5BRJA

Structure of the bacteriophytochrome response regulator atbrr
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
140
structure length
140
Chain Sequence
b'PELRPILLVEDNPRDLELTLTALEKCQLANEVVVARDGTEALDYLNVTGSYHNRPGGDPAVVLLDLKLPKVDGLEVLQTVKGSDHLRHIPVVMLTSSREEQDLVRSYELGVNAFVVKPVEFNQFFKAIQDLGVFWALLNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Two component response regulator
molecule tags Signaling protein
source organism Agrobacterium tumefaciens ccnwgs0286
publication title Arm-in-Arm Response Regulator Dimers Promote Intermolecular Signal Transduction.
pubmed doi rcsb
total genus 45
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2015-05-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5brjA00
2PKXA 3BREA 3M9WA 3O2QB 4P98A 1JFVA 3OMWA 3CTPA 3QEKA 4MR8B 4N0PA 4O1IA 1R8JA 2IDMA 3E61A 1SRRA 5CHYA 5FWXA 4MLDA 2E4XA 3JY6A 2A9RA 1W9HA 2RGYA 4MLCA 5T3YA 4DN6A 2I6FA 1JYEA 3QLTA 4Z4GA 2R4QA 2N9UA 6CHYA 4ETNA 1KGSA 3RQIA 3TO5A 2HPHA 1DC8A 1A0OA 1K68A 3TD9A 3RVOA 5T7BA 3IDOA 3CG0A 3GV0A 3BBLA 4KREA 5F64A 2FEKA 4EYOA 1CHNA 2JVKA 5C5EA 3C6QA 3DBIA 1YMUA 4LDZA 5TPWA 3O1JC 1TVMA 1M5TA 3TX6A 3GYBA 3I42A 4MS4A 2XDYA 1BAPA 2L2QA 4Q7EA 1LK0A 4G0XA 4NICA 4ZJPA 2IPLA 3LOPA 5BRAA 2ID9A 5PNTA 4YRZA 3KHTA 1BVHA 4Z4FA 4HYEA 5IULC 3P9YA 2W42A 3GT7A 2FQWA 4RWEA 4TMYA 4F12A 1DC7A 5KC8A 4RKQA 3RVLA 4G97A 1ZESA 1DBQA 4MS1A 3DGEC 1PNTA 4XFKA 3OQOA 4PE5B 3HK2A 3L49A 3O2JA 3H5TA 3UK0A 1P2FA 2GKGA 3RVPA 4RK4A 1QP0A 3LUDA 4IF4A 1DRJA 3HCWA 4RDCA 1U0SY 1YMVA 2NT4A 3JVIA 2L19A 1UDRA 1MAVA 4KV7A 3LUJA 5JS2A 3H1GA 3TMYA 5TQ0A 5IEBA 1DBWA 1QNLA 2NZUG 3IP6A 3KLNA 4Z4EA 1OXKB 4MS4B 2FLKA 1MB3A 2JK1A 3H5OA 4L85A 3RVKA 5KI6A 4XXHA 1JDPA 1FFWA 1ABFA 3LUFA 3BILA 1C4WA 1MVOA 3DGFC 1GCGA 5JNUA 4FE7A 4N41A 2LPMA 1Z13A 2IPMA 3MIZA 1QQAA 4RXUA 4DQDA 8ABPA 3OO0A 3IP9A 4G0YA 2AYZA 2PUEA 1H9CA 4ZMSA 2PL1A 2FMKA 1QQBA 2OQRA 5CNMA 4Z9BA 5JNSA 2PAFA 1EAYA 1MIHA 4KRFA 5DKFA 3C97A 2F8SA 2P9HA 3CU5A 3VNAA 4ML3A 3Q15C 1XWWA 3GRCA 4IMIB 3CLKA 3KTOA 5BQ3A 4W5RA 3SNKA 2PUGA 1D2AA 1AB6A 2V0NA 2JRLA 4XLTA 4YP9A 1KRXA 3QELA 2YHBA 2JBAB 2GI4A 5IUJC 4G0QA 2QZJA 3Q7TA 1TLFA 4XASA 3OQNA 1NTRA 1TMYA 3D8UA 4RK5A 1ZHHA 1D5WA 2YHAA 3N0WA 4RK7A 5KQGA 1S8NA 3CZCA 4MQFB 3UUGA 1DZ3A 1SXHA 4FE4A 4MS3B 1Z12A 1ZDMA 2MYUA 1P6QA 1L5YA 2FMFA 3IPCA 4TLLB 4WXMA 1ZITA 1RZRD 1YK1A 2WY2D 2MYTA 1JFTA 2WJWA 3HSYA 3T6KA 4OLAA 4OTZA 4KPYA 2FMHA 3OLXA 5D2CA 2VUHB 3NBMA 3HDGA 3DLHA 3MYYA 3KG2A 1DJMA 3ROTA 3LKBA 4KQ9A 1LBHA 1RPJA 4W5OA 5IUNC 1OXBB 1GUBA 9ABPA 1KMIY 4ETMA 1Z2EA 3JS5A 7ABPA 2IPNA 3FMVA 3CRNA 5I4CA 4MS3A 1QP4A 3FFXA 4EYGA 1E6LA 3O1IC 5CNJA 5EWLB 3EQZA 1Z25A 2MSLA 5IBQA 2MSWA 2L18A 4RS3A 2FKAA 3HM9A 1PUXA 2RJNA 3T38A 4YLEA 5EWLA 1DP4A 4XARA 2A9QA 5HSGA 1U8TA 2NZVG 3ROFA 1DRKA 4F3TA 4JA2A 4DADA 2QW1A 1TM2A 2FSPA 2RJOA 1DBPA 3CZ5A 3GA5A 2R47A 3CFYA 4PEVA 4KQCA 1NATA 2IPAB 1ZGGA 4ZMRA 1I3CA 5HKOA 3LUAA 3NNNA 1HEYA 1Z17A 2FEWB 3Q7RA 1ABEA 3I09A 4EVSA 1JFSA 4KMRA 5GQSA 5KQPA 1JF8A 3EDCA 2DRIA 2FQXA 3NNSA 3F7NA 3N53A 5KWSA 4MR9B 1M5UA 5JNVA 2LBPA 5JNRA 4E7PA 2FQYA 2FMIA 1ZN2A 4D6XA 4PZ0A 1NXXA 2HQOA 3LTEA 4G0OA 1Z15A 3QEMA 5ABPA 1YVUA 2FN8A 4YV7A 5E3JA 4IGAA 4Y9TA 1ZY2A 5IEJA 3D02A 2A9OA 2QU7A 3IP5A 4LE2A 5TPWB 5HQJA 3HS3A 3N8IA 4XAQA 1DG9A 4H60A 1RXEA 6ABPA 4KFCA 2PUBA 2P4UA 2HQRA 3KKEA 1D4ZA 2KYRA 1NY5A 4LX8A 3FDFA 4QPJC 4EVRA 3LMKA 4LE0A 5TE9A 1FFGA 2FW0A 2X7XA 1CEYA 4NV3A 3H5IA 4EYKA 4YS6A 3S99A 4CBVA 3NNDA 4MR7A 3OLVA 4Z4IA 4MR8A 4WXEA 2LP4Y 3MF4A 2R25B 2GWRA 2ID7A 4N47A 1NXWA 2MYNA 5IX8A 2QVCA 2CHEA 3HUTA 4O5AA 4QYWA 4JB0A 5EWMB 3O21A 4KVFA 2IYNA 3H75A 4N76A 3SQNA 4LDAA 4RK6A 2VYCA 4LZLA 2PJUA 4F11A 3O1HB 3N6VA 3O75A 3EULA 3BRQA 3A3KA 3JPYA 4LE1A 1D1QA 2TMYA 1WETA 4Q6BA 4WT7A 4HNQA 3H1FA 1F51E 4HNSA 4RV5A 3EODA 3UKJA 1DCKA 1VRVA 2GX6A 4EY3A 5HM6A 1ZAYA 4IRXA 3LUHA 4ZYLA 3LKVA 2JVIA 1EHCA 1NXOA 1RXIA 3LUKA 1K66A 2PLNA 3QELB 2E4WA 3A10A 2CWDA 5IC5A 5KC9A 1JL3A 4FB4A 2WRZA 2JB9A 3CG4A 2BGGA 3ILYA 1M2FA 4G0ZA 1APBA 4EGSA 3GBPA 2WB4A 3N0XA 2PUFA 1YIOA 3HXMA 2PMCA 1DCMA 3GL9A 3LUCA 4S05A 4WWHA 1SD5A 3EJWA 3CKMA 4YWHA 2LIVA 3OLWA 4PYRA 4QYMA 1NXVA 2FVYA 3MA0A 5FWYA 3KYIB 3JPWA 1VLZA 3C3KA 1EWKA 5BRJA 4UHJA 4KK3A 3KSMA 4MYRA 1BDJA 2Q5CA 2QR3A 5DTEA 1BDIA 4RXMA 3EAFA 3O74A 4OLBA 4JB2A 3DZDA 4IMJB 4RK1A 1Y1LA 2J48A 3C3WA 4Z0NA 1JWLA 1NXPA 1QMPA 2FEPA 3HUUA 4MQFA 3SAJA 3MQ4A 1SXIA 1T34A 4KNYA 1YTUA 4P1ZA 5FWXB 3OO1A 2O20A 2IOYA 4F8JA 3OQMA 2AYXA 4RKRA 3CNBA 3RVSA 1EWTA 2QVGA 1A2OA 3Q7SA 1U2QA 2JCGA 1B00A 5C5CA 3SM9A 2ZWMA 3H1EA 4IILA 4Z4HA 3O2SB 1JHZA 4RK0A 4RSMA 1BDHA 1JX6A 5DGCA 1GUDA 1YS6A 3H6GA 2JVJA 1E6KA 3G85A 4D74A 2HSGA 5TQ0B 3SG0A 1PHRA 3E3MA 4QICA 1Z16A 2CHFA 1QO0A 2WWVD 5GOTA 1L5ZA 3RH0A 4Z9AA 2M1ZA 4JAVC 4MGEA 4OATA 1JDNA 3BRSA 2FN9A 4GNRA 5IUKC 1FQWA 1M2EA 2PUDA 4RY9A 3K4HA 3GBVA 3VNBA 4JASB 1MB0A 4G86A 4N0QA 4MR7B 2PUCA 2H3HA 5TQJA 3RVJA 1USIA 3MM4A 1PNRA 3QLUC 3QLUA 2E4VA 3CHYA 5TQ2A 2CD7A 3HZHA 1A04A 1QKKA 4EVQA 4H3KB 1LJUA 3KLOA 3RVQA 1ISRA 5FBKA 3EGCA 1Z26A 1EFAA 1U04A 3HO1A 5EWJA 2GBPA 2RDMA 4Q6WA 4EYQA 5BR1A 2IKSA 3JTEA 1KRWA 1QO0D 1VPWA 4MQEB 5ED4A 4MRMB 2QXYA 5EWJB 1QPZA 3W9SA 1NXTA 2NT3A 3M9XA 1QP7A 4F06A 4Z99A 1W25A 3LUGA 1ISSA 2VUIB 1URPA 5JNTA 1Z2DA 1C0EA 2HQBA 3TB6A 3M6MD 3GWGA 3N75A 4ETIA 1FFSA 3QK7A 4UHKA 3FFTA 2H0AA 3L6UA 5FBHA 1FSPA 3QLVC 3QLVA 3QX9A 2E4ZA 1ZGZA 4RZSA 4G0MA 3OM0A 3OLZA 2A9PA 4NCAA 3HJFA 4TLMB 2FLWA 4MPTA 4PICA 1AB5A 4KZKA 4ZPJA 5DLEA 5CNKA 3K9CA 5FWYB 1BA2A 5JNWA 3KJXA 4NQRA 4TN5A 3F73A 4WUTA 1YS7A 3H5LA 3KS9A 1E2BA 3KCNA 3SY8A 1LJLA 4M88A 1USGA 1ZH2A 1CYEA 3H5VA 4N03A 2L17A 4MRMA 4W5QA 3DLBA 3H5WA 1D1PA 1DCFA 3B2NA 3CS3A 4B09A 1U2PA 4RY0A 2OENG 2M98A 2MYPA 3JVDA 1JH9A 4LRQA 3Q41A 2JBAA 1SXGA 2HJ9A 2ZAYA 4RU1A 1Z18A 3LFTA 3HEBA 3OM1A 5EWMA 1LBIA 3RVNA 4O1HA 3QX8A 3A0RB 2PUAA 4L4UA 2FXIA 4KK4A 1JYFA 5JS1A 4MR9A 3H6HA 1VKRA 3Q9SA 1P6UA 2PL9A 1PEAA 4G0PA 3HDVA 3N0RA 1PEYA 3IPAA 5B3JA 4MS1B 5B3JC 4E7OA 4JP1A 3C3MA 3NHMA 4H3HB 3ILHA 4NCBA 3QEMB 3I45A 1JLKA 1GLGA 3MMNA 1JBEA 4RXTA 1IIBA 2QV0A 1YK0A 2MSKA 3R0JA 3OMXA 1NXSA 3T95A 3F6PA 4W5TA 3OLYA 4YO7A 1P8AA 3F6CA 4OBBA 4W5NA 1E6MA 1ZH4A 2WJAA 4D6YA 4YR7A 1EWVA 4MAAA 3URMA 3RVMA 1F4VA 5TPZA 1USKA 2QSJA 4HNRA 4RY8A 1RNLA 3EQ2A 2E4UA 3NHZA 5KQMA 3G1WA 4JOQA 5KQLA 1RZRA 2LUOA 5TQ2B 4OG2A 4S04A 4YGXB 3I5AA 4GPAA 3IP7A 2E4YA 4MQEA 3A0UA 5DCLA 3FFWA 5CNIA 1ZVVA 3KYJB 4EUKA 1XHEA 1XHFA 3RVRA 4Z4CA 3T8YA 2VK2A 1TJYA 2NUBA 3HVRA 1GCAA 2F8TA 3HV2A 2B4AA 4WZZA 2PE5A 1J56A 2R48A 4YCSA 2FTKE 2WMYA 2B1JA 5TPZD 3FGZA
chains in the Genus database with same CATH superfamily
1A71A 1JZTA 1N92A 3V1TC 4D9GA 3KOUA 1N7IA 1NI3A 1PT5A 2J6CA 1LX7A 5K8LA 3WWCA 2A14A 5BYBA 3KSRA 3RYTC 1SRRA 2Q4TA 1KJWA 3QKRB 3C1AA 4M60A 3ROXA 4C0XA 2C2HA 4EI9A 1OIVA 2E0IA 2R4QA 4IH9A 1K4YA 1XA0A 4NQZA 3SM3A 1K68A 1JMKC 3BK1A 1LSJA 3A06A 4PNZA 4G9GA 1AK2A 5AHOA 1GZ7A 1M0SA 1N7JA 3GDWA 4PPNA 5AYVA 3V7UA 3KWMA 4AS1A 1S2OA 3QPUA 3NAZA 2ONJA 3OWXA 1TCVA 5HEKA 3U7EB 5GGYA 1QYDA 3ZHTA 2V9PA 3D5EA 2AW5A 2O0KA 2IS2A 2AWOA 3DXYA 1PWXA 4WFQA 1Y9EA 1F4LA 1L5OA 2AFRA 5DBFA 3EWNA 4ZJPA 2JRCA 3NC1C 2F4NA 1E1LA 2W71A 5BRAA 4Q9IA 2QZZA 2XQIA 2QTWB 2NU9B 1FSGA 5ELXA 2VZEA 1DOZA 5CXQA 5DTMA 1JEQB 1EWQA 1WXEA 2BJWA 3QNWA 2W42A 1QYCA 2CVZA 2VYND 5KIAA 5CJ2A 3M6IA 2EG9A 1NZJA 1AUQA 2IH5A 3TDMA 1DC7A 2X9QA 4JDUA 2AE2A 3ETDA 4BLRA 1OREA 1IB6A 1XXHA 4JI5B 3A26A 1OLOA 2JJMA 4B47A 4Q19A 1CS4C 2HIGA 3L49A 3NBYC 3OPXA 3MSXA 4QPPA 1JBQA 1Z7BA 3KAJA 2PBLA 3DZJA 4KU4A 1U0JA 2VF5X 4L4RA 4BGDA 3VJKA 1ZBDA 3SJCA 3VPBA 5LNK1 4U9IS 1U0SY 2I65A 5IXSA 3KXDA 1WTCA 5KKCA 5DI3A 4LHVA 4RFLA 3WK8A 4FGSA 3NJRA 1QYWA 2Z95A 1DBWA 4QPCA 1ST2A 2ODPA 3HCRA 4A0FA 5BV8A 3B5IA 2IEZA 3GN1A 1UDCA 4JJFA 3RJZA 4FCWA 5IK2A 5FBLB 1DZIA 1FY2A 1V1MB 2Y0CA 3DD5A 5F23A 1KQFA 2WWHA 2ORIA 4OMFG 3PICA 3V46A 3NR2A 1EK5A 1FVXA 3GUZA 2D74A 5D5QA 4BEBA 4L3VA 4WRRA 2X8BA 1G8GA 2JS7A 2YUIA 2C2ZA 4W99A 1HGXA 3A7EA 4M0FA 3C74A 4QAQA 3IERA 3NBKA 5F7OA 1UJ5A 4ZMSA 3AOGA 3ONNA 4MGYR 2FI1A 3EYAA 3NXKA 4Y6PA 1F7UA 3DE6X 4PRZA 5TVKA 2CF6A 2D1SA 2UZ0A 2IHNA 1T3HA 1DBSA 2NZYA 3QW2A 5J2UB 1I14A 1RYZA 1Y4SA 2F8SA 3VNAA 4D25A 2GK4A 3TD6A 5HFJA 1KSHA 4HUTA 3N1UA 1NVBA 1Y37A 1EUCA 1AGYA 2EJBA 3GI1A 4DR1B 1BS2A 4HL6A 4N9WA 1RPZA 3OD5A 5H5JA 3TNDA 1AE1A 4ZQCB 2VLBA 2X3YA 3ZU5A 3DMPA 1LDEA 1EBFA 2G4VA 2IYSA 2ORED 1SIUA 2QMYA 3KLPX 1O94A 3AZQA 2IYQA 4EKYA 3R9WA 3ZD6A 2IUFA 3KDPA 4BHTA 1CW2B 4H1WA 3LLUA 3IKJA 1GSAA 1SXJC 1GSOA 1XL1A 2OHHA 3QUBA 4UULA 3TCKA 3WYDA 3RAJA 1UPAA 4BRUA 1JFTA 1J70A 2WJWA 3WLTA 2WLTA 5ICSA 1NVUQ 4BS9A 2YN4A 1ENYA 2Y1KA 4GEKA 3CNEA 3FSJX 2HYIC 5JMTA 3Q5GA 3PFBA 2OBLA 1K89A 2AZDA 3E48A 1C9MA 1J39A 4P4NA 4BFWA 5K4GA 2V7QA 1BJTA 3KFXA 5L4SA 2XH8A 2ZRFA 1IXZA 1LBHA 2DMRA 1MQ8B 4G0VA 2GH1A 1CLEA 1GUBA 3TKLA 4ETMA 4KNWA 4TV8A 1OFUX 3T9EA 3ZYCA 3GK3A 4JP8A 2VF8A 2C5EA 5AJZA 2XUGA 3DDSA 3K72B 3OP1A 3W2FA 5KNDD 3I12A 4BEWA 3RASA 2R8EA 3FIJA 3U4QA 3SR3A 2Q6KA 4FJ0A 4DL9A 1V26A 1V8DA 1RQNA 1ZD9A 4M9SA 3GFQA 5IXJA 4OSOA 1WWKA 1EINA 5JARA 2AOXA 3OCXA 4GE0A 4RS3A 5LDGA 4BLOA 3C3YA 4XB2A 3DOCA 3TSOA 2XNKA 3BUSA 2H2IA 2VP5A 4PG5A 1RPTA 3EFHA 1QZ3A 4XWWA 1CYDA 3TZKA 1EUZA 3F3SA 1G4AE 4KP7A 3DO8A 3UJDA 5H8WA 4IDQA 2NMVA 3HBMA 2VKQA 2XUKA 1NVMB 3SVLA 1XFDA 3HRKA 1V5EA 2V5VA 3CZ5A 3P45A 4CMEC 4YT8A 4LHEA 1FEZA 1NW4A 2EBFX 3KOZA 1UKVY 1OFVA 3G5TA 3K6KA 4LYGA 3A1VA 3GRPA 3ABSB 4TUYF 5CCBA 5DBHX 1CRQA 1A2KC 1FRQA 2OCKA 2J87A 1QR6A 3AVOA 1X7ZA 3ABZA 1H1LB 1YOBA 4EW6A 2YTZA 2R6GA 4R40A 2C4HA 4KV9A 4M9XA 5CK5A 4DE5A 1LNSA 3EDCA 3PTAA 4GG1A 1ZMBA 4GYJA 2N1BA 3DWEX 3SKXA 2H2FA 2YDXA 5JCZA 4NCHA 3DMTA 2FOLA 1EQAA 2RGCA 2LBPA 4LWZA 1Q84A 1AXGA 4M8LA 3HU3A 4Q9AA 3VPHA 4C7BA 4XOUA 4D6XA 1N2ZA 1NUHA 5KTTA 3WBJA 1K7SN 3FOFC 1AG9A 2FDRA 3AZOA 3G8YA 3WRXC 1Q74A 2PH5A 4V3BA 4HZUB 1YJXA 4L15A 4TL6A 1KH2A 2QU7A 1GG9A 2AZTA 2LWIA 4JJ7A 3M4NA 2P1ZA 3D7LA 4QU8A 3AHJA 2W48A 1PZFA 3LQRA 4O4IB 1UXOA 2X0FA 3WP1B 5M04A 4D9NA 3KFLA 4OF4A 4CUJA 1QK5A 4DR7B 2OHGA 4DKXA 4LQ4A 1S7GA 2QT1A 1LCIA 3HDTA 1NBMA 4KLNA 2EJWA 3FB1A 4G4IA 2HHCA 5BXYA 1EFHA 1QYVA 4LYHA 1QCCA 2O2SA 1T1IA 2PQ2A 3EXG1 1P2DA 4HNUA 1MC5A 1RIIA 2QUBA 5KTNA 3I01M 5CPFA 2C7VA 2EJVA 1E5XA 1F3LA 4NBUA 4C0BA 3LGAA 1FLDA 2BZGA 4RA9B 1RHUA 2I7CA 2R9VA 3FPGA 5F7XA 1BCSB 1CNEA 2CHEA 3L1JA 4XE5A 2FOIA 3HKCB 3PYXA 2BEKA 3OLQA 3QMPA 3CXUA 4UCWA 4XUEA 4ZA2A 2ZUTA 1U8ZA 1UC8A 4F4DA 4FFWA 2O4UX 3EHDA 4XB1A 3Q8MA 1YNOA 2GHRA 2KE5A 4Q12A 2CBZA 3C7DB 3N6VA 4H59A 4AY4A 4JMLA 4CW7A 4HEA6 3GU3A 4TTTS 1RQXA 2A1UA 4HD8A 2HIAA 3ZNOA 1UKZA 4HQRA 3H1FA 4RH1A 1CWUA 4XD2A 3VC3A 1ZAYA 1KARA 3EODA 3I9JA 1X94A 2P4HX 4G9BA 2XUAA 3HXQA 2ZWAA 1UH5A 1XZLA 1Q1EA 2BELA 2ZUVA 3EDQA 3D8HA 4QNNA 5DNDA 1HNNA 3P94A 2ZUFA 4X95A 1IAVA 4MA4A 2Q9CA 1I7QB 1OX4B 1JIJA 3Q5EA 3OIVA 2VYNA 4MW5A 1ZR2A 2PX4A 3CPJB 2I4TA 3QH4A 1KBZA 4HPWA 2V7UA 4X20B 3V2IA 3GNTA 4B6FA 5MDHA 2BFWA 2RJ3A 1I13A 2H57A 3A7DA 1I4LD 1BJKA 3KYDA 3PFGA 3N0XA 4PSUA 3JQFA 4M99A 4JLJA 4I6JA 4MLPA 1NNLA 3IYLW 3OHMA 2J9RA 3ANLA 4LBYA 4RPCA 5D5PA 2D2VA 5I8ZA 4AP5A 4DLPA 1TYCA 4UDOA 3TTTA 4CN9A 4ZYVA 2FWAA 4Y6LA 1OKKD 2XNJA 5L3ZA 3FNFA 1QG4A 3R7WA 2OVFA 4ZT3A 3YASA 3KYIB 4QSHA 5BSHA 3MERA 4QREA 3Q7PA 4TS9A 3MTBA 1JDJA 4ZREA 5IM4A 4A9AA 2E18A 4UHJA 1LF5A 5DTRA 5A6VA 1BDJA 2LR0A 2MCFA 4G1UC 1YRYE 5EJAA 1CJUC 3QE4A 1G41A 3ORRA 3KTAB 1NUUA 3HKEA 1T36A 1RCTE 4S1TA 1IZYA 5FWXB 2WSYB 1OOEA 4OIFA 2IL1A 5HG0A 2C42A 3PEYA 3ABQB 2FHPA 1L4GA 1DE0A 2VDRB 3CNBA 3DTVA 1BWQA 3ZW9A 2PA0A 4M7OA 1U2QA 4INJA 1KNXA 2V5AA 4R8RA 5M2QA 4TXLA 3VR1A 3ELBA 5HP4A 4UZFA 4NL4H 3C5HA 4B0OA 2EBHX 1RKUA 2D1QA 1D2RA 1ZICA 2WLSA 4Q03A 4C0JA 2CHGA 4UC0A 1IN6A 5K8CA 4K6KA 5DYNA 5BNIA 3P9PA 1TD1A 2OHIA 2WG0A 3CUUA 5TS3A 2HPAA 4TRNA 4PXAA 1XJQA 1QO0A 4A8HA 3HWRA 3RCBA 1COZA 1N9GB 4BNIA 1YC5A 3K6RA 3UMYA 1KR2A 1ZNZA 3KKMA 4E70A 4ZJYA 3ZDDA 2H1CA 4OATA 3RHTA 5EPEA 2RGNA 4NJMA 2FG5A 4R1OA 2ZBVA 4IDEA 1DTSA 1W85A 3MQFA 4IY1A 4NU0A 3Q85A 1KI9A 1T6ZA 3UJ8A 5JBQA 2YWDA 4JASB 4QDJA 2YV4A 1UPXA 1M0EA 1HFJA 4BGEA 1CQXA 3IODA 2V6FA 5HFNA 1UJ6A 3CPSA 4Q3NA 4R0VA 1A2QA 4PAOA 1NN5A 2NXEA 1V43A 3T1OA 3ETLA 1I4TD 3OFJA 2J41A 3NIBA 5FYQA 4DNXA 3EX7C 3G0HA 2P5TB 1QZXA 4Z8YA 5LA6F 3UK1A 4LTDA 2IZ6A 2CLFB 1TDJA 4OO3A 3AUJB 4EVQA 4CIAA 3G49A 4DJFC 2DSNA 1W4ZA 2OMEA 3AJDA 5EUCA 1E1YA 1VPVA 2V6IA 3K31A 4AY3A 5LA6A 4JVMA 4PR0A 3U3DA 3N05A 2O59A 4ZT7A 1NBEA 3HGMA 2YMMA 1JXQA 3IJ5A 3PUKA 1YMQA 4LVOA 3FVRA 4PYIA 1U7TA 2WQZA 5BMVA 4YHHB 3BS4A 4NBTA 3R7LA 3BGIA 3CC8A 3UTCA 4YNBA 2X5XA 4F06A 1ADJA 2CFOA 5F2NA 1W25A 3MN1A 4D82A 3D5QA 1ZUWA 1QHNA 3HI4A 3NHKA 1PKXA 1TMKA 1HYQA 3GGSA 1L1EA 4EG0A 3GWGA 3MTIA 4HZIA 1GPKA 3R20A 4UHKA 4FDAA 3VGJA 4MZDA 1J2YA 3IUYA 5ALXA 1RJDA 2H0AA 4EF6A 4GL2A 5EN4A 4BVHA 4TKUB 4DG5A 4MKXA 1FDTA 4XWYA 5GZ6A 3N3BC 4Q4LA 5I7HA 2CLDX 5IC4A 3NDRA 2QRMA 4R7ZA 1JIKA 1U0HC 4LC1A 1AB5A 4TMTA 5I9BA 4R9VA 1X1DA 1N1MA 2BY4A 1O89A 2C82A 1MH1A 3H1TA 2A5FA 1I24A 1RJWA 4XWGA 4A5OA 1YS7A 5FEUA 1NX6A 1F6BA 1FXSA 5KOHB 1B42A 3PPIA 4N5LA 4OIMA 3U7JA 5EIXA 3H65A 3OIFA 1Q3TA 521PA 3JZAA 5BNTA 4HOYA 1XRLA 4YEDA 3QW4B 2FWIA 3AB7A 3M83A 2A67A 1RS0A 2E85A 4JGGA 2NZWA 4HUJA 2WJ3A 1JU9A 4BV2A 2BMVA 4K6CA 4S1VA 4QSMA 1EM6A 2PGNA 5LP6A 3VDQA 1X1EA 1W0KA 4UXJA 5JLJA 2FSHA 4RU1A 1PYGA 4OB7A 1Q1ZA 1O4VA 3ELWA 3QXHA 4RX1A 5JVDA 3TLKA 3IAXA 1R8SA 2NYVA 1XZIA 5ITZB 3HPRA 1TNDA 3K9LA 3MB5A 4CI0B 1WOMA 3FETA 3GUHA 3O8DA 3QBVA 3CH7A 4YLGA 3SLGA 4A8PA 4DXAA 5JEEA 3DUFB 4PYOA 3UK7A 3I61A 1Y1TA 4AQ7A 1M6YA 1IPEA 3GJ5A 3IB3A 3NHPA 3QKIA 5J2TB 4OI4A 3NTLA 5A3QA 4IZ6A 4PWYA 5DJ5A 2WPDD 5KWJA 3DAHA 1Q7TA 4EFNA 3WWYA 1M1XB 1SKAA 1HSOA 1Q0PA 1JBEA 2ONZA 2XQJA 4EABA 4TT3A 1BQ4A 1ORRA 3MWJA 2ZYUX 2PYIA 5A62A 4GBED 1OJ7A 1C3OA 3EISA 3P52A 3T4UA 3L4BC 1J22A 1OASA 2YXEA 2X76A 5INTA 2JDID 2ORWA 4JU9A 3ZCUA 1EGQA 2GERA 3NIWA 5AHRA 5G0VA 4D6YA 4PN7A 4YFVA 5CGQB 1FDSA 1F06A 4PZCA 4YRJA 3JQ9C 2IHVA 1Y1RA 3OT5A 5L7WA 1DKRA 2PLRA 2YR0A 1NUTA 1B15A 2JLAA 2YMPA 5LBTA 3SHWA 4OBWA 3OY2A 4PFKA 2BMDA 5FOWA 4M53A 5GJBA 3COSA 4MARA 5T4FA 3H17A 1J8YF 1ZXXA 2WBLC 1JP7A 3KT3A 1YFLA 4FKMA 1R6XA 2LUOA 4AWXA 5EIBC 1A2BA 3ZJTA 4C7MA 2HWXA 3WB1A 1UDBA 4M76B 3BC1A 1FL9A 1J42A 2O2EA 4L5CA 3V00A 4WK6A 3P9RA 1G21E 2VUTA 4YAWA 4BX0A 4V03A 2IWHA 3KAPA 3KKNA 3C98A 1U1IA 3A6EA 3OQ6A 3FCSB 4V0LA 3U6KA 1NSTA 4IH1A 2OEPA 4H31A 4BFYA 1EFPB 1EGAA 3DVAA 3QWFA 5LZ9A 2NUAB 3H2GA 1KYYA 4OQNA 1Y6RA 1ZO8A 4A2PA 3GLKA 4D98A 4DCOA 4DQ0A 1GITA 2B1JA 2CJWB 2Q3DA 3SZOA 1B93A 1L8AA 4C7OA 3EWSA 2BGRA 3VSBA 1QSGA 4K6FA 3DEIA 1FOEB 4OQXA 1T3SA 5CDFA 3I8OA 3OZEA 4F21A 2V58A 3X1ZA 4MIKA 1OWOA 3HCFA 4YT4A 1B14A 2AQKA 1FS5A 1KGSA 3RE1A 4LZOA 1WB4A 2GAJA 3RC1A 3AETA 4J0GA 1N3IA 3WX0A 2C92A 3FTFA 1G5IA 3ZNNA 3BQMB 1MVNA 4Z0PA 1JKJB 3PUYA 5F64A 4DA6A 4EYEA 1XRRA 3DBIA 2XE8A 5BN5B 4MRVA 4EBBA 4PPQA 4KIUA 2PEYA 4O4HF 4CIYA 4E09A 3R0QA 5L8VA 3H04A 2EW1A 3WKAA 1WD7A 2GCEA 3FCCA 2DVMA 2AV6A 4Y2UA 1ZI6A 4LSMA 2CDCA 2JH9A 1OT5A 4M0PA 2YYYA 1CDZA 1YUBA 5JEDA 4WBNB 3O4HA 5PNTA 1Z73A 4PTYA 1U3GA 4PVCA 5IKEA 2A5GA 5IDQA 3RM3A 3WJ2A 3VR3D 2VS1A 4UMDA 3WGUA 2FMTA 2XTJA 2XVXA 1Q7EA 2Y3IA 4QU9A 3RVLA 3SOZA 3AEQA 2PNFA 1SULA 3EEIA 3CIOA 4X45A 1TECE 2KW5A 4PE5B 5DRTA 5IKOA 2Q41A 2GKGA 4CKYA 1ICEA 4CLOB 2C83A 2H0QA 2PX6A 3MGGA 4UTOA 3LUDA 3PLNA 4FMDB 4QRHA 4BX9A 1MOZA 1OXVA 2AHOA 3JVIA 2ZI3A 2C5AA 2IHJA 5KYVA 4UQLA 1B8VA 1W49A 1ND6A 4M21A 2WHEA 1P5JA 2BFEA 1J0EA 5JS2A 2O7NA 1JS1X 1KK0A 1P19A 3MWYW 4QBGB 3TVTA 4F5ZA 3Q3EA 3H5OA 3U3JA 3F8TA 1M72A 5D01A 3OU6A 3R77A 2ERYA 4BQRA 2PZJA 4BJ3A 1YB5A 4D1YA 3KETA 3OEED 4AX4A 3DVRX 3MAAC 2RHHA 5ADUS 1WMAA 3KBBA 3ZY4A 4TVBA 1W85B 4FE7A 4N41A 4LK2A 3SYTA 1N2BA 3CXRA 4DUGD 2J5BA 2G9UA 3DS8A 2O0JA 3KHUA 2QRUA 4HJXA 3E0QA 3VJLA 3W04A 3ZU6A 5ITWA 1H9CA 3ZZ1A 1T2NA 1RMTA 2GUGA 2F7SA 3BL5A 1ZNWA 4FE3A 1U5CA 1LX6A 1C1XA 4DWWA 4LXUA 2CNLA 2WMOB 4XGIA 1XZQA 2O2HA 2OESA 5F2OA 2Q8QA 5M34A 2ZBUA 2J33A 4Q1CA 1T8UA 5EEGA 3JYQA 2PUGA 1ATIA 2V59A 2WZBA 1VG8A 3ZI0A 4D45A 2JIPA 4KFUA 4LK3A 3RV3A 1CUIA 1GFWA 1JW9B 2QZJA 4WKOA 2C57A 4WFJA 1UZLA 2OXIA 2VLIA 3WADA 3TLAA 3WXBA 3NHAA 3BHNA 4B76A 1LVHA 3ENQA 3E2PA 2J32A 3H1BA 5AK4A 2ECQA 3LJKA 2AX4A 3NBXX 3RHSA 4ZCRA 3DOUA 4P3NA 2BKLA 4ZGWA 2LCFA 1R27A 1H2BA 1XVTA 1V0JA 3KT8A 2X22A 4ZK2A 1B0PA 2VF4X 2X0RA 4P4TA 3GVCA 3ULKA 4ILEA 2ZG6A 1H5UA 2E7ZA 1RU3A 3VPXA 3HSYA 1NNUA 1DIHA 1NHWA 5CHEA 3T6KA 4R8VA 2C61A 2FQ1A 3UKDA 1VMEA 4MVYA 4IJ6A 5E7QA 3V8VA 4DCNA 1N4DA 4HR7A 2A3NA 2O5VA 1LLCA 3EYWA 4QQNA 1HZZA 4ZHSA 3GZTB 4BFCA 5G41A 2DPGA 1DAMA 1FP4B 3ROTA 1XDGA 4LZZA 1ZSYA 4HDMA 2PWPA 2QP4A 1Q21A 2D2EA 4BIIA 1SEVA 1U6KA 2XMSA 3OD1A 4LOAA 4WTOA 4UEKA 2RH9B 1KMIY 3JS5A 3D3KA 1ECCA 3CO5A 4BNHA 4JBYA 4WADA 2P5UA 5JT1A 5AXBA 4CV2A 4BQOA 3FFXA 3G2NA 3HU5A 3JAWB 3OZVA 2NTVA 2ESRA 4FHZA 2SCUA 5CTJA 4DPMA 3UHJA 2C9YA 1STOA 4BO2A 4TKVB 4UTRA 5JY1A 1FX0B 2I6UA 1HL7A 3C6MA 1K1EA 2H4JA 2VZLA 1DP4A 1H0KA 2OYCA 5BWNA 4ZI5A 1GFSA 2BR3A 3IVGA 1DL5A 1TYDE 2DOKA 4CG3A 3NYWA 1SD1A 1EDEA 1KDTA 1XAIA 5BV0A 2B4TO 3PEEA 4H7IA 4ZV9A 4ATNA 5A6SA 1NATA 2ATIA 1U3TA 1ZGGA 3AP1A 5CW2A 3D1LA 2VSOA 4EY5A 1T9DA 3IFSA 1MLDA 4Y6OA 2AEFA 3C7TA 4TRMA 4PINA 5HKKA 4KXXA 1QTIA 1Y8RB 3DE2X 3KXPA 2PXXA 4C0SA 2HKIA 3IUQA 2PFKA 3GFRA 5KWSA 1DG3A 4BAZA 2W6IA 2Q8PA 3PRKE 5FUYA 4YV0A 1CUCA 3VNQA 4B34A 5JNRA 5LM3A 3ADBA 4EFKA 3NTRA 4OFZA 1P5ZB 3JWJA 1FYVA 4ND7A 4ENRA 3C85A 1R3UA 5K2OA 1QAMA 4K6OA 1V8FA 2K2WA 4GUDA 2XR1A 3UJ6A 2YV5A 3WIVA 1YRBA 4TLDA 2OZLA 2O14A 1RKBA 2H7VA 2ZKLA 2EKBA 2YWRA 3IP5A 2QGZA 4KAJA 4LZJA 2JD0A 4KO2S 1JPVA 1J09A 3LWNA 4M1ZA 4QRDA 3U80A 1ULBA 2ZXUA 2OCPA 1RXEA 2FLVA 3IC5A 1B4DA 4V3CA 3KQSA 4KW7A 2ID8A 4J3JA 5IHXA 2WF7A 1XNHA 2B1IA 3TRJA 5BSUA 3HA5A 1AXRA 3V42A 3ZY2A 4LX8A 1H5QA 1M6VB 5EE3A 4DR3B 3GLHB 4M9UA 4NNOA 4RVGA 4WNCA 5EUMA 1Z8FA 1T91A 1KK3A 1GGJA 1N6HA 3UC9A 1T8YA 2B4QA 2EFGA 4DA0A 5JPDA 1Y81A 4ECAA 3ZU2A 4NZZA 4EAAA 2LGJA 3K9WA 4HQLA 3KZ1E 5L7YA 2ADOA 4RFSB 3E53A 2MYNA 3QITA 1FFCA 2QVCA 2XGOA 1M2NA 3O0TA 4UM5A 2WD7A 4E4YA 1N2GA 4IXWA 4G5RA 3NTVA 4XM0A 1A8PA 2C94A 3WMWA 5H59A 1GTJ1 3TJMA 1SURA 3NBZC 4LZLA 1LUAA 1JFFB 1X7DA 3WA7A 1QLJA 2O5CA 1TZKA 5FPSA 3EIXA 1TT5A 1TFRA 3ZK9A 3PHBE 1K6MA 3A32A 3GD7A 4K86A 1DBVO 3IAFA 5F78A 4B6JA 1OYYA 4D3FA 1KFBB 4MV4A 4XWOA 2YBDA 1A7JA 4A73A 5BV7A 3LPDA 3FJOA 4MVJG 5KUTA 1WB9A 2XSZD 3S81A 3EZYA 2VPIA 1RXIA 5TR9A 5HZHA 4OXQA 4I8XA 3ZGLA 1ZGCA 1CPYA 2F3SA 4KQMA 2AA3A 1FU4A 3VDRA 2FWRA 3LDHA 3ND9A 3SDZA 4OFXA 1T8TA 3AWDA 4KPFC 2FPLA 1ZN8A 3DKVA 3FCUB 1IVNA 2MDTA 1O0CA 5KJEA 1I9CA 1O0SA 4B0PA 3HXMA 1YR3A 1L7VC 2QMOA 4RD1A 3LUCA 3QUAA 3HJGA 5HRUA 1SD5A 1ZMOA 4LJLA 4LVNA 4F5EA 2CV1A 5EFOA 4Q4JB 1GXSB 4L27A 5U4XA 4ZZ0A 3T99A 4NDZA 3QV2A 5G1NA 1FDRA 1RIFA 2X0EA 3VHXB 5BT8A 3NDIA 3JPWA 3GXOA 4HP8A 3T0IA 4I4LA 4AKSA 2O57A 2P35A 1PN3A 4AN0A 1TO6A 3DE5X 5AKGA 3TTSA 2HB6A 2QR3A 5AK3A 3WDMA 4EB6A 1BDIA 1RR6A 5A4FS 4QGFA 1BEUB 3DZDA 4GO1A 3K35A 4QOGA 1F60A 2FEPA 3W5IA 3RAGA 3U44B 3VR3A 3HNOA 2JLYA 3V4RA 4LYAA 3QFHA 3EXIB 1NRJB 4UDYX 2CV2A 4IHQA 3V2UA 1LPBB 1LC0A 2EDCA 1L7BA 2RKBA 4WZ6A 1P60A 2DBRA 4RF2A 5C5CA 4M38A 5CK4A 2XCLA 4L1KA 4X41A 3UMGA 2B94A 3FWNA 3G0IA 3KQWA 4RK0A 1MRZA 1UBTS 1OROA 2FEOA 1FFXA 2IZOA 4Y6GB 1ADYA 2R0QC 2INGX 1ENPA 1DAPA 3RROA 4R2MA 3DE0X 5HM8A 3ICEA 3R9XA 1NT2A 1FMJA 3RRZA 2PD6A 2VUUA 4CG1A 1SQGA 4IW3B 2EFDB 4MUMA 1NF9A 2SKCA 1TYEB 1XCJA 2WWXA 4FSDA 2GPYA 3BBPA 1Y4AE 1MUUA 1FRFS 5CB4B 4GLOA 3K1TA 4E2XA 1XDBA 1M2EA 1VTKA 4WPGA 3DMDA 1JT2A 4LYJA 4FHDA 4JXKA 4N0QA 4MR7B 4BAGA 4MKFA 4WOBA 4PZDA 1ID8A 1KXJA 2VHVA 3W7BA 3C3EA 3F9CA 3MMPA 3QLUA 4XRRA 4NZ9A 3CWQA 4B3CA 3N2ZB 4Z1OA 5TQ2A 1OI4A 2BR5A 3B6EA 3T4EA 4XDHA 3A2LA 1PJQA 4WOCA 4TTPA 3DAGA 4UUQA 3H8VA 4MI9A 1OWLA 3KLOA 4NH4A 3HKDA 3P4YA 5FBKA 5BN4B 3THRA 3OF2A 4AG6A 3GLFE 3EVZA 4HB0A 1UMCB 3AVXA 1EFAA 2LZ0A 2RDMA 3SHTA 5A4MS 5MFZA 1DC6A 3ZDBA 3IA2A 1VCNA 2AZ4A 3TS1A 5JWOA 1IEXA 3MINA 4D4KA 3V1LA 1MJGA 1G55A 4JQOA 4AMGA 4IIFA 1Z4JA 2QVYX 3QKSB 2VCHA 3V2GA 4EDFA 3GMDA 3MIIA 2ZE8A 3C6YA 4Q3DA 4PX9A 3ZQJA 2RE8A 3LUGA 3IVAA 1OAOA 4CQMD 2GCGA 4HXYA 2RGUA 3F71A 1UIMA 1BXZA 5AKZA 3W5JA 2W2KA 3ANTA 4QGBA 3E9QA 3T9FA 1RBMA 3ZWAA 1PZHA 1W30A 1G17A 2NZJA 1TO1E 1EDZA 1JFLA 2OFPA 1I1QB 4DZZA 4NCAA 4MWEA 3OMLA 4TLMB 3LLSA 1JDSA 2LNDA 5B36A 3GLIA 3D6UA 4IIJB 5DLEA 1U0FA 5F33A 2EQ5A 3NALA 1I0LA 3PJRA 1M0WA 4W7SA 5JNWA 4TN5A 3MT7A 3AILA 1K0UA 1BWPA 3DTTA 4KGDA 2IHYA 1F0NA 5FWAA 5TMBA 5IEJA 1W2GA 4DY4A 1IVYA 1UT5A 4QDZA 1ZH2A 3H5NA 1W47A 3T1NA 1JLRA 3C0KA 4UHCA 1NONA 3O8BA 2R2AA 3CS3A 4FZRA 4HDMB 2ZRDA 3IQFA 4NMXB 4RY0A 2YHUA 4J16C 2D5LA 3Q5DA 1HG0A 1V8ZA 5JDCC 1CEXA 4XIFA 1PWZA 2WE7A 5TV2A 4JQCA 2Q29A 4RD2A 2EJUA 3LQ1A 3JQ8A 2ACVA 2RK6A 3HJHA 421PA 1KJ9A 2PIAA 2YIJA 3CLHA 3FTDA 1TZMA 2UUOA 3ZQ4A 4A2CA 1BG6A 5EESA 4EG8A 4US2R 1UFRA 2L82A 1SVIA 4IWXA 4R2LA 3ZU4A 4NXMB 2RGDA 2NYRA 2R7MA 4Q4HB 2Z4SA 3VX4A 2KLHA 3Q0EA 3KHKA 5JXJA 1UZAA 4DBLE 2WIJA 1E2LA 2XVYA 3NOQA 5K3SA 3C3MA 3HNRA 1JG1A 4CDRA 3GELA 4QGHA 3LU1A 1U80A 3IQZA 4DLBA 3HR4A 4B3JA 1YKSA 1E9RA 1B3BA 2XUJA 3G2OA 1VHTA 3LG2A 3ORFA 4YJ3F 4BTLA 4DJJA 5C7OO 3M5PA 1UIRA 1YVPA 2QMQA 1E89A 4FBMA 5GWXA 4CNQA 1NJSA 2TRSB 3C87A 3CWCA 3GFSA 1KJNA 2JJ2D 2PYDA 1ZH4A 3IAAA 2PR7A 1BEZA 4FHCA 3W8DA 2D6FA 4GVLA 2UZIR 1V1MA 5JMPA 1Z4LA 3NFRA 2ORVA 3CRZA 3I34X 3JQ9A 4FKZA 2QSJA 3GLVA 4GI7A 4JBHA 2XA2A 1Z9BA 4NYJR 1XJWA 4AYXA 4BO4A 4IJVA 5BVHA 3KNZA 5J47A 3F5MA 1MU0A 2OM2A 3TLZA 3RLFA 5KOYA 3QF7A 2VWHA 1JKFA 1C3XA 2GN8A 5CVUA 1N8TA 3FNGA 3A0UA 3IUNA 3MS7A 2HHAA 4GC5A 4X92A 4WZAB 4Y0AA 3OOSA 4ER5A 3I1YA 4PQRA 1DIAA 1QDEA 3EPRA 2PPLA 2YIVX 4Q24A 4L08A 4OYHA 1BOOA 3WL8A 4LGYA 4MDEA 3BXEA 4CM6A 3PD1A 4IO0A 1HX7A 5FWDA 2X77A 3CBQA 2IEDA 3GFVA 1FVOA 1VIDA 3N76A 4AJKA 3NYIA 2JGDA 3EEBA 4WZZA 1WQ1R 4PXSA 2IA5A 1AZLA 3IKVA 5CU7A 3A6PC 1E58A 4Y9SA 4PNPA 4KR2A 4O8ZA 2ATCA 3B1FA 3PE6A 2UUPA 3UCEA 5BXQC 2E5LB 2PUTA 4RL4A 5F1OA 3WBFA 2QNIA 4QEZA 5M3BA 5TMEA 5C8DA 3AVUA 1P9OA 3AY7A 1CZLA 3HV0A 3Q3IA 1N36B 3VUFA 5EMHA 2PX8A 3RUCA 2QXTA 3D7RA 3ISVA 2FSIA 3KOMA 1W1IA 2PT5A 2YVUA 2YY6A 5FTNA 3W2HA 1Z0IA 4ZT6A 1R6UA 4JEIA 2I3DA 2IXFA 3KQHA 3PFKA 2KMLA 4IV8A 2FWMX 3K0AA 3WMRA 1NPYA 4TRJA 4GMDA 3JWIA 1F0PA 2HA3A 2NQ8A 2PTGA 2VBCA 4HVAA 4MS4A 3K20A 1HT1E 4GPD1 2JANA 4ZANA 5C80A 3DJYA 3IOYA 2OBYA 2ZS7A 4XQEA 2I5PO 1RHJA 1V37A 3DOJA 3O73A 4IRMA 4Q1AA 3W6ZA 2VJDA 4F72A 2QZ9A 4CXMA 2TSYB 3IEMA 4TSRA 1TADA 2GKSA 4LRWA 3SEQA 5DSXA 4Q16A 1SCBA 5CA1F 1MB4A 2ET6A 3IB6A 4RWEA 4JC4A 3V3TA 3W79A 3WSVA 2N46A 2VJBA 1EFVB 1A3CA 2OO7A 3WWZA 5T64A 2R44A 2XZPA 1LDYA 1F0YA 1MT0A 3UGKA 4WMLA 1Z07A 3OQOA 4II3A 3V7FA 1I4WA 1R7RA 3IEIA 2D0IA 3A9RA 3KOOA 1QP0A 2GPTA 3ZCRA 1AKYA 2I8CA 5FHQA 5FV4A 1BE8A 1PNOA 4D80A 4IF4A 1DRJA 2JH3A 4DJ5X 3H86A 3UWPA 1UUFA 5DHFA 2A92A 2G83A 1DBRA 4HH4A 1IJBA 1MMFB 2RI0A 1EX1A 3LUJA 2W6PA 1LPNA 4MHSA 4E2FA 1FW8A 5D3QA 3VR2A 3X43A 4JNCA 1Q91A 4EHHA 3AWIA 1QVAA 3DBRB 4ONEA 1S01A 1F14A 4JSRA 1OSNA 3ZH2A 4CG0A 1O0BA 1JDPA 3EIOA 4RZHA 4UBLA 5GAJA 5B7QA 5F76A 2PKCA 1G20E 3II6X 3PZRA 4MV7A 3P2OA 4AWAA 4ZD6A 1MVOA 1E2MA 1OTXA 1VMIA 2PMKA 5JNUA 2BR4A 2LPMA 4IV5A 4ALNA 4WZBB 3GCWA 4E2YA 2R8PA 5AVYA 2Q28A 3R3YA 4Q9HA 4CT0A 5HJ5A 3EW7A 2ID4A 4A0HA 4J2TA 1H2AS 2RHBA 3P20A 4HRYA 3JR7A 1R15A 2W0MA 3G1TA 1CP3A 5EVCA 1IOZA 3TI9A 2FPPA 4BNLA 1BE1A 4EHJA 2BEVB 1DINA 3G7SA 1PL7A 3HZRA 3WOVA 3UV7A 2E37A 1G5TA 1FX0A 3HWX1 1L3IA 3R41A 2XYQA 3SKYA 4TYPA 5IN4A 4DZRA 4J0CA 1PTKA 1V11B 1XWWA 4U2EA 4PGHA 4U9HS 1HSZA 1Q6ZA 3HCOA 4R7GA 5CDUA 2Z4TA 3N6RA 2NUPA 5HYVA 1GRNA 3FBWA 2YHBA 3ED5A 4MQ4A 1C50A 4CTNA 1ORHA 3D7MA 1NBMD 3KXLA 1VG1A 4D9BA 1UPTA 4BO3A 3OQNA 1NTRA 2UYOA 3D8UA 5IFKA 4ENTA 3ZJ5A 1D5WA 1I5OA 1XGKA 2LXNA 4D9CA 4WK4B 5ERXA 4E51A 2JBWA 3LCMA 4CMIB 5HRAA 2IDJA 2J5XA 3C6XA 4FE4A 1B0ZA 4YJHA 4ZRMA 1RHRA 3IA7A 4YP7A 3T94A 5EMLA 4PSCA 1YJBA 3D2LA 2JI9A 4U0KA 2H5JA 4AZ3B 1QH8B 2IEIA 2AFIA 3OJFA 3D6AA 2ZIXA 2VDUE 4ZOLB 5C8VA 7ADHA 3THYB 1WDWB 3U3OA 4GMXA 3U0BA 3O31A 3EIEA 3TEJA 3DE7X 5ISMA 3QHPA 3LF2A 1JU3A 1HDXA 3L8MA 1XEXA 4P22A 1SB8A 1UKYA 5JXHA 1WJGA 1A82A 2P91A 1N6KA 1Y6QA 5BNZA 1SQ0A 2AX3A 1UQUA 4ROSA 1GT6A 4RQBA 1NJ2A 3B1KA 1R6TA 1CXZA 3HQ4O 4KHPB 1D8AA 1WDKA 2WIFA 4DR6B 3G8DA 2DUUA 5FFFA 3WQRA 4R68A 1VRWA 4E2WA 4KL8S 1Q16A 3LF1A 1KYWA 3ZIDA 3UCFA 5DP2A 3DBLB 4FTWA 2EOAA 4NG5A 3ZGXA 2CE2X 1QIDA 5KPJA 1JXAA 1E6LA 3N86A 5CNJA 5K45A 1DIOB 1G0OA 2YCLA 2BEUA 1SBTA 2FKNA 1JECA 1Z25A 2XKBA 3LQKA 2YXBA 1YHYA 1VPLA 1S2DA 4Q3LA 4RMNA 1T9GR 1YE3A 2JIZD 3HFJA 1HE3A 3D6TB 2HNBA 4UAVA 1T9AA 2I91A 4BKMA 4YRLA 5D84A 1PJTA 2GCNA 3C8UA 1BXGA 1TKBA 2AG5A 4ALJA 2OB2A 4NV0A 4YJGA 4ZI3A 4OU5A 1P7CA 2DWPA 1ODTC 2J0EA 4JU8A 1PJRA 2HLPA 2IYOA 5DGTA 5DX0A 3TYXA 3UENA 4ZMRA 2QLMA 2Q21A 1Q5PA 2ZWOA 4KDCA 4KMRA 4BNDA 4Q37A 2AQHA 3T1QA 1E98A 5EJ9A 1KMNA 2Z5VA 1X7ZB 3NRJA 4BNWA 1HR0B 3X2EA 3O4GA 3A4IA 4OOEA 3COPA 1U0LA 3K05A 5FADA 1F1JA 5SZJA 2FGJA 3W5HA 3WYGA 4ZYXA 4AQYB 3PJFA 3UMFA 5IHPA 2VBGA 3WHLA 4ME6A 1TX4B 4AECA 1OYOA 3PVSA 3EAQA 2Y4NA 4UOQA 3ZBTA 5F7JA 3ANXA 3FKJA 1FU8A 4AX8A 4BVJA 3RG2A 5JYBA 4MVJH 1E9SA 1V11A 3BJRA 4Q48A 4OOFA 1I36A 1RP1A 4LOKA 1WW2A 1CB0A 3E22B 4XAQA 4CT5A 1WZCA 1DHRA 2YWBA 6ABPA 4R16A 3H1PA 5F2EA 1R0KA 5J4VA 2P4UA 1K8XB 2HQRA 3DOOA 4KFCA 1PT8A 4F9FA 1PRYA 1M2WA 1T5DX 1XAGA 3A1EA 3QXXA 4ZALA 4DMRA 1N2IA 2ON6A 3F1KA 3KQMA 2FW0A 3PPVA 1X70A 2GMWA 3AUKA 1YR8A 1D9XA 3P19A 1L4UA 3U7RA 1NVDA 2ZSAA 2E5WA 4YS6A 5K0FA 4PS0A 3S4YA 3X44A 1KP3A 2YMQA 2ZYHA 3DLIA 4DBZA 4UDXX 2JLCA 3SE7A 4HS4A 3KPWA 1RXCA 5EIFA 3TE7A 4YUVA 1W35A 3FOAA 4WXYB 2G9VA 5ARBA 2CZGA 3VU1A 3ZR4B 5K0SA 4G09A 4MI6A 4RK6A 4WESA 2OTCA 1V39A 3UT5B 1L5QA 3CJTA 2G06A 3E82A 3IAS6 2QMZA 3LIIA 3NDPA 1DWQA 3O4RA 4X1IA 4ZT4A 2EHJA 4QOEA 5UKDA 3TW4A 3BRQA 3A3KA 4C4TA 1D1QA 5JAIA 2C8JA 1CQIA 4HNQA 1UWCA 1S3GA 3OZDA 4BVLA 2CUTA 3ZGYA 1IJKA 5BNFA 4HSEA 1XCBA 2CVPA 1TE2A 1Y7HA 2NXWA 2VHZA 2I71A 4F9TA 2A0KA 3JQ7A 1R74A 1JL3A 1CY1A 3SHOA 1CR1A 2VDNB 1JMVA 1KRHA 3B20A 3FH0A 4G0ZA 1TM7E 1VIMA 1WMSA 2HU7A 1E2IA 4RM3A 1N1GA 5E6SB 5TY0A 3AVWA 4RHEA 1B41A 2YV3A 3ZHYA 1FC0A 1N57A 4OB8A 3I4FA 2IYVA 3P5BA 2PQ0A 1FTYA 3AFHA 4OGGA 2A0XA 1UOPA 2PIDA 2WUFA 3CKLA 5DK4A 3OTOB 4HDKB 1EG7A 1GCIA 4URFA 5KYTA 3EZ2A 3K0AB 5HDQA 3EVBA 1ZZGA 3FWYA 1HWYA 4XJTA 5AKLA 4C5CA 4HDNA 3RIXA 1EP3B 1EXNA 5JY6A 4N8EA 3HZOA 2DF8A 4URZR 4WACA 2NV0A 1DEXA 4NHOA 1DKOA 4G1CA 1L9XA 5GPBA 5L3SA 2PXAA 2HUNA 3PNOA 2AC4A 3LHIA 3WVNA 2HRDA 4EJSB 5F3WB 3DE4X 4FGWA 2POQX 1ZD3A 3FCYA 2YJ3A 3AC0A 3FUUA 4PM4A 2B8NA 2QW0X 4IXTA 1Z2NX 2NO0A 3MWEA 1C9YA 4TT8A 2BZ0A 1H9BA 1D2NA 3IIEA 1MT3A 3FYTA 4FXPA 4Z4HA 5EXXA 4EGAA 4ITVA 4I5EA 1FFAA 1JNXX 1LPOA 5JXIA 1BDHA 3UJBA 2W58A 1FTSA 2Q45A 1QORA 5ADVA 5J2TA 1M7HA 3CT4A 3WNBA 4XKJA 1JVNA 2FAXA 2P4QA 4K6HA 3RT9A 3WGJA 2RGWA 1T3ZA 4BKUA 2CHFA 1HPLA 3OQHA 2P6MA 3TLEA 5EGSA 4HWRA 3E8XA 5CW1A 1E3TA 4P0PB 1QAOA 1XMPA 1I2MA 1WG8A 5AOVA 2OA0A 5JZSA 2TYSB 2V98A 2WJ6A 4YV1A 5I7EA 4NCIA 3QKSA 4ND8B 2EP5A 1Z29A 3W1WA 1B3RA 2FW7A 3IE2A 1KR5A 1UMBB 3JSXA 1QS0A 4JLMA 4YB8A 4DUGA 1AK1A 2BMWA 2ZR0A 3JASB 2GK6A 2ZULA 2XT9A 2XVZA 3T0GA 5CVTA 4JI0B 4WK2B 5TJ9A 4L4SA 4ISCA 2CJFA 1JAYA 5KNCA 5K0NA 3REOA 3N9IA 4HXGA 3CO0S 1TM1E 1JHRA 2B8EA 2IEYA 3LS2A 2FK7A 5BR1A 2JGRA 3IKTA 3D2BA 2G9QA 1LRLA 3EDYA 2VHEA 5EKDA 4WBNF 3L7AA 2QQGA 1A8UA 1HBJA 1ORVA 1TJPB 2KBFA 3DO5A 3ET5A 4FR0A 4M8IA 1KOLA 2W2OA 1K8ZB 5KZMB 2JFUA 4WOPA 5G53C 3AF4A 2BZSA 1AN9A 5SY9A 2CNNA 3U4AA 1OQAA 3VR6A 1OAOC 1MJ5A 2ZOSA 1C0EA 1LNQA 1Z0UA 2HQBA 3H9JA 3LI2A 3NFYA 4UNSA 1VL1A 2QEQA 2VYVA 1SC4A 3OUZA 3R6LA 1LSOA 1PGOA 3CLSD 4WBXC 5DW0A 1NTOA 2IKQA 5FPQA 3UUFA 3WHKA 1YCFA 3VZBA 1HNXB 3CF4G 4YUZA 3FPBA 3HCNA 3T3OA 1XA4A 4MUJA 1GPNA 1RFGE 1YUNA 1P3DA 4MGHA 3WLJA 3V97A 3TCNA 3NONA 4G85A 4NBLA 1THMA 5LYJA 2CBGA 2R751 3DFZA 4LGCA 3BD8A 1DKLA 3UK6A 1EIWA 1QVWA 3SX4A 1Z47A 3PSHA 2BKAA 3K1JA 4OLHA 3D54D 2H1IA 1USGA 5JC8A 2RB5A 4QRIA 3WTBA 3MELA 5K3FA 3NATA 4A26A 4F9EA 3JWHA 4N0EA 4B43A 3R3SA 3HXPA 3D5TA 4P92A 3H2KA 1RRFA 4X8MA 2WG2A 3OOJA 4O2LA 4HBZA 4IG4A 3K1AA 4W8GA 3VV2A 1GYRA 2G1KA 3ESZA 4ARUA 1ZHOA 2EP7A 4LRQA 5EOVA 4K1LA 4P5PA 4YRSA 1RI5A 1ZU4A 4KWCA 3WB0A 3O92A 5CT5A 3B53X 2F6RA 3GLHE 3ICWA 2W2KB 4NFHA 4MRNA 1I10A 4MVWA 3PWTA 2ZW9A 5AM1A 5EY5B 3F2VA 2OXCA 2HCFA 1V5FA 4HI0E 3ZWVA 1KMCA 1YKGA 4JT9A 2FXIA 1QGDA 4UCFA 2HJVA 1V7PC 2HMUA 2NVBA 3H6HA 1VKRA 4ZDKA 2NG1A 1P4HA 3AR6A 5CT6A 5IT5A 3UMCA 1P2SA 4FN4A 1GWNA 1SUPA 3LA6A 4HPJB 3PA8A 2J4DA 2X7JA 1KU6A 2QRLA 2QD4A 2RCNA 4WUVA 3ILHA 2WD9A 5EKUA 3JQCA 4D5GA 1U7WA 3EG9B 3PC8C 5ES4B 2QV0A 3MJFA 1DRUA 1RABA 2FJPA 1T5OA 2ZYAA 4G24A 3TZQA 5CAEA 1Z2OX 3CUEF 1NQXA 5C1OA 4LI3X 4UOEA 4QPZA 2ZU6A 3LY7A 2PT9A 5CFMA 1GL3A 2FETA 3CX3A 3IURA 3F6CA 1XTJA 1NBOA 1YUMA 2Q2NA 4A6PA 3VAAA 5DNAA 2HJSA 3WLQA 1EUQA 4KJZA 4AJ4A 1XALA 1L5VA 1TTQB 2CNWD 3SU8A 1IM2A 5I45A 2GEUA 2JATA 4WKNA 4DT1A 2OSBA 1YKFA 3BH6A 4JK3A 2H2GA 2QDKA 4PYQA 3G0OA 1YZ3A 4IOJA 2Z6QA 4KPUB 2JI6A 4XIYA 4JOQA 5FXMA 3DAOA 2J9FB 1N7HA 2A94A 3GMSA 4OK5A 1P29A 1D2MA 2X9GA 2QRPA 3FDXA 5ENVA 1EH5A 2HH9A 3QNUA 1IHPA 4NDNE 1HY3A 1NE7A 3O91A 2BUBA 2J0SA 3P32A 1EWYA 1IK4A 1CUEA 1JWBB 3GEDA 3CGGA 4TMZA 3HB4X 3I1FA 4YAEA 3RIMA 2BLLA 3TRFA 1Y1SA 2VK2A 3HVRA 3TM5A 4ER6A 3AQ4A 1V16A 3MJCA 4ZZ1A 1CVLA 1QIKA 4LFAB 3WLKX 3NT2A 1II9A 1BD3A 2SECE 2V6BA 3F5QA 1E2EA 4XTRA 4BVKA 1GO2A 1W4AA 5F52A 5KINB 2UUAB 1NVXQ 2DLDA 2B0JA 3UUEA 3P0JA 4TS1A 3UJAA 2XZDA 5IYZF 4DPLA 1XCGB 2ES4A 1BX0A 1H2HA 3AEKB 4XM1A 1VCIA 4QE3A 4KQHA 3F5DA 1ODLA 3QLTA 4Z4GA 2GLXA 3FNRA 3DEHA 1UBMS 2IYYA 4PG7A 4Y2GA 5KEIA 4B6EA 4JODA 4TM7A 1XDSA 1LRJA 1O87A 1T8RA 2JIZA 3EG5A 3NLLA 3R2JA 5A0FA 3ZG6A 1CHNA 4DIEA 3CB4A 2WUVA 2CF5A 3IELA 1OVGA 4H6WA 3F2IA 1FUYB 1HTWA 4EF5A 5KOHA 1WU8A 4C0HA 1CZHA 2RMKA 4YJKA 1TVMA 4YRBA 3GP8A 2WHQA 3O9MA 5FKJA 2ZI5A 3HCBA 1BAPA 3DNMA 3ZLTA 2ZTHA 4PYMA 4O4JF 1KWGA 4MI3A 1UFKA 2DFLA 3RSHA 2D1TA 1F5SA 1KI8A 1WF6A 1A50B 2OB1A 3OHSX 3W2IA 4Z4FA 1FJGB 5IMBA 1OJLA 3IMKA 1M2HA 2R6R1 4QECA 3PEVA 3K6SB 3ZS9A 1J8DA 4G97A 3LK6A 3PD0A 2W2LA 4FEEA 3RBAA 1AHHA 1R16A 1KJJA 1TQDA 3ICCA 3I92A 4ASUA 1LQUA 1RWQA 4RK4A 1VJ1A 4PAMA 1RAEA 2PRZA 3O93A 1E79A 4US1R 2EU8A 3RJ9A 1YJ5A 1YR6A 3Q7IA 3QVXA 2IEGA 4BY9E 1CERA 3MWDA 3RHZA 8AT1A 1QC5B 5HUJA 1MEEA 3BXFA 4DYDA 4BEJA 5FNZA 4RMIA 2X8AA 1U90A 2F1JA 1MEJA 1OU4A 2D3WA 2FLKA 2Z8YA 4EJ2A 3ZK7A 3EOBI 1L8XA 3HR8A 3SSOA 3VNVA 1ORTA 3QMMA 1PAUA 2V1UA 2B5OA 2H59A 3K0CA 4MZXA 3ON5A 3PI7A 2QKYA 1T9ZA 2ACKA 4N8SA 2D5CA 3MB8A 1GZ5A 4Y6SA 1Z13A 2WHPA 4X1YA 4D9JA 1WDLA 2IYXA 3NO4A 4K9DA 5ECWA 3T06B 1I94B 4JC5A 3BE8A 2HSJA 4DAOA 2OWDA 4LXIA 1V9CA 2EDAA 1ICIA 2QM7A 2YOGA 3M5CA 3IJEB 2YRFA 2C03A 5CNMA 4PZAA 1WMBA 2GEVA 5LOVF 3QU7A 4JVOA 5GJCA 4BP3A 4XWKA 4DILA 4HQKA 3QFRA 3GARA 1I5RA 5JJKA 1LY1A 2O07A 3GZNA 1L7AA 4D3SA 3MBKA 1Z63A 4OAPA 3AU8A 1PI3A 2KHZA 2PRIA 4HXFB 4YP9A 3JAMA 2BEWA 3A9UA 2DQZA 3RFCA 1IN7A 3U7HB 1VJ5A 4QFDA 3QVLA 5JADA 2MTBA 4DEVA 4E6PA 1JQ5A 1A8HA 3OOEA 4O0MA 3HYSA 2ZYGA 5DMXA 3EY9A 2H1RA 4FIZA 2W8BB 2VHXA 4X8HA 4BUCA 1MIOB 2FCAA 2HA4A 1DXOA 1NLFA 1SXHA 1YR9A 3OE4A 4M1YA 2A9FA 2K4MA 3BXPA 1ZRMA 3HHEA 1Z34A 3AFGA 1RC1A 4ICIA 4O02B 1L5YA 1TCAA 3G8AA 3W3AA 1GPYA 4FDVA 5BWBA 3S28A 4KMSA 4L73A 3RYIA 2A57A 1GPMA 2RG7A 4FXOA 4OXKA 4KE9A 2WU1A 1HO3A 5K0ZA 5D2CA 3MVEA 4H35A 4B6OA 4URHA 2HBYA 3NV7A 4KUGA 3NUZA 2VNSA 3TBKA 1LSSA 4BU0A 4RESA 4RVNA 1QF9A 4L5YA 4TPKA 2K7FA 1MD9A 1M8JA 2O8NA 4NEQA 4WKBA 1Y9JA 1SU7A 1U9IA 2XW6A 3GNLA 4ENWA 5EJ8A 4OQYA 1CV2A 1CNMA 5ELMA 3DMNA 2RIPA 3A8TA 4C89A 2IPNA 3C8ZA 2YY7A 4EJFA 3CN7A 4XVHA 2JC3A 2QTBA 2IELA 4TROA 1A7KA 3ZPXA 3EAGA 1VZ2A 4DA8A 2JHPA 2ENUA 1BH2A 2EZ9A 1FNNA 4FMCB 4RD6A 5BW6B 4B4WA 4EGFA 4FWTA 2JHFA 3MBIA 5CB8A 4BKRA 1S8AA 2GN4A 3S2FA 2GD2A 4Q47A 2BTQA 2WHRA 4YLEA 2D5IA 1OKKA 1RWBA 1W6RA 1Q15A 2A7XA 4IQ8A 10MHA 2OLJA 1YZQA 4YAFA 5I8WA 1U8CB 1PG0A 3E9MA 3ROFA 4CCWA 1TUBA 4G5OA 4OAQA 2DLCX 4HWOA 4P4SA 1JDTA 4OQ4A 4G2TA 1GKYA 3E7XA 4X6YA 2WM8A 3KV1A 4HDRB 1DJOA 1V5IA 1WS6A 4JQSA 1AS3A 1EU1A 1X1RA 4YCMA 1HF3A 2G0NA 3AHCA 5LP1A 5HKOA 5LYJF 3NGXA 2XI4A 3IP8A 4YDHB 3I09A 4JLPA 4XTCS 1ZJZA 4EVSA 2PV0A 4ENSA 3MAGA 4LZPA 4B6PA 1W88B 2RHOA 3UBTA 4DIMA 5FI1B 2G8NA 1XTKA 3I9NA 1XMQB 4A4DA 3MK31 2H1VA 5T4BA 4BNVA 2J0UB 3L8YA 3RR2A 3W0LB 2BFCA 4EG7A 4UDNA 1JR6A 3E84A 2J1LA 5KYXB 1X7YA 1EHYA 2VXOA 3R40A 1ECBA 2GSWA 1Y33E 3AXTA 3IAHA 3P0HA 1BMQA 4NV1A 4S0ZA 4U5QA 3SZUA 3TQOA 1E2UA 4I8IA 5A4KA 2IXTA 5DCWA 4EY7A 1Z08A 4IGAA 4NS1A 3OFSA 1UCFA 2A9OA 2QP3A 3ZWOA 4HB3A 5DTQA 1TKCA 5I7WA 3WTCA 3ZIUA 2OGZA 2IU4A 2GVDC 4ZHQB 2ASEA 3IEVA 5A2QA 2REXB 2QMEA 2PVPA 5A9SA 1N4AA 4XDZA 2HBQA 3LY8A 3V8MA 1OAKA 4D46A 3M1AA 1YI8A 2FWJA 2OBXA 2NU9A 3BF7A 1KDZA 4LCJA 4RUKA 4C14A 1PV2A 4Q3OA 1T35A 1VXOA 2XUQA 2XYVA 3VR6H 1B6TA 4FZ5A 4KFSA 1NNI1 4PCVA 3VAZA 3KQKA 3F6BX 1W5AA 4U6SA 4BASA 5IZCA 4N47A 3GLQA 3BAFA 3IQXA 5A5GA 1CVRA 4BQPA 1U31A 4N5HX 3OJLA 4J9VA 5IAOA 1Y3HA 621PA 1NQTA 2EEZA 1LTQA 4PHTA 1IBKB 4MSUA 4RKFA 5K0TA 1KKMA 1OWPA 3AP3A 4E5KA 5DLDA 3TKYA 3ZE7A 1M0TA 3EULA 5FFNA 3RO7A 2XBMA 1CULC 4A8JC 2CEKA 4OQEA 2UZ1A 4HVTA 3V9AA 2B3TA 3HGTA 1CY7A 1PFUA 1Y3BE 4FNAA 3RWMB 1X7WB 3U7QB 1ZG3A 3WE7A 4ZTUB 4RPIA 3I9KA 3JYHA 4OHCA 1YVRA 1R9MA 1ZQ9A 4KPGA 3KPVA 1HDRA 2WSSA 2CWDA 2XIQA 1GQQA 3LXRA 4JL6A 4M8KA 4CMKA 1IB0A 2DHRA 5H80A 4DA7A 3GAZA 2J3KA 4OFBA 2IYAA 2VZ9A 5IMSA 1A4RA 2B5WA 2WQ7A 2WIAA 1E1RD 2ICAA 4H6PA 3AK4A 4LY3A 2WYOA 2GAFA 1YIOA 3O94A 4GPEA 5GJWC 3AKYA 5BOSB 1T4GA 2HHHB 2H17A 3HY6A 4DR2B 2H06A 2XRZA 3DAFA 1TCUA 3CKMA 5DO9A 5HGJA 2ABWA 2V6GA 2WZQA 1GHTA 4RSHA 5BSVA 1BX1A 1AQIA 3TTWA 4IMRA 3LBFA 2JAQA 4OI1A 4E03A 2HO4A 3C3KA 3WAKA 2EX4A 1Z06A 2YQ4A 3MFYA 4Z7OB 5HIKA 2OCGA 4XPIA 1BWSA 5LQDA 4WE3A 1A9TA 1NW6A 3CH6A 3OZTA 3ZKWB 1QQ6A 2WMNB 3EQ7A 1SIWA 5LOVA 2FFRA 4CKWB 2VNHA 2GTHA 3OOHA 3WGMA 3WO1A 4CIBA 1LV7A 3R5XA 1E1MA 4U1RA 1XTPA 2BJVA 1II0A 3P4UA 4KPUA 1R64A 2ROQA 4JQYA 2II6A 3JRXA 5FF9A 3W4IA 2Z5LA 1IU9A 5DP1A 3CZMA 1OUMA 1HEUA 4GSYA 1SBCA 2BWJA 2ZRGA 3MD9A 1JHZA 3O38A 3UJ3X 4QVKA 2OT3B 2OAQ1 5AO9A 1Y9ZA 1E6KA 2HIMA 4L9SA 4LI0A 1U2EA 2FE1A 4TYNA 2C5LA 2FPSA 4F4HA 5K0BA 2O2CA 1SB9A 4NOLA 2PWYA 4R8KA 4L0MA 3AESB 5JCPA 4KR7A 5FWNA 5AVQA 3CVWA 4CKBB 1QMGA 4MTCA 4W1QA 1I4EB 5GOTA 2BMJA 1UEXC 3KC2A 5JJLA 1WVIA 4OKNA 1CUGA 3VSEA 1SG0A 3T15A 2Y67A 3CURA 3N0TA 1ZNYA 5P8WA 4HLNA 1TCBA 3FUWA 3S2SA 4A2QA 3NUGA 3KUDA 1NN3A 3FPEA 4RABA 1WXFA 4ZC8A 3ZDRA 2F3TA 3LX6A 3HXOA 4LNHA 5COBA 2ENWA 2AH5A 2VHUA 3MNFA 2OQIA 5TQJA 1QGZA 4V0NA 4BMNA 1HC7A 3LKDA 3GEGA 4ZN6A 3EGDB 5EHQA 5FLEX 5JBIA 2BGNA 1WQ4A 2C3MA 4BJ5A 3VX3A 4BLTA 1OXTA 4FJ2A 4QPNA 5CRIA 5I9IA 1NOJA 3NVDA 4I3GA 2Z5GA 2FJUA 2V3VA 1JJVA 3H1AA 2HJHA 5TMPA 2XCIA 5AKJA 2J3EA 1J0AA 2Q5OA 3CW9A 3S68A 2GZ1A 2CDAA 2LIPA 1SCAA 1R0SA 2FUKA 4UMFA 1IOLA 1JUDA 3ODPA 3IQEA 4GFDA 1I0ZA 1YGYA 2JI4A 4LTMA 3STUA 4RMHA 4DEXA 1IM5A 4OUKX 1UWKA 4FYIA 2Y93A 1W1WA 4ARZA 1RWWA 2QS9A 4XW2A 1E2FA 3Q88A 4V2IA 1PWYE 3L01A 2GD6A 1LEHA 1T43A 1M2KA 2SKDA 3MMSA 3J7AC 3M6MD 4H7FA 3H84A 1M34E 2VDMB 4D41A 1KDRA 3C6BA 3PQ5A 4CIWA 1VLQA 1IMJA 4JUAA 4XFDA 5IVIA 4ZU6X 2XWSA 3L6UA 5F12A 4LKRA 2FGKA 1QRUA 1DQZA 4DMFA 4GXTA 3P8ZA 4X3CA 1IXRC 3LYUA 1E7RA 1VCOA 2QUZA 3QYAA 4FGUA 3CX8A 5K8UA 3D4PA 1U1GA 1G8FA 3K9CA 1SD2A 3IXLA 3JX9A 4MP6A 2OV6A 2P2LA 4KWTA 1WKCA 2JW5A 4G5HA 4GGOA 2JGLA 3PR1A 4YAIA 1QU3A 1F17A 2Z5FA 1LI4A 3KCNA 5C8ZA 2ODEA 1T5LA 2PU5A 2X0JA 1IUNA 1OLUB 2P2NA 4TT3D 3H0EA 5FTJA 3H5WA 5SZIA 1XOIA 1OPRA 2JJ8A 3D4LA 2QE7D 3K16A 4LDPA 4MB2A 2V6JA 6NULA 3JATA 3B89A 2X5NA 3IPYA 2DPXA 3CRW1 2QR2A 5JVDB 4KQ6A 2PVSA 2WKRA 1O9BA 2H48A 1I1HA 3CJQA 4NDAA 2P9BA 3Q0TA 3EH2A 3HJAA 4OP2A 3STYA 1M2OA 4FILA 1VJCA 2FWPA 1KYZA 2FQQA 4FT2A 1J8VA 1AGXA 3AM3A 3QX8A 3BWBA 4OQQA 5BYJA 3VQTA 2JAWA 1PD1A 4BVBA 3PLAE 2VK8A 2FNAA 2N1MA 1W7AA 3QA9A 5JCOA 2DY0A 3TW8A 4TSKA 3N0RA 1PEYA 3QQ5A 3WL3A 1J20A 1U3DA 5B6PA 3BM5A 1ZGHA 1I3NA 5H0IA 4H3HB 5IAJA 1X0VA 4OQPA 3R7SA 1JALA 4URXR 1G21B 3V4FA 1LKZA 3ZK8A 3FHJA 4QNMA 1I8TA 1SAYA 3PC8A 5L3RA 4J2HA 4W4TA 2QD1A 5JSQA 2QYOA 3PD7A 1Q1QA 1NXSA 1NVEA 2HGZA 3L46A 4DIDA 2FZLA 2H7CA 3F6PA 2IP4A 1Z6PA 1F6WA 3D4BA 2PS9A 4IGIA 4INPA 4JYPA 5G40A 1P8AA 5BSFA 1QIFA 4B81A 1NN1A 2P27A 3GFPA 1JXMA 2OV8A 2Q2OA 4ZHQA 3MTAA 4LTNA 3UKOA 3WYEA 3HG7A 2NIPA 4KC0A 1USVA 1VE7A 3GGPA 1JV2B 5FJIA 2BI7A 4XVQA 2OPHA 2OBMA 1N25A 1VBMA 3WMEA 4BNZA 4I7EA 4CMIA 1EBUA 5E6UA 3UCXA 4Z0TA 3C14C 4N18A 3VNUA 4TUYA 5B3KA 2QJRA 5HF8A 2QU8A 4YJ2A 1E5DA 3EQ2A 3NIGB 4D6PA 3K53A 4EZIA 1DI0A 2OV4A 2JJ1A 4KQWA 5CIYA 2PR2A 1Y3DE 3B38A 2GXQA 2BP7B 2WYVA 2V8OA 5TQ2B 4U7DA 2V9ZA 2VOJA 4FINA 5ALDA 3JQAD 2H1FA 4PBSA 1E1CA 2X2EA 2GASA 1L4FA 2GGSA 2ZROA 1TU4A 2GJSA 2J6BA 2O9JA 1SU4A 2QR5A 2V7GA 3DHEA 3M3HA 4JNKA 3IQWA 4JBGA 2WU4A 4LKOA 4JQZA 3U19A 3GRFA 3NOVA 2BH2A 1MTZA 3T3MB 1A95A 3L7LA 3OEHA 2O1SA 1UEIA 4L75A 4JV5B 5CFQA 1PR5A 3Q1LA 4RADA 5B7PA 1QH0A 1SUFA 1J56A 4OQZA 4RD3A 4YJGB 1RWVA 2QAGB 2BFBB 2WMYA 3G8CA 4YMIA 2XHEA 5EIOA 5TPZD 2PH1A 3EEQA 4MVJF 3SBDA 3TH5A 1YONA 3M9WA 1EB9A 1BU5A 4PGFA 2QL7A 3WYNA 3B5EA 3KSUA 3LFUA 4XYBA 3SSNA 5FWXA 5IANA 4BCCA 2JGAA 3AM1A 2WE8A 1Z0KA 1S9DA 2GYUA 4ETNA 3DZHA 1JN0A 2GF2A 2HPHA 1XJ5A 1HQDA 4NLLA 5BN5A 4BC1A 1J24A 4DMLA 4KREA 1JLMA 2BV3A 3AGPA 2H1LA 3D7SA 3PTLA 1Y4ZA 2OORC 2MMGA 3LM8A 2WKSA 4LDZA 4XYGA 4KKVA 2HWKA 3K9BA 3BSYA 4UJ3A 3IHWA 4FYWA 2A35A 3L6BA 2R6FA 4IP0A 4CTMA 1YVDA 1SFRA 1PJCA 2A5YB 3GZNB 1USWA 4LF9B 5K3AA 4UE3S 2OILA 4MQBA 1CS0B 4DCCA 3GVXA 4ECEA 3B85A 3QPBA 4JT2A 3TRHA 2ZE7A 1I5EA 5ALIA 4AKIA 4MGZR 1H4QA 1QG0A 3EOAI 2CB9A 2QN7A 1NQWA 1UBUS 3ZWXA 1K2WA 3L02A 1U2SA 2ZIXB 5CH8A 3A27A 4BMSA 3FI0A 2WHPB 2ZDQA 2EG5A 1R0CA 2AJTA 3O3MB 3L77A 2VR1A 4YO8A 1PZEA 3O3CA 4NC9A 5G0UA 4EEZA 2AWNA 2C1XA 4DV3B 2HSEA 2PL5A 3ZXUB 2RGRA 4MCIA 1YMVA 3LPNA 3OKFA 3HUEA 3GLGA 1NVVQ 1UJMA 3M6AA 4IJMA 4Y2TA 1PS9A 5CXXA 3A4NA 1HZJA 3AZPA 1T3LA 2G0TA 3KVNA 3OKPA 4I1UA 1GTRA 5IKXA 2GT1A 1NKSA 3MGAA 4YRKA 5BMVB 1OBVA 2CMKA 5ALNA 4CL2A 4C30A 2BSAA 5KI6A 4BRZA 2O8DB 2PZAA 2UV8A 4KVGA 3PS9A 1K7CA 4YN3A 2EJCA 4RA9A 2BC9A 3CUTA 3PKJA 2AR9A 3QOWA 1GDDA 2YXNA 4AN4A 1UBKS 1CB7A 2YICA 4ZYUA 4INAA 2DR3A 3QTTA 1XIVA 2OQ2A 1C3JA 1ODSA 4K88A 3PYMA 4I4TF 2DAPA 1SMKA 3L8GA 3E58A 3VO9A 1CUAA 5JVDF 4LA4A 3EEYA 2YVAA 4CMJA 1NKVA 3NDJA 1EVJA 4HDKA 3GPLA 4L4XA 3CE6A 4LY6A 1F8XA 1JQAA 1JNYA 2C0QA 2RHDA 1W8DA 3B9QA 4P53A 4LXTA 5I5GA 4ARSA 4H6VA 4DFDA 4DDTA 1K06A 1AT1A 4KDRA 2V96A 4NU8X 4C4PA 5BQ3A 5BQPA 3A4TA 3C45A 3GRCA 3C16C 1SXQA 5KU7A 1IM8A 1JEOA 1QIHA 2F1OA 1D2AA 4QGGA 4Z8XA 4JT4A 2A1IA 3GEMA 1TZBA 4MVJD 1DUIA 2W83A 3C48A 3UYKA 1YO6A 3UY4A 5CMLA 2ZPTX 4JYZA 1NW7A 1L7DA 3EGOA 3HCDA 5AW7A 5KTRA 3RADC 5F9HA 2HF8A 4MW4A 1MEOA 4RK5A 2WAYA 1E1NA 5KDOA 4FI3C 1ZU5A 4LV8B 3NVAA 2QTGA 3O8QA 4HUQB 4MQFB 4BO0A 4IMPA 4Y67A 4MJ3A 3MMXA 5FHRA 2B2NA 2H2HA 3HN6A 5E6RB 1YK1A 3PT9A 4E1AA 2HXSA 2NO9A 1JPUA 1MAAA 3K32A 2O8CA 3BDIA 4WSOA 3NRBA 3Q11A 4N7RA 4UAGA 5CP8A 3I5MA 5HJ2A 4RIFA 4EK9A 2CNKA 1WPGA 1W4LA 4HZUA 1DQYA 3FDIA 3FPAA 3CJRA 1RAGA 1DWPA 3OZXA 4YJ3A 1C3VA 1NE2A 4I81A 4KYTA 4G26A 1VL5A 2G04A 3U7GA 4EKDA 3VR6D 5KKAA 4MK4A 2NQ2C 1YZYA 2Z2IA 1RYDA 1VIVA 2NUAA 2XB6A 3TSCA 3FOWA 4HAVA 1Z2EA 4R9SA 3FMVA 5D3MA 2J6HA 5DYTA 5AW5A 1H93A 2HMAA 3ZCTA 1E20A 2IU6A 1QP4A 4EYGA 3THXA 1X7XA 2DJIA 3IUSA 2OYRA 1NM5C 4D0LB 2PZEA 4NESA 4G3XA 3UFXA 2VQ6A 1X7GA 1QB7A 1LS1A 4O4IF 4Q21A 3V6MA 2VPTA 3VYWA 1SCNE 4RJLA 3GX1A 3H4VA 3T38A 1PFKA 4KH0A 3T3GA 4RD0A 3OJWA 5SY6A 4D2IA 1JIQA 4ESHA 3UAYA 5HSGA 4OSEA 1XKTA 3HVIA 3GA5A 3ESAA 4YI5A 3THOA 3CFYA 1O8CA 2JFHA 3WK5A 3HFGA 1EK6A 1PT6A 4NPCA 4TL7A 4B3GA 2VQEB 1KVUA 1KBQA 3FVVA 3FOBA 1Z8NA 2H6EA 2QJOA 1JDVA 1Z22A 2ZT7A 3U4QB 1HE8B 4YX9A 3EVCA 1O97C 4IS3A 1GZUA 2X1LA 1W2HA 2K6GA 5AW9A 1BCRB 3GEBA 4HFMA 3FXAA 3TZ6A 1YASA 1G2OA 5EE9A 3UAOA 4L57A 5LZ2A 1ZN2A 4PO1A 3A6FA 2NGRA 4MKGA 1WO8A 5EPOA 3UH0A 3ZD9A 1P45A 2C9BA 5A3SA 2E21A 3EC2A 3TTUA 5KWVA 1SVSA 3MJEA 3O6VA 2XUDA 1OLXA 1ZPDA 2VP0A 3GPDG 3TIXB 4EPWA 4R01A 4IOKA 1RC8A 2OCBA 2VQDA 3HYCA 1VKZA 2OOKA 2ZCVA 4U0JA 4IO1A 2OY0A 4OK6A 4FS8A 3WNCA 3PJDA 5K3FB 1YZHA 5F9FA 5HBRA 1EEXB 2GBLC 2PUJA 3OKAA 1YT5A 4WNAA 3CKYA 3CV3A 1UP4A 2FV8A 5AI4A 4Z3OA 1KYTA 3RWOA 3E7WA 3C3CA 2ZBDA 4BXOB 1JG7A 4IQ4A 2YIDA 3B3JA 3E7DA 1GN8A 4HUQA 3I28A 5DSTA 2IOQA 5JJ5A 3STVA 4BMZA 2DQYA 2HLHA 3ZKWA 3LLMA 1NRIA 4ZQBA 4DLRA 3NHFA 5JISA 4XM2A 3Q2IA 4DMKA 2QX7A 4QO7A 4HQOA 4EL5A 3D6MA 5IZCC 3PQ4A 3PX3A 4O5AA 1R10A 3EFEA 3UQZA 3DVLA 4UUMA 5DM2A 2VKTA 4UPVA 3E2IA 5JRDS 4FLEA 3T3DA 1YZNA 3MFQA 2Z56A 1QH8A 1JILA 4ZOLA 4DMMA 1QKIA 1NV8A 2HRQA 2ZRAA 4ZVMA 4WECA 3LRXA 1ZNXA 2PN1A 5IJAA 4GH5A 1H1LA 2CLLB 5K03A 4F3YA 5LMCA 3P2JA 4R98A 3RYFA 2YN0A 1I2BA 2BDTA 4EG5A 4EY3A 3UJHA 3PX2A 2ASVA 5IAAA 1XYVA 4AKTA 3O9VA 3K8YA 3CZQA 5B58T 1NR7A 4WN9A 4AF7A 3VZRA 1NVFA 4G5XA 3A9SA 3T0FA 1OYVA 1KO8A 4HDSA 5EE5B 3C3XA 2XVAA 4CM4A 4MUFA 4FB4A 3GLIE 1WXQA 3D1VA 1FLAA 3IV6A 4MX8A 3ILYA 1GNLA 3OP4A 1RJEA 2GN9A 3AUFA 3CYFA 4GP6A 5IWCA 4C2UA 3GBPA 5AKYA 4D0RA 4G9EA 4PLWA 1EI9A 1B6RA