5BRJA

Structure of the bacteriophytochrome response regulator atbrr
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
140
structure length
140
Chain Sequence
PELRPILLVEDNPRDLELTLTALEKCQLANEVVVARDGTEALDYLNVTGSYHNRPGGDPAVVLLDLKLPKVDGLEVLQTVKGSDHLRHIPVVMLTSSREEQDLVRSYELGVNAFVVKPVEFNQFFKAIQDLGVFWALLNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Two component response regulator
publication title Arm-in-Arm Response Regulator Dimers Promote Intermolecular Signal Transduction.
pubmed doi rcsb
source organism Agrobacterium tumefaciens ccnwgs0286
total genus 45
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2015-05-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5brjA00
3Q7TA 3DLHA 3Q7SA 3JVIA 4OBBA 5KC9A 2FQWA 1E6LA 2JVKA 4KPYA 2X7XA 3DGFC 1U8TA 3SG0A 4EYOA 1YMUA 1ZGGA 1DBPA 1USKA 2GBPA 4DADA 3Q41A 1ZAYA 3TX6A 1RXIA 2FSPA 1JFTA 1P8AA 3OLWA 1S8NA 3URMA 3FMVA 2QU7A 1QKKA 3QX8A 1FQWA 5IEJA 4O5AA 5KQMA 5FBKA 2A9OA 3QEMA 4OLBA 1RNLA 3I42A 1B00A 4KRFA 3RVPA 1QNLA 2WB4A 3KTOA 1I3CA 2OENG 3O2QB 4OG2A 5JNVA 1YK0A 5DCLA 2WY2D 4KQ9A 3ROFA 2MYPA 2FMHA 4PZ0A 4KMRA 3OMWA 3HVRA 1JYEA 3CG4A 3GWGA 2M1ZA 1SXIA 4RDCA 3EULA 2P4UA 1JYFA 1NXSA 3FFXA 2PL1A 3HO1A 1CYEA 3P9YA 1LK0A 4RK4A 3MQ4A 2QW1A 5FWXB 3VNAA 2YHAA 1F4VA 1VRVA 4MAAA 5HSGA 4YWHA 4S04A 1LBIA 1BDJA 1AB6A 2CWDA 1MVOA 3BILA 3RVOA 4OLAA 1UDRA 3NHZA 1JWLA 4JB2A 1RPJA 2A9PA 5TQ2A 1SD5A 2HQBA 3E61A 1Z13A 3IP7A 2TMYA 2NT4A 4YCSA 3IP5A 2WMYA 3G85A 3KKEA 4JB0A 3T95A 1ZY2A 3MM4A 4XLTA 3RVRA 3CFYA 1P6QA 4F3TA 3KLOA 3QLUC 1D2AA 1FFGA 3BRQA 3KG2A 2HPHA 3A3KA 5JNWA 5FWYB 2L18A 1M2FA 2GX6A 5C5CA 2N9UA 4EVRA 2LPMA 4N0PA 1DP4A 3QLVA 4MQEB 2PKXA 5CNJA 2DRIA 1NTRA 3HUUA 1NATA 1TJYA 5IULC 1U04A 2E4XA 4GNRA 3O1HB 4MS4B 3O1JC 2RJOA 3QEKA 4MGEA 2FLKA 3GBVA 2VUIB 2CD7A 1MAVA 1MB3A 5JNTA 1U2PA 4MYRA 1C4WA 4LRQA 2LIVA 3EQ2A 4ZMRA 5KQLA 3N53A 4MR8B 3JPWA 5E3JA 5EWJB 3OLZA 4O1HA 1RXEA 4RSMA 4EUKA 1ABFA 4JAVC 3H5WA 1DC8A 4XXHA 3RVMA 1USIA 3ILYA 3LUCA 3KYIB 1M5UA 1Z15A 4MR7B 3TD9A 2FN9A 3GRCA 3HZHA 1GUDA 1EHCA 2PMCA 5GQSA 4N47A 4EYGA 3O1IC 3RVSA 3IPAA 3GBPA 1OXBB 4PICA 1XHEA 2FEKA 1DZ3A 2ZAYA 3SNKA 4YV7A 1VPWA 2F8TA 4Q7EA 1KMIY 2YHBA 1SXGA 4W5RA 2BGGA 3K9CA 2FW0A 4MPTA 3D02A 3Q15C 2HQRA 4WWHA 4OATA 4ZYLA 1GLGA 3LTEA 4RZSA 3F7NA 3JTEA 5IC5A 1TM2A 3RVKA 1BDIA 2J48A 1ZDMA 3KSMA 3MYYA 2L19A 2FMIA 1AB5A 1LJLA 1EFAA 4RK0A 1PEAA 3L6UA 2WWVD 2IPNA 4LX8A 4PE5B 3I5AA 1T34A 3GV0A 3T8YA 1QMPA 1GUBA 2JVJA 2WRZA 1EWTA 3A0RB 2PUGA 4M88A 2VK2A 4L85A 2HSGA 3DLBA 4RY9A 1DCFA 3N0RA 4D6YA 1QO0A 3IP9A 7ABPA 1DCMA 3C3KA 3KHTA 5GOTA 3D8UA 3ROTA 3HUTA 1U2QA 2E4UA 3HK2A 2NT3A 3QLUA 4ETIA 1LBHA 1SRRA 3FDFA 4G0MA 4MRMB 5BRAA 2LBPA 1USGA 3KJXA 4FE7A 4H60A 5F64A 4F12A 5JNSA 1E6KA 4LE0A 3NNNA 2B4AA 1TLFA 4KNYA 2H0AA 2I6FA 1L5ZA 5B3JC 5KC8A 5IUKC 1P2FA 3EQZA 5EWMB 2Q5CA 1QPZA 3OM1A 2VYCA 1M5TA 1NXTA 1Z2DA 2PUDA 4IILA 4KZKA 4LE1A 4XASA 4LDZA 4MR9B 3M9XA 1NXWA 1ZN2A 3A0UA 3JVDA 4HNSA 1Z17A 1JHZA 3UKJA 3OMXA 4W5TA 3OM0A 4IGAA 4RXMA 1KRXA 3G1WA 2MYUA 5HM6A 3MA0A 2IKSA 3LUAA 2PAFA 4MS1B 5EWLB 6CHYA 3CKMA 4UHJA 4ETMA 3SY8A 1PUXA 3CU5A 5T3YA 2JRLA 1Z2EA 5I4CA 4Z4EA 2MYNA 4P1ZA 4XAQA 3T38A 2QVCA 2R47A 1ISRA 2PUAA 2VUHB 5KQGA 2PUCA 5FBHA 4QYWA 2MSKA 2NZUG 3KS9A 2MSWA 4OTZA 3CS3A 3OQNA 3HDVA 4RKQA 1OXKB 2IPMA 1FFWA 3LKBA 4G0XA 4QPJC 4EGSA 4ZJPA 5HQJA 1U0SY 1D1QA 2JB9A 1IIBA 3I09A 3TO5A 4P98A 4MS3B 5DGCA 5BQ3A 5JS1A 2AYZA 1KGSA 2FMFA 2FEWB 3VNBA 5C5EA 6ABPA 5TPZD 4W5QA 1KRWA 1ABEA 1DBWA 3CG0A 3CTPA 3QELB 1YS6A 3FFWA 1LJUA 3BBLA 3R0JA 4LDAA 2GWRA 2RJNA 5EWJA 3SAJA 1SXHA 4DQDA 2JCGA 4G0QA 5IX8A 4EVSA 2E4WA 3NNDA 4MR7A 1DCKA 5DTEA 1K68A 4EYKA 1PEYA 3N0XA 2L2QA 2QVGA 3T6KA 1JDNA 2E4VA 3HM9A 4KFCA 4RXTA 5IUNC 3BREA 2A9RA 3MIZA 4F8JA 9ABPA 1QP0A 2QR3A 4IF4A 4YRZA 4W5NA 1DC7A 1TVMA 3QLTA 2NZVG 4Z99A 5IEBA 5BR1A 4G0ZA 1WETA 4N0QA 4Z9AA 3RVQA 4E7OA 2WJWA 1P6UA 3DZDA 3EDCA 3RQIA 3A10A 1JF8A 5TQ0A 3H6HA 4TLLB 5TQJA 5TPWB 3HJFA 3LMKA 1DJMA 3E3MA 2JVIA 4Z4CA 2PJUA 5B3JA 4RWEA 2IDMA 3JS5A 2A9QA 4O1IA 4NCBA 1NY5A 3NBMA 5DKFA 4RS3A 4PEVA 1M2EA 1FFSA 4RY8A 1E6MA 3HSYA 1XWWA 1C0EA 3KLNA 3O75A 5JS2A 3TMYA 1EAYA 3CHYA 3EODA 1QQBA 1YVUA 2JK1A 2L17A 3N8IA 2JBAB 4QYMA 3O2SB 5KI6A 3I45A 4W5OA 1NXPA 2PUEA 2W42A 4Q6WA 2ID7A 3LFTA 4JASB 4MRMA 2PUBA 2QXYA 3QK7A 4G86A 1MB0A 2RGYA 3GL9A 3H1GA 1J56A 2LP4Y 3CZ5A 5IBQA 4MQFB 1GCAA 1D4ZA 1A0OA 5PNTA 2MSLA 2FXIA 1ZHHA 3H6GA 4RK5A 3S99A 1RZRA 4FE4A 2V0NA 1H9CA 1ISSA 5EWMA 4UHKA 2E4YA 2NUBA 3QLVC 4NV3A 4RV5A 1YTUA 2PL9A 2IYNA 3Q7RA 2O20A 3O2JA 4ZMSA 3HXMA 1DRKA 2B1JA 3GYBA 3GA5A 3JPYA 3LOPA 1PHRA 3EJWA 1TMYA 4RK1A 2IPLA 3LKVA 2FTKE 4TLMB 1MIHA 4NCAA 2GI4A 4Z4IA 5FWXA 4HNQA 4MS1A 2OQRA 1K66A 1YS7A 1APBA 2RDMA 4Z9BA 4IRXA 3UK0A 3QX9A 2PE5A 1URPA 3LUKA 3OQOA 3OLXA 3LUGA 3BRSA 4S05A 2H3HA 4N03A 4YR7A 4Y9TA 3RVNA 4XFKA 5CNMA 4IMJB 3N75A 1HEYA 3HDGA 1Z16A 4MS3A 2QZJA 3IP6A 4Z0NA 5FWYA 3H1EA 1R8JA 1ZITA 3F6CA 3H5IA 4Q6BA 1F51E 1NXVA 2HJ9A 1ZESA 3HCWA 3QELA 4QICA 3C6QA 1YK1A 2ID9A 4MQEA 4WXEA 2FLWA 1Z18A 1JX6A 1Z25A 3F73A 1Y1LA 3KYJB 1PNRA 4Z4GA 8ABPA 5KWSA 5CHYA 3QEMB 4G0YA 1QQAA 4MS4A 3IDOA 2FKAA 3LUDA 3W9SA 4ML3A 4NICA 1D1PA 3B2NA 2QSJA 3ILHA 4WT7A 1PNTA 1JDPA 1VLZA 3HEBA 3M9WA 3OO0A 4MR8A 3H1FA 4N41A 3FFTA 5JNRA 4RKRA 3K4HA 3JY6A 4HNRA 1YMVA 1ZVVA 1L5YA 4YP9A 4TN5A 5HKOA 2IPAB 2P9HA 4RU1A 1JLKA 1QP4A 4N76A 4WZZA 4KK4A 2CHFA 4H3KB 3O21A 4NQRA 3L49A 5D2CA 4KVFA 5DLEA 5ED4A 4ETNA 4L4UA 4RY0A 5TPWA 4KK3A 1JBEA 3FGZA 1ZH2A 4RK6A 4GPAA 1EWKA 5TQ2B 2AYXA 1W25A 4FB4A 4LE2A 3C3WA 4PYRA 2PLNA 2FQXA 3EAFA 5T7BA 2LUOA 3NHMA 2E4ZA 1DG9A 4LZLA 1YIOA 2M98A 3H5TA 3OO1A 1W9HA 1DRJA 1NXXA 4KQCA 3KCNA 4RK7A 1JL3A 4WUTA 2FMKA 3SQNA 1ZGZA 4YLEA 4E7PA 5BRJA 3CNBA 1A04A 2JBAA 2WJAA 2CHEA 1BDHA 3OQMA 3EGCA 2R25B 5CNIA 3CRNA 4F11A 4Z4FA 1NXOA 3TB6A 3MMNA 3Q9SA 3IPCA 4YS6A 5TPZA 3DBIA 4D6XA 3F6PA 4JA2A 3RH0A 4CBVA 3N6VA 1BA2A 1RZRD 1QO0D 4ZPJA 4IMIB 4MQFA 3RVJA 4WXMA 3M6MD 5ABPA 3LUJA 2GKGA 4Z4HA 3C97A 4MLDA 5JNUA 1CEYA 4KREA 1GCGA 2PUFA 3GT7A 1BAPA 1EWVA 2XDYA 3HV2A 1JFVA 3OLVA 3UUGA 4EYQA 1E2BA 3NNSA 4G0OA 3MF4A 5TE9A 3LUFA 1Z26A 3CLKA 4G97A 3N0WA 3CZCA 3SM9A 3H5VA 4KV7A 2R4QA 3RVLA 2FVYA 4XARA 4YO7A 3H5OA 5KQPA 1QP7A 4HYEA 1CHNA 5TQ0B 3OLYA 4B09A 4RXUA 1D5WA 4TMYA 4YGXB 3C3MA 3HS3A 3LUHA 1A2OA 1DBQA 2KYRA 4H3HB 4D74A 5IUJC 2IOYA 2FEPA 4JP1A 4MR9A 1ZH4A 4EVQA 1VKRA 2FQYA 3DGEC 2R48A 4G0PA 1Z12A 4JOQA 4F06A 2ZWMA 5CNKA 2QV0A 1XHFA 2F8SA 2HQOA 4DN6A 1JFSA 4EY3A 1FSPA 1BVHA 3H5LA 5EWLA 1JH9A 4MLCA 3H75A 2FN8A 3O74A 2MYTA
chains in the Genus database with same CATH superfamily
2ZYVX 2NU9B 1EBBA 1LCIA 2Z1DA 4ITVA 1U7PA 4E51A 3ZVNA 4D3YA 2QRHA 5HJEA 3UANA 1V3UA 2DG2A 4REMA 1PG5A 1ZGGA 2QN9A 3CINA 3MOGA 3RM3A 1ZJ6A 3E35A 3DHWC 1U2SA 2ODNA 3O0TA 2H4HA 3PDIB 1J0BA 1TZBA 1ZI9A 1VSVA 4V0MA 2YW2A 3BULA 1GL3A 1LPSA 1NASA 1NKTA 3OLWA 4I0WB 4X3PA 3K8OE 5TT0A 1A8QA 4B32A 3INYA 4BOYA 5C8DA 2FW1A 1CZUA 2X8BA 2QKYA 3HKBB 4QUHA 1A4XA 1QFZA 1TM1E 4OLBA 1CJCA 3MJ4A 3N74A 3QQPA 4OAPA 5CFLA 4MEBA 1IUOA 1KHTA 2GZAA 2IYFA 1K27A 4DTCA 3GP8A 2WE7A 3ROFA 1EGVB 4HAWA 1PWEA 2GSDA 3ONEA 3E5RA 3KKLA 4GOLD 3O8CA 5HIMA 4EITA 5A2GA 1SU7A 1SFRA 2XQIA 4MPDA 3WVNA 2GZ3A 1TAGA 2VWPA 3IE0A 3T1VA 1FVFA 2WFZA 2AFIA 3FJOA 4FS3A 5HS6A 4BGIA 1NP7A 4DLAA 5AUQA 4ZC1A 1TMKA 3KL2A 2SKEA 3PE4A 3SOPA 3DD1A 2ZATA 4BRSA 2DKNA 2Z5LA 3P4XA 3TLZA 1FLDA 2OGTA 4BMNA 1E2QA 1TAHA 2AC2A 4AYTA 5F78A 1PJAA 3EA0A 1U28C 4XYEA 2QGZA 1B14A 5CDGA 1ONSA 3Q9NA 3P9XA 4WX2B 4KR7A 1SZCA 2J7PD 1CF4A 1C2TA 2A3RA 2XI4A 3R3XA 3HADA 1YDFA 1JDZA 1QVAA 1Q57A 1S0UA 2V7EA 4IV0A 1MO4A 5HKLA 1MFZA 1QNFA 4XLTA 5C0OE 5KNBH 3HLTA 2X2FA 1GYQA 5ERXA 3IBYA 4LI0A 1DPGA 3VOTA 3FR8A 2UDPA 2H7VA 1DAOA 2E21A 2N0SA 2ZBFA 1QFSA 4KLRA 5ALLA 4RD2A 2IELA 4P7BA 2WFLA 5JNWA 4NXNB 4DLLA 1J2UA 3FGPA 5HFNA 4RPIA 1OZ0A 2A88A 3CR7A 3MW8A 4C3OB 4LJ7A 1J7JA 2R7NA 3BB1A 4MW1A 4IHJA 3TNDA 3COZA 4X44A 4YRIA 1WXQA 2CHQA 1BEZA 1N2CA 1NUQA 2G1UA 2ISSD 3HUUA 3C4VA 3K9NA 4FBLA 4JA0A 3FYSA 1EBFA 3E1SA 3LSYA 4OXXA 2F9FA 3LBAA 3C1OA 3TNFA 1K92A 3BA1A 1Z39A 3PC6A 5DLDA 1MB3A 2YWRA 4NYMQ 3TQQA 3U44B 1OF1A 3A6JA 1QIGA 2C3UA 3DULA 4MYRA 1E1QD 2WSSA 3W4JA 4DDKA 3AVVA 3VTZA 4GMHA 4C7JA 3GFPA 4Y9SA 2GYVA 5LLTA 3PNOA 2PX5A 1CFJA 4TSFA 7AT1A 1U65A 3R3JA 4CM1A 1DG3A 1VCHA 2FEMA 3OLZA 2H5LA 2RCYA 2WTMA 4GF5A 4XCXA 1XRQA 2Q8NA 1ABFA 2YNMC 4R83A 1ISFA 1HC7A 3VPSA 5LM3A 1DC8A 2GH1A 1TU4A 4P84A 1TYCA 3H18A 2J0QA 4ZGBA 5HPYB 3HFGA 3SYMA 4FD3A 1MIOA 1U02A 5LQDA 1ZIYA 2ZR8A 3NETA 5H68A 4Q9HA 4DLZA 4I5DA 1AQUA 3U0BA 3RS4A 4LGCA 2EATA 1XD9A 2EQ5A 2W6JD 2A78A 2ZBEA 1BVYF 4W82A 2EFHB 4UZEA 4UBJA 3B7WA 3TE6A 2BGGA 1Z8FA 2G77B 5KNDD 5KYGA 2GA8A 1EA5A 1RRMA 2FW0A 2VQEB 1OFUX 3EH1A 3R0VA 4Q34A 5SICE 2PMDA 1L5HB 3SZGA 3QM1A 3W05A 1BU5A 4D44A 2Q1SA 2YIDA 1Z06A 1FDWA 3PQEA 5EP3A 2DULA 3PF8A 2V7QD 3E0QA 4OGKA 1U3FA 2EW1A 3DOOA 4LXIA 2I7DA 4R9UC 1FDSA 3OAAD 3WLPA 5I8PA 3S81A 3ED1A 5K1ZA 5AFSA 1D4FA 3BFJA 3OLCX 5ECWA 4YQEA 1PSZA 2CNNA 3PVZA 3EPRA 1T4MA 1JFRA 2BZ1A 4TV8B 4V0LA 5IDQA 4YFVA 1K5GA 3NTRA 4GZ3A 2AXQA 4L08A 4L9SA 4NBRA 1JS1X 4ZCPA 5A4IS 4JIMA 4GR9A 2QAJA 3AY6A 3T8YA 2JHFA 2WRZA 1OI4A 3OEYA 1W85A 3SD7A 2QUJA 3DO6A 4L85A 4GX2A 4WECA 1NOJA 3AUUA 3K2BA 5EXSA 2CE7A 2XUQA 1SK8A 1I6WA 2IVFA 1DB3A 1M72A 5IK2A 2QT9A 2F2TA 3DQQA 3R3YA 2NT3A 2B7CA 1W9MA 4ETIA 2A5YB 3DDSA 3JQ8B 1PFUA 1QE3A 4G0MA 2HSDA 5A4DA 1NY6A 1JIJA 4FXOA 2G1PA 4F12A 5LJLA 2O3UA 2BJVA 2GO1A 3NNNA 2HDHA 1SOUA 4AC9A 5IHPA 1F5SA 1GZSA 1I7DA 3NMUF 1KVQA 1XEXA 1EUCB 3MYRA 2ZTVA 4F0JA 4WY5A 3NPMA 1Z88A 4XQ0A 1XAJA 2HT1A 2XBLA 2VYCA 2RC5A 1NXTA 3ICVA 4MV3A 4YAOA 3U17A 2O19A 5AVSA 2RGNA 4YV1A 3UA4A 1YIAA 5SZJA 5DXJA 2MINA 5A9RA 3IXQA 1IHYA 4XDZA 4IW3B 4DLKA 3E58A 1T3LA 5CEJA 1GZ5A 4ND4A 3OPMA 3M9XA 2JGDA 1VYTA 2PRIA 3MGKA 4NS4A 4CMEA 4JJ4A 3PFFA 1Z17A 1JI3A 2I78A 4LRTB 1FXWA 1XMPA 2WHPA 1IPFA 4V0KA 2P4HX 4IFBA 2Y3IA 3K6RA 3M3DA 3TLBA 3TSOA 3B53X 5L7WA 5BNZA 3GAZA 1QHHA 4LZZA 4YMVA 2C7VA 1C9MA 4GSYA 1M1YE 1OX4B 1SOWA 3MS4A 4XQEA 5YASA 4YT4A 2UXDB 4KW7A 4P1ZA 4XAQA 1JXAA 1GQOA 3GH3A 5C9ZA 2ZSDA 4MVJF 1ISRA 2GXQA 5JE8A 1QUEA 5TJ9A 1FS5A 1YQDA 1YZHA 2OCDA 4H0FA 5EIOA 4LF8B 3PFNA 2A2ZA 1NJ1A 2QTNA 1OYVA 4YFYA 4QASA 2H48A 4G4IA 2EEZA 2VUUA 3BIJA 4MUYA 5DLQC 4ZVPA 3KWFA 1TAUA 1XC7A 1TF2A 3B3JA 1KSHA 1WLSA 4YJHA 3W9UA 4DNQA 1OT3A 3BMNA 3REOA 2C04A 1KGSA 4HKTA 1I8TA 4KGVA 1MTZA 5C5EA 5K3EA 4LNHA 3L05A 2PZKA 3MAJA 4CT5A 3K70B 1N7GA 1QHGA 4MQUA 1GG8A 2JW5A 4FHCA 10MHA 2HBQA 3GAFA 3BERA 2SBTA 4FR2A 2VAWA 2JEYA 2IYUA 4B3XA 1H3EA 1M8JA 3OUZA 1C8LA 2LW7A 2X3UA 3WZLA 2WZCA 1GCIA 1M1YB 3PG5A 1JZSA 4WLUA 4E5VA 1K97A 3LQ4A 5K6TA 1UPCA 1Z7EA 4K9DA 2FK8A 2QMUA 4G4SP 4MGYR 3LPDA 3F3YA 3N0XA 2X0EA 4AM8A 4AKGA 3D6TB 2ZK7A 3O47A 1ZR4A 2VLBA 4YMTA 5BWOA 4KAJA 2JAUA 2FN3A 2MSCB 4RZUA 2J0SA 2I6UA 1I32A 1MV8A 4P4UA 3GPCA 4QAQA 4U2GA 3ZHCA 1FLAA 1EGMB 5F76A 1BKSB 2C1XA 1TVMA 1ZBDA 2HQ1A 1U7OA 2OVBA 2W11A 1E3EA 3NVMB 4OJQA 3LT1A 5DN9A 1HMYA 1BKDR 3IDAA 1P62B 3UMFA 3UHPA 4L27A 3WNDA 4LFBB 3RQIA 2CYBA 1O6ZA 2NAFA 3M8KA 2Q2VA 2HL6A 3GFSA 1DJMA 3FPBA 4DJDC 1H69A 3H3XA 4OB8A 4AQYB 2K2QB 1R88A 1XDUA 3V1TC 4BB6A 1MJGM 1GPWB 1YRQA 4AWBA 3RWOA 4I4NA 1PEDA 3JS5A 4QOSA 5DRTA 1C4XA 5HRCA 5TGZA 1DJPA 4NEGA 4S24A 4EX6A 1QGUA 4FYPA 2JDID 3Q12A 1GA4A 3F5SA 1T2FA 4IIGA 3KFLA 2W8BA 1KI7A 2HUPA 3I6YA 4PPQA 3ZHBA 4MV7A 4OI0A 3QNWA 5IJ0A 5FLEX 5KWEA 4N3GA 3OQVA 4UMEA 1K5PA 4KX3A 5J2TA 4HGZA 4ZT5A 1EHYA 4AMYA 4QQKA 1Z28A 4DUYB 4LOHA 3IHKA 3ZVMA 2B21A 1XBTA 2CJPA 3MHPA 1ZK1A 2NPOA 3GUCA 2C00A 3QK7A 4RHCA 4QM6A 3AU9A 3H05A 1TGYA 1KP9A 4D96A 1AGXA 2KBFA 3CCCA 3E2MA 4JJ7A 5FPTA 4BXOB 4RPJA 2PFKA 5BYBA 1W0KD 1K2WA 3B2EA 2Q3CA 3PUVA 3R8XA 3GUVA 1PGPA 3ZPXA 1TT5B 3KKOA 5LMCA 2Z5GA 1TVKB 3ZU4A 1XPOA 1YTUA 4ME6A 5ER6A 2OHFA 3V4PB 4ZTUB 4FTWA 3O2JA 4IXNA 2OM2A 1VHLA 3Q0IA 1SN7A 4JBWA 4EG3A 1FS4A 1EVQA 3UWOA 1R4NA 1FFXA 3R3UA 1KDZA 1KC3A 1YZNA 2ACWA 1Z56C 5JAOA 4YV2A 2NSJA 1REQB 2QE7D 4HSEA 4YJFA 3RRBA 3DZHA 3NT5A 4TLAA 1VB5A 4CIAA 3LY5A 3PKIA 1LWNA 3T0IA 3C2QA 2XLBA 4TMKA 5E2IA 4J94A 3V1NA 1VIAA 1D0VA 2X2OA 4PHTA 2AVDA 1G0NA 5I9MA 5HVNA 4PANA 1W5EA 1JA9A 1E3WA 4FDLA 1P2SA 5DHFA 5FR1A 3OLXA 2UXCB 3LUGA 3QPUA 4O2AF 3M6VA 3OWOA 2H3HA 2PBFA 4YR7A 4NU6A 3UMSA 1QK4A 4BO0A 4AFNA 4HNGA 5CNMA 3AYZB 4NH0A 3ZDQA 1TQ8A 3N75A 1GSHA 3ON5A 4O4JF 4FNOA 4MMZB 5ALJA 2F3UA 2RHBA 2OG1A 1ZVQA 2HXGA 1UC4B 3KPWA 5FWYA 3G1TA 3ESCA 1NU8A 4FHZA 4OOFA 3TW8B 3U13A 4E15A 3EGEA 3AR4A 2IUYA 1IVYA 3HNOA 1IJFA 1WCIB 3O5AA 3QFHA 3LI2A 4Q3AA 1TU3A 2CLCX 1KJNA 4L4RA 4GPBA 3SSNA 4X1OA 3KOXA 4C43A 2IYEA 3GP3A 1X13A 4RVSA 5L4SA 5CM8B 5AVKA 2NU7B 4X7PA 3CRW1 3DBRA 3IPYA 1CKEA 1NFRA 8ATCA 4E2ZA 5ICCA 1R9NA 2P5UA 1GQYA 2P67A 3BTOA 4XIYA 4NV0A 1NJFA 2A14A 5A9SA 2CVOA 3VKUA 1AZSC 1T43A 3KKKA 1N9GB 5DHRA 3ZCQA 5A02A 1DTEA 4NZPA 1EM8A 1Z5GA 3IIKA 3NBZC 5IF9A 3UB2A 4LXUA 3EG5A 3EUFA 3HEBA 3OT4A 4MWSA 3RKSA 1P33A 1IEQA 4MV8A 4P31A 4ZOEA 4XB2A 1BWQA 3AL3A 3BUSA 3B7PA 1GNPA 2QVXX 3F1LA 5TY0A 1M6YA 3BD9A 2CXUA 3AIMA 1QF6A 3CO5A 1TEHA 5DLEA 3WHLA 2NTEA 4C04A 1M2HA 4C7MA 4EEKA 5CA0B 5HQ3A 4L5IA 3NV9A 2QX9A 4PHFA 1T3ZA 4RDHA 1SK9A 1VJTA 3LOQA 4GPAA 5KVQA 3QOFA 1HTBA 4KO4S 3KLBA 5AVQA 1F17A 4A0FA 4PYRA 2V5UA 2OXEA 5BN3A 2O5CA 2DFLA 3ACBA 1FNNA 1GCOA 2ZJ0A 4LECA 1RYMA 3NJRA 3QV2A 4NK4A 3NKVA 3CYFA 2PWZA 2QTAA 4LF4B 3BSYA 3BGSA 5FTJA 2FPOA 3A1NA 1E0DA 1UKBA 3GFTA 3TI7A 4I14A 1GG2A 4O2RA 4WBSA 4E7PA 1XCJA 2F4VB 2WSLA 1D6MA 5GP1A 5LCXA 1QH1A 3QF4A 3T9BA 2WJAA 2H4WA 4YCLA 1L6RA 1I7NA 2IW1A 1N8TA 1RBZA 1KK3A 1P7VA 1WE2A 2J9GA 2NO0A 1NZJA 2XITA 3QWFA 4BTLA 2ZSHA 2ZE7A 3CGWA 4FKMA 4F4HA 3MCAA 3BORA 1QG4A 3MGCA 3LRTA 2IK8A 4HJRA 1AMOA 3WJ7A 3BQNB 4F2WA 4MCIA 4UTNA 2H1VA 1OH6A 2BSQA 4BE4A 3RVJA 3HWWA 2A0YA 2NTVA 3D7MA 3ID6C 1G3QA 2YV2A 2A9FA 3M6WA 4IHJF 3EPHA 1B1AA 3RS8A 1POWA 1OAAA 3EPKA 2BTQB 1YRBA 2LVBA 1GCGA 2PUFA 3AFNA 3JAMA 1OIWA 4H27A 2BEKA 3OUUA 4C2AA 2FRDC 1PT5A 3G9QA 3OF5A 4B80A 4ZYTA 4JLPA 3SHQA 1EVYA 1TB4A 1S2LA 4GOND 2QWXA 4PAMA 4MVJD 5DGIA 4WFJA 3O82A 4EWLA 1X39A 2HBRA 4OJMX 3ZD7A 1KDRA 1H2EA 4XARA 1IWBB 1JKJB 2C92A 5G4LA 3M4NA 3AHCA 1JG4A 4ZWNA 1E4EA 1KPGA 2H16A 3OPYB 3LUHA 3HY3A 2Z2IA 3LP8A 4IG4A 4JQSA 3AX6A 3P9SA 4U9UA 3RTCA 4CQMA 4ERNA 3DE3X 1CS4C 2FPIA 3BTSA 4CMIB 1VKRA 3EVZA 1LD3A 3PQDA 4F4IA 4JOQA 3PLNA 2AFRA 3IULA 3D3KA 1CUVA 3K09A 1QB8A 5D7NA 4ZT6A 2HQOA 2PEZA 1XU7A 1K8XB 2Q27A 3S68A 5IDWA 5IS2A 4G0VA 2DR0A 1B15A 4GG1A 5FTWA 4AMBA 4BCCA 1SVUA 2DJ5A 1KXJA 1L1QA 2VZ8A 4E09A 3QJ5A 3F98A 1O2DA 5AP9A 1KO8A 3B1YA 4W7IA 5HMLA 3ZDEA 3HN6A 3DGFC 2YMQA 3A36A 2EKZA 3HO6A 4OHRA 1S01A 1FNBA 3EPLA 4IJ6A 1L1RA 3ND7A 1MHTA 5JD4A 4DMCA 3PKZA 1RRFA 3HKDB 3DBVO 4LRWA 1E2PA 5LXTF 2ZWAA 1XWIA 5KUTA 4O5AA 5KQMA 3WIVA 4B1FA 5BN1A 3MT8A 3K0FA 1J07A 3GGJA 3A9CA 1KAOA 1XFAA 3IV9A 3ZH9B 1JXOA 1SU8A 1C7ZA 2AFHA 2B8JA 2OENG 2ZUDA 2JCBA 3I2YX 4K6CA 4IH9A 3KEMA 2AN1A 2MYPA 3QU7A 4NMXB 4TKLA 2O8DA 4KMRA 3PR1A 2O3QA 3HVRA 3KOOA 3QLEA 3NTOA 4RIEA 3TMKA 4FZ3A 4LMRA 4LY9A 1YTLA 1FFEA 4AUKA 3Q8XB 3VKVA 1YGYA 4BZPA 1EEXB 3C4QA 3PC8C 2JHPA 3PT5A 4TMFA 3VU3A 2C99A 3DE5X 1UBEA 1UIRA 1UMDB 2BFBB 2OC9A 2BBWA 1VLQA 3AVPA 3PTZA 2BEWA 2VRCA 1ODKA 1P45A 4QYIA 1FIUA 4MW5A 4D80A 2C7GA 3LT5A 2XOKD 1AUPA 1NJ6A 4Q3OA 4A6DA 2ZAMA 1JALA 1B23P 1SC1A 4ZCIA 2QNRA 2O5EA 2NT4A 3QVXA 1DC3A 1G19A 2IEGA 2X22A 4KVZA 4NYMR 4L74A 4BC1A 2GBIA 4P7KA 4ZPXA 1ZRNA 4X92A 4ZARA 4ER6A 1XVAA 4F96A 3DFFA 1HT1E 3OIFA 3UKDA 1UPBA 2WKSA 3SZ3A 4WTOA 1NBIA 4CHTA 1VL8A 1OLXA 4F6CA 1U9YA 1TTQB 2R1VB 2AEMA 3EXHB 2FFRA 4UTOA 3S2GA 2FZ4A 2OV8A 1DWOA 1NLZA 2X6RA 1DTWB 2AOTA 3SR4A 4CT4B 1JR3A 5LYYA 2NZ2A 2QPTA 3GT0A 4M0UA 1KYQA 5AJUA 2AYYA 3LLSA 1Y5MA 3OURA 5CNJA 4DPKA 5JISA 4D0SA 2V6GA 4A27A 2H59A 5FL7A 8ADHA 3GVCA 4W4TA 4HWTA 3ZHVA 1N2GA 4N3BA 1Z9BA 2YN4A 3VR2A 4EZIA 1Q7RA 1DQPA 4DG8A 1FK8A 1ZIDA 1RS0A 1N3BA 2ZUSA 2G4CA 3ANMA 4D5EA 1AGNA 2CNWD 3M89A 4W1RA 4ZVOA 4DKJA 2YVAA 1E3MA 1NW6A 1ADYA 3EQ2A 3FYDA 5K3CA 5CB4A 5KQLA 1X1TA 1QH8B 4MVWA 4L3OA 5KTKA 1LVHA 3DC2A 3UOWA 1V1MA 3CNLA 2B34A 3NAQA 4B3MB 3D6UA 2EQBA 1YQWA 2ZB8A 1EX7A 1H0KA 1TUIA 4TRJA 1OGYA 5JANA 5LKAA 1N6HA 2DLCX 1Y3BE 1HDXA 5TXGA 2C98A 4HYQA 9GPBA 2H08A 5CJ2A 5CFNA 2WHEA 3AUSA 3HZHA 4UFPA 1UEJA 4AJNA 1K89A 3LIIA 4OYLA 1GAWA 4EYGA 1RHRA 1E9RA 3GBPA 2ONZA 3QMVA 4PICA 5CK5A 5JXIA 5KMGB 1YVPA 1GQSA 1MQ8B 4WK6A 2ZU6A 3HXTA 4BNWA 1V9SA 5ULLA 1X3SA 2REQA 2VYND 3H2JA 3K9CA 4N8EA 4CMKA 1TLTA 3ZUGA 3RSCA 2DZDA 1TTPB 3O4RA 2VA9A 3JWJA 3VSDA 4C0KA 3I62A 2WJ4A 2XTNA 5JXWA 3K31A 1J22A 1TADA 1EP2B 3BD7A 4HDOB 1HLDA 3MYYA 2OWEA 4TS1A 2AG5A 2FMIA 4Y18A 4A73A 3A26A 5CLHA 3MN1A 1NJGA 1QQTA 3FI9A 1R9GA 4X95A 4JT4A 2ANBA 3RNOA 1N34B 1V48A 2CYAA 4UBOA 1GUBA 1MPTA 1XOIA 2ZDHA 3IOCA 2H1WA 3QKRA 5KVAA 1RYDA 1CR1A 1E1DA 1BS9A 1S7CA 2K5UA 3N0RA 3P2JA 4CNBA 5DWQA 5LD2B 3FR7A 4HXFB 3KOWA 1Y89A 4URWR 4OMFG 5DZSA 1NN3A 1XXHE 2EHJA 1ODJA 4D42A 4P58A 5JRZA 1S1CA 4EG1A 2JI6A 4ZCTA 1GPDG 1SZPA 2E5LB 4NFLA 3KPVA 3LBNA 4OA8A 2GHRA 3UO8B 2WU4A 5FAKA 4JC0A 4GDMA 5JAPA 4AG3A 4D8UA 3S7ZA 3PLAE 5J2TF 4E5SA 1UWCA 3RS9A 2CUTA 16PKA 3PZBA 5G4KA 1U4SA 1KYIA 2FFBA 2Y1OA 4L0QA 1Q6YA 1M6VA 2PGLA 5B7NA 3FWPA 5C7YA 3F2IA 1ORIA 3U3JA 3WMRA 3ZGZA 5BV2P 1TUBB 3AR5A 4JJZA 3OD1A 2PX0A 1C81A 4XX0A 5LQCA 3SIRA 4OF4A 1XYVA 2QUBA 3SC4A 1N2IA 2GJ4A 3MRTA 4FYYA 1GFZA 2QN6A 4TS3A 4F9EA 1ZMRA 3OM0A 1XA0A 1QCZA 1S4MA 1YBMA 4GECA 1RLTA 3KDAA 2IUEA 1ESEA 3O4VA 1UFVA 1Y33E 1JIVA 3R6WA 5KDLA 3ILXA 1XXHB 2ZKLA 1P77A 3HB4X 4RTRA 4J6FA 5J2UB 5AW1A 2AJCA 1JDVA 4HNAB 4PZCA 1EEHA 2CJWA 2R47A 4KYIB 2IS1A 4R2XA 3LG2A 4KAAA 1IN7A 3IE2A 4IXMA 4Z9YA 2IODA 4I4TF 1NLUA 2PIDA 2JI9A 3CVXA 3GD5A 4PZPA 1STOA 1YDHA 3O95A 2FRDA 4DJAA 4QU5A 3I09A 4QVKA 3SKYA 4LHEA 2AXNA 2Q3DA 1FMCA 1X86B 4C0AC 3T5MA 2CT8A 2QW0X 4YJ3B 5K3FA 2WSSD 5CLIA 5AKIA 2NO4A 2ET6A 2BF7A 1YHNA 3TRJA 3FDZB 3N8DA 4RJJA 1RWBA 3PPWA 4Y0VA 3VA7A 2DCUA 3AEXA 2MJLA 1YL6A 5IJWA 5KYYA 2XNJA 3JZDA 4MRRA 2ARKA 4CEIA 1CZOA 3MRXA 3E1GA 4PGMA 3EB9A 2ONYA 1PD1A 4M9RA 2GWRA 2WF5A 1ZCFA 3EXG1 3ICCA 2OLJA 1QG6A 4XLLA 3WGNA 3SR0A 4C03A 1EI9A 3U16A 1RQLA 4EG6A 2IY8A 1QG2A 1FP6A 4BL5A 4LDQA 4FFMA 4CM6A 2NZXA 4DDWA 2VRBA 3U81A 4FD2A 3GLVA 3UAZA 5JD6A 3LCJA 4PTYA 4WNCA 4MI3A 1JVNA 4CMJA 4DCTA 3PC4A 3IB6A 3PJFA 4K9QA 1FP7A 5DFAA 1KKUA 2JLZA 1I01A 1BEUB 2I22A 4O5OA 4U6NA 4K5QA 4UUMA 3TOXA 5KHLB 5AIBA 521PA 5ICGA 3GDWA 1F6DA 4N4AA 3DJYA 1CB0A 4TKVA 4JX9A 2A84A 3P9PA 4II7A 2BEUB 3IJPA 4HPJB 4ZAWA 5LB4A 3WIDA 3A10A 1O97D 2FFHA 3X1XA 2WQZA 3SQXA 4EMUA 4BTVA 2ASEA 1VG9B 2PD6A 2SICE 4IIHA 4KO8A 2AL7A 4PYIA 1U1DA 2VPWA 2UXBB 1XKQA 1QRDA 5KJEA 4RWEA 1CQJA 2HI0A 2ZU0C 3S2YA 1KVTA 3SX2A 3S29A 3OKPA 3GXOA 1WHSA 3EXG2 3J81k 1VBFA 1XMVA 3OX3A 4PEVA 1MPXA 4DXHA 4JI8B 2ZAIA 4UDXX 4EHDA 1W2HA 1E6MA 3KOYA 3I05A 4QBHA 4URYR 1VE1A 3SZLA 1GL6A 1R9MA 2JGRA 1Q3HA 2ECPA 2ZAOA 5CX1B 4FDTA 2WE8A 2O0HA 4NU0A 4C2BA 4C4TA 2ANCA 1QZ3A 4ZQIA 3J81A 1G38A 3PC8A 3QE2A 4F71A 2ZYIA 5G3ZA 1JH8A 3IEVA 1FFYA 1HYEA 5DX1A 3DAOA 1FUUA 3MUEA 2ZYRA 3DDWA 1CU1A 1XA3A 2GLTA 2D0IA 1Y34E 1Y1PA 2HPAA 2WVJA 3D43A 1E2EA 5CBPB 3LLCA 1LNQA 1MB0A 4ARCA 3RKUA 4YCNA 3GA7A 1L4UA 4I50A 3R7FA 1GCAA 4R69A 3WB9A 4ZEVA 1DV1A 2HA4A 3K0KA 1X14A 1W4CA 4UBLA 4W7HA 2ONJA 1IXYA 2O8CB 2Z83A 4PINA 4IQ0A 2P40A 5ALOA 2P6PA 2CDAA 5EWMA 4NV3A 2GD1O 4DLBA 2HAEA 1AG9A 3SS9X 4ZMBA 3LRPA 4M0CA 1YJCA 3PQ2A 3TWOA 3HO8A 2G67A 4KOAA 1AN0A 2QZ9A 1U0TA 2X0IA 5GJWC 4LKOA 5C34B 5HHTA 3IT0A 3V6LA 3L18A 3W3AA 5FKJA 3EIQA 4LISA 3H11B 4M1QA 1K3FA 1IPEA 1MOQA 1NBME 2HA2A 4V1CI 5AW6A 2W2KA 1QKIA 1GNSA 1KU0A 2ZE8A 2IXBA 4O4LA 4ENPA 1SKBA 1K4MA 1DC6A 3MTGA 4UCFA 2ZE5A 4TX1A 3OF2A 1Z0AA 1A88A 2NLOA 4NTZA 3OQOA 3H9EO 3SFZA 3ESBA 1W4ZA 1Z45A 4QBTA 3ZWQA 2GJKA 1XLTA 1WHTB 1XQ6A 2ILTA 1L7RA 4S2UA 2JFFA 3LHFA 4KODA 1NSYA 3RYHA 5CA1F 1GQRA 3OT1B 1Y9DA 4OKNA 1FQOA 1W30A 1N5RA 4RC9A 4H7KA 1BD4A 3NBUA 4Z3OA 4V0SA 4RUKA 4Z0NA 1P0CA 1GUZA 4TYPA 1DOZA 1RJEA 4KXUA 2JHGA 2M9MA 4RD3A 4D3DA 2V9CA 3HB9A 1EQ2A 3O90A 5BORA 3QELA 3C6QA 3LU1A 4MQEA 4DQKA 1KZGB 2AOUA 3PFHA 5SYMA 1K9VF 3OCCA 3NHJA 3AR6A 4V0RA 2DUWA 3X1WA 1PJTA 2VS1A 2FXVA 4BRZA 1BFUA 5B1SA 2XPCA 1E2HA 1L4NA 2VRWA 4LXTA 3L8FA 4HH1A 4CPDA 4CMGA 3H9JA 4E70A 1BMTA 2H2GA 1KFCB 4EPVA 5ADVA 2CLOB 3BF7A 4QTTB 1IOLA 2XWJI 2ZPUA 2YCBA 3ORYA 4KDCA 1YFLA 3D4NA 2YOFA 2QXUA 3A58B 3WGJA 4WT7A 2I4OA 3SN6A 4M7PA 3WOVA 1XF1A 3RIEA 1E66A 1JDPA 1W29A 4I4CA 5KOJB 2JZOA 3IUBA 2O5RA 1SXJE 3A27A 3BK2A 4ITRC 2QMHA 3LHSA 1EFUA 1ORVA 4HNRA 5AK5A 3I92A 1RABA 5H81A 1QTIA 4MP8A 4DR5B 1EE2A 5K8UA 5E3HA 1JZTA 3GZNA 1ZD8A 5A5VA 4HAUA 1SBZA 2GHTA 2PLAA 2VT2A 3DBOB 3H87A 1AS2A 1PNOA 3L49A 4JJ6A 4LYHA 5D2CA 4BKOA 5DI3A 4GMDA 3LNTA 2HF2A 1JBEA 3FGZA 3FUXA 4MINA 1YI0A 5KTTA 4DIMA 4YP0A 4UHCA 4W8GA 3SZUA 2GZ1A 1BC5A 3EC2A 1G5HA 1L8AA 3HVUA 2WA1A 3RROA 3NX4A 4R2MA 4WDRA 4QNMA 1CUZA 4P53A 4RY2A 1T5TA 3GCZA 4HZIA 1HKHA 3DMPA 5EPOA 2AG0A 2DBRA 3RHTA 1RC1A 3FOWA 2RHWA 4LJ8A 3SQNA 2IUSA 1LF5A 2JH8A 2Q9CA 2BCJQ 3LW8A 5FBVB 3HJCA 3ZV6A 4A4DA 1J1ZA 4DQLA 4O6VA 4EPTA 5BW8A 4OK6A 2J3HA 4GPIB 4DWOA 5AUNB 1USWA 3C74A 1CV2A 1GSOA 1SXJB 2WVAA 3CIFA 4BWVA 3FWNA 4C22A 4QG3A 3L06A 3ME5A 2FRVA 3FMIA 3S5JA 3CX8A 1W5SA 1NW7A 3HDJA 3RS2A 4LOLA 3LC0A 4BGUA 2OAQ1 5EHXA 3VPXA 3N05A 3IAS6 3PLRA 1E58A 1YCHA 3VKWA 1Q7TA 4MQMA 5CFZA 1XPUA 2FVXA 3NHUA 3IHWA 5ALYA 1BXRB 5D6NA 5A71A 1FP4B 3SK0A 3MNFA 4V2UA 3WX0A 4Q9KA 3R3WA 5L3SA 3DR5A 1D7OA 5JDCC 3V1LA 3WLKX 5EESA 1P1BA 1D2GA 1EUDB 3G1UA 2FHPA 3GRKA 4KR0A 1TZKA 2OBBA 4U9IS 1PT8A 2CLLB 2CB9A 1F8FA 4G97A 2HF7A 4PLPA 3CZCA 3EC1A 5HWSA 3MCTA 4ENTA 2V98A 2EFGA 2HMVA 3H9CA 3NXSA 5EXXA 1QP7A 2DB3A 2IIVA 3E9MA 2NVOA 1UDAA 3K2IA 2GJ9A 4TXHA 2VHCA 1M2KA 5DM2A 4EI8A 3MJRA 1PZXA 1OC4A 1A2OA 2J9ZB 2KYRA 2ZM5A 2A5GA 4BUCA 1B0ZA 2N47A 3VPGA 3OC0A 1P2DA 1HM5A 4RZXA 1VCIA 1DFIA 1NSTA 4Q12A 2FQYA 1PYDA 4UBMA 3BAFA 3FPGA 1Z12A 3KZMA 3NANA 2ZCJA 1EU1A 5FULA 4Z54A 4HCJA 1PZHA 2N1MA 3L4EA 1MCZA 3AC0A 5KU7A 5F3RA 1UEXC 1BROA 1J5PA 4JJAA 2LWIA 4CIDA 4M60A 1OXSC 3EZGA 3O74A 1RQXA 4D0GA 3JAKB 4DDTA 3K1YA 1M1NA 4LJAA 1I3NA 2IEIA 5KBYA 3DLHA 1QZTA 2WIFA 3Q7SA 3Q6MA 1QVZA 4R1PA 3V33A 3SEFA 4YAKA 2GZRA 4MDEA 5GV8A 1P0QA 2GEFA 1OH7A 4LXQA 1NM5C 1A8PA 3AESB 5T8KC 2WJJA 3TNJA 1JAYA 2QMZA 3KHKA 4US0R 5REQA 1E6EA 4KLAA 3AK4A 1SHKA 3WBKA 1BMQA 1RNLA 3ASUA 4UTVA 4MGZR 3RVPA 5LWHA 4M8IA 1T5OA 2RGGA 3ETEA 1L2TA 4IAOA 1U6JA 1C7EA 3D8BA 1YK0A 3OM9A 5DCLA 5K0TA 1E1MA 4MVCA 1IC6A 1D6JA 4OQZA 3VVCA 2ROQA 4D79A 1HO3A 2P4SA 3V00A 4YRCA 4ZGGA 2B9EA 4BGEA 2P4UA 5B55A 4EGCB 1BWPA 2GAJA 4F1KA 4YMGA 5JY1A 4RLFA 3E8MA 2WM3A 2V3WA 3GF4A 4OU5A 4OQ4A 5L3ZA 3SKXA 1T4BA 5G1NA 4TMTA 2OAGA 1H9BA 1BX0A 4AD8A 3JQAB 2XUPA 2JLBA 1MDBA 5B7QA 5JCZA 3DONA 4XDHA 5IVKA 3DO5A 1NC1A 3FCEA 2V6BA 4I5IA 4XOIA 3IAEA 4FZVA 1ZM3A 5EMHA 5JFTA 5H16A 4TOIA 2YZNA 2QA5A 4HH3C 4EY7A 5JYBA 1PWYE 4PLZA 5EA2A 3KR1A 4RD0A 4EA8A 2W6ZA 4DPLA 2YCLA 3A6EA 1CR2A 3DW3X 4WFQA 2O1SA 1XZPA 2II6A 2GRAA 1MX9A 3CXRA 3QLUC 1OFVA 4JBHA 3JU3A 1YGPA 5LP6A 2ZI4A 4P22A 5DGTA 4C4RA 1C9YA 1EPUA 1G6KA 1WDTA 2OLKA 3GQBA 2FMTA 2I99A 5B58T 2C9CA 2ZTHA 1BOOA 4MLPA 2OMKA 4FQ7A 5EI5A 3E23A 4AX8A 1NQ5A 1WD7A 4UEOA 3ICEA 3KL4A 5DIZA 3HN7A 1LNZA 5LZ5A 4TTTS 1GZ6A 4A2QA 3FZYA 3OCVA 1G9TA 2WOOA 3GXBA 2ICAA 3O8DA 5IM5A 4AO7A 2ZUCA 2O8EA 4LAFA 4GEGA 3RAFC 1AV6A 1IDN1 4IDDA 3AI7A 3TZCA 4LJ4A 4NCHA 2CBGA 2BUBA 1N2BA 4YROA 4MUNA 3MERA 4D9MA 4YUAA 2QG6A 1EZZA 3KYCA 3RYFA 5AQ1A 4A15A 4E5NA 3MUNA 3V80A 3WOHA 1COWA 4L2IB 4EARA 4ND8B 3EMBA 3K0AB 1PHPA 4JBIA 4HLNA 1NRWA 4K28A 1JQDA 3D4PA 1I3MA 2NAPA 1U4OA 1T9CA 2QN7A 4O1HA 1KJWA 4UFOA 1RXEA 2A1UB 3T0GA 5ELMA 1PJSA 1C4OA 4KR3A 4RFVA 2REBA 5A2QA 1OC2A 3MMZA 4EKIA 4MB2A 2E37A 3U7JA 2ZJOA 1DTSA 1S5PA 1RQRA 3EH2A 5U9CA 1KR2A 2QQEA 1Y1RA 1HV8A 3AETA 4S2EA 3HXOA 1C3JA 4CQMD 3EA4A 5JI2E 3AXTA 2C84A 5AVZA 5KJCA 3MCWA 4CMCA 3MGAA 3K9BA 4G81A 3I37X 3ZBTA 2F8TA 3FBGA 4IKEA 3D5TA 1JECA 2QP4A 2P62A 1KMIY 3JR7A 3RUDA 4ZT3A 1O9BA 4WCFC 3NWEA 4LMAA 4N3CA 4BNLA 1YB6A 3A28A 4AZVA 4ZI7B 3ERCA 5JALA 2IU4A 2HQRA 4DKXA 1IUNA 4JGIA 4UZFA 4O25A 2OYRA 1K0UA 3C87A 2V0GA 3HYRA 3LTEA 1KI1A 1A8SA 4PQYA 1TM2A 5J4LA 4N8DA 2ORED 1DQNA 2G5CA 3UGTA 1T3SA 1HL3A 1ZDMA 3DNFA 2IKQA 4AJ9A 4ZEMA 1KOGA 3X44A 4UVIA 2VRNA 3ZQKA 1R16A 3IHTA 3JQ6A 4L51A 2V1XA 3PVSA 3K32A 3W34A 3TG8A 2VWGA 1E96A 1XMXA 2GPAA 2PT6A 3A1VA 3CLUC 4QDUA 5HDBB 3V8BA 4ZCMA 3H42B 3IQXA 3UCEA 1IN4A 1C0LA 2H5EA 1G5QA 2W6IA 4J91A 4YMLA 1I3KA 3UNXA 4E13A 4M9SA 1PV1A 3SMQA 4BNGA 1VXRA 3BHMA 3KHTA 3OEHD 4W63A 2KMLA 3I6BA 1TM3E 2NX2A 1XZBA 2YXEA 1KY4A 3I01M 4NNOA 5ES4B 2D6FA 1HE1C 1WXHA 3R5KA 1Q0UA 1V3VA 4PG6A 2AMYA 3BK7A 1GYRA 1XZMA 3KJXA 4J2TA 4F1WA 1JEJA 4HSGA 5F64A 4YJ2B 3W5JA 1VDZA 1EVZA 3AUKA 5HK9A 5JQGA 1P4SA 4JOBA 3DCYA 3DMHA 1E94E 2YOHA 3C1AA 3G79A 3WGZA 1FFBA 3WBFA 1H3FA 4CIBA 3SLGA 2OO3A 2GF9A 4YECA 5CDUA 2IIBA 2VRCD 1XEFA 5D3QA 2P27A 3VGJA 2E6UX 4R68A 3GRAA 3SR3A 1M5TA 2C8LA 2AMFA 2HHCA 3N2ZB 4XEHA 3P2IA 4KNVA 4B84A 5KTPA 3TRFA 3AL0C 3EIHA 2DTDA 1TM5E 4U39A 5C51B 3OKCA 3PXEA 3L92A 3U3ZA 4R1NA 3A6FA 3JALA 1X7YB 1UC9A 1NXWA 1ZG3A 2J4DA 5IDYA 3DDUA 4CUZA 3F0TA 4DGQA 4TLDA 5K6AC 1PJQA 3Q4GA 3DCNA 5EINA 4IQ8A 5AUPB 1PWXA 5AJXA 4E5KA 3G1WA 4RYDA 5KDDA 1Q91A 3PV0A 2IKSA 5EJGA 1CUDA 1L9XA 5AJTA 2VCYA 4R7GA 3TZQA 4IFTA 4UHBA 4JVMA 1XP8A 4CCAA 1P75A 2OFOA 5I4CA 1V4VA 4JKOA 2P3LA 1JR3D 4FGZA 4H3VA 5DTIA 5FOXA 3AFHA 3KQTA 3TRKA 5JZVA 4L8FA 3B70A 3W7AA 2P2GA 1BJTA 4C3VA 1FJGB 1BVUA 5FL7D 3KS9A 1ELOA 3B36A 1ZN9A 4MULA 5JDCA 2H07A 3D2AA 3F97A 3MINA 1FFWA 1G7RA 4QA9A 3VR2D 1RDFA 3PRJA 5JARA 4KYVA 4OQMA 2XVMA 1OHHA 3KJZA 1YB5A 1CF9A 4P98A 3WTCA 4BLPA 1TIBA 2BV3A 4J0KA 4ZEXA 3BJEA 1IZ8A 1EK2A 1X1BA 3ZU6A 2Y0EA 4A5OA 1FFDA 1Y6RA 4M1YA 3K2QA 4X6YA 1SUSA 2XZDA 5AJYA 3FPKA 4LMBA 3HDTA 1RMYA 3FIJA 5BYJA 4JI0B 1FF9A 1YZ3A 2IZZA 1IQRA 4Z1MA 3RODA 2F7SA 4PGGA 3OJCA 1LKZA 1SBTA 3FYUB 3MSCA 4OJYA 3OZWA 4J03A 1ZU4A 4AUMA 1IY1A 2Q2WA 4G0QA 2XKAA 3MMPA 1LLFA 1YJBA 1V7QA 1RWOA 2IX9A 4AF6A 4JI2B 1AU9A 1Z0SA 1ECCA 2NTNA 4PGAA 5LU9A 4QREA 2HLDA 2VI5A 4RFSA 4O2BA 4HEHA 4L6AA 2P6NA 3VO9A 3R5SA 2CLFB 3ZY6A 3WJ2A 4C4OA 2QT1A 4J0GA 4BAUA 4RTKA 4Q19A 3SQMA 1YZQA 1PDWA 1SVNA 2NXNA 9ABPA 5KIAA 1RQ7A 4IF4A 1JPNA 2Q1UA 1G66A 1Z4QA 4NS1A 4ZYYA 1XRSB 3R9WA 4P0QB 4E32A 3BH7A 4B3IA 5E8JA 1TYZA 2B61A 2K6GA 5HZGA 2BDEA 4ALLA 1NM5A 5T8KA 4TM7A 3UKOA 2JL1A 4RTQA 1I3OA 3HGMA 221PA 3VYTB 2JKZA 3DZKA 1B93A 4XGRA 4FCVA 2FGKA 4D3XA 1QH9A 2R3SA 1EMDA 3KTDA 3KXPA 4D4GA 3CSSA 2O2YA 2AG1A 1QHEA 2EGGA 4X85A 3FLAA 5ER9A 5GWXA 1V43A 3RT9A 4C4XA 4WKBA 1MB2A 1QJ4A 1GKKA 2MMGA 4MUFA 4INJA 3BIFA 3Q11A 4IOMA 1J2RA 3WADA 1XZFA 5CDFE 4Y6PA 2BGUA 5AH0A 2JK1A 2WWTA 2JJMA 1MRNA 3O7WA 2J3IA 1CQXA 1S6YA 2QD3A 4QYMA 1JKIA 2A7QA 4WEOA 2C4HA 3TL6A 3V9AA 1Y3AA 3UIEA 1IEWA 4G26A 1YZFA 3NHFA 4I5GA 1C30A 5C4GB 1MBZA 3OPQA 4QJ5A 3R9IA 4IZIA 5DVZA 4RA6A 2FI1A 3JYQA 1M2VB 1ZRMA 4CTMA 1D8TA 4OQNA 3EW9A 4S1VA 3TSAA 1CQIB 1XZNA 3CZ5A 3GN1A 4BPRA 1PJBA 3DM9B 1FA9A 3C7KA 4I6EA 2G63A 3CW2A 2K87A 1P7WA 4LF7B 1GKUB 1XCPA 3GVIA 1Y3CE 3I28A 4GWGA 1LI7A 4TWIA 3I9V6 4PO9A 4DLNA 2EKDA 3I9MA 2PL9A 3IVMA 3RT1A 4C9BA 1A82A 1GZ4A 1EZ4A 3C5WP 3BCRA 3E5HA 3KE9A 4NE2A 4IDHA 4HGYA 4YCJA 3RG8A 3V4VB 3WHIA 3BDVA 3AT1A 2G06A 2QX8A 3AKCA 3RRFA 4MP3A 1CP3A 4V0ME 2IDZA 1U3UA 1AUVA 1RLMA 1PGQA 3O4HA 1CEEA 3ZK8A 1ECBA 4QQRA 4NCAA 3KIPA 4Z4IA 1FP2A 1U0NA 5LQJA 1DS6A 4E1BA 2QB5A 5B7PA 5GJVC 3WQRA 1VM6A 5KYUB 1APBA 1FRZA 3LCCA 4ZQHA 1O5IA 1AHNA 5IPFA 2W2QA 4LJ5A 1EFVB 5AKYA 1O08A 1ZD3A 1QYDA 5K0CA 1X2EA 4OA5A 2QN1A 3ACCA 4RELA 4BU0A 1U1GA 2ZUUA 5IP5A 1G8MA 2MIIA 1KS2A 2AFIE 2VF7A 3DFKA 4RULA 4RTLA 4X71A 2NU8B 3A1DA 2H2AA 4K05A 1XRMA 1OOEA 4H1UA 1NG9A 3IEUA 1K1EA 1RD4A 4HNUA 4EM6A 1H2YA 2QZJA 1YKSA 3IP6A 1DARA 1E92A 1PR5A 2CYCA 4LDJA 5FI3A 2WAYA 3K5WA 2CHUA 4XDGA 3TAHA 4GDFA 1OWPA 3KYDB 2OBMA 4BKUA 1JKFA 2GF2A 4IH4A 3BWCA 3ZGYA 1ML4A 3GDHA 3KXIA 5C8VA 2O2CA 2ZJ4A 2G5TA 2YJNA 1R6UA 3H04A 4KI7A 1Q74A 1D6NA 4G6ZA 3BAZA 1WY7A 1PI3A 1VCOA 1X70A 4FCCA 2DBQA 3PPIA 3EZFA 2OCAA 2Z1NA 1EX1A 3EY4A 3CRVA 1LLDA 3ESRA 4KQJA 4R1QA 4WCFA 5FUMA 1WZNA 1WA5A 2QYHA 3VSAA 1T36A 3PJDA 4PCVA 1WXWA 4NCXA 1TA9A 3GMSA 5LIRA 4W9MC 2AFIB 3OO0A 3NTUA 1DUSA 3WKCA 2YZGA 4FMDF 1UBNA 5AVWA 3A3YA 1NI5A 1WXIA 1H2RS 2QTBA 3I9JA 1N2CE 3CXUA 3IR6A 3PVCA 3AHDA 4HLUC 2P9HA 1Q1AA 2JLQA 4EB3A 2F55A 3I04M 1CUGA 2CHFA 3ETJA 4H3KB 4FSHA 4F5ZA 5KNCH 4NQRA 1TCCA 3V7NA 2FUG6 3LVFO 5BMVA 5J3JA 1XO1A 1XL0A 2CLMB 4BO4A 3NDBB 5DF1A 4D4KA 2EXXA 2BJWA 2YJZA 1ULAA 1HFWA 1QUFA 3STHA 1KA9H 4N3NA 3PXBA 1E3LA 2YHIB 5AI9A 1Z4PX 1TUEA 3A6DA 3GLIE 4IIVA 2B36A 3D54D 3FN4A 3KSDO 4Q4JB 4PZUA 5IYZA 2D1TA 1JT9A 2FP4B 3K53A 5F9HA 1NQVA 1VLJA 1YIOA 2KWIA 4R6WA 4A9AA 5EJ6A 2HWYA 1NXXA 3STYA 5EHGA 4Z86A 1JL3A 2BGTA 4YHHB 1RHKA 2IL1A 3FPAA 3HABA 3BFKA 1E6WA 1ZGZA 1U7XA 4I66A 1BH2A 1THMA 2WFLB 1MGOA 4D1YA 1J0CA 2NV0A 3CNBA 3G0BA 4HYYA 4X1YA 3WK9A 1PFKA 2W71A 1RVDA 1TRHA 5LP6F 1DIRA 3CRNA 1LDGA 1HEUA 2EP7A 4DLXA 1UPFA 1II8B 3TUJC 4MYTA 5CYPA 3DBIA 4Z9XA 2C83A 1N2CB 3AM3A 1LPMA 4JJKA 3RH0A 1KWKA 2ATEA 2P91A 2PUVA 2W8ZA 3QW4B 1HBJA 1EJ0A 4DLWA 4S3MA 1YI8A 5ESDA 1EK1A 3HYSA 4UDOA 3C97A 2GYUA 2A7XA 4R2LA 4DLRA 4CTNA 2EZTA 5JC8A 4M86A 4LNUB 3HFJA 4TXJA 4ZODA 5ALPA 2HA0A 1XMJA 3GLIB 1PIWA 3PWSA 1VXOA 3GRUA 2XIJA 3EC7A 2ZVPX 1I4WA 2NM0A 2BFEB 2WJGA 3T3MB 2KB0A 4L8WB 1I2MA 2QU8A 3LY7A 5HFAA 3W3AD 1GGVA 1NMZA 3A06A 3HB1A 2BIFA 5TS3A 3U48A 2CLKB 2JD2A 3HWSA 2VTDA 3LW7A 1ETUA 4EZEA 1OQAA 4KIFA 3S44A 1JFLA 4MVXA 3RRXA 3FTDA 3H5OA 5KTSA 1OE0A 4HDMA 3ZLVA 4BC0A 5I01A 4RMJA 4JJGA 5D51S 1D5WA 3EGDA 2Y92A 1G4HA 5KTRA 4JXZA 1YZLA 3SS8A 1EKXA 3AM5A 1DLIA 1SB9A 4DOMA 2EG9A 4GLJA 2GN0A 2FEPA 3TQSA 3P4YA 1Z75A 3MMSA 1PE0A 2PDAA 1QHYA 2R9VA 1VJDA 4AS2A 1VMDA 3L93A 1M8PA 3UHAA 3F74A 5EWLA 2X8JA 4YJ2F 4MGHA 3Q1KA 3E5NA 3U4IA 3TIFA 2PD3A 4MGIR 4ZZ1A 4I55F 5HG0A 5JMPA 5K5EA 3K0CC 3QY9A 3FFAA 5I9SA 1E6LA 5B4TA 4KPYA 1UBKS 4KDEA 2YV5A 1ZUD1 3TLXA 1Q1EA 3W5UA 3VSBA 4CM4A 1JA1A 1TCAA 3E15A 3FTQA 4PVDA 3Q7IA 3WNQA 1JSZA 4Q5IA 1FFAA 2ZGVA 1T2EA 3FMVA 4M46A 5MF6A 4BO3A 1IPHA 2OUIA 2ZYHA 4NZ9A 1CLEA 1EA7A 2VL7A 4JHLA 4MOWA 3BIWA 4EG8A 4MVYA 1T9AA 3W5IA 1L5NA 2G1JA 1M73E 2WB4A 3AB3A 4XM1A 1KC1A 5CUQA 4D97A 3TTVA 2W83A 1N57A 4DLTA 2YXDA 4BP8A 1NLFA 3TNLA 4P2BA 2XGGA 3EXIA 2DWPA 4YMWA 9ATCA 1Y6GA 2BKXA 2J5BA 3RAEC 4BP1A 5AW5A 4QE3A 1T0UA 2RHJA 4P6VF 1W44A 2JCYA 5GINE 4A92A 2P0YA 5JSZA 1USUA 3OOJA 1JQ5A 1XEXB 2GJAA 2PKRA 3E8XA 2X8AA 3B1JA 3ZXSA 3PGA1 4MW2A 4ZD6A 3H4VA 1BDJA 4Y3UA 1OASA 4IIJB 1H5NA 1YE5A 3DTVA 3BILA 2DWOA 3QHQA 4N6GA 5D86A 2F3SA 3MTIA 2FR0A 4D4IA 4C4SA 4D8VA 2V6FA 3IP7A 1A72A 4KQKA 4HMOA 2BD0A 1VE7A 1CY7A 1CS0A 2O3SA 2P9EA 2WMYA 3BXZA 3EUWA 2BRUA 4XWYA 2FSVA 1AF4A 1OV4A 2C7PA 2WBLC 2ZAGA 3MWFA 4OBXA 5GZ1A 1EUYA 3KLOA 4U7JA 4DDUA 1GUAA 1QHHB 4YCMA 1YNOA 3G9XA 5ALMA 2OK7A 2FQ1A 1EQAA 2IHZA 1GPLA 2V97A 3I2GA 3OPVA 2X14A 4H08A 1Q3TA 4MKFA 4UBNA 1L4LA 1SY7A 4RVDA 4UOEA 4KE9A 2FOIA 2OVFA 4P7FA 3M6XA 5A6SB 1NV9A 2IS4A 3L6OO 5GVRA 4G36A 1NQXA 4TL8A 3RYCA 4N0PA 5KINB 4RPLA 1GARA 1LDEA 1QX3A 5AK0A 3ZWMA 2Z6UA 1H6BA 1SU4A 3U3DA 1KEKA 3PEEA 2JLWA 1X7GA 3E7WA 4BMVA 4YAIA 4Y30A 1KR5A 2DRIA 2GLUA 3MXTA 1N92A 3Q3CA 3DBHB 5AYVA 4DC0A 2N46A 3GLTA 2QJTA 1RRPA 4HAZA 2F43A 3OPYI 5KDOA 3H2HA 1SHZA 4R9RA 2I5PO 4B8ZA 1KTVA 4IBOA 3WK8A 4DANA 1UP6A 1I51A 1UMBB 1MKYA 5A62A 3WA7A 3GK3A 2H63A 3N7UA 4PSUA 2R66A 4LBWA 3RHFA 5EJIA 4A2PA 2OECA 5ARBA 2PS1A 3IXLA 5EQJB 6REQA 2W2VA 2Y1WA 1U1FA 3E2PA 3TN7A 4MVJG 4MR8B 4LHSA 1THZA 2AJBA 3QI2A 3SXUB 3U4DA 4ARZB 2J3DA 2CNLA 4AMGA 3WWYA 4B6PA 5ERYA 4FFLA 3RIYA 2CMKA 2G83A 5AKKA 3UK7A 1YZKA 1Z15A 1M5UA 3TD9A 1ZHOA 1KIMA 1A4UA 3E8SA 1TC2A 3CRRA 3V8RA 3OZRA 3F8WA 2LRHA 2Q28A 4OREX 3IPAA 2FB9A 2IYVA 3CH7A 1KU6A 4D98A 2ZAYA 4JYBA 5BR8B 1WU8A 4MW0A 3FCSB 1M0EA 1YQUA 4YMUA 3FUTA 4X66B 3MCVA 3TR6A 3DEZA 4O2BF 3VR0A 3WRYA 4P08A 1P1FA 3FY4A 2VR1A 3Q15C 1RLJA 5LR6A 2O7QA 2AOWA 4FFBB 1UXJA 2CXHA 4Z3KA 4PQGA 1R2QA 2JS7A 1QH0A 1FTWA 1RWWA 3U7IA 1AA6A 2XKJE 1Z6ZA 2FFAA 1XRPA 2QRVB 3L0IB 1Z34A 4FC7A 2VYFA 1TTHA 2R6DA 5KJ1A 2HZ7A 1PLKA 1QGUB 1DNPA 2JFGA 4CM3A 4DEXA 4D8WA 3RFFA 2BUAA 3GB9A 1T6XA 2W8BB 4J7AA 1UP4A 3FMPB 2FA9A 4HATA 5IJ0B 1QO0A 3MWKA 2PY6A 3PUKA 1UBGA 4KXQA 4MP6A 1O54A 4ODIA 3RQSA 1EGHA 1Q7EA 1EP3B 2F64A 4OHKA 4E3WA 1QK3A 1W88A 5C31A 3UJCA 4O0MA 1RMQA 4RTMA 2JZNA 5C53B 1USGA 2KLBA 4H60A 2FK7A 2IE0A 4B31A 1K7EB 1DC4A 3PD7A 4O4IB 2Z5FA 4NQZA 5SYNA 3IR5A 3OCYA 4QDZA 1TLFA 1C9EA 4FMCF 3D1JA 2NP7A 4U9HS 2F1JA 3PNYA 5B3JC 3LLVA 1C1XA 1SGWA 1T29A 4MKIA 4MV6A 2L42A 4DQUA 3DR3A 1T9GR 4OMUA 3NOVA 3ZGXA 4FFNA 1JU9A 3GR6A 4X94A 4XIGS 3Q8LA 3A70A 2ISQA 4RIIA 4P3YA 1FFXB 2XUFA 1ZN2A 3A0UA 3IIIA 4GQBA 2QP3A 2X4GA 4X1IB 2X40A 3PICA 4CUJA 2QZPA 1WD5A 2OCXA 4BNNA 2G6TA 4YJFB 3AEZA 4UBKA 4YQYA 4UQPA 2VF8A 4A5SA 2OAP1 4Q9DA 3RC3A 1HLPA 2JFPA 2NYAA 3HN2A 3I9OA 3PC3A 4WACA 1JEYA 3FM9A 4IGFA 1TFUA 2TMKA 1N5OX 3G8AA 3TLGB 3UV3A 2GLXA 4DMFA 4I3GA 2Q6VA 5CGQB 3LPNA 3WG9A 5H3HA 4B4DA 2QVCA 3D8HA 3L0CA 4NZZA 2PUAA 3QFSA 1J8FA 3KLPX 3NBKA 3S40A 2YN0A 1H1LA 4P0PB 3DKPA 3OLQA 3BL8A 1RJGA 1PYOA 2VDMB 2HJSA 5E95A 1BXKA 3WXMA 3QYJA 2X8WA 4YUWA 4WZBA 3UJAA 1S2OA 1QOZA 4BNDA 2AW3A 1M7GA 3RIHA 4AMZA 3UJNA 2CXSA 1V6CA 3B8HA 1FYEA 2IUFA 2FPGB 1KRWA 5JZ9A 4PTZA 2G72A 2BF4A 3LPLA 3DMNA 3BBLA 1DQSA 4QTZA 2QRMA 2O6HA 4JBNA 5A4MS 3PSAA 1OB2A 3FGNA 1ORRA 3TDKA 4DMKA 2JCGA 4RMIA 1R4ZA 4JBGA 2ZEJA 3H2IA 4D56A 1ZXLA 1L7NA 1MO2A 2WM2A 4G5QA 3SNHA 1G60A 2BJHA 5BWMA 4XKJA 1QHNA 2JEOA 3L0PA 3VOAA 3U4QA 2XMZA 2ZJFA 2IYAA 1EM8B 4JYCA 2VAXA 3VPFA 4MGKR 3UT0A 3MT9A 5HKKA 3MIZA 1U81A 2X0KA 2FEAA 1Z4IA 3IRUA 2RAPA 3N1UA 3K0CA 3RVBA 4EHAA 4LBYA 5BR1A 4K0RA 1YF3A 4WN3A 1RFLA 2HNKA 3BZBA 1A9ZA 1POXA 1RYNA 3MWEA 5JAQA 2FE4A 5A4FS 3QPBA 2AMJA 1PS0A 3DZCA 4P3KA 4P5EA 2A57A 5AXDA 1E77A 3D64A 1KI6A 4Y9RA 5CM2Z 821PA 3KTFA 5K6RA 3ZE9A 4AIRA 1BE0A 2QW8A 4CLEA 2C2KA 2PGJA 1IJBA 1OYOA 2R6ZA 4B3FX 2D1YA 2G08A 3K9GA 1E0AA 1Z08A 5AKLA 5ALGA 2A9QA 4BX0A 2W6ID 1E8NA 4MSUA 4OBEA 4PNZA 1BSVA 3RW9A 5BV0A 2K7FA 2ENWA 3TQFA 3AUTA 3A9RA 1YAJA 1JDTA 3U61B 1C7JA 4BTEA 3PHLA 1VBKA 1L5WA 2MTBA 5DIFA 2D5LA 3SC2A 5CFPA 5JS6A 3QUQA 4YP1A 1N6OA 1PBTA 4N12A 5IYZF 4EPWA 3O2SB 3QF4B 3D0KA 4ACAA 5DNAA 3ZX4A 3U37A 4TYNA 1HMPA 4G37A 4WXRA 1XCBA 3MCUA 3BWYA 4HPWA 2A5LA 4J3FA 1GYPA 1Z2NX 2VP4A 4JASB 2PUBA 4Z3DA 1COZA 2BKVA 1V1JA 3COWA 2R6R1 4PFJA 1CUHA 1NVWQ 1QS0A 3SF8A 4PWZA 1A0OA 3VI3B 1BRTA 1US8B 3GLFA 1V8BA 4I8IA 4IJUA 1ZHHA 1Z63A 3MS7A 2HW8A 2R0QC 1WUJS 3AR2A 3CEPB 1L8OA 2QUAA 4DAOA 4Y6GB 4TVSA 4QOEA 1JHDA 1PJ4A 3UWPA 4F1JA 2FQQA 1QK5A 4M3NA 5PGMA 4WKCA 1XMOB 2PX6A 3WGHA 3Q7RA 1OLUB 1ONBA 4XR4A 4AQDA 2VQ6A 3E7XA 4FYWA 3ZWYA 1DRKA 5GV7A 4JEIA 4P38A 2OZKA 1QR2A 1H9AA 2P5SA 2VHQA 2IYXA 2LCFA 1NRJB 3OJ0A 1JHMA 5C1IA 1WZ2A 4HWGA 2IPLA 1X6VA 2QD1A 5EG5A 2HMAA 1XXLA 3AV0B 4MS1A 1CRQA 3U4AA 1K66A 2O14A 2XNKA 3A4MA 4BYMA 5B1YA 1JR6A 1JQAA 4KKXB 3S1AA 3DMFA 3WIOA 3TUZC 5DH9A 3BWDD 1RW4A 4RW0A 3UK0A 4WINA 3HCOA 4Z4QA 2P2SA 2CJYA 3DD5A 2JJ1A 2FPIB 2XWBF 3TDMA 3V5NA 4EHKA 2MDTA 1YULA 2P2NA 2X77A 2VT6A 4AZSA 2C95A 4NRDA 4TKUA 1SAYA 3OZBA 1JPJA 5C3UA 1JHUA 1OHHD 2UZ4A 4DIEA 3VOSA 1I0ZA 3EPPA 2IGTA 3L1JA 4CIVA 5KU1A 6GPBA 1CUWA 4L4SA 1TNDA 4NOLA 4NMWA 3T54A 5AO9A 4RACA 2NSDA 3BMOA 2PWYA 2ZW9A 5C8YF 3GRRA 4EHHA 1EFCA 3BWBA 3MJEA 4UM9D 2AZDA 2JLRA 4XCVA 5J9FA 5KPDA 2PGDA 3S28A 2XADA 2HJ9A 1I2DA 2J59A 1CEQA 2BI7A 4KIWA 3OEED 4U7WA 3UQYS 3V7FA 5BQXA 2FPKA 2ID9A 5ICFA 3SE7A 4B45A 4CFYA 3MGGA 1S2MA 1ULZA 4M89A 8ABPA 2C2OA 3UPDA 4CM5A 4EJ2A 3RLFA 3A4YA 1CC1S 1LGYA 1LSJA 1M0SA 4U7TB 1T8PA 1M54A 1KQOA 1K6EA 3AMVA 1SHLA 3E70C 3OP4A 4OKIA 4RZHA 4ZVLA 1SXPA 2VOEA 2YIVX 4IMPA 3TD2A 4PX2A 2ZIXB 4OHFA 1C3LA 2O8DB 4IZ6A 4X6UA 1KQNA 5C46F 4A36A 3T3OA 5CRIA 3H3FA 3ZQJA 3V2HA 3DB2A 2GHIA 1ONNA 1Q77A 2Q5LA 3D4BA 4K6GA 3QE0A 3M9WA 4KX5A 1EAMA 1VJCA 4N5MA 3NATA 1P81A 1ZUNA 5F1PA 3W5DA 1ULTA 2E18A 2XMGA 3V2UA 2DXIA 1OKKA 3LQKA 4A6XA 2UYCA 4JZKA 1U90A 4LVNA 3TZ6A 2EBFX 2YASA 4RKFA 5BXYA 4ER7A 2ZBDA 3HJUA 4CV3A 3AVTA 1KXZA 4QYIB 2J85A 5JXGA 4HQLA 4E4YA 5I4IA 1OTYA 3TOVA 2WDPA 2AR7A 3D0RA 3UWSA 1H2ZA 2JFNA 1QE0A 5BN5A 5ANRB 3F9CA 3E2IA 4ERXA 1W25A 1JLRA 1KI8A 5ETJA 1XLUA 4ZCQA 1P7PA 5B3KA 3FF4A 4WA7A 2W70A 3W6NA 5TMPA 2WSMA 4DB4A 3DYBA 4Q1EA 1H8HA 3ABSB 3A7EA 4FR5A 4J7UA 5B3LA 1QG0A 4PZLA 1FTGA 1C14A 2B20A 4P35A 5KSZA 1UT8A 4GEKA 4CLOB 5C7OO 1UM9A 4ZHQB 1JE1A 4BVJA 1UEIA 2XCRB 3DFUA 1OLXB 4XWAA 5D1HA 2JBAA 4UTZA 2B8EA 5BR4A 2CHEA 2D0OB 4BGDA 3JARA 5CNIA 2J0UA 4L8VA 5AESA 4UQLA 1OILA 4DGSA 4PCUA 1WW2A 1VSTA 3VNVA 3OZ7A 2Q41A 4TVKA 2QLBA 5K0JA 5LUAA 3DLCA 5HNKA 2G9UA 4G2TA 3I32A 3LP5A 3NGXA 4KE6A 4M49A 3LP6A 5JH7F 3W5AA 1WUYA 2GKGA 2FWJA 3ETGA 3UZUA 1CW2B 2XUOA 2ODQA 1IRIA 4LOAA 3EOAI 1QIDA 4MWOA 3ZWXA 1JQEA 2X7HA 4PXSA 4A2WA 1TQ6A 2XUZA 4MUMA 4B87A 1Z4LA 2JAXA 3GGOA 4NMMA 5CB4B 1GIAA 1J8MF 2GN6A 3CVJA 3QXXA 5B1DA 5TX7A 4KQMA 2HMWA 2VK4A 1V1MB 3CLKA 1J0XO 4FWIB 2A8YA 5FR2A 3W79A 2NOAA 1SNYA 3UGJA 1GZ3A 2G09A 2YWGA 4DM3A 3O93A 4U63A 4A6PA 1P9RA 2X13A 2J45A 1Z73A 2OR3A 4YAFA 1IONA 1CHNA 5TQ0B 2QTGA 3GCDA 2GQ0A 1U9IC 1XZEA 2EFJA 5BNWA 2OCBA 5I7EA 3LGXA 4YGXB 2F67A 3WSTA 4HHEA 2G9ZA 3LA6A 3NRCA 4L5BA 5CXUA 4KAFA 4XGQA 3N58A 4RWZA 2CB0A 1LH0A 2REQB 2ZBVA 2HEIA 1ZIXA 3O9MA 2PZJA 3PUYA 5FLKA 2ZWMA 1OFIA 1FUYB 1E2IA 4KUGA 3C70A 2C3MA 3SJ7A 1WZIA 4LVUA 3TBFA 4C4PA 4EY3A 1HDYA 2UVPA 2HU2A 1JH9A 4WFKA 1FSPA 3IQGX 1UMCA 4ZI2A 2NV6A 3BQMB 5K09A 1P6QA 1UC5B 1KWGA 1JWBB 1B8VA 1PT7A 5DYWA 2VQFB 3QEBZ 2JGAA 1P2VA 4OBBA 4BV8A 1A9TA 3VC7A 4Q48A 3ZNQA 4EYOA 2E6KA 1TEZA 5CR9A 2I67A 4N40A 4OKSA 3I8SA 2NWQA 4M1OA 3H1BA 4UFNA 1Z2CA 4UXJA 1QRTA 1P8AA 3FNQA 4INPA 3KB6A 3URMA 4JC4A 4LF6B 1PL8A 2OHGA 1ZJ4A 1JRLA 4U0KA 3AF2A 1Z35A 4TL9A 4UULA 5AOBA 1VMEA 1Z6YA 3I42A 3CKLA 1WPGA 1QNLA 2R7LA 4P2GA 4RZ2A 3EAQA 4UDNA 1NJ8A 4AJIA 1MB4A 5D5PA 4B7XA 1R8YA 3JV7A 4AX4A 5AICA 1YCDA 1ZQ9A 4MAFA 2P9GA 2IZ0A 1GCUA 3OMWA 5D00A 5KOHB 2D1RA 1GPH1 1U8AA 3JATA 5JECA 2V5AA 4ABTA 1JSXA 3QPCA 1MO3A 2VCEA 3CLUD 5G4KB 4ZQEA 1CJTC 3AJRA 4O3MA 2PZ8A 1M6VB 3Q0EA 2B8TA 1SURA 2VF5X 4KPFC 3WLRA 4JL8A 5KTMA 4F9TA 4S04A 2FN7A 3GJTA 3AI2A 4JU8A 3CEHA 4G8JA 1J9EA 2P90A 4YRAA 1F9AA 3NHZA 3RD5A 1OPRA 1R7RA 2WI8A 3ZR4B 1SD5A 3BWMA 3M3PA 1P1KA 3NP7A 3W8EA 2BE9A 3TLEA 1C7IA 1YDMA 1G8GA 4BQQA 3BTUA 3RVRA 1N2JA 4DCSA 3QU5A 1EXDA 4KIUA 3NTQA 1WEHA 1NLMA 2P2CA 3CX7A 4TLEA 2AHOA 2ERCA 3PFBA 4QUJA 2OHOA 2WUVA 4RA9A 2YHUA 4EEXA 2JIOA 4UAGA 3A3KA 2FR1A 2DU8A 5C80A 1PFVA 5AW2A 3HJGA 1Y8ZA 4FB5A 1O3YA 2NZYA 3GGSA 2M6RA 3ESAA 4AF8A 2OORC 2OB1A 1P5JA 3KSRA 4KFSA 5JMWA 2W2MA 1XEWY 4A8TA 3V7UA 1J24A 1EFDN 3CUSA 4OSOA 4KRXA 5CFOA 2DPGA 1MJNA 4RAQA 2BHNA 4IDFA 4P82A 4JI7B 4FMBB 3H19A 4KIJA 5AJVB 5IULC 1Z0FA 3BSWA 2OGSA 5G40A 3VR6D 3CVUA 1AZTA 1D4OA 1PWZA 3PT9A 1I0LA 5K9ZA 5K3FB 3K70C 2FLKA 1BDBA 2J3MA 3AEKA 4I1OA 4E14A 5IN4A 4TQUS 5JTTA 3ODGA 4BJ1A 1KEPA 4FFDA 2YVLA 4WL0A 5CT8A 5DYYA 2WWXA 4QTXA 4CEIB 2F4NA 4ZMRA 3VAAA 2F3QA 2NACA 3BG5A 1E2FA 1E2LA 2D00A 1CQWA 2Q2OA 4RSMA 5B57C 3PJRA 2ZIVB 1RTKA 2JIPA 4F85A 4FDVA 3ADKA 3L6DA 4HPXB 1M75A 1DLJA 2OBNA 5AK3A 1MC5A 4PONA 1PTKA 5JSYA 4R6XA 1J1IA 2VHEA 4N47A 1XCMA 3D9QX 4CU5A 4GMXA 1DIAA 2Y27A 4ZRDA 2NXWA 3GJXC 3KVYA 1PT6A 3LBIA 2GBGA 3KK0A 2GRJA 3VDNB 1E2NA 2B5OA 1RI4A 2QRQA 4F5DA 3T1QA 3D0OA 1NPYA 4NBLA 2BGJA 3O3CA 3LKZA 4LQLA 4OMDA 5AUOB 1BDIA 3UPUA 1Q7GA 3GLKA 3VHLB 3KSMA 1P74A 2JIRA 4JVNA 1XE3A 3KDPA 1LK5A 2PK3A 1YD7A 2QZ4A 4J0EA 4XSHA 1A77A 3OX1A 1XYGA 1X7XB 1CQJB 2ISCA 2PT7A 2Z95A 4MX8A 4WV3A 2MSNA 4BKRA 1V96A 3SQDA 3VOBA 1O77A 2XT0A 3TUIC 2W4MA 4HXEB 4J29A 4TQAA 1KH1A 1F6BA 3IUSA 4L57A 5L7YA 5AM4A 4E33A 4M88A 2FDXA 1I6MA 2DFNA 2XE6A 1DCFA 3ZC3A 3TJZA 3ROQA 4M21A 3U60B 3UOGA 4HOYA 5WRFA 2BEVB 5E6UA 2XOEA 4HZGA 5TEVA 4A0HA 1JEQA 5AW8A 1NJ5A 1OZGA 1R5JA 3TCKA 2R2GA 3FRJA 4R9VA 1BE6A 4DXAA 1CDZA 4FE7A 2VBIA 4OM8A 4AURA 3AF5A 2REXB 4M0PA 1W8DA 3SSMA 3MLBA 3CCFA 1Z6PA 2P3OA 5JCJA 3ZOKA 2XQJA 3R0IA 1AXRA 5EGSA 1F4LA 3FRHA 3ZZ1A 1BE1A 5EZYA 3DTVD 2BFCA 5I9LA 5EWMB 5JO9A 1QDUA 3W2TA 3OM1A 4LC9A 2YJ6A 5BPFA 1MX3A 3CO0S 4UBIA 1T2DA 2DY0A 3UGKA 4QOIA 1II0A 2R87A 5LL6P 2QTVA 1EXNA 4UEQA 3ICPA 1GADO 2BAGA 2OCIA 1MRSA 5BSKA 1A9YA 1DV2A 1TM4E 2QI9F 1TVCA 3JVDA 2AMLA 5FUYA 2WV9A 5BVHB 1U0OC 2AQKA 5EKSA 2XGOA 1N5DA 3WGMA 4TWRA 2QTMA 3T7AA 1OWNA 1X2BA 2Y1KA 3FFBA 5DW0A 3GJYA 4O4LB 3ITKA 2FSFA 3SY8A 4XPIB 1T9BA 2X15A 2WHYA 2B37A 3ZLJA 2OESA 1ZIPA 2DYKA 2A5FA 2ODTX 2DM6A 1K98A 2AUNA 3TFQA 2DERA 5A06A 5A03A 1UWVA 3VI4B 5BY2A 3EGXA 2QAIA 1N5KA 1WB5A 2UZ1A 3CB4A 1F14A 1YZGA 3AINA 3QHPA 2M6SA 3RYHB 1P9WA 4Q3CA 2VDWA 1H1TA 2D4AA 2ZYSA 5LQNA 4G0XA 4MB0A 5CVJA 1D1QA 2CCJA 3I4LA 1IMJA 1Y3DE 1Y7HA 3LCVB 1BW9A 1F8XA 1J09A 1AKMA 3JQBC 5JS1A 3B2QA 2CL0X 4BJ3A 4BKPA 3HRKA 3L7DA 1FNCA 1GRVA 1B16A 3IKVA 3M6IA 3QELB 4AO8A 2PD4A 2QORA 2PYZA 3FMOB 1QTRA 2H7YA 2Y66A 1ZS9A 1U9IA 2AOUB 4Y1RA 3TPCA 2UU9B 2IYWA 3QLJA 2V3CC 3ISVA 1UANA 2ASVA 2ZTMA 1WG8A 3FHOA 4GBMA 4XI9A 1BYUA 4XVUA 2GTHA 2A3NA