5BRJA

Structure of the bacteriophytochrome response regulator atbrr
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
140
structure length
140
Chain Sequence
PELRPILLVEDNPRDLELTLTALEKCQLANEVVVARDGTEALDYLNVTGSYHNRPGGDPAVVLLDLKLPKVDGLEVLQTVKGSDHLRHIPVVMLTSSREEQDLVRSYELGVNAFVVKPVEFNQFFKAIQDLGVFWALLNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Two component response regulator
publication title Arm-in-Arm Response Regulator Dimers Promote Intermolecular Signal Transduction.
pubmed doi rcsb
source organism Agrobacterium tumefaciens ccnwgs0286
molecule tags Signaling protein
total genus 45
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2015-05-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5brjA00
2GKGA 4LDZA 1ZHHA 3Q41A 4HYEA 4MQEA 4Z4CA 3H6GA 2OENG 3C3WA 1H9CA 3O1IC 4WUTA 1GCAA 3M6MD 3Q7TA 4MR8A 5DTEA 3TMYA 3QK7A 5DCLA 4WWHA 4ZMSA 4P1ZA 5FBHA 1A0OA 1JF8A 1L5ZA 5TQ0B 1PNTA 5T7BA 1SD5A 3GT7A 5JNRA 3GL9A 1J56A 1W9HA 2FEKA 2OQRA 3I42A 3JS5A 4KNYA 5IUJC 1DZ3A 4NCBA 2PAFA 4RY0A 3I09A 2W42A 2HJ9A 4FE7A 4G0MA 3G85A 4G0YA 5TPZD 3HVRA 5JNWA 4IRXA 3H75A 1PNRA 4MGEA 3IP6A 1ZH2A 4G0OA 1NY5A 1PEAA 3HV2A 3RVJA 3E61A 3KLNA 4YV7A 5B3JC 3QELA 5CNKA 1D1PA 3Q7SA 1E2BA 2IPAB 3OLWA 2VUHB 2PUAA 4EYOA 5TE9A 1TJYA 1AB5A 4LX8A 5JNVA 2NT4A 2L18A 3UKJA 4PYRA 1DCFA 4IMJB 1U2QA 2MYTA 2CHEA 3JY6A 4O5AA 4MS1B 1ZAYA 2FQWA 1D5WA 1Z2EA 4Z4IA 4MS3B 1XWWA 2PL9A 5F64A 4N76A 1NATA 4F11A 4O1IA 1GUDA 1ZN2A 4KRFA 1SXGA 5I4CA 2WY2D 2V0NA 4O1HA 3N6VA 1GLGA 3NHMA 5KC9A 3H5OA 3NNSA 2FW0A 1USKA 3C6QA 2WMYA 1RPJA 2FMHA 5TQ0A 3OLYA 1USIA 1Z26A 4PICA 5IEBA 1VRVA 5TQJA 2FN9A 2L17A 1Z17A 3LFTA 4N0PA 4QYWA 3H1EA 1JWLA 2MSWA 5E3JA 4W5RA 1Z25A 1DC8A 3IP9A 1RZRA 2PUCA 3RVQA 4JB0A 4KPYA 1TMYA 4OTZA 1YVUA 3DGFC 3GBPA 4RKQA 5KQGA 1JHZA 1QO0A 3FDFA 1OXKB 1PUXA 2WB4A 4WXEA 3KTOA 3ROFA 3KCNA 1DBWA 4W5TA 1BA2A 2FXIA 2M1ZA 4JP1A 3CNBA 2YHAA 2FMIA 3CKMA 1Y1LA 1DCKA 5TQ2B 1YMVA 1W25A 1MIHA 5CHYA 2DRIA 3TX6A 1MB3A 1PEYA 3LUHA 1D1QA 1VKRA 4F06A 4E7OA 2AYZA 2CHFA 2IPLA 4F12A 5HM6A 3ILHA 2FMFA 3N53A 3QLUC 9ABPA 3HK2A 3RVKA 4RKRA 4MS1A 3LKVA 1KGSA 2B4AA 4IILA 3H5VA 3EQ2A 4MS3A 4RXMA 1APBA 2NT3A 1DC7A 4DN6A 4OG2A 3DLHA 2Q5CA 4G0PA 1JFTA 1ABEA 3IP5A 3FGZA 2E4YA 1TLFA 1DBQA 4H3KB 6ABPA 3F73A 3O2SB 1C4WA 4MRMB 4W5NA 3C97A 3D8UA 3Q15C 3H5TA 1KRXA 2A9PA 1Z18A 3JPWA 3RH0A 4EVRA 4LE1A 4KK4A 5FWXB 4LE2A 3H1GA 4WT7A 4N0QA 4JASB 3QLVA 4N41A 1M2EA 1ZH4A 2BGGA 1JFVA 4HNSA 1WETA 3N75A 2HSGA 3HDVA 3OM1A 4IMIB 4RK5A 3HDGA 4RZSA 4YWHA 2PUFA 3MYYA 3OM0A 4EYQA 3C3KA 1ISRA 3O21A 1ZITA 3L49A 3NHZA 4PEVA 3TB6A 3O1HB 1XHFA 3HM9A 1RZRD 1FFWA 2VK2A 4EGSA 1DG9A 2PUBA 2RGYA 2FEWB 3KYJB 5TQ2A 1QO0D 1U8TA 4S05A 1RXIA 2E4ZA 2JB9A 3IPCA 3QLTA 4EY3A 4ML3A 1JDNA 5HSGA 4MR9B 3CS3A 2GWRA 3BREA 4G86A 2GX6A 1SRRA 1CEYA 2FSPA 2FQYA 2FN8A 2IPMA 2MYUA 2A9RA 3KKEA 1A2OA 1Z2DA 3EGCA 3OLVA 4G0XA 5D2CA 4KZKA 2PJUA 5CNMA 1NXPA 1C0EA 3O2QB 2RDMA 1KRWA 3MM4A 4RY8A 3T38A 1QQAA 5T3YA 5BRJA 1VPWA 3MA0A 4D6YA 4MRMA 4N47A 2JCGA 2WRZA 5B3JA 5FWYB 1DRJA 5EWJB 4Q6WA 5DKFA 3OO0A 3HXMA 1SXHA 1ZVVA 2FKAA 5FWXA 3LTEA 1EWVA 1YIOA 1Z12A 3RVSA 2HPHA 4EUKA 3FFTA 5EWLB 1LBHA 1U0SY 4ZPJA 2MYNA 3IP7A 4YGXB 3KS9A 4TLMB 4KQCA 3EULA 1SXIA 4EYGA 1DRKA 2FVYA 4JOQA 4UHJA 3ILYA 3LUGA 2M98A 1M5UA 2PE5A 1USGA 1XHEA 4RDCA 4RK1A 4OLBA 5BQ3A 2IPNA 4RK6A 4YLEA 1ZESA 1JYEA 5HQJA 2P4UA 1GCGA 4D6XA 2X7XA 1BDJA 1R8JA 1P6UA 1AB6A 2FLWA 1ZDMA 1L5YA 1A04A 5JS2A 3EDCA 1EAYA 2FEPA 1LJLA 4MR9A 3RQIA 4HNQA 1ZGZA 2QR3A 4DQDA 3IPAA 1QKKA 3EQZA 4YRZA 2R48A 3DZDA 3LUDA 2NUBA 3L6UA 2VYCA 1NXOA 3QX8A 4MYRA 5TPWB 1RXEA 3T8YA 4MPTA 1P2FA 4UHKA 2QVCA 1JL3A 3OLZA 3A3KA 3DGEC 6CHYA 1DJMA 1ISSA 4RXTA 2E4UA 1QMPA 4MR7B 1Z13A 5DGCA 3LUKA 2MSKA 1M2FA 5FWYA 5IX8A 5EWJA 3OQNA 3VNAA 1I3CA 3LMKA 3NNDA 4MAAA 3O75A 3KHTA 4KK3A 3W9SA 4H60A 5IBQA 1QP0A 4RY9A 2FLKA 2CWDA 3FFXA 5CNIA 2RJNA 3GA5A 4W5QA 1TM2A 4MQFB 3N0WA 1EWTA 4FE4A 3CHYA 3OLXA 3GWGA 1YK0A 2AYXA 5KQPA 3QLUA 4QICA 4Z9BA 3JTEA 4XASA 3HCWA 4Q7EA 3TO5A 2WJAA 1D2AA 4ZYLA 3CG4A 1NXWA 4HNRA 3DLBA 3Q9SA 2O20A 3BILA 4JA2A 1M5TA 3OO1A 3QX9A 1BVHA 4XARA 4EYKA 3GBVA 2GBPA 3JVDA 4RK0A 3SM9A 3IDOA 3F7NA 4GPAA 3MMNA 3HS3A 1P8AA 4KVFA 4NCAA 3RVMA 3F6PA 3M9XA 5JNTA 4D74A 4KMRA 4Z4GA 3RVRA 2PUEA 5C5CA 3CFYA 3I45A 1D4ZA 1JDPA 3LUFA 4MS4B 2ID9A 4XLTA 3UK0A 2MSLA 4Z4HA 5IUNC 2NZVG 1HEYA 4Z0NA 1YMUA 2QU7A 2QZJA 1JFSA 5TPWA 3G1WA 4Y9TA 3LKBA 2LP4Y 4W5OA 1FSPA 2VUIB 3BBLA 3JVIA 3QEMB 4TN5A 2CD7A 3TD9A 2ID7A 3HSYA 2FMKA 2PUDA 4ETMA 1YS6A 1FFSA 3D02A 1JLKA 4MR7A 5PNTA 3F6CA 1B00A 1K68A 3GRCA 2QV0A 2XDYA 1KMIY 1T34A 4PZ0A 1LJUA 2QSJA 5BRAA 3FMVA 4NV3A 1MB0A 3O74A 4RK7A 1E6LA 4XAQA 1U2PA 5GOTA 5IEJA 3M9WA 3EAFA 3C3MA 4PE5B 3CZCA 4ETNA 5ED4A 4H3HB 2IDMA 4MQFA 4ETIA 4EVSA 4KV7A 4L85A 4G0QA 1EWKA 3OMXA 1FFGA 2WJWA 3RVLA 3EODA 2E4WA 3K9CA 2A9QA 4DADA 4KFCA 2TMYA 3Q7RA 3RVPA 1QP4A 1BDIA 2JRLA 1OXBB 1QP7A 1E6MA 1DCMA 3A10A 4RS3A 2H0AA 2LBPA 3SAJA 5KQLA 1YK1A 2B1JA 4LRQA 2IYNA 1IIBA 2J48A 5KC8A 5IC5A 5KQMA 3HJFA 3SQNA 2R47A 4G0ZA 1JH9A 2I6FA 3N0RA 2F8SA 3H5IA 1TVMA 3CTPA 4RK4A 1NXVA 2ZWMA 4YO7A 1K66A 2KYRA 1EHCA 4RXUA 3T6KA 4CBVA 4MLDA 2FTKE 2L19A 3O1JC 4MS4A 4IGAA 2JBAB 2LUOA 3MQ4A 1NXTA 3MF4A 2RJOA 4G97A 4LE0A 3H5WA 2QW1A 3K4HA 3QEMA 2E4XA 4KQ9A 4L4UA 8ABPA 4LDAA 4EVQA 1ZGGA 4NICA 3OQOA 3CLKA 1GUBA 2NZUG 2PLNA 3OQMA 4RV5A 2HQRA 1BDHA 3NBMA 5CNJA 1Z16A 5IUKC 1QQBA 3BRSA 3A0UA 2L2QA 3LUJA 3H6HA 1CHNA 4M88A 2QVGA 2QXYA 5ABPA 4OLAA 4Q6BA 3EJWA 1NTRA 3NNNA 3URMA 1LK0A 5IULC 4F3TA 2LIVA 1MVOA 2P9HA 1ZY2A 3T95A 2PMCA 4F8JA 4IF4A 3RVOA 3LUCA 3SY8A 4FB4A 2E4VA 1YTUA 1UDRA 1RNLA 2FQXA 3BRQA 1CYEA 3I5AA 5JS1A 3JPYA 5EWMB 1F4VA 2JVKA 4XXHA 1F51E 3S99A 1BAPA 3KG2A 4WXMA 4S04A 3H5LA 3MIZA 3OMWA 3P9YA 2MYPA 3E3MA 5HKOA 4P98A 1QPZA 4Z9AA 4N03A 4XFKA 4NQRA 3KLOA 2R25B 4TLLB 1DBPA 3HUTA 1JX6A 4MQEB 1NXXA 2HQBA 4TMYA 4YP9A 4ZJPA 3QEKA 2PL1A 3UUGA 2LPMA 4MR8B 3HEBA 3SNKA 1ABFA 5EWLA 7ABPA 2IOYA 1URPA 1P6QA 2GI4A 2JK1A 3N8IA 2PUGA 1NXSA 1Z15A 2JBAA 2ZAYA 4OBBA 3R0JA 5TPZA 4ZMRA 3A0RB 2F8TA 1QNLA 3B2NA 4WZZA 2JVJA 1MAVA 4JAVC 3SG0A 4MLCA 3HO1A 5KWSA 1EFAA 5KI6A 3ROTA 5BR1A 3LOPA 3CG0A 3N0XA 4GNRA 1JYFA 1PHRA 3CRNA 4YCSA 3DBIA 3CZ5A 2YHBA 4JB2A 4RSMA 4B09A 5JNSA 3KJXA 4QPJC 4Z99A 5GQSA 3KSMA 3LUAA 4Z4FA 3VNBA 1S8NA 1LBIA 4YS6A 2R4QA 3HUUA 3HZHA 4E7PA 5DLEA 1FQWA 1YS7A 1U04A 3CU5A 2JVIA 3QELB 5FBKA 3GV0A 1E6KA 2A9OA 4QYMA 4YR7A 5JNUA 2WWVD 5EWMA 2PKXA 1JBEA 3O2JA 4KREA 4LZLA 4OATA 3KYIB 2HQOA 4RWEA 2H3HA 5C5EA 4RU1A 3GYBA 3QLVC 1DP4A 3FFWA 4Z4EA 1VLZA 2IKSA 3RVNA 3H1FA 2N9UA
chains in the Genus database with same CATH superfamily
3KKOA 1ZHHA 3RVDA 2C7QA 3AEXA 3MWDA 3SLKA 1CUWA 2PGNA 2EP5A 3C1TA 3CZQA 2ERYA 3ZQJA 4F2DA 2M2IA 1YQTA 4FS3A 4L8FA 3K53A 4FYXA 4I1VA 3K92A 4OHMA 1HR0B 1V16A 1X3LA 3K94A 4OIMA 3RT9A 3TIFA 2M6KA 1SVMA 3KUCA 5BYJA 3AOEA 1E5DA 2GXSA 4DLUA 4RZQA 1ZM4A 1FP1D 1G60A 4JLSA 3JAWA 4LSWA 4OQEA 3EPKA 1IAQA 4P35A 3TPFA 4U5XA 1I3OA 4IVQA 5E7JA 3G0IA 4G41A 2EZ4A 5IPFA 4J9VA 1PAUA 1ZW1A 4YJ3F 3ER8A 5FEUA 5BMOA 1T5HX 3CUSA 3B52X 2J3JA 3DFIA 4M21A 3N74A 1B0AA 3GR6A 3K5WA 1G3RA 3VAAA 4Q9NA 3E8SA 1FVFA 1W7AA 1X9IA 2PRYA 4RBNA 5BR1A 3BIFA 1JE1A 5DWQA 5HR5A 1LSOA 3RYHB 4WK0B 5B3JC 4XM2A 4PLFA 1TM3E 2O3SA 2JAWA 4X8MA 1CJUC 5EQFA 3PTAA 1RHJA 4J1NA 1JJAA 1QONA 4WOBA 1MP0A 1SVOA 3HWSA 4KX5A 2RHLA 4Q4AB 4ZOCA 2BW0A 2C4NA 1UP4A 3C3AA 4MRRA 1O8BA 4D3FA 4URXR 3RUPA 3OPNA 7MHTA 1UP7A 3MXTA 1F7UA 4R1QA 2BBWA 1WUTA 2GPJA 2PBLA 1SC1A 5F12A 5ULLA 4AAYA 1XEFA 2X6QA 3DL0A 2WJYA 4CJXA 4NU6A 5BVGA 2FOIA 1QK5A 2N0SA 2OHFA 4Q4HB 1KH2A 4FCCA 1WU8A 1I4EB 5D01A 5EVCA 4EB8A 3UMJA 5KBYA 4OAPA 1E79A 1RM0A 2IX9A 1FFEA 1JDSA 2G0NA 1Z2CA 1GLGA 2RHWA 3MELA 3PJRA 3X1KA 3H5OA 3RFVA 2YWDA 1QTIA 2BP7B 3EFOB 4HQ6A 4MUHA 5CT6A 2XJ4A 3DXFA 1CIVA 2A2ZA 1JHDA 2BMAA 4JGIA 3NTVA 3H18A 1ZIOA 1MC8A 4B3SB 3K2IA 1Z0JA 5AM4A 2OM2A 3B6IA 3EEQA 4EH1A 3AR9A 1NFRA 2JBWA 2O1XA 2NSDA 4FONA 4OAQA 4RTLA 5C8YB 2XUZA 1NI5A 4NH0A 1A77A 1F06A 4MUNA 3DGFC 3VTFA 3W6PA 3CC8A 1FXWF 3E6AA 1SZJG 2F3RA 1HLDA 1TT5B 1B14A 2VP4A 1CEXA 1I0LA 3QA9A 2AOUA 3WQHA 3C4QA 1KR2A 2VRNA 3CZ4A 2DBQA 3QFSA 4NE9A 1ENOA 3MCUA 5EMNA 4W5TA 2PN1A 1JKXA 3CNBA 3ECSA 4IGIA 4E22A 4XE5A 1V71A 3IXMA 2WF6A 1R4MB 2DQ4A 1Y4AE 4KFCA 1QFJA 2RHGB 3CVJA 4FYJA 1N5DA 4KQHA 2H1LA 4LXIA 1MHPA 1F12A 2FUCA 1QYVA 2Q99A 1RP1A 2HC9A 2A0KA 4Y30A 4NULA 1L5VA 1XP8A 3GFRA 4R2IA 4DZRA 4N82A 1BC5A 3SKXA 1ORTA 2CNOA 2I7CA 1W5SA 3E58A 5C8YF 4XX0B 5JFGA 1CUHA 2ECFA 3IVMA 4WA7A 1VXRA 4K86A 3GLGA 4RFSA 4DR2B 2DULA 3BX1A 4GMXA 1EX7A 3KZCA 4WSOA 1NQTA 5EA2A 2WVAA 4S1WA 3W5CA 3ZD6A 4OG2A 1QHSA 1D2RA 1XN4A 3HGQA 4WASA 3VNQA 2X5JO 3WB2A 4BMVA 4V0ME 2G0AA 4ND5A 2A58A 1AQUA 2ORYA 3MRSA 4IICA 4FB5A 1DBQA 2CL5A 2ZWPA 3L7JA 5CCXA 4EKIA 1E3SA 2QRZA 3EUEA 3O1LA 3QUSA 3T9FA 3D8NA 3DHEA 1QHNA 2JFOA 2W6IA 2QM8A 1EQ2A 4NOKA 2OILA 3QFCA 3QOYA 4UE3S 5FHQA 2O5EA 2WUGA 1NASA 1TO2E 2QM3A 1Q22A 1VFNA 3H1GA 4HOYA 3HO6A 4EMTA 4DR5B 4ZQHA 5KTTA 3GROA 2RI6A 2ZUCA 3M49A 5CBPA 4Q24A 2L69A 1W0CA 3DCYA 1XJ5A 3QLVA 4FS8A 4YT2A 3THYA 1CNFA 3L7YA 1A96A 2B61A 1F48A 1CS0A 4Q34A 3OY2A 4TTAA 2G5PA 4TL6A 2XT0A 4PBTA 4WZAA 2J7KA 1KHHA 2WU0A 5CYGA 3BQNB 4E5PA 1M73E 5BSKA 3RC8A 2Y71A 5J40A 3TYXA 3IQFA 4DRYA 2R84A 4R0NA 4UDXX 2I2DA 3SYKA 3WYCA 1U9YA 4BLUA 4EABA 1BGVA 3CF6R 3WMRA 3I53A 2Y76A 4MGIR 4PGFA 3C5WP 4R68A 4TXHA 2PUBA 1B0PA 1IHUA 1MC5A 1A4RA 3UFBA 3LGSA 2C7RA 5FUMA 1QF9A 5U4XA 3X1YA 3UGJA 2VF4X 3VHLB 5GINE 3IT1A 4NZPA 2I2BA 3QZUA 2ZUTA 5BMVA 1KOGA 1E2QA 3FB4A 3CY6A 5MHTA 1GPMA 4KE6A 4RH3A 4IQ4A 4IZ6A 1JLLB 1T9DA 2BBTA 1NBHA 2EW2A 2A88A 3HNRA 4PNHA 3TW8A 4EKEA 2VTDA 4OB7A 1GUZA 5JRJA 1IHYA 1ZUWA 1DXOA 4IO1A 3S2SA 5LB2A 4KIJA 4RQAA 3ZDZB 1R3DA 2BUBA 2VH1A 3GN1A 3LCMA 4Q1VA 4RV4A 3V1YA 3W3ZB 3PDCA 2ZPAA 2PJUA 3IQGX 5LDHA 2PKRA 4CKCB 3DUFB 5D1NA 5M7EA 4PCVA 2BR3A 2YS6A 3B8HA 3RNLA 1BHSA 3DSRA 2JF0A 3RSGA 4GSKA 4O4HA 1FX0A 1M6VB 4OU5A 1DDOA 1TPYA 2I7VA 5FWYB 3K9GA 5IAKA 4BLSA 4UTZA 4HKTA 1MKYA 2Q1WA 3HMKA 4AS2A 1MB2A 2CMDA 1ZI8A 3FSJX 5I01A 2H2AA 3DE0X 1MA3A 3HDTA 4B4DA 3NWJA 4XM1A 4FKZA 1ADBA 3S0JA 3VJKA 2X13A 4NTZA 4O2AA 3AILA 4P7GA 1NSFA 3CO0S 1EZ1A 1H8EA 4QG7A 3NRBA 5DNVA 2AMJA 2EFDB 4ZVNA 2J08A 5BQ3A 3E18A 3WNZA 4GKKB 1UFQA 4RKEA 1ONBA 2OKCA 2B2CA 4ICIA 5BOVA 4DDUA 1IMJA 2V6MA 3DYIA 1ZWLA 3RE1A 2NADA 4YRAA 1AB6A 2PKQP 4LY0A 5DBFA 4KPFC 4A8JC 1RQGA 4FGZA 3AERA 4IJMA 2H85A 3AV3A 1OIVA 1F4LA 3RQIA 3JVEA 2Q1TA 4UU8A 3ZI0A 2QNRA 2YMLA 4LGYA 4GI5A 1ST2A 4BLOA 2YWEA 1FPQA 2OHOA 2SBTA 3NV9A 1MC4A 1V2GA 1GYQA 1ZEJA 1XRJA 1G0NA 2XVXA 1Z6GA 2DPMA 3M6WA 1H5QA 3W5UA 3RUFA 1Y6GA 1RXEA 2JD2A 4IXNA 1XLTC 3KQOA 2GJ8A 3KOOA 5E0OA 2NUPA 3T4EA 4F4FA 2M32A 3P97A 3MS4A 1AY0A 1Q0UA 2C0QA 3OEHA 2CWWA 4UCWA 3N2ZB 3IMKA 4UEWA 5DNEA 4MLPA 3TLKA 3TRDA 4AWXA 3MOGA 1OFUA 2GGSA 4J1TA 1M34E 1UZMA 4MR7B 1CEEA 3PKZA 4B6EA 3WGIA 2JL1A 5I7FA 4F1KA 4N5DA 2BE9A 3NNDA 1JTVA 3MAJA 1EK1A 1FUIA 1GXSA 3FDZB 1Y9EA 3OZIA 2I03A 2WJ6A 1CU1A 4KK3A 3U37A 3FNBA 3FBTA 4MTCA 3FFXA 3ASYA 4FUTA 1Y8QA 1RYYA 1SKBA 2IX3A 5KB3A 2QWXA 2R44A 3TL2A 5AHWA 5C53B 2ET6A 3HE3A 4JYPA 1RRFA 2LWIA 3K70D 2WSBA 3NBQA 3ZN2A 1L5OA 3RTEA 4RIIA 1IY2A 1US8A 2FPWA 1KAGA 3G0CA 4Y2PA 5AK6A 1KP3A 1BJKA 3TJZA 4DWOA 1H1LB 2OC4A 2QUIA 3KJFA 5EIBC 4OGWA 2D5LA 3K5HA 4OXYA 4UBMA 4XARA 5EJGA 2CXQA 3ROKA 2CHUA 5AM3A 3L5KA 4JJGA 1ZK0A 2O2HA 3QE0A 1TUBA 1DPGA 2F8LA 1S8OA 3EXHC 3UBTA 2WHPB 3E5HA 3H9EO 3HN2A 3NEJA 4QUJA 4C0BA 1N7JA 5E2IA 4NCJA 1WPRA 4NCXA 1GSOA 3WKCA 3NT5A 5IVHA 2PUEA 3C24A 5KQRA 3A4LA 3AF4A 1D4ZA 1PWZA 2PMKA 5F7OA 5ALXA 5DTRA 1LX7A 3A9VA 1MRSA 3FOCA 3LQKA 1U8FO 2VDKB 3UUEA 1CUJA 3F97A 3RD5A 4BQNA 5AFSA 4DLTA 1FFXA 1LQTA 3WLSA 1AXGA 4NZMA 1NV9A 4HNHA 1VYHA 3EGVA 4JOSA 1G3IA 3HJAA 3DHVA 1DKLA 1K8XB 1FCJA 4U3JA 5JV5A 3ESXA 3PQ8A 2HIGA 3H2GA 2B20A 1JLKA 1MFZA 2BFCA 3FOZA 2H1IA 3CVWA 3U40A 3RSFA 2BFNA 2HRRA 2QV0A 4GIBA 1XMVA 1T34A 1CJVC 3NZEA 4TX1A 4D99A 5IMSA 4YCCA 4ZXPA 4RCYA 3GLFE 4YV2A 3WSWA 4UOQA 3RIEA 4A8JB 3OPYB 4WNAA 3IP8A 2YDYA 2PGAA 3OSUA 4GM4A 2JJMA 4FJ0A 3FPKA 4AMYA 2NVOA 2JEYA 3LC1O 4KQMA 3T9DA 5I7SA 3GLIB 2JJ8A 4HF7A 4I9GA 3U4CA 1RC1A 1I6KA 1QVZA 3H9JA 3KRTA 4LJ5A 1I7PA 3ET4A 3M5CA 1BXZA 3NASA 2V98A 3JYHA 1U65A 4LXYA 5IVDA 4J07A 4LYFA 4EUFA 5CG2A 4PHCA 5K8CA 4G81A 5BWBA 2VWPA 5THXA 2QTVB 2WIKA 4G4SP 1KWGA 4BNHA 1V5EA 4MA4A 3PEUA 4G24A 1NPYA 3N1UA 1KH3A 2IZ5A 5JSFA 1KIFA 3DF9A 1SG9A 5AVVA 3IP1A 4PLHA 4ZOEA 1JKJB 3NYRA 3HY4A 5HGJA 4EVIA 2HHLA 2VHYA 1L5SA 2WWHA 3OU2A 5CH5A 1X8KA 2DHCA 4YDRA 1LLUA 4ZODA 4RA9B 5DHRA 4DCTA 4DJDC 5AXAA 1R8QA 1R0CA 2P6OA 4M1OA 4Q7KA 4FPXA 3KQMA 3BFPA 1KOLA 4W5JA 1E1RD 1UXHA 2E1PA 4MDFA 1LQ2A 4RIEA 1PL8A 1YVDA 4FX5A 5F3DA 1SQSA 5IK2A 3WZLA 1EE1A 2GBGA 3I62A 2ZYSA 1QP7A 3A9WA 5JPCA 3MJVA 3VXKA 2YINC 4KX3A 2JIZD 4H9GA 3GLVA 1C1HA 1B8VA 1QDLB 2JGRA 2PLNA 5K4HA 2I66A 3OQMA 1R0YA 1MG5A 1WZEA 2R3SA 1YO6A 4URUR 1DAIA 3TS1A 3WK9A 2C7OA 4Q3NA 2WJVA 4TMZA 1UJNA 2RGNA 3N05A 4YCBA 3AXSA 3UWOA 1LW7A 4WY5A 2HD4A 4U9HS 1QRTA 4V03A 2NUAB 1X7YB 1ZOIA 4UUMA 5IXYA 1I5OA 3EXHB 5EMJA 1U0BB 3FOAA 3HY3A 5EYPB 2XZTA 4R01A 5ARDA 4Z6KA 4HH1A 2JFGA 1NA5A 2IZ6A 1ODLA 2GNPA 3F9IA 5BW8A 1KI2A 1FTGA 2CV0A 4WN3A 3TQTA 4JVLA 1KY5A 1N78A 4Q9IA 1S4MA 1NKVA 5A9SB 1PZFA 3OOJA 3Q5GA 3R3WA 1D4AA 2YC2C 5EZSA 4EDHA 2F8MA 2OCGA 4BMSA 1Y34E 5IXJA 4K81B 3OIYA 1FW6A 4OSOA 3DO5A 4S12A 3OZTA 1CQIA 5M29A 1NZJA 5FUVA 2EJBA 2C3UA 1R5JA 3DBRA 2RHCA 5HOEA 1WF3A 1R4ZA 3DF7A 3MTJA 4IS2A 5I7RA 5PGMA 3UUGA 4HRAA 3F5DA 3OY7A 4KFRA 4MR8B 2FPMA 5F35A 3R9IA 1JQEA 2IOYA 2YZGA 2Q4EA 3FRHA 2GI4A 3IOEA 2JK1A 4OYRA 3BWMA 4M2LA 4PG5A 1TIPA 4BGIA 4TS9A 4BUJA 2JVJA 1RLMA 4C1NA 3G02A 2UYHA 3R5SA 4MLCA 2IHTA 3N0TA 4ZC8A 2CJFA 2HI0A 1TYZA 2KB0A 2O4UX 3BCHA 3FR7A 1YV9A 1GYPA 1N6OA 3MW8A 1MO4A 4G07A 1H8HD 4GNRA 5K3FB 3S2UA 1WXEA 2E6UX 5FXMA 4CR8A 4EKYA 1X1BA 2I2AA 2X4LA 3PIIA 4ZAFA 3K9FC 2FPLA 1VL2A 2P6UA 3KJXA 3N8HA 5DM2A 4KN8A 3PPIA 4REQB 3WMWA 3TLXA 4F97A 1ZK2A 2RAPA 1LPMA 2PZFA 1L4YA 3P0HA 4LYYA 4MZDA 5DE3A 2MR6A 2XQKA 1SR8A 4HY3A 4MUJA 4KWIA 4BRZA 5LYJB 2DFDA 4K9KA 1IG0A 2X6RA 1SUCA 4B73A 4B2PA 4DT1B 3P20A 2V7WA 4G3XA 1XDDA 4PYKA 4IIEA 2QVYX 2R6JA 5BV1A 1OGJA 3CT6A 1NYTA 2DFNA 2NVUB 3ZVMA 4Q12A 1YOVA 4P4SA 1MJNA 4JI2B 4J6EA 3HKBA 4L4RA 4OATA 3K0AB 3N2KB 4QRIA 4D56A 3K71B 2OCKA 2IP2A 1ORWA 2IZ0A 1EK2A 2G1JA 3FFWA 1VLZA 3WLLA 4AP6A 5KHLB 3QFHA 3BJIC 3RVNA 1XMOB 3M83A 2HSZA 2XADA 2Y1KA 3PF8A 5KNDA 2D2IA 4KR7A 4QZVA 1VHDA 4DDWA 3C3JA 4YJFA 3HTXA 4QFMA 2AZ4A 4EPXA 4DDTA 1JT2A 4J03A 5DP2A 3IYLW 3EOBI 4WY2A 3QVGB 3F7OA 3TMYA 1ECPA 4XB6B 4XWAA 2JIDA 5LYJF 1P91A 1W581 2I2CA 3EVEA 1STOA 5JCJA 1F9EA 1RQLA 1JF8A 4G9BA 3GO4A 1ZMBA 3EE6A 1COWA 1W59A 2PMBA 5HF5A 4A6PA 4R1MA 1PZNA 1ZKDA 2WABA 4YRRA 4DXHA 3QBTA 2FSVC 2TECE 4LRTB 2FRVA 3A6EA 3OFNA 3EZNA 4LCBA 1Q95A 5EKUA 2UUOA 3KC2A 4FXPA 1SCUB 3BMOA 1T2VA 2X2EA 1G4HA 5JATA 4IRXA 1NUUA 4L0CA 5FPPA 5D7NA 4PBSA 1ML3A 5AD1A 1U0RA 1NY5A 3HZRA 4KXWA 1GZDA 2EWMA 5AI6A 4OHYA 4IKOA 3ZTYA 2F7SA 4I2NA 1WBBA 4XGIA 4DCVA 1SQ0A 1QGYA 1QHIA 2GCPA 3FYUA 3ZVRA 3CRZA 3CVUA 4O6VA 3RIXA 4RKFA 1AC5A 3KPVA 1WM1A 4QPZA 5BWCA 3LH5A 3OJWA 4JS0A 2DX7A 1JQAA 2BR4A 4HYTA 1RAEA 1KFCB 1W5AA 1ZU5A 2QJOA 3E9EA 4FYHA 4CKZA 2R8YA 2EFHB 2ZP1A 4CM4B 5L4LA 1RXYA 4WCVA 2AX3A 3SIWA 2D4HA 1YB5A 3ZJVA 3JY6A 4NQZA 3WAGA 3N8GA 4O5AA 3P2YA 13PKA 1J22A 2FMUA 3BVPA 1J8DA 1BMQA 2DFTA 1FMCA 3IT3A 4MS3B 4WXHA 1NATA 1P5FA 4MWTA 4BX2A 2VQEB 3TEMA 4RD2A 2P6MA 4F11A 4F5ZA 1PZEA 4XB2A 3V42A 1NR1A 2A59A 3F90A 4HDRA 3B5EA 3F6RA 4X1IB 3RS7A 1BEZA 4KAJA 1EH5A 4OREX 4ZGGA 4BKUA 3NP9A 3C6QA 4C14A 3I23A 1SUWA 3ZNNA 3G1UA 4PICA 4KQIA 2XCTB 1GN8A 2VAMA 1NI4B 4L8WB 1CPYA 3R8FA 1YZVA 4QYWA 5BV2P 1JWLA 4M9QA 3VOSA 2MSWA 1XPUA 4DLZA 1SQ5A 4C7OB 4QYIA 1K3UB 1UDAA 3PKIA 3RVQA 5DNWA 3T4XA 5DASA 1LUAA 3WGKA 2GHIA 4EA7A 1ZCZA 3MJEA 3U7EB 3AGPA 4QE3A 2D13A 3K30A 2XODA 1SC3A 4K1XA 5HF6A 1IK4A 2W93A 2XI4A 2KMLA 3U3XA 1YGYA 4W6ZA 3DV9A 3L2OB 4O0MA 1CUFA 2VSOA 3R09A 1MEOA 1LEHA 1JW9B 1PLJA 2C3PA 3L0ZA 2JD0A 5B1IA 1XNQB 3CKMA 1AGYA 1LTQA 1KZGB 2VZ0A 4N5NA 5FV4A 1K4YA 2ZR7A 1KEZA 2OHIA 1K92A 1KVUA 1IUPA 4UNIA 5CT9A 4WK6A 1KDZA 3RDPA 1XRPA 1QO9A 4OI2A 2PQ6A 2JS7A 2VATA 2NTVA 2VN8A 3EDOA 4ASUA 4KNWA 5JY6A 2ZUFA 3LCCA 5KSYA 2V5UA 2Z1MA 3W9BA 4URWR 5JXWA 2G25A 3UJCA 1JAYA 5I5EA 3K9WA 4KUEA 5FR2A 1P29A 1C3OB 3G5TA 2P6PA 1JLRA 1W4BA 1E9AA 1W19A 3GMTA 1EZZA 3PE6A 4RFVA 4XSGA 2IUYA 2Q0QA 1L5MA 2PX3A 2Q4DA 4MMXB 4B6OA 1ABEA 3QM1A 3U56A 1U3TA 3I73A 4UASA 2QORA 3TL3A 3M33A 4Z1MD 3G0OA 2MCFA 3I05A 5AW9A 3W9YA 3PXUA 4DSTA 4WRRA 1Y63A 2X0JA 5B6JA 4NS1A 4TPKA 2AB0A 1N3IA 4DQ0A 1H3EA 2Y1GA 1EX9A 2V6GA 3OHSX 3PDJA 4FIDA 4M6WB 2RGXA 5JAHA 1KTIA 3ZDCA 2GAJA 3VR4D 2A9FA 4QEDA 4WNIA 4M8KA 5CA1A 5I7WA 1FL9A 4Y8VA 2O2EA 2PUTA 2QN1A 3T41A 5JBNA 5M2QA 3EPRA 3PD1A 3T0FA 4FHDA 3B48A 1NQXA 1AXRA 2I2FA 1QHEA 2PUFA 3FMFA 1H6BA 1T1RA 1WZNA 2BFDA 1JIJA 2VNKA 1RBMA 3CNLA 3Q12A 4I1RA 4LOKA 5CMLA 1BN7A 5FPSA 1B42A 1OXVA 1M9NA 1QHGA 1ZITA 2DFVA 3A6DA 3CLSD 3DOFA 3O1HB 3PUJA 4BV9A 5HRAA 3VO8A 2HQSA 4DYDA 2EXXA 3X1MA 3PQFA 4EUHA 1A7UA 1NW4A 5KX5A 5E9QA 3Q4GA 5CXQA 3KYCA 3KL2A 2KSQA 3KZKA 2PRJA 3AFMA 2XXAB 1UMBB 2RGRA 3A6HA 3SR0A 1GRRA 1YI1A 1ZLYA 3L1UA 4JJ4A 1Q7TA 4KI0A 3B9QA 4IP0A 4W1RA 1UMDB 4H18A 1UJBA 3D6VA 5BUCA 4AJ1A 2AJBA 3DEZA 3DVAB 5H4GA 3N76A 3SC2B 1V5FA 2COUA 4GLJA 4CM1A 3MCVA 1O4WA 3TOZA 3N87A 2A9RA 1PW7A 4US1R 4YI5A 1GR1A 5LJLA 4EPYA 2PQ0A 2YUIA 3THWA 4GMKA 3IULA 5ETJA 3QVKA 3VUEA 4G6ZA 4BFYA 1NX6A 4L4XA 1ULAA 4DPMA 1NXPA 4QUKA 4FW8A 3DV0B 1MCZA 3PDIA 4Q02A 4E14A 1QB7A 2HHCA 4MPDA 3P7MA 5TMEA 1C2TA 5JS6A 5DKFA 2JGAA 3AONB 3TQHA 4ZCQA 2C2YA 4H35A 1OZHA 2FX2A 3HA3A 3GJ4A 1WULS 4G25A 4MDYA 4EB6B 3ORSA 3UT0A 2IGBA 1E3MA 1HMYA 2VJBA 1TCCA 1U28C 2VOJA 2WUEA 5JVDA 1E1LA 1D3AA 1W73A 5EWLB 1IBMB 2D1SA 5CCDA 1DLIA 1V1RA 4BATA 4U7PB 2YXLA 3TZKA 4U9IS 5EZYA 2FZWA 2UUPA 4QOHA 2DKOA 5FEMA 4LZWA 4B6GA 2VFAA 4PW0A 3D6NB 5BN4A 4CIXA 4E2ZA 1M8JA 1XWIA 4M1QA 1MVLA 4GX0A 1MNAA 5CGQB 3HCOA 5JSHA 5TJ9A 2JA1A 2HCJB 4YRGA 3D5QA 2XJ9A 3GDOA 3IEIA 3JV7A 4L16A 5J4HA 2HYDA 4M9XA 3O73A 2C7GA 3AI7A 3NVAA 4D9BA 5I3CA 4C5AA 1FYDA 1I2AA 4WGFA 1GZUA 4JC5A 5EE0A 3UWKA 4OPMA 4BAGA 2IBSA 1GAXA 2C4UA 4J2TA 5E95A 5K8JB 1QH8A 2A5DA 1DFIA 1EUZA 1Y8AA 3DZDA 4QOFA 4ZHQA 1E4OA 1BKDR 5KAPA 2ZB3A 2P4QA 1N2CA 3UAWA 1NVFA 4BIIA 1V25A 1NBWB 2Y1OA 2X86A 4MW6A 1X3SA 4WLVA 3AG5A 2E4UA 3QU7A 1QIHA 2AOTB 4BQIA 3LFHA 4E4RA 1NT4A 4F9TA 3A4YA 2FV8A 4ARUA 4BKPA 4YMGA 2QD5A 1P2VA 3FUUA 3LUKA 5JC1A 5KTSA 1XCPA 1QAMA 1ZM3A 2G7ZA 3W4IA 3OQNA 4AJNA 2IS2A 2H9AA 4U7HA 1L7RA 2FFAA 4C7KA 1GU7A 2BGLA 3EG9A 5DWDA 1GO2A 1OJLA 2LE0A 1Y3CE 2IYVA 5JZ9A 1ZYUA 3UJBA 3GMDA 4DJTA 2BN4A 3R40A 5A6SB 1YCFA 3QU2A 1JNYA 2X3YA 1LFDB 1UM8A 5F9HA 2XOKA 4KMMA 4EY6A 2VJNA 4Z9BA 5G02A 3JTEA 4BRUA 2V7TA 2WC1A 3HCWA 1XVLA 2QRLA 2XQGA 3O2NA 4WKPA 5DBHX 5T5QA 1WWKA 9ATCA 1UPUA 1U81A 1V26A 3L06A 4HWSA 3CEMA 4LUCA 2YJTD 4NBUA 3JAKA 2C7PA 1V11B 3GBVA 4QAJA 5G2OA 3SM9A 1Z6TA 3AXTA 5CVJA 2BUAA 3FVWA 3FWPA 2EFGA 4NCAA 1X7WB 2J31A 3CR7A 1X13A 1E0JA 3D4OA 4IS3A 1EESA 2D1YA 2QUZA 5AKYA 5CRIA 4Z8XA 3T15A 4U7TB 1PJ2A 3LHDA 3WHKA 3BD6A 5IUNC 3D4IA 5F7XA 1MAWA 2HK6A 1HYHA 2WSIA 2XCUA 3RRXA 2QU7A 3KFLA 1WNFA 2A3NA 1M2WA 4HMPA 4BB0A 1RYEA 2ZYAA 1JA0A 3ESRA 2HK8A 3D3KA 3PQ2A 1QZ3A 2QL6A 1PR5A 3O92A 3D1VA 3TD9A 3X1XA 1SIUA 1Q7CA 1RJWA 3FYDA 4LRYA 1V5IA 4RGQA 4ZYUA 3VI4B 3O4FA 3GCDA 4DR4B 1KJ8A 1U3VA 2J6HA 5C7LO 2CDNA 2NAFA 1P3DA 1LTKA 2QYOA 1P39A 1XJWA 4KWHA 3NM6B 1HSZA 4PZ0A 5G0WA 1QR2A 4RFLA 4IDEA 1EBFA 3SYLA 1QVAA 1B23P 3JYOA 1XD2A 1RAAA 3RG2A 3ZWXA 1RLOA 1O89A 1N34B 3FYSA 3CZCA 2IDMA 4W7IA 5FA5A 3LYHA 1NYRA 4LJ6A 3QPBA 4EVSA 4G0QA 1EWKA 1WB6A 1A8SA 4JL6A 3GRFA 3NX4A 2W2XA 4I1PA 4GRIA 5D3ZA 2I2WA 3FYHA 2R6DA 3D4NA 3D7KA 1X8XA 4HATA 4WPGA 3RVPA 1T5IA 3NP7A 5DX0A 4IGEA 1QS0A 4HCJA 4WOCA 1Z5GA 1UZNA 1KEEA 2Q6KA 4QU9A 2C9DA 3RU2A 1DCMA 4IIYA 4XCVA 1AK9A 5BORA 4FEGA 3PC4A 1XMPA 4L02A 4MVJA 4HQLA 1D04A 3MC1A 1DC6A 2AR9A 1ZOSA 3PFIA 1YB1A 1R0KA 2ZI6A 3ZBPA 3ZHTA 4CKEA 2JFVA 4BUZA 4DJ5X 1TVMA 4AO6A 721PA 4DR1B 1NXVA 1O94C 3G0DA 1Y5MA 3MLBA 4KQWA 4UUBA 5I3ZA 3IPLA 3S2EA 2I4OA 1TEZA 1ISJA 2COEA 3EF3A 3KKZA 5JXGA 4L3OA 4QUEA 1NVMB 3F5FA 5F7ZA 4WLEA 4GPIB 5CVEA 2RJOA 1C3LA 1JECA 3KAKA 4HPXB 4DMLA 1JJ7A 1O6FA 4YYZA 1B2RA 6YASA 4LF6B 3PXCX 4PR3A 4AG3A 2KM1A 4PF1A 1SOMA 1BS9A 1HDOA 2FG5A 4EHDA 4RVGA 3S8MA 1RHQA 1XNGA 3H2KA 1YDHA 3N58A 1AD2A 1TT7A 3SOZA 2IDJA 5IJWA 3LWDA 2G04A 3LUJA 4U63A 2OPHA 2QTGA 3QE3A 4HYQA 4NCNA 4WZAE 4C08A 1UOPA 2JIBA 2Q28A 4BLRA 2DJIA 1AMNA 4XVUA 4OLAA 5EJ7A 4DV7B 1TUIA 2NW6A 2XMCA 5KCZA 2OY0A 1WW2A 4POOA 5HZKA 3IIJA 1RT9A 3WJ1A 4GL2A 3MHPA 4IIUA 4UPVA 4PAOA 1GPLA 1TQHA 1U0GA 3KT3A 4HAZA 1PFKA 3WR5A 2ZR8A 4WFIA 2H2WA 3BRQA 1YZKA 1SUSA 1PD0A 3JPYA 1SUDA 2JVKA 1CDEA 1XSEA 5G4KB 3T7AA 2QMQA 4E11A 1U0LA 3H5LA 4JQYA 3S5UA 1E2GA 2WE7A 3MIZA 3K6KA 4HAOA 3T3PB 1Z2NX 3MINA 5A4MS 1TTTA 3OT4A 3UPDA 1Y7IA 4XH9B 4FHZA 5AHXA 3HR7A 1OU4A 2ZRQA 2ZJOA 2H1WA 4QBTA 5GZ6A 2H11A 1CG6A 1P0QA 4X20A 4P3NA 2UVDA 3GRKA 3COZA 1TAQA 3RK0A 3X1WA 3KFXA 5F23A 2O5VA 5HM8A 4L75A 5IC4A 3SNKA 3WDLA 5E6RA 2OBLA 2WJGA 2IYOA 3FUTA 2FEOA 3H19A 5K05A 3H8VA 1TI7A 2E85A 4QQ8A 4M8IA 4AS3A 1WUIS 5T4FA 3UA3A 5KOYA 3PEYA 4HDSA 3UK2A 4BO9A 4EAAA 5IG2A 3WA7A 1VCNA 4BFXA 3OZVA 1YACA 1JYFA 1EFLA 2J30A 3JQGB 3KU1A 4QOGA 3RSCA 2YKGA 1FJXA 5DCUA 2C20A 1X7HA 4B09A 2C1XA 5LZ8A 1QQTA 3QVLA 2AG8A 4AKSA 1FSFA 4LYDA 1KIMA 3K32A 3ZQ4A 1TEVA 3QJYA 2R7LA 4U2GA 4E7PA 1R0BA 1QIIA 4FKMA 3HCBA 1JPJA 2GESA 3P0RA 5DLQC 5SZIA 3VPGA 3W8RA 4BEWA 2WWYA 2EAUA 3GV0A 1EP9A 4US0R 1U7ZA 3EMDA 4IO0A 4FHGA 2NO0A 2XQIA 1GIAA 4FSXA 2D1FA 4TL9A 5JFOA 2HWUA 1KP2A 3B6ZA 3FDIA 4TQ9A 2YC4C 5D5HA 3SI7A 4AF8A 3ZU6A 2DLDA 3IO3A 4G5FA 4REMA 2OD2A 2BFAA 1XVUA 4M83A 1W4RA 2IKSA 2GPAA 5A3RA 2VDRB 4OP2A 2O1SA 1H5UA 4Y2SA 1MRNA 4Q37A 4BB6A 1E3LA 1CY0A 2Y1EA 4F86A 1FQOA 2HMSA 3D6JA 3BJRA 4YJHA 2DEUA 4NJEA 1X7XA 3TOXA 5K0EA 2V3WA 4JR2A 4NE2A 3VOAA 5E0KB 3HRKA 5LCXA 4H31A 1KDVA 3AB7A 2P6RA 2IZOA 3R24A 5JANA 2XRFA 3P19A 4ZHQF 5K3BA 1HO3A 1DQSA 4P3OA 5TQ0B 4JVMA 1Y8RB 4I4NA 4B2YA 2WPDD 3MB5A 2JHAA 4R2WA 4IF6A 4DL9A 5HZMA 1MXFA 3ZCUA 4YLYA 2OECA 2OQRA 2D1QA 3EEOA 2WYIA 5JMWA 2G6TA 3DLPX 2ZVJA 1LPNA 3WMXA 2NYUA 4Q47A 2GK7A 3EOZA 3SD7A 1TA0A 5FADA 3PG5A 4LF7B 3QFFA 4PXYA 4I08A 2G67A 3LNTA 4G0WA 1PNRA 5CH8A 4CT4B 5LNK6 4XLZA 5MFZA 4JL5A 1JBKA 1L7PA 4IZOA 5K99A 2RSLA 1X80B 1XX6A 2HTFA 1A2KC 1FOEB 2V8BA 3A06A 1T9KA 2WD9A 3C43A 3E61A 2B34A 4FZ3A 3EBLA 3Q7SA 3KO8A 2GPBA 4KO3S 4L0DA 1FVOA 1T24A 4KXQA 1Z8HA 2HJGA 4LQDA 4ZA2A 1PT6A 4WXPA 1EGMB 3PQ3A 4ISBA 1P61B 2B21A 4CG0A 1A27A 1PKXA 2W71A 2PH3A 1AF7A 2VYVD 2IGTA 3EN0A 4JELA 1VIMA 1ZVJA 3UAVA 4AY2A 2UYYA 1QWOA 2OZVA 5LSAA 2N1BA 3A4VA 1Z5PA 4JJIA 2WD7B 4IWXA 1ZAYA 3P2JA 4L74A 5ICSA 4EQ6A 4HAXA 4D0LB 4XTRA 1UOEA 1NVVQ 1C30A 1PKEA 4HEA6 1Q17A 1T0BA 1ZN2A 2VA8A 5B2ZA 2G77B 3ICCA 1CQWA 2DBYA 5AK4A 4NWIA 2Z3ZA 5TSDA 1XZDA 3DE4X 1ONPA 4R9RA 3EXFA 1MOQA 5LFAA 2WMYA 4JI6B 5DTJA 3BFKA 5ELLA 2ZRCA 4A5OA 4BU0A 4WJKB 1WHSA 4RQBA 5CM8B 4X3PA 1HH4A 2ATVA 2XDAA 4FU0A 5F1OA 4ARVA 5KVCA 1BYUA 5LQNA 9LDBA 2H17A 3FB1A 4BKMA 1E4EA 2PMDA 3LC0A 4PBRA 5KYKA 1LDYA 4CTNA 1DIAA 4AUEA 1JEQB 4A73A 2PWAA 1Y4ZA 2VF8A 4LIPD 1E3WA 3VR2D 4LZZA 1Y3DE 3FLEA 1T1GA 3GJYA 3S2GA 4H6VA 1EJ0A 2AEFA 4X90A 3SPXA 4PRZA 3E22A 2VTBA 4E12A 4YAJA 2Q5EA 3Q8LA 5IT4A 2I65A 1E0AA 1T8SA 3SLGA 3QQ5A 3U7JA 1G6KA 3WWYA 4V0KA 1DCKA 4JU9A 1TQDA 4OQZA 1THZA 3PNBA 1SIWA 4R40A 4U8HA 4UTXA 4DMCA 1OFVA 1EVJA 1E2HA 3LUHA 3IURA 1OT5A 4BJHB 3PXBA 1C7RA 4O59O 1V4VA 4L5BA 4B0OA 2IIBA 4J2HA 2PKCA 2QHXA 1S96A 4V38A 3CR3C 1H2ZA 2E0IA 2YWCA 3H4VA 4G9GA 5C35A 1YL7A 3HRIA 2NZXA 4XWGA 3WC4A 3O4HA 5K20A 3EQ2A 3W6OA 2H63A 2AQ8A 5H02A 3W5JA 3B2EA 3ENZA 3P5SA 1Q7EA 4P6VF 1DTEA 1TL7C 3MMSA 4XFDA 1AK1A 2GD2A 2P9ZA 3ORQA 5EP1A 4AYXA 2BHTA 4B31A 1A5BB 1PJ3A 2AW5A 3TKLA 5IKMA 1XELA 2ZAOA 3OJEA 5KJCA 4P3YA 4K6OA 3RJMA 3PDHA 2C9YA 3H5TA 4LECA 2IXGA 1JG3A 1VKJA 1HL3A 1LBTA 4MHOA 4KK4A 3IC5A 2XUKA 3AI2A 3I2JA 5ALPA 4QFBA 1KJWA 1N5LA 4S3MA 3WLHA 4EG8A 4FLMA 4CF7A 4G0VA 5AVWA 3CLRD 1J8QA 5IS2A 1JEYB 2A1TR 3KB2A 2OD9A 5ALJA 1HMPA 4BO4A 3RRBA 5IZCA 3DZKA 5AP9A 1VSTA 2EGUA 3WYDA 2C5LA 2OXRA 2OMEA 1HFEL 2K4MA 4OK5A 1FK8A 1XLWA 2R2GA 3O21A 3OPVA 4P4GA 1E0DA 3NVMB 5D7BA 1EPUA 3LQFA 4XDYA 2P30A 1PX2A 4A6DA 2O14A 2C31A 2G9VA 4PQFA 1DB3A 2X1VA 2W6MA 4H6WA 3H2ZA 5TRTA 1J7KA 4JJZA 4AZSA 2VK8A 5JYEA 4OLFA 1QO0D 3ICWA 4BDSA 3K4QA 4JJAA 1L8OA 3MRVA 3LAWA 5BSTA 4EM6A 1U8EA 3CS3A 5DEIA 1T26A 2YDXA 1SN7A 2BCGY 2FK8A 3NBAA 1B6TA 1N33B 4K9NA 1MVNA 4IFTA 1II9A 4YO8A 1EWQA 3UWDA 4PRLA 2WU1A 2FZLA 5KNCA 1W4LA 2FCRA 2ZWAA 3KKEA 3EYWA 3G8AA 4ND2A 2GEJA 1BS2A 3UJNA 4P4NA 2O8NA 5JCOC 4NJMA 3HBLA 1GWNA 3K09C 3OCCA 3UJ8A 1H93A 1CRLA 3COWA 3VHXB 5A4KA 1O5TA 1L1RA 1J70A 1Y89A 1THMA 3OIDA 2QM0A 2ZZKA 3GVIA 2D5AA 1M72A 1SBZA 2KW5A 2Y6VA 5ALDA 1A9OA 4N9QA 2ZB2A 4CM5A 1ESNA 4IL5A 3R3SA 3OO0A 1SBHA 1GGVA 4EY8A 3LHKA 5FWXA 3E2MA 1NLFA 3OM8A 4C0KA 3AI1A 4CV2A 1UXJA 1J42A 2VNJA 3RF6A 5FJJA 1HBJA 2WAMA 3BDIA 2BE7A 4CCSA 4D46A 3MFQA 3AMVA 1NBMD 1GM5A 4DLBA 3N5CA 1JTFA 4AJOA 4F2PA 1KR5A 4EX7A 2QAGC 4QIHA 1SEPA 9MHTA 2MYNA 1AZTA 2V5VA 3A3NA 3I9JA 4TLMB 2DTEA 1E9VA 3LY8A 1Z7YA 4GYYA 1SXIA 4ND8B 5SYNA 2FPPB 4H7IA 1RFGE 4RPIA 1AQJA 3FCOA 3L1VA 4MI9A 4DWVA 1N3YA 3QE9Y 5IT0A 4O2BA 2EF0A 3ZCTA 4OLBA 3HKDA 3SQXA 2YYAA 3AL2A 2Y0BA 5DSZA 3RU7A 3V4ZA 1UPFA 5HQJA 1VDMA 1JNXX 3EC2A 1KARA 2X7XA 4I5EA 2GA8A 3H9GA 3PENA 3LBIA 4GLFA 4ZV4A 2ACEA 1L1QA 2Z43A 1S5PA 2XF2A 3DBLB 5JS2A 1YASA 2FE1A 1GZ7A 2R85A 5IXSA 5JHHB 1OREA 1F1BA 1U2ZA 4MR9A 1CBUA 1RQPA 3TPZA 4D81A 4DQDA 3NKFA 3NGLA 2PGLA 4MB2A 1KO7A 4BP1A 2FUKA 2NPFA 4C1BA 1L1FA 4MYRA 4H7JA 3T8YA 1JR2A 4U2CA 2P9QA 3UUFA 1OILA 2OCBA 1GKLA 2X0IA 1SD2A 1ISSA 4U7JA 3CH7A 4TYQA 2GK3A 1ZD8A 1KY3A 3EXIB 3O94A 4L27A 4TZTA 1UPTA 5ALNA 4NK4A 2X8AA 3ZU3A 4YMHA 4X1YA 1K88A 1EUQA 2JFXA 2Q1UA 3OEED 1QH1B 3KUKA 2QPLA 4GXTA 4KQGA 5KDLA 2MMCA 2WM2A 3EHDA 3WV4A 5M04A 1Z08A 1OH5A 3MUOA 4UZSA 4XYBA 1NF9A 3IKTA 2HPZA 3GUVA 1E3EA 3GGPA 4UHFA 3GP3A 1LZKA 2J07A 4EDFA 4P08A 3DMRA 2QG9A 3QUQA 4L6AA 2MMGA 4OM8A 1II8B 1IOZA 1E2DA 3JQ6A 1HT3A 3NDIA 1Q2UA 3TJMA 5AVSA 2WJAA 1D2AA 5DT9A 5FF9A 2Z8XA 1GJRA 5DX8A 2JKYA 2VDQB 5A3JA 3MRTA 5K8LA 1YUMA 4FFBA 3RUHA 1EUDB 1M5TA 1T3LA 2R7NA 4RLHA 1FZQA 4MNTA 4E31A 2GM9A 1E1RA 2GEKA 3BOSA 4AKIA 4NPCA 3F7NA 3G2QA 1BKYA 2X5KO 3R5FA 4U2BA 5LQKA 2Y2VA 3EFEA 3NUGA 3T06B 3WKEA 4CFYA 1W8IA 5L8VA 1IRIA 1YB4A 5T6MA 2V6JA 3HP1A 2PR7A 1ZSVA 2GK4A 2ACVA 4NOJA 3V9PA 4L3VA 5C5CA 3SDSA 3R76A 2Q7OE 2QLBA 3LXUX 1ST3A 4YH1A 1BIFA 1NVKA 1JDPA 2BI7A 2PGXA 3L9WA 4MS4B 4PXSA 2BKVA 5DXFA 5C1BA 5GZ3A 1EUCA 5IN4A 2AMFA 2Y05A 2AJ8A 2VPXA 3PE3A 1QQ6A 1YMUA 1N1GA 1S2OA 2QZJA 3VKFA 4K9RA 2QAGB 4LRWA 5EQTA 3V8MA 5ADUS 4B33A 3CMMA 3EPLA 1ISHA 2MIIA 4J8PA 4D0GA 1ABBA 4WQMA 4FDAA 1TLLA 1FFSA 1QOQB 3FH0A 3WJ7A 1B0ZA 4FNMA 1OI3A 4EHBA 2OK8A 3GRCA 3WGMA 3ASZA 2I4RA 4YASA 3E1KA 4H7EA 1R5NA 4WZBE 4D8UA 2H65A 2CKMA 4E07A 4O8ZA 1V0JA 3FSEA 2OESA 4PE5B 5A02A 5ED4A 4CF5A 1E3QA 3S6JA 3TJRA 3ZDEA 1ZW6A 3NBFA 4QATA 4HB3A 3KQKA 2ZPUA 2BCJQ 1HOTA 5A7HA 5P8WA 5DSXA 4D57A 4DW8A 3CR8A 1U7HA 3JD3A 1ZM9A 2A9QA 2FG6C 1O4VA 2IEZA 1D03A 4NU0A 5GGYA 3TSOA 3ZGYA 1ZBQA 4DADA 5JDCA 1THGA 1P4SA 4WV3A 3SX4A 2I7DA 3T7JA 2JRLA 4K6GA 1QVVA 5BQ5A 3A10A 1RRGA 4PFSA 2HJHA 2I6SA 2G1KA 2OO3A 5L4SA 1RRPA 2ORED 4TTJA 5K0NA 3SKYA 3VYTB 4DC1A 2QAIA 4HTFA 2FGJA 3CPHA 3OE1A 3SQNA 1E61A 1UZAA 1WSBA 1ZAKA 4HVLA 2JKZA 4L8VA 3R0QA 2AMVA 4IOKA 2R1TA 2G63A 3EGOA 4LGCA 5FT9A 4PRYA 1OC4A 1K5PA 1H8HA 2L19A 3C6MA 5IFLA 2J33A 3BB1A 1QFYA 3MGKA 1F8GA 2VDPB 4Y7DA 1BGXT 1O95C 3NHBA 2IU0A 2TSYB 4MYUA 4DAEA 2RBGA 1TLTA 3IHLA 3QJGA 5GIOE 221PA 1T4MA 1RHMA 1SQFA 4NKRA 4NBNA 5CDFA 4KQXA 5DN9A 1P9RA 5EXSA 4PGMA 3NUQA 1JYSA 1T6NA 4GP9A 4XWTA 3RAEC 1CY4A 2PS3A 3PDWA 3FJOA 3DG9A 2DGDA 4HBGA 4LK2A 5GJWC 5C1IA 3NHPA 1RKBA 3KYDA 3SYNA 2AFIB 3I9V1 3ZHSA 2GILA 1WXHA 3VV3A 1Q3HA 3UT5B 2PFSA 4QKQA 4I8XA 2PMCA 3HZZA 3Q8KA 5J5VA 1LI7A 4LGVA 1NF2A 4E51A 1V47A 4OXXA 2QDXA 1O87A 3A9TA 4FC7A 1BAPA 1HQDA 1FFCA 5HF8A 2O9JA 4YRNA 2CW5A 1DINA 2MYPA 4IZHA 5HILA 5HKOA 1J90A 4N03A 2R87A 2XKJE 1QHHB 2WSMA 4XDZA 3R7NA 1T9AA 1KIAA 3KXDA 3O83A 2QZPA 3PBKA 3N2GB 4PHTA 3J7AC 3R75A 1J6UA 5AMXA 3RABA 4JI8B 5IBRA 1Z5OA 4WESA 4I4TA 1BU5A 2Q3HA 3AUYA 5C8DA 1DX9A 1J25A 1J8FA 1JFFA 1RXSA 1YE3A 3VZCA 3W3AH 5KHOC 4W1PA 3JQBA 5H3HA 1KVSA 1X7ZA 3IA2A 1Z15A 2K7ZA 2PUGA 1KYXA 2I33A 3OT5A 3H7AA 2F8TA 2VXYA 1HLFA 3N0VA 4QGHA 2J0VA 3DOJA 3BH0A 3RC1A 1UF9A 2JFQA 4YUYA 1IZ0A 1VLVA 1N9GB 2KLBA 3PHGA 4O1MA 4ZOLA 2ZXFA 4TTVA 5BSEA 4GOMD 1NF3A 1FFBA 3KEOA 4YCSA 2Q5HA 1E9BA 3KQTA 7YASA 1E2FA 4MVYA 1CF9A 4HH3C 3A3PA 1ENYA 2F43A 4M0MA 4OKNA 1R9JA 3A3YA 3RG8A 3EEYA 4OUDA 3STYA 4ZMBA 2A1IA 1NQ5A 2YY6A 4ZAZA 1LBIA 4YS6A 2NSYA 3E3OA 4DCOA 1S2LA 4PLVA 1P6XA 2A92A 2ZJ0A 1YS7A 3EZXA 4IHKA 4Q1BA 2VF2A 4WBNB 1T4DA 3LW7A 1HPLA 2QX7A 2YJNA 1ZXXA 1R4NA 1P2UA 1TO1E 2GHQA 2XWQA 3PXEA 3TNDA 1TF7A 2A9OA 2H52A 3ETJA 3ZE7A 3EDRA 1NG1A 4JX8A 2ZVQX 4J3FA 1G9TA 2HJSA 4COKA 4B4WA 2QT1A 3ZE0B 3D0RA 1XO1A 3R7FA 4OA8A 1ZJZA 2VZ8A 4LFBB 1UBLS 2VNSA 4Z4EA 4YK7A 4Q3DA 4N8DA 1AQNA 1DJLA 1SC9A 1HQKA 2ZE7A 4OHXA 2UDPA 3GLIE 4WACA 5DFAA 5T4EA 1ZNYA 4HYEA 4QDXA 4Z4CA 3V8PA 2P2SA 1BFKA 1MV8A 1VBKA 1WQ4A 4CMIB 2O6HA 4RTPA 2NPIA 5GJBA 2V7QD 2XTJA 2Z5LA 4EW3A 3A6PC 3C3YA 3QVSA 4ZP1A 1P19A 4ZO4A 4UD2A 4YY3B 5DCLA 4A0SA 4WBNF 1T2FA 3IL2A 5AXDA 3VR6H 3BWDD 3GJQA 1VLLA 2ZJ7A 5BPHA 4G2TA 1J8YF 3GL9A 4NNJA 1X70A 5AKGA 4G65A 4RMJA 1KEWA 3KEMA 5DVZA 4EMBA 3PXXA 4MZXA 1IATA 3H2IA 5CPFA 3CCFA 3F4BA 2JLWA 1IZYA 4X8OA 1XTQA 1AQ6A 2PJZA 1BKSB 3G85A 3JU3A 4JJEA 4FOPA 4LK3A 2O52A 3EGXA 3NXKA 5BYBA 3WK5A 5KYGA 1KYYA 3WYEA 5JNWA 4JLVA 3NONA 3EQ8A 3T3DA 3QU9A 1SUBA 3T7TA 2B35A 4GMHA 1P4AA 3RBZA 4UBIA 4D7AA 3HV2A 1TPZA 1SA0B 2DF8A 2C8VA 3TUZC 2QZZA 3KEGA 1I33A 2ZBVA 3O8CA 2VDVE 2Z83A 1MTOA 1D1PA 3HWX1 1GFWA 4K6CA 2O7RA 2P91A 2Y1CA 3FRJA 1U6JA 3GJ5A 3QYJA 3UGKA 4O63O 4PZUA 3OZXA 2XEXA 4JLBA 3NHWA 5REQB 3RIHA 3V6LA 3WLRA 1EXWA 2L18A 3AEKB 1L4LA 4MEJA 3MCWA 4CM9D 3GCZA 4IMJB 5FUXA 8ATCA 1Y1KE 1U2QA 2A0UA 2I22A 1AUQA 3EEBA 1XZKA 4L5CA 4R7ZA 4Z1MA 3SN6A 2BHRA 4OK6A 4MCIA 3HVJA 1SKMA 2NQ2C 4JI4B 2IYQA 2X4IA 3RWOA 2C8KA 1MRZA 2BEWB 1XVIA 4YCAA 3WIVA 1Z4LA 1ULTA 4IJQA 4YP6A 1ZIYA 2BMDA 2ZETA 3U19A 3N6VA 2ACWA 3FF4A 4MWSA 3VI3B 3VR4A 1FW8A 2XGGA 3TX2A 4JA0A 4YVFA 2CHGA 4NYMR 4E6EA 4HADA 4QDJA 1FVXA 1M76A 3PQ4A 5FPHA 1XLVA 5LM3A 2DVMA 2H8GA 1GQYA 3TCKA 3JWHA 1LKZA 4DLVA 3SVTA 2AV6A 5DWVA 3AVTA 4DUGD 1BW9A 5LN1A 3LFUA 1FMTA 4DDHA 1Y9DA 1W29A 1J0XO 3EIXA 5JAOA 5JARA 1BVYF 2B30A 4UFPA 4ZVRA 3MJFA 3AVQA 3PVZA 4XKJA 4E88A 2JZOA 1NDQA 3CRMA 2ZROA 3E9CA 3NORA 3Q3EA 2O8BA 4S0ZA 3TSAA 2JG3A 1LB1B 4Q39A 1H2WA 2P79A 3P2MA 2E3JA 2P9CA 1Q0ZA 3RASA 4HFJA 4WXEA 2A67A 4MYTA 2L82A 2B4KA 1SPXA 5H81A 3ROFA 5B7GA 5BYKA 1GSHA 5CLHA 1V3VA 2M1ZA 3P9NA 2ZUDA 2BL4A 3WYGA 2VA9A 4EG5A 3KXLA 5H70A 4AD8A 1UKYA 4YHHB 2C82A 5LP6A 4DUZB 1T9ZA 3MUEA 4HD8A 1U1FA 2G70A 5B4VA 2IBMA 3UGTA 3ZZTA 2V54A 1N2OA 1EXVA 2H4HA 1ZM2A 4YC7A 4DRZA 1L3CA 2EBFX 4J16A 1IPEA 3D4BA 1JXAA 1QYIA 2XB4A 3BFXA 4D9GA 4A2WA 3L4KA 3CSUA 2GDJA 4FD2A 5CLLA 1G8JA 3NS7A 5IW8A 3PXDA 2WU3A 2HRDA 3AM3A 2FDXA 2FMFA 1DQPA 1MOPA 3PUYA 3UAOA 3KHSA 5JJLA 4CMEA 4MVJM 2ZZMA 3RVKA 5E2BA 5ALGA 1CW2B 1P81A 3O8DA 4N5IX 4U7GA 3NHLA 4KYVA 5H1YA 3TOSA 1VXOA 4CKWA 1QRUA 3JWGA 3PD7A 3DLHA 2BGIA 1WVMA 4F6CA 5HRCA 4M9ZA 3M1IA 1B15A 3ZV6A 3FGZA 2FRXA 2WBLC 4JJ8A 2ZTLA 2FLVA 5E38A 3ZGVA 1QRDA 1ZINA 4MRMB 2EJVA 3RHFA 1VMAA 4W5NA 1SKAA 3LLUA 4EW1A 3AR6A 4ALLA 5AWFC 5BNZA 4QC2A 2OCDA 1M66A 3A1NA 3ONWA 3SJUA 3T61A 4LE2A 4DAOA 3OQJA 3FROA 5FIUA 6GPBA 2JNWA 2VWQA 3DLIA 3OH8A 4DCCA 4YMLA 1NBEA 3ICPA 3B85A 5H59A 5FLYA 3T12A 2Z3VA 3U3RA 4G5XA 4B6FA 2VJPA 3AJRA 5HXAA 4OB8A 1M2EA 4FWTA 1IM8A 1IBCA 1TZKA 4H17A 5BP7A 2D0OB 1LY1A 4RF3A 3N75A 5CCEA 4X7RA 4IMIB 4CQLA 5TS3A 1SCAA 3P2IA 4LF5B 3A7DA 3G2MA 3F49S 1RQ7A 4LJRA 1WO8A 1V1JA 4RW0A 4Z2AA 5JTUA 4A36A 3VM6A 2NNLD 1N7HA 1NRJB 2IPXA 3U9SA 1JSCA 5JCXA 1RZRD 2YOGA 1G8FA 5D86A 1E5TA 4UTOA 3WJ2A 4B46A 4EUNA 2Q3FA 1D2GA 1F2TA 4RM2A 3UJAA 2XYRA 4A8HA 2BGNA 2DWOA 5H82A 3G2LA 3ABRB 5AUQA 2X0FA 4YAUA 3JYLA 4P3XA 5ENDA 4ZK2A 4KXVA 5CFOA 4XPIA 4NZNA 1JQJC 2D1TA 4YP0A 2REXB 5IAAA 1KK1A 2B83A 3H05A 3SBEA 2R6FA 1M1YB 1SIBE 4CT0A 4RQTA 3OTQA 3MQFA 1RVV1 3TQOA 2ZFUA 2CVQA 3MGGA 2XT9A 1Q83A 4OHWA 2EKZA 2VT2A 4MW7A 4PZEA 5LB4A 3CE6A 3SXJA 1TUEA 5HMMA 1KRWA 4IH4A 5FTLA 5JHGB 1EP1B 1G6Q1 2EP7A 3M1AA 4EL5A 2X5OA 1VPWA 3TTSA 5IDXA 3MEQA 4C0QC 1EMDA 1FUKA 1QFSA 2Q4TA 1OXXK 1IWPB 1ZUNA 1B41A 1NMSA 4KBFA 2FKAA 1HZZC 5C7YA 4ZT2A 1YJ5A 2C54A 2NX2A 1XQYA 4K9PA 4M1KA 3L7OA 2E18A 3CUYA 2YUTA 4GOOD 5BSFA 2VP3A 2LKDA 2H9YA 2OAP1 1SVUA 2D5BA 2IYTA 3KZOA 3TNJA 4AN0A 3A1SA 1CR0A 4DIOA 3CUWA 4NAHA 3N6RA 1FP6A 5A05A 3DLAA 4QPCA 4UHJA 1GTG1 4DEXA 1W96A 1OBCA 2BMJA 3IT2A 5K0ZA 2OXEA 5A71A 3TE7A 1JSZA 2YQ4A 1Q1GA 3CINA 4P58A 3TLGB 3TQSA 3UIEA 1NE2A 1IJBA 3O9ZA 1J8VA 2QRUA 2X8LA 3CX4A 3G7NA 5TVGA 3PA6A 1DARA 4EA6A 5E7IA 3I64A 3TEJA 1YBHA 4PPNA 4K40A 4JEHA 4K5QA 5ARCA 1UKZA 2GOYA 4JEUA 4NRDA 2HRCA 4C4AA 1VP9A 3TOCA 4H7HA 3WWPA 5FAXA 1J97A 2JLUA 3AZPA 4GF5A 1ADFA 4DG5A 4EENA 3EQZA 3ZJUA 4R8LA 3SXPA 4YRZA 1L4MA 4PCAA 4PIPA 3CIOA 3FJ1A 4IX1A 5K09A 4MYSA 1P2FA 3UNXA 2JGDB 4URZR 4GW3A 3AYZB 1RAHA 3R0XA 2HL6A 3HJUA 4BX8A 1WMFA 5LA6B 1CY7A 3RS9A 2XUIA 2BR5A 1DT3A 3NYQA 4AECA 1R74A 5T4BA 1ZH0A 1M2FA 4Y0VA 1ZBDA 1GGJA 4PZCA 4C21A 3OICA 3TZCA 2FCAA 5TS2A 3D8HA 2FP4A 2NO1A 4JBNA 3ED5A 1I2DA 1XAIA 2F1JA 2FI1A 3H0EA 2ID4A 5IBQA 1ADGA 4RY9A 4L72A 4QPPA 1KK0A 1P4HA 5E6UB 1KAMA 4ZOQI 1XYGA 2KQUA 4DJEC 1CZUA 3ZBUA 4QWMA 3R9WA 4BYGA 2ZIZA 2I0FA 3CHYA 1XKTA 2WT8A 3ZKWB 1GTL1 3DNFA 1E9DA 5EUBA 4C30A 5KQPA 1DBIA 1YA8A 5CM9C 3UG7A 5EKSA 2AUTA 3WGZA 1UL1X 2ZSUA 3FY4A 4AYWA 5EN4A 1G7SA 3IEXA 3Q9SA 3FWYA 3IA7A 2PX4A 3ZHOA 3IKLA 4JUIA 4A10A 1XQXA 1DRVA 2HA0A 2BP7A 2PXCA 4WFJA 3LVRE 1VA4A 5LA6F 1C1YA 3JVDA 4V2IA 3IHTA 1P0CA 3IDOA 4BCCA 1SU8A 2YVAA 4IKPA 4YP5A 4F85A 2CL6X 2WU8A 5DM60 5CXXA 4JCOA 3U7HB 5DPMA 3ISJA 3RUEA 2YV2A 3RT7A 1I7DA 3CRRA 4FR0A 1MJ5A 2CLHB 1PWXA 4DLAA 1E18A 1WDWB 4UHCA 1YR6A 4KODA 1E5QA 4RF5A 2Y66A 4IIJA 2ODBA 4Z0NA 4FFVA 1V4BA 1E1MA 1OLXB 1M1XB 5H83A 5EJAA 4RV9A 5MN4A 1VECA 3PJEA 4JMLA 2WICA 1M5RA 4W5OA 3NH6A 4Q4CA 2ISQA 5K0BA 2WAAA 4JI7B 5BO5A 3UB4A 5EHZA 2YJ4A 1N5RA 4L9RA 3ROXA 1QAQA 1FBTA 1I4WA 2PIAA 4HPWA 1KA9H 1NOJA 1LVUA 4NV0A 2BM9A 1UBNA 1C9DB 1XRMA 4WY8A 3F7TA 3B3GA 3FWHA 4WECA 4JEMA 4BNDA 1O0SA 4ONEA 1TTHA 5EIEA 2IRWA 3O74A 3BGDA 4G1EB 1JWAB 2AK2A 2R65A 3ND8A 5CX4A 1Z6QA 1FLAA 2YR0A 4RH1A 3C3MA 3CUUA 5FP0A 3R9XB 4BV3A 4QBKA 1JG6A 5A4JA 1EUYA 2B6HA 4KVZA 4MJXA 1NVXQ 3V1KA 4DBVO 3E8XA 3IE1A 3KZNA 4CIYA 4MP3A 5ALTA 3A1DA 3K1AA 4CEJA 1NJGA 1ODSA 3I12A 1S2NA 4YJ2A 1GNQA 1RI2A 1Z4OA 4AUNA 4C0WA 2E6KA 1JMVA 4HP8A 4NYJR 6PFKA 1EEXB 1QQ5A 3UMVA 3KSDO 5TF0A 1EGAA 2HCFA 3W2GA 7GPBA 3UEOA 1P31A 3I6BA 4RCZA 2O0MA 2VP0A 4OBWA 2IYNA 5D6OA 5J4YA 2V5AA 4HUQA 1D07A 4TT8A 5JZSA 2PVSA 4UM8B 3PDUA 4PANA 4G1FA 5CD9A 5GONB 1OT3A 5T67A 2OBYA 4DG8A 3ODGA 1TGVA 3HB4X 4HEQA 1QGUA 1F6DA 3LCRA 3KT8A 2YHIB 5ALIA 2FTKE 3HJGA 4ZYVA 2A0WA 4Q05A 2HJVA 4EEXA 5L3VA 1XRLA 2PUWA 3PS9A 4QARA 2ZSAA 3N2NA 2PX6A 4I5GA 2OC9A 2RCNA 2P8SA 2P9TA 1DTWB 2HEIA 3QEMA 4CMCA 5BWMA 2GZMA 1Z8NA 2DFPA 2UZ1A 2YVQA 1FS5A 1KYQA 4M7RA 5E9AA 3ITKA 2P1DA 4NY1A 3F5QA 4EB0A 3AF0A 1N7IA 2Z56A 1PDOA 1A4XA 4JYAB 4B3JA 4UVIA 5J2UA 3NBZC 4FE3A 3KOUA 2NP7A 3KKPA 1CS4C 3DW3X 1OR8A 1AQIA 1DG1G 1Q7GA 2O2YA 1X2EA 2WOJA 5TNXA 4ENVA 2CSUA 5AR1A 2NU6B 1CE8A 1K6JA 3AZOA 3OJCA 4WW0A 5GONF 3UCFA 4GXRA 2GYUA 3MWJA 4KKXB 3K20A 3ORHA 1JU4A 2C4TA 1VFPA 1QVRA 2LIVA 2QQ5A 3ONVA 3RYIA 3LPAA 4RM3A 5LQSA 1FY2A 3EZGA 3FHOA 1XTTA 3SY8A 1ZR4A 1U3FA 1NMZA 4XEHA 1LD3A 3MVEA 1T3ZA 1M0SA 3SJBA 4HT3B 5C7IO 1YTUA 3VDXA 1HWYA 3EBOA 2DQSA 1L5RA 1QCZA 2J3LA 3S99A 4CLDA 2XNJA 1OI7A 3TZQA 2Q9UA 1A72A 2ZBRA 4N5HX 4FTWA 4CQMB 4GBED 4UQLA 5EGSA 3NI2A 5EY5B 1YRHA 1EVEA 3KBOA 3PNYA 5D87A 3REOA 3IQIX 2C83A 1PJRA 1Q12A 1DAPA 1OV4A 5H0IA 3RAPR 2Y8EA 3GJ3A 3JATB 3RANA 3UQYS 4YPVA 2WPDA 1OFUX 3JZDA 4PINA 3O8NA 3W2IA 2FNAA 1IDOA 5JS8A 2FA9A 2ZLBA 1XNRB 2AG6A 4GDFA 1V8DA 2FWMX 2JC3A 4U6SA 5G0SA 1VKHA 4B47A 3TLJA 3AHGA 2EKDA 5KYUB 4UQPA 4PNPA 2J5RA 2XUJA 3GFGA 4JOCA 2HWKA 2B5WA 3ON5A 1L5NA 1F8UA 3CSDA 5A3QA 3W04A 2D8MA 1QG0A 2QTWB 2ZB4A 2C00A 1F9AA 2GO7A 1KF0A 1N3LA 3KUUA 5ERGB 5CAEA 5E4JA 3QKRB 1XU7A 5FB3A 2ZYDA 5GMOA 3A1UA 1EFAA 4ND3A 1Z36A 1U6KA 3ZWKA 3MB8A 4QDOA 4R05A 3GVCA 3MT8A 4K2AA 4WCFA 5E1DA 1J00A 3OFSA 3S2YA 4IWYA 2PX0A 4EELA 4Q03A 1WBDA 2OEPA 2XDQB 2EWWA 2YRXA 4Z4FA 1S8NA 3ZHZA 3DZFA 1RAFA 3T5CA 3HUUA 4L95C 3VOTA 3S2FA 1G18A 1XDSA 1KC3A 2FPUA 4XIYA 1C9MA 3L6OO 4UNNA 4TYYA 1Q44A 5IWAB 2UVPB 1JKMA 1J2UA 3IMCA 3UHAA 3H2YA 4RNDB 1ZR2A 3DB1A 1ZEMA 1MFPA 3FZGA 3VPAA 2W2QA 2FMXA 3K8QA 1I80A 4MB0A 4V02A 5TARA 4ZYZA 1HLGA 3IBTA 3O2JA 4GKVA 4QYSA 2HGSA 3TD2A 1MENA 4RU1A 3OTWA 4MEAA 1HNZB 1P75A 1UKVY 1R8XA 1O96A 5IP5A 2Y68A 3V8BA 2FSSA 4YIKA 2WFMA 5E1MA 2IFTA 4M22A 4JLDA 2INGX 2JH9A 4RAOA 4YLGA 3Q98A 5HK9A 5ALMA 2ATXA 3DDWA 2GZ3A 2PU5A 2W83A 2Z1NA 4RJTA 3VJRA 4E3WA 4EZIA 5HKBA 5DTEA 2WWXA 3E84A 3LPNA 3BC1A 4M1YA 4UMEA 4C6TB 4D0RA 5KKCA 4Z8YA 1EQUA 3VR2A 2J5KA 4XQGA 2JATA 3O9MA 4Z49A 3STXA 5JNRA 5KYYB 4FOTA 4GUDA 3GLHA 4AT1A 1RI1A 4BLQA 4DVJA 1I36A 1KY2A 1DWQA 1ZRMA 1XEXA 3CGWA 3I42A 5AKEA 1IOVA 1CQZA 1WOMA 2W00A 4TMTA 5KTRA 5IUJC 1N6HA 3LA8A 1DZ3A 3U4DA 3ERCA 1LWOA 2I6UA 1QV6A 4OL0A 4OMFG 2W42A 2QYSA 3H4TA 3QWAA 4NENB 1DADA 2GRAA 5BN3A 3ADCA 4KN6A 4JC4A 4EG7A 1W48A 4JP3A 2J5XA 3FZQA 4D5EA 1H6DA 5KWJA 2QD2A 1FJHA 3KDAA 2GPWA 1H66A 2ENUA 2G1UA 2Q2QA 1ZIXA 4H0FA 5GM1A 3RK1A 3WWDA 4GU5A 2O54A 3H8JA 4LBVA 2JJYA 1GFZA 5GVRA 3CX6A 1VIDA 1NI3A 4NL4H 3VMMA 4DIEA 2H1HA 4HDNA 4EHNA 4XGRA 3OCUA 3IILA 3IIIA 2IP1A 1TJYA 2QMHA 4PYRA 3JVUA 3TM4A 4ZI7F 2HA6A 4DQXA 2P9JA 1ZA2A 3H42B 5CFQA 5H4HA 1YR3A 3GLGE 1U3CA 1VHQA 2EARA 4L8LA 5GV8A 3ZK9A 3U4QB 2POQX 3UMFA 1H4QA 2CHEA 4ENSA 4MS1B 1BS1A 2QRKA 2NU7B 1IZZA 3K3PA 1NN5A 1TFRA 3I0ZA 3N8NA 3QMWA 2BJWA 4A8JA 1Z8DA 1A97A 3F6YA 1PQYA 4H1UA 1XJ0A 1IEXA 3VSBA 5M3BA 2QTMA 1NNSA 3K1JA 3DAHA 4JEIA 3KR0A 1I6WA 3VHQA 1IBRA 3W2FA 4EG3A 4HVTA 2VSQA 3NETA 2OHGA 2V74B 5HMLA 3KZMA 4KLZA 2BFFB 1ICEA 3ZU5A 2BC9A 1G2PA 3LK7A 1T6ZA 2BF4A 1VRVA 5AT1A 2WM3A 3D7NA 1U94A 1HURA 2FN9A 3T1NA 2JLZA 1PJZA 4CM3A 4PSKA 2GS9A 1C50A 1QANA 2V7GA 2X9LA 3CEAA 3HEAA 3C16C 3OPQA 2BGRA 5KS2A 2Z4RA 1WD7A 2ZYGA 1WXFA 1U8UA 3GBPA 3MT7A 1DCTA 5KQGA 1MABA 1QO0A 2ANCA 3NR2A 3NWPA 2X0KA 2HMYB 2C5BA 3GLSA 4UW9A 5HFAA 4OQYA 2VIIA 4C4RA 1T0JB 3NFYA 4BY9E 2BGMA 3ISTA 3KTOA 4M9CA 4D9JA 1QG6A 3BTUA 4UU0A 2OXFA 2FXIA 4BVJA 4JV5B 3VR1A 3P9XA 4R16A 3GA7A 9LDTA 3QPUA 2FYTA 4S0XA 2YASA 2QD4A 2WMNB 1QSGA 1SVWA 5FYQA 3AM5A 4GKAA 4F56A 2BTEA 1YFLA 1G8KA 1I14A 4IDPA 4E03A 3PPWA 1W76A 2CHFA 4N5LA 4E21A 1I1OA 5HM6A 2QXUA 4HI0E 1QO7A 4QO8A 2CLIB 1W85A 5JT1A 3QLUC 4UFOA 4M36A 3I6MA 4MVJP 2XKKA 5BVHB 1GTVA 1U4NA 1VI5A 2GASA 3CKKA 3KR2A 5BXYA 5DM70 1V7PC 3AHEA 4DYVA 4RKWA 4I3GA 2E87A 1J2RA 2WYWA 4TLEA 3ZV3A 1RP7A 4FDMA 2BDUA 1IHXA 2QG4A 2WSSD 2WVHA 1DHRA 1FS6A 1T3SA 3GLTA 4V0NA 2FR8A 1N2JA 4A2CA 4AKEA 3A2KA 1DIHA 2XMSA 4RHFA 4UCFA 5CDFE 1NBMA 1Z0KA 3WGNA 1SVNA 3QF4A 3C97A 1UINA 2B1IA 5DHTA 5FNVA 4O0LA 3WK8A 4X64B 1O97C 5A9SA 5ECDA 3UKOA 4HAVA 4IIVA 1JV2B 1L6RA 2OM6A 2XVAA 2YJGA 3ETHA 3I37X 1YMQA 3IUYA 4HJXA 4MJ7A 1EVYA 2P62A 2IEGA 4KU4A 4RVUA 3GT3A 3DKIA 3GEBA 2BFEA 4YBRA 2QTRA 1DO2A 1Q1ZA 4F0JA 4GMFA 2BGGA 1WUKS 4DIBA 1Q1BA 3PQCA 4JBYA 3OMLA 5CP8A 1N4AA 2XMRA 4QQRA 2AR0A 4IV5A 4RK5A 1G17A 1WMSA 2DY1A 3E7FA 3HDGA 3HI6A 5FI3A 3SSMA 4F46A 1WCV1 3C3KA 4BO5A 3IQXA 1U2DA 1ZLXA 1YDGA 4MITA 2SICE 3BMCB 3L49A 1Y9AA 3H1BA 1XVAA 4HDKB 3T9EA 3SEQA 4DLSA 1S8FA 1MDBA 2ESRA 3L6CA 4E2XA 5HIAA 3O90A 4Z3OA 3PE4A 1QYCA 2VP5A 4DV1B 4OX9B 4LTNA 4AF6A 5FQOA 3EXG2 2W6JD 4IDOA 4IJWA 3R77A 4RHEA 1VSUA 1V39A 1IE3A 4URHA 4UPDA 1BQ4A 3Q3JB 3LIPA 1ACLA 1QCDA 3H1TA 3K0FA 1IK6A 4ZO9A 5EIAA 3UXMA 2GX6A 5JD6A 5AQ1A 1GARA 4WOPA 3R44A 1BHO1 2ILVA 3T7RA 1W5TA 5IAJA 2JLVA 2I6QA 1IXRC 2IHUA 3OEEA 4HDAA 2E5WA 1TVKA 3C1UA 3DTVB 1EFHA 2YXPX 1A2BA 2ZM5A 4US2R 3OE7D 4BGUA 5DRYA 4K88A 5CB4A 2GZ2A 3MTAA 5HG0A 3OIFA 1YJBA 1ZO8A 1OPXA 1NDHA 2BH9A 3PZRA 4GEKA 1AX9A 4MK4A 1J5XA 4UUNA 1EFKA 5G4LA 1T9BA 3W1WA 3DLTA 3IIKA 1JHQA 1WUHS 2JCGA 2ONYA 4M8SA 4D3ZA 5A1JA 3LO8A 1T2NA 2P4EA 3QKUA 4QL3A 5L9AA 2ZYTX 5CHEA 4HMOA 3DMNA 4ZT7A 4P2GA 4AVYA 3DXYA 5LOVA 1XDUA 3MLEA 5L95A 3USCS 2PKYX 1KAEA 1EWRA 1XTVA 3WYNA 4N7JA 1TZCA 2D2FA 5C1PA 3KS9A 1U1GA 3NHYA 4KQCA 5TV2A 2EGGA 2FVYA 4JOQA 2J9GA 3LHIA 3BB4A 2O8FB 4FP9A 2J3QA 2J5QA 4A23A 2HSDA 3G0GA 5CVTA 4I9FA 2IPNA 4YLEA 5C31A 4MIOA 5L4NA 1TQ8A 4BZWA 1AUVA 1C1DB 5CFRA 2ZE6A 3ZD8A 2VDWB 1BNCA 3WKAA 5J3JA 1OLOA 4MWZA 4UARA 4XM0A 4N0MA 4YUAA 2QYTA 1ISGA 1HM5A 3KDPA 1IUKA 1YH3A 4Q66C 4S1VA 2EBUA 1AT1A