4QKQA

Rada from methanococcus voltae in complex with copper phthalocyanine tetrasulfonate inhibitor
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
265
structure length
257
Chain Sequence
SHMDLGFKSGIDLLKQRSTVWKLSTSSSELDSVLGGGLESQSVTEFAGVFGSGKTQIMHQSCVNLQNPEFLFYDEEAVSKGEVAQPKAVYIDTEGTFRPERIMQMAEHAGIDGQTVLDNTFVARAYNSDMQMLFAEKIEDLIQEGNNIKLVVIDSLTSTFRNEYTGRGKLAERQQKLGRHMATLNKLADLFNCVVLVTNQVSAAEQAIGGHIVGHAATFRFFVRKGKGDKRVAKLYDSPHLPDAEAIFRITEKGIQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords DNA repair and recombination protein RadA
publication title Crystal Structure of an archaeal Rad51 homolog in complex with a phthalocyanine tetrasulfonate inhibitor
rcsb
source organism Methanococcus voltae
total genus 95
structure length 257
sequence length 265
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2014-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08423 Rad51 Rad51
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4qkqA00
2I1VB 1ZNWA 4LHWA 2RMKA 1KDPA 3FKSD 4XWOA 2IXGA 2VF7A 4GNKA 5HPYB 3NVAA 1QVAA 4RD2A 1G16A 5DNYB 4HYYA 3T1TA 3FHCB 4TTRA 4FIDA 1TQDA 2WWIA 3C5CA 3ZJYA 3SYNA 1E79A 2ZR9A 3NBZC 5G40A 4E22A 2J7PA 3FFBA 3DMNA 2QAGA 1KK1A 2A5JA 2O52A 4EPRA 3U7GA 2WKQA 4JLNA 5JBQA 4MRPA 4DBLC 1KO5A 2V3CC 4KBFA 4EAQA 1SVKA 2ZM5A 3BH7A 1N5JA 4WOPA 3L2OB 2ZE5A 5JEEA 1U81A 2QZ4A 2KWIA 2PMDA 3CZQA 1G5PA 3WYAA 2A2ZA 1IY2A 2JEOA 2YWGA 2IYYA 1SKYE 3GJ0A 2ZI7A 2ZRKA 2NQ2C 4CEIB 3V00A 3B8HA 4OBEA 3QBVA 1IN5A 2ZSFA 2QAJA 2N46A 4LZZA 1JAHA 5J4LA 3DHWC 5C4MA 3Q85A 3CPEA 3P4XA 3ZS9A 2DWOA 3RYTC 2PL3A 2EVWX 2WJHA 3R20A 5P21A 5GJCA 3PUVA 3GJ6A 5IK2A 4A6PA 2W6JA 5TVKA 1E4YA 3TSZA 4IFEA 2IYWA 2Z0MA 2QPTA 4AIIA 2AN9A 4IFBA 3U7FB 2BOVA 4JVMA 1E9BA 2RHDA 1SQ5A 4KXFB 5DYIA 1EFRD 4JSTA 2PX3A 3LX8A 3EWSA 3VHLB 3SR0A 2ZRBA 3Q5EA 4BFYA 4HDCA 2WJJA 2PLRA 2C03A 2YZ2A 3KX2A 2ZI3A 4Q9KA 1JR3E 3QVUA 1AZSC 3EC1A 3EAQA 1NBMD 2OBNA 3A58B 2VH5R 4DLVA 3W3AA 3RSOA 1CJMA 2XOKD 3IHWA 2R62A 2BC9A 3KDSE 4N0DA 2Z43A 4KBGA 3QJYA 5EXTA 1EFCA 3LH5A 2Q3FA 2IHBA 1G6OA 4JMPA 1HQYE 4LJYA 1VKJA 1E9AA 2ECKA 2NGRA 1G8PA 1SKYB 2RGGA 4WA7A 5AR1A 3G5UA 3UWKA 1CJTC 3BS4A 2EFEB 3HP1A 2GF0A 3GJ3A 4AURA 4MA4A 4BEJA 4CRWB 3GP8A 1G9XA 3AVYA 4X8MA 4G5SA 2ZRAA 4M9QA 1W48A 2QEQA 2RHMA 3U7EB 3IIMA 1UEIA 4TQUS 4OI2A 3HU2A 4D4KA 1JALA 4TT3A 3T1OA 3PQCA 4V03A 4DVGA 2F9LA 2OT3B 3CRRA 4Q4AB 2CVHA 3K70B 3AVTA 3L0OA 1QHHA 1P2UA 4LSGA 1MOZA 5SZIA 4TMZA 1C1YA 4JLMA 1Q1ZA 2WAXA 3AEZA 3EIEA 4OI4A 1JXOA 4UNQA 5A5GA 1QHSA 4IXMA 3EC2A 1G3MA 5EXPA 4HZUB 5DN6A 1F48A 1OYYA 3T06B 3QBTA 4E03A 3UATA 1E96A 1U8YA 2FOLA 3ASZA 4TZ0A 1N6IA 4L8GA 3GD7A 1G8FA 3T5GA 2OCYC 2JJ2A 3U3MA 2G0NA 3S1AA 2FU5C 4RVCA 3EX7C 3DDCA 1IN8A 5DI3A 2V6JA 2J46A 3GPLA 1Z3IX 2RB4A 3CX6A 2F1HA 4TL9A 3W6NA 2O8BA 2WVJA 3K0FB 4LC1A 2IYQA 4JYBA 2KSQA 1EGAA 1NN5A 3KJHA 4U02A 3RS3A 3GEEA 1XD8A 1XCMA 2ZYUX 3U5ZB 1OIWA 2A5GA 3KZ1E 5KNCA 3UANA 2BKUA 4LOAA 1NJFA 4MQBA 2WWWA 4MRVA 5DHAA 2FFHA 4GRAA 4PANA 3HWSA 4ASUD 1PLJA 4LJ9A 3BH0A 4XWKA 2DFLA 1E2FA 2HYDA 3AV0B 5FOWA 4DXAA 2FZLA 3EPJA 2XTMA 2IUSA 3OFNA 4FCWA 5BQ5A 1XNJA 4UJ3A 3RANA 4DSNA 2VTKA 1KO8A 4J0QA 2J0UA 4LUCA 4DWJA 2RGAA 3KKQA 3N70A 2E9SA 4HZIA 2IS4A 2O8EB 1DADA 4OQFA 5CM9C 2J0SA 1NLFA 1T4GA 2ZUBA 2VEDA 1G4AE 1T91A 1AS0A 2HCJB 5DLQC 3RRMA 1R0WA 2PEZA 3PEVA 4LC0A 3CF2A 3EZ6A 3RWOA 3UIEA 4IW3B 3DZDA 2JJ1A 121PA 2HXSA 3L8YA 1GWNA 2BM1A 2EW1A 3EARA 1R10A 2PEYA 521PA 5FTNA 5HE9A 4F7WA 2CHGA 4B48A 3VMFA 2BCGY 4QGFA 2XNDA 3CM0A 1G7RA 3BK7A 4LDJA 4HLQB 4WXRA 2FMXA 2W2TA 3BWDD 4Q9HA 4C2UA 2CXXA 1NN0A 2BBWA 3I1FA 5A0FA 3L43A 3TUJC 1SXJC 2NO7A 1BMFD 2C5LA 621PA 2W2XA 1CJVC 3GJ5A 1R4AA 3BRWD 5FOUA 1YRBA 1E1QA 2GJSA 4M1MA 3VR6A 5JHHB 1ZUNB 4DLSA 3KQUA 4YMUA 5G3ZA 4TSFD 4Q9IA 1Z08A 4KHZA 5JJLA 2IW3A 1AKYA 3IDQA 5K8IA 1GL7A 1N5LA 4GOXA 1KKMA 3BXZA 1UBEA 4KJZA 5JRZA 2CJWB 1U0LA 1OFTA 2PCJA 4ITRC 2ZRIA 2O8DA 1KO1A 2ZJZA 2NO1A 1XEFA 4A2WA 3BAFA 2R8RA 2VSOA 5AK0A 5FL7A 1XDBA 1G8GA 4F93B 4W9MC 4PC7A 2IXFA 3ZGXA 4HAXA 1A2BA 5IDVA 1A5TA 3I5XA 2HCBA 2W0MA 4LCBA 1FP7A 4RZ3A 3MUFA 3Q7PA 5LBIA 4DDWA 4NYIQ 4F92B 1JQLB 4MGZR 3PJRA 2XAUA 4ACAA 3Q7QA 3QEJA 1RVDA 1YZKA 4FW9A 4KCGA 2J9RA 1HT2E 3OHMA 4MGKR 1SGWA 3GJXC 5TDHA 3W8RA 1K5GA 3EA5A 2OBLA 1E0SA 1XJ0A 2ZI6A 5JLJA 4Q21A 4RZ2A 1YZNA 4P4SA 4CYMA 6Q21A 4L5BA 3KQNA 2IUUA 4QM6A 1J70A 4URXR 2QNRA 2PX0A 3ICEA 1GG2A 2B8WA 1R7RA 1NN3A 2C98A 4M22A 1RC8A 5DHFA 4W5HA 2WHXA 2HF8A 4BZXA 3EPKA 2ASEA 5JSZB 1YU9A 3MMPA 1R0ZA 4ABYA 3RC8A 4PC2A 1R5OA 1JNYA 1M1YE 3CX7A 3G82C 3CO5A 4BQSA 4PQFA 5DI9A 3FMPB 4EQ6B 4PC3A 5FOSA 1IN7A 4MYTA 4IDNA 3ZDQA 3GFPA 2IS1A 4KVGA 3IBYA 3BOSA 1XP8A 2SHKA 4JKYA 4UJ5A 3MWLA 3OE7D 1P2VA 1RZ3A 3VU9B 1E2PA 1WF3A 4JLVA 1T3HA 3HYTA 5BYKA 4TQAA 2QPAA 3NHAA 4AG6A 2ZPTX 4JBYA 1W5TA 1GRQA 1AKEA 2JIZA 2ZR0A 4PQYA 2P0EA 2OV2A 4CEHA 3A37A 4HUQA 1OFUX 4XSHA 3RNLA 3FTQA 4C0KA 4LJ8A 2OXCA 1FP6A 2PBRA 4KV9A 1XFAA 5LB4A 1SULA 1W4BA 3KQKA 4RY2A 1M7GA 2P6UA 5J4HA 2C9CA 3ECCA 5F3WB 1M7BA 1SXJB 4EPYA 4L9WA 1Q44A 3U7HB 3VNUA 3PG5A 3U3KA 4TMKA 4Q9JA 1D6JA 2VL7A 2CVFA 3QKSA 5B30A 4V0NA 2ZSDA 4XD7A 4ESHA 1XTJA 1E9RA 1E2GA 1T3LA 4ZCLA 4G5OA 1OFHA 4RZUA 3SJCA 3LQQA 2FV8A 2BMEA 1NIJA 3KTAA 4Q7MB 4DLUA 4Q00A 2GHIA 1IN6A 4NYJR 1ZW6A 3BD9A 3RRYA 3K70D 5CJ2A 5J40A 3VKWA 3OEED 1R5BA 3IO3A 4BUJA 2Z4RA 2YWEA 5HKKD 2JATA 2VP6A 2GBLA 4O2RA 3R9IA 4DUGA 3FKQA 2XTNA 1EESA 3RC3A 3B5JA 5KNDA 4M1SA 4R2HA 4NCIA 1JR3D 4XWAA 2QORA 4PC1A 5EE1A 5EQTA 3CB4A 3AKDA 2AR7A 4D81A 2OBMA 4F91B 3BB4A 1KAGA 5EZ5A 4A15A 1RJ9A 5AJYA 4OQMA 1NMXA 4A0GA 4CT5A 2GEVA 3A1UA 1G5TA 3EA0A 4DCNA 3SJBA 2JA1A 2P3SA 3ETLA 5KSZA 1XJCA 4MDFA 3A4MA 1DTSA 4NBSA 4Q4JB 5G53C 1MO4A 4IEIA 1T8UA 1BS1A 4IRUB 5FUVA 3W6OA 1WBBA 1KI6A 5SZKB 2LWIA 3O47A 1KTVA 4PFSA 1FUUA 3SHWA 2H1LA 4Q19A 2NTYC 1YKSA 3T34A 4BEBA 2NZ8A 3VTKA 5FOXA 2GJAA 4S35A 1P3JA 1DBSA 1FOEB 1ZBDA 3H84A 4QC2A 4QL3A 5AJZA 4ZI3A 3SFZA 1OLOA 2P2LA 1LS1A 1P7CA 1XPRA 3KJGA 1H65A 1X8KA 1OYWA 2X77A 4WVFA 3T1VA 1LF5A 1F2TB 1JXMA 3B1YA 4B2PA 2CBZA 5J4KA 1MO5A 1W4CA 5BN3A 2O0KA 1T9HA 2W00A 4YC7A 1T3SA 3VR2A 3BB1A 2ONKA 2IA5A 5CB8A 4M1KA 3RABA 3DKVA 4P32A 1X1RA 1KO4A 4Z8YA 2FPLA 4X8OA 1D5CA 1ODFA 3ADDA 5JJKA 1OHHD 3FMFA 5EUMA 4BFWA 4QRHA 3M1IA 2GDJA 2X1VA 2JLXA 3ZIAD 2Y8EA 3UK6A 1W5SA 2ODNA 3EG5A 1TQ4A 3PEUA 5JJIA 3CNNA 5BW8A 3QXJA 4KU4A 5KDLA 2C9YA 2JASA 5CK4A 3LX5A 4ZCIA 2ZAMA 3Q72A 1TF7A 4IDOA 3NHBA 4HSEA 4MYHA 3ZZUA 2W58A 1CTQA 4JBWA 1ZNYA 4OL0A 2HDNB 2GXUA 1KI2A 2P6NA 2WWXA 1CRQA 3QY0A 3UMFA 2O8CA 1UBFA 4NP6A 1ESNA 5L3SB 2AWOA 5L3QA 1CR0A 2ZI5A 3CRW1 5AJVB 4B76A 4P31A 1W44A 2CNWA 3ZVRA 5JWHA 5L3VA 3PUYA 1VG8A 1II8A 5A4JA 1GL6A 1KOFA 1YR8A 2DBYA 1N0WA 3D6TB 2V4ZA 3SYLA 1KMHA 2YOGA 4RFSA 4B2IA 4ZDKA 1PUJA 4FXPA 1H8EA 1XCPA 4KAXA 2N42A 1KI8A 4BFTA 2VP5A 2WZQA 3K9GA 4QNMA 2ZS7A 2OCPA 1TPZA 4EPXA 4HAUA 2VP9A 1ZU5A 1CP2A 3F0TA 2XZLA 4DDVA 4DKXA 4BECA 2F7SA 1J8YF 1FX0B 3QI2A 4Q5IA 2GNOA 2AXPA 3DM9B 4PPQA 4F4JA 3GLGA 3K9LA 1XD2A 3KFXA 5CB6A 5C4GB 5KSOA 1HUQA 1ZCAA 2Q3HA 1E2DA 1S9DA 1ZM2A 2V55B 4LJ6A 3U4QA 3U6BA 1AQUA 4OHXA 3IEVA 4UXIA 1EK0A 4OYHA 1XMJA 2WSSA 3TAHA 3IGFA 3A1SA 3GLHA 1MH1A 3NIBA 3N5CA 3QVVA 4C0JA 4LPKA 2XSZA 4DDTA 3QF4A 2NO0A 1CR1A 4EJSA 3MJRA 2HEIA 5ELXA 4B3XA 4MKGA 5GJVC 3EZ7A 1OH6A 4JJKA 3V4FA 4M9ZA 5JCPA 2C77A 1XWIA 4C9BA 4R71A 4CDGA 4EPTA 3GJ7A 5EP2A 4BE7B 2HV8A 4QGHA 3GLIA 4Q4HA 5EE0A 2EQBA 4PTLA 5HZKA 4XSGA 3KB1A 2QM8A 3BFVA 5FTLA 3C7KA 5J47A 4P33A 4QBHA 4PZZA 3UKDA 4EDHA 1F60A 2IF2A 4GI7A 1X8LA 3MCAA 1XEXB 2A5FA 1E3MA 1KGDA 4AC9A 4E07A 1U9IA 1H8HA 5UKDA 5EP1A 1US8B 2AXNA 1NL3A 2RGDA 1D9ZA 2C95A 3BGWA 3OEHD 4M9XA 3W9YA 3QSYA 1FL9A 2QMOA 5EZ6B 3QKUA 2G0TA 4IKEA 4A2PA 1IHUA 3J81k 2B92A 3KUCA 2F3TA 2BHRA 5DGXA 5EJEA 2I4IA 1EFHA 2QP9X 3CUEF 1Z6GA 3GFOA 2O8FB 2CE2X 1W0KA 5FPKA 5SZHB 1GVNB 1BYIA 1G6HA 2ZRDA 3P4YA 1BKDR 4IJMA 4DDUA 1D9XA 4Q7JB 3LRPA 3L8ZA 4TLEA 3NKVA 3AF4A 1VG1A 1R8QA 3O8DA 1M74A 4BPBA 1NP6A 2RGNC 3KXKA 4LJ7A 1T6NA 1GITA 2FSHA 4NL4H 4WIAA 1E79D 4DEXA 4WZBE 2OCBA 2PT7A 5DE3A 2R9VA 1V43A 4LHYA 2XJ9A 4US0R 1FMJA 4E09A 1OKKA 4ACBA 3SS8A 1E32A 3DOFA 1HQCA 3ZYCA 4TTQA 3QKRA 3AUXA 3NTUA 2NO6A 1W0JA 3AF3A 4TYQA 1S0UA 1Z22A 2WBLC 3CONA 2ANBA 2EYQA 3DPUA 2GXSA 1JEDA 4DSOA 1EFUA 4LYJA 1K6MA 1G64A 1SVWA 5F9HA 2A5YB 1E1RD 1Q1EA 3CF6R 2DFKB 3LO5A 1YZQA 4ARZB 1J7KA 5B64A 3HR8A 2UZ3A 3RDPA 2ZSAA 2OLJA 3OAAD 4Z51A 3VHXA 2R6GA 2QSYA 4NTZA 3CWZA 2H16A 2IYUA 1VYTA 2QG6A 4BFXA 4RZXA 5IK2D 2W6JD 1UDWA 1WA5A 4FMCB 3K0AB 1Z63A 4HB4A 2FZ4A 1ZM9A 2XX3A 4CGZA 3IKJA 2DCUA 4XVUA 1TEXA 4PAOA 1N6PA 3MLEA 4DB4A 1VYVA 3R7WA 2IWRA 1N6RA 4P3YA 4G0NA 3GLFA 3K70C 2MSEB 3SC3A 3R8FA 2REXB 2YWHA 3TBKA 3KQLA 2X8AA 5D3MB 5FR1A 1F2UB 2EWVA 2V54A 4L9SA 2BJVA 2B8TA 4LI0A 4NYJQ 2VHQA 4Y0VA 2IYXA 5FFMA 2QGNA 3HPQA 4D0LB 4EPWA 3ADBA 4CEHB 8OHMA 1VCIA 1OSNA 1Z83A 4FMDB 1XXHE 4LV6A 1CS4C 4MRSA 1E94E 4DT1A 4A1FA 3REGA 3PV0A 3AVUA 1M6NA 2FFQA 4KO8A 4DCUA 1COWA 2QE7A 3ASYA 3MFYA 1GRNA 2EYUA 3CR7A 4QHSA 4B6EA 4A8JC 3FFAA 3MD0A 3O8RA 1VMAA 1C4OA 2DHRA 4LX0A 3QKSB 3PFIA 2JLZA 4MDEA 1RE0A 3SBEA 1U8AA 3I3SR 3K0EA 3NEYA 1NLYA 2QT1A 5KHOC 1PLKA 1LTQA 3OIWA 4KYIB 1IONA 2V8OA 4S2EA 4G5GA 5FR2A 4TT3D 3Q8XB 4GP7A 4OK5A 1I2DA 1GZSA 3K53A 2ZE7A 4OJQA 2RAPA 2XXAB 3WNDA 2G77B 1FPMA 3FHOA 4FINA 3VAAA 4HAYA 4C0LA 3X1DA 5AUQA 1T0JB 2Q6TA 4C0QC 2GCPA 2GETA 3BFXA 3EWAA 4A82A 5JRJA 3OESA 2HT1A 3QF7A 1FMLA 1XPUA 3THXB 3EXAA 4IOLA 5TV2A 5EE5B 2QP4A 3KXIA 3KFVA 3BERA 3CX8A 5DN6D 3AH8A 3FKSA 2ZQ5A 2IX3A 4C0HA 3C16C 4XVRA 3M6AA 3SFVA 1GUAA 1XXHB 2ODBA 1DAMA 1G8YA 5KOYA 2RGEA 2ZJBA 1OH7A 2H5EA 4L15A 3TR0A 2J59A 3ZZ0A 421PA 2QTHA 1Q21A 4NPHA 4LYFA 2BMJA 2WV9A 2V9PA 3WMFA 2GKSA 3LVRE 1KIMA 1G3UA 4EIWA 2V7QD 2Q9AA 1Q12A 2AX4A 1VG0B 3CRMA 4ZKEA 1DARA 1P9RA 3PEYA 4NCJA 3VR3A 4CEJA 1GKIA 4MGYR 3NWJA 4BLOA 3ND8A 1E9SA 4X8LA 4HI0E 1XTIA 3RS4A 2UKDA 2J1LA 2XB4A 3UPUA 4QKQA 4OI1A 1DOAA 1LV7A 1YZUA 2REBA 3LAWA 1ZCBA 5H68A 1U2RA 2VSFA 4KLNA 4IDHA 1OB2A 3OFND 1DAGA 4CIDA 3ADCA 1E9CA 3KJEA 1N6HA 2P5SA 2YJTD 4MKHA 1XB2A 1L4UA 1SVLA 2JLSA 2CLCX 4I1OA 4RCZA 3AVVA 3B1VA 4V0ME 2WJIA 5CYOA 2ZRNA 3BJIC 1WRBA 2GA8A 1KSFX 4IXNA 3AKEA 4TYWA 1IY1A 1KJZA 1Z47A 3X2SA 1LNZA 4WXPA 3WRXC 4PHHA 5BWMA 5C1BA 2WWGA 4RKFA 4A8JB 5KPJA 2J41A 2E1RA 2ZJOA 3GEHA 3U60B 2FF7A 2JJ1D 3C14C 2GJ8A 4ZPXA 3B60A 2CDNA 2CE7A 2IEYA 4HB3A 5JI2E 3QE0A 3VX4A 3RLFA 5TB5A 3K09C 2XOKA 1HTWA 2XNDD 4M21A 1JPNA 1WBDA 1CXZA 1AA9A 2ZJYA 2D2EA 3T15A 2WPDA 2ODWA 3FDIA 4XIGS 3RS7A 3ZVNA 2R44A 2VBCA 3IIKA 4PAQA 4PPFA 1QF9A 3KUDA 2ZYTX 1JQJC 4TL8A 2FSGA 2E87A 4RFSB 3IO5A 1Q20A 3MRSA 4QBFA 5DSZA 4LY6A 1J99A 1TNDA 5J5CA 4ZIRB 3LBHA 3OIVA 2QN6A 5JZVA 1IAQA 1UKEA 1A4RA 2RKOA 2VF8A 1X86B 1OT3A 3T35A 5J4VA 1O87A 1RRPA 3W90A 4Q47A 3WNBA 3X1YA 1ZJ6A 4QJ3A 1KDTA 3QOFA 1P72A 2R6FA 5E3HA 3OZXA 4CF7A 1E98A 2IYTA 3HPRA 1NLZA 3THYA 1OIVA 4K81B 1CR4A 2IXEA 1HYQA 5JWOA 4QBGB 1IXZA 3I32A 2AK2A 3WMGA 1WB9A 1FW6A 1LF0A 1VECA 2ZRPA 3W5IA 3C15C 2D06A 1XCGB 2ZUDA 1G3RA 5KU1A 5CDFE 4DSTA 1J90A 2AL7A 4FWIB 3K0CC 1NSTA 3TRFA 4FCTA 1NI3A 3R8CA 3UG6A 3SEAA 3N2EA 1DG3A 3FMOB 2CCGA 4MYUA 1G18A 3THWB 2FPMA 2CK3A 5FBRB 2PJRA 5C18A 1E0JA 2OFOA 3B7GA 1NVVR 2NG1A 4TYPA 2YKGA 1WDTA 2NIPA 4Y0AA 5FOTA 2ZE6A 1BOFA 1TF5A 4RFVA 1NVXQ 4LBVA 3NH9A 4B43A 2ORVA 4UXHA 1EWRA 3IEUA 1P9NA 2EFCB 2FG5A 2ZIAA 2B6HA 4OK3A 1EWQA 1JJVA 3DEFA 3TH5A 4JVNA 1XBTA 3NBXX 5FPSA 1KK3A 4FI3C 1VTKA 2W6ID 4N1AA 4RKEA 2JCSA 3PUWA 4LV5B 4QBIA 1OH8A 3R9XA 3TE6A 3PENA 1KAOA 1P6XA 3AP1A 3F8TA 3E5HA 1XEWY 1JJ7A 2VHCA 1PJRA 4Z1MA 1F6BA 4URWR 5E7JA 1N6OA 3TLXA 2DWPA 5CLLA 4X8HA 3CNLA 4NZYA 3D7MA 5FPTA 4A0HA 2IYSA 1O3YA 1OXXK 1GRRA 3BORA 4JL6A 5HZHA 2GVZC 4NCHA 3C5HA 1X8JA 3IPYA 4I81A 3X1ZA 1GKUB 5CK5A 3SQXA 3V9PA 2QPOA 4HLCA 5IHPA 2GCOA 1MKYA 3NG1A 2GK6A 4M1TA 4G1UC 4AKHA 4NMMA 4XD7D 4JSYA 1E2IA 1TQ2A 4BFZA 3SHFA 3QNUA 2GXAA 2PMKA 4Q02A 4DCVA 3LY5A 3ICQB 3BBPA 4ZO4A 1ETUA 4HLUA 5F9FA 1VPLA 4QJ5A 3GLFE 5BN5A 3K9NA 1ZU4A 2F1RA 2QQ0A 4WW0A 2FJUA 1NVWQ 1N3BA 1Y63A 1MABA 1BMFA 4URYR 3L0IB 1G7TA 4NDZA 4DUGD 4B33A 1I2MA 1KSJA 2X2FA 1HE8B 1TUIA 4PX9A 4QFMA 5FOVA 2C96A 2IT1A 4QHYA 2KI5A 2MSDB 4PAMA 1PLLA 3QPWA 5EUQB 4UNPA 5FPHA 1GIAA 4II7A 1CF4A 4OHYA 1KI1A 2AD5A 5M04A 2X2EA 1WQ1R 2F43B 5TY0A 1NRJB 2YVUA 1AIPA 2PLFA 1DS6A 4BRWA 3TJZA 3W3ZB 1G4UR 1NF3A 1TL7C 5JWRA 4JT4A 4C4PA 2DPXA 3LBNA 4OQXA 2GVDC 1JECA 2IYZA 4Q9LA 3WRYC 1DE0A 1R2QA 5EE9A 1DG1G 3GMTA 1ZM3A 3H0KA 4ZDWA 3SN6A 1E6CA 1SVIA 2FEOA 3AQ4A 1QHIA 3U3OA 5AUNB 2ZREA 4D0NA 2J0QA 2YYZA 3B82A 2WJYA 4I4LA 3H4MA 3CLVA 3X1XA 3GLFB 3JVUA 3LD9A 3W34A 3JZAA 4AYTA 3PITA 5K8LA 3UMSA 4CEIA 1D2NA 4YXWD 4LRWA 2QAGB 4TTPA 2ZS9A 1HH4A 4P4UA 1MRNA 3TNFA 4N3NA 2ZRGA 2BVNA 1KMQA 2OZEA 3A6PC 2ZSEA 2BMFA 4DC9A 3TVDA 3D8BA 3TK1A 4CW7A 4PSVA 1DAHA 3QXXA 4AWXA 2RGNA 4DHEA 1E69A 4CZ2A 1P73A 3W5JA 4NYMR 4MUAA 3P26A 3ZLJA 4LYAA 4TL6A 2R2AA 2D7DA 1E0AA 3B1ZA 4HAZA 3UG7A 4URVR 2GAOA 4DCTA 5JHGB 4Q7KA 4TYNA 3LBIA 4FMBB 4OQLA 1SKQA 1JB1A 3WHKA 2H18A 2ORWA 4U00A 1RPZA 1CRPA 1R8SA 1VHTA 1SVOA 4DCSA 1Q3TA 3T61A 2WIBA 3CNOA 1Z28A 2WICA 2B7CA 3M0EA 4JJZA 4JBXA 2F1JA 2GTPA 3Q9LA 4O25A 3UMRA 2WAYA 5D3QA 4A6XA 3ZS8A 2AHOA 3H2YA 1YJ5A 3FYHA 4IHQA 4FN5A 3UXMA 3AF1A 5E7MA 1KJWA 2LKDA 1W47A 1SVMA 2QMHA 5FBVB 3O8BA 4OHZA 3TAUA 2H8KA 2QENA 4BFUA 1L2TA 2CNWD 3I62A 2ZRLA 4WZ6A 1EFTA 3TGPA 4R7ZA 3BC1A 3PVSA 3W8NA 3K1JA 1H8ED 3B6EA 4Z54A 1KSHA 1ZIOA 4R9UC 4AYXA 2CL0X 4TLDA 1YZGA 2GCNA 3CW2A 4Q4AA 1S1CA 4UXJA 3WXMA 1R0XA 2PCLA 1N6LA 1ZIPA 5CLQA 2IF0A 4Q01A 4PZYA 2J5XA 4JLAA 4OHWA 1BIFA 3LLMA 3CH5A 1RRFA 1U98A 3SJZA 4EUNA 5HKKA 4KSCA 3LDAA 3SNHA 2VRWA 3FVQA 4LJ5A 3ZH9B 4Q1CA 2ATVA 3BIFA 3P27A 2QM7A 1UEJA 1QDEA 2ZJ5A 4HZUA 3IUYA 3WMEA 1P5ZB 2OFXA 4NH0A 4TL7A 2QBYA 4GSYA 4OI0A 1KHTA 3C41J 4F4IA 2B21A 3WBJA 5KYKA 2CCJA 4MITA 4AKGA 1MT0A 4FD2A 2W0SA 3RRZA 4CEJB 1KI4A 3AP2A 1AS2A 1NY5A 3F3YA 1N0VC 1QHHB 2C04A 2NPFA 3UWOA 2D2FA 2BEJA 2YOHA 4POAA 4AYWA 1AQYA 3K0FA 5GVSA 1R6BX 4TMWA 2H7VA 2QP3A 4IVQA 1OB5A 2BEKA 2MMCA 1DAKA 1KYIA 3IBGA 1ZVQA 1VYUA 2GESA 2QMEA 5KSPA 4WAUA 2HLDA 3ADKA 4BLSA 2IS6A 2ZETA 4KFRA 3V4RA 3S1AB 4WBSA 3AVQA 4B47A 3QG5A 4NCNA 5DI3B 3AF0A 2XJ4A 4QM7A 3VQTA 4TMXA 2O8BB 1ELOA 4JLJA 2EFDB 1OF1A 1QHXA 1H8HD 5DYGA 1Z2AA 2VP0A 3AVWA 3CWQA 4PHGA 4PPNA 2R6CA 2TMKA 1QZXA 2O8EA 1UJ2A 4D0GA 2RCNA 1P61B 3I73A 1UKZA 3FB4A 3VX3A 1ESMA 2Z5FA 1ZYUA 3E1SA 1XEWX 5HCIA 4LPSA 4IVPA 2H17A 3EASA 4WZAE 2C78A 2NPIA 4BFSA 4NCKA 2WKRA 2OESA 5FTKA 5JECA 4MUBA 2DR3A 1ZP6A 1C9KA 1F3OA 3CR8A 4A0FA 4KFUA 2HUPA 4B75A 1S9HA 2J0UB 3I8SA 2RGXA 2FA9A 3I92A 2G1KA 1W7AA 3WHLA 1ZAKA 4H9GA 4JLBA 5E95A 1DPFA 4US1R 2JLWA 1Y3AA 4RSGA 1UBGA 1Z07A 4ZDIA 1PUIA 1IOZA 3SU8A 2QT0A 3NXSA 1NVVQ 3NC1C 4TLCA 1TU3A 3THYB 2WTUA 1HE1C 1A2KC 3D31A 1CR2A 1FTSA 3RS5A 4Q03A 3NBYC 1UBCA 2FN4A 3I4LA 3SZRA 4P0TA 4B71A 2CHQA 2CJWA 4F4CA 4Q1DA 4KITB 1GILA 1IM2A 2YHSA 221PA 2WWHA 3QEOA 4FMCF 3WP0A 2Q9BA 3AGPA 4AY2A 1PV4A 2GZDA 2REOA 2IYVA 1IY0A 1GNPA 1II9A 3LW8A 3U2QA 3B78A 1G8HA 4PO9A 4OQNA 2FPKA 3NH6A 1E2MA 3SI7A 4ZDJA 2OO7A 4GBMA 1P9WA 4HDOB 4U7DA 2VO1A 2OUKA 4NONA 3PIRA 2BMDA 2O8DB 3LQRA 5HE8A 1TUEA 1G291 2ZI9A 1VCNA 3Q5DA 4B6FA 4D4MA 4D4LA 2I1QA 2JLQA 1W2HA 2QI9C 2XZPA 4FMDF 1I4TD 2J7PD 1XZPA 1XMIA 2AKAB 2A9KA 3NDPA 3SOPA 4E5UA 3TIFA 2HJGA 3RVBA 1QG2A 3CF0A 2A5DA 2GBLC 4QGGA 5AWFC 4BWYA 2PT5A 4KVAA 1CU1A 1E2QA 3B85A 4D4JA 4LHXA 1VG9B 4XJXA 1CLUA 4DB2A 5JSZA 2VP4A 2OAQ1 2YC2C 3VKGA 4TZ6A 1Z0DA 4EQ6A 2B7BA 1SVSA 3ZZTA 3MWJA 4MKIA 1G7SA 4URUR 2ZYVX 1P75A 1XTRA 1COWD 4XH9B 4BGDA 2QE7D 4ERNA 1KZ7B 4P4SB 3P1JA 4QNRA 4LYHA 3VU9A 2BBTA 4DLWA 3CZPA 3MG9A 1AM4D 1SHKA 1NMZA 3TQFA 2JDIA 3LFUA 1TTTA 2YC4C 3CRQA 4A92A 5FI1B 5FH9A 3B13B 3QKTA 2ZITA 2DY1A 1ZD8A 2D3WA 1QG4A 4B3DA 2RGBA 2XGJA 3CBQA 2HF9A 1Q1QA 4JS0A 1FTNA 2P67A 1V5WA 2XEXA 3C8UA 2OAP1 1S2MA 2C99A 4BASA 2O5VA 1M8PA 1SXJA 2AFIE 1XPOA 2W2VA 4MRRA 3LW7A 5CIQA 5IT5A 1P2TA 2WIAA 5B2ZA 4ZKDA 1PVOA 1Q1BA 1OE0A 1OV4A 1G3IA 2GWHA 2QTVB 1XD9A 3BFKA 4B73A 4PC6A 3A36A 4D26A 1E9FA 2ZJ8A 4IOKA 4RD6A 1MR3F 4HUQB 3BB3A 2OHFA 2F55A 3X1WA 2L0XA 4PO8A 2G88A 2ZE8A 4QG7A 1LS6A 4YLGA 4QHTA 2FSIA 1L7VC 1DAIA 4Q1FA 5FBWB 5LD2C 3AM1A 2D7CA 4LJ4A 2OG2A 4C7OA 1QRAA 3MWYW 1KDRA 3VR1A 1WMSA 2QY9A 1NKSA 2ZRHA 1W36D 4NYMQ 2IYLD 4JZKA 4B32A 5JCZA 1GDDA 3DOEA 2FFAA 3KTAB 4M0LA 4IDPA 2IYRA 1E1RA 1KNXA 5AUOB 1FNMA 2BKEA 2NO9A 4I1VA 2IL1A 5LDDC 3EIQA 3OAAA 2BBOA 4QGAA 2WSMA 1G19A 4JL5A 4Q4JA 3FGNA 1TU4A 3B9QA 1IJEA 3KL4A 3TW4A 4M2LA 2ANCA 2CHVA 2QUZA 4D6PA 1F5NA 4P4TA 1KI9A 4D80A 1L8QA 2XNSA 1RYHA 1RJ9B 4HEJA 2F1IA 1W46A 2AFHE 2C2HA 3GCGA 2JJ2D 1ZC3A 5JEDA 2G3YA 4DLXA 4BZPA 3VKHA 2C8VA 4XOIA 4GOKA 2NMVA 3A4LA 4UKDA 1F2TA 1RRCA 1N5KA 2YWFA 4I1UA 3H86A 1XF9A 2R6DA 1WCV1 1KO7A 3IQXA 1M34E 2WWYA 5AJWA 1KI6B 4IOJA 1KY2A 3AP3A 3CPHA 5H1YA 1Z6AA 1DO2A 3AUYA 1RKBA 1R5NA 1YVDA 4KSBA 1XTQA 2WPDD 2ZR7A 2OCAA 5KTYA 1RYFA 4JVSB 1D2MA 1E99A 4M4SA 4B34A 4C0AC 3R9WA 2DYKA 5KUTA 2KJQA 1GL9B 1E2LA 1G17A 1AGRA 4EJSC 3JZMA 2ZROA 1HV8A 3Q3JB 3RS0A 1Q3HA 2WWFA 3I72A 5F98A 5CJPA 1GAJA 3I8XA 1IQPA 3QQ5A 4DIDA 1KKLA 2VHTA 4CT4B 5FL3A 4OKSA 2ZS8A 4RJLA 3GJ8A 4HDQB 1NMYA 1JBKA 1M7HA 1ZMXA 2JLVA 1RFLA 1Z0FA 1NKTA 4MH0R 2IWHA 3N2IA 5L3SA 1EFRA 3NEJA 1UKVY 1XJQA 4ESVA 2BWJA 1G7CA 4G3XA 4XTCS 3GLGE 4L4UA 5LD2B 1FZQA 2NOAA 5JS8A 3IIJA 4DLZA 2D4HA 2JJ8A 2HJVA 1RIFA 1CBUA 1GOTA 3HJNA 2AWNA 4XTRA 3KKNA 1NBMA 1U9IC 2GZHA 2QBYB 2JLUA 4PHFA 1UF9A 3RSLA 1N5IA 3GLHE 3SBDA 3U61B 3JVVA 3LV8A 1Z5ZA 2VHJA 1N25A 5F2EA 2OILA 3GJ4A 3M4YA 2O8CB 1HY3A 4JIMA 1FNNA 2LKCA 1KZGB 4I99A 5L3QB 1D8TA 1UDXA 1E0KA 3OF5A 5CITA 2JGNA 1FX0A 4TWZA 5DISB 1Z8FA 1BYUA 1E4VA 2OM2A 5FTMA 2ZANA 2JAQA 1YR7A 3E70C 1E1QD 4LWZA 3VR4A 1II8B 5CIWA 5H8WA 2CK3D 2PZFA 4LGMA 2I3BA 4NU0A 3DO6A 1KMHB 4K8OA 4R2IA 2D74A 4PSKA 3TVTA 5C46F 2V7QA 3TUZC 2H57A 3GFTA 3T5DA 4M1YA 1KK2A 1RW4A 3MGCA 1G20E 4IOMA 3ZQ6A 2K5UA 2F3RA 3IQWA 3GLIE 5JFGA 4PQRA 3LA6A 2UZIR 1XMVA 1JPJA 3IILA 2ODEA 4HB0A 2OSBA 5FL7D 1LFDB 4H1VA 4Z8XA 4IEEA 4BLPA 3FWYA 1W4AA 2RGCA 1Z0KA 4GFDA 4LHVA 2ATXA 3GEIA 4M8NE 3GLGB 1GM5A 1XD2B 1DAFA 4EKDA 1P60A 1Q57A 4BLQA 5KSYA 5GJBA 4Z1MD 2R6AA 2V1XA 1E2NA 3B1XA 3U4QB 1K8RA 3VR5A 1IBRA 3A1TA 4LBZA 2PJZA 2BCJQ 4JL8A 3GLHB 3PUZA 3DM5A 5TXGA 2KB0A 2IHYA 2ZVPX 1WXQA 3OIYA 3AB3A 1YQTA 1NJGA 4UNSA 3RAPR 3QF4B 1A1VA 2QU8A 3U3RA 4DSUA 1X3SA 2WMNB 1TX4B 3I61A 4EJSB 3C4JA 3TMKA 2A3RA 1S8FA 1XEXA 2VQSA 3WY9A 5GVRA 4BLTA 3SJAA 4B3CA 4URZR 4YDHB 4KFSA 3CPJB 1LB1B 5JS7A 5SZJA 1US8A 2QSZA 1KI7A 3U44A 2EFHB 4Q7LA 1T5IA 2ZYWX 3SE0A 1ZUIA 1HT1E 1S4QA 2BV3A 2FGJA 1EG7A 1CJUC 1KNQA 5E4FA 4AD8A 1MRSA 4C3ZA 1Q22A 1AJEA 2X19A 4QJ4A 4Q4HB 4R98A 5FBQB 1IXRC 2DFNA 4IDQA 3GLIB 4B3GA 4O0MA 2W83A 2CMKA 3FPAA 3P32A 4KI0A 1J8MF 4Q1AA 2LCFA 1AZTA 4Q4LA 2ERXA 4ASUA 1VIYA 1SHZA 4A2QA 2O8FA 2HT6A 2QRZA 1PZNA 2GXQA 4LBWA 2QAGC 4V0KA 1SZPA 3AVXA 5JMTA 2ZRCA 3TQCA 5HCNA 5GJWC 5CYPA 2JIZD 4JKIA 4PZLA 4D82A 1B23P 4PPGA 2XTZA 4EPVA 3H1TA 1U0HC 3RHFA 2QGZA 1WE2A 4C30A 1VCMA 5IRCD 1U94A 1W2GA 1TQ6A 1GSIA 4HLDA 3RWMB 3CKLA 2Z6VA 1CJKC 1S96A 2QROA 1EXMA 3PUXA 2V1UA 4I1SA 4DRZA 3VFDA 3HU3A 1P62B 4B44A 3ZD7A 4Q1EA 1IN4A 3MAAC 4KYUA 3MWKA 1HEIA 2Q3MA 4D25A 4YMVA 3QIAA 2CL6X 1XTKA 4HATA 2D62A 4BLRA 1JI0A 3SQWA 2Q0HA 3MSXA 2IK8A 3QENA 2GRJA 1SXJE 2CLDX 1FQKA 2MSCB 4ARZA 1RRGA 2VA8A 1IXSB 1VHLA 4ILEA 1B0UA 5AUPB 1GTVA 2WMOB 2ZRMA 3B2EA 5JI3E 2N1BA 2J45A 2BJWA 3PR1A 1WP9A 3REFA 4TSFA 3QKRB 5FPYA 2XB2A 4A0RA 3QPUA 3E2IA 1Z6YA 2DB3A 4GL2A 3K0AA 1IJFA 1ANKA 5BN4A 1JEEA 2Q21A 4KODA 4NE2A 2ZEJA 3CIOA 2ZRFA 4PR0A 1QVRA 2XITA 2KE5A 3EPLA 1GNQA 3AF2A 4TN1A 2A78A 4MGIR 3T12A 4Q1BA 3HU1A 3K9HA 2W6IA 1EX7A 1KDOA 2ZTSA 4C0SA 2YOFA 4PSAA 2G1JA 2IBMA 5D3MA 3WYFA 3CH4B 1W49A 5BXQC 4V0LA 1DAEA 1F2UA 3ZD6A 2JLRA 1Z0IA 2QQEA 1KY3A 2ZXUA 4O3MA 1W36C 4DJTA 4GMDA 5TMPA 5L3RA 2OLKA 3SDZA 3EZFA 1VDZA 3DZ8A 2CCKA 4O2LA 1X1SA 1S3SA 2ERYA 5FUYA 3R7WB 3EZ9A 1X6VA 3QXSA 4GMXA 4QOSA 2GEDA 2Z4SA 1Z6XA 4YMTA 5KPDA 4QXAA 4W7SA 3FOZA 2A30A 2OEPA 1YHNA 2IS2A 4Q48A 2WOOA 5DH9A 4W5JA 2ZU6A 1E2EA 3KQHA 2QRNA 1XZQA 1ZNZA 1D2EA 4M1OA 1E2HA 1G3QA 4BRUA 1ZC4A 4B2LA 5EE3A 2EWWA 2BIFA 1UAAA 1OIXA 1Z0AA 2VP2A 3FHTA 1N0UA 1G41A 1NY6A 4GP6A 1ZRHA 2DFTA 2J0VA 4JT2A 4DT1B 4GZLA 1MO3A 1OJLA 1OW3B 2XXAA 2GILA 1T8TA 3RS2A 2ZAOA 4U5XA 1N6NA 3OE7A 721PA 2GEUA 3FE2A 4YMSA 2YV5A 3THXA 1E2KA 1M2OB 3AVOA 4C7OB 1T0HB 2J7KA 3HYRA 4Q66C 5EP3A 5FUXA 1YR9A 3L0SA 4GDFA 4EFNA 4KFTA 5EXXA 3LNCA 2IUTA 1NN1A 1U99A 2OXRA 3THOA 2VLIA 4JLOA 1UM8A 2P65A 3A1VA 3KKOA 4GPTA 2BBSA 1UKYA 1XXHA 4G5RA 4D2IA 2FFBA 1Q0UA 3IPXA 4G5QA 2FH5B 4ZI2A 4ON9A 2FWRA 3HR7A 3A1WA 4JLDA 1A7JA 5K8UA 3B9PA 1W1WA 1XMSA 1ZM7A 4W5WA 1UFQA 2FE4A 4HUTA 2A7QA 1OXTA 1OXSC 1ZD1A 3MJHA 2JLYA 4LK2A 1GFIA 4TMVA 1P2SA 4A36A 5C2JB 1AS3A 2KBEA 5K8TA 1DVRA 5L8VA 1YZLA 2HLDD 1ZUHA 1CEEA 1LW7A 5DIFA 3NC0C 4LV8B 3K8YA 2C9OA 1YRAA 2FX3A 1XRJA 3OEEA 2FEMA 2KBFA 3LXRA 5HTKA 3RRNA 3QPVA 1E2JA 3KKPA 4PO1A 2IEZA 4YXWA 3T1QA 3EPHA 3PCRB 4AKEA 2PZEA 2XZOA 5HR5A 4A4DA 4RD0A 1NBME 3ND9A 2O0JA 2IC5A 4RD4A 3VNVA 2HXYA 4DZZA 1W4RA 1JR3A 2O0HA 5DO9A 2WJGA 1KJYA 4A9AA 1W36B 1AK2A 4H1UA 3CRVA 4EFLA 4L16A 1S3GA 1CIPA 2P5TB 2WSSD 5KO2A 5KDOA 2VYFA 1OFIA 1AGPA 2EU8A 1L4YA 2GJKA 4EFMA 4MRNA 2XSZD 2QL6A 3KJIA 2OFWA 2QTFA 3QUSA 3ZVMA 3ONWA 4A8JA 4M9SA 4N0EA 4US2R 2VHUA 1QHYA 3AGQA 3K0SA 1R0YA 1ZD9A 4HAWA 5TARA 1CULC 4TLBA 3L82B 2BDTA 2VIIA 1YZTA 4LBYA 1I4DD 1MV5A 3DMDA 1G21E 1UPTA 4M53A 821PA 2G6BA 1KI3A 1G5RA 5AJXA 2DWQA 3AVPA 5GADl 4G01B 4YMWA 3TSWA 1ZINA 4TLAA 3LLUA 1NSFA 4JLPA 4DLRA 3TSOA 5B58C 2EFGA 2ZJAA 3FMIA 4K46A 1HA3A 1S1MA 5G41A 4AI6A 1OXVA 4MYCA 2J3EA 4CVNA 1EX6A 1FUKA 5ANRB 2UVQA 2FDCA 4ZIRA 1OHHA 1LY1A 1II0A 1TF2A 1JAIA 1QBKC 3LWNA 1TAGA 4V0MA 1FQJA 3ZIAA 4AG5A 5BYJA 2GF9A 2WM9B 4AKIA 3A8TA 2ZRJA 3WYGA 3QXHA 3GQBA 3EZ2A 1G1MA 1QHNA 4OHVA 1OXUA 1W0KD 4GT1A 1FFHA 3AKYA 1U90A 1MO6A 2FGKA 3EW9A 5KNBA 4JLKA 4B3BA 1XU4A 1UADA 2VPPA 5KDDA 5IF9A 2ZU0C 1TEVA 1I4LD 1KK0A 2PH1A 2PZGA 2OE2A 4ZV4A 4UNRA 4HLUC 3QG1A 3SYKA 4RD3A 2Z83A 4RD1A 2WKPA 1KSGA 4RCYA 4NKRA 1YE8A 1OPXA 4DLTA 3DVLA 4UQOA 1Z29A 1OKKD 4JVLA 3L0PA 3HDTA 3THWA 3TW8B 4BZQA 1NG1A 1Z0JA 2VSXA 4JYCA 4F38A 1W0JD 1Z6TA 3B1WA 2R65A 4ZCMA 2QA5A 1VCOA 3NDBB 3U6KA 3TKLA 1GNRA 4B3FX 1XTSA 3LXXA 4HAVA 1AN0A 4FCVA 1K5DA 4YONB 3U3JA 3ZVLA 3PEWA 2J87A 2BM0A 3G0HA 1J2JA 4M1WA 4DLYA 1N2CE 3DKPA 3WP1B 4AK9A 2G9NA 2ORIA 2GJ9A 4V02A 1A82A 2F6RA 1XX6A 3EIHA 4TMTA 2AD1A 1U0JA 2JDID 2AK3A 2GK7A 2CLSA 1U8ZA 3WBKA 4DIEA 3K09A 3U44B 2GZAA 4OJKA 3KB2A 4UNNA 5LB2A 4PHTA 1LVGA 3KXLA 2YINC 1BO6A 4GOJA 2ZUCA 1E9DA 4B74A 5EXSA 3LVQE 1SXJD 1T5LA 3PXGA 5CDFA 3KKMA 1OH5A 3QXCA 5FBLB 3BH6A 4NHOA 4TQ9A 5FI0B 4FWTA 1DEKA 4KLZA 1DO0A 1E9EA 1Z2CA 2NZJA 1TMKA 1NVUQ 3D3QA 4DEYA 2CEAA 2CL7X 2FSFA 2H92A 5CM8B 3ZQJA 1QHGA 3AKCA 2P6RA 2G83A 4NYIR 1TADA 2ZVQX 4OK6A 4PXAA 3W6PA 5J4YA 2WOJA 2RH5A 4V0OA 4LJAA 4HB2A 4XVQA 1NIPA 1P4SA 1GKYA 1DELA 3I5YA 1VIAA 4C0BA 4BFVA 3TUIC 4Q18A 2GCOB 2ZSBA 2GAAA 3TR5A 3NBFA 4TYYA 2FNAA 1ZM4A 5G3YA 4IVRA 1CKEA 5H70A 4YQFA 1Z06A 2AKYA 5E7IA 5LPNA 5EP4A 2HYIC 3OEHA 4C2TA 1BH2A 1N6KA 1GP2A 1ONBA 2ONJA 1ZNXA 3O8CA 2WJVA 2ZI4A 1NNEA 2MMGA 5FTJA 4B35A 2F43A 2QMUA 2Q9CA 5FUWA 3A4NA 2YNMA 2ZJ2A 3K0CA 4GZMA 3WNCA 4MKFA 2V6IA 3IHLA 5B57C 1JR6A 2F9MA 1MABB 3BE4A 4LHZA 1HURA 3P20A 1YR6A 1NG9A 3DL0A 3OIUA 3F5FA 4YDSA
chains in the Genus database with same CATH superfamily
1SOWA 1ZNWA 2F8MA 2RMKA 1KDPA 2O20A 4XWOA 3TLGB 5HPYB 2AG8A 4GNKA 5E9WA 2CN1A 2GQ0A 3QP9A 1HM5A 1EHCA 2JA2A 3OQPA 4XVCA 2DSNA 4TTRA 1TQDA 4JYZA 4FYYA 5G40A 4LMBA 2VQFB 2OCGA 4D99A 2Y6UA 3LKDA 2E4ZA 1XRNA 2A5JA 2ACEA 3RUIA 4J16C 3KE9A 3R75A 4GF5A 3SZOA 2JPDA 3BRQA 2WKQA 5AP9A 5BV0A 1QIJA 2JGAA 2YN2A 3S8MA 4DBLC 4KBFA 3HFRA 1SVKA 2NLOA 1G4HA 3BH7A 2WHPB 4DY6A 5IHXA 1GUYA 3TPCA 5JEEA 2KWIA 5JAMA 2I7TA 2QY6A 3BTOA 3CZQA 3WYAA 1XAJA 1GCOA 1XTPA 3KSBC 4WBXC 4KO4S 4H3HB 1KTIA 4D1YA 2IYYA 5JOQA 2ZRKA 2O50A 3RAGA 2YJZA 5TR9A 4BP9A 5CT6A 2FSVC 3ILSA 3QBVA 3W5SA 2N46A 4IEFB 4KQFA 4DCGA 4J1QA 7ADHA 3CLTC 4MHTA 3CPEA 3I0MA 2B4TO 1EKXA 2PL3A 5G0WA 1S8OA 2WJHA 2ZB3A 3PT5A 3PUVA 1E4YA 1B6TA 2IEAA 4CETA 3DVSX 2AV6A 1FU7A 2P69A 2AN9A 3P9KA 4XQEA 2X5XA 4JVMA 5ALSA 2RHDA 4CWAA 1WEKA 4RTPA 1EFRD 2XMBA 2WWVD 3EWSA 3N58A 4PSUA 1OA0A 3SR0A 3DOHA 2HIGA 1F0KA 4HDNA 3UT5A 1ZIXA 3H8VA 1W94A 3C98A 2PMCA 4RY0A 4BFYA 3IQFA 3ZWNA 3AEKA 2Q1WA 4HEHA 4MAAA 3PKIA 3KX2A 3RRFA 2CXTA 2FUG6 4YB8A 3QVUA 3ZTYA 1UM9A 2PX5A 3MUNA 3TTSA 4MV5A 1KVRA 1MV8A 3A58B 3DXZA 1X3LA 3B12A 3PQDA 3VVBA 2D3TA 4O4HB 3V1YA 1USUA 2ACVA 2ADMA 2XOKD 3IHWA 3AHCA 5TPWA 1U3TA 1ZOOA 4I5DA 3I9FA 1TO1E 3H1AA 4N0DA 2Z43A 2ZBQA 5FYQA 4W5TA 1H93A 1LKZA 1HGXA 3CHYA 3DE1X 3CKYA 4YCNA 4DR1B 4G84A 1PVDA 1VKJA 3LK6A 2PY6A 3OT1B 4WA7A 5BSRA 1SKYB 2RGGA 1Y1KE 3G5UA 3HP1A 3BS4A 4AURA 4BEJA 4ZZIA 4CRWB 3NI2A 4MUEA 4C78A 1FXWA 3RB8A 1EE1A 1JF8A 2MSKA 4HDKB 4X8MA 4UREA 3UEOA 1YVUA 5B3LA 3D64A 4EVIA 3D8RA 4QPJC 1W48A 2OAGA 3WWYA 2QEQA 1FRZA 1U5CA 4F9TA 4TQUS 5A5VA 3KBOA 4S1VA 2GFIA 1S2OA 1D3AA 1JALA 3IBSA 1GTMA 3PQCA 1J06A 4DVGA 5HJ7A 2JFWA 3E7DA 1H5QA 1ND6A 2OT3B 3CRRA 4Q4AB 1E8MA 1M3SA 1WPXA 2PPLA 1GXSA 5E2BA 2Q7OE 1MB0A 4D42A 1QV9A 1MOZA 2W4IA 1KRXA 1C1YA 4JLMA 4QYSA 3WLIA 4HGPA 2C2ZA 4W7HA 3QUBA 4O3FA 3MQFA 3EIEA 5JCOA 1H69A 1JXOA 1O54A 3G88A 2PLWA 3ETEA 4Y2SA 3RIHA 1WSDA 3GFSA 3B1FA 1PL6A 4AP5A 1UZMA 3L8MA 2VAVA 2NAFA 5G0VA 1F48A 2ROQA 3BA1A 2PQMA 3LWDA 3QBTA 5ERXA 1Y6QA 3UATA 3UXHA 2AKEA 2FOLA 4DNPA 1N6IA 4IV0A 3CLHA 4L8GA 5ECWA 3DV9A 2PD3A 4OM7A 2MINA 2C31A 4HDRB 3U3MA 5B3JA 4CI0B 5KMGA 3S1AA 1BMDA 3OFKA 2OCDA 3LUDA 5CNIA 1N75A 1EGQA 1IN8A 3F4LA 4JB0A 4YRPA 5IEJA 3ESQA 4FLFA 4JGGA 4UAVA 1U6IA 2RB4A 2F1HA 3CX6A 4TL9A 3OQIA 2WVJA 4QREA 1H5UA 1I3MA 3U48A 2B5OA 3M2PA 2YJ3A 3D2CA 1EGAA 3PWTA 4KXYA 4YRLA 1YA8A 3A6GA 4HLNA 1P5RA 3RS3A 3GEEA 1XD8A 4JAVC 5HS4A 5CDSA 1LPBB 4O33A 3X2FA 3KZ1E 2JAWA 4HH1A 1QIGA 4GOOD 3UANA 1OX4A 1NJFA 4PYJA 3CE6A 2QDKA 3V4LA 5T6MA 3JQDA 1EVIA 4H6VA 3O8OA 1VSVA 4G5YA 3QZUA 3BH0A 3LA8A 4DREA 4XWKA 2ZUVA 3IOEA 5FOWA 3NUZA 4DXAA 1VJ5A 2JFPA 3OFSA 4E5UA 4RBNA 2Z3VA 3EPJA 3EZGA 4WPGA 2Q4TA 1QWOA 3K94A 3RIYA 4K88A 4QQ8A 4FCWA 3UW3A 5BQ5A 4C01A 1XV5A 1XNJA 2D5AA 1F51E 4UMFA 2VTKA 4J0QA 2J0UA 2VG8A 4LUCA 3K05A 2YYYA 2WT4A 1SB8A 2GPBA 2RGAA 1C14A 1JBQA 2JGDA 2EOAA 1MC8A 4AX8A 1NULA 3IOMA 4HG2A 1GUFA 1BD4A 2AXEA 5CM9C 2YIDA 4DC0A 1UKBA 3MGBA 1LVHA 3H6HA 1RKXA 3NNDA 4OCZA 1XOIA 5TF0A 5BRNA 5COBA 4AJEA 4CGYA 4HNVA 1WXIA 4C04A 2X8JA 5DLQC 3CT6A 3RRMA 5I7SA 1OLUA 1JI3A 4IIJA 2Z6QA 3RWOA 4FFRA 3UIEA 3DZDA 2Z56A 3S5JA 2JJ1A 5AXDA 2P9CA 3I52A 1WMDA 3A14A 4YJHB 2GRAA 3BZWA 3L8YA 3GAZA 4PLCA 3I5MA 1R10A 5HF6A 3KEFA 4FQ5A 521PA 5FTNA 3KJZA 4CU2A 1SN7A 1PFWA 2QZPA 2UXCB 5AI6A 3BT7A 1G7RA 4E4YA 2XHZA 2FMXA 1ZJZA 2W2TA 5IYZF 3PICA 2NVOA 2BBWA 2LVBA 4JLWA 1BDHA 2LRHA 1E58A 4G81A 4UEJA 5EPEA 4AJLA 4CKWB 3TUJC 1FDRA 4C4SA 1YR2A 4N7MA 2C5LA 3DKKA 5EFZA 4YJFB 5FOUA 3BRWD 3EZYA 4RK1A 2DPMA 1X0VA 1ZUNB 3CZ9A 1Q84A 4Q9IA 2JS7A 3OM8A 1Z08A 4KHZA 5M34A 5JJLA 3N75A 2BFCA 3DE7X 1AKYA 5K8IA 4EA7A 4KJZA 1KKMA 3HM2A 5AKJA 4MVJD 3NBAA 4FDVA 1GFWA 4ITRC 2GKOA 4QXMA 1BS2A 2VUHB 4KR7A 1KO1A 3LKVA 2XEDA 2ZJZA 2M2IA 3TMYA 1XEFA 3SQNA 3LPAA 3OE1A 2VSOA 1VJCA 5FL7A 4IJVA 4FIZA 1D7OA 3T5BA 2P2NA 2ZWIA 3QV1A 4JJ6A 3HXMA 1M8FA 1RQNA 4HKTA 2HSEA 1BDBA 2X9VA 1X42A 4WFJA 2N0SA 4HVLA 5BWBA 1RJGA 1XPUA 1LPAB 1VPDA 2W0MA 1VP9A 4LCBA 4V1CA 2A7XA 1TUBA 2F4NA 2NU6A 3MUFA 4RTLA 2W22A 4W6ZA 5KVAA 3Q7PA 3ZWBA 4FBGA 4QPZA 3P9YA 4MGZR 1EXDA 2XAUA 4HZGA 3WB0A 4ACAA 1TA4A 2XRZA 2VHWA 1Q14A 2PLAA 1HT2E 2F64A 2I4TA 2PRJA 4CV3A 1SGWA 4QOGA 2IDKA 4EUHA 3MM4A 3FMVA 4ZQCB 1SQFA 2J32A 2ZI6A 2VT6A 3EF0A 5C4IA 4I4NA 2XUKA 3BXFA 2AF3C 3C7DB 3LPCA 2YRFA 1CY8A 1YBHA 3OZBA 4J0IA 2QNRA 3TTVA 1V1RA 3MILA 1Y4ZA 3A1EA 3O2QB 5IVKA 3WGHA 2A0XA 1NN3A 4UCQA 3KALA 4W5HA 1B15A 4K9RA 2HC9A 3P0IA 2JGLA 1PFUA 4MMYB 5BNTA 2Q0QA 2ASEA 3RC8A 1K7XB 1YU9A 3UPTA 1NJ5A 1MOQA 2RIPA 3G82C 5AHRA 3MAJA 3QVGB 4GMHA 4O8CA 2QN1A 3UJ8A 2PTHA 2VXBA 5FOSA 1IN7A 4H6XA 4TLMB 4Y1RB 2JIDA 1W88B 1DTWA 4GXTA 2I8AA 2QLNA 3OECA 2DF8A 1WDKA 3BOSA 5F5LA 2SHKA 3T3IA 2YV3A 5B3KA 3C85A 3MWLA 3OE7D 3TRHA 4CCAA 1NW4A 1RZ3A 1SVNA 1UBOS 1VKHA 3UV7A 1WF3A 1Z7BA 5DP2A 4H1HA 1T3HA 5THKA 4ER0A 1KZYC 2WINI 4DPKA 1TZCA 4AG6A 3HCAA 5FA5A 4E7PA 3U7RA 4PQYA 4X85A 5ITZB 3FWZA 1OROA 1S7GA 4PYIA 3A37A 1FVXA 4MQEB 5B37A 3DXXA 4HUQA 4I3FA 3T95A 2R1VA 4XSHA 4ZOLB 3RNLA 2CV1A 1Z25A 1TVKA 3TW0A 1VA5A 2YQ5A 3FHLA 4KV9A 1JTEA 3QELA 3BXGA 3GCXA 3K0BA 4RY2A 3AERA 3RNOA 4EI7A 3RYCA 1CEYA 2XRYA 3HCPA 5F3WB 5AW5A 4EPYA 5GV8A 3RIEA 3VNUA 3OWHA 1OX6A 2IZ0A 3IUJA 2M6SA 4TMKA 1KC3A 4YJGA 1D6JA 4BJHB 2CVFA 1VLJA 2QV7A 2I6XA 3QKWA 2ZATA 5EVCA 1CUAA 1GGEA 1X1BA 1UAGA 4HNTA 2QRVA 3LYAA 3ITNA 4ZCLA 2DBVO 1F5SA 2PA3A 4RZUA 5L53A 4OHUA 1IXKA 5B58T 2VDOB 5DHSA 3IERA 1M1YB 3KLNA 2PWBA 3AINA 3EFHA 4W1QA 4KMMA 4OXIA 4NYJR 2AZDA 1ZW6A 3BD9A 3K70D 3O6VA 1R4MA 4CM9D 5J40A 3N2GA 3OEED 4DY4A 4BUJA 3A9CA 5K2OA 1RYBA 5KWJA 2OP1A 3AZQA 3K92A 2PU7A 1FXSA 1OFUA 2XVZA 3R9IA 4DUGA 1HORA 4Z9YA 3UH0A 1CQZA 4IIHA 4N7JA 5KHLB 1PNTA 2WVAA 4NCIA 1U6JA 4MNTA 3FNQA 2JD2A 4PC1A 1Y5MA 5EQTA 3RC2A 2F17A 2J4CA 2ZUFA 3NVKI 4NENB 5KVVA 3L7AA 3SS9X 2AR7A 3R6WA 4D81A 3HH8A 4ENVA 3M4XA 2PYZA 1O03A 2QTGA 3EUWA 2C94A 5IS2A 2GEVA 3A1UA 2FRDC 3EGDB 3EA0A 3SJBA 2JA1A 4Q3OA 2P3SA 3EXHA 5KSZA 1ZI8A 2FKNA 5JJBA 1QX4A 2SKEA 5FWXA 3V8RA 1PJZA 4ZQEA 1DTSA 3CGGA 1X7HA 2R00A 3G2PA 1H3FA 4IR7A 4QYXA 4IRUB 3HWRA 1WR8A 1H2WA 1KI6A 1CV2A 2NUPA 3JQQA 5A6SA 1KTVA 4WNIA 3BE6A 4ALJA 3EZNA 4EG6A 1TVMA 2P11A 1BE0A 1HFEL 2VLBA 4WHMA 2GD1O 4I4TF 4XI9A 2L18A 2WYWA 3PF8A 3VTKA 1XMQB 2XW6A 1NRIA 1P3JA 2MWMA 3A26A 1ACLA 4HNSA 4YIKA 4AXBA 4UBNA 2XODA 3KJGA 3BRCA 3BE8A 4M8IA 4BCCA 2RH8A 4WVFA 4B2PA 1LF5A 3B1YA 5J4KA 3S99A 2CBZA 3HDJA 3MTJA 4TV9B 4TYMA 1LGYA 1BROA 1T9HA 5J5VA 3T5AA 1FY2A 2ONKA 2IA5A 4IRXA 4J0KA 2XQVA 3R44A 3RABA 1DEAA 3LIPA 2PGXA 1MU0A 2G82A 5F7OA 4K26A 3ADDA 1AQJA 2J9FB 4GI2A 4LF8B 5JJKA 3EOBI 2RD2A 2CWDA 3C3PA 2Z2KA 3UK6A 4B85A 4EJ6A 3JU3A 2ODNA 3N76A 1I7DA 2I2AA 2OAEA 1FMFA 2WWRA 4UVGA 5JJIA 3F1KA 1R4NB 2Y67A 3QXJA 1U3UA 5HGJA 4NMHA 3CTPA 3E53A 2C9YA 1OA1A 3NBUA 5CK4A 3LX5A 3ZC3A 2L19A 2XA9A 4QOJA 3TL3A 2DQSA 3TLBA 1IEQA 2NXNA 3NHBA 3O3MB 4HSEA 4FYMA 4MO9A 1M34A 3G2NA 1J49A 2W58A 2DHQA 1SA0B 2XWJI 3MJEA 5REQB 3ZZUA 1D5WA 4BKPA 4YV0A 1VLZA 3VMMA 4A26A 1GAXA 2D13A 5IWCA 2GXUA 2WWXA 4EP1A 2WD8A 1KEZA 5BNWA 3DEJA 2V0CA 3P45A 2QD1A 5GONF 2XUFA 5FP0A 3ONDA 5IUKC 4AY5A 5BPHA 5L3SB 1SWWA 1OZHA 3HVHA 1GJRA 1Z0SA 5KQMA 1P5HA 3R2JA 5CDTA 1IEVA 3NORA 2VJLA 4GDMA 1IY9A 4D9FA 1VG8A 4DEVA 5A4JA 1GL6A 1WNFA 1UIMA 1KZHA 5HOEA 1YR8A 2DBYA 3D6TB 1PG2A 3D8HA 1KMHA 2YOGA 3K1AB 5KB3A 1WXFA 3G23A 1H8EA 3TLJA 1KI8A 2N42A 1KQNA 1EDBA 4GPBA 4ZVSA 4EAAA 1YZFA 5HM6A 1GGKA 1JG3A 4FT4A 4ARVA 1C0IA 4ZI5A 3EGXB 1TK3A 4F7DA 3U4CA 3ER8A 4DA7A 2H08A 1WU7A 5AVUA 3ZY3A 2Y77A 3A6HA 3ASUA 3O2SB 5KJEA 4Q5IA 3UAWA 2WD9A 1XD2A 1ZH4A 1E66A 3OQIB 4H0CA 3W1VA 1MX5A 2GASA 4J1TC 1U8TA 4FX2A 5C4GB 5A06A 4YWJA 2C7QA 2VCEA 5I01A 3R0VA 4KQGA 4OV6B 1ZCAA 4INZA 1G5HA 2HHLA 3TTTA 2VQ3A 1XZMA 1OAKA 1LJUA 3DTYA 3H19A 3U4QA 3ESZA 1GTJ1 1I3NA 4O08A 2PH7A 2UYOA 1UWVA 3WLJA 3FY4A 2WSSA 3F71A 4QDKA 2AE2A 4UU0A 3A1SA 4OA8A 3SKYA 1V96A 1VSTA 5E9QA 3X1MA 1C7IA 3G68A 1Z4IA 4LCEA 5ITSA 2PS1A 3A32A 4HAIA 4LDNA 1JLKA 3I1YA 1N5RA 1A71A 3GHHA 1DL5A 1Y8AA 1ZX1A 2MDTA 2EZ4A 3DP7A 3FUCA 3L7DA 1N92A 1GG5A 3TQQA 3K1ZA 2NO0A 4AZWA 4CR7A 4F3NA 4MVCA 3PDIB 2E5FA 2YX1A 3F67A 1TOAA 4CMEC 3A6EA 2ONZA 1I8TA 1OPRA 4QT4A 2B5VA 4I36A 1YT5A 1OAAA 4CKBB 4FGWA 3EZ7A 1JHPA 3EXFB 3H3FA 1N2XA 2QN7A 3UV6A 5JQGF 3OE4A 3O5AA 1XROA 1XWIA 2C77A 1YQQA 3C87A 4R71A 5JCPA 2IIBA 2YW2A 4EDFA 4EPTA 2RC6A 4JEIA 2NNLD 3U31A 2HV8A 3DF7A 3J7TA 5IKPA 3GLIA 5EE0A 2C2OA 3KWFA 3KB1A 3BFVA 1H6CA 4WJLA 2JHCA 3DBHA 2Q28A 1YC5A 1C9YA 3GVCA 3GUHA 4OGFA 2H63A 3QWAA 4P33A 4PZZA 2O7SA 3PXXA 4YAUA 2IF2A 3C6MA 2PUTA 1F8FA 2BSXA 2VVTA 1CYDA 1XCBA 4DFDA 2NUAA 2BFNA 2Q1UA 2GLUA 2OZVA 4CTJA 3DWGA 5UKDA 1S3IA 1X9GA 3FGPA 2PG3A 4EG8A 1R27A 5JPCA 4R2LA 1ZLXA 3KSRA 3BGWA 2B8NA 3E2MA 3PEFA 4M9XA 3U7IA 4CLXA 2PBFA 3L6DA 3VH1A 3QSYA 1X7WB 1FL9A 2QMOA 5EZ6B 3AHIA 1X77A 4E14A 1IHUA 3QUCA 3KUCA 3DMGA 2W90A 2YMMA 4QBHA 1Z37A 3A7DA 4I66A 5EJEA 1EFHA 2QP9X 3CUEF 3MVEA 5D3ZA 3H97A 3S2SA 1XMOB 4M38A 1Q7GA 3GDOA 3FB1A 2CE2X 3OA0A 4JJ7A 4YV7A 4DQKA 1GVNB 1BYIA 1V8FA 3ED1A 4PU0A 1VLHA 3ROEA 1ZISA 4HNUA 2AR9A 3FR8A 1RCFA 5DWVA 2BFCB 3H4IA 4FSDA 2HU2A 4OXYA 3LRPA 4J1SA 1C7JA 1TIPA 1KAQA 3K32A 3L8ZA 4MYRA 4X20B 5G0SA 2XWQA 4AZ3A 1DQRA 4DWOA 4TZTA 1LI4A 5MFZA 1Z4OA 3B52X 3O8DA 3FF4A 1T36B 1QGAA 3B1KA 3I9KA 1NP6A 3WQHA 5KYGA 1GITA 3QUTA 1B76A 3CU5A 1MIHA 1B7GO 4WZBE 4DEXA 2OCBA 4WKCA 5DE3A 4DG8A 1V43A 2G5CA 4G0XA 4LHYA 2XJ9A 4XR4A 4US0R 1Z36A 3BIOA 4Y6SA 1NPTO 1XALA 4AS2A 4UBKA 4ACBA 3Q88A 2BPOA 3DOFA 4Z0HO 2HPZA 4TTQA 3QKRA 3AUXA 4Z4IA 4BVKA 1YHZA 4ZYLA 4TYQA 1Z22A 4RLSA 3W06A 4UHKA 4UBOA 2EYQA 1RYNA 3DPUA 2HPAA 2W2OA 2A14A 4TLLB 5HQTA 1CUIA 4H4CA 3ZDXB 3C6KA 4ZVLA 5F9HA 2A5YB 3UGQA 2OCKA 3KZKA 5DCYA 1SU6A 3HXKA 1PJ8A 3H1FA 4GWGA 1DXQA 3SR3A 5JSQA 1WUKS 3OHPA 1H4SA 2IODA 3ZHYA 3X43A 2UZ3A 2V98A 2PAAA 4FEEA 2ZSAA 1J1ZA 1R8YA 2IDJA 2ATEA 3PI7A 3TQSA 2YWRA 4MQ5A 4RHYA 5JD3A 1UXOA 4C06A 1MXHA 2R6GA 4ALNA 2QSYA 1BX0A 1A5BB 3H2SA 3I12A 2CYCA 1NFFA 1VYTA 4RZXA 3THSA 4W5QA 3HI4A 5DTJA 2DXIA 1EDDA 4HB4A 2FZ4A 2O2HA 3JQBC 4OMUA 4P5DA 3W6UA 2DCUA 2HB6A 5HK9A 4KRGA 3MLEA 5LOVB 4JD5A 4DB4A 1XN1A 3R7WA 2YJ4A 4QJIA 3FUUA 3D7RA 1YJ8A 4OYYA 3EVDA 1N6RA 4P3YA 1Z3CA 1JHVA 2YN4A 4J03A 4KXNA 3K70C 3SC3A 3R8FA 4P92A 2REXB 4Z6KA 5FUBA 3R5XA 1MBZA 5MHTA 1NAHA 4EA6A 4EELA 5BV8A 5D3MB 3F8SA 4FZ5A 2B3TA 4AAYA 1EFAA 4K9DA 2EWVA 2O0MA 2V54A 3CX3A 1JXQA 1YD7A 3PQ3A 4I4TA 4L9SA 5CTJA 5EKUA 2VHQA 2P1RA 4NK4A 4F9FA 3KVOA 1UOQA 3S0JA 3W3AD 1CNMA 3DAPA 1JVSA 4B40A 8OHMA 1L3CA 4FMDB 3WIUA 3W2TA 2RGRA 2UUOA 4DTIA 1E94E 3QELB 2GAJA 3AERB 4N18A 3FPKA 3V8VA 3PD0A 1KFJB 3C3MA 1GRNA 2QTLA 3FUWA 1NWHA 3MFYA 4XM1A 5HXAA 3BXOA 3Q0IA 5T64A 3ECSA 4S12A 1ST3A 4W1PA 3PFIA 2GERA 1M2OA 2GF2A 1LSJA 3A2KA 3GCDA 4AT1A 3C4VA 1NLYA 3KYIB 5KHOC 1LTQA 4KYIB 2V0GA 1KY4A 3OJ0A 1WIWA 3C3WA 3E22B 4LNUA 5FR2A 3GZNB 2WD7A 3R0XA 4TT3D 1UIRA 4GPIB 4JQCA 2ZE7A 3VH4A 4OJQA 1H6AA 3I4FA 2XT9A 4JB8A 1R4MB 3WNDA 5J2TB 3FHOA 2OWDA 4FINA 4C0LA 4EY4A 2CNDA 5DM1A 3R3JA 2A88A 2H11A 3K4PA 3BREA 5JO9A 1P4RA 3VPHA 4JA0A 1ENZA 2GCPA 3EWAA 1L1FA 1ZJ4A 2MYTA 3CPSA 5JD5A 5JRJA 3VGPA 5KEIA 1JFRA 1FMLA 1A2QA 1R6TA 4P8RA 1OMOA 1T15A 1YQEA 2PTGA 5HFAA 4DMRA 3BERA 1BRTA 4KQMA 1GU7A 4LTDA 4HWPA 4I1YA 3VZRA 1WXXA 4EYQA 4FQ8A 1R88A 3O73A 5GM1A 2XMGA 1F7VA 4FR5A 1GPH1 1DAMA 2XWPA 2PK3A 4D9NA 2MJLA 3HN7A 4MW5A 5IM5A 4HXGA 4DSZA 1OH7A 4I1RA 3BX1A 4MTCA 4OIMA 3CE9A 4KMRA 4L15A 2J59A 1K89A 4BNNA 1MCZA 2QTHA 5T4FA 1BA3A 4QOHA 4LYFA 3GLSA 4I8XA 4J7CA 2WV9A 6REQB 5SY6A 1TEZA 1UT6A 1KIMA 4EIWA 1IZ8A 1PFVA 3L7IA 1YNOA 1A9SA 3AR9A 4Z7NB 3VNSA 4P7FA 4RQTA 1MFZA 4UQPA 4TUYA 3IAM6 5K3BA 5BVHB 3CRMA 3HCEA 4ZKEA 2YH2A 3NWJA 2HWWA 4DNOA 3EYWA 4Y6QA 3C5VA 3C8MA 1QO0A 1Q91A 3OOSA 2XB4A 3MCZA 4EHLA 1D6SA 4QKQA 4I55A 4UE6A 1DOAA 4EJ0A 2X0EA 4GNRA 2ZYGA 1DJMA 1U2RA 2CDCA 5BP7A 2WI8A 2HLHA 3OFND 1OB2A 3LY9A 3H5WA 4QYTA 2QNBA 3DAHA 5TVGA 5KSWB 2YJGA 2Y68A 1A9PA 4BLUA 1IVYA 1KR2A 4LMPA 5CG2A 1L4UA 2PRZA 2FPOA 3B1VA 2WJIA 4V0ME 3LGAA 1T3GA 3BJIC 4IHAA 3D7LA 2GA8A 4IXNA 3AKEA 2PZKA 4U0KA 3A6JA 1AHHA 3CWCA 2XD9A 3GMDA 4A8JB 3IVRA 4XCXA 1KIAA 1L4LA 3GEHA 1VMEA 1SBYA 3IJ5A 1P19A 3U37A 4P5EA 4LFBB 4TS1A 3FOEC 2FF7A 1GNTA 2WTMA 1BQ4A 2B4RO 2FW9A 2IEYA 1TTHA 4UMDA 5K0LA 1O6ZA 3H5VA 1LA2A 1Y82A 2O5EA 1RTTA 1DKRA 2XNDD 4RHXA 2HMVA 4YRQA 4ARAA 4BNVA 1E4OA 3U4AA 3G2MA 1NI5A 5F1YA 2WPDA 3PQFA 1H1LA 3JZDA 4RHUA 3Q6NA 2H2FA 1H2ZA 4P0QB 1YNSA 2VNKA 1T43A 3RS7A 3ZVNA 3F6RA 1A27A 2VBCA 2HJHA 4R1SA 2YCLA 1JP7A 3N59A 5DX8A 2DR0A 3WK9A 1SXIA 2N75A 5FWDA 4ZO8A 3A31A 3VDXA 1ZHHA 3HJUA 3AEXA 1EP2B 5AM2A 2WNIA 3HV2A 3ZHQA 4N76A 1OBFO 3MSCA 4U2DA 1JG4A 2O06A 1TNDA 2XCQA 1SBTA 2C1ZA 4FJ0A 4R1TA 1BCSB 4DMUB 5CBKA 2XNKA 5CFNA 1MAAA 5I51A 2EAUA 3GQVA 4WK2B 1IAQA 1BGVA 1UKEA 2CLFB 3GT4A 4KPGA 1TQ8A 3DMFA 3K6KA 4ZN6A 4QDZA 1N3LA 5A6VA 4QIHA 1TCUA 3W90A 3KDAA 4MQFA 3WNBA 5CAEB 1TAQA 3GQBB 1U1FA 5D87A 1M6VA 3QNMA 3QOFA 2R6FA 3R6DA 4U7JA 2VF4X 4CF7A 3W77A 5KCZA 4QVIA 2NZVG 4RPCA 1NLZA 3CMCO 1QKIA 4YAJA 1I2BA 1ML3A 1OIVA 2PO7A 3B20A 3MT7A 4GPD1 4KTTE 5CVCA 4BN4A 3NHMA 1ZEJA 5JWOA 2G9QA 1X7GA 2PKYX 3A11A 2PS9A 1DU4A 1TJYA 3IBCA 4H27A 2YYAA 4L8WB 1BAPA 1LQ2A 2Q29A 3DCNA 3T3HA 3X3HA 1L6RA 3C15C 4P38A 2D06A 1O5TA 1R6UA 1T9GS 1I3OA 2WG0A 4FR2A 3ZHUA 5KYWA 2AL7A 4OJYA 3K0CC 3GAFA 3TRFA 3D7NA 1HO3A 2IKQA 1STOA 1QO7A 4GM0A 3R8CA 5I8WA 3RV4A 3HM9A 4R16A 1DG3A 3DDNA 3FMOB 3PXBA 2B99A 2FXVA 3F49S 4RVDA 4MYUA 1GLGA 2OUIA 1SBQA 3FRHA 3WZLA 3IVMA 4YQYA 3HP4A 4EKGA 3DTTA 1T1GA 3IEKA 2LIPA 1Z56C 3WQRA 1QGOA 1UC4B 1KEEA 1WDTA 2YMQA 3EY4A 4Y0AA 1RCUA 2IVZA 2ZE6A 1BOFA 1TF5A 2NQTA 4YI3A 2QX6A 1S7CA 3WLOA 5C8XA 3LKBA 4RMIA 1Y3CE 2OQIA 1EWRA 1AKUA 2DAPA 3AG5A 1K2VN 1Q7TA 3PNSA 4GYYA 4ZOLF 1WCYA 2FOIA 3L92A 3LO8A 3AIIA 1JJVA 3BE5A 1O89A 3DBHB 4JVNA 4OK3A 1FBNA 5IEBA 4Z9XA 4YROA 2NVUB 4FI3C 1MOSA 4N1AA 4NDAA 4WCFC 3EGOA 3LUBA 4LV5B 3R9XA 2AJBA 3WRWA 2HHCA 1JNXX 1P6XA 3EXIA 4U7PB 1YSCA 3E5HA 1XEWY 1QH8B 1JJ7A 2VHCA 3S27A 1JDPA 3LHSA 1PJRA 3O2JA 4Z1MA 1VJ0A 1TDJA 5E1DA 2QM0A 1XVUA 1N6OA 4EY7A 5T8KA 5KWIA 5EJ9A 1KPGA 4OJTA 3IT3A 1E1CA 4YTEA 1O3YA 3TZQA 1A3CA 3DOOA 1C3OA 1T1RA 2B8JA 4HVCA 3ESYA 4L50A 3INRA 3EH1A 2DHEA 1JDUA 3C5HA 1X8JA 4QLOA 4I81A 3X1ZA 4CW7A 4ZZ1A 1T2CA 4B9EA 1R00A 2G4CA 1B8NA 3HJFA 3MWEA 3PGVA 2CVPA 4HLCA 2RARA 1P7ZA 3C39A 4FGSA 1MKYA 1T8SA 2RAFA 4FFBB 4F71A 2Z8ZA 3H6GA 4G1UC 3H87A 2DSTA 3GR6A 1JLLB 1Z5OA 4JSYA 2H2IA 2H2WA 1XVLA 5D01A 5AK5A 4BFZA 3QNUA 3WYEA 4EG5A 4D3SA 4IQ0A 3LY5A 5A03A 2C57A 4FN4A 2J3QA 4LOIA 2C9DA 3JSXA 4R51A 1G5IA 1VPLA 4H7JA 4JJIA 2BFDA 3GLFE 1ACMA 4RF2A 2PQ6A 1ZU4A 1V5EA 1IL0A 1GVHA 4G56A 3GMIA 3VPAA 3PLRA 2C5GA 2QXYA 2DLNA 3EGIA 3REQA 2CVZA 1BMFA 1U2ZA 5KYVA 4MQUA 4RVFA 3TEFA 1Q2XA 2VQ6A 5H0IA 4B33A 1QP7A 3BD6A 2RI0A 5I7HA 4BQPA 2X2FA 4PX9A 2HI0A 3C5EA 5FOQA 3TQHA 1RXVA 2C96A 2BJHA 2VAWA 2YCBA 2IHTA 4L2IB 5GV7A 3RIXA 3SIXA 4PAMA 1Y9ZA 5FPHA 2I2DA 4K6GA 2GYUA 2O0LA 4OHYA 1ORHA 2B8EA 4FYHA 4P08A 4OMFG 4IPTA 5TQ2A 1UODA 5DCUA 5BR1A 2OSVA 4K7JA 5SY9A 1ML4A 2MCFA 2P2SA 5TY0A 1U2DC 3RTBA 2FN8A 4D41A 3AR4A 1MB4A 1QC5A 4GW3A 1W5AA 5ESRA 1C29B 3CURA 4BRWA 3TNLA 3W3ZB 2MU1A 1NF3A 1FP4A 5JCJD 3FUVA 5JWRA 1U3DA 4WV3A 3RSFA 1RD4A 1E1YA 5TIIA 4TV8B 2P91A 1J0CA 2I6GA 2IYZA 2PYDA 2CJYA 1E64A 3DMTA 3H0KA 5DBOA 1ZL2A 3O9ZA 1SVIA 3W5CA 2XUHA 3AJ9A 4JH0A 4TS4A 1XQVA 2RGYA 4Q1VA 2J0QA 4LXUA 2WZCA 2WJYA 1VRCA 2N9UA 3HS3A 1UJMA 3PE4A 3SZUA 3W34A 3DOCA 3QV2A 2XLCA 3PITA 4NFHA 3UMSA 4QO7A 4RGVA 3VTAA 4E1VA 2W7TA 3AR5A 4LRWA 3M7IA 4D9HA 4P4UA 4L07A 1F3LA 1TXGA 3I5UA 5ULLA 4NJEB 1M73E 3E3AA 1MC4A 3E84A 4N3NA 3TNFA 3U81A 4B8YA 5ES3A 1YRHA 2BMFA 1X8XA 3TQTA 1FXWF 3TVDA 3VBEA 5INTA 1L7OA 1I14A 4ZTBA 1YACA 3NFYA 4AWXA 1FW8A 4EZBA 3P2OA 3W5JA 1KR5A 3HCDA 1P1BA 2VZ9A 4NYMR 2R4QA 5E1BA 1CE8A 1MIOA 2GNPA 10MHA 4LYAA 5CDHA 2J5BA 3CR3C 3CTMA 3EDRA 1E0AA 3N05A 4HAZA 1H0HA 4R9NA 3D2BA 4O2BA 4DCTA 2J3IA 4PNZA 1AQNA 4CFZA 4KDRA 4OQLA 3WHKA 2BGLA 1RPZA 2X5OA 3HEMA 1VHTA 3OJCA 3W79A 3IV9A 2DKOA 3Q15C 4DCSA 1Q3TA 1N8SA 3UXYA 4G0YA 3CNOA 1MG0A 1I2AA 1O9GA 3PYMA 3M0EA 1CUVA 2VSQA 4H4DA 3LE8A 1AMNA 3G49A 1N9KA 3DZHA 3AY6A 3UMRA 4E12A 2PHZA 5D3QA 4EL5A 3HHEA 3UXMA 1YULA 4FN5A 3V4ZA 4DRXB 1KJWA 1K08A 1BSVA 1M2KA 2EJCA 2GO1A 2HJSA 1C3VA 2QMHA 3I5AA 3O8BA 3OLZA 1ULHA 3L1VA 4JUIA 3ZYZA 1L2TA 2CNWD 1YRLA 3M49A 4FD3A 4RDCA 2JIOA 2VJDA 4R8LA 3MFQA 5BSTA 3R24A 4HH3C 3VSEA 1ABEA 3GEMA 2LXNA 2WRZA 3UWPA 2V3VA 2VI5A 3W8NA 3K1JA 5TS2A 1EJ6A 4J0JA 1FYXA 1DEXA 1Z6ZA 4K1XA 4DJDC 1NV9A 2CL0X 2NXWA 4K6HA 4RNCA 1H4QA 4P7GA 1YZGA 2V7XA 3DE2X 4U0JA 1G59A 3WGOA 3WXMA 1R0XA 1M1UA 1N6LA 2PCLA 1ZIPA 1A9XA 4Q0MA 4FKZA 4Q01A 2C4KA 1K92A 1GPDG 1Y3FE 2Y99A 3CH5A 2JZCA 3HCRA 4J16A 4KSCA 1YA4A 1PW5A 1DUIA 1V95A 2VRWA 3EH2A 3TZ6A 4YR7A 4IQ4A 3P27A 2VPWA 5J58A 3IKLA 3P9XA 3D59A 3NEAA 1GGMA 2JBAB 1A98A 2NYVA 4JOBA 4BJ5A 1NDQA 5DNWA 2X0RA 2XWBF 2O2YA 4IFTA 3TE7A 3WQBA 1FLAA 5TJ9A 4DIDA 2WHQA 5KYKA 2CCJA 4JEHA 3ER6A 4KG7A 3G8AA 4L5YA 4FD2A 1YZ3A 2A0KA 1AUPA 3V7FA 3EVCA 3AP2A 1NY5A 1KYZA 1DBWA 3F3YA 3MT8A 3ROPA 5CW2A 1JV2B 1UPXA 4EX6A 2C4VA 2FSVA 1P0MA 2OGSA 3P52A 4RZSA 2BEJA 4UHBA 4F5ZA 2YOHA 5A1TA 2AW5A 2GZMA 1URPA 2AZMA 1RI5A 4AYWA 4F1JA 3K0FA 1R6BX 4NH4A 2P5YA 1DLJA 5E6UB 1PEYA 1L5VA 3IAS6 2I3GA 3SY8A 4IIJF 4EI9A 2PBZA 3H6KA 4ALLA 4IVQA 3PC7A 2EDAA 3P0EA 3Q87B 1QV7A 2OYSA 1L9KA 3EF3A 5JNSA 3ZU6A 4DHWA 3DMPA 4J7XA 2HGZA 1IG0A 4WL0A 4UHFA 4EF5A 1YZYA 4BLSA 4E6PA 3C1TA 1ZA2A 3DBRB 2PUEA 3I2KA 2DT5A 2QVYX 4B47A 4TXNA 3M6LA 1JSXA 1WDMA 3PXCX 4J29A 3AF0A 1NX6A 3OURA 5J2UB 4QM7A 3PX3A 1YIAA 2DZDA 3R7AA 3F73A 5CT8A 3E7PA 2BT4A 2EFDB 3DEYX 4MKRA 4DNQA 1UFOA 1Z2AA 4LI3X 1IZZA 2FPIB 4QQFA 4UUPA 1LBEA 3FM9A 3U80A 4DR3B 3HRHA 1T5HX 3QVSA 3WRVA 4DMKA 2BGGA 2HX1A 4MJ7A 2K87A 3K0HA 2WVGA 2E4AA 3OLYA 3VI4B 3VX3A 1ESMA 1EUCB 2PMWB 4QEDA 1U4OA 1ZYUA 1J1UA 3KL2A