 1MV8A 1TDJA 4JLKA 4WPGA 1MU0A 4JEUA 1FJXA 3VO8A 3SIRA 1CY1A 5BW8A 5I7FA 5EP2A 1TNDA 4HB2A 2WWHA 4C88A 4RTRA 4L5IA 1ECFA 2Z08A 3F8TA 4N8SA 4J43A 2CZGA 3UKOA 4E7OA 3GJ8A 3ZHYA 4I6GA 5H82A 4W9MC 3DXFA 4G8BA 5ELMA 5H70A 2CVPA 3W90A 3NLLA 1HOTA 1WZIA 1UZAA 5FEMA 1DDOA 1P9WA 1QE3A 1DX6A 2HDNB 2QSUA 3D4OA 1U31A 4B9AA 4BKRA 5ITZB 1JU3A 1M6VA 4WCDA 4C30A 3QNUA 2Q0HA 3HB1A 1RRMA 2XBUA 1QRDA 4ZYWA 5L53A 2WV9A 3ZXSA 1CJTC 1P5RA 2PPLA 4HH0A 2PL5A 2Y1KA 3QOWA 1Z2DA 4CCYA 4NEHB 2ZTUA 2BL4A 4HAOA 1YMQA 1KSHA 2GCEA 3E0XA 4IQFA 5LBIA 4QARA 3ZBTA 1ZH0A 3DZ8A 1QOQB 1Z0DA 1BH6A 2XGMA 1Y1PA 1BFKA 1XZBA 4LJKA 1X14A 3G0DA 1QOPB 2BDEA 3FZNA 1IG3A 3OQHA 1V11B 3NJ8A 1K8RA 3JZMA 1B0AA 3MJ4A 3OE5A 1BFDA 4V1CB 5HW0A 1T5OA 2LGJA 3HO6A 2X76A 3K0KA 2AFHE 1F60A 1Q7BA 3ZE9A 2VN8A 3QBEA 4BRUA 4Z8XA 3HXQA 1UC8A 2GGSA 4LHSA 1XFAA 2PXAA 1J2UA 1P3DA 3D6JA 3OFVA 3PUVA 4OB7A 5AMXA 5L95A 3AIMA 3TF5A 1I6WA 1KEUA 3GMIA 3E84A 3I8OA 3ZV3A 3IEVA 2ZBGA 1HE3A 4CGZA