5JOQA

Crystal structure of an abc transporter substrate-binding protein from listeria monocytogenes egd-e
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
258
structure length
258
Chain Sequence
b'KEPKIVATTVAITEIMDKLDLPLVGIPSSSKKLPKRYADVKETGSPMGPDLEIIRMLKPDMVLSTKTLEADLKSGFEGADLEADFLDFTSIASMQTEIKNLGAKFDRIEEATKLNKDLTSDIDQVKSNVAKKKKPTVLILMGVPGSYLVVTEHAYIGDLVKLAGGENVIKDQKVEYLASNTEYLQSANPDIILRAAHGMPAEVVKMFDEEFKTNDIWKHFDAVKNNRVYDLDENLFGMTASLNAPEALKEMEKMLYDN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lmo2184 protein
molecule tags Hydrolase
source organism Listeria monocytogenes serovar 1/2a (strain atcc baa-679 / egd-e)
publication title Crystal Structure of an ABC Transporter Substrate-Binding Protein from Listeria monocytogenes EGD-e
rcsb
total genus 81
structure length 258
sequence length 258
ec nomenclature
pdb deposition date 2016-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 5joqA02
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 5joqA01
2PRSA 4H0FA 2YNMC 4TKUB 5JG7A 3BE5A 3ZK7A 3AEKB 4MDYA 1M34A 1N2CB 4G09A 3AEKA 1KAEA 3HJTA 4FILA 5GGYA 1K7SN 2PS3A 5M3BA 3TEFA 2OV1A 4FI3F 5JJ5A 3MWFA 4B8YA 2MINA 3MINA 4MX8A 3TLKA 4XPIA 3ZKAA 2O1EA 2XV1A 5B58T 4INPA 4WN9A 5M34A 1K0FA 1EFDN 4WZBB 5FLYA 5BVHA 1PSZA 5KHLB 5KOHA 3CX3A 1H1LA 1KARA 3AERB 2PHZA 1MIOB 4UDOA 2RG7A 1QH1A 3ZK8A 5BVHB 4OVKA 5KOHB 1K75A 1MIOA 1M1YB 4G07A 4OXQA 3MFQA 5AFSA 1G21B 4K3VA 3PSHA 3HH8A 4XPIB 5M29A 4TKVA 1N4AA 2WHYA 5CX1A 3U7QA 1G21A 4HN9A 5CX1B 3UJPA 4WZBA 2R79A 4TKVB 4FKMA 2M6LA 3HXPA 1H1LB 2YNMD 4DBLE 3AERA 3AETB 2AFIA 5HDQA 4M7OA 3AEQA 4NNOA 2XUZA 1M1YA 2AFIB 2OSVA 4ND8A 1PQ4A 3ZK9A 3K1AA 4PM4A 1M1NA 3AETA 1G20B 2AFHA 4INOA 1KAHA 3K1AB 1M1NB 3U7QB 1QH1B 3G9QA 4TKUA 3BE6A 2WI8A 4PAGA 5HX7A 5JPDA 4IRMA 3TNYA 3LI2A 2X4LA 3EIXA 2PS9A 3R5SA 4UTPA 3PDIA 4NNPA 4WNAA 3AEUA 2AFHB 4FNAA 3EIWA 4WNAB 3ZTTA 3AEQB 5KOJB 1N2ZA 4HMQA 3AESB 1L5HA 1N4DA 4ND8B 4GICA 5JOQA 2XH8A 2OV3A 4H59A 2XDQB 4LJSA 5BVGB 1G20A 2OGWA 5BVGA 3GI1A 4N01A 2Q8PA 3PDIB 4MLZA 4WESA 3LHSA 4MO9A 4WZAB 4UDNA 1QH8B 1K2VN 1FP4A 1TOAA 3PSAA 1QGUB 2M6KA 4OXRA 1M34B 1N2CA 4WESB 5I4KA 1FP4B 4HMPA 1QGUA 5KOJA 1ESZA 4WZAA 2XY4A 4LS3A 1XVLA 3R5TA 4UTOA 2MINB 2QI9F 2XDQA 3AEUB 3MINB 5CR9A 5M2QA 4HMOA 4CL2A 3NU1A 2XQVA 3MWGA 4WN9B 2PS0A 5GGXA 4BBPA 3AESA 1L5HB 2ETVA 3MD9A 1QH8A 2Q8QA 2R7AA
chains in the Genus database with same CATH superfamily
3LLSA 2HDWA 3RSSA 4GR5A 4QG7A 4M54A 2V3CC 4F92B 4NP6A 4RZXA 3V8MA 1UBRS 2ZU6A 2C4NA 1ESCA 3IXQA 4OREX 1XZDA 1JG3A 5ELXA 1QC5B 4I6JA 4AY4A 2HU8A 3HI6A 4NZYA 3C5CA 4YV2A 1E9AA 2ZYTX 4Z86A 4RTQA 3T1YB 1KA9H 2D2IA 4KWCA 2JBHA 1WLYA 1GILA 2ZYHA 3P0FA 4IUCS 5HUQA 2VZLA 3MGKA 1V8DA 1WZEA 3KYDA 2HMWA 5A5EA 1GTVA 1S01A 2RJ3A 2VF5X 3K5IA 1G2IA 2IW3A 3KELA 3MAJA 5SV2A 4KR9A 5DE3A 1QCCA 1II0A 2C96A 5D7NA 2V7GA 3E9RA 4O29A 1RYBA 2B2CA 2CNDA 3WOVA 3KVVA 3OTGA 5EXTA 3EW9A 4HB3A 5H3LA 1F2VA 1YB1A 4YDSA 4RCVA 1Q0UA 1NTRA 4YP5A 3P0EA 2JGIA 5U4XA 2C7PA 4A82A 1GFZA 1R0LA 1ECLA 5AK5A 1YZKA 5JCZA 2PCLA 4I2NA 4QT4A 4YAKA 1GNQA 3GCDA 2PYZA 1P31A 3K73O 5L40A 5J2TF 5CD1A 3Q9LA 4OB7A 5TPZD 4DQ0A 3HCEA 1ZJ4A 3N2ZB 3OESA 2QRPA 2WD8A 1U7ZA 2J5BA 1NBOA 2DUUA 5BXYA 2LZ0A 3RTAA 2LXNA 2NX2A 4PZEA 3ENZA 5BSTA 1A7UA 3LQ4A 4DMHA 2HBRA 4F8EA 2O8CB 4EUNA 1JR4A 1UZAA 4G85A 1N57A 3KXKA 2IK8A 2K2QB 4PM4A 5HDBB 5A3RA 2VTBB 1Q7TA 5C5EA 3P7MA 2NUTA 3HCWA 4OB8A 2E4VA 2H16A 2H4HA 3OTHA 4R83A 1PDVA 5K51A 1KJZA 4WVLA 4D3ZA 1JBEA 3RFUA 5B4TA 1D2RA 4G26A 1SZPA 1JJIA 5IM4F 3KSZO 3TG2A 2HK6A 1GQSA 2BSXA 3ZXXA 1ZD3A 4DILA 1JAYA 2FQQA 5KTRA 2PJUA 1TAHA 1W9HA 4HQ0A 5BWNA 3LM8A 4QPCA 1YMVA 1RACA 4OHUA 5KYWB 3KT8A 3FNRA 4X1IA 4GWLA 1RD4A 3T5PA 3DV0A 2H9AA 2PH1A 4HNHA 1LVHA 3UAWA 2A9PA 3L79A 4GM0A 4MQLA 1BWSA 1Z83A 1E9BA 3LQ1A 2ZI4A 3OA0A 4RPJA 2EZTA 1FPQA 2VTBA 1I4WA 1AS2A 3S2UA 1Z39A 1T8WA 5EXSA 2CB0A 3QU4A 2GBGA 1USIA 3STHA 4F84A 10MHA 1X6VA 2CHFA 3GGSA 4ROTA 3VM6A 5ALFA 2JK0A 3VJKA 4BWFB 1Y6QA 2ZITA 5KPDA 1Q3TA 3PU6A 4DMLA 3IULA 4ZT3A 4ZU1X 5I47A 4ID3A 3CWCA 1YB4A 2R48A 2VATA 2XTNA 3ESXA 4J3NA 4NESA 5EFOA 2QAGA 1DAHA 3HZOA 3BRWA 4I50B 3GG2A 1ADYA 3I05A 1CDEA 1DBQA 1WSAA 2MIIA 3TOVA 3VPSA 1P9WA 3ND9A 2XNCA 5KS2A 2XAUA 4X41A 3WYFA 3WQBA 4E09A 2BMAA 1SXJA 3CA8A 3FUUA 4MKGA 5HRAA 1BU5A 2R7AA 1UM9B 5I7SA 2FW0A 1DE0A 2QD3A 4F8YA 3K92A 3UN1A 2HOQA 4LVCA 4BLRA 5K99A 4F85A 1XRNA 2YNMC 1SU6A 2A5JA 3D3QA 2B9EA 1ZEJA 4JMPA 2GCPA 4KDFA 5CP8A 5K0GA 4UVIA 1RP1A 2X0EA 4RXMA 4PBTA 3ZVKA 2P2SA 1H9AA 3NWEA 4MEBA 5CA0A 1AQYA 2JGDB 3JWJA 1FFXB 4JHLA 4U2BA 2F9LA 1NVGA 2FR8C 1SVSA 1HPLA 4HTFB 3HJBA 3AP3A 2FGJA 4H27A 4JU9A 1IJKA 5DLYA 2AQ8A 1I2BA 4IRXA 5G4LA 1KS9A 5HIJA 1NU8A 1P9RA 1XU9A 5JQGB 1CRWG 3CM0A 4HDRB 4W99A 4YRFA 3COJA 4Y6GB 1SKQA 1RQRA 1SH7A 4LK2A 1YR8A 4XCVA 3ND6A 2UVQA 1NAIA 4RD2A 4MHTA 1KARA 4FYWA 1ZN9A 1UM8A 4HNAB 4YCCA 5F64A 1D2GA 4CMEC 3H65A 1L1RA 2OL4A 1PLLA 5T3YA 2W2KA 4P7BA 4P2BA 1WL8A 2IVFA 2GT1A 1HE3A 2PY6A 4Q15A 2XVMA 4WY2A 4ZIRB 1FS5A 3M5CA 4HDSA 1ZRMA 4BLTA 3LP5A 1ZUHA 1ZXBA 3GLFB 4KE9A 1WEHA 1V7CA 4UEQA 3PUZA 4BLUA 3ENVA 3AVQA 4BNVA 3A70A 3TLEA 4IXWA 4E5DA 1JHYA 3QEAZ 3QX3A 2R3SA 3I5MA 3GUYA 5G1OA 2IWRA 2VDRB 3NETA 5TPWA 4G5FA 5JRZA 3DEFA 3S40A 4EDFA 2ECFA 4TXJA 3NWPA 4FFRA 3PZBA 1QH1B 4V1CI 1OWPA 1TM7E 1BX0A 3L9WA 3W2GA 4YCNA 4R6XA 4DC0A 4GMKA 4DCGA 4KFUA 4MR9A 4ND3A 3RR2A 2Y0BA 2PS9A 5F7XA 4MRPA 3LZ6A 2NO1A 4HADA 4R1OA 2LNDA 1R8SA 1T25A 2YXPX 3QMWA 4QARA 5AXBA 4GX2A 4MLDA 4ARZA 3HN7A 1IBKB 5C8YF 2F1RA 2OD7A 1U4NA 1LLFA 2YXBA 3H0CA 2HF7A 3R6TA 4DIUA 2ST1A 1M6VA 4D25A 4HDAA 3L7BA 2MYNA 4JYPA 3C5VA 2GSWA 3PE3A 3JWIA 4BEJA 1Q1BA 2CCKA 1E3SA 3KKKA 2B37A 4NJMA 3C1OA 3M4NA 1IZ8A 1ZC4A 4M99A 3MTJA 2YFYA 4IV0A 4URZR 3KSMA 4K5QA 1I7PA 3I4CA 4BKPA 3PSAA 1AQUA 1X87A 3AWDA 4DABA 1XLTA 4GDFA 2VYFA 2WP8J 4QQ8A 3C6YA 3VTZA 4EG8A 2WHEA 2YJ3A 2NGRA 1TL7C 3IV7A 2OPHA 1SBCA 2CUKA 3HB9A 5D5HA 4D81A 2HXSA 3OZWA 1L8OA 2Q8NA 4FM9A 4HQ6A 5DEOA 2QJRA 1MJGM 3CVJA 3TRHA 2YY7A 3W8DA 5EJ6A 1XTSA 1ETUA 5EXXA 3K05A 1MV5A 1JJAA 3A3KA 3O9VA 4X61A 2EW8A 2Z2JA 3ITNA 4J94A 4PO3X 5JG7A 2JGNA 1U8CB 2WOJA 4NPCA 4BNZA 2WJIA 4MDYA 3QPVA 4YUXA 3B3FA 1HXHA 4JR1A 3VJRA 4QXMA 1JS1X 2FZLA 4E13A 3M5WA 3C24A 3IELA 3GHYA 4LGMA 5AJUA 1WVGA 2C7GA 2INGX 3AI3A 1TECE 3LKDA 4IGIA 1WKVA 4RHEA 2XF2A 3DMTC 3SE7A 2QQ5A 2KSQA 1N6NA 1NVKA 2WIDA 4HDKA 4I36A 3VC7A 2O5RA 4MIOA 2QT1A 2FR0A 3MUEA 1YFJA 3OOJA 4NPHA 3USCS 2AI1A 1V8ZA 4WV3A 2C42A 2ZR0A 4E2ZA 5HJ2A 2GPYA 2C9MA 2IEBA 4X93A 3UK2A 2ACKA 2GM4A 3TL6A 2DBYA 1TKCA 1I0LA 2XBLA 3PEFA 3UEOA 5K2MA 3EGXB 2PZKA 1XZIA 3EVCA 4D3YA 4EYKA 2K5UA 2XVZA 4BMPB 3QI7A 1AGYA 3UJHA 1W0KD 3E9NA 2BSQA 1C14A 3R44A 1V6SA 2O2IA 1VZ3A 5FI1B 3RROA 4AIIA 1YJCA 2JJ1A 4HZGA 5DXJA 3W5SA 5KJ6A 3NVAA 1X80B 5G4KA 1B6RA 3AM3A 4EATA 3DEZA 1I3KA 4TTIA 4Z9AA 4PGHA 5FWAA 3ZWCA 4E21A 4GDMA 4MGKR 3CE9A 2UXCB 5L95A 4TMKA 4LY0A 2GA9A 2HJSA 3AMVA 2VJLA 3HUEA 2HWYA 2AD1A 3K1JA 3FFXA 4NZMA 1RBYA 1W5BA 3OPQA 4IHKA 4CKZA 1PT7A 1NMEA 2A9OA 1OQAA 3LWBA 4IIHA 4RGVA 4PQFA 5TDHA 5KYUB 3CLSC 1TYBE 3GLIB 3GFSA 2Z6VA 1NP3A 4D98A 1FFYA 5HCUA 1PEDA 1BN6A 3N5CA 1ZCJA 2NUPA 3QEMA 3FVWA 4PTLA 1TZCA 5IYZA 2XQFA 1LUAA 1ISHA 4JODA 5KKCA 4IFIA 3DQPA 1XJQA 3P4XA 3VSDA 2FI1A 2HQBA 2IYFA 2VDWB 4DCJA 2BM0A 3WNZA 4QSHA 5B6PA 3GPCA 3HBLA 4OAQA 1R5BA 2DECA 2BLNA 1SRQA 3K0BA 4GICA 4RIGA 3SX2A 1EQUA 3V8RA 2ZJ8A 3MPUA 4C14A 3FVTA 5ALKA 4HKTA 3U44B 4WIAA 3AVPA 3K4HA 3BZWA 2YC4C 4K9NA 5F7ZA 1HDIA 3KFLA 3UATA 1AHHA 2EWVA 2WWIA 1XN1A 3QF4B 5AI0A 4UTRA 2GK6A 3HO8A 3TOZA 1U7HA 3I28A 1LK5A 4OK3A 3KR0A 2EX1A 1FP4A 1Y9DA 4Q1CA 4XIJA 4M7PA 1CQIB 1MRNA 1HTBA 3QA9A 3T5TA 1GTL1 3KT6A 1JSZA 3TW4A 4O4LB 4R2LA 2QYSA 1M2VB 2QY9A 1AKYA 3DONA 4MI6A 3UV7A 4Q3BA 4Z0NA 2BFAA 4E1VA 1GOTA 5ALHA 5I9BA 4PBRA 1Z8DA 4EHDA 1AX9A 1S2NA 4YMLA 3T7KA 3SG0A 4O4HF 2DT8A 3EZYA 3X2EA 1RJDA 2OY0A 1MO5A 1WD7A 2FK7A 3A9SA 4P0QB 2B1GA 3FA2A 4CM5A 1FRVA 2WWVD 1YDFA 3FPBA 5FA6A 3F4LA 4ND5A 2F8SA 3PLAE 1CJBA 3KJIA 4FHDA 3OCYA 2FDXA 1RXYA 5AJWA 3TWOA 4WMLA 2MSLA 3GUZA 4D2IA 4CW7A 4QVIA 4MVJP 2VDOB 1ORRA 1A9TA 1RQ7A 4QDOA 4IDQA 3I8XA 1FDTA 2BMJA 5EJEA 4MQMA 2PGIA 2CNKA 3IV6A 1UMKA 1ZNXA 3ILYA 5KREA 2Z9CA 5JATA 5I3ZA 4RKFA 1MV8A 3N8KA 4WCFB 3Q7TA 4AZTA 5CG1A 1V8PA 3P9IA 4QOIA 5AI4A 5K2OA 2REXB 4KE8A 4BPRA 1USKA 2XMZA 4MYDA 3K9NA 5C35A 2A7QA 2IKSA 4LYJA 2PL1A 2R2GA 3U7GA 4L5CA 3R7LA 2PZFA 4C7JA 3DLBA 4MWSA 3THXA 3L0YA 1QIMA 2Y66A 4KYUA 1TEXA 5HOEA 3L0BA 4TLLB 3T8YA 4DT1B 3UG7A 1KMHB 2DOKA 1JJBA 4IKOA 3I0NA 4LTDA 1U2ZA 2Q6KA 3OD5A 4XQ0A 3ZGZA 4R1TA 2ZJ4A 4QDUA 3VOSA 1ORIA 3IDQA 5E8JA 1UOOA 1OPRA 3KQYA 1NYLA 2IXTA 5DLEA 2Q9BA 1AC5A 2D4AA 2P6UA 2WILA 2VPYA 4R4JA 4B3DA 3QPBA 1Z5WA 4ZKEA 3HLKA 1R9GA 2UVPA 5EEGA 4PHTA 3I3OA 1NDQA 1TVMA 1PU2A 4IHJF 3K4PA 3LC2O 1G4HA 2FTKE 5CNIA 2IT1A 1KHHA 4WGFA 5FUVA 3VV2A 1EVEA 3EG9B 4Y98A 1G3QA 1RHQA 1R15A 4HT3B 3HN2A 1T1RA 2XTZA 4MARA 4XR4A 4F60A 1BXRA 2WIJA 3BE6A 2AQIA 2FB9A 4S3MA 1DB3A 1L7PA 1DTEA 1GZ4A 1F0NA 1PR2A 4QECA 2X4LA 3BJIC 5JEEA 4F5DA 2I91A 3COVA 3KT0A 4GOND 3R0IA 1WS6A 4UTVA 1XTIA 1AGRA 4A8JA 4E2WA 2VPPA 3I9V1 2YWEA 3DT9A 1LI4A 2RCNA 3IPRA 3H75A 5ITZA 3F67A 2CYCA 3AJEA 4IV8A 4X84A 1DAPA 3UXYA 1NW9B 3R9XA 1DC3A 2I2DA 1V8FA 4RMHA 2W2NA 4YDQA 4RQBA 3SD7A 2QT0A 2G4VA 2G88A 3TZLA 3HKEB 2HV8A 4L6AA 2VF2A 4WZAE 1G41A 2E9SA 3B8EA 3JV7A 4FR0A 3RIHA 3AQIA 3O8CA 1HMYA 1RLTA 3BK1A 3T12A 2XX3A 1JALA 3F6CA 4JLWA 1P2DA 2X9QA 5DCYA 1MGOA 4Z9BA 3WTBA 3WAKA 1Z08A 1PCXA 5AUNB 4QWMA 5FD8A 4BPBA 3Q12A 4EGQA 3IAHA 4R2HA 1C3XA 1XTJA 5F5NA 3Q5EA 1B3RA 2OFPA 2VEDA 1UKEA 1TYAE 2WR8A 1DDGA 2JI4A 3CNOA 3DMTA 4BTLA 4CL2A 3I6ZA 4GWKA 5IP5A 3MMSA 4GUDA 1B2RA 1TQ4A 4XGIA 2ZVQX 3WOHA 3G2IA 4RFSA 3DXZA 3ISJA 3O8NA 4TZ6A 4ESEA 1YMUA 2O0KA 2YYAA 3ZD8A 2AJLI 1C30A 3FPEA 3OQIB 1Z07A 4JOQA 2GHIA 4DR2B 5JXWA 4MPTA 2OO5C 2YDYA 1RVDA 3S27A 4QHSA 2NPFA 4LY3A 2XMSA 4MO2A 4IJVA 4KGXA 3W5DA 4CF7A 1IWBB 1UPCA 2VP0A 2G1JA 4TUYA 3KPVA 4EKYA 2JL1A 2RAUA 4CIVA 1LPAB 4CMHA 3O4VA 4DC1A 1EKXA 1UDXA 2HPVA 3ZZMA 4V1CA 4JI8B 1KRXA 4Q5IA 3QNWA 4OLHA 4GC5A 1YS1X 1IEVA 2UYGA 3DTVB 1EK1A 2V9PA 1KVSA 2Z1NA 2FSFA 2YJNA 3OIYA 1ULAA 2RHMA 4DCNA 1GRCA 2CVQA 2ZJ0A 3SIXA 4BDSA 2JCGA 2C9BA 2PUCA 3NR2A 2VRWA 4FGSA 4G1BA 4F5ZA 3T7DA 3RRBA 5HSGA 4L8LA 5FYQA 1XRLA 3W3AH 4U6QA 5CEFA 4D44A 1MJNA 1GGJA 1NU6A 3CX3A 2WDZA 4FSDA 1KH2A 4XWAA 3GRZA 3P2JA 5ILGA 2FN8A 1DPGA 1EFHA 1XKQA 1YVPA 1J70A 5G1NA 1QP0A 1M3SA 1QG4A 2GKGA 4AS2A 4ZREA 2Y0DA 1AS0A 3EZGA 1JDTA 2D1QA 1IRXA 3GBVA 2H7YA 2QU8A 2QROA 1Q19A 4C3VA 2QOEA 1RM3A 4M6WA 2RJNA 3SC2B 3U4CA 1POWA 5EZYB 1ZGBA 2NNWB 3WHPA 2PFSA 1SQSA 3ZI0A 3TGPA 2F1IA 1C2TA 1BE8A 1EWRA 4IFTA 4XD2A 2AFIB 1JILA 1EE2A 1GG9A 1NBMA 5TE9A 4DLYA 4EECA 4DV3B 1VL2A 3UK1A 4XVQA 4KQJA 1RQLA 1QR6A 4BMDA 1M33A 1YCHA 3E27A 3E9ZA 2ALJA 2W6OA 2P6MA 3R4VA 1J49A 1X74A 4K86A 1FUUA 2HJ9A 1O6CA 5JSZB 4KMMA 4BCBA 4IEIA 4EG6A 2EFJA 1TAGA 1RWKA 5G0SA 3SYTA 2ZKIA 3TSWA 1D07A 3CLHA 2V7VA 1X7HA 3WG9A 3WGTA 2HI0A 2PV7A 1PSWA 1E6KA 2XJ9A 3O2QB 4TSRA 5EZ6B 4ENPA 5A04A 1U94A 1Z6TA 2QD1A 2VJOA 2COKA 4QO7A 2ID4A 4LJ8A 5K0FA 2WF8A 3MWDA 3LO5A 3OETA 1MNAA 3RVKA 4EWLA 2DF8A 3FD8A 2LD4A 4OUDA 2KB0A 1Y8ZA 4QXOA 4XM0A 1NQTA 4F2HA 4N9QA 1H0KA 4QPZA 5ISMA 3TIXB 4REMA 1ADCA 3TLAA 1DS6A 3FKQA 3ESQA 5F4ZA 1BDHA 1ZUNA 1A76A 4NV3A 5IT0A 3L4BC 4DDKA 4NYIQ 4IVRA 1YRLA 3JVUA 1X7XB 2VNKA 2HA0A 2Z98A 3OF3A 3ISVA 1XZCA 4KC0A 2RGNA 4REQA 1MRSA 3UMJA 3W9UA 4B6FA 1YRWA 3ZWPA 2OORA 4TTPA 5AKZA 1FP7A 1OYOA 3OEEA 3TKAA 2BJHA 4AF8A 4ZHQA 4P31A 3JSXA 3KRTA 3ZKWA 5CR9A 1RFLA 2OT3B 3MWDB 4JI2B 1ZBDA 3Q0TA 1NM5A 3DWFA 4G23A 4QDJA 4Y1RA 3T54A 1N2HA 4RPIA 4CL0A 1AH2A 2P1DA 1PS8A 4MVYA 4W6QA 3O2JA 5CT6A 5AVRA 3PG5A 5A5DA 4XWKA 3O8QB 5LYJB 3ONNA 5BOVA 3FKSA 4JJGA 2CLIB 2GCOA 2AG6A 3G3EA 4N12A 1FNMA 3H9GA 3HLTA 1Q44A 5G1PA 4C0XA 4IDEA 5KX5B 2NV0A 3T9BA 1BE0A 1B0PA 1OLXB 1S89A 2BUCA 2JIQA 1ZJ5A 4QTTB 4ES6A 2CFSA 1BOOA 2WJZB 3LPMA 1T2FA 4CEJB 5F12A 4KGVA 4GC9A 1P6XA 2AQHA 4OHCA 2GBCA 1E7MA 1S2IA 3GJ6A 1RWWA 2XYPA 4JC8A 3UMBA 2ZTUA 4KIWA 4FYMA 4LZZA 3U56A 3ZQ6A 4YJ2F 3KBOA 3NAMA 1O97C 3PKZA 5E4YA 1BQEA 1Z0SA 1PF7E 2FY8A 1WB9A 2G76A 4XE5A 3WRWA 1JQBA 1HURA 3C1TA 4RPKA 1Z6ZA 3T06B 3WB2A 1I4OA 4L50A 2ZR8A 5F1KA 4AMZA 3GLHA 4KLNA 1PSZA 2CSXA 4DLLA 4EJMA 1GNRA 1EFPB 1P60A 1Q50A 2IUFA 4H35A 1JE1A 1U2PA 4FMDB 4JDUA 1JPNA 1KZ6A 5AYVA 1OJLA 2CHUA 2PFKA 3V6MA 4CT4B 3KLMX 4BNFA 2ZBPA 1FUYB 4L6IA 4PLHA 2B3TA 3CPSA 1QX4A 2BFNA 2BEWA 1V11B 2O2XA 2Q3MA 2BMEA 5D1NA 3ST7A 1M2WA 3DC7A 4C20A 4EG4A 1E7WA 4YHHB 3IKVA 4HHEA 4WBSA 4CM9A 3KKNA 4UOEA 4U5XA 1LPSA 3PTZA 4D3FA 2C4TA 3O84A 3RW9A 3I9JA 3LNCA 1SK9A 1JQJC 4NBTA 5CLFA 4HFMA 3RNLA 4MQ4A 1DARA 1AGPA 4G89A 1JQDA 3PDUA 3QBDA 3TTTA 4LSWA 1ECFA 1WF3A 2WWFA 5MDHA 3A4VA 3DO6A 3OE1A 3FR7A 4PO9A 1R8JA 2A14A 3AINA 4X20B 3ITKA 5FAXA 2RE8A 3JQGA 4JITA 4A2WA 1QFSA 3U7IA 5JUWA 3EDYA 4ESVA 3L8DA 4YP1A 3QKRB 3VI3B 1XFDA 2GLTA 3O4GA 2IS1A 4W82A 4LMRA 4U2EA 2XSZA 2FSGA 5EMHA 3ZPXA 5BNIA 1MVOA 4QYMA 3FUCA 3CF0A 1RJGA 5HE8A 1Y1LA 5TC4A 4FONA 3T5DA 3TX6A 4FYPA 4R2MA 3R24A 5EYPA 1V5EA 2DX7A 3D3WB 4P92A 4WNAA 5DYWA 1QIFA 4BJ1A 2JGLA 5CLJA 5ICMA 4PGAA 3BHJA 2ZJ2A 3DFZA 1ZW1A 1XLTC 3T0FA 4Z4GA 3E3LA 2FX2A 1KYXA 2FU5C 2IEAA 3AOEC 1YZHA 2PWYA 3CSSA 5EA2A 2NZJA 2XXAB 2BTEA 2H1IA 1GQYA 1IHDA 1UOPA 2ZPUA 3KSUA 4PYRA 4ZARA 2P67A 3ZHXA 2AR9A 2J3HA 4F45A 3B13B 2BDUA 4K03A 5JO9A 1V47A 3A25A 3KDSE 2OM6A 1RKQA 3BCRA 2FZVA 2QRJA 3CJTA 4RF5A 2DGDA 4RK6A 1GSIA 1F1JA 2H7XA 2YW9A 1RPZA 3R9IA 2PUWA 4UDNA 1MX9A 1JJ7A 3BH0A 1CY1A 3ESDA 1PS0A 4HGOA 4LI3X 3ZZ1A 1HLPA 5K8VA 4KR3A 1U11A 3I2HA 5IUKC 5H81A 2JLSA 1KYZA 1DDOA 1Z2DA 5DM1A 1E2IA 1IBRA 1OR8A 2DRIA 2GKOA 3IURA 5HF9A 3ZTYA 2M1XA 3OIVA 3G0OA 3PNVA 4MITA 2VJAA 4HMOA 5DB4A 1XD8A 3CUUA 1TT5A 4BWYA 3IP7A 4D0RA 5DHFA 5BSVA 2EJBA 3BIWA 3OURA 4E2YA 4TVOA 1E0KA 2C2GA 4JJEA 3E18A 1HH4A 3VR3D 1ZKDA 5DULA 3MJHA 4G9GA 4AKTA 3PDJA 1DCMA 4URWR 2P91A 3A1SA 4C4ZA 1APBA 5K20A 4QULA 3CTMA 4NATA 3QWIA 4RTNA 4I50A 1N6RA 1LWOA 3KCQA 2J9RA 2H1RA 4JELA 1FTYA 1SG0A 1YBAA 1N2CB 3CLRC 4UNPA 5T67A 2YRWA 1YFZA 4NOJA 4B80A 3TE7A 3ND5A 3PE4A 3A31A 2DPYA 2GN9A 1CQJA 221PA 2SNIE 4PFQA 5KVVA 5EE9A 3FOAA 5KSPA 3PPYA 3QTLA 1ZOLA 4GSLA 2ZJ6A 3DOCA 2I6FA 3QPDA 4KREA 1MT0A 1TPYA 3ABOB 3HYNA 4XB6B 5ALXA 2WHPA 1FF9A 3GJZA 1K4KA 3PHHA 3GGPA 1V16A 3G2KA 3GUVA 1TT7A 4JJZA 3CKYA 4I1IA 1I0IA 1H1LA 3ADDA 2GN1A 3ETGA 4B7AA 3O1IC 3PRJA 4YLGA 1WULS 2C07A 4EA8A 4HWTA 4O59O 1QUEA 4RDXA 4PONA 4WW0A 1TQHA 3GGCA 4P3YA 3AJ8A 3E1GA 4YUVA 4FDUA 4FN5A 4DANA 2O2JA 3M49A 4MLPA 4OQEA 2W5UA 4I1YA 4KVZA 1JU3A 4O4HB 5E3JA 5MFPA 2TMYA 2JD2A 4QLAA 2R6R1 1SQGA 2OG2A 1DIBA 3EJWA 3LPCA 1GZSA 4TN5A 5K6RA 5CFPA 2CNLA 1GO2A 1V3TA 3R6GA 2DERA 2BFMA 3NW9A 3U3JA 3QE9Y 1GEGA 3KWLA 3LK6A 2DXIA 1KERA 1BKDR 1RWQA 1UFVA 4RVDA 3TXAA 4O4IF 2Q0XA 1LJUA 3G9QA 4DADA 2YZKA 3GYBA 4ZODA 3RAFC 3BAZA 13PKA 3PFFA 4DMMA 1OC4A 2A88A 2HO5A 3KTAA 3LRPA 1RHKA 3GP5A 5DNAA 4BGIA 2BDEA 5LN1A 3CCBA 1GG5A 3RRZA 1FUKA 1PYOA 3GLSA 4JB0A 1SXJD 2C54A 4M21A 1FFHA 3BH7A 3W3AD 4YVFA 4D8UA 3MT7A 4HTAA 5IF9A 2EARA 1JNYA 1D5CA 2QAGB 4H6PA 3X2FA 3IEPA 2JK1A 3DBRB 4I55F 3MB8A 3PQ3A 1ORWA 1CYDA 2E21A 2R4UA 2VHQA 4TV9F 2YN4A 3CJQA 3PX2A 2AUNA 1TZMA 2OFXA 5DBOA 5KNCD 2XBUA 3TR5A 3T7TA 2PG3A 1ZW6A 1RQPA 1N9GA 3I5AA 1WR8A 3L5KA 5DRTA 2PZAA 4YQZA 3JQ7B 3GUCA 4GR9A 4I14A 1PVOA 5ESXA 5LC1A 3HU3A 3T7RA 1ODJA 1PGJA 4MGHA 3O75A 4P58A 1W75A 1ODSA 3MJTA 2IXAA 3I76A 4ZO7A 4DMGA 2P2ZA 2LTAA 2WTUA 4RMIA 3RYFA 4C43A 2WF5A 3ESAA 2AN1A 2I87A 4DY6A 1QFZA 3GLHE 5HZMA 2CL7X 1UEXC 1O5TA 1M9NA 2IYYA 4CMIA 4X24A 3OUTA 1BFDA 3KT3A 3KSDO 1Z62A 4Q12A 4BEBA 2G25A 3DDNA 3CUWA 4TPKA 4DR7B 3GGJA 4LRSB 1H4SA 3FOEC 2GVNA 5KNBD 1NASA 2WHQA 1EJBA 1M6VB 2Q2WA 5JYBA 4FFBB 3KAPA 2ZI6A 4H7IA 1XZMA 3CZ5A 4WN9B 1G4AE 2F59A 2IOYA 4OQPA 1DFGA 5EUQB 1ZK0A 3G02A 3TTVA 3WGQA 4EJSB 5IUNC 1AE1A 1QFJA 1Y8RA 3TQSA 3CX6A 3R5FA 3VYUB 2WYHA 4JQZA 1Z38A 3I9KA 1QOPB 3N2NA 3BC1A 3BWVA 4LJKA 1N3BA 1U3TA 3SKXA 3F98A 2X0DA 4LRYA 2YOHA 2GPNA 3C2QA 3RB8A 4HAWA 2BELA 2VA8A 1E1MA 3BIOA 1WHTB 4G67A 4RU1A 4YLEA 3AW8A 4CMIB 2WWRA 3CG0A 3TSOA 1C41A 2P9QA 2QYOA 1R0WA 4M8LA 3RBVA 4KOAA 4WY8A 1GTRA 2V8BA 1LI5A 1YK0A 3QYJA 4NQRA 1GZVA 4AUNA 5GONA 3TB6A 4EF5A 5IT5A 4JB2A 5IU6A 2GN6A 4OKSA 3VH3A 1TFRA 1GV0A 1RDFA 2W11A 1ZH4A 4V39A 4EJSA 2AV6A 1OFVA 3GDHA 4O2RA 1QIKA 1O2DA 1ZK2A 2ZW9A 2HSEA 3BD6A 3HZRA 4UHJA 3NM5A 3O4JA 2J7PA 5F77A 4FFVA 2NYAA 2ZYUX 4B71A 2EP8A 4YQYA 1E69A 2JARA 4FOLA 1EVIA 4F3KA 3ZVLA 1BX1A 4PC7A 3OP4A 3ZNNA 2ZUEA 4N41A 1B8PA 3DE3X 3IKMB 4R9RA 5ALLA 2B4TO 1CHDA 1KMQA 3U4MA 2CXTA 3II6X 3K1TA 2YHIA 3MWEA 3PI7A 4OA5A 5REQB 1D2CA 3RTEA 2Z3ZA 3IVAA 4CE6A 3UMYA 5CNMA 1VBKA 3V42A 4EYEA 2CB9A 1I1OA 4LQ4A 2YZ2A 3Q5DA 4NG5A 3ZZNA 4EVQA 1EVQA 2XUZA 3AJDA 3PIRA 3BA6A 4F4JA 2AS0A 1J1UA 3RJTA 2E5FA 4IFBA 4BN0A 2BPOA 3E9EA 2ABWA 3BFXA 3EFBA 5HKLA 3UJDA 1OXBB 1OAKA 2DBRA 5GOZA 4ZDKA 3PL5A 1MH9A 1L1QA 3B6IA 2AEMA 1O96B 3FYUB 3RK4A 3K9QO 3L18A 5A4IS 1TW3A 4PPNA 5TNXA 1P18A 2ADFA 1RXEA 1UMCA 2Y1XA 1LDBA 2Z4TA 1YJBA 5D3ZA 3WLOA 4UTZA 5BMOA 5CM8B 3EIXA 2D74A 3FVVA 5K8CA 4AN4A 4NZNA 3CGGA 1M66A 5CFRA 1JXQA 2B8NA 4RQTA 2TMDA 2ZANA 4B4VA 5C8YB 5J3JA 1WEKA 4KO3S 2DWUA 3S2EA 1L4HA 4RLQA 3TGLA 3EPLA 1UINA 1DT5A 1OLUA 2X41A 1NMYA 2ZSKA 1K06A 4JLUA 3KYIB 4EELA 2P3LA 1ONNA 2FA9A 3ESYA 3DWIA 3NVMB 4FDAA 5E9QA 3TR6A 3DAOA 1IE3A 1Q92A 1ZVQA 2A8YA 3Q3VA 4E4YA 1U2RA 2HK7A 1WHSB 1LTHR 3QA3E 4TX1A 1DCKA 3ADOA 4RPHA 2ZLBA 3AJAA 4O2LA 1GRRA 1SVIA 2GVZC 4MEAA 1LK7A 2QPLA 2P8SA 4LBWA 4OQMA 2AUTA 1RM5A 4KDEA 3U3MA 5CHYA 2RGXA 4KXLA 4EF4A 2Y1EA 4PU0A 4FPXA 2B92A 4GBGA 5GMOA 2RGEA 4RJJA 1JZSA 3SYLA 4F4CA 1M2EA 5KVAA 4XGQA 3NWOA 2A1IA 2AJCA 1MT3A 1T0UA 5E9WA 3PEWA 1OLUB 4KNYA 4WSOA 4OH7A 3SOPA 3WIBA 1NXPA 4GX1A 1HG0A 1XALA 2Z8YA 2FUCA 3PR3A 3VTKA 2WD7A 3JQQA 1OH5A 2G7MC 1OZAA 4WOCA 3V7WA 5LQDA 5IAKA 4ZTZB 1DJQA 3N7TA 5TQ2B 4YV0A 5I7WA 4Y6SA 1VPEA 1KF0A 3DOHA 4HZUA 4LW8A 3ASUA 3GJ3A 4CKBB 3GAFA 2JATA 4R1QA 1RS0A 3QXSA 2FUNB 1OHHD 3ABZA 2BTQA 5DN6D 3U19A 1DQNA 4HGRA 2ENUA 5IM5A 2OP0A 3JAKA 3V8VA 4ZO6A 1I3LA 2GJAA 2IRWA 3OCXA 3A9CA 3PDCA 4LXGA 1C0EA 2WM9B 3HKBB 2C2KA 4N0DA 4EB8A 2W2MA 2YY6A 1K8ZB 5BYAA 1PGQA 3ABIA 4GX0A 2YL2A 4G5GA 4CLDA 5HYVA 1Y3AA 2Y8EA 1DRVA 1VIVA 2J08A 2QVBA 4RK1A 4Y2GA 5C3MA 1K0FA 1IC6A 3LL4A 2VP6A 4YIHA 3ZNQA 2C9CA 1XEWY 2G70A 3GIDA 1MU0A 2I66A 2R2AA 2WD7B 3LYUA 4RETA 4GLOA 4UDOA 3SHTA 3T3DA 3WJ1A 1ST2A 1PYGA 5LU9A 2OGUA 1PZNA 1RWVA 3RT7A 2A0KA 2A30A 3BQNB 5JYCA 4PSCA 4TKVA 3CZMA 1XR3A 2J9GA 5ADVA 1ZD9A 3UGJA 3F7NA 5DX0A 5EP3A 1SU4A 4Q02A 5IHPA 1Y6ZA 3TDKA 3D54D 1O6ZA 3JD1A 5LP6B 2ZBFA 4B2YA 2JGRA 3NFYA 4ENQA 2FUKA 4UNQA 5CDGA 2QRGA 3DF9A 3DYVA 4TTJA 1UMCB 3UMSA 1GPH1 5JCXA 4M0FA 3L6OO 2IPNA 5CLQA 1ZOIA 2QRZA 3KJZA 3QNUA 3UMFA 1M0EA 3I6QA 2HXYA 2CV0A 3PFBA 3WRYC 4AUKA 1M73E 2VTVA 4LTNA 5CLIA 2ZRNA 1Z22A 3ENKA 3D8RA 2PGOA 4C4AA 2E4UA 5LUAA 4IGFA 3MBIA 1PNQA 2JC3A 1PR9A 3H4VA 5FFFA 2W58A 4XZ3A 1KPHA 1AHNA 3UO8B 3MJDA 1M2VA 2APJA 3HY3A 3WGLA 2ZATA 1W4CA 2AJ8A 4MUHA 4D4JA 1Q1GA 2CVFA 4K9PA 3RVSA 3LVRE 1X19A 2QKYA 3KV1A 2Q0QA 3M5PA 2AA3A 4NCBA 4NE2A 2O5CA 1CRPA 2ZT7A 1UBUS 1QMPA 2CFIA 2NSDA 1R4NA 1N2ZA 2BM1A 2UZ1B 3FJYA 1NW4A 4BNJA 4N3CA 2EJUA 2UUBB 3U3DA 4OG2A 2R8EA 5FXMA 2FMTA 5EIBD 4AQYB 2JVJA 1NVDA 4UAUA 3MGAA 3KKPA 4XWWA 2OBYA 1R6XA 3WNCA 1ZCFA 4I1SA 5AW4A 2XMDA 4MWTA 4IF4A 4U2GA 3W5UA 2HHAA 4IW3B 3I72A 2OCIA 1TQ2A 3C1AA 1DMSA 3ZW7A 1MAHA 4Z1OA 2GEDA 4CM8B 4TROA 3ORQA 2PKQP 3RWBA 2IY8A 5BWBA 3OOWA 3HDHA 4TMZA 4X0EA 2BFWA 3X1KA 4AF7A 1BXGA 2RH9B 5AKGA 1U6IA 2QM3A 4LKOA 4OYLA 5I9MA 4BB5A 3D8SA 2QP3A 1J9EA 2VDVE 3PC7A 4IPTA 1ECCA 4MV7A 4C0JA 3R9XB 4LSGA 4UEKA 4BVFA 2AK2A 4QOFA 3DCJA 3W2FA 1R74A 4LAFA 4IO0A 4MWOA 3T5BA 1KJJA 3RVJA 1UKCA 2UZ1A 3BIFA 3E70C 3K6SB 3O4IA 4XYEA 2ZETA 2IYRA 4B46A 4BNDA 1STOA 4RMGA 4IIJA 5LL6P 5ERYA 3WNDA 5U4QA 3AKYA 3V3KA 4B85A 2OCPA 2ODNA 4IJ5A 1UDBA 2WTNA 4Z4EA 1Q0SA 3ERCA 1F51E 2P8JA 4ZICA 1TADA 3X2SA 3CEPB 4EZIA 1FU4A 4QODA 3FF1A 1OW3B 4YS6A 3SM3A 3FZEA 1KAEA 3HMQA 4TQGA 2YBEA 1KFBB 2UAGA 1CC1S 4RFSB 1D0VA 2IP1A 5KX5A 3S1LA 1T35A 2W2OA 4Z9XA 5AUQA 2BKXA 4RE5A 3WZMA 1PJ3A 4BAUA 3IDOA 4ACAA 3L04A 2ATXA 1BG6A 2CXPA 1FIUA 1N2XA 3FYCA 3PQ4A 4GOMD 2F48A 5FJIA 3UW3A 4DR4B 4FHEA 3MM4A 5DBFA 4BBJA 5KTMA 3LX8A 5KHLB 1R10A 2H0RA 3BA1A 3FOWA 3MHPA 5GZ6A 2Y27A 4OEHA 3CNEA 1VJDA 2NVUA 3Q85A 5KSOA 2AMFA 1IZZA 2QG6A 4U00A 1BJRE 3LHDA 3NTRA 4OBXA 1ZGGA 4RHTA 2DR0A 2XGOA 2QEQA 3KYCA 1E1CA 2QF7A 4OI0A 3LUAA 1V5IA 1EGHA 2AN4A 4GI2A 4YJ3A 1O6BA 2Q3EA 3CLKA 4C4PA 1EG2A 3AEXA 4TSKA 4A8JB 5J2TA 3FNEA 2M6LA 3PHCA 1KK1A 3DZBA 4M7OA 3WTCA 5TB5A 2YS7A 2LCFA 3EAGA 4QXQA 4MKHA 1N92A 4N5DA 5DX8A 7ADHA 3R5HA 2XI4A 1U8TA 5HKOA 2OHIA 2Q6VA 3UJCA 2BBTA 4RGBA 1M1NA 4I9GA 1CEEA 4QD3A 4INOA 1HT1E 1Q17A 3RT1A 3VPHA 2NZUG 2OAEA 3HKEA 1ZNWA 3PEEA 3L6BA 3PUYA 4QGFA 1GKLA 1QR2A 1JA0A 4NZOA 3VDRA 2WI8A 1KY2A 1ZD5A 3VR6D 2DJIA 1NNEA 2CXHA 3NDJA 1E1CB 4G97A 3KEMA 4J0KA 3NHZA 5KCMA 3CVWA 2JZNA 3TW8B 2X8JA 1JHOA 4Y18A 1PK7A 2O0LA 4M0LA 5CDUA 4LISA 1CULC 2BEJA 4YAIA 1C4WA 4PRYA 3E3AA 4U2DA 1OBCA 4AJOA 4ZMRA 3JYLA 5F5XA 4CIBA 2PPVA 1GVNB 2ZG6A 2IHNA 3CH4B 3H8WA 1ECGA 1CB7A 4PC6A 1I4TD 1KJYA 3BTSA 1QZ3A 1DIRA 1EGQA 3DZFA 4QBGB 2VF7A 4A0QA 4ASUA 2LGJA 2OCLA 2ATCA 1HE8B 5A3JA 4C29A 3BVPA 4Z6KA 2PBFA 1M6HA 3K6SA 1TJNA 4FR5A 1AY0A 2JHGA 1YKGA 3AGQA 4BYGA 2WT9A 4B3CA 3EEYA 3JD2A 3KWMA 4UBOA 5I4KA 4ZYUA 2C82A 5KOJA 1QAQA 1Q11A 3PI6A 1YJ8A 1SVMA 1HYQA 3K35A 1JEDA 1WP9A 4HRAA 4EJSC 5IJ9B 3L0CA 3JYOA 3WBFA 4KLRA 4ODIA 4MQFA 3UHJA 3EAQA 3PXEA 4JT2A 3BMQA 3KLNA 4PGFA 5MN4A 2EHJA 1I5RA 2QNIA 2RHLA 1KK3A 4PZYA 5TVKA 5T4BA 3M2PA 4Y30A 4MJ7A 4BYMA 2UZ4A 5JAZA 3PKIA 1BJKA 4J0CA 3WB9A 4RULA 1UWCA 4OHOA 5HA5A 4R7GA 4W9NC 1OREA 4ZV9A 2B69A 4K9DA 3WIEA 3LUBA 4S1OA 1E1QD 2GOYA 3ZV3A 3OKAA 3ADBA 2F8TA 1LTQA 2H0QA 2J5KA 2PKEA 2Z04A 5EIWA 1PO7A 2VTKA 2L42A 3FB4A 2GB4A 3AEKA 4PAOA 4L4YA 2F64A 2GFQA 5C52B 3J80A 1VPDA 1RAEA 4DUGA 3O8QA 1WUHS 2WY2D 4ZCMA 3MINA 3WAGA 1V1RB 5C1BA 2VHJA 1NJSA 2VJNA 3ZU2A 4HDRA 1U0LA 4S24A 4NE7A 3UCXA 1RABA 3IPLA 1TLTA 5K3FB 1PKEA 1WXHA 1E6MA 4HNGA 4PS0A 2ZRIA 1HYHA 1V4NA 2PBRA 4N7BA 3OLZA 1EXMA 3N7UA 4ILKA 1CVIA 2P7IA 2WSIA 1QFMA 4ZDWA 3E9YA 4E11A 4FSHA 1TU0A 2C9DA 2ZI7A 1GPJA 4F5EA 1OA1A 4PANA 4UBMA 1RI5A 2PX0A 6PFKA 4CR6A 1O4WA 3B2EA 4MV1A 3F47A 1I9GA 5FR2A 3QMPA 3UPDA 4ER3A 1OX4B 3S8MA 4P6VF 3HBNA 3W0LB 4EM6A 2JBWA 3B60A 3I6YA 5DISB 5IFKA 3F9IA 3L07A 1WMDA 4ND6A 4RFLA 2P4HX 3SSOA 1AKMA 3TUIC 5HQ3A 4G0NA 8MHTA 2C3OA 2V4UA 1VQ1A 3O4FA 4WL0A 5LKAA 1WUJS 1P0QA 3E3OA 4PHHA 3SLGA 4MA0A 3NI2A 4NLLA 2B3DA 2B30A 3MF4A 4BXOA 2GPWA 3DE4X 1BEZA 1M6WA 4DCCA 3UBTA 3NYIA 3TQQA 4D46A 3H8VA 3QLVC 2JJMA 1RRVA 3P1JA 2Z56A 3C6QA 3D8BA 16PKA 1Z2CA 2NZXA 4Y7CA 2QM0A 1ZY2A 2OGSA 2R66A 2FN9A 1ZNZA 4E5UA 3PR2B 3BD9A 4ARZB 4JVSB 4MRMA 2B8JA 3C16C 1QBGA 4JQOA 3UOGA 4QGAA 4UNRA 3L6CA 3RUEA 3ZWWA 4JI7B 3TCKA 1NXSA 1Z34A 1FFGA 2QE7A 3CFYA 2IHJA 3IUNA 2ZE6A 1AM4D 2ZRKA 2Q29A 4LVOA 1W6UA 2J3MA 1JDVA 2GYYA 2SKCA 5ES3A 5CXQA 4DJEC 4V0NA 2D5CA 1I14A 3ZQ4A 1K3FA 1QBKC 1VSVA 2K87A 3LGSA 3G7NA 4LXYA 4M49A 3IAAA 4F4IA 1UK6A 4AYXA 1T4CA 2I54A 1VIAA 1Y9JA 6GPBA 3D3WA 1G0OA 4P4SA 2H4YA 3LOPA 5A5GA 2DQSA 3H5RA 2DR2A 4LYAA 1SEPA 4FZ3A 1H4TA 4R31A 3ZCUA 4WCDA 4X1OA 1V8OA 2XB8A 4RD6A 1SN7A 4LRTB 1IJEA 3UM9A 1YIOA 4Z1MD 2HV9A 5IDXA 3TMKA 1UC5B 3VPGA 2QRVA 5ECWA 1CQXA 3FPKA 3HPQA 3IQFA 3N2KA 4IDDA 4QOGA 3VVCA 3ZDQA 3O8RA 1OVMA 4KITB 5KVCA 2BGIA 3CZQA 3GXBA 2AG8A 1OH6A 1J99A 3R0XA 1Y34E 1PRYA 2VSFA 3Q6IA 4QUHA 1Z73A 4GM1A 3V4SA 5CLGA 3N58A 4LOKA 1C7IA 3LBFA 4RD4A 4D0GA 4MK4A 3BWEA 4NDZA 3T94A 2YWDA 1O5OA 1PJBA 2TMGA 3DHNA 2G80A 3OZVA 1W29A 2HT6A 2B6NA 3PVCA 4IIYA 1CNMA 5I5EA 1CQWA 5KNLA 4CGYA 1QDLB 5IASA 1E8DA 4MMZB 1IXKA 4FYVA 3RGGA 1UKAA 2PL9A 1UK8A 4MVJA 4HEJA 2QW1A 2WFZA 2W6NA 2E0IA 3FMGA 5FCDA 1ZAYA 2BP7B 1W2GA 4BAZA 2CT8A 1PJ2A 2GRUA 2OUKA 2YH2A 1I13A 3UFBA 3KQVA 3K6JA 4BNUA 5M34A 3DE2X 2FG6C 1CW2B 5ESWA 1ILEA 1J9ZA 1VDMA 4DHWA 4LHXA 1EK5A 2QYTA 1ZMXA 4ETWA 4C3ZA 2NU8B 2GZMA 4AI6A 1YR7A 3NBZC 1R8QA 2X7HA 4B79A 3IMGA 4ETMA 1Z0AA 2YQ4A 1D6NA 4OXQA 1A95A 2VBIA 1QZXA 4JI4B 5AVTA 2Q7DA 1CZUA 3I12A 4O2BB 3P97A 3MT8A 3V1LA 5B30A 1KVTA 1RAFA 1W5TA 4ZOBA 3RIEA 3EQZA 1PUJA 3E7WA 5EYPB 2FPGA 3FZQA 3ASYA 3MD0A 4JYZA 2QGFA 3UA4A 5YASA 3UJ7A 2FFJA 1HDCA 1G16A 1H1LB 3EXAA 4DMRA 3VHLB 3OU2A 2JFNA 1WKBA 1J0DA 3AHDA 2C5EA 4H7HA 4JY7A 3VJMA 4M9SA 1S3GA 1U1FA 1IIRA 2P4EA 3PFIA 3V1NA 4WXMA 3D5QA 2H57A 1Z25A 2C4MA 2FZWA 2KS6A 2N46A 2DFKB 1H2XA 2AFHA 1X7GA 3AETA 2NU8A 3THSA 3D6AA 5F51A 3UQZA 2AOVA 1JDBC 2ZBGA 4IX9A 5TMBA 4IJ6A 1ODFA 4CUZA 2BFCB 2OCDA 1J25A 5JD5A 1P5RA 3GFPA 3D81A 2Q0SA 4F12A 5CGQB 4ZRMA 5CMLA 4O02B 1KIFA 4QSMA 5CFLA 1D6MA 3OCVA 5IMBA 1RQXA 2QMYA 2FPPA 5HUHA 2E4YA 1GA1A 1SG9A 2VC2B 1TTTA 4EYGA 3ZTTA 1P8AA 4UUQA 3HLYA 5JZVA 1HA3A 4MWBA 3LSTA 3DXFA 3LSYA 4YBRA 3OFVA 2J9FB 2RGRA 2JGKA 4KQ2A 1GR1A 3DL2A 1HTWA 3DR5A 3DVAB 3Q8MA 3P52A 1P9NA 1KSHA 3QF4A 3FCXA 1G19A 1A4UA 2PRJA 3BD7A 4TWIA 4R1UA 3ME5A 3T5MA 4JI0B 2XUJA 1FSZA 2R6GA 2VLBA 3LHSA 1X86B 4UBLA 4XX1A 1PNRA 5T57A 1D7AA 3AJ9A 3TEJA 3EIOA 3KB2A 4WE3A 1WHSA 1N9GB 1NN1A 2QK4A 2WABA 3VR2A 1X9IA 4RJIA 1WLSA 4JI1B 1BO6A 5KJCA 4DN6A 4D9BA 1OZ0A 4P2GA 1KBZA 3UK0A 1X1BA 4Z2AA 3T9AA 1VLHA 4MQBA 2IGBA 1TA4A 2QBYB 2GEFA 4DL9A 2XCOA 1O94A 1RHRA 1WAMA 4KP7A 2OWDA 1VBMA 3AOEA 3IVXA 2UVDA 1Z12A 2IU3A 1C7FA 2AR0A 2VLIA 4S35A 4DM4A 5BSKA 1NP7A 2W9XA 2FPIA 4KYTA 2H18A 4A2PA 4YT2A 3HS3A 3WMGA 3TDMA 4ND4A 1RZ3A 3WWDA 3H18A 3H2HA 4TMWA 4ZYYA 1XUOA 4ZI7A 5JCJA 5E7JA 4O4HA 3OEWA 4R98A 5HXAA 3EYAA 2OV2A 4YRDA 1YRBA 3E48A 1ISIA 1HDEA 3GRVA 1ZI8A 3PJFA 3C3EA 2QBYA 1KC3A 2FQWA 2G3YA 3NTXA 2B9VA 3ZHSA 1XZNA 3M6FA 3E8MA 3T9CA 5M5BA 3OLYA 4DVGA 1R4MB 4E70A 1OB5A 4ZJPA 5LU8A 1CNEA 3GJ8A 3KU1A 1XAGA 1Y89A 4J0DA 4C7KA 2P65A 5TEWA 2IZOA 2FN3A 3WIUA 1GU1A 3NXSA 3IXMA 4CQLA 1AT1A 1G21B 2PGDA 4KNVA 2P9JA 3O6VA 4O33A 5JNVA 5HP4A 1YS4A 4MYHA 3MOSA 1JLLB 1U9CA 2P5YA 2QR5A 3K0FA 4V0ME 1K4MA 3ZY6A 2PUEA 1LZLA 1ZC3A 2A67A 4AY3A 3UY4A 4NV1A 3BFPA 3LNTA 3VYRB 4CKEB 4BFCA 1D4OA 1G3MA 4MICA 2IW1A 1YVEI 4QFBA 1U9IC 5E8RA 2IDJA 1I33A 2XMBA 5F1OA 2QXTA 4RH0A 4BNXA 2JI6A 1EHIA 2W71A 1FVXA 5AVQA 2FLWA 4HXYA 5JH7A 5F7JA 1UKVY 1Z6PA 5BN5B 4G65A 1QIIA 1A5TA 3U7QB 2C9YA 4ER6A 1B8OA 1F12A 3HN6A 3JQAD 3FSGD 1QM5A 4IG9A 4BRZA 4E6PA 4YBZA 4PZCA 3OZSA 4XJTA 4ARSA 4C5AA 4ZHQF 3QVWA 5JYDA 4A0HA 1GAXA 4NYIR 1NVFA 3GVCA 3EGVA 4UTPA 1AMUA 2CV1A 1CUDA 1UBLS 5EHGA 1RJWA 3W04A 5BR8B 4M8IA 3ANTA 1U6KA 5ENDA 1JPVA 4Y2VA 5ARDA 2B7CA 2VT7A 5C1OA 3IAS6 3THYA 2Y1LA 4B3MB 1E98A 3FYTA 4CCSA 4ZZ2A 3SJAA 3KO8A 3IOYA 3RU3A 3DYIA 1NBMD 1PFKA 1WU8A 2JFUA 1TB4A 1Z0FA 3EVDA 4JMLA 4JLJA 2HYIC 1RZRA 4RY8A 4X00A 5BWOA 2CDNA 5CFMA 1XYYA 2RIPA 2NSLA 1L7VC 4PS1A 4R01A 4L08A 2GM3A 3DZHA 4J75A 4RSRA 4CEHB 3B38A 3RFXA 3WBKA 1XHEA 2R6JA 1SHUX 5ECGC 1PBTA 3ZWXA 3C43A 1MO2A 5IZ4A 4UBJA 4NBRA 1H6CA 4RVUA 1ADFA 3E7FA 5HW0A 1OXUA 3G9UA 2BGUA 4ONEA 3W1VA 3DJFA 2MYUA 4NDAA 3THYB 5CT5A 2OB2A 3A28A 3V2GA 1U1EA 5JARA 1KPIA 4TMTA 4JHXA 4MW2A 1BVHA 4YRLA 4JA2A 2AXQA 1S6YA 3IVCA 1XA3A 5AOVA 3JASA 4D45A 3CX7A 4K9OA 1XCPA 1LI7A 1SQ0A 1CU1A 3ICOA 5L6MB 4NZZA 3HDJA 1C7JA 4INZA 3BE5A 1U2QA 3T0GA 3NDPA 1D09A 1FMFA 5BNTA 4AJEA 1Q1NA 5IBRA 3BQMB 4E4TA 1KMCA 4BMSA 5CVTA 4ND7A 1TYDE 2H63A 3MFYA 4R40A 3OECA 3VR6A 1WNFA 3QEJA 3QWFA 1NFFA 2IHYA 5A9TA 1YU6A 4NKRA 4LOAA 4BFSA 3BRSA 2V7TA 1K6XA 2PBZA 2FWAA 1P2GA 3LY5A 1B0AA 2PR2A 3GT4A 4LCEA 2YUTA 4HPWA 3LH5A 4L2IA 4BVGA 3QX9A 5DIFA 3VNRA 4HC4A 1YI1A 1VKJA 3DO5A 3UAOA 2YVUA 3KKMA 2PX6A 1IN1A 2I3AA 3C15C 1EHYA 5CIYA 4B40A 5DBEX 3U60B 4PEVA 5AKHA 1BAPA 1GTZA 2XNDA 5AKXA 3TVDA 1J22A 1SULA 3WYDA 2JD1A 2ZTSA 3PXDA 2PJDA 3PVZA 4Q7JB 4CYMA 3DLTA 2IEZA 3M8KA 3U4AA 3ZE6A 1JEYB 2WSSA 4PC2A 1PR5A 4I8IA 1Z35A 4FB4A 2P5UA 3MTBA 5LQCA 4BNYA 3ZJYA 4KQ9A 3ZJ5A 3D6FA 1G8YA 3AZQA 3ORHA 3ZHYA 1F4LA 5K5EA 1UKBA 4K6MA 3GQVA 4ND8A 3ASVA 3RRNA 2FVXA 4E2XA 1Y1TA 4COKA 5AW6A 4GPEA 3A3YA 1HOTA 2FZKA 4QUIA 5FPHA 4C4RA 4H1HA 1KYVA 3CKKA 2N0SA 2C4UA 2C0QA 4K6GA 1VHLA 3JD4A 5A5VA 1HO3A 1MOPA 1H2ZA 1LDMA 4W5HA 2F8LA 5J2TB 3NV9A 1F0YA 4M7RA 4D82A 4EHJA 3PQDA 5FUBA 4YLYA 2COUA 4MP3A 3BHMA 5G53C 3GK3A 2WSBA 2Z58A 3K9LA 3QE2A 3QJGA 1BXRB 2QTVB 3M34A 4NNPA 1H22A 1I1QB 4HN2A 4B6RA 4R41A 2VUUA 4MJXA 4CEHA 4NH4A 3P5SA 1BXKA 1CD5A 1T9DA 2O2ZA 3NOQA 2PSDA 3QUTA 1KAMA 4FWIB 4IDFA 4HDOB 3IQGX 4IEFB 4X3PA 4MAAA 1Z06A 3G49A 4MP8A 5FORA 4BUCA 1PP4A 3QKIA 3G8DA 2LR0A 3CWQA 1VPVA 2BONA 4WTOA 2HRQA 3VU8A 3FSJX 5TGDA 1E1DA 1QLWA 1TU3A 1RBZA 1XMVA 3PTLA 1HZZA 3U62A 3KXIA 1MXFA 2X58A 3GCWA 1E18A 1ZIYA 1JDUA 3HEAA 1XDSA 3QUBA 1XTUA 1L5KA 5T8KC 3UC5A 3CB4A 3W5HA 2B1IA 5EJ7A 3EXFB 4L8WB 1TJYA 4XFDA 3N0VA 1KZ4A 2Y71A 4B7CA 1QHXA 7GPBA 2G8NA 4BQNA 2HF8A 5AJTA 3EEBA 2PM8A 3CLUD 4IKPA 2FQ1A 2OK7A 4JOCA 3HGMA 4X1YB 3ZXSA 1A04A 2C5AA 1G9XA 4HRXA 3U48A 5GGXA 3ICQB 5B7QA 1Q0LA 2BMWA 4LZJA 1R9NA 4MS4A 1GL3A 3ROEA 3NHRA 3ZBUA 4J6EA 3KEGA 4XUCA 1Y8QB 3Q3CA 1DGQA 1P2VA 1X8LA 4OQQA 5ADHA 1PT8A 1A8PA 3L8FA 3D2CA 2Z6UA 3H5IA 1MN6A 3FYHA 2EP5A 2X5OA 2YMPA 4DA0A 1SVWA 4JUCA 4CG0A 1JKJB 3ROMA 2VFAA 2R7MA 2IFTA 3PYLA 1C7QA 4KDCA 4P08A 2JFXA 4EVIA 2JGJA 1DAFA 4WBNB 2Q9UA 3GVXA 3P0HA 3SWWA 1JQKA 2D1YA 4K81B 1RYDA 4BNNA 4ZZIA 1NPDA 4DF3A 4X8OA 3K9WA 3DHEA 4YMTA 2NTYC 2O59A 2WJPA 1NATA 4XQ9A 1LJLA 4PZZA 1XNHA 4EO7A 3C8MA 4B7ZA 1JX6A 1IBLB 4O4JB 1OZFA 2UZ3A 2GEUA 2HTEA 3CR8A 1EUDB 5JDCA 5TJHA 1CHNA 1KS2A 5K0LA 1ICEA 5HNKA 4YIKA 1P3JA 1WXFA 3I30X 1TD9A 3C3BA 3FBWA 4QX6A 3BL5A 3LY7A 1L7XA 2GD6A 2ZEJA 1FQOA 4OQ4A 4DJJA 3BJRA 1L3CA 1BCRB 1T5HX 3CR7A 3MFQA 1U90A 1V11A 3H6HA 4PVDA 2Q2OA 1C4OA 1E9VA 4HJRA 1QE0A 5IARA 3VOAA 4A4DA 4QUGA 3PX3A 3SJUA 3TM5A 4B7XA 3FDXA 2HRCA 1ULHA 2PZEA 3FDZA 3M0EA 4JSYA 2P4SA 1P33A 4OH1A 2DWOA 2Y1OA 3NHJA 1UXKA 1JR3E 3S2IA 1ZH8A 2C4HA 2EKPA 5EESA 5FH9A 3B1KA 3MJEA 1ZS9A 4GYWA 5L53A 4CV0A 3FW1A 4MNTA 2VL7A 4NOMA 3ZI7A 1E2EA 2YW2A 3MCTA 4OF4A 1MCZA 2IDKA 1T9GS 4TLBA 5C8ZA 4GKJB 4BX2A 3PR1A 4ZHSA 2BWJA 3C8UA 2BZGA 1W4RA 4GO1A 1E5QA 2CBGA 1E8MA 3EF3A 3G2HA 4D0SA 5HG0A 4ISCA 4N65A 4D4LA 4MPRA 1T91A 4EEZA 4R5MA 3W5AA 1NRXA 1D5WA 1GU7A 4PHGA 2D8MA 3BCSA 3OJLA 3QLUA 4HAYA 4YJFB 5LUBA 1ECBA 4CM8A 3UV6A 4QELA 4YRJA 1WMEA 3F6PA 1ICIA 3GLFE 4C0HA 1CJSA 4KXMA 2AI2A 3MGCA 3OLXA 3VZBA 2J6IA 2CNOA 2XQIA 3RJ9A 1V5FA 2JBAA 3NC1C 3NBFA 2GASA 1Y9AA 3LWZA 4OXKA 4WVFA 3SZLA 4D6YA 2VHEA 1GAWA 3EZ2A 5F35A 3BWYA 2WIAA 2PKYX 3GDGA 4PFJA 2XUKA 2FRDA 3X1JA 5BW4A 4MRMB 5E95A 2X76A 1X7DA 2NQ2C 3BMOB 4IBOA 2QGNA 4BKUA 3IR5A 2RGGA 3IP1A 3WA6A 2ZXEA 2V6BA 1SKMA 2R7NA 4BWGA 5BQFA 4RK0A 1VJ5A 1V96A 5NLLA 2YV2A 4BO4A 3TLGA 3ZWKA 3KFVA 4UFNA 4EYQA 2HHHB 3DG9A 1E2PA 1R6DA 1RXIA 3DNMA 2O2HA 4IQFA 4MLZA 2X13A 3EDCA 2PWBA 1FMTA 3L3BA 5C51B 3FPHA 3V9AA 1F5NA 4C6HA 2P9HA 4II2A 2RB5A 4QPNA 1H3FA 3N74A 1X7XA 5A4KA 5GONF 1T13A 4PRKA 3AUTA 1U7XA 2X6QA 4A2QA 3ZBTA 2CN1A 4M89A 3TIIA 3WADA 1E7YA 2FNAA 2ZROA 1Q2XA 2X3UA 4ER0A 2HSJA 5DYGA 2BGKA 3C3DA 4ED9A 3COYA 2B25A 1EZ1A 3W7BA 2QLNA 2JDIA 3FDIA 3L0ZA 2CJPA 3PICA 3ZIAA 2I1WA 4OOFA 4MR8A 4A0FA 2VJMB 1GZ6A 2E1PA 3K8YA 3CRNA 3L1JA 3MJRA 4M0MA 5ALUA 3A3OA 3NHFA 5BO5A 2ZT8A 1BKYA 3R1IA 3UVEA 1G8JA 4CG2A 1IULA 3MN1A 1JEEA 1N1GA 2X0JA 4BMCA 3BMQB 5LXTF 3HACA 5A6SA 2ZI5A 4I66A 1I6WA 5LA6F 4Z7NB 1Y7IA 3ZZUA 5HM8A 4HDMB 2VYCA 4H7KA 3G5UA 2QQGA 3ZLUA 3FVRA 4UTNA 3UJ8A 1W36C 3KJQA 4PYKA 3L0OA 4HEHA 5J5VA 4H17A 3CUTA 2BN4A 3PC4A 3TJMA 5IC4A 2GUGA 2AGVA 2HYDA 3KJHA 3MSCA 4XSVA 4CFZA 5JJCA 5JO0A 3SEAA 3KQLA 5C0OE 3G0HA 1E6LA 4NOKA 2WB4A 2B0CA 5TT1A 3SC4A 1FXWA 4HATA 1SZJG 1NVVR 2RG7A 4XIFA 2ZIVB 2WQ6A 1WW2A 3H9UA 2XUGA 5A9RA 3O26A 2BD0A 4DPMA 4ZJYA 4PYOA 3SGLA 3NWBA 2F00A 3A4TA 3T9DA 5L4NA 2I3DA 1N2BA 4DEXA 3NIBA 1XI2A 1IY8A 4QDTA 3MBOA 4N5HX 5CX1B 2NO6A 4LJ7A 3FWPA 1AZWA 3LBNA 4EUSA 2WNHA 3W6NA 1V39A 2PGJA 2ZDHA 3ICVA 4JOBA 5T3UA 3DKPA 2DFLA 1T5DX 2A1TS 2HMYB 2R1VB 1P2SA 4MKFA 4BFZA 2BFDA 2P5SA 1IB6A 1L5RA 2BY4A 1EB8A 1Y5NA 1NC1A 2AR7A 1XTPA 2XHEA 3U3XA 4EHHA 5AH0A 5MF6A 1DXYA 1TIPA 2IOFK 1JI3A 3H99A 1V7PC 1U8UA 2ILTA 4JXKA 4AN0A 3D3JA 5ITWA 2OXIA 2FJ0A 2BCEA 4X20A 1C4XA 3E5HA 1PJ8A 4U6NA 5B7GA 3SJ7A 2C4WA 1I2MA 3A27A 3ZNPA 2I62A 4Y9RA 5KJFA 5CYPA 1QQ7A 4B3SB 4MIYA 4RVGA 3L7IA 1T6NA 1YI8A 4BFVA 5HQ3B 2YC2C 2FE4A 3E81A 3IGFA 3VVLA 1A9OA 5KYWA 4B82A 5BQ5A 5I45A 2PR7A 1QHHB 3EF0A 2OBLA 2HK9A 4LDRA 5T6BA 4EYOA 4F6LA 3NYRA 1DIGA 4XEHA 3UMCA 1J8MF 1VJTA 1SC9A 4AROA 3ZE0B 4X6LA 4BO5A 1EINA 1NN5A 3WLJA 4NS4A 4PNEA 1CJKC 2X5JO 3VPFA 4RD0A 1MDBA 3OCCA 5L7YA 1C7ZA 4IMPA 3RHZA 3PHLA 1IQPA 3UG6A 1VZ2A 3H3JA 4U0KA 1YQQA 2B8TA 1PG0A 5BMVA 3LDAA 4UU1A 1G18A 2DKNA 3IJ5A 2YXDA 5JRJA 1HF3A 1KI6A 2QRNA 1PZFA 3FTPA 3LX6A 4DBZA 3GRFA 3SCZA 2XT0A 3RS8A 1FSSA 4N82A 3ZJ4A 1BMFA 1U0GA 2VHXA 4IFEA 4D41A 2XGJA 1UJ4A 2NYUA 2EJVA 4FS8A 2OMEA 3P2EA 3L4EA 2ID8A 5AW7A 1TJ4A 1FUIA 1AZTA 4GAEA 4GZ5A 4XSHA 5J5CA 3AVXA 3LU1A 4YP9A 4YASA 2WD9A 3GEDA 2JNWA 2ROQA 4Y1EA 3G8CA 1A0OA 1EFVB 5GJWC 1NQOA 1KY3A 3OP1A 2AYYA 4PV7A 5KQPA 4J7UA 4LQDA 1E0SA 1R16A 3IE2A 4QYIB 4RA6B 5AXCA 4TVSA 5ALQA 1YQGA 1JA1A 3G89A 3FFTA 3RKRA 3TH5A 4YRKA 4WAUA 1J8QA 5FRDA 4OBBA 5KSYA 1XNQB 4Q18A 3CW8X 1QZZA 2G40A 4HTFA 4OHYA 5EP2A 1RPTA 5KYKA 1V6AA 1M74A 1R0KA 4EJ0A 1NUSA 3WDLA 5F52A 5TIIA 2A3RA 3ZHOA 4HX9A 2PKCA 3B48A 1BHO1 2YWRA 4RM3A 3JY6A 1R27A 1YCFA 3PPXA 4BU0A 4F2PA 1GT91 3IR6A 4GRIA 4ALNA 3H11B 4GMHA 2FJUA 3DVQX 1K68A 4RS3A 2O05A 2OQIA 4Q66C 5EFZA 3QU5A 1H8HD 3LHKA 1EFVA 2HMAA 2JLUA 1M76A 2BFDB 4HNRA 1Z68A 3WP1B 1CDOA 5E9JA 5JSUA 2YXNA 5L3RA 2O2GA 4ALMA 3H4IA 4QYXA 3DT6A 3SQMA 4F8JA 4JGGA 2WNSA 3BM5A 3W8FA 1KDVA 1K86A 4MB2A 2H1LA 1Q21A 2VQ3A 3R0JA 5PNTA 5AK6A 3VNVA 1D0SA 4DSAA 2PYDA 2VPTA 4BZWA 3I34X 1NPYA 4M88A 5FULA 1HDYA 1MOZA 2BGNA 4M9UA 4RCYA 3GRCA 2B36A 5B1SA 1V3UA 1QCDA 1X38A 5TQ0B 1XRQA 1X1QA 2YBDA 3RSQA 3IVMA 5JMPA 1V26A 3JRWA 4AKHA 4K7JA 3REGA 3RVLA 4MWCA 3ZWVA 1EE9A 3CONA 1EZZA 2FPGB 2GARA 4A3SA 1LFDB 3OQVA 1A9ZA 4JD5A 3ESRA 4MB6A 4J0EA 4J8PA 1Q0QA 2C3PA 5ALYA 4LQLA 4BO2A 4K9RA 1TJPB 2Y67A 2YN0A 4EFDA 5KIAA 2B5OA 3TJRA 3ZGOA 1SUCA 2C1EA 1MQAA 2NZ2A 4OJYA 1M7BA 2N42A 4F72A 5FPTA 5BNWA 4FGKA 1NNI1 5HBRA 5KINB 1OAOC 2Z6AA 3MS2A 2WF9A 4L3OA 3X3HA 3D5TA 1P5JA 3AIKA 1YFKA 3ED1A 2BAGA 3EASA 4H7FA 2A9FA 1IK4A 4JJAA 1GUFA 2BCJQ 2C59A 2G08A 3RG8A 3HVUA 4JEUA 4TTVA 3V32A 1PL7A 1QG2A 4MUBA 5KYGA 3L05A 3NNDA 2OWEA 2O4UX 5AIAA 1DJLA 4R81A 4JGIA 4JZYA 1Y7HA 3JAWA 4ID9A 3HJGA 3E8XA 3IFSA 4JUDX 2H1WA 4I5DA 3L77A 4V3CA 2Y1GA 1UBJS 2A5FA 4E3WA 2BH2A 4J6FA 3JPWA 1PD0A 1QVZA 4ZTUB 5BRAA 1PFUA 2R4TA 4KX3A 1A50B 3KXLA 4WPGA 3UYLA 1GM5A 1BEUB 3PEUA 5JQWA 4O0MA 4R3WA 2Q2VA 3FMPB 4FYIA 4KVFA 1S9HA 3LRXA 1QIHA 1IHYA 4OQFA 1JIXA 3HKCB 5JAPA 1OU4A 1YONA 3H84A 1E2LA 3SXUB 3RK1A 2GBPA 3VKUA 4B7UA 1KO1A 5AKJA 3GRKA 1CVLA 3EFEA 5E1DA 1SD2A 4HSEA 5SY4A 1BCSA 3GLIE 1T1SA 1O8BA 2QMUA 1T3ZA 1E4VA 2Y6UA 4DDWA 1G38A 1M6NA 1KOLA 1XLWA 5FTWA 4JXJA 3KDAA 1FRZA 3FH0A 1VLMA 1GPMA 1N5LA 1H0SA 4YACA 1NWHA 3NRCA 1G17A 1GT6A 3V34A 4E31A 3SBDA 3FYDA 4YFYA 1B7GO 1GNPA 1G5HA 2R47A 5HEKA 3R7WA 3T34A 4D9FA 2OECA 4FCWA 2PEZA 3LDHA 1U99A 4W1PA 4QASA 2RBKA 3PCTA 3QV1A 5FNVA 1NXWA 1ZZGA 1Y48E 3NM6B 3EIUA 2CLOB 1IQ0A 3DDZX 1M7GA 3AKEA 1AHIA 4JVLA 4P4TA 4URYR 2FSIA 3LUKA 2DBVO 4Q3KA 5HKBA 4LOLA 5BVHB 5KYXB 3QXXA 4MW0A 1E1YA 2H48A 1K63A 5J59A 2ZRGA 1O94C 4US1R 5E38A 3UH0A 4WHMA 3NBQA 4C7BA 4BLOA 4C07A 5K9ZA 2WPDA 3HH8A 1UDAA 1X1AA 2ZFUA 1EZ4A 1IVYA 2DT5A 2POQX 1UOQA 3QELA 4TKMA 4DM7A 1OFUA 3NG1A 4H6VA 3R74A 4LMPA 3ZQKA 2GYWA 4NC9A 4K40A 2Q6LA 4TL7A 4PG8A 1KMNA 3MSXA 1Q5PA 1CY6A 1QO9A 1BXZA 1OI2A 2V7PA 2EGGA 1RKBA 3AI7A 3TSCA 3I2FA 5B4UA 1XDZA 4EKNB 3PK0A 1MA0A 4QPDA 4ZGBA 1JJVA 1DC5A 1BE6A 2PL5A 1LRJA 1PJLA 4ON9A 5BSMA 1C9EA 5KYXA 2FR1A 4CI0B 3BJZA 3C14C 1W1WA 1XIVA 1LH0A 1LF0A 1XK7A 1JF8A 1RC8A 4F97A 1V9CA 2OZVA 2X3FA 2I6SA 4PC1A 5DHUA 4TM7A 4L16A 3M3DA 4JBYA 3DKKA 4K6HA 4QBHA 4UQOA 3RV4A 5FA8A 5BY2A 4BDTA 4YJHA 2WYOA 3EFOB 4LF9B 5SZJA 1Q22A 2LP4Y 1N0UA 2BT4A 3ZHRA 3H0EA 1ZOSA 4QNNA 1XAJA 4WK2B 3AUSA 4HGYA 1N4DA 3AF5A 3KU4A 3DV0B 4R2JA 4HUQB 4MYSA 2OV3A 4NWIA 4LJSA 5B3JA 3OZXA 2SBTA 1ISPA 3OAAA 1M67A 2WFLB 5A62A 5BQOA 1ID8A 4NAUA 4GP9A 4UPEA 3HQ4O 2ZIAA 4R9UC 3V97A 4O4LA 2H08A 2JF0A 1LX6A 5FUYA 3EQ9A 3EQ8A 4QU0A 3VO8A 5AVSA 9GPBA 2PZBA 4DJDC 1KVRA 3IILA 5H4HA 4W5RA 4O2AF 4Y2PA 4RJKA 3VNSA 2BHLA 2E6UX 4WECA 5J2UF 4DCPA 3A1UA 1NMSA 1NLMA 4I9FA 4BQEA 4QGSA 3QSGA 3O82A 5HKKA 2VH1A 1QQAA 1ENPA 3PNPA 2O20A 4FLEA 5ENVA 3IAS1 1XC7A 3AV0B 3B3GA 4HNVA 2A1TR 3FI0A 3SZUA 4EGCB 5FHRA 4X6XA 5L3QB 2JAPA 1K8RA 1SCDA 3KL4A 4IP0A 4CDGA 1W9MA 5E6UB 1HQCA 4TL6A 1U8XX 4JBIA 1KEEB 4CCYB 1P7VA 3P20A 3PRKE 4YXFA 1MVNA 1P7YA 1Q15A 1A7KA 4PG7A 5AI6A 1AVTA 3WKEA 3NKVA 2GHRA 5FOWA 2PJZA 2V7XA 5JXGA 2DTEA 5FPYA 4A6DA 2ESRA 1DKRA 1AO3A 3UAVA 4C4SA 4Y67A 5LOVA 1D6JA 2ODEA 2DE0X 2V5VA 3EEIA 2AH5A 4YI3A 3B5EA 4PCAA 3TLBA 3IBCA 4WK6A 1G2QA 3ZGYA 1DT3A 2DBZA 1JKIA 1SOUA 4IXNA 2R86A 3R7FA 4Q3LA 5EJMA 2AC2A 3CHYA 3KOUA 2F3PA 2QLFA 5K4GA 3VO9A 1IHUA 1XOIA 1JT2A 5JH7B 5FUQA 4RZQA 1E2DA 4IOMA 2XKJE 1KFEB 3T5GA 4RY9A 4PPYA 3JQFA 1HC7A 3QM1A 4IL5A 2FH5B 3PNMA 4FX5A 5CJJA 2WPDD 4B83A 4TZKA 1ZWLA 3M82A 1KJQA 1DCFA 3EWIA 1I3NA 1JMYA 2RI0A 2F9FA 4GPBA 4BJ3A 5B5SA 1RLIA 1FSGA 2NVWA 1IN7A 3SIWA 2YWFA 3HA7A 2ZYWX 4G2TA 4OMDA 4QTXA 2BEUB 1E3TA 3UMGA 4TKVB 2VNIA 1J2UA 2CHEA 2G67A 2BFFA 3LCMA 3NT2A 5KNDH 5KTNA 1JNXX 4EX7A 1UK7A 2KLBA 2VAPA 3ETLA 1A69A 2JJ2D 5AI9A 5ULLA 3I83A 2RSLA 5FO1A 3VNQA 3K1AA 2VYVD 4KX5A 3A9VA 2O8FA 3ESCA 2E3JA 4HY3A 3UWMA 2CNNA 2VCEA 1REQA 1T8UA 1CVRA 4KXYA 3ZWNA 3L7CA 4CG1A 3JQCA 1ZNYA 5T4FA 5JAHA 1PAUA 2YR0A 4KBFA 3F90A 4XUDA 3WV4A 2PSHA 4HUQA 4I4TF 4IRMA 5IAAA 3LY9A 5K4HA 3EXHB 1Y1KE 3DOOA 4DSOA 3AF1A 2DQKA 4NEGA 4ECEA 1V3VA 3B1WA 3GJ4A 2BEUA 5IEJA 2RHDA 3TD6A 1A9XA 1RT9A 4MJLA 2D4HA 4RF2A 3DMDA 4TYWA 4PLWA 4EY3A 3ZUGA 4CMAA 2M6RA 3SXPA 2PU7A 3ANYB 3GJ7A 1NV9A 4GZ6A 4EENA 1CUEA 4PAMA 4MW7A 2QR2A 3JASB 3MIZA 4Y0NA 5ALPA 3WZLA 3M1LA 4RK5A 3ZGNA 5BR4A 4KIFA 3V48A 1VGQA 1REQB 1FTSA 4UULA 4R1SA 4EPRA 1CUJA 5B36A 1PW5A 2OD9A 1PQPA 2W4QA 3QVVA 2WUWE 4IF6A 4Q3AA 4M2LA 1A9RA 1QQTA 4CIXA 1L2TA 2VAWA 1S2MA 1ZOPA 1MB2A 1SCJA 2DR3A 3R3HA 4MRSA 2NP6A 2HU2A 5DSXA 1M1ZA 4FN4A 3W2IA 1R8XA 3C5WP 3DTTA 3WMRA 1XK6A 1C9DB 2V7BA 2X3YA 3EDQA 3P2KA 4C2UA 1K66A 2XLBA 3L1HA 7AT1A 5AHRA 3EXIA 2Z8YM 3RTDA 1KO5A 4MVJI 1XTKA 4JB3A 4BO1A 2ZJOA 3ECSA 3FOZA 1P2UA 3W6PA 1ZMBA 1NVXQ 1Y80A 3GEPA 3TRDA 3ZY4A 4LC1A 2X14A 3NTLA 4UZEA 5BPFA 1SUEA 1U1GA 5D3KA 1NGSA 1WPXA 1A27A 2A78A 2WUVA 4Z7OB 1C9MA 1R0YA 1KQGA 1MO4A 3EISA 3H5VA 1KEKA 2PS3A 4FYKA 2Q49A 3TEFA 1UMDB 3W90A 1A5BB 2KLHA 4Z2YA 5CYGA 3ZD6A 1WETA 1CETA 4L0QA 5FEMA 2GNOA 2YOGA 1U2DC 3H83A 3BXGA 3VC2A 1NF9A 4INPA 2JB9A 1CIPA 1ZJ6A 1BHSA 1JHQA 2VXBA 3O3CA 4FKBA 5DLQC 3LPAA 5HIMA 2W4IA 4DLPA 4DWJA 1TW2A 2L19A 1XDGA 5K01A 2QN1A 1NMZA 1I36A 2QLJA 2WZDA 3E23A 2UZ0A 3NANA 5EUBA 4Z0PA 4DJAA 4EUEA 3UAYA 1WCIA 4FFMA 5DHTA 3WSWA 4AG3A 2QORA 2BKLA 2C77A 2ZBVA 3CW2A 4TRNA 1JR2A 4B6QA 5ALEA 1WWKA 4J1TC 4IZIA 3V1TC 1QP4A 2IS4A 4Q4CA 4EZEA 1UKZA 1X9HA 1MHTA 4BCDA 2G77B 2I6GA 1ZJJA 2CXSA 2VXOA 2FSUA 1ULZA 1JSLA 1TUEA 1U98A 1EX6A 3L6UA 1K08A 3LUHA 3OZDA 5DWVA 2AJDA 2A5GA 1UWLA 3A3NA 3EZNA 2AFIA 3HXKA 3KCNA 4PPGA 4R1NA 2YRXA 2WJHA 1IZYA 4MINA 2B1JA 4NEQA 1ZOOA 3PKJA 1L5ZA 4UBNA 4E4RA 4YONB 2II6A 4RPGA 4F3TA 2XEDA 3HXQA 4TTAA 4ZT2A 1TK3A 3ZI4A 1VC2A 4JNCA 3VKVA 5EXDA 1R5JA 1HYEA 2JI8A 3DV9A 3R4CA 5EKTA 1YKSA 4ZV4A 1QGED 3S1AB 2X6TA 3C87A 4RACA 4RTOA 1TVCA 2DC1A 1WB4A 3GLIA 1Z29A 4HWSA 2CY0A 3KTOA 3TDNA 5LP1A 3I5XA 3M6AA 4HVTA 4RBNA 5I5GA 3LLMA 3PZRA 4PSUA 5CU7A 5AMXA 5T6MA 5EJ8A 4ZAZA 2B8WA 4CWAA 2NACA 4HAUA 4KTTE 3RFTA 1Z63A 3ESBA 1E2QA 1HDXA 1GDTA 2HGSA 3DMHA 2I4IA 1XMIA 4TSFD 3DGEC 2V1UA 4AS1A 2GJ8A 2HSWA 3M2TA 1Z0DA 1W1IA 4N9WA 1IFXA 3BBLA 3IKJA 1YF3A 2AOXA 2WC1A 5GVRA 3MZ0A 1GPAA 1NVTA 2I7XA 1EXDA 4OBEA 2AC4A 1Y4UA 4BATA 2GD0A 3QOFA 3IOEA 4KNWA 5EKXA 1O9HA 1QYXA 1WZIA 2CFCA 1NX6A 3OQ1A 4J16C 4LBVA 3BAFA 5D2CA 3WFJA 4BJHB 2R00A 3IP6A 1XEWX 4DR1B 2I8AA 1SWWA 1M54A 2ZBEA 1XP5A 1OIVA 2NTNA 1KDTA 2ZP1A 4UEOA 3KHUA 3N87A 3SXJA 1DG3A 3TSAA 3QLUC 4HWPA 3GUHA 3V6LA 4C4XA 3ER6A 3QKSA 4QRHA 4B47A 1P72A 1RCTE 3I1JA 3Q9NA 4XUEA 4DMUB 5FWYA 3K70B 3PGLA 1N25A 2VOJA 2H5EA 1M8FA 4NHOA 1YUMA 4GXRA 3KBBA 1NVMB 3NC0C 2VP5A 4ZI7B 4CKWA 1FLVA 1EUDA 5LJLA 3MGBA 1XPUA 2A6PA 3IAUA 2QN6A 4XX0A 3A7DA 4TGLA 3OQ6A 4EB6B 3LYLA 1KVUA 2G36A 5TX7A 2CMKA 1CY2A 5FNVF 2RKWA 3L7DA 4WCVA 3WGMA 2IODA 1D9XA 3FGOA 1Y3HA 4XIIA 4ETIA 3T1HB 5K3AA 1NJ6A 4G0WA 3WK9A 3DQZA 3GLUA 2R6DA 2ZUVA 3KQSA 2EL7A 4RXTA 3DOUA 5EHXA 4L8GA 3NTQA 5ERXA 1Z6QA 5CLHA 4PXYA 1KAQA 2XEXA 1HI9A 3WK7A 2B61A 3PNKA 3QITA 4IDBA 3SR3A 1MLDA 3B7WA 4FMBB 1FW8A 1JEAA 4KRYA 4Y0VA 3WDMA 1T1EA 5IVDA 3GRPA 2IOQA 2C5LA 5FPQA 4PSVA 2ZIUB 3NMUF 1ZSNA 3JATB 5K7SA 3VTFA 3ZEAA 2XDAA 3FPGA 5C7YA 3DW1X 4RJTA 1KI7A 4O1MA 3ZJTA 3GAZA 5FPKA 5JC1A 5JC8A 3MWKA 3L2OB 3WSTA 4DT1A 3PVSA 4YRQA 3W7VA 1DADA 4DIEA 3IEMA 2NP7A 2ACVA 2EL9A 1GAJA 3SYMA 1KDOA 3QXHA 4AJLA 3R3YA 5HVNA 4OLJA 1LB1B 3JWHA 4CXMA 3UJNA 2PZGA 3EA4A 5K3DA 3ROZA 4D9NA 5JMTA 1CUIA 4Z0HO 4MVJD 1HMPA 3BMOA 4L85A 1GITA 1IOZA 1CLEA 3QHPA 5E1OA 5IC5A 1B26A 1YA4A