5JOQA

Crystal structure of an abc transporter substrate-binding protein from listeria monocytogenes egd-e
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
258
structure length
258
Chain Sequence
KEPKIVATTVAITEIMDKLDLPLVGIPSSSKKLPKRYADVKETGSPMGPDLEIIRMLKPDMVLSTKTLEADLKSGFEGADLEADFLDFTSIASMQTEIKNLGAKFDRIEEATKLNKDLTSDIDQVKSNVAKKKKPTVLILMGVPGSYLVVTEHAYIGDLVKLAGGENVIKDQKVEYLASNTEYLQSANPDIILRAAHGMPAEVVKMFDEEFKTNDIWKHFDAVKNNRVYDLDENLFGMTASLNAPEALKEMEKMLYDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lmo2184 protein
publication title Crystal Structure of an ABC Transporter Substrate-Binding Protein from Listeria monocytogenes EGD-e
rcsb
source organism Listeria monocytogenes serovar 1/2a (strain atcc baa-679 / egd-e)
molecule tags Hydrolase
total genus 81
structure length 258
sequence length 258
ec nomenclature
pdb deposition date 2016-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 5joqA02
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 5joqA01
4UTPA 1G21A 4MX8A 4MO9A 2PS3A 4PAGA 5KOJB 4K3VA 2ETVA 3HXPA 5JOQA 4UDOA 3LHSA 2OGWA 4FKMA 2AFHA 4N01A 2X4LA 3NU1A 2YNMC 2YNMD 2XQVA 1K7SN 5KOJA 1PQ4A 5BVHB 3MWGA 1N2CA 4M7OA 1FP4B 3HJTA 5KHLB 1QH8B 1K75A 4G07A 4HMPA 4BBPA 4TKVA 5GGYA 4NNPA 4OVKA 5HDQA 2PRSA 1L5HA 4FI3F 4WESB 2O1EA 3HH8A 2XV1A 3EIWA 4WZBA 5BVHA 2WHYA 2OV1A 1QH8A 4CL2A 1M1NB 2AFHB 3TLKA 5M2QA 4WN9A 1TOAA 3MINA 2XY4A 2R7AA 4WESA 4OXRA 3R5SA 1N2CB 2M6KA 3ZTTA 5AFSA 4FILA 1M1NA 2XDQB 3MD9A 4TKVB 1MIOA 2PS9A 2RG7A 5CX1B 5M34A 1L5HB 3PDIB 3TEFA 2Q8QA 3LI2A 4WZBB 1N2ZA 3AEQB 3AERA 3ZK9A 4MDYA 1KAEA 3BE5A 4UDNA 2XDQA 3AESB 5CX1A 4WN9B 2OV3A 2PHZA 3MINB 3PDIA 3PSHA 1G20B 2PS0A 5I4KA 2R79A 4LJSA 3MWFA 2XH8A 1ESZA 1KARA 3AEQA 2MINB 5CR9A 1MIOB 3AESA 1K2VN 4NNOA 1G20A 4GICA 3AERB 1EFDN 2MINA 3AETB 4WZAA 1H1LB 4LS3A 1M34A 1QH1A 2Q8PA 5M29A 3MFQA 5M3BA 2WI8A 1XVLA 4UTOA 3AETA 3ZK7A 1QGUA 4ND8B 1H1LA 1K0FA 4XPIA 5JG7A 5BVGB 2OSVA 5KOHB 4WNAA 3ZKAA 4INOA 5B58T 4DBLE 3U7QB 2QI9F 4WZAB 3R5TA 3AEKA 4ND8A 5FLYA 4H0FA 4INPA 5BVGA 2XUZA 3K1AB 1M34B 1PSZA 5KOHA 1QH1B 3PSAA 3EIXA 4H59A 5JPDA 3BE6A 3U7QA 2AFIB 4OXQA 4TKUB 4HMQA 1N4AA 3AEUB 1M1YB 4FNAA 1QGUB 4MLZA 4PM4A 4XPIB 3K1AA 1G21B 3G9QA 3CX3A 3GI1A 1N4DA 4HN9A 4WNAB 4G09A 2M6LA 3UJPA 3ZK8A 1KAHA 2AFIA 4IRMA 4TKUA 3TNYA 5HX7A 3AEUA 5JJ5A 1M1YA 5GGXA 3AEKB 1FP4A 4HMOA 4B8YA
chains in the Genus database with same CATH superfamily
5DYIA 5CIWA 1NYLA 5B6PA 2IHZA 2X2FA 4AG5A 1DLJA 2HA4A 3QMWA 4CQLA 1U6KA 5CJ2A 3WB1A 3G9TA 1LTHR 3BRWA 3CNLA 2QJWA 1IY0A 1XF1A 4X95A 2Q4RA 2QAIA 1X8XA 2I9PA 1GGVA 1Y81A 2Q50A 2IP4A 4JYBA 5AHRA 3W5SA 5JSQA 2O54A 2Z9BA 1XRSB 2PL1A 3VC1A 3EY9A 4Y18A 4ZQBA 4HS9A 1XK7A 2H6EA 4LV6A 1BCSB 1E1NA 1F51E 1F8GA 4HDNB 4HTFB 4BEVA 4NTZA 3PEVA 4YAUA 1BAPA 1QOPB 5K8JB 4NFHA 1H2AS 1FBTA 5FPQA 1VKNA 4JASB 3W04A 7ABPA 1A5SB 4LA4A 4ZK6A 4QBKA 5JY6A 3ZZNA 1PV1A 1N1DA 2QRJA 2HMAA 1EDBA 4P35A 1ZMRA 4UBJA 4CF3A 3NX4A 1LBQA 5G53C 5IVHA 2PWYA 2PR2A 3ZZ0A 3THYA 4RUKA 4OMDA 5L9AA 2G0NA 1VB5A 2Y1CA 3NM5A 5AVWA 3F5FA 4KRXA 4G4SP 5HCNA 2IU3A 3G8AA 1HLPA 5EE9A 4Z2YA 3SHVA 3S2GA 5KJFA 1N0VC 5EZYB 3KJGA 2PD6A 4LXTA 4L4SA 3D2BA 2CHEA 5KC9A 1T9HA 2ID4A 2HRDA 2C8VA 4AYWA 2ZROA 4FFNA 5AI4A 3REFA 4BIMA 3L7NA 3KE9A 2E6UX 2IDKA 3D8SA 2PL5A 3WXMA 4YJ3B 6ADHA 2FWBA 1SWVA 5F5NA 4I5IA 2QMUA 3UY4A 4L16A 2AUTA 1KKUA 2BCJQ 2FWPA 3CLHA 3JZMA 3OI7A 2CXNA 4V0ME 1ZHFA 3SR0A 3IAUA 4DCSA 2FXIA 4PZCA 5FWAA 2VK8A 3FMOB 5GV7A 2XRZA 1YFZA 5LU8A 2EF0A 1JDNA 2IUEA 2YHBA 1U7XA 5AW9A 1Y3IA 1ODSA 2HHHB 5IARA 2Z2IA 4C1NA 4O8ZA 4U02A 4KOAA 3NW9A 4K6KA 4DYVA 4JFAA 1C3OB 1Q2XA 2FPXA 5CIYA 2PA0A 3ER6A 4HAOA 3IEUA 3WGOA 5HIKA 5DYGA 3KTDA 1X7ZA 4PSCA 4HUJA 1H1LA 3A6ZA 2HQBA 2Q3FA 3VAYA 5KJEA 4ND5A 5KQRA 2JD2A 3BZUA 3ZCUA 3W3AH 5KNCD 2ZTMA 1WDTA 5BVGA 4PGMA 1SKMA 2I76A 3ND8A 3B1YA 3IUEA 4QQ8A 1KQOA 2WTAA 5TPWA 3LCVB 3UT0A 4TMYA 4E5DA 2B4AA 2FEKA 2ZLBA 3TE7A 4B3GA 3LDGA 5I8PA 4LCJA 4V1CI 2NP7A 5AJZA 3RUFA 4NZYA 3CUUA 3A2NA 1KY3A 4URWR 3GRZA 5F12A 2OVBA 1JPVA 1NRWA 2W37A 4JYCA 4XIFA 1GCGA 1YKFA 1MRZA 4YJ2F 3PQ7A 3W5VA 4BYGA 2F4NA 3K70B 3PFGA 3NMUF 2OBNA 1DOAA 3FWKA 3O0TA 4BVAA 1GL9B 4FJ0A 2Q4DA 4ABTA 2Q27A 4XASA 3ISJA 3KHKA 8GPBA 3R3XA 3TCXB 1EE2A 1KPIA 2LBPA 3IAM1 3UAZA 3D2LA 1CEYA 4NK5A 3GJSA 3VTZA 2H7CA 4E3ZA 1JT9A 4Z9XA 3C85A 3WA7A 1GZ6A 1UBTS 4ZT2A 1E3TA 3NHYA 2YH2A 4E4YA 4RLHA 5JD6A 1DAIA 1JKXA 2PH1A 2TMYA 2ZRGA 1EGVB 1OH5A 2WF5A 2OGUA 4P4SA 2P1ZA 4B09A 4M0KA 1OB5A 2VNKA 5KQSA 3O84A 4D99A 4ZRNA 5K3CA 1F38A 2PUTA 1TLLA 4IDOA 4WEQA 4DF3A 3CVVA 3GZ4A 5HZHA 4D6PA 4G2TA 2HU7A 4UCXA 4QOIA 2I4NA 3TMAA 2V3WA 3O91A 1XUOA 2C95A 1Q2UA 1E1MA 2ZS9A 3W8EA 1CTQA 5HIIA 4LZNA 4BMXA 3CR8A 3JQGB 4BZPA 2NQ2C 3TLKA 1LDGA 4PYRA 3HRHA 4WDQA 1P7WA 2V03A 1TJ3A 3AILA 3GFQA 3ADOA 1ZUNB 3IX7A 2QG9A 1IK4A 3GEDA 3L7OA 2GAIA 1R9JA 3FRIA 4OFZA 1E6WA 4DDUA 2FZWA 5BN1A 1YFLA 3DP9A 1U02A 4RW0A 4R6WA 3AT1A 4YR7A 2RHWA 2OAP1 2DKNA 3DEYX 2BEWA 2HNKA 4BAGA 3U16A 2VBIA 3VU1A 3EZ9A 1W2WB 2OBFA 5PGMA 2RK6A 4BB6A 2MJLA 3HEMA 5LMZA 2PKWA 4CTOA 4HSEA 3ZEIA 4DDHA 1H65A 1OAOC 1EP3B 1TF7A 5LQMA 1VQ1A 3H5IA 2AFHE 3DYBA 3M1YA 3HFJA 5I51A 2OV3A 3HKEA 4C3VA 4AZTA 4D4HA 1YKSA 2SHKA 3KZ1E 3R0QA 3W78A 1ILWA 1PZGA 2JBAB 2G8NA 3I52A 1Q12A 3PYMA 4FEGA 2OL4A 4MR8B 4PF1A 5ERYA 1L4NA 3EFOA 1L7AA 4KH1A 3O93A 3TPCA 4Y8VA 3OCCA 2FWRA 1F14A 1NZJA 1RM3A 5HBRA 4CMEA 4MULA 3ENZA 1XRNA 4INAA 2CNNA 2Z4RA 4YP7A 3Q8WA 2F3QA 4XA8A 2I67A 4YCCA 1U6IA 3C4VA 4NE7A 4Q3KA 5AHKA 3F3SA 4RA6B 5TY0A 2Y1OA 1UMCB 1JG2A 2BGKA 2TMGA 3ESXA 3KJZA 4WFQA 5CBKA 4AKEA 2HCFA 5M3BA 3SEAA 2BCEA 3P4YA 1H66A 2C9DA 2Q3MA 2WB4A 3ET4A 3NBXX 3WL8A 4B6QA 1V39A 4Q7QA 4B83A 1BXRA 4HNTA 1DU4A 3HVIA 1IOVA 3EE6A 3KYIB 3MERA 4ZO4A 1EBUA 2Z58A 3EZ7A 3ZE1B 3RGGA 1HF3A 2WAOA 4IJ5A 3TSYA 4Z3KA 2H4HA 3ZCXA 3DMHA 3HQ4O 1Z2CA 2CFOA 3HKBB 4BBAA 2QYSA 3KPYA 5EHQA 5FDFA 4NXMB 5AH0A 4ZT7A 4LXGA 4JUIA 5GPBA 1ZAKA 1HDCA 1Z6XA 5F51A 3W8RA 1O5IA 2YJNA 5GMOA 4PHTA 2FPMA 3UNXA 2Y1LA 3ABQB 3WGJA 4YRAA 1E3JA 1HETA 3T3PB 1I13A 1X13A 3C5CA 3BT7A 1HA3A 1GU7A 3SFZA 5JTTA 1VKHA 2A0KA 4CKXA 1W85A 2HB6A 4MRMB 3GLIE 1YQDA 2HYIC 1WS6A 2Q2OA 3MTJA 4FZVA 4L15A 5BRNA 4OQNA 1RTTA 2F3SA 2LV8A 4MX8A 3WLAA 2O8FB 5C53B 1N5RA 4H6VA 4ZCRA 5IVKA 1SELA 2QTTA 3LA6A 3QBTA 4BX3A 4LF9B 3LQYA 1VSBA 1UOPA 1S5PA 3A27A 2XWQA 4B6JA 2W8BA 3CLKA 3GPLA 4ZJPA 4W5JA 2C7OA 1P2GA 3IC5A 3ROFA 3AHIA 3RRZA 1QG0A 1UZAA 2NSJA 3S6JA 3WRVA 2IXEA 4IS2A 5ENZA 3UJ8A 3QHQA 5HFAA 1N2CA 1K1EA 2IXBA 2OXCA 4JITA 1SHLA 3I9NA 2EBFX 4QUKA 5AXAA 3TQSA 3WAJA 2JAPA 4JT2A 4YCNA 3CFYA 1Y8QA 4NG4A 3EUEA 4QXMA 2OGTA 3PNOA 1H8EA 3R75A 2PRKA 4R2HA 1QFSA 2ZQZA 3W6ZA 5CMLA 4JL5A 1S2NA 3H99A 4BNDB 5KWSA 2WIDA 5HEKA 4DMUB 1L4EA 4WLOA 3I83A 5B37A 3PTLA 4E2ZA 2WFMA 4DCVA 4BP1A 4CL2A 5CURA 2F90A 3M9XA 2OHHA 1P4JA 2MSNA 3OJOA 3D2AA 3QU9A 4YGYA 3WIVA 5FPSA 1FFGA 3PC4A 1JHPA 1GRQA 2RCNA 4J8PA 3N3AC 5E2BA 2OYRA 1FMJA 4QO7A 1EUDB 2OB2A 1I7SB 5JQWA 1KMNA 3H2YA 3QYPA 2MSDB 1Y8RA 1V16B 2CGEA 2JFHA 4ZMBA 2XGSA 4NC9A 4MDFA 1XTIA 5JD4A 3DT8A 3OC6A 3OTIA 4Q9NA 1ZVKA 3Q72A 3D3JA 2A5FA 3LW8A 2NAFA 1N2GA 4BVEA 4MKXA 1XTQA 2FSSA 4MVJP 2OEPA 4BQOA 1G2QA 5ERXA 3EB9A 4FWTA 4EG5A 4LG1A 5EIBC 4JOCA 3DA8A 4F06A 1N6HA 2FR1A 3AIKA 4D9EA 5BYAA 4DJDC 1PLKA 2SCUB 4POAA 4PZEA 4AURA 5FRDA 4LTNA 3EGWA 3AVUA 2ACWA 4A6PA 4AMGA 3O8NA 1U8ZA 2WD7A 4PSKA 5IT4A 1W9HA 4WKOA 2JW5A 3PIIA 5EHZA 3O83A 1LDNA 3B3AA 1DMRA 1NC1A 3HJAA 3NGLA 4DLAA 5P8WA 4F85A 1J2RA 3VPGA 4JQCA 3N2KA 2F43B 1ATIA 2J59A 2GI4A 5HFNA 3TO5A 2FN7A 4A2CA 5IJWA 1P1JA 2RAVA 4QGFA 4WCFA 4K6FA 1M3SA 3V4SA 4I1PA 2NU9B 1ZD5A 3NNDA 4J94A 1N0UA 3EG5A 1M83A 3FH0A 3ITDA 4NONA 3F0TA 5HKKD 2G07A 3IRUA 3NBZC 2Q4TA 3MBOA 3NAZA 4B6GA 1GEGA 4G1MB 4C0JA 2J0SA 4PGHA 2V59A 3RC7A 4B4DA 4C3ZA 2RGCA 5J5VA 2W4QA 3EASA 4V39A 1A04A 4JB3A 3L1JA 4CCSA 4FLFA 4J0FA 1X0XA 5D1NA 4GR4A 3ABOB 3CZ5A 4KREA 3CX4A 2CJPA 2WKSA 4M55A 2VSXA 4FOOA 1FX0A 3WOVA 4MP6A 2CLCX 4M99A 3UQZA 1QCYA 3AF0A 5AJVB 2VLIA 3MTAA 4M9XA 4ETIA 3QU7A 5LQDA 2DR3A 4K3VA 1IFXA 2QZJA 3PGJA 4B9AA 4CM8A 3MXOA 1L3CA 4QSMA 4BNNA 3OFVA 2HUPA 4OBBA 3IO3A 4EHJA 2REBA 4IFEA 3VMMA 3MJFA 3VJRA 4D0LB 1E2NA 1GUYA 1LBEA 5IK2A 1Z5GA 2O7SA 2QT1A 5DFAA 1VHWA 2VL7A 4Q3LA 1BCRA 4UVHA 1IULA 2LR0A 1V6CA 2ZWAA 3QLJA 2GAJA 3RHZA 2QBYA 3GRFA 4JYZA 1JDJA 4B4KA 1PJLA 2YZGA 2Z2XA 2ZIGA 3VSAA 3VMFA 4TZTA 4P3OA 2QGNA 2C1XA 1EK5A 1JVNA 2Y1DA 3HI4A 4RHUA 1AGYA 1UPUA 3OZWA 3ICPA 5BSUA 3ZDFA 4PO3X 3ZG6A 4E5UA 2YFHA 1G9TA 1Z5VA 5KX5A 1RXWA 2VDWA 5HKKA 3DTVD 1OFTA 3JAKA 4JC5A 4F4FA 3W4JA 1G16A 1DXYA 2G5TA 2PWZA 3UG6A 1TTQB 1XCBA 4BLQA 1JR3D 1O5OA 3IKJA 3K96A 3H7AA 1FFWA 1T8YA 3MT0A 3QKRB 4Z51A 3H42B 4LEIA 1IOLA 1LSOA 1YJBA 3G0IA 4EHKA 5AVZA 5EJIA 1AB5A 2WVHA 5HUHA 1HE2A 1KO7A 2B36A 2ZPTX 3H2BA 3OESA 3P7MA 4MDYA 4LHYA 1XXHB 2ATXA 2NUAA 3VV3A 2W6OA 4L28A 3O21A 4OX9Y 1KEWA 3DZGA 2J30A 3O8BA 4KL8S 2IHVA 2O1XA 2XH8A 5D8DA 2K6GA 4IDHA 5CR9A 3CIFA 5HJ5A 2GJKA 4UUBA 4GDFA 1OXVA 1Q3HA 3FG9A 3N5KA 4M4SA 5DK4A 1B0AA 1V5EA 4Y2RA 5CCBA 4OQDA 5L4SA 4MQUA 1DC3A 1U8UA 1UQTA 2VYQA 1XQWA 3M34A 4MVJF 4YACA 4C14A 3H9EO 1ISHA 3GIDA 4GXNA 4TTAA 1KBZA 3GGDA 4JY7A 2VWPA 1UMKA 1VLJA 4ACAA 4NQRA 4NKRA 1T9GR 2CHGA 1X1TA 1TVKA 3GZTB 3G1TA 4BNZA 4ER7A 3RIYA 3KSBC 4C5BA 3P0JA 3QWAA 1XC7A 4OY3A 3ZK7A 4GP7A 1K0FA 3GHYA 3GT4A 1YE5A 4WVLA 4QXOA 4H08A 5D3QA 4LF5B 2ZIAA 2ZI5A 2N1BA 4B7UA 4K0RA 4NBLA 1O6BA 1LJ8A 5ESWA 1IHDA 1TRHA 1MB0A 5LP6F 1KPGA 2OK8A 4Y6RA 2QTHA 2HV9A 1JR3A 4PS0A 3EFBA 3LQKA 1BYIA 4W1RA 4DQXA 1U2QA 3B8EA 5T4HA 4QVIA 1XZPA 2EOAA 1R5NA 3O9ZA 4UM8B 5G0WA 5TC4A 2GBLA 5A1TA 1IZ8A 2FPIB 2C4NA 1XRLA 4R7GA 5DHRA 5GZ6A 4LF4B 3Q0TA 2EHDA 4FD3A 4BRWA 1K9VF 2I4MA 4KXLA 4EF5A 3HXQA 2X9NA 4TV9F 1KIFA 1KAHA 2A0UA 4G8DA 3W06A 1NVKA 1AA6A 2VJBA 3HO6A 3FDJA 3JQ8B 2OSBA 3AEKB 4QASA 5FOVA 3WMEA 5I47A 2HX1A 4L4ZA 1QHXA 1XZAA 3E22A 5E9AA 3SYTA 4ZIRA 3RIHA 3PPXA 1RXUA 3LHKA 2FJ0A 3U48A 2QTFA 1FJHA 3OKAA 4HEA6 4ZVNA 5HKBA 4JZYA 2VHQA 5B64A 1SXHA 5JXWA 1XMIA 4JLJA 2XMGA 3TRDA 5M04A 2OQVA 3H9CA 1EAMA 1X42A 1FQKA 2PJUA 3R3WA 4YJFB 4RTPA 1T36B 3ZVRA 1OBOA 3PE4A 4YONB 4UPDA 3ZQKA 1G6OA 1EJ2A 2DYKA 3G49A 3L8MA 4BMDA 1M54A 2VHEA 2XQVA 4ESEA 3CH7A 5AXCA 3A6JA 3RS2A 5GIOE 1PDVA 3K9WA 1HNXB 3HPRA 4WFJA 3T15A 1ECGA 1Q57A 5J2TF 3OIYA 3WQRA 1NFFA 1TPYA 4LNUB 4MVJM 5ES3A 2VDVE 1NTOA 2AN9A 1JR4A 5SZKB 4RSHA 2OCYC 1JFFA 1QX3A 4QDTA 1KQ3A 5HILA 2PX6A 2PH5A 2VT7A 4UNRA 1XMQB 3ANYB 3USCS 2N1MA 2I2FA 4U2BA 1T35A 1U0SY 3AFGA 3AJAA 3W9YA 2FVXA 2YMMA 1YBVA 4EOGA 2DBVO 4N3NA 4TUYA 1KY5A 4D9GA 3CPEA 1ZCFA 3BN3A 4RKYA 3BK7A 4G6ZA 3VZPA 5KYWA 3NNSA 4E1AA 2FOIA 5EYPA 2I34A 2ZUDA 2BFBA 1MABA 2W00A 3IBYA 4PG7A 4RK5A 2R6R1 2CHVA 1E1QD 2HN9A 3GF4A 4G89A 4KUHA 4LJYA 4R9SA 4KTTE 2X8JA 3WNBA 3OWXA 5I6DA 3WGUA 2QNBA 5DOZA 1X1EA 3B38A 3GAFA 4RY2A 4B7AA 4DIDA 1SVWA 2C2OA 3Q41A 1N2OA 2MYNA 1W6RA 4UXJA 1J4AA 2VKTA 2WM3A 3S2YA 1A5ZA 3UATA 4D0RA 5JNUA 4D82A 1P62B 3CISA 1E4OA 3DSRA 3FWHA 2O2XA 1KFCB 3ANMA 1EXVA 1F6DA 5BNTA 1JHDA 2QMQA 3AK4A 1AURA 1YCGA 3H4VA 4LYFA 4H6PA 4MVWA 4OSEA 4ZOEA 3WSVA 4CCYA 4DBZA 3ZGZA 3GNSA 4RH1A 4IVNA 4DRXB 3MLEA 4FJ1A 4EPTA 4FCWA 1KMCA 2XWPA 2WU0A 1EDZA 1QO9A 4O2LA 4ZYLA 4K7JA 3G7NA 4F86A 1VGVA 2V97A 5L51A 5FQNA 4IVQA 4E32A 4WNCA 4UASA 3E61A 3EZGA 1Y0BA 3E8XA 3KDPA 4IVPA 1UJ2A 3T52A 3OHPA 1EJ0A 1KSHA 1U2EA 2NQTA 4GGOA 3E4DA 3PC8C 4MUJA 2J3JA 1QE3A 5K0BA 4HUQB 4NMLA 2COKA 2BI4A 5G0SA 3S2UA 4WXHA 1VLQA 2GUGA 3EQ9A 4LJLA 2FKAA 4EG6A 3DQZA 2O8DB 3DHVA 2HFKA 5AVOA 5DRTA 5JQGF 9ABPA 3A4MA 4IKPA 1E1QA 1NJSA 1IDN1 4Q18A 421PA 1E2GA 1O6FA 3BGIA 5FHRA 1S0UA 3CY6A 1VMIA 4LX0A 3DE1X 4UMEA 2PH7A 4GQBA 4KNWA 1J8QA 1Y1LA 3IBTA 5B53A 5IANA 1I4TD 3ABSB 4B2YA 2G6TA 1AGRA 1G7SA 1U7WA 3RK4A 3ROXA 4XQ0A 2D3TA 3B3GA 4CQMB 2G5GX 4O4IB 3RE1A 1SXJE 2OO5C 1OHHD 3KYCA 3T4UA 4BNTA 4EJFA 1OLOA 2B9EA 1F0YA 1XZDA 2XB9A 1VLZA 3CCFA 3GUZA 4GOMD 5JALA 3LM8A 4DPMA 3AHFA 1L4FA 2C82A 3TIVA 2C99A 2QX7A 3KVYA 1XROA 5JPIA 5LQAA 1XEAA 2IXDA 5BW4A 2NNWB 4ALKA 3IP5A 2H08A 2LZ0A 2GVZC 2ONZA 2FH5B 2X2OA 1BU5A 1WMBA 5DHSA 3BHIA 3C3YA 4DT1B 1YR2A 2C61A 3HG7A 1NVWQ 3LF1A 1E66A 3NNNA 3VPHA 5AJYA 1DDIA 4PZ0A 4DSUA 4B6OA 1E2UA 4YAGA 3EA5A 4TXHA 4CMCA 1A9QA 1SZJG 1TM1E 2O3JA 3RREA 2AKAB 1M2VA 2WICA 4AJ4A 1KI7A 3K32A 4P34A 5HP4A 1ODJA 3PFKA 3E9NA 4EY4A 1DRVA 2VF4X 5BSTA 5L45A 2JEZA 1MEOA 3QF7A 4D9HA 5DNUA 3EH2A 3QENA 1ZICA 1EZ1A 1ISGA 2HQSA 4J0QA 2QTCA 3V8PA 5IMSA 3EIOA 4EUHA 1L7PA 1AMUA 4Y2XA 3N0WA 1BMFD 1PZXA 1OVGA 1I5EA 1DIRA 4H0NA 4D74A 4FUQA 3NWJA 5AUPB 4BFLA 1UOQA 4TRMA 5T4FA 2CHUA 1OLXB 2I2WA 3T9AA 2DH6A 4LKRA 5CX1B 4P32A 521PA 5FYQA 4YJHA 1ZOOA 2IHJA 1C3LA 1U04A 3I05A 4D6YA 4I5DA 4RM3A 4R9VA 1C8VB 4U7PB 4D9MA 4ZCTA 1T8UA 1ZWKA 2QV7A 3NT5A 2XE8A 3P0FA 3QY0A 2Q0HA 4MARA 1I2AA 1MN6A 1X2BA 2GM3A 3FCYA 4HDKB 3WB9A 5JBIA 1CB7A 2FRVA 2ZIWB 1FDUA 1L4YA 2FG5A 3DLBA 1M8JA 3KEGA 3BCSA 3LUJA 4TS4A 4TN5A 2WU1A 4OXXA 5EWJA 1GDDA 2XT0A 2Z95A 2IZOA 2WJYA 2Y3IA 4BGUA 3SIRA 4P36A 2A67A 3NHFA 3RUHA 1GVHA 2RG1A 1U8TA 4K6OA 3IQHX 3GRCA 5B3KA 1SBYA 1H2BA 1ZM7A 2CDCA 4KEAA 2VP4A 2ILTA 1K7YA 1KBQA 4Y2UA 3FVVA 4MH0R 3VFDA 1R8YA 3S1LA 3DV0A 3ED5A 4MUNA 4B3JA 4ZJYA 2CV2A 2Z3WA 4L2IA 2X14A 1NASA 1PKEA 1CETA 1CDEA 2GJSA 1GT6A 1N5LA 3I4LA 4OIFA 4EG3A 3ONVA 2M6RA 1GCUA 1I33A 1DT3A 1Y1SA 4DR2B 8MHTA 1I9GA 2ICAA 5TNXA 3CQ9A 4X1KB 2OV6A 1YA4A 3CZ9A 3AM4A 2BZSA 1CR1A 4M60A 1LK7A 3SR3A 1BMFA 1VP9A 2VSNA 1WL8A 4K9PA 4B6SA 5BQ5A 4ZHQB 5IFKA 2I62A 2P91A 5EIOA 4QYMA 3JYPA 1TEHA 4ZVVA 4C7MA 1XVAA 1OXBB 4IEEA 4B5KA 2YS6A 1G8MA 2J5XA 1G0NA 4KR3A 2ATVA 1DIGA 3ONNA 4FIDA 1CR0A 1CU1A 2D4HA 2XTMA 2ZIEA 4J6EA 4XW2A 1OXKB 1AKUA 1G21B 3NIFB 1CJKC 1QGDA 3DDSA 2ETXA 4C0LA 4UHFA 1T8WA 3R3JA 3JQEA 1VL5A 4TKUA 3H8JA 2HGSA 4BP8A 1M7GA 3FCCA 1P75A 3HJGA 2GWRA 3EPJA 2GZMA 3HUEA 4KMRA 4L51A 5FHQA 2IP2A 1EWKA 4YRGA 3DG9A 4TXLA 4EPWA 2YVKA 3MAJA 5I45A 4DXHA 1JFLA 5A3QA 1O95C 2Z2JA 2B37A 3HKDA 3AM5A 4A0RA 4E30A 4Y7DA 3DZHA 3RU2A 4KGVA 2ODTX 2VT3A 2HSEA 4Q6BA 4OLHA 3FPSA 5EJ2A 3WFIA 4JS0A 1RI1A 2CBGA 2X4LA 4Y0VA 3ZWDA 5J4KA 4A8JC 4EG4A 1CUAA 2B6HA 3DB1A 4O2AA 2WFAA 4V0RA 1UWVA 5E3HA 2B35A 3S27A 2ZBQA 4TSKA 4BX8A 4CKCB 1DI0A 1DP4A 4FZRA 1EVLA 5G4KB 2B8EA 3DPUA 4BMVA 4NOMA 5IAAA 1AS3A 3FTFA 1XK6A 4CF4A 2Y1XA 3A4VA 2ASVA 2GK4A 4LUCA 5JMTA 1TAGA 3K15A 5F2OA 4PWZA 2I1WA 1N6LA 3KT8A 3VR2D 2ORED 3M6LA 1W36D 1N2JA 2C5EA 5AT1A 3U7RA 1JDTA 3HP4A 3GX1A 4AN1A 3C16C 4R01A 3ZN2A 1B14A 1IM8A 1AZSC 1CW2B 3HN2A 1IIBA 4JOSA 4EG1A 2OZVA 1PCXA 4IX9A 1EXMA 1I10A 3G0GA 3IBGA 3ZDQA 5KQMA 4L8WB 1YOBA 3TLXA 1ZD1A 2VPZA 2WAAA 2IVFA 2PIAA 1MO6A 3R7DA 1MDBA 1IPHA 3BE5A 4BUCA 2A84A 4EG8A 3PC6A 1IWBB 3PNSA 5CFLA 5CCXA 4YJGB 3MINB 4Y3UA 5T8KA 2VOEA 4KACA 1QCDA 3ZWYA 1I0ZA 3MLAA 1BMTA 1ZOIA 4I2VA 4KNVA 3Q3HA 1DWQA 3SC2B 3PXXA 2R5FA 5C0OE 3KHSA 2FSVC 1QIDA 2X4IA 4AS1A 1CUUA 3N2IA 1JLHA 4FCVA 4E5KA 1MT3A 1W5EA 3KJEA 1BEZA 1Y4DE 2BOVA 4F4JA 4R7TA 3N8IA 1K5GA 2HY7A 2AEMA 4LV8B 1WP9A 5DJ5A 4GKVA 3PUWA 5LXTF 3QLVC 3GAZA 1QFXA 2I7XA 3IPLA 1G8FA 2OFFA 5B1YA 1NU8A 2CVHA 3NDPA 4KV9A 3P2EA 1V7CA 4X1IB 5G3YA 5J2UB 3WLSA 3RAGA 4KV7A 1RQPA 4B76A 4MW5A 5JCPA 2BRUA 3TCNA 2ZT7A 3ZBUA 1ZJ5A 4M9SA 1GGJA 2DVMA 3VR2A 5J43A 2HBZA 3JD3A 4R8KA 1C0PA 1KYXA 4W5NA 3WDMA 2GAFA 1AKNA 1R4MB 1P4HA 1NYRA 1RJ9A 2PAFA 3CTMA 2PS1A 1YKGA 3CF4G 4BS9A 4CV2A 4LF8B 2VF7A 4FFLA 5AP9A 1MOZA 3B7GA 2CSXA 4H0FA 2ACVA 4UQLA 1U1DA 5I3CA 3RU7A 5LJLA 1LI5A 1M34B 2C3PA 1DAPA 2J4FA 3HYNA 2R6CA 3LY8A 1E1DA 4INZA 2OCKA 2J6IA 4X71A 5E1DA 2WTMA 4UCQA 1QGUB 3FOCA 5JI2E 2X77A 1TADA 2Q3HA 2NO0A 4IP0A 1DAEA 4X00A 4K05A 1XHFA 4NMWA 4PGFA 4YK7A 3Q1KA 2V1XA 3UT5A 2B7LA 1GY8A 2BHRA 2YWRA 4B3BA 1P4GA 1MC1A 1Z7YA 3PE3A 5AIAA 5FL7D 5JVDF 1V11B 4F4CA 2D5LA 1WCYA 5L4LA 3FPHA 3R7FA 3GP8A 3CUSA 3NHSA 2PBFA 1GQFA 4ZD6A 3ONDA 1GG5A 3GFBA 5AVKA 2VNIA 2Y2UA 4AJ1A 4PZDA 5IT0A 1RPJA 1JA0A 2IEIA 4QKQA 3C5HA 3RTAA 1OV6A 4I3GA 3R9IA 3PPWA 2IK8A 4IDDA 5F4ZA 1H9CA 1DOZA 4N47A 3UMFA 1N6KA 2GTIA 2AJCA 2GKGA 5CB4A 5JSFA 4OLBA 1JAHA 3PWTA 1AN9A 4TLBA 1QMPA 4DMKA 2I22A 2GYUA 3R0IA 3QFSA 3TNLA 3H5NA 2WVAA 3F67A 4QAJA 2FETA 1H0RA 5DXAA 2X7JA 2FSPA 2CMHA 4HCJA 1S2IA 4FMBB 2IRWA 2BF4A 4IMPA 1SIWA 2H1WA 2W2KA 2ZWOA 4UXIA 5AOVA 3W4KA 5JRJA 3LUGA 4BNKA 1F7UA 4IQ4A 2GN9A 4AF6A 2UZ0A 3ZWCA 4TKVB 1T4DA 1G21E 3B51X 7REQA 2BEKA 2EX1A 4XXHA 2FZ4A 3W5IA 1P7VA 2PR7A 5GOZA 4C6SA 5IXSA 4Z4QA 1SGWA 3ZD7A 2QAGB 2OCAA 2Q2WA 3ROPA 1VOTA 3H18A 1IXSB 2EP5A 1GTVA 1KI9A 3NJ8A 3G3EA 1JEOA 1Q3KA 2WTNA 2Y1WA 5SZHB 4E88A 3JQAB 4KR2A 2VSQA 3E8SA 4G1VA 5EL0A 1XXLA 3DEJA 3QUAA 3UB2A 1I36A 4FONA 3S28A 4OHRA 4GKBA 1USIA 2ZYTX 3KZMA 4AUMA 1YC2A 1DJMA 4JR2A 2FEWB 1ULSA 5HMMA 4J2OA 1RBMA 2GN0A 4JVLA 3TX6A 3NTUA 1YIOA 5ITVA 4IV0A 1DKQA 4FGLA 4BO7A 4TMFA 1ISMA 2BTQB 1OE0A 2ZCUA 4BRZA 4KQHA 3AETB 3H4TA 3Q98A 4MQFB 4N0QA 5KWIA 2NT4A 4WUTA 4FNMA 4WK0B 5JPCA 3RABA 3VTAA 1UBKS 1CUZA 1ZFNA 2RKOA 3EIQA 4J90A 1RJEA 3VPAA 1W35A 3U40A 1PJ2A 4H7KA 3ZHOA 4DLVA 2G88A 3QITA 4R2KA 1P39A 3ZE9A 4PBSA 1A2BA 4UZEA 3CMCO 3GMTA 1R4AA 3HFGA 5ICGA 4AMUA 1E7WA 1ZI9A 4GXRA 4LMBA 4RQUA 4BZXA 1NSYA 2A86A 3NASA 2CD7A 3CM0A 3NOOA 1R9MA 2UZIR 2G28A 4XIGS 1JEYB 4WWHA 4AROA 1Z34A 1M73E 4L5YA 1XI2A 2RBKA 5EJFA 1ICIA 1RJFA 5FNZA 3WQBA 1JVSA 4FE3A 4O1HA 1M1XB 3L01A 2PRYA 1JBKA 1KOLA 3UAXA 3JAWB 3M5PA 4EFNA 1N7IA 3A9CA 5I9MA 4LY9A 4JBWA 2C4UA 4A1OA 3KIPA 5FADA 2JGRA 5FUQA 1JSCA 1JTVA 2PYDA 2RHDA 2AEJA 4OYYA 1BVHA 3NONA 5GV8A 1NXTA 4Q5IA 1ZUHA 2II6A 2K87A 3ZK8A 3OVMA 1FP2A 3NPMA 5JJ5A 1CD5A 3LWDA 4Y9DA 1DX9A 4IIXA 1BRMA 3DT9A 4JT9A 2NXEA 2V7BA 1JPJA 2VF5X 4EHLA 4P6VF 4GX0A 3W6NA 1Y42X 5JLAA 3M6VA 4JELA 4KHZA 2N0SA 3M4NA 5HUQA 5JNRA 2NV2B 2BGUA 4I0WB 5ALZA 2G9QA 3NI2A 4YDHB 4R1TA 1ZA2A 2FP4A 5FBZA 1MB3A 1DINA 4P4GA 4JI6B 3RJTA 4F92B 1Y7IA 4K8RB 5KVAA 2AVDA 1G7CA 1OKKD 2HLNA 2Q0SA 2Y93A 4IDBA 4F12A 3B9QA 4WKNA 4ZK2A 5HWSA 1QH8B 1TL7C 2XD9A 3AF4A 2LGJA 4R9RA 1O5TA 1FYWA 3QX7A 4O8CA 4ZA2A 2RI0A 1YB4A 5K8IA 1R0ZA 1GKLA 1ORRA 3EIWA 2RSLA 4RXMA 5J5CA 3UJAA 3K6RA 1V9CA 4YLGA 5J58A 1BFDA 2OV1A 1WUIS 2GAAA 4BGIA 1VG9B 3EODA 1C80A 2WHPA 1SVKA 2I8LA 3RYCA 1IC6A 5TRTA 3ZWWA 2WYOA 3B6MA 3DBIA 3EDRA 3KZKA 3M5CA 4HDMB 1JKMA 2GAOA 4EECA 1KMHA 3PLAE 3QFFA 1YDGA 2VA9A 3AGPA 3EXIA 2X5JO 3T5TA 2CZQA 2X4DA 2UVPA 2B1JA 2XADA 3C3AA 1VCIA 4RHCA 4QTYA 2ZJBA 1BC5A 1WUTA 3HFRA 3M8KA 1SULA 2VPXA 4FN5A 4PHCA 5L3ZA 3ANSA 3UGKA 1QOZA 1AS2A 4LC1A 4ZHQA 2JGKA 4OMUA 4ZYZA 3QUTA 1UM9B 3ZJTA 4QBGB 3LA8A 5BWLA 4H3HB 3TAXA 3H7IA 3HDYA 3V34A 2QROA 4LJSA 1G7TA 3F5DA 1P5JA 2O3QA 3LBIA 1IIRA 3L7DA 4L3OA 4FMDB 4QEDA 2Q3CA 2J41A 5LMUB 4KI7A 3HBMA 4WBXC 4X1YA 2QU8A 4MUXA 3DHWC 3LPCA 2XQKA 4ND7A 4R2JA 1ACJA 4XM2A 5EZYF 3T61A 3OQ1A 4B5LA 4Q1EA 4RTJA 1OI4A 1REQA 4FYXA 3RF7A 2YFQA 1PKXA 2AFVA 3AI1A 1XZCA 3JZIA 1E9CA 3JU3A 3W79A 4A8PA 3OICA 4YDRA 3VPXA 2EEPA 4YJ3F 1CX9B 4JB8A 2DRIA 2J87A 3T3OA 3MWDB 5DTRA 1ZI8A 3ZZMA 4ZDJA 2Q5LA 3C98A 5HYVA 4CF6A 1M9NA 1VBFA 2QXUA 3GFRA 2HIGA 1IH8A 4HLUC 4WNAA 5LYJA 1YL5A 1FJGB 1BDHA 3NOXA 3M3DA 5JJCA 3HR4A 4JEHA 2YC4C 3OZTA 2P9BA 2BTOA 4P84A 4IJKA 4B7XA 4G0WA 1T3GA 3HYRA 2XUQA 3TSAA 4B7ZA 5ALOA 2Q3BA 1O0SA 1PFUA 3A6EA 2B8WA 2OZKA 2IXFA 3MRXA 2CUNA 3PXUA 3Q6NA 1Y5LA 5F7JA 3EXG1 3U3DA 3R7WB 2AR0A 3NVMB 3QHPA 4CQJA 3K1AA 3OSZA 5EMMA 5SV2A 5LZ8A 1M8FA 1US8A 4H6WA 4JR0A 3KUDA 2V45A 1YBAA 4LI3X 4GGPA 4D97A 4QAQA 1XAHA 3ADKA 1PFQA 2FHPA 3K8OE 3PVSA 3NHBA 2OQRA 4N7BA 5IYZA 1JJBA 3R7BA 4OU5A 4F7WA 1AUPA 3VGPA 5IWCA 1M1ZA 3FA2A 1CIJA 3DE0X 1TMGE 1A98A 2CL6X 4JFRA 1JSLA 1XD9A 2GEJA 1X3LA 1FMLA 3UCEA 1P2VA 3OECA 4RKRA 4DPKA 2KBFA 2KMLA 3BH7A 1KPHA 1XG5A 5JRDS 4LJ7A 1NPTO 2NVUB 2O52A 4JGIA 5CFMA 4E5MA 4UEWA 5BVHB 1FDIA 1PJBA 1RAAA 3CUWA 2GBGA 4R0VA 4DG8A 3AHGA 3PIDA 1ONBA 2PXAA 3L41A 3NBUA 2BKVA 5JYCA 3F8TA 2X42A 4X5OA 5IPFA 1L8AA 3TQCA 5A9RA 1S02A 2QL9A 2J8ZA 3UCFA 5A62A 4RCVA 1R3UA 5HZGA 2HWWA 3A9TA 1E96A 4LPKA 2ZJZA 2HRZA 1B15A 3MJEA 2IZ6A 1RWMA 1Z9BA 2PBRA 1C3VA 4M53A 2XZLA 5EJEA 2I6QA 4WESA 1VYUA 4KI0A 2ZYAA 4WK4B 4A4DA 1RI4A 1LX7A 2ZIFA 3K70C 5HRAA 4GSKA 5BWBA 5SYAA 4MV5A 5AK4A 3CBQA 5BV1A 1PFWA 4ML3A 2IHNA 3GLRA 4HADA 2PL3A 3BF8A 1W4CA 4FQ8A 4RY8A 3E9RA 1XDWA 4YPOA 4G0VA 4C3UA 3B7WA 2I71A 1FTWA 2QUIA 1PNTA 2JL1A 2O14A 3FNQA 3OM0A 5FNVA 3KR9A 3IVRA 3R7AA 4DA6A 3TD9A 5BOSB 3WWYA 3BD6A 2CJYA 1L5WA 1FPMA 4YDQA 2M6SA 5CDHA 2R1VB 3THYB 3KUUA 3CU5A 4CI0B 5B7PA 5JD5A 2QDXA 1QRAA 3C39A 1XCJA 1TQDA 4DNFA 3LYHA 1RPTA 1Z3CA 5DTJA 1C8KA 1SBIA 2V7QA 3H1PA 1YVUA 3ND7A 4R8RA 2V6MA 4LY3A 4QUDA 3C7AA 3KSAC 4DG9A 2DXIA 4HY3A 2ZTSA 1LNZA 2NYAA 4JIGA 1QH9A 2FFQA 1H0SA 4BY9E 1JDVA 3V48A 4TOIA 2A92A 4S12A 1SBCA 1U4NA 2XUHA 4TKLA 5F64A 3A8TA 3P9XA 2BGJA 1I7NA 5JZVA 3EGCA 2YCBA 3F8SA 4M86A 4N54A 1Y6FA 1FNCA 1FTNA 4G0MA 4HVTA 4PLFA 4M9QA 4XPZA 3C6KA 3R6LA 1WHTA 2WYHA 3WC4A 4G5QA 5C7OO 5EZQA 5FBVB 4YUZA 1M6NA 1G8GA 1YS2X 3AXTA 3MD0A 4FYIA 2IS2A 3E70C 2VI5A 3OLCX 4WCFC 5E8RA 2VZEA 3WGTA 1KJYA 1JHQA 1YIAA 2R3SA 2HV8A 3E7XA 4QUIA 2XW6A 1TQ4A 5BQOA 2WUEA 1QJCA 1T9KA 1N77A 4V38A 1FTGA 4RTOA 5DO9A 2QN2A 2AI2A 1FQWA 1YCDA 3M4JA 3B20A 3EEFA 1X7ZB 3X1KA 4GC5A 1AQUA 3AHJA 3VUFA 4I6EA 3A4YA 3QX8A 3ETEA 3IH5A 3IUQA 5BPFA 2VJMA 3ELUA 1Z5OA 2RC5A 4HL6A 4JC8A 3ZU2A 1CZKA 2FTKE 3U6KA 1OLSA 2XT6A 2MT9A 5ELXA 1KXZA 2Q9AA 3L7MA 2AI1A 1FIUA 1GNLA 2IYVA 3SKXA 4L8YA 2NACA 3QKWA 1NV8A 2BUBA 2OYSA 4L4UA 2K7FA 3V7NA 1DARA 4U5QA 4YMWA 3AC0A 4KRYA 3WRXA 1CYDA 1AXEA 1JDPA 1TJ5A 3EGEA 3DHEA 4CIBA 2ZBFA 1YQ9A 1BFUA 2Q8NA 3Q2OA 2QVXX 4UMFA 3WK6A 1HQCA 1RPNA 3NU1A 3S29A 2FPWA 5K8TA 4U7DA 1PVOA 3DXZA 4WJLA 4J16A 2PNJA 1DJPA 1I3OA 5G1OA 4M6WA 5AOBA 2RDMA 1LDEA 1V0JA 3DOJA 4U7GA 1R9NA 3VC3A 4Z4FA 5TEVA 4RZIA 5IH7A 4WEOA 3DDHA 2I87A 1BE0A 4ZVSA 1ZCZA 4JGBA 4BBZA 4CG3A 1FP7A 1RIIA 4BWGA 1HFKA 5JI3E 1SXPA 5C37A 2F64A 3OO0A 1QAOA 2QRMA 2DT5A 2HPZA 1D0VA 3B5EA 4RQTA 4URZR 4E51A 2AZXA 4OKNA 5JCXA 2IDZA 2ZJAA 3UJ7A 2J5RA 2NU8A 4GD3Q 2ZZKA 1QFZA 4NZMA 3W6UA 4EITA 4LXQA 3OQPA 1WDWB 1G41A 4J1QA 2XMRA 3WWOA 4AO8A 1O9GA 3QUQA 3E0QA 2EP8A 3N53A 2M6KA 4MGEA 4P4SB 3MYRA 2ZRNA 3LX6A 4LJ9A 3PJEA 3OZEA 2ECOA 2PZJA 3DBVO 4MW7A 3SLRA 2ASEA 3L07A 3K5IA 4CIXA 1DEKA 1E3WB 1CUXA 2QYHA 4KSBA 3DR3A 2O7RA 2Q7XA 4G5HA 5CT9A 3WTBA 4M98A 3K7EA 4L6IA 4L8LA 3A32A 2A1IA 2UV8A 3W3ZB 2NYVA 3AESB 3CS3A 4OO3A 3H6GA 1RM5A 2YASA 4JXKA 4AG6A 4F6RA 3GLKA 1A69A 5LYYA 3ANTA 2ODNA 1LW6E 5KJ1A 5JUWA 1KEZA 4OPMA 4JI2B 3VR4H 4MQMA 9ATCA 3RC2A 1VGQA 4YMLA 2WWVD 2D2FA 5JH7B 3GDWA 3KOMA 4Y1RA 3PQDA 3ORHA 1TECE 3L7CA 2GF2A 3PNKA 1L5OA 2O48X 4BUZA 5ADUS 2B2CA 1QBKC 1JNXX 1IBSA 1T8TA 2ZSUA 3DOIA 3D4NA 4KVAA 3IDOA 4XD2A 5BUZA 1WB6A 5KWEA 4KZKA 4JJZA 5J4HA 3KPJA 2NADA 3C87A 1GT91 3D02A 3DO5A 3ZXYA 5AO9A 2H48A 2V6IA 4QLAA 5EP2A 2BFAA 4S24A 4ALNA 1YQWA 1WR8A 2ZRBA 3D59A 4U4AA 4LMPA 3THSA 2PX3A 3ITEA 1L8LA 1J8DA 2C5GA 3RF6A 4M0CA 1QRSA 3X1DA 1XYYA 2IOFK 5THXA 1EUCB 3PNQA 4DGQA 3WVNA 1LW7A 3CXUA 1U3UA 5IAEA 2P4HX 1Q50A 1ZGCA 2C92A 3QMPA 5EIXA 2GARA 2GBLC 4RA9A 2I2DA 4B0OA 1YR3A 5IBRA 2PD4A 1E0SA 4CODB 1U1EA 4WH0A 3E2PA 1JDZA 4S2UA 2PUFA 3PRHA 4HZUB 3UMCA 5I7AA 1R0SA 5FR1A 5DHPA 1O6ZA 3E23A 1NE2A 3MUFA 1CJMA 2JATA 3AOEA 1SJ9A 1U0RA 2ZSDA 3PP8A 4JU9A 2DFTA 2ZG6A 1V9SA 3EGIA 3HV0A 1A96A 3V1NA 3KZNA 5GJCA 5HOEA 5AVJA 4Q47A 2E3JA 2A14A 4EL5A 3OJLA 4AWXA 3NC4A 1ZN8A 2KB0A 3WMWA 3GWZA 3KHTA 4JEMA 2JLYA 3AP2A 3ZGOA 1W85B 1NRIA 1DRUA 4BASA 8ABPA 1CFJA 3FLAA 3ZU6A 4MOWA 3IJPA 4MEJA 3V6LA 1SAYA 4QREA 1YMUA 1VIDA 3OPYA 5BQPA 3G8DA 1C2YA 2H52A 1JG1A 2Q29A 5HDQA 3T0FA 1G5RA 3I6YA 4NMHA 5JRZA 4M8LA 5KMGA 3H13A 4GXTA 3G82C 1DBRA 1V37A 1DKOA 2V0NA 3QIVA 4Z8YA 3TQTA 4JI8B 1MO4A 3V6MA 2OP0A 4Y6OA 3G89A 5FEUA 2VKQA 3I1JA 1QDUA 4KSYA 5BT9A 1KOFA 4WHMA 4DMHA 3LO8A 4IJ6A 3KL4A 1JWLA 1QRDA 2HKIA 3BHMA 4KQCA 4OTZA 4AK9A 1N2CB 3GP3A 3QPWA 4XE5A 4EHDA 3ST7A 1JJIA 4JXJA 3ZUPA 3BB4A 3U81A 3SBEA 4J0DA 3TD6A 3KQNA 2AG8A 3EF3A 1Y8QB 5EN4A 2PZFA 1GAJA 5HJ7A 2O2SA 1C8BA 5HGJA 2F8SA 5T5QA 1VZ3A 4W6QA 1ENYA 4JCCA 2JVJA 2P4UA 3BGDA 4PLYA 13PKA 2QVGA 3PF8A 5HZKA 4KLAA 4D25A 2IIVA 3DCIA 1CUFA 1NM5C 3DBHA 2QIOA 3IHLA 4RESA 4CT0A 3PG5A 3HMKA 4RDCA 1SD5A 1DC4A 1JW9B 3NFYA 1MC4A 1UC8A 1DWOA 2HEIA 1X74A 1EGHA 2NW6A 3DR5A 3SLGA 4H7EA 1MJGA 1AUQA 2F62A 3LHIA 1NW4A 5LZ5A 2YW2A 3KZCA 4K9RA 3QEMA 1WPXA 1EVJA 1NN5A 1QZTA 1S3SA 5WRFA 4W9MC 1FYFA 3D1JA 4KE9A 2JZNA 1G5PA 4BWFB 2C54A 3GWGA 5A4KA 2XXAA 1WF6A 3BERA 1FSFA 2WSSA 5C46F 4W5RA 2FCRA 4JSTA 1B8NA 3D8TA 4KFRA 2P0AA 3EXFB 3LKDA 4JOBA 4QU9A 4RTSA 2JH3A 2M1ZA 3BX1A 3IV9A 3K92A 4Q1VA 5TVGA 2VBGA 4BMOB 1UUFA 3EVEA 4KYUA 2P9ZA 3WJAA 1CJCA 2D13A 3R6DA 5CEJA 1T6NA 3I6ZA 4FZJA 1NBHA 3HDHA 2DQYA 2WD7B 2R7MA 3FLBA 1YDMA 3UMVA 1J5XA 1U7UA 2YNMA 1LTKA 3PSAA 1SXJC 3DAYA 4XLLA 1OIVA 4ESVA 3GJZA 2RAUA 2CVZA 1I6WA 3GG2A 1M1YB 2WVJA 1NUQA 2BC9A 3M6FA 4FNAA 4FT2A 4NPHA 5K0EA 3X44A 3M6AA 4PYNA 2FI1A 1Z4MA 1G8SA 2QW0X 1NIPA 1OASA 1UKEA 1RLOA 2XX3A 3O31A 1EDOA 4HN9A 5E1BA 2P9CA 4DQDA 3PJRA 4JL8A 4YDSA 4FGWA 4DMFA 5TB5A 3J80A 1JH9A 1SCQA 3BL5A 4CN8A 2HBRA 1Y89A 2WEKA 2HSGA 2IQIA 2MWMA 2DFKB 2XB4A 2ZYIA 4JJEA 3V2IA 1U2GA 4NCBA 2OXEA 2I3DA 3GC6A 3P5SA 1SVUA 2E21A 4DV3B 3G85A 4NG5A 2WM9B 4QOEA 3VPBA 2Y67A 3FJ1A 5H8WA 4AQDA 1RRCA 1PS8A 4XFJA 1QFMA 2V7TA 1NUTA 2R87A 2Z4SA 2HSZA 3NUZA 1ZU5A 1YD7A 1D4FA 2HCJB 2IELA 5IMBA 4PPNA 1IQUA 1ETUA 1G5HA 2WFZA 4UAGA 1YS6A 2H63A 2P35A 4UBIA 3ZXUB 3KL2A 5B2FA 3KQKA 1P31A 2GRAA 2VDMB 3CRZA 1OSNA 4NYJQ 5JEEA 1K86A 1RLJA 5AKJA 3PICA 1UJNA 5LQCA 3EMBA 2XTZA 5H5JA 1DAMA 2LIVA 2J7KA 2JFUA 2XOXA 2Q99A 2YV1A 3FBWA 4GI7A 4I36A 1G6Q1 4DHEA 7MDHA 3NWOA 2PXHA 4YP6A 1YL7A 3HU5A 3K0SA 1BG6A 3KSMA 4ND4A 3AUFA 4U9IS 1PTJA 1MLDA 3R9KA 3RS7A 3U19A 3AR5A 1RRGA 2QNIA 5JNWA 4F21A 2OOKA 2NUPA 3PQFA 2GGSA 5E3IA 1MIOA 4AUKA 1VMDA 2A9VA 3JX9A 1FLAA 2PMFA 2PYZA 1Q5PA 3MIZA 5F98A 5K0NA 3GLGE 3TTXA 3HMQA 4PQRA 4GZ5A 1IUOA 3VVBA 3DVAA 4JT4A 3WYEA 4HT3B 1ZCAA 4GVLA 4BB9A 3CT6A 2PV0A 4KWIA 5KX5B 4PE5B 1GYQA 2IZ1A 1P1CA 2VDWB 5GJWC 3JAKB 2PVSA 1FS6A 1CF4A 1Z8DA 4LBVA 4RTMA 4GBED 4A92A 1OA0A 3LVRE 3W5JA 3MAGA 4RPIA 3UV7A 1KGDA 1YB1A 5DISB 1TQ2A 1LBTA 4E31A 2R00A 1XRRA 1JWBB 5L3RA 1G20A 1N25A 3A37A 3PVCA 3BZBA 2E82A 3GGJA 4DLNA 4J49A 3QNMA 3VU9B 1E8DA 3E03A 5EZSA 2CUTA 3EDYA 3GW8A 2C0QA 4P5PA 4ILEA 2W2TA 1G20E 1ORTA 1QH1A 3QG1A 1U8YA 3P32A 4XUDA 1FA9A 2IYQA 1SIBE 4FFMA 5H68A 5BXYA 4RULA 2DETA 1NQXA 1G2OA 4EY5A 1AKEA 1KR2A 3PC3A 2CWWA 5HVNA 3OEYA 3GLTA 2JGDA 3JQBA 3ZWPA 1FXWA 1T1RA 1G18A 2XLBA 3OJ0A 2XZPA 1L3BA 3R3YA 2DSTA 1N9ZA 4CRWB 2OCDA 1QIIA 3V5NA 1SKUA 3W6OA 3WBBA 2ZRJA 1Z4LA 2PEYA 2X8BA 1FL9A 3WL3A 2PMBA 4P53A 2DY0A 2G72A 2GEKA 3ESZA 5EVCA 4G1FA 1YASA 3G88A 1ISPA 2QQ0A 3WLEA 2WM8A 3JRWA 4LY0A 4Z99A 2H1FA 1WEHA 3QFCA 4S1VA 4DE5A 1FCJA 4YAFA 1TVKB 3K2BA 2IXAA 2QPOA 5JPDA 1G17A 4M76B 1T6XA 3EGXA 4CEHA 1DT5A 4M83A 2YWBA 3CX3A 4JLBA 1KTIA 1J1ZA 3D3EA 4V02A 1U2TA 2G70A 5FUXA 4BLRA 3W9SA 1DADA 2VH5R 4X45A 5JHGB 3DTVB 4E94A 5HX7A 1ZNWA 4OD0A 1T1JA 4DLLA 1EX7A 4QU5A 4NYIR 2VNHA 2HCRA 1HDXA 1M2HA 2F9FA 4K0KB 2D2EA 4R1UA 5ALIA 5IG2A 1O58A 5ICEA 2BSQA 2IZ0A 3UT6A 4MW9A 1RYHA 4GX2A 4PPYA 3ZUGA 3AKEA 5LR6A 1NHWA 2Z5FA 5DV9A 3SOZA 4B3DA 5AW7A 4B84A 4EDFA 3BDAA 1VG0B 1YRAA 2AG5A 3FNHA 3WYCA 3VKUA 3FUWA 1IK6A 3ZX4A 2JDIA 4O4IF 4JI1B 3WYAA 2ZI4A 4BLUA 4DLPA 4BFTA 4ENSA 3L8EA 4ZIRB 1IHPA 3F4LA 2ZXUA 4XB1A 5SY9A 2O3TA 5GONB 1CUIA 2IOQA 2VJLA 4JBGA 2GEBA 2QX8A 5CNJA 1NNLA 3HB7A 4CL3A 1Q17A 1WNFA 3AUYA 5CHYA 2ENWA 4MI1A 1JKFA 2WUDA 1YA8A 3BCUA 4OQEA 1YU9A 4PIMA 4X9XA 1AE1A 4ZKDA 1NF8A 3PGKA 3ROQA 1Z0JA 1A7JA 1WXQA 2IS4A 4XOUA 4BCDA 1JHOA 4N0EA 3VDNB 3IAHA 1RZUA 3ESQA 5ESDA 5TPZA 4G0ZA 4CEJB 4PIPA 3OA2A 1WU8A 2F9LA 3HJFA 3D6UA 3EEIA 3AZOA 3Q9LA 1U8XX 4M0DA 3WGLA 1IEWA 3O2SB 1FYEA 1GNSA 1LI7A 3DUFB 5DM0A 2DULA 2XDQA 2PD3A 3G2MA 1BIFA 1F6BA 2JI8A 2PHZA 3M9LA 2WJAA 3NV9A 4B2IA 3TKAA 4BVGA 5B3LA 1KDRA 1SUAA 1J1UA 1E64A 1N8KA 1QG2A 1ZCBA 2HF7A 5HQ3B 2CMGA 2IU6A 4Q4CA 3ZJUA 2X8JB 2P9HA 1ISSA 1I51A 3KQVA 1ESMA 4CDMA 4DABA 3ZLJA 3K5WA 4XM1A 1ZCJA 3SI7A 4WBNB 4QUEA 1V4BA 1RCTE 1NNI1 2MSLA 1POWA 4IFBA 1Y1TA 4IS3A 1YBMA 3PKZA 2R7LA 4ZT6A 3FOBA 4K1XA 3IQZA 1LVGA 4JUBA 4XZ3A 4HJRA 4QTZA 1WW3A 5DCYA 4YRBA 3T1TA 1Z6YA 4BO1A 2CXQA 4LZOA 2R4TA 4I5EA 4DXDA 4KZPA 2CLMB 2BRUC 1W0KD 3WIUA 5K4AA 2ONCA 4M1MA 1JIKA 5B7GA 1KU6A 4NP6A 1ZGBA 4RF4A 3PT5A 3UQYS 1R66A 5LKRA 1MJ5A 4M1SA 1P6UA 3D7KA 2VNAA 1TU3A 3IAM6 5D84A 3I2FA 2NVOA 2GDJA 3GJ7A 3IESA 3U7QA 1QB7A 5A04A 3PL5A 2XUFA 5AKZA 5DB4A 1Q7CA 4R2WA 3DTYA 3AVWA 3DMRA 2ODBA 4H15A 3BJZA 1R6BX 2F9MA 2HLDD 4H9GA 1OBCA 1AA9A 4PV7A 4NAVA 5D3ZA 5J4VA 3I5YA 1D2CA 3GEGA 1QLHA 4GKAA 3I28A 3E2IA 4YUWA 2YJZA 3AEUA 3N0XA 1W0JD 4NIMA 1Y5IA 4LVOA 1Y37A 4JVSB 2BDUA 4ZHQF 1BNCA 1IEVA 2YRXA 3FZNA 3EGDA 3HGQA 1K8QA 2P3OA 3VNSA 5CH3A 4AZ3B 1UBOS 4EA7A 4P54A 4RABA 1N0IA 3PNYA 4RJLA 1K4YA 4XUCA 2GBCA 5B7QA 3W5CA 1JQ5A 5IC4A 4EKIA 1Z07A 2XMPA 3UG7A 2FW6A 3AWIA 1QYWA 1QQ5A 1E4EA 1URPA 2OPHA 1ZR2A 1W0CA 4C76A 1E79D 1NUUA 3DLTA 3OD1A 4TT3A 3SYKA 3K8YA 2O59A 4KDCA 3SHTA 3L3BA 5JR3A 1MIHA 1GCAA 4N5DA 2XVAA 3OOSA 1CJSA 1JAXA 2OKGA 4GL4A 2H1RA 9GPBA 2YV3A 2PKYX 2DUUA 3KKNA 5MN4A 3FSGD 3PUVA 1RYDA 4AN4A 1EGMB 3NVDA 3ZH9B 1POXA 2BKLA 3ZW9A 5L3VA 4X84A 4OXYA 5BWOA 1YVEI 2FPRA 3IKLA 1IATA 3D0KA 3CMMA 5DX1A 5G2OA 1L7VC 5JTUA 2Q9CA 1M2VB 4RD0A 5CNKA 1RD4A 3SYMA 2XQIA 3N2YA 2PA3A 2ADMA 1R12A 2HLDA 5HKLA 2BKXA 1R18A 4YECA 3GGOA 1TCBA 1YB6A 1JSZA 1PK8A 2BE7A 4LHVA 3ZI0A 3FR8A 4MS1B 1H5QA 2W22A 1X7HA 1ZMOA 3DAPA 1W0JA 3B2NA 4KQ1A 2QVLA 4KKXB 5LMCA 2R6AA 4C04A 1K89A 1RKQA 2OGZA 1BA2A 3DOFA 4I4LA 4V0NA 5DEOA 3DDZX 3OQJA 4RFSA 4DQUA 4RTLA 1WB4A 3U31A 3GJ6A 4BATA 3FPBA 3O0DA 1UJMA 3KZVA 1CRWG 3L06A 2ZB3A 3CW8X 3QJ5A 2VZ0A 2NXCA 1P0PA 1ZUWA 4F8EA 3HBNA 4M8KA 1RKVA 4M1YA 1VI6A 3OOEA 1PIWA 3HWSA 1U9IC 3G2QA 2C77A 1HE1C 4X8OA 4WPGA 4Q21A 4Q3DA 1DZ3A 3JWHA 2VHJA 3S1AA 3EEYA 3G2KA 4CT4B 3U7GA 2FN3A 2D1YA 1Y34E 4KK3A 4S1NA 3KFLA 3ZH2A 4LMRA 1Q0RA 1CIPA 3SX4A 4KAFA 4DZZA 1UDCA 3L7LA 1UOEA 4JBNA 4YTEA 5EJ4A 2PTGA 1HDGO 4ND8B 5I9IA 1HDZA 2XECA 3EOAI 1HNWB 2NZVG 1E6EA 2A9PA 4XSGA 5JCJD 1U7ZA 1CF2O 1XP5A 2A1TR 2MSWA 1YR1A 2O06A 4WJKB 4TTSA 2IXGA 3IOEA 3VKGA 1ID1A 3RAFC 3HTXA 2AMVA 4RVSA 3ZCRA 4MKIA 4DARA 1ZJJA 1IG0A 2QN7A 1QTIA 1DQZA 2ZJ0A 3QFTA 4KWTA 4TLDA 4LOLA 1DJNA 1UKBA 3DT6A 4HNAA 4L2IB 2FG6C 3VYRB 1R0YA 1SK8A 3A7EA 2HMWA 4ZT3A 4U3JB 5DP1A 4OXQA 1Z6AA 2QEQA 4J1TA 1IWPB 3P96A 3WNCA 3VKVA 2BMAA 5CB6A 3WBKA 5ES4B 3SC3A 1R88A 1T8PA 2IS1A 2GH1A 5J2UF 3M89A 4K9SA 2PMDA 3ZXIA 2AFRA 4G09A 1YNSA 1D4AA 4LYJA 3VTFA 4XYGA 2ZRFA 3L49A 1XJWA 3VAZA 2XCLA 2ADOA 3I9LA 3DCNA 1XEXA 2IHTA 3REQA 1ODIA 1BEUB 3TG2A 2P41A 4A8HA 5C3MA 1Q1QA 2OQ2A 4ARBA 2ZU0C 2CMKA 4MO9A 5AVQA 4Q9AA 2M9MA 3L1UA 4PAGA 3MZ0A 1YQEA 1WW8A 2QTNA 2ZI7A 3LIIA 1X14A 2HTFA 5F7OA 3IB3A 4WT7A 4FI3C 3O4HA 5HF6A 4F46A 2NZ2A 4HDQB 1QGZA 3PHHA 2Q6TA 1NU6A 4J1SA 1HZZC 1DPGA 2VJNA 3OC0A 3RUEA 1QF6A 4EA6A 5JZ9A 4H3VA 2BAGA 1MEJA 2H2FA 4AKGA 3ZV7A 2MYPA 2VRWA 1AGPA 3E7FA 4HKTA 1C30B 5DN6D 5KTSA 1KKMA 4B8ZA 4NPAA 5HQJA 2BFCA 5LUAA 4EEXA 2IW3A 3F7MA 1OUMA 4OVKA 2FF7A 5JCJA 5CFNA 2O1EA 2ORIA 3RBZA 1GRRA 2A5DA 2FRDA 3MTGA 3QLEA 2VHZA 3A36A 5IC6A 4EO7A 3O4RA 2D0PB 2EARA 5CYGA 1IYZA 2ONJA 1NT4A 1SM4A 4GX1A 1NVUQ 2R1TA 3VZSA 2PVPA 4OK6A 2YUTA 2JZOA 3T06B 1FJ2A 1WCWA 4QZVA 4X7RA 1JEEA 3FDIA 4ZRMA 1QP8A 2OAEA 3RKRA 4AD8A 5JSUA 3QNUA 1X9HA 2QK4A 4I6GA 4XSHA 4PNPA 4BO8A 5MGNA 5EMLA 3MHTA 2O8CA 5G0UA 4OHXA 4BECA 5CJJA 4IUBS 1OVMA 3OQOA 4M7WA 4NS1A 4E5YA 2ZT5A 4OSOA 5JJLA 3KQTA 4KQJA 4OOFA 4IINA 4ARSA 1V8DA 3RHFA 4UEOA 5A5DA 1YVPA 1U8FO 5EUBA 1DAHA 4UZSA 1MMFB 1N6RA 2QRKA 1LA2A 1CS0B 2BGTA 4TL7A 4QWWA 2L42A 4RTRA 3RVBA 1TQ6A 4W5QA 4ZAWA 1E2BA 4MYCA 3H4MA 2HL6A 3IFSA 3UAVA 3ZZTA 5FBRB 4AY3A 1LBHA 4R2MA 821PA 2AMYA 4RDXA 2AOVA 3BIFA 5FOQA 4PG6A 2A88A 3LUAA 2DQ4A 4GI2A 4GP6A 1KJ9A 3JSXA 4YYZA 4F96A 2D1RA 5DN6A 2BGWA 1ISIA 4ZREA 3CWQA 1F8FA 3VSEA 5K45A 2PBZA 3G17A 5HM6A 4P3KA 1LS1A 5EQFA 3ROMA 1MP0A 4NENA 3VUEA 2E4AA 3NYRA 4BJ3A 4ZI7F 4CM7A 1QNLA 3NEJA 3PDUA 1Q22A 3O38A 1D8TA 3V1LA 3TLGB 3KKMA 1ZITA 1SRQA 1PTKA 3UIEA 1YDWA 4G56A 4TVOA 3JZDA 4R1PA 1F2DA 2JJ2D 1SU7A 1OFUX 1JAIA 1QNFA 1D2MA 1RTKA 3HCEA 3NIDB 3QKIA 4FN4A 1KVRA 4TMZA 2G25A 1DLIA 1ZM4A 1GSIA 3RYFA 2B1GA 1PL6A 1JJ7A 1KBOA 2IPOA 3EXHB 3B36A 3E48A 4XI9A 1F2UA 3GD5A 3V1YA 3ZCQA 1MQ8B 1M10A 4Z1OA 1ENOA 5BN5A 1KYIA 4NV3A 1Z28A 4KH0A 3HCNA 3OT1B 3QP9A 4GPBA 1N1EA 1W36B 3OQMA 4MS4A 1OT5A 1E9SA 1DRJA 1MR3F 1K9SA 4FJ2A 1RI2A 1RJ9B 3DWFA 2WY2D 4TLLB 3UZUA 4N0PA 2PMKA 1CJTC 2RGNC 1QR6A 2YVQA 1H3FA 2OHOA 3NKVA 3RFCA 3M3HA 4N8SA 3GN2A 5D5HA 1YRYE 1E9RA 2MU1A 1E1CB 2WK1A 4HOYA 4JWKA 4D8VA 1QZ3A 4IIBA 3UYKA 5CDUA 1KJJA 5FLKA 2Q2VA 721PA 4X97A 1OBHA 4RMIA 4BNLA 2CL7X 4HNGA 2KLHA 4QJ5A 4G1UC 1MPXA 1ONNA 4BE7B 4NWIA 2R86A 1IQPA 2YJ4A 1PT5A 3NO4A 3KEFA 1O57A 3KRTA 5HHTA 1S2GA 5CA1A 3IPXA 2RIPA 4CFYA 5F33A 3KQYA 3T9DA 5F2KA 2ODQA 4MKZA 1AM4D 2HBYA 5CBPA 4MW4A 1G59A 4D4GA 3MT7A 3NUQA 3BULA 2I6UA 3O3OB 1I4LD 1KAGA 2ODEA 3C3CA 1H69A 1Z36A 3GFPA 4HFNA 2W6ID 3VA7A 2HT6A 3GRYA 4QYIA 5DYYA 1JEQA 4OBEA 5IAGA 5KJCA 4P0QB 2JJ2A 4JIMA 3I4CA 2WIFA 1CC1S 1Y9EA 3F7NA 3FMFA 1GLVA 4HZIA 2J9FA 4NJMB 4U7TB 4O1IA 2C94A 3B13B 3CZ4A 1EG7A 3LGXA 4L9WA 5F4BA 4ENQA 3BQ9A 3S55A 3BKWA 3Q9NA 1H9BA 2AHRA 3DMNA 4UFOA 1ACMA 4AAYA 4HAUA 5FBQB 4BFCA 2EKDA 4TMTA 2G9VA 3H17A 4BNXA 2HPVA 3UXHA 2O1SA 1WVIA 3Q85A 2ISCA 4X91A 3A1VA 2VAPA 4CG1A 1GKKA 4NFYA 1P33A 1MCZA 1VHTA 4X6XA 5DBGA 4O4JA 2J85A 1E59A 4M8SA 3RYIA 2L69A 2YOGA 4EUNA 1A27A 3T3GA 4Q03A 4EPXA 2W2KB 1ORIA 1BRTA 1RHRA 4L3VA 5AM3A 5AI5A 4BO3A 3QW4B 4H1VA 1J5EB 2D5AA 2V7EA 4IZHA 1UDXA 3TOSA 1EVYA 7REQB 5K0FA 2YYSA 1J1IA 1Q0SA 3PGA1 3ASZA 4BQRA 1YZKA 3M6IA 4WZBE 5F3RA 1ZA1A 4BLOA 5TF0A 1UXKA 1ZQ1A 1WZIA 3MWEA 4F45A 5JJBA 4GPIB 2JLZA 1QR2A 1KYVA 2MR5A 2OFXA 3AJEA 3BILA 3IUBA 1YS4A 4KXQA 5B1SA 1EUZA 1KC1A 4YJDA 3ROGA 3T7TA 1L4GA 4ABYA 2QTVB 3M1LA 4EMSA 5BURA 4UEQA 3D3WA 1PNQA 2AG0A 2W6IA 2XGGA 5HCIA 3UENA 2Z04A 2K2WA 2POCA 3BYZA 3FIJA 3Q11A 4DLXA 1V35A 4KPGA 3HLYA 3AUJB 4TWBA 4FMDF 4D8UA 1DWUA 1RHQA 1PZMA 1ZZEA 1RC0A 1ZOPA 2W6PA 3GOQA 1EHIA 4BLVA 4HTAA 1IB0A 1S89A 1Z6GA 4WSOA 3RSSA 1XZHA 4TQAA 2ZVPX 1F12A 1L3IA 5KBYA 1MH1A 3OEHD 1CQJA 1L2TA 2YWDA 2VAWA 1EVIA 2C0PA 2FUG1 4E22A 3U4CA 5A5VA 4JXXA 3CEJA 1NBMA 2AQKA 4ADSG 4ZYUA 1T3SA 3OCUA 2OAGA 4WOKA 1T2UA 1R0RE 2G1KA 3I23A 1TZCA 4G37A 1GNRA 4ES6A 4PC3A 2P7HA 2VG8A 1D04A 2QN8A 1A77A 4G24A 2QLJA 3MQ2A 4HQOA 4KQMA 5K3EA 2AEFA 2YDXA 4J7UA 1KFBB 1P5ZB 3DDOA 2CWDA 1NBME 3DLPX 4FWIB 4XDGA 1QK4A 1Y63A 1G2IA 2BHTA 2Z8YM 2QQGA 1PBTA 1CVIA 3WRXC 2IY9A 4ARUA 3KR0A 2DG2A 3PENA 1NFQA 3FX2A 4H4CA 3R5XA 1U3FA 4M9ZA 5THQA 1NSFA 4JSRA 1FBNA 1T9AA 3C74A 4ZO7A 5HCUA 1PZNA 2FZGA 5AKKA 4EQZA 4EYQA 4N5NA 4OKIA 3GJ4A 4TLMB 3DCYA 4XLTA 1HG1A 2WIKA 2YZ2A 2QM8A 3QKUA 1RRVA 2KM1A 3Q7TA 3BWXA 3K0BA 1Z25A 3HPQA 4K26A 4DR6B 3T8YA 2Y1EA 5B58C 3D6VA 2MSEB 2UZ1A 2COEA 2IEAA 2Y0BA 2HDOA 4HLQB 3TW0A 2G9UA 2RONA 4KPYA 2R6FA 2CF6A 1E9AA 3E3AA 3EFEA 1JJVA 3BXZA 3HE3A 2NAPA 1TKCA 3KOWA 4JNCA 1HRKA 2I66A 4D56A 3WKDA 3IBSA 3LGSA 3OEHA 4PQEA 4I1UA 4OGFA 3O3MB 1IOWA 2EL9A 3GNLA 3FSJX 3QJYA 4HWOA 5CNIA 3MD9A 1MB2A 1RQ7A 1ULTA 2PS9A 3DGEC 3FJOA 3JR3A 4AY5A 5L3QA 3WAGA 3I04M 5ENDA 1AVTA 2NXWA 1KQPA 1Z15A 3DDUA 1VHQA 3L4KA 1J70A 3UK1A 1OTYA 5H4HA 1VIMA 3KKLA 4TRNA 4UDNA 4R0NA 5HMLA 5EJ6A 1UK6A 2B94A 3RYCB 3TINA 4ENTA 1H4TA 4URYR 5CW2A 3C45A 2ZYDA 2NTYC 2XT9A 1YS1X 3WRYA 1TJ4A 4HDRB 5B4UA 1A97A 2BJVA 4F11A 5JARA 3EXIB 1E6KA 1RR6A 2FX5A 4Z4CA 4EY7A 3NBYC 2OFWA 4Q7MB 1DEHA 1MVLA 2FHSA 1RADA 4WCVA 3UB3A 3VH1A 1E62A 1NBOA 4CKEB 1N5JA 4UU8A 5HDBB 3T1VA 1J0XO 1SU6A 2QRVB 3KXDA 4TVSA 4AC9A 3U7JA 3GLSA 2QU7A 5JE8A 4KITB 1DQNA 4AXBA 1ZVVA 3C1AA 5D7NA 4W5WA 1VDMA 2VTDA 4G0QA 3T9BA 2CCKA 1SH7A 4X90A 4MI9A 3PXDA 2CVQA 4I2NA 1M8PA 1XALA 2D5BA 3G8CA 4OUKX 2DKFA 3WL4A 2BEJA 1MQSA 4E2XA 5AI6A 3O7MA 4KLZA 2B99A 5DZSA 3UMSA 3NS7A 2O05A 3H87A 1B3BA 4ZQIA 3SEQA 4MMZB 3H4IA 3I9FA 3EGOA 3EIUA 4IM7A 1RYZA 1REQB 4ENRA 4GX5A 4G2NA 2WNSA 1K88A 3DVRX 1KZYC 1LQTA 3UA3A 1GGMA 4E09A 1E7SA 5LOVF 4FCCA 3A06A 1AZWA 2AFIB 1QIHA 4R6XA 5TVKA 3IOMA 2WLTA 3L46A 3NEYA 4B4OA 4U2FA 4AQYB 1XTTA 2F17A 3DMPA 1QHNA 1O03A 1XZMA 3CEMA 3IDFA 4WNAB 2B8TA 1X38A 1HTWA 3BA1A 5DBIA 4B3IA 3AKCA 1MG5A 2QRLA 1GQQA 3RODA 4FYMA 4RXUA 1IAQA 5FIUA 4NECA 2Q1TA 4Q12A 1E4YA 5HS6A 4WKBA 3GLQA 3N8GA 1HDEA 4ZEWA 2A0XA 1GPAA 4AJHA 4G9EA 2EF1A 1RLUA 4CHGA 1PJAA 3Q7IA 1FYXA 3A26A 3IOCA 1B76A 1EM8A 3UWKA 1Z6TA 1US8B 3F71A 3OTQA 3WFJA 2WJGA 3LL7A 4PVDA 4XR9A 1M72A 1OF1A 3EXEA 1JFRA 2RGGA 3L4SO 3ND9A 1N9GA 2E49A 3OCXA 5BWCA 1BXZA 4DCPA 1PNVA 3KQUA 5EKDA 1U5BB 2OHIA 2H0RA 2XOKD 3OX1A 3DLHA 2XI4A 4GVXA 4OAOA 4JLSA 2R25B 2Y27A 3BS4A 2E48A 3HB5X 3TQOA 1TNDA 2C7PA 2JVKA 4AJOA 1R3DA 4WKCA 3HVRA 3AL0C 5BPHA 3HGTA 5EP3A 3SJ7A 1DBPA 2JKVA 5C2JB 1NDHA 3DJFA 4B45A 5BSGA 1X2EA 4OJQA 1X15A 1N8SA 2R0QC 4K03A 4U7JA 2W2LA 2QYOA 2XKAA 4PAMA 5F1OA 1Z29A 3SHOA 3SVZA 3PD7A 3D6NB 4EEKA 2VQEB 3C6MA 1ORDA 5KJ6A 5AFSA 2ADFA 3HM2A 4UAUA 3E3LA 2FFAA 1O9BA 4H16A 3HZOA 1UBGA 4MLCA 3SQLA 3IKVA 3WGMA 5TT0A 1XQVA 5IT5A 1CEQA 1DV2A 2XYPA 1W4ZA 2CV1A 1ZN9A 2F1HA 1SC3A 4Q1CA 1XYGA 5LQJA 1CUBA 4OQLA 1MD9A 4K3UA 1XDDA 1KS2A 3X3HA 5DX0A 3FGNA 5FWYA 2ANCA 1VLHA 3FDZA 3ZWKA 3O47A 5KNLA 1ESZA 2O2DA 1AQNA 3ZJ4A 3QVGA 4QFBA 3CLRC 4IFTA 1PV4A 1UEJA 3C1TA 3W7BA 2QVBA 5K0ZA 5JU6A 1RYEA 1S8NA 2DAPA 2G06A 1XGKA 3ECCA 4XFKA 3HP1A 4FXPA 2PQ0A 2QG4A 3IAFA 3LY9A 3QU4A 3LLSA 2XOKA 4OQMA 1KQFA 3QMVA 3RG8A 1EK0A 3PQEA 3WLTA 4QUGA 1FU7A 2JH9A 5KQLA 3GA5A 1EFVB 2UXBB 1ML3A 2XD4A 5FTMA 2ZUTA 1CIVA 3L7BA 3LP6A 1OTHA 3P9CA 4MHTA 2FLWA 5KS2A 3G5MA 2P30A 5ALUA 1SIUA 3ZHZA 2CBXA 1W4RA 3OIVA 5EZ5A 1UODA 3D7NA 3F7TA 5F9HA 3ZJVA 3CX6A 3CE6A 2ID7A 2UYOA 3S8YA 2CVPA 3WZMA 1P2TA 1UQRA 1ZM3A 3LDAA 4AZVA 5JH7F 5T7BA 4CIYA 1VIVA 4JLPA 3LKVA 2WVGA 3NDJA 4UOQA 5IN5A 2O2YA 2ZANA 2OV4A 4DS3A 1WZUA 1GCIA 4FOSA 1BWPA 1QGYA 4NZPA 5TQ2A 1E1LA 1L7NA 3QUCA 4I50A 2AJDA 5CG2A 1HYEA 5ITWA 3EPHA 3WLFA 1JQLB 2ZZMA 3S81A 4YAKA 4KYTA 1ZISA 2WUWE 2KI5A 1I0IA 1A1SA 3W5AA 2H06A 3LCRA 3A3NA 3MNFA 4LDAA 2IX3A 3PFFA 3BDIA 1J0AA 4D3YA 1B8VA 1FSZA 2B1QA 5ADHA 1XLTA 5DLDA 2IA5A 2BJWA 2YY6A 4GI1A 3BCRA 1U2GC 3M6WA 5HE8A 2Q0QA 3Q7EA 5DDIP 2H16A 1U9CA 3IEPA 2ZE5A 3C5EA 5JROA 3EUAA 4WOJA 2C5SA 3EFHA 2VJMB 3BSYA 1NJ6A 3HEAA 3LF2A 5DBEX 3S2FA 1ZC4A 5JCOC 1J9EA 3BK2A 4I14A 1RU3A 3ZGNA 1J9ZA 5CA0F 5ALJA 5KCZA 2UUAB 2EGGA 1XFAA 2V5VA 3WV4A 2XZOA 5CU7A 4C4AA 4F5ZA 2G83A 5F3WB 5C1BA 2QMHA 4GT1A 3F9IA 3QVWA 4DRZA 1FLDA 1RZ3A 4G81A 1E8MA 4KAJA 1TYZA 3KT6A 5SZIA 5DW0A 1AO3A 1YJCA 2Y1FA 3F5SA 4IDCA 1V5IA 1XWWA 3T4XA 2UXCB 1V7PC 1YMQA 2IPAB 5G1PA 3KWLA 3GVCA 2Q2NA 1THMA 1IONA 5I5GA 3EA4A 4IIUA 5CDGA 4XR4A 1WTAA 2EIXA 1PTJC 1ONSA 3F49S 1O89A 3GPIA 3HY4A 2I6TA 3FKSD 2EJWA 1ZGJA 4BDTA 1FW8A 3ICEA 2A5YB 4JI4B 4L5BA 5ULLA 4OHWA 5DU2A 3JTEA 3KUKA 5TQ0A 2X1MA 1FPQA 4NHEA 3EC7A 1Z6PA 2QUBA 3GYBA 1UFVA 2QORA 1ENZA 1MV5A 1WKCA 5F78A 1Y80A 3LPMA 3O3CA 1XQYA 3PRJA 1CR4A 4FYWA 2NU8B 2ERCA 3CUYA 3A6PC 4L8GA 4HXGA 3G0HA 2VJCA 3REGA 1SKYE 3ELBA 4CNQA 1RLMA 2QUJA 3T4EA 2XR1A 3LUBA 4LOKA 4B33A 1EXNA 3A05A 2NO4A 3CH4B 3KAKA 4LIPD 4MCHA 3H9GA 4YRLA 1WO8A 1P7YA 1ZW1A 3R4CA 5DCWA 4KN5A 3D4PA 5J63A 3H75A 1IN1A 1ZRNA 4YQEA 1GTL1 5EMNA 3T5MA 4HVLA 4W7IA 1S9HA 4RZ3A 1RQRA 2HF9A 4N40A 3BPSA 4OA8A 4KJXA 3GJ8A 1XR3A 3NC0C 3HI6A 4RVDA 4F6RB 4D7AA 4YAWA 1C7FA 3UMJA 3R0JA 5IVPA 3FTDA 2WI8A 3VRHA 4IHJA 1WXXA 3N07A 4TYYA 4UTOA 6REQA 3EBOA 1JPNA 2XUDA 2AOUA 1IJFA 1XRQA 4EGFA 1IZZA 3JQBC 4YGXB 4TTQA 2HFJA 2H5EA 3I92A 5JJIA 5AKXA 1GOTA 1GQSA 1I6KA 4MNTA 4Y1RB 1LBIA 3BD9A 4ZARA 3R8XA 4XYEA 4TS3A 3FKSA 4FGUA 4KIJA 1XZLA 2BEUA 2X3FA 1X39A 5BSHA 3HYTA 4W5TA 1ODKA 2Q46A 1DL5A 5JBNA 4KFCA 4CMAA 1R6DA 2BELA 1RP1A 3A6KA 1YQTA 3KUCA 5EWMA 2CE7A 3L0IB 1OWMA 3TFWA 3WGYA 5I9TA 1SCJA 3K9QO 5JS1A 1VKZA 3EVAA 1F1BA 4CEIB 3FFWA 4WECA 2Z3ZA 5EWLB 1UXGA 1UWCA 4G01B 4D9IA 1VCOA 1M8KA 3DEZA 4GE3A 1L7EA 1Q1BA 1F1JA 2F6RA 3MCTA 2VWGA 4M7PA 4RZHA 3RJ9A 3FHCB 1PSWA 4MLPA 3UEOA 3VO8A 2NVBA 3OZCA 1JMYA 2WWHA 2UKDA 4E08A 4C0HA 4Z6KA 3LZCA 2XA1A 1EK6A 2FCAA 5KDLA 2XHEA 5KC8A 3UC5A 4P0PB 3PHIA 3SVLA 1IY8A 1E2QA 2Q1WA 4GYYA 4ZN6A 5KTYA 1EB9A 3L79A 3SBDA 4F1JA 2VTBB 5C35A 1LC3A 2H4XA 5AM2A 3BTOA 3FNIA 1A9TA 1CZUA 3RRMA 3H11B 5K0JA 1D6SA 4LYEA 5KVVA 3IIEA 1RQGA 3FYHA 3CH5A 4IXWA 1PJ4A 5EA2A 4BV9A 3O4VA 3DHYA 2XCUA 3FFTA 1K7EB 3JYOA 2WW8A 3NHJA 4RIEA 3CZAA 4I55B 2XCSB 1E69A 2AX3A 3LT4A 4OB8A 2IYTA 3LQRA 1IN6A 3FKQA 3I1YA 3MJCA 4PC2A 1Y1KE 4PO1A 4IXNA 2CFRA 4MYRA 1YJAA 2G63A 3CX8A 3I58A 1XT6A 5E95A 3WTCA 3X2EA 2JJ8A 3QQPA 4D96A 5HSGA 2IOHA 2IBMA 2A5GA 3CRNA 4J75A 5SYMA 3WIEA 5I4CA 4TZ6A 4U6NA 4ZOLB 1WMFA 1HQKA 3Q0EA 3KKPA 3H2HA 3RKUA 5KMGB 3ZDAA 1G3UA 1TLFA 3SSNA 2B0JA 2JRLA 5JZMA 2A33A 1P1IA 4W82A 2C59A 1Y3AA 2WJJA 1LJLA 3Q7PA 2IYYA 3AY7A 3QVVA 1DCFA 4MW6A 2IZ7A 1BVRA 4NU0A 1WXDA 4OI2A 2VJAA 1NVTA 3R5HA 1RHKA 1OY1A 1UJ6A 3WLPA 1OI3A 2V6FA 3PCTA 4GWGA 5KZMB 3BWDD 1OREA 3PXBA 4O3FA 5CYOA 4NNOA 3VISA 4DIBA 5CFPA 4YMVA 2WMOB 3CLSC 4XVHA 3THOA 5CNMA 5HK8A 1R6UA 3CGGA 1KEKA 2QX4A 3GT0A 4AJIA 2EBWA 3DBHB 2I8CA 2XNKA 3I5XA 2XYGA 2UAGA 2PSJA 4GE0A 3KE8A 1P2FA 4B9EA 1RZRD 4N9WA 3U9TA 5JWHA 1U7DA 1YR7A 2REQA 5CLIA 3U9LA 3SFTA 2OBBA 3CRW1 4RQAA 4YBRA 1QK3A 1CUHA 1RFGE 1YQGA 1ZNYA 3N2GB 3RTDA 3QXGA 4N18A 2ZBDA