4QKQA

Rada from methanococcus voltae in complex with copper phthalocyanine tetrasulfonate inhibitor
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
265
structure length
257
Chain Sequence
SHMDLGFKSGIDLLKQRSTVWKLSTSSSELDSVLGGGLESQSVTEFAGVFGSGKTQIMHQSCVNLQNPEFLFYDEEAVSKGEVAQPKAVYIDTEGTFRPERIMQMAEHAGIDGQTVLDNTFVARAYNSDMQMLFAEKIEDLIQEGNNIKLVVIDSLTSTFRNEYTGRGKLAERQQKLGRHMATLNKLADLFNCVVLVTNQVSAAEQAIGGHIVGHAATFRFFVRKGKGDKRVAKLYDSPHLPDAEAIFRITEKGIQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of an archaeal Rad51 homolog in complex with a phthalocyanine tetrasulfonate inhibitor
rcsb
source organism Methanococcus voltae
molecule tags Dna binding protein
molecule keywords DNA repair and recombination protein RadA
total genus 95
structure length 257
sequence length 265
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2014-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08423 Rad51 Rad51
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4qkqA00
1S4QA 2EU8A 1DE0A 1E99A 1F60A 3TSOA 1D9ZA 4LHWA 1VYUA 1GUAA 4ARZB 2ZTSA 1C1YA 2G1JA 4LYHA 1KI3A 3CPEA 3Q5DA 2GCOA 2E1RA 1Q57A 3ONWA 2IXGA 3WNCA 1KO8A 221PA 2ZE5A 2OM2A 3K1JA 5D3MA 1B0UA 3VKWA 4LGMA 4C0BA 1OIVA 4UQOA 4D4LA 2ANCA 1XCGB 2HUPA 2NOAA 3OZXA 1MOZA 1JALA 3C5HA 3SC3A 1XNJA 3SBDA 1EFCA 2D06A 3B2EA 3TVTA 3Q7QA 4FN5A 4PANA 3IIJA 1II8A 2F1HA 3UXMA 4KU4A 3TW8B 4EPVA 2P3SA 2ZRJA 2OBNA 3REFA 3MCAA 4GL2A 2WAYA 2WJHA 4AYXA 4TQ9A 3TUZC 5DNYB 3GLIA 1GNPA 3CRRA 3K09C 2JJ2D 2PCLA 1JPNA 2GJ8A 4F7WA 5A5GA 2JLWA 5JRJA 2ZRMA 2XNDA 3EW9A 4PQRA 4S2EA 1V5WA 3IPYA 4C0JA 1NSTA 3EA0A 1N5JA 2OLKA 3KL4A 2PBRA 4UNNA 2CVFA 4Z51A 4PZZA 3OAAA 1QHHB 2ZRFA 3VR3A 2CHVA 3AKDA 1JAHA 1N0WA 1ZM9A 3LX8A 4TTQA 5IT5A 1NG9A 1KI9A 5JWHA 2O8EA 3N2IA 4PO9A 4TQAA 2WKPA 3LAWA 2IK8A 3NBZC 2GEVA 3A6PC 2MSDB 1K6MA 1XX6A 1Z0DA 4L15A 3CF0A 3LDAA 3ASYA 4TTPA 4J0QA 4WZBE 2PZEA 2C78A 1F2TB 1AGPA 1UAAA 3QENA 2GJAA 4N0EA 4BFTA 2NPIA 3I61A 4OQFA 2CHQA 2BKUA 2JIZD 4W5WA 4C0LA 4NZYA 4EAQA 1O3YA 3AUXA 4BUJA 1DTSA 4RFVA 3BOSA 2BEJA 2BIFA 1KDPA 2JA1A 4MKIA 821PA 1NY6A 3AGQA 1IJFA 5F9FA 1P9RA 4XVQA 2V55B 4OI0A 1ZNWA 2OFOA 2J0UA 4OI4A 2J59A 1CULC 3D8BA 1W4AA 2ZJOA 2ZUDA 4GI7A 1CR4A 1RIFA 3LXXA 4B33A 2Q3FA 1SKYE 3QKRB 5LB2A 5F9HA 3DOEA 1YZKA 2DWOA 4TMZA 3VR4A 2BDTA 4GMXA 4Z8XA 2ORVA 5CM8B 1K5GA 1AN0A 1FNNA 4LJ6A 4PQFA 3UG6A 3Q5EA 4LPKA 4PSVA 4OL0A 3TAUA 1IM2A 3H2YA 3NEJA 4BFUA 3FTQA 4ZV4A 3SYKA 4QM7A 1EFTA 2ZSEA 2NPFA 4KV9A 3VHXA 1HH4A 2H8KA 2QPTA 4Q1DA 5IK2A 4QBGB 1ZUIA 4JLOA 3CF2A 3LVQE 4IVQA 4W5HA 3CX8A 1SVIA 1W46A 4JLJA 1GVNB 4HLDA 2DCUA 5FFMA 1G3RA 3A1VA 4RZ2A 1IN7A 2RGXA 1ZM7A 4PSAA 3ZVLA 1OFTA 3GEIA 3WYFA 3L8YA 4NKRA 3TH5A 3GJ7A 2YJTD 2IYXA 1II0A 2ZXUA 3K53A 3C16C 3ZS9A 3I72A 4ASUD 2FFBA 1IOZA 1TEVA 3O8DA 2VP5A 3TGPA 5FTMA 1KMHA 2WSMA 2ZS8A 1M7HA 4WVFA 4XWOA 4URVR 3IQXA 3MMPA 4W7SA 3T5GA 1W36D 4KLZA 1SKYB 2IS6A 3SS8A 3U4QB 3THXB 1FMLA 2AXNA 3FWYA 4HEJA 1IXZA 4JLMA 5AUOB 1XEXA 3VU9A 721PA 2GAAA 5EE9A 3T06B 4P33A 2R8RA 3PR1A 3BE4A 3EPKA 3AVVA 1YZGA 2R6AA 4BPBA 1YKSA 1T91A 3NC0C 1IONA 3ZIAD 1XD2B 1Z6GA 4A0RA 4QM6A 2EVWX 3QI2A 1KO1A 5L8VA 3SJZA 1G8YA 1UFQA 2IYLD 1AA9A 1E2IA 1US8B 3N70A 2VP9A 2BM0A 2ZI5A 1XTRA 2ZRIA 4Q48A 1P73A 1T9HA 4EPTA 3P20A 1XEXB 2BCJQ 2WHXA 1J2JA 3ND9A 4AKEA 3BFVA 1W47A 1ZJ6A 2BEKA 3BGWA 4C4PA 4LJAA 4JVMA 4M4SA 5CB8A 2ZRHA 2YKGA 5TDHA 3TK1A 1HE8B 3NXSA 1E2DA 5GJVC 1Z28A 3RRZA 4AURA 1JAIA 2QI9C 2PZGA 3BC1A 1QRAA 1Q3TA 2X19A 5G3YA 4M21A 1E4VA 3OESA 4L5BA 4DB4A 2F6RA 4HAYA 2JDID 1NVXQ 1TADA 2B6HA 2BHRA 2GHIA 1BOFA 1YRBA 2IS4A 1ETUA 1UDWA 4NCHA 2CXXA 1WP9A 4I4LA 1CRQA 4O2RA 3ZQ6A 5H8WA 1KO7A 2ZR7A 1C9KA 2KJQA 4LHZA 3CRVA 3WYGA 2PX0A 1O87A 4PO8A 5BN5A 2WWXA 3AF2A 1S2MA 2JJ1A 1UEIA 2PJRA 2PL3A 4I81A 2CBZA 5CK4A 4EPWA 3GLGE 2QT1A 3T15A 3AF1A 1E2QA 2CL7X 4NYMQ 4YMSA 3MWLA 4IJMA 4M1MA 1G21E 1IN4A 1KTVA 5JI3E 2GF0A 4Q1EA 4JVSB 2VYFA 2D7DA 3NHBA 2XJ9A 1DAGA 3UWKA 4KHZA 1GDDA 2F43B 2KB0A 2H57A 3NG1A 3FE2A 3DO6A 2RHMA 3U3KA 1F48A 4HZUA 4TMWA 2JLRA 4RKFA 4M22A 3QF4B 1G19A 4FCVA 2AKYA 2CNWA 2FNAA 2VL7A 3EC1A 3L0OA 5EXTA 5FUVA 4TYYA 2J5XA 4JYBA 2GZAA 3C15C 4Q9KA 2BOVA 3RAPR 4QJ3A 4MUBA 4NMMA 3GLFE 2ZJZA 1E9FA 1X86B 5A0FA 1UEJA 2VRWA 3CLVA 5DN6A 1J99A 2NGRA 5HPYB 1OE0A 2W2VA 2QBYA 1ZNZA 2QSZA 5G3ZA 2F43A 3HYRA 3TAHA 2DBYA 1E3MA 1TPZA 4JL8A 4HLUC 4JZKA 4ZKDA 1SXJA 2NZ8A 3BB1A 2YHSA 3AP3A 2RB4A 1NY5A 5ANRB 1R7RA 2PT7A 1XPRA 1Z0AA 3H4MA 5J4HA 3A1SA 4DSTA 1NVVQ 4AKIA 2DFTA 1HTWA 2F1JA 3WYAA 3KJEA 4ZCMA 1G3MA 5FOVA 2VQSA 4Q9JA 1KZ7B 3BK7A 3DVLA 5HZHA 2R6DA 1SHZA 1KY3A 2QM8A 3KXKA 1EWRA 4YC7A 3TQCA 2WIBA 4NTZA 2PEZA 3GLIE 3H1TA 1G6HA 4PPGA 2OG2A 1AS2A 3C14C 4I1VA 3F3YA 2YWFA 1VYVA 3GMTA 2HLDA 2ANBA 3AB3A 3GLFB 5K8UA 1WBDA 3BBPA 4AKHA 1YZLA 5HTKA 2OXCA 3Q8XB 1HEIA 3PG5A 4YMVA 3TKLA 2J7PA 2H18A 1HE1C 4GPTA 4IVRA 4D0NA 4C3ZA 2GEDA 3A1TA 2GETA 2O8EB 2WIAA 3K0AA 5JECA 3SEAA 4HLQB 1P2VA 1L8QA 3IGFA 4TL9A 4UNSA 4C7OA 5E4FA 2I1QA 3RS0A 1U0JA 4MH0R 5IHPA 2OHFA 1P62B 2AN9A 2NG1A 2H16A 4PAOA 4CYMA 2EFDB 2G1KA 4XTRA 3RC3A 2CLCX 1S1CA 2RGBA 2A5DA 1M34E 3TE6A 1U94A 4W5JA 3LW7A 1U9IC 4KO8A 4B44A 3O47A 4TLAA 1R5NA 2VBCA 2Q6TA 2YV5A 3I62A 3K9GA 5EP2A 3W3AA 3QUSA 5DI3A 3RS4A 3CX6A 2IS1A 4G3XA 3IQWA 4DDTA 4CEIB 1TEXA 3SNHA 3VR1A 1JR6A 4LWZA 5HE8A 3KX2A 2GXAA 1TNDA 2OCYC 4EPYA 3KFVA 3AP1A 4HB0A 1GNRA 2WJYA 4A2PA 4URYR 3AKCA 1AZTA 2NQ2C 1HQCA 1VCOA 3GLHB 4WOPA 4QGHA 4ZDWA 3R20A 3W8NA 3BWDD 1VDZA 1QHYA 1R8QA 3MWJA 2XXAB 4WA7A 4GZLA 3LX5A 2VLIA 4TSFD 5FOSA 2QT0A 5DYIA 4R2HA 2CK3D 3DKPA 1BS1A 2LWIA 2W58A 2ZI9A 1UKVY 4FMBB 3MGCA 2O8DA 1IY2A 4P3YA 621PA 3AVOA 1KK0A 1BO6A 4QJ4A 1GIAA 1GL9B 2LKCA 3NIBA 4IW3B 3LQQA 2HT1A 5AJZA 1PUJA 3C41J 4A9AA 4GT1A 1VIAA 3AEZA 2BV3A 3GJXC 3HPRA 2IYUA 3TR0A 2NO1A 3QEOA 3UK6A 2BJVA 1LNZA 1ZUNB 2HJVA 2W6ID 2WTUA 3EXAA 1JQJC 2HEIA 2WJJA 1CJVC 3MJHA 1E98A 5L3QB 4IXNA 4OQLA 1G8HA 2IC5A 1UKYA 3FMIA 4NYIQ 3CX7A 4Q1AA 2FG5A 4A0FA 1ZCAA 5L3SB 3P27A 1OH8A 1G4AE 5JWRA 2RMKA 3C8UA 4NL4H 2ERXA 3K0CC 3ADCA 3FMOB 4MRRA 3BAFA 4ACAA 5M04A 4LBZA 5JLJA 1X8KA 2OCBA 2QROA 3A58B 3CONA 4V02A 2ZVQX 1FX0A 3SJCA 5KPJA 4A36A 1N0VC 2YZ2A 3WBKA 2HV8A 2AK2A 1UDXA 4B2PA 3ADKA 3LH5A 4LUCA 4X8HA 1G64A 3MRSA 4LV6A 3K9NA 4V03A 2QAGC 4V0NA 1WRBA 5FOUA 1EXMA 4YMUA 2EFEB 1II9A 1HT1E 2DFKB 1KI1A 2RCNA 1SGWA 4IXMA 4C0QC 3ADBA 2VSFA 3R9XA 3SFZA 1UADA 2JAQA 5AK0A 4AYTA 1EFRA 1L4UA 2A78A 6Q21A 2F7SA 3DL0A 2ZREA 3CW2A 4US0R 1MR3F 2DPXA 2C04A 4CEJB 5K8LA 3A1UA 4E07A 5K8IA 3TNFA 4BEJA 1LVGA 4JLKA 3RYTC 4HI0E 2D74A 4Q4HA 2W6JD 3VR6A 4P4TA 1PVOA 1MV5A 4L4UA 1DEKA 4M2LA 1XZPA 1S3SA 4Q02A 1YZTA 5B57C 2PMDA 3A1WA 3I3SR 3PEVA 4PHGA 3B78A 3V00A 2WWYA 3A8TA 2I1VB 2X77A 3EIQA 5AJXA 2RGNC 4MKFA 1EGAA 1NI3A 1E9RA 1XD8A 2GTPA 3ZZUA 1AJEA 4Q03A 1GKUB 1NVVR 1Z8FA 3RNLA 2KBEA 1H8HA 4GOKA 1E9DA 1VTKA 1T3LA 1Q20A 3QSYA 3KJHA 4B3CA 1XDBA 1OKKA 3H86A 4B2LA 2JLVA 3EIHA 4JJKA 1F6BA 2P67A 3UPUA 2NO6A 3QXSA 2B7CA 4LC0A 2QAGA 2GJ9A 5DN6D 3U3OA 2FGKA 4DEXA 2HF9A 4Q1CA 4RKEA 1OH5A 5AJWA 4OHZA 4MRPA 2GK6A 3GJ0A 1X1SA 2Z4RA 4IKEA 4DIDA 5EXXA 4BWYA 1VIYA 5EE3A 1TTTA 5JZVA 3ZQJA 4KI0A 4YONB 4QXAA 1GNQA 4QL3A 3SYLA 1F2UA 2QTFA 1E9AA 4DXAA 1P5ZB 3LLMA 2QAGB 4RCZA 5J4LA 4QNRA 1TF5A 2PLFA 1BYUA 1LFDB 5FBQB 3B13B 1GILA 1PUIA 1MABA 5KHOC 2G83A 3VNVA 3FFBA 3HR8A 1DPFA 4HAWA 4HZUB 4NU0A 4Q4AB 3SZRA 2ZUBA 2ZS9A 2GZDA 3EZ2A 1E2MA 3WP1B 4GOJA 2QRNA 1U2RA 2W0SA 4MA4A 2VP2A 2VHQA 3AKYA 3C5CA 4Q66C 5JEDA 2D62A 1SVSA 3T12A 3TUJC 1IY1A 2J45A 4G5RA 3THOA 4RFSA 4BLTA 4LI0A 1YR9A 1TF7A 2A5GA 4WXPA 2YWGA 1ANKA 1R10A 2ZJ2A 4KBFA 5EE0A 4DLUA 2E9SA 5FTJA 1COWD 1JR3D 2FH5B 2R9VA 2UVQA 2IYVA 3CWQA 3FKSA 4EPRA 3BH0A 3BXZA 2YOFA 2IYTA 2EFCB 1FW6A 2J7KA 3Q7PA 2G77B 4UNRA 3HPQA 5EZ5A 2WPDD 1S1MA 5IK2D 1PJRA 3CRMA 2JCSA 2B8WA 2EW1A 1RYFA 4AWXA 4CDGA 1TL7C 1M74A 4FMDB 1NJFA 2YWHA 2H1LA 1YR6A 2ZE6A 3BD9A 3P4YA 1E1RA 3AV0B 3NTUA 4LHYA 4AG6A 2ORIA 2D2EA 5FR1A 3Q3JB 3X1WA 2X1VA 2EWVA 1ESMA 4TN1A 5KUTA 1DARA 4A6XA 3KB2A 1VKJA 2IEZA 5HKKD 5E7MA 2WJGA 4FXPA 4RCYA 4KFTA 1DBSA 4Q4JA 4ASUA 2B92A 1LY1A 4KSBA 4P0TA 4WZ6A 4FIDA 3L0PA 1G7RA 4LJ5A 1P2TA 2JEOA 4Q5IA 2FF7A 3I4LA 4UNPA 4BFSA 3LBHA 1ZP6A 2QMHA 1SULA 2IEYA 2V54A 2WV9A 3GFTA 4LJ9A 1Q12A 4Q19A 2ZJYA 2FSIA 3I92A 5TXGA 3T1OA 4LCBA 1EX7A 4DJTA 2WWFA 3TR5A 1YU9A 2C9CA 5KO2A 1OIXA 1Z47A 2YC4C 3G82C 3NHAA 4JKIA 5IF9A 4M9SA 3FMFA 5BQ5A 5C46F 3KQHA 1GP2A 3BRWD 2PLRA 4E03A 3JVVA 1N6RA 2V1XA 4JLBA 3GEHA 1AGRA 4JL5A 4KXFB 4D0LB 1OYYA 1CLUA 3KB1A 1AK2A 4EFMA 4ZDIA 5C18A 1E9EA 3PUVA 3EPJA 2O8CA 4OHYA 1T6NA 3IBYA 1BYIA 1P9WA 3VQTA 1M8PA 4A2QA 1Z08A 5DYGA 1FOEB 2CVHA 3P26A 1U0HC 2ONKA 1KIMA 2CL0X 4PC7A 2WJIA 2C03A 3ZD6A 1XZQA 2GK7A 3SHFA 5E95A 5ELXA 4C0AC 4G5SA 1XJ0A 2ERYA 1IN5A 2B7BA 5H70A 1G3QA 3P1JA 1ESNA 3KFXA 5BN4A 3RRNA 5CK5A 3BB3A 5TY0A 5H1YA 1LV7A 4B76A 2P5TB 1FQJA 1QZXA 1VHTA 4OHVA 1OV4A 1NN1A 1Z0KA 4OJQA 3BJIC 4EFLA 2Q3HA 4MGZR 4JLAA 2ODBA 1CKEA 2O8DB 2RGAA 2ZRCA 3OIVA 2F9LA 3PUXA 3ZVMA 1M7GA 1Z06A 3LA6A 2F1IA 4PAQA 1OXTA 3A4LA 4DLVA 3KDSE 3P32A 2O0JA 1E2JA 2GNOA 3PXGA 2K5UA 1W5TA 5CITA 1SVLA 2SHKA 1JPJA 2OCPA 4Q21A 1RVDA 1T0HB 2REOA 4WXRA 2WSSA 4B73A 2CLSA 2R6FA 1W5SA 1HT2E 1XEWX 3SN6A 4B74A 5EE1A 4E09A 3VTKA 2IHYA 2CHGA 1XCMA 2W6JA 2OE2A 4FINA 1GL7A 2IYZA 1LTQA 2A2ZA 4QHYA 2ZAMA 2A3RA 2DHRA 3ZJYA 2C96A 1CBUA 5KPDA 4TTRA 2OESA 2ZUCA 4G1UC 2D4HA 2XZOA 2WICA 5E7IA 3CH5A 5JMTA 1XTIA 1DAHA 2IX3A 2C9YA 4RJLA 3PUYA 3D7MA 4DT1B 5FPTA 4YXWD 4KYIB 1CP2A 3LBIA 3PUWA 3FPAA 4WAUA 1DS6A 3GLGA 1N25A 1W2HA 3QF4A 2CE7A 3ETLA 3PJRA 1E9BA 1DAEA 1W0JD 3AVPA 4Z8YA 4JLNA 2IWHA 4POAA 3TUIC 1I2MA 1KO5A 3LV8A 3K70C 2AWOA 1KK1A 1NF3A 3QKSA 2G6BA 1AS0A 3GJ8A 1JB1A 4PFSA 2ODEA 3W6OA 4F4IA 2D3WA 2QP3A 2GBLA 2RGCA 3DKVA 4UXJA 5FOTA 4OHWA 1GFIA 3MG9A 4MGYR 4B32A 1DVRA 1KI8A 2HDNB 3MWKA 4ZI2A 2LCFA 1G8FA 4DCVA 1Z6AA 1WQ1R 4PSKA 3RABA 3IO5A 3LQRA 1Z6TA 2O0KA 4AK9A 5JHHB 2CCKA 1J8MF 2IW3A 1XMJA 1FUKA 4XVRA 1GRQA 3B6EA 3V4FA 2VPPA 1BH2A 1TQ4A 4PTLA 1VCIA 5A4JA 5TV2A 2XB2A 4I1UA 1G7TA 4LSGA 2VP4A 4MKHA 3FB4A 4TMXA 4TLBA 2BKEA 1KAGA 5AR1A 3OEHA 2P0EA 4CGZA 5JSZA 1JJVA 2JATA 1Q0UA 3HYTA 5EQTA 4G5QA 2IWRA 2VHUA 5FL7A 2XSZD 5SZIA 2FPLA 1XD9A 4CZ2A 1JXOA 1F2UB 3TIFA 3CNOA 1SHKA 2ZSFA 3D31A 2ZRGA 3AH8A 4LHXA 1COWA 1J8YF 4HB3A 3IEVA 5FL3A 3L2OB 3MLEA 4NCIA 4RD4A 4Q4AA 1NBMD 3GJ4A 3IHWA 3OE7D 4BQSA 1T0JB 4YDSA 2JLSA 2CEAA 2XTMA 2G0NA 3N2EA 4MYTA 3EA5A 4RVCA 1VCNA 2BBOA 1N6OA 3HWSA 1G1MA 3OHMA 4ZDJA 3ZYCA 4BLRA 1AQUA 1KZGB 1M2OB 1DELA 1ZCBA 1QF9A 2C99A 5CYPA 1N6IA 3M0EA 3EWSA 4NYJQ 1QHHA 2ATVA 3BH7A 3HR7A 1MO5A 2OZEA 5B30A 1MT0A 2F9MA 4Q4LA 4PXAA 1J70A 5HKKA 4HB2A 4JJZA 3K70B 1PLLA 1N5LA 1X3SA 2IBMA 4BEBA 2WOOA 2AR7A 2WBLC 4GP6A 3F5FA 5JS8A 1UBFA 2WSSD 5KSOA 4MKGA 5G53C 3CPHA 1P72A 3B9QA 1IN8A 4JT2A 1P60A 4G01B 4S35A 3R8FA 2V1UA 3NC1C 4QOSA 3CZPA 2OSBA 4DKXA 2WZQA 1Q1ZA 4DEYA 3R9WA 4F92B 3NKVA 1XJCA 4B43A 2ATXA 2H92A 1KNQA 1OIWA 4GOXA 1CRPA 3ZZTA 4DSOA 3KKOA 4EPXA 4A15A 2GILA 1C4OA 4Q7MB 1KKMA 1YQTA 4RZ3A 2Z83A 4IOKA 4LPSA 3O8CA 4GMDA 4AIIA 4Q4JB 2J0UB 4E5UA 5FPKA 5CJPA 2A5YB 4BFXA 1QHSA 4LBWA 2HJGA 2WMNB 4YXWA 5SZKB 3OEED 1KNXA 4OI2A 1OT3A 1GZSA 5K8TA 1ZBDA 3UWOA 4OHXA 3CR8A 3L43A 2VHJA 2OUKA 1RW4A 1E0KA 4ESHA 4Q7KA 4LX0A 1W4RA 2OLJA 1T5LA 3DM5A 1Z0FA 2XTNA 1GM5A 2WOJA 4URXR 4H1VA 3U6KA 3RSLA 1IBRA 4KFUA 2GA8A 3CIOA 1CJMA 2MSCB 4TT3D 1G3IA 2H17A 1E79A 3REGA 4IRUB 4KAXA 4IVPA 3KKNA 3SQXA 4AKGA 3S1AA 3QNUA 3CRW1 2ODWA 2O8CB 1N6NA 1D6JA 4Q18A 4X8LA 4HATA 4IDQA 2OCAA 3Q85A 5FTKA 3LRPA 4OQXA 5GADl 3QXJA 5DGXA 4Q7LA 2VH5R 4LJYA 1SQ5A 3W6PA 2OT3B 1G9XA 2QP4A 1DG1G 4BRUA 1BMFD 3KUDA 3X1DA 4H9GA 4MRNA 3GFOA 3MAAC 1E4YA 4CEHB 2MMCA 3IIMA 2ZYUX 3IDQA 3NBYC 2CLDX 3RHFA 2WKRA 3AF3A 2R2AA 2OV2A 4M8NE 5DIFA 3N5CA 5FPHA 3UKDA 1E1QA 3THXA 4HLUA 4P4SB 4WIAA 4CEJA 4KBGA 4TL8A 4HDCA 5EJEA 1RC8A 2XSZA 3LXRA 1CIPA 4IDPA 4UJ3A 4AI6A 4Q4HB 2A5JA 4DLTA 1OXXK 2G3YA 2JDIA 1F3OA 3SHWA 1XD2A 1ZNXA 1MRNA 1TU3A 3E2IA 2F55A 1QVAA 3I8SA 1KDRA 3IIKA 3TSZA 2V8OA 1U9IA 3SE0A 1FQKA 4EIWA 3RC8A 1ZINA 3GLHA 2FE4A 5JCPA 2P6NA 5DLQC 1HA3A 1H65A 2JJ1D 4LYFA 3BFXA 2CJWA 4O2LA 4IDNA 2HXSA 3I32A 1K8RA 2GBLC 4L9WA 3R7WA 4QNMA 1N0UA 2ZR9A 3K0EA 4C30A 4HSEA 3KUCA 1BKDR 4M1KA 3D6TB 4MGIR 3SYNA 3G0HA 1E2FA 1UF9A 1F2TA 4GBMA 4PC1A 121PA 4ZIRB 3MJRA 4URZR 3EWAA 4MUAA 1EFHA 4LK2A 2CNWD 3VMFA 3PEWA 3TRFA 2C77A 2OAQ1 2UZIR 1NVUQ 2GXQA 4TLDA 1CJKC 3BORA 2FSHA 5JFGA 1ZAKA 2ZE8A 2FA9A 2YNMA 3GJ3A 4JSTA 5BN3A 4DDVA 3SI7A 2JJ8A 2TMKA 3HP1A 3LVRE 3M6AA 3K0SA 5FH9A 4KSCA 5EXPA 1A4RA 5GJBA 3X1ZA 1G17A 1NVWQ 2REXB 2CDNA 2F3TA 2Z43A 3QIAA 4ZIRA 4B34A 2ZI4A 3H84A 3I73A 4LYJA 5TMPA 1RRPA 2A7QA 2VSXA 2G88A 4NYJR 1KSJA 4HDOB 5LB4A 2QZ4A 1I4TD 3HDTA 3IUYA 3QKUA 3RS5A 1U81A 3QKSB 4JLDA 4ABYA 5EP4A 4R7ZA 4A8JB 5BYJA 1QG2A 3M1IA 1NNEA 4ZPXA 3PVSA 3D3QA 2BMJA 1LS6A 4ILEA 4M1SA 1ZC3A 1QHIA 4EQ6B 2NIPA 4G0NA 5L3SA 1HYQA 1FFHA 1J90A 5J47A 3FKSD 4RD2A 4GNKA 1N6LA 3K0CA 1ZD1A 4ZCLA 3NH6A 1E69A 3ZDQA 4RFSB 2C2HA 1W0KA 2ZSDA 1MO3A 1XP8A 4PAMA 1SVOA 5FBLB 1FX0B 3L82B 5LBIA 2NO0A 1X6VA 3QXHA 4ITRC 1R5BA 2GCOB 2ZU0C 1GKYA 1QHGA 1GAJA 2OBLA 4NBSA 5LDDC 1N2CE 3QPVA 1EX6A 1E0JA 1E1RD 2QN6A 2HLDD 4HAXA 5AJVB 3MSXA 1NBMA 1XTQA 2HXYA 3CO5A 1XCPA 2QNRA 5P21A 1G5PA 3L0IB 4QGGA 1SXJB 3CF6R 1QG4A 3K9LA 3P4XA 2FOLA 3GPLA 3WRYC 1MH1A 1UJ2A 5E3HA 4GP7A 3QXXA 1OH6A 3TQFA 2QY9A 3QJYA 5FR2A 3WP0A 4X8MA 2VSOA 3SQWA 3O8BA 2F1RA 5B2ZA 2OBMA 1BMFA 4HZIA 4PPQA 1RFLA 4B47A 2XAUA 5KYKA 4OQNA 2EFGA 4JL6A 1MKYA 1D2MA 1NJGA 2X2FA 1W44A 3PQCA 2QMOA 1WBBA 3LWNA 2QRZA 3B1ZA 4FW9A 4HDQB 3B60A 2FX3A 1G41A 4URUR 3B5JA 3KZ1E 4K46A 4B48A 3THYA 3W8RA 5DISB 4F93B 2GRJA 3L0SA 2V6IA 1ZRHA 4M9XA 1YE8A 4DB2A 3O8RA 3IBGA 1GWNA 3WHKA 3VAAA 2XTZA 2AWNA 4LBVA 2ZI6A 1N5KA 3WNBA 4BFYA 3AVUA 4A1FA 4Q9LA 5DHFA 4R2IA 3FOZA 1ZUHA 3SBEA 1A7JA 2YOGA 2YVUA 3QOFA 4PO1A 2O52A 1OH7A 2BMEA 2EYQA 4RZUA 4MQBA 1XU4A 2VP0A 2O8FB 2QUZA 1GKIA 1U8AA 2VA8A 1KI2A 3TW4A 1XTKA 2OAP1 2XZPA 1VG1A 2BMFA 2Q0HA 3OEEA 4TYPA 2IYRA 2FMXA 5AJYA 4F4JA 1OB5A 1NMYA 1QHNA 3CUEF 4D0GA 2A9KA 1TU4A 5C1BA 2D2FA 2V4ZA 4JLVA 1YR8A 3V4RA 3ZVRA 1XJQA 2WAXA 2RGGA 3VR2A 4DVGA 2A5FA 4MYCA 5FI1B 1Z0JA 4BZPA 2C8VA 3W9YA 2GZHA 2BBSA 2FEOA 4WZAE 4Y0VA 1DAFA 1ELOA 1I4LD 2XOKD 2CCJA 5DE3A 2IXEA 4C9BA 1R4AA 1CJTC 4M1TA 1ONBA 2Z6VA 5HCNA 2BWJA 4QBIA 3K9HA 4TQUS 2GCPA 2J7PD 5J4KA 3AGPA 3BERA 4XSGA 2ZVPX 4NYMR 1LF0A 3UANA 4KCGA 5B58C 1I4DD 4PHTA 3IPXA 3KTAA 1KKLA 2HCJB 4Q7JB 4ZDKA 2N1BA 3R9IA 3CH4B 2ZI7A 4C2TA 2KE5A 3TSWA 3UMRA 3EZ6A 3FYHA 1NLFA 5FBWB 1KMQA 1A1VA 1OJLA 3NVAA 2GKSA 4LJ8A 3I5XA 4BLOA 2IUTA 4DSNA 1G4UR 3E5HA 1NRJB 4XJXA 3X2SA 5KSZA 3KJIA 2Q9BA 1G7CA 2V7QD 5FOXA 3OFND 5LPNA 2GF9A 1XFAA 1A2BA 3PUZA 3QKTA 1S8FA 4DLZA 3OE7A 4P4UA 1P75A 5FUWA 3U2QA 1KMHB 1KI4A 3X1YA 3FHCB 2C98A 1U99A 4CF7A 1D5CA 3GJ6A 3NDPA 2GJSA 4JBYA 1VYTA 4JLPA 4K81B 4PX9A 2WWHA 5KNBA 2W00A 2IXFA 2GJKA 1UBCA 1OHHA 2QP9X 4QBFA 1SKQA 4TLCA 4NPHA 4CIDA 8OHMA 1Q21A 2ZSAA 3VU9B 4OKSA 4GDFA 2JIZA 3PFIA 1Z6XA 3UMFA 4MDFA 2R65A 5EZ6B 4DT1A 5C2JB 4QGFA 4QG7A 3PV0A 4O3MA 1TX4B 2IYWA 1G3UA 1PZNA 4BLPA 1UM8A 3B1XA 2AFIE 2QMEA 3QBVA 1ZU5A 1EFUA 3VFDA 4IHQA 1GRNA 4ON9A 4XD7A 3I5YA 4A8JC 3F8TA 2XNSA 4DLXA 2QMUA 4B3BA 3AVXA 3DZ8A 5EXSA 1ZC4A 1NSFA 4BASA 5HCIA 3EC2A 1V43A 4QC2A 4V0ME 1Z29A 2Q9AA 1KJYA 2QE7A 1ZIPA 1OB2A 5J40A 5KDOA 1T3HA 1P2UA 4DWJA 1S3GA 4F91B 4RD6A 4HYYA 2PT5A 1N3BA 2ZJBA 3MWYW 4JT4A 1KDTA 1ZU4A 1YZNA 4JBXA 4C0SA 1KO4A 4D4KA 2QTHA 3HJNA 2EQBA 1LB1B 5J4VA 1AKYA 4DCNA 4FWIB 2C5LA 4HAZA 2MMGA 2GDJA 2XNDD 1RKBA 3HU2A 4EJSC 2B21A 1Z6YA 1UPTA 5TB5A 3QY0A 1AM4D 2OFXA 2Y8EA 3B9PA 5DI3B 4DZZA 1W1WA 3C4JA 1X8LA 3EG5A 1XTSA 2IS2A 1R0XA 2QPAA 3QKRA 4XIGS 5HZKA 3AVYA 2KI5A 4OQMA 4FI3C 4D81A 4EDHA 2Q9CA 3L8ZA 2DYKA 4OI1A 4OK3A 3QBTA 3ICQB 1XMSA 3F0TA 1KSGA 1TF2A 2R6CA 2RGEA 4RZXA 3RSOA 3RWMB 1RE0A 1F5NA 1P6XA 1IJEA 3B1WA 1UBEA 5FUYA 4WW0A 3U3RA 2XXAA 1SVMA 1W49A 1E0SA 2VF8A 2W2TA 3ZIAA 1Q1EA 5EP3A 4US2R 2YC2C 1H8ED 1QDEA 1JEDA 3OEHD 2KWIA 4D2IA 1IAQA 2P6RA 2IYSA 4A82A 4DCUA 3DEFA 2IYQA 2ZRKA 3AKEA 4DBLC 1OXVA 5AUQA 4KODA 3DM9B 1Y63A 3UG7A 4N0DA 5J5CA 2ZS7A 2ZAOA 5CIQA 4YLGA 1E2GA 5FUXA 1NG1A 1A82A 3X1XA 1DAMA 4AYWA 1R0YA 4CT5A 3DMNA 2J46A 2FZ4A 5JS7A 4NHOA 1W4CA 4IOJA 521PA 1I2DA 1FL9A 2X8AA 4D80A 4V0KA 4DLYA 2UKDA 5CDFE 1IQPA 5JEEA 3B7GA 1S9HA 3EAQA 3JZMA 4B2IA 1CXZA 1MO6A 2IA5A 1WE2A 2W83A 4Q00A 4DCSA 2FFAA 3OIUA 4JSYA 4A6PA 1OSNA 1HY3A 5AUPB 3UIEA 3QF7A 2J1LA 4DC9A 1WCV1 1AZSC 3AVTA 1S96A 1IHUA 2IT1A 3ICEA 1DG3A 4M53A 1YVDA 1VECA 4PPNA 2XJ4A 3EX7C 4AC9A 5BWMA 5F3WB 1VCMA 4L8GA 4I1OA 3ASZA 4M9ZA 3ZS8A 3W6NA 4DCTA 3FKQA 4A92A 2PX3A 4CT4B 2IYYA 4DUGA 1NKSA 4B6FA 5KNDA 421PA 3SFVA 2VHTA 3OIYA 1XMIA 1U98A 1WXQA 4O25A 2IF0A 1Z3IX 2NO9A 1NLYA 4IOMA 3HU3A 4Q9IA 4LV5B 2FEMA 5AWFC 2QENA 3CNNA 1GRRA 3QXCA 1U90A 3GP8A 1Q1BA 4TZ0A 1S0UA 1CTQA 3T61A 1KK2A 4RSGA 3K70D 4DLRA 1R0ZA 1SVWA 2KSQA 1NLZA 2EWWA 1TQDA 2JJ2A 2R6GA 4P31A 2Z4SA 2O8FA 3LD9A 1KSHA 4B75A 1II8B 2YWEA 3CPJB 5GJWC 2PMKA 4UKDA 3S1AB 3CRQA 3U60B 2XB4A 3SDZA 5JJIA 2AL7A 4NCKA 3OAAD 1KJZA 1NN0A 3AUYA 2DY1A 3T1QA 2DWQA 1PLJA 3VHLB 2D7CA 2QU8A 2AD1A 4ZI3A 1Z0IA 4FWTA 2WPDA 2CL6X 4JIMA 1E9CA 3TVDA 5J4YA 4KYUA 5DO9A 1A2KC 2OEPA 2VP6A 3E1SA 3VR5A 2JLQA 3ECCA 5L3VA 5CB6A 4M1YA 2V7QA 3KKPA 2GVDC 2QPOA 1Y3AA 1GITA 1JNYA 1NBME 1Z83A 2C95A 2R62A 3KJGA 5JWOA 3T1TA 1XWIA 1D9XA 4KLNA 5B64A 4BFWA 2Q21A 2C9OA 2ZIAA 3GCGA 3IKJA 1CEEA 1KI6B 4JBWA 4I99A 1P4SA 4OYHA 1CF4A 1T8TA 3T1VA 1KSFX 2L0XA 1JBKA 4EJSA 4IFEA 1VPLA 4BLSA 4IDOA 3KQLA 2XGJA 1OHHD 2JASA 3M4YA 2ZRBA 1KYIA 1D2EA 3DHWC 1OXSC 5KTYA 1Z2CA 1MABB 1ZD9A 3KTAB 1R8SA 3EIEA 1HUQA 1YZUA 4M0LA 3FFAA 3V9PA 1TQ2A 4RD1A 5G40A 1X1RA 5E7JA 1TUEA 1DO0A 2ODNA 5D3QA 4AY2A 3MFYA 5L3QA 4UXHA 2OFWA 3NBXX 4NH0A 2H5EA 4NE2A 1LW7A 3SOPA 4EJSB 1Z2AA 3EZ7A 2IF2A 4Q1FA 2Q3MA 2B8TA 4KFRA 1XPOA 4MRSA 2KBFA 2OXRA 5IDVA 2QORA 1KI7A 3ND8A 2RKOA 1OPXA 5FI0B 3CB4A 3VNUA 4US1R 1XXHA 2HYIC 2XEXA 1MO4A 1P61B 5CLLA 2ZJ8A 1Z5ZA 1P9NA 4TMTA 1ZYUA 2BCGY 2R44A 2N46A 4Q1BA 5TVKA 4HUTA 1OFIA 4UNQA 5D3MB 2FSGA 4BLQA 5CJ2A 1ZNYA 4PHFA 2REBA 4FMDF 4Z1MD 1SVKA 2E87A 1RPZA 1R6BX 3QPUA 2QQ0A 4NONA 1YRAA 3GJ5A 4IDHA 1CS4C 4LZZA 1EESA 4U7DA 5H68A 3U7HB 4TYWA 2ZPTX 4LC1A 5CLQA 3NH9A 1E32A 3LO5A 1CR0A 1GL6A 1SXJD 2AHOA 4MDEA 1L2TA 5FPYA 5JI2E 3CM0A 1D8TA 1FP7A 1FNMA 2XITA 3MUFA 4NYIR 5FBRB 4A8JA 4LRWA 1ZD8A 3CZQA 4UJ5A 1S9DA 3C7KA 4DLSA 1KK3A 2QG6A 3OF5A 5AUNB 1E79D 1E2NA 2GAOA 3TBKA 2NMVA 3RS7A 1QVRA 1T4GA 3RANA 3THWA 1T3SA 1DAKA 4F38A 3U4QA 3GQBA 2AK3A 4V0LA 4TL6A 5FPSA 4KFSA 2QA5A 5KSYA 1E9SA 1NIPA 1NN3A 4D4MA 3G5UA 4B6EA 4QGAA 5KU1A 4PC3A 1WB9A 4P32A 4CRWB 1TMKA 3ZGXA 3U6BA 4CEHA 1E2PA 1VHLA 4HLCA 3B1VA 3DOFA 5G41A 3WBJA 3THWB 1E0AA 1E1QD 1RZ3A 2I4IA 2P65A 2NO7A 1N6HA 1K5DA 4OBEA 3QE0A 1YHNA 3QVUA 3JZAA 4TLEA 3BH6A 3OFNA 1M7BA 5EP1A 2CMKA 2AX4A 4C0HA 3LBNA 2PJZA 4NDZA 2J9RA 1J7KA 5HE9A 3I1FA 1G5TA 1G6OA 3PENA 3R8CA 1NP6A 2RGNA 3EPHA 2BBTA 4G5GA 1NMXA 3GD7A 3ZD7A 2VTKA 3AF4A 4RD3A 3ZH9B 5DI9A 2JLUA 1WA5A 2BMDA 3IO3A 4BE7B 2P6UA 3K0FB 1Z63A 1FMJA 1Z22A 3WHLA 3FVQA 4XWAA 3RS3A 3KQUA 1ZVQA 4TMVA 3SJBA 1W4BA 1XB2A 4B3DA 5C4MA 2DR3A 3SU8A 1G5RA 3R7WB 3SJAA 4Q47A 3WMEA 3PIRA 4M1WA 1P3JA 2QL6A 4KJZA 4PQYA 1TUIA 2FFHA 4TWZA 4D4JA 1E96A 3H0KA 2QAJA 1DADA 1P7CA 2A30A 4Q9HA 3WNDA 5DH9A 4XD7D 2XZLA 3K0FA 2VEDA 5HR5A 4LOAA 3NBFA 2GESA 1QHXA 3LY5A 4DUGD 2VIIA 4BGDA 1QBKC 4KITB 3ZLJA 1E2LA 3W5JA 3CBQA 1U0LA 2CE2X 1SXJE 4DHEA 3U7FB 3MD0A 3LLUA 2FV8A 1IXRC 4EFNA 1KY2A 4R9UC 3OIWA 3ADDA 2ZEJA 4LYAA 4QJ5A 1EG7A 2J41A 4A0GA 2BC9A 2DFNA 1KDOA 2F3RA 5KNCA 1EWQA 5FL7D 2GWHA 2WJVA 3KXIA 3VX3A 1Q44A 4DIEA 1M1YE 5FBVB 4D82A 3QG5A 1FPMA 1XEFA 3DZDA 2ZROA 5CIWA 2AD5A 4CW7A 1LS1A 2HT6A 2RAPA 1YZQA 2WWWA 4XTCS 4O0MA 2QBYB 1W7AA 1WMSA 4DLWA 4LDJA 2H7VA 4OJKA 4QKQA 5FTLA 3U7GA 1WF3A 3GLGB 1SXJC 3QG1A 4AG5A 4E22A 4D26A 2DB3A 4GFDA 5FOWA 3BB4A 1JXMA 1L4YA 4RY2A 2WM9B 2EFHB 2NZJA 4IFBA 1JECA 1US8A 3J81k 4JMPA 3W34A 2V6JA 2FDCA 1R0WA 1W36C 4CVNA 5JBQA 1DOAA 2ZQ5A 1Q3HA 2V9PA 3U3MA 3QPWA 2FFQA 3FMPB 4LBYA 3CKLA 4ACBA 4A0HA 1OFHA 4DDUA 2V3CC 1PLKA 4A4DA 4XOIA 5JHGB 1EK0A 5L3RA 1T5IA 1R2QA 1EFRD 2FU5C 4LHVA 1OLOA 3WMFA 4K8OA 4PZLA 1X8JA 1NL3A 4NCJA 2ECKA 3K8YA 3ZZ0A 3U44A 4BRWA 3IEUA 4XVUA 2PEYA 3PCRB 4QBHA 1HV8A 2BM1A 3K0AB 4L16A 1CJUC 2GEUA 4PZYA 3EARA 3RRMA 2ZYTX 2ZYWX 4GZMA 3GLFA 2ZITA 3RWOA 3FHOA 2G0TA 4KVAA 4MYUA 2ZYVX 3HU1A 2ORWA 2WMOB 1G20E 4BFVA 5KSPA 2AXPA 1GTVA 2OILA 1E2HA 3I8XA 1NKTA 4MITA 3UMSA 1M6NA 4B3XA 3U7EB 4U02A 1TQ6A 1JQLB 2QGNA 4NP6A 4B3FX 5IRCD 3AVWA 4QHTA 4Y0AA 1JR3A 1IY0A 3U44B 1GOTA 4XWKA 3A4NA 5JCZA 3TMKA 5TARA 5JSZB 2Z5FA 1RRCA 2QE7D 4C0KA 2QQEA 4HUQA 3NEYA 4M1OA 4G5OA 3PEYA 1DAIA 2ZE7A 4LV8B 2FZLA 4PR0A 4Z54A 4ZCIA 1KI6A 1R5OA 5KOYA 1H8HD 4U00A 2W2XA 2DWPA 2WWIA 2ZRDA 4FD2A 1HURA 2RHDA 4YQFA 2J0SA 3GLIB 3GEEA 3K09A 1KJWA 2ZR0A 2FJUA 3WMGA 2QTVB 2G9NA 4L9SA 4BFZA 4PC6A 2QGZA 2JLYA 2HYDA 3B85A 5DHAA 2RH5A 1RYHA 4HUQB 1JI0A 1CU1A 4CEIA 1VMAA 2FN4A 2XX3A 4N1AA 3WY9A 1Q1QA 2LKDA 1KAOA 2DFLA 1VG0B 4PC2A 1E94E 4TT3A 1OF1A 4R71A 5GVRA 3U3JA 1UKEA 5GVSA 2PZFA 1CR1A 4IEEA 3A4MA 2IUSA 3JVUA 4JKYA 1JEEA 4TMKA 4LY6A 3ZVNA 1ZIOA 1MRSA 5FTNA 1UKZA 1OW3B 3QQ5A 3WRXC 4DRZA 1OXUA 2Z0MA 4URWR 2AFHE 5SZHB 1HQYE 2ZM5A 3IILA 4R98A 5JJLA 1JJ7A 1BIFA 2ZANA 4OK5A 4XSHA 2ZJAA 1UBGA 1XXHB 1H8EA 4Q01A 2J3EA 3SR0A 2GXSA 1G16A 1XTJA 4NCNA 4HB4A 2MSEB 1IXSB 1ODFA 3Q9LA 4DDWA 2ZSBA 4YDHB 3IHLA 5BYKA 3AP2A 1RRFA 2VO1A 3CR7A 5F2EA 3DMDA 1PV4A 3DDCA 4GRAA 2WKQA 1JR3E 3VKGA 1W0KD 2GVZC 3BS4A 4ERNA 5KDDA 4JYCA 4PHHA 4II7A 2JLXA 5EUMA 4WBSA 2ONJA 4FCTA 4OK6A 3GLHE 1D2NA 2J87A 2PH1A 4FMCF 4F4CA 2HCBA 2VF7A 2P2LA 1N5IA 2JGNA 4QFMA 3CNLA 1E2EA 4TYQA 3B8HA 1FTNA 3LNCA 1KOFA 2GCNA 4EKDA 1SZPA 5UKDA 3W90A 1XBTA 4KVGA 4QHSA 5C4GB 4UXIA 3DPUA 3B1YA 2QM7A 4V0MA 3E70C 2FGJA 1OYWA 5LD2B 3FGNA 4C7OB 4EQ6A 4DSUA 3TJZA 1RRGA 2O0HA 1NN5A 1XXHE 3AVQA 3FDIA 1ZM4A 1YJ5A 1G7SA 1T8UA 1AS3A 2ZJ5A 3U61B 4D6PA 3T34A 5LD2C 4M9QA 4LJ7A 3VX4A 4C2UA 4YMTA 4BZXA 4B3GA 1CR2A 2WWGA 2ZRNA 2PCJA 3GFPA 3LFUA 4EUNA 3T35A 3NWJA 1AQYA 5CYOA 2BVNA 3A37A 3BIFA 4RD0A 4I1SA 1LF5A 4LJ4A 1FP6A 1G18A 1E6CA 3B82A 3CWZA 4U5XA 3U5ZB 4V0OA 1G8GA 3KKQA 4MGKR 2O8BA 2ZI3A 4ZKEA 2BBWA 3W5IA 2AKAB 2J0VA 1A5TA 1TAGA 1XRJA 4P4SA 1GG2A 3RS2A 1P2SA 2RGDA 4PPFA 2ZU6A 5EUQB 2OO7A 4MRVA 2ZRAA 1KHTA 2YINC 3RDPA 2N42A 4Z1MA 5GJCA 4X8OA 3UATA 4IEIA 1G291 1XEWY 1KGDA 5F98A 1DO2A 5CDFA 2QEQA 1W0JA 2W0MA 5JRZA 2O8BB 1VG8A 2FSFA 4HAVA 2IUUA 3KQKA 2JLZA 2P5SA 2NTYC 3A36A 3THYB 4D25A 2BJWA 3QVVA 1WDTA 2EYUA 5BXQC 4TSFA 4BECA 4FCWA 1L7VC 2CK3A 4XH9B 1ZM3A 2X2EA 5BW8A 2CJWB 2XOKA 2FWRA 4JS0A 2VHCA 1YR7A 2WVJA 2ZRLA 3BFKA 5EE5B 1FZQA 5SZJA 1AKEA 2IHBA 5KDLA 3RLFA 4BZQA 1FTSA 2J0QA 1U8ZA 1ZW6A 3AF0A 1N6KA 2FPMA 1RJ9B 2CCGA 3EZ9A 5DSZA 1N6PA 1W48A 1XPUA 3FHTA 1GSIA 3KKMA 1Z07A 4TL7A 1AIPA 2IL1A 4JVNA 2W6IA 2ZETA 3EASA 4HAUA 3KXLA 4TZ6A 2O5VA 5JJKA 4B71A 2I3BA 3KQNA 1OFUX 1XF9A 3NDBB 4TYNA 3VKHA 1NIJA 3T5DA 3LW8A 4YMWA 2HF8A 1E2KA 1G8PA 1VG9B 5CM9C 1U8YA 3RVBA 1RJ9A 2ASEA 3Q72A 3W3ZB 1FUUA 1NMZA 4ARZA 4A2WA 4FMCB 2YOHA 2FPKA 3PITA 1XMVA 1ZMXA 2GXUA 4JVLA 4N3NA 4QRHA 4ZO4A 3AQ4A 3RRYA 4W9MC 4B35A 3EPLA 1IN6A 2QSYA 4MYHA 3WXMA 4ESVA 3TLXA 1ZM2A 1W2GA 1W36B 1OKKD 1Q22A 4AD8A 1B23P 4H1UA 4GSYA 3QEJA 2YYZA 2ZRPA 4IOLA 3EZFA 3PEUA 3AM1A 2UZ3A
chains in the Genus database with same CATH superfamily
2J6HA 2MYUA 3T99A 3FPFA 1Y80A 1F60A 2VPTA 5IDWA 2RHJA 3HU5A 3PQ8A 4YRFA 3T3EA 4EKYA 1UMCB 4BMXA 4RVGA 1GUAA 1L8LA 1ST3A 3G49A 3WZMA 5MN5A 2G1JA 2WI8A 3CPEA 3Q5DA 1X7ZA 4P4NA 5F64A 2E1RA 4URFA 4NDAA 2NXNA 1KO8A 2C3OA 2YJZA 1MX9A 4J1QA 221PA 3IAUA 3WNCA 2ASVA 1DWOA 1L5FA 5DHPA 3N2GB 4E2WA 3C6QA 4FFRA 5D3MA 1VSUA 4C0BA 4D4LA 1OIVA 4UQOA 2IUFA 1XCGB 2NOAA 4HJRA 1MOZA 1JALA 5IULC 2AUTA 3M34A 3C5HA 1UT5A 3QVXA 3SC3A 1XNJA 3QLEA 1FIUA 3WQBA 5FPPA 2D06A 1RXSA 2AG8A 5ALVA 3B2EA 1TA4A 1WMEA 4Q4DA 2HNKA 4YAOA 1VE1A 3ABQB 3G8BA 4LTDA 2O7RA 5IJ0B 3LBFA 2YZNA 4R8MA 5FV7A 4KXNA 1Y6ZA 4UBLA 4XX1A 3ZXSA 4CG1A 2P5YA 4FSXA 4I14A 3UGQA 5K6AC 1FX1A 1P3Y1 3MWEA 4QA9A 5T4EA 2XAAA 5DHSA 4B85A 1ZA1A 3HABA 1KVSA 3NCHA 4QEZA 1JHYA 3E0QA 4EPVA 2XUZA 2QV7A 3MCAA 5A5DA 2WJHA 4TQ9A 2O57A 4X1YA 3TUZC 2Q3EA 5DNYB 4MXDA 3ZE2B 5K99A 5KYUA 4BGEA 4U7PB 3TZEA 3KLNA 2GJ8A 1NRXA 1OROA 2I65A 1YKGA 3JS5A 1JHDA 2PZKA 4F7WA 5JRJA 1TK9A 3A0UA 4EGJA 3ZGYA 1XZFA 2XNDA 3EW9A 1FP1D 2V4MA 3GX1A 3K1TA 4BQRA 1XYGA 1N5JA 1QRRA 3KL4A 3GA7A 1UJ4A 3P2MA 1MXFA 1XA3A 4QEKA 1KS9A 1JHMA 4F2WA 4Z51A 1E8NA 3OAAA 3Q10A 1KWKA 5AD1A 1N0WA 1ZM9A 4TTQA 1ZHFA 1D0SA 2NZUG 5JWHA 2NZWA 4K9DA 3N2IA 2EEPA 1YU6A 3ER6A 2WKPA 3LAWA 4TQAA 1BG6A 4W82A 5FI5A 3HFSA 1DRVA 3MTGA 4UCWA 5G1OA 4UOZA 3A6PC 1ACJA 2MSDB 5WRFA 2D59A 4EY4A 4NAUA 4EL0A 4P92A 3C70A 1ZBQA 4YCBA 4EB8A 2XWJI 3IEIA 2MINB 5AJTA 1EFDN 2HX1A 4TTPA 4J0QA 3MJVA 4WZBE 2PZEA 1SIBE 3O9VA 3ZTWA 4FB5A 3DLHA 3IC5A 4BQIA 3IKMB 4C4YA 2PWPA 1Q7BA 4UOEA 2GJAA 2Q5IA 3VC2A 1K6JA 2XMCA 3C1OA 3FCUB 4FOSA 4OQFA 2JGJA 4LXGA 2BKUA 4QLBA 2AVNA 1EA7A 3IRUA 2OHHA 1HX7A 1RXVA 3BQ9A 4IIBA 4X20B 4X9XA 4BUJA 4L78A 1A5BB 4ENWA 1KEEA 3URKA 2BEJA 1FFAA 3IDZA 2Y3IA 821PA 2EX0A 3KKEA 1ZXXA 2ZB2A 3D2LA 1KJ9A 3HO6A 4F5DA 2VNAA 1C0EA 2V55B 3BEDA 3MERA 2BN4A 1V3TA 4XVQA 1XGKA 1IB6A 2OFOA 2J0UA 3VNRA 5EGSA 1CULC 2I33A 3GV0A 1H0KA 2ZUDA 1JTEA 2Q3FA 4M0KA 5LB2A 5AM3A 2UU9B 2VT6A 3DOEA 3RIGA 4RXTA 5JATA 4ROSA 1PT5A 5HZGA 2ORVA 1G38A 4U2CA 1D2RA 4Q9DA 1K5GA 1WZEA 2XGMA 5A3RA 3GRKA 1A9XA 3IKTA 4AXXA 1FNNA 4R9SA 3BWYA 1WKCA 1VHDA 4QSHA 4B3SB 3G85A 3PFGA 3H2YA 4C3VA 4I7EA 4JGGA 4BFUA 4I5IA 5IX8A 3SYKA 2V45A 1EFTA 2IHNA 3OJWA 2NPFA 1PFUA 1PEAA 1A5SB 2H8KA 1OILA 4Q1DA 4QBGB 2UXCB 5SYAA 1TJ3A 3AV3A 4IVQA 2GOYA 3NYRA 1SQFA 5DB4A 5A5FA 1XDZA 2DFPA 1U0BB 1V96A 2OV8A 3FDFA 2A35A 4Q1VA 5AKHA 3TE7A 1W46A 3VISA 1HNNA 4YR7A 4XARA 1QF6A 4JLJA 4JJFA 1KQNA 3LL4A 3VOTA 1R9MA 4UZFA 5DM2A 3S1LA 3SPXA 4EWLA 1IN7A 1AXRA 3HB4X 1OFTA 2NSHA 1TVCA 3L8YA 1SNYA 3TH5A 1N0HA 2YJTD 1II0A 3NHYA 2H59A 3L0ZA 2VAWA 2FWMX 3N76A 1HKHA 4Q24A 3VHXB 1NW3A 1IQUA 2NX2A 3V7UA 1RC0A 4MWCA 5B1DA 4PV7A 2D1YA 4FC6A 4OHRA 2OLEA 4R5HA 3H1AA 1KMHA 2QWXA 1P33A 2ZS8A 4WVFA 4EYQA 2RKBA 4PG5A 3RJ5A 3M9LA 3JXEA 3MMPA 3P7MA 4R83A 4Y0NA 2XE6A 1Q7GA 2QW1A 5DT2A 1SKYB 1PDOA 1Y6JA 3DJYA 2FK7A 1C2YA 3ZYZA 5CDYA 2WE8A 4DA9A 1QORA 1YGPA 2VFAA 5T7BA 2AXNA 2A1UA 1SO8A 1G20A 1RADA 2GAAA 3WIUA 1VPVA 5LIRA 2C3UA 3BWEA 3QITA 3D7NA 5LA6B 2FSUA 3FCXA 5IBQA 4RTNA 3HN2A 4KQGA 3EPKA 4BPBA 5EIBD 2ACKA 1Y3IA 3NC0C 2SKEA 1OX4A 5ALEA 5ALSA 4IIEA 1EXNA 2Q5CA 3DOCA 5L8VA 1KRWA 1PJSA 3KCNA 1G8YA 3X1MA 3N70A 3NRCA 5JALA 4DLNA 1WQ4A 1JU3A 4F06A 4FJ0A 5JDCC 1BQ4A 2ZRIA 5JANA 5U9CA 2GPTA 1D1PA 1C14A 3OU6A 1XPJA 5EEGA 2Z9CA 4MV5A 4C4PA 3WSTA 1ECLA 5BORA 2W2QA 1PP4A 1I10A 4RKWA 4JVMA 3UH1A 1XZEA 2JZOA 4NR0A 2ZRHA 1CERA 1BFKA 4B6GA 5AM0A 1QLHA 3B5EA 3NXSA 3DXYA 3RRZA 1O6BA 1Y33E 1VRWA 1Z5NA 2QI9C 5JNLA 4F3CA 1X1AA 2X19A 5G3YA 2E4YA 3MMXA 5JLAA 2Q4RA 1OYOA 4CMBA 1AGNA 4ZQGA 3C1TA 3KSBC 4DB4A 5SV2A 3QA9A 3BCUA 4HDMB 5HR5A 5K4HA 1TADA 2BHRA 2INGX 5BXYA 1BOFA 1HTBA 2Z09A 3EXEA 4YJ3A 4DJEC 4F2DA 5I8PA 3HDYA 2IS4A 4X62B 1Y4UA 3H7AA 4B7CA 1TEHA 2CXXA 1WP9A 4I4LA 1FMTA 3VU3A 3LHFA 4GKAA 3VKUA 3IH5A 4O2RA 5H8WA 4KN5A 1KO7A 4PSUA 4PZPA 2ZTMA 1P1KA 2VUUA 4MI9A 3I2KA 2HY7A 1VLLA 2QYSA 3AF2A 1ZESA 3W8FA 1UEIA 4QG3A 3E5MA 2PJRA 2JFWA 1EDBA 1C7ZA 2VWGA 4UD6A 1E2QA 1ONSA 2TECE 3TGWA 2Q0XA 4IJMA 1TA9A 1RAIA 4AP6A 4ETIA 5L45A 5DXAA 3HBLA 3I0ZA 1U1EA 2VYFA 1P5HA 1OBHA 3IJEB 2H29A 3WSVA 3UWKA 4CWAA 4GOOD 3Q8MA 3JR3A 4HN4B 4XW2A 3S2IA 3FE2A 1XZGA 3DO6A 4JYAB 5LBTA 2CD7A 2JLRA 1VPTA 3FPGA 3I34X 1YKFA 4M22A 1G19A 4FCVA 1O9GA 2C9DA 1VJDA 2VT2A 2VL7A 3Q7RA 2NU6B 5EXTA 5J2UB 4ZP1A 5FP0A 1SK9A 2EZ9A 4JYBA 3TRDA 5FULA 1SCUB 1I7DA 1JMVA 3AR6A 1XMPA 3C15C 3QYFA 3RAPR 3QWFA 1E9FA 1NLMA 2O07A 2WWRA 1C7FA 1H1DA 3F71A 4RGVA 5BUCA 1J99A 1TKRA 4CU2A 1ZAYA 1O4WA 1XOIA 2W2VA 1UBHS 1VBMA 2WU0A 2QSZA 4XB6B 5F4ZA 5G3ZA 2YY7A 4ENQA 2BGKA 2XUIA 5BRAA 2Q0QA 2FJPA 2Z5VA 4G4IA 2PTGA 3BJZA 1FJGB 1E3MA 1TC1A 4EO4A 4JL8A 1NNSA 3UUFA 1JW9B 5CD1A 4GICA 5ENDA 2EL9A 2XQGA 5HFJA 3UXEA 1M2JA 2VZ8A 4WFJA 3M6UA 4QU9A 4TS1A 4X64B 2F2TA 5KVSA 3FNBA 2E37A 1R7RA 1GCIA 4GAEA 3H4MA 3I04A 3MLAA 2FRDA 1NVVQ 3I3OA 2DFTA 1P4AA 3T52A 3F7MA 3I6IA 1S3IA 2VS1A 3N2GA 3KJEA 1G3MA 4JT8A 2VQSA 4Q9JA 3BK7A 3LIIA 5C5EA 1BCSB 4RLFA 3ZDBA 1SHZA 2F1KA 1KY3A 4IIGA 4N01A 5LZ7A 4U9UA 1VI5A 3MGKA 2PFKA 3I9KA 5BWOA 2G9QA 2WIBA 4CMKA 3QEBZ 1MB2A 4U7TB 3F5DA 3MJDA 5IAOA 4EJFA 2CMGA 4FR2A 3TFWA 4PPGA 1Z4KA 4L1KA 3G0DA 3NHUA 9LDTA 1G42A 1BGWA 5CEJA 1VYVA 3AY0A 3THRA 4PQGA 2ANBA 4MW9A 1ADFA 1HE2A 1CY8A 1OI2A 1YZLA 5HTKA 5LXTF 4CLDA 2H5LA 2IU6A 1GGEA 2D5AA 3CH7A 2PT9A 1UPAA 4DC1A 4BMYA 1RCTE 4DUPA 5JQGF 4NCBA 4K86A 5CBPB 3N5KA 3RQSA 4GPTA 4IVRA 1H9BA 1TJNA 1YB7A 3EA4A 1J6UA 1NV8A 1TAQA 3H65A 4N6NA 3BF7A 2GEDA 4ZVKA 5EIXA 2WIAA 3ZWBA 2QNIA 1M1UA 1GZ5A 1P2VA 1CQXA 1G2IA 3IGFA 4HLQB 4KE7A 5CYFA 5ICEA 3NVKI 4Q7EA 2I1QA 1JA1A 1U0JA 1Z2PX 4IUDS 3BIOA 4N6GA 2OHFA 2YNMC 3WLSA 5IHPA 2B0CA 4CMEA 1N1DA 1PR5A 2NG1A 2G1KA 1UWKA 3HKDA 3MD9A 3TQHA 3IMFA 1MGOA 4FBLA 4FC7A 3DKRA 4IDBA 1F6WA 1CF2O 4I8DA 1PX2A 4BQNA 1A9XB 5LLDA 3ZDDA 1U94A 2NSLA 2WSIA 4W5JA 4MVXA 4D6XA 4QYXA 2FI1A 3RFTA 3OX1A 4XIIA 3RIYA 1E3WA 5A03A 4EMSA 5DM0A 2VBCA 2XA1A 4D57A 1H1LB 2I3ZA 2YV5A 2I9KA 3I62A 3K9GA 2BEUA 3EOAI 3F4LA 3W3AA 4KQ6A 5DI3A 4D9JA 4YX9A 2EBHX 3SNHA 2HBZA 5EIHA 5H9WA 3ES9A 1IXYA 2HDWA 3PWKA 4H27A 2GXAA 3KPVA 4E15A 3I5AA 1JHVA 2OCYC 3VR5H 4EPYA 4EHNA 3L7NA 5IKOA 3KFVA 4HB0A 4C22A 2YCBA 3RWBA 4K40A 4KAJA 3ZD9A 2VQDA 4H7HA 3F6BX 4PPYA 6GPBA 1QIHA 3GLHB 4QGHA 4I4IA 1PFYA 1UPUA 3R20A 1BVHA 4EF5A 2FPPB 4HRYA 1UKBA 2BGGA 2XXAB 4GMKA 2E4VA 3ORRA 3HJHA 5ES3A 2VLIA 4QXOA 1RI2A 3LZCA 3CZRA 4XFKA 3BK2A 3DKPA 3HCNA 2ZI9A 1JH8A 1M2KA 2IZ5A 3MGCA 1PJ8A 2O8DA 3PHLA 3CVXA 1WXHA 3ZQUA 3JZDA 3K8QA 2DULA 3RVDA 3ZW8A 1GL9B 4FDVA 2C5SA 2H5IA 4O4IB 1T9GR 3F3MA 1NW4A 5H4HA 3C41J 1I2ZA 3EZNA 3OJEA 2SNIE 3PEFA 2BV3A 1KR2A 2NO1A 3QEOA 1ZY2A 4U8GA 1VHWA 1QVVA 3HNOA 5DTMA 2BJVA 1LNZA 1GGHA 3A9RA 2W6ID 4RH0A 1CETA 1JQJC 5AJHA 3MJHA 4BB9A 1E98A 2PT6A 3F7NA 1N2XA 1M6YA 4OQLA 5CVDA 4LDQA 3I58A 3P27A 4ID9A 5CLIA 1G4AE 3E1GA 5HILA 4HFRA 2ERXA 3KYIB 5CLJA 2YIVX 3BAFA 3RC7A 1ETHA 5JLJA 1GLVA 3QQPA 4K6OA 3DBLB 3PNOA 4X0EA 1DAOA 4PLZA 2CUTA 3CEMA 4XJTA 3UJAA 1UDXA 2Q8QA 4DNQA 4GBJA 4B2PA 4AP9A 1XTBA 2QQGA 4X8HA 1N2GA 3DMPA 3BUSA 4IIFA 4V39A 4A03A 3JAWB 2ZJ1A 3OFJA 4RZHA 1WRBA 1TJYA 1QTNA 1EXMA 2IHTA 1PHRA 1KI1A 1HT1E 4IDDA 2J9GA 4IXMA 4P3KA 4QTTB 5D86A 5F12A 3OPVA 3ADBA 1YVPA 2ZT8A 2L18A 2QTBA 3R6TA 5AK0A 1XLWA 4AYTA 3ISVA 4CLHA 1K3TA 2IPXA 5JVDB 1U2EA 2DUNA 3ETGA 4OU5A 4P82A 3EDRA 3HB9A 1CE8B 2MR5A 2PU7A 3R40A 1TXGA 2CZGA 2K7ZA 2C3YA 3ORHA 3QVWA 3V80A 5C7OO 1L1QA 2C4UA 1VJTA 5FJJA 2ZQZA 3JD1A 3PX3A 4QTXA 5HW0A 5IS2A 1NOIA 4E07A 5K8IA 4A2WA 5CXQA 1S2NA 4JLKA 2ZBEA 5JC8A 1WEHA 3FLBA 4BBZA 1NXWA 3HVUA 1RI1A 4PG4A 3GYGA 2A57A 1ZK2A 3W5HA 2JGAA 4Q02A 3HCBA 5B57C 2ZAGA 1SCDA 3A1WA 3ZV7A 1C3VA 3ZHQA 5JVDA 4YRQA 1ZO8A 3V00A 2WWYA 3A32A 4AM8A 1QANA 1BEZA 2BFEA 4LF8B 2X77A 1JPUA 3VRHA 5IAKA 5AJXA 4BVAA 1OAOA 3TKAA 3EVEA 1PR2A 3DLIA 1I30A 1O94C 3FY4A 1XLTC 2OORA 4Q03A 2P0AA 2IIVA 1NVVR 1Z8FA 4J1TC 1XZLA 3D64A 3GVXA 4ND7A 3ROZA 4IDFA 9ABPA 4QPCA 3QSYA 4ER3A 1RI5A 3MB5A 4M0CA 3ZCSA 1JVSA 4IHJF 4R1PA 1O77A 2GBPA 1LZKA 2OFPA 3H4IA 1WOYA 1E5VA 4MV1A 1YFZA 4G89A 3ZCXA 4CQJA 3U4IA 4EEZA 3E27A 2C97A 4NESA 1T9CA 2HF9A 4Q1CA 1BAPA 3WDMA 2FUEA 3O9MA 1OH5A 1SCJA 3ZE0B 5EJIA 2FOXA 1MW8X 2JRCA 5SY9A 1QWSA 3VPHA 5LKAA 4EHKA 3K5WA 4ENPA 5EE3A 4DARA 5JS6A 5AOAA 3EFOA 5JZVA 1TTTA 2OXEA 4PLGA 3ZQJA 4LVUA 2PXXA 2QVZX 1IY9A 4OAPA 4QL3A 5HXAA 2KX7A 1QR6A 2MWMA 3AJAA 3ACDA 3LRXA 1P5ZB 3JD0A 2IKQA 1I0IA 3LLMA 2VSYA 4RCZA 5DPMA 2QLMA 2ZTLA 3DW1X 1LFDB 2P11A 4RIGA 3U09A 4QDKA 1GILA 1PUIA 2JCXA 1MABA 3IQZA 3ORYA 4G26A 3IOYA 2G83A 3D9QX 4YVFA 2J9FA 4OLBA 4DQ0A 4Q4AB 5BR7A 2ZUBA 3J81A 4Z3OA 4V2IA 1AH2A 4FKBA 1ZR4A 1NBWB 2XWQA 4B81A 2Q3LA 3NI2A 3K9CA 2NU6A 3COWA 5J2UA 1F1JA 4KMRA 1BHQ1 3FBWA 1DT5A 4QU8A 3FPHA 2QRNA 1U2RA 2W0SA 3H05A 3OWXA 2VHQA 2W8BB 1BA3A 3KUXA 4NFHA 4M88A 3AKYA 3TVYA 2HU8A 1EHIA 4Q66C 3VYVA 3L6OO 4A5OA 1CEXA 3INRA 1MQ9A 4Y1EA 3PQ2A 1Y8AA 3CTPA 1UK7A 1YR9A 3SEFA 1K6XA 3KYBA 3SIPA 1MP0A 2BGMA 4UCXA 1QQ6A 1JFFB 3KC2A 5AJUA 2ZJ2A 4KBFA 2H7YA 5EWJA 2UZ4A 4L7VA 1QFMA 2IIPA 3LUAA 3OQ6A 3D4BA 2IYVA 3CLSC 3GLVA 2EX4A 3G79A 1LBQA 3TNLA 5DRYA 5B37A 4UFOA 3I6BA 3E9CA 3H1EA 4MVWA 1BE0A 1YE5A 4ARBA 4UNRA 2OGUA 3RE1A 5IK2D 1PJRA 2JCSA 5CT5A 2B8WA 1U28C 3CUSA 4KE8A 4WOBA 1RYFA 3EDCA 3H8VA 4A27A 2PL5A 1R6DA 1TL7C 2YZ7A 1WV0A 3EVDA 3E03A 1WABA 2WWTA 2HSDA 3P4YA 4XVCA 3BD9A 1E5TA 1KFEB 5LLSA 4PNEA 1GPNA 1CQWA 4QQNA 2D2EA 3ON5A 4FILA 4IWNA 5FR1A 2H00A 2X1VA 4K0KB 1ESMA 4TN1A 2ZBGA 5KUTA 1ESEA 1NX9A 1VKJA 2GX6A 2G82A 1PL0A 2X4IA 3JPWA 3DJFA 3O82A 4BNKA 4F86A 4Q4JA 4RSHA 4RYDA 4ASUA 2PRZA 3QBEA 1FNDA 3BE6A 5AH0A 4FIDA 4RETA 2Q1YA 3CT4A 4LJ5A 2HWYA 2I03A 5CPFA 3BKWA 5CW1A 5KYTA 4HCJA 2GVNA 4HY3A 1ZP6A 3GFTA 4J7AA 3AEYA 2WV9A 3EZYA 4V02A 5J5AA 2FHSA 2VTDA 4JI4B 2FSIA 3I92A 2J5KA 5LYJF 4R2MA 3MWEB 1HC7A 4LCBA 2WWFA 5F5XA 3V1MA 2B2CA 3PF8A 1UBJS 1QH1A 1YU9A 4WLUA 4F21A 4EHDA 2FP3A 1Z47A 3G82C 3U16A 1HO3A 2V7PA 3FDZA 4ND5A 5AM5A 3UJBA 3S3TA 4TRRA 1GP2A 1NZJA 3BRWD 4R8VA 1QH8A 4E03A 5BVGA 1N6RA 3FNGA 1EUDB 4RV4A 1GGVA 1BSVA 4OXYA 3TNJA 1XJWA 2COEA 2HA0A 2P9BA 5TGTA 3UF0A 3WQRA 1UOEA 2ZYDA 1Z12A 3PXEA 4P7FA 2G7MC 3MA0A 3Q2IA 1FUEA 2QMZA 2QVGA 3LC1O 3VZRA 1DJNA 1E9EA 4QYIB 1K9VF 3FCAA 3ME5A 3U17A 1GAXA 4HXEB 3HJTA 1T6NA 2WD7A 1BYIA 2GM4A 4H3HB 4OV6B 2WPNA 4G5FA 3KALA 2J8ZA 2B61A 2C9BA 2ZB3A 4UBOA 5DYGA 2R00C 3C7DB 1FOEB 1GKKA 2CVHA 3HXPA 4NQZA 2HRQA 3TYXA 3P26A 1U0HC 1YMQA 3BK1A 1NNLA 4C7VA 3PXUA 3H7IA 1JE0A 2HNBA 3M83A 2FPPA 3IFSA 1OT5A 2A0YA 2JI7A 4X3CA 1XJ0A 3F2IA 3STTA 1VJRA 3WQQA 2CXRA 2MINA 4YFYA 1QIKA 5H82A 1I51A 3KFXA 4QOGA 4TTAA 1TM7E 4G5XA 4W8GA 5BN4A 2NPOA 1X74A 1VPEA 1YZVA 1YAHA 2FPUA 1OTYA 4GI2A 1PSDA 2H0QA 2W6PA 2ACVA 4UBKA 5HS6A 1QZXA 5JD3A 5T3UA 4DIKA 1S2DA 3JRNA 4LFBB 1HORA 5I5GA 1Z0KA 1L4FA 3GUYA 3KKKA 3FUUA 4EFLA 5HOQA 2AQKA 4PLFA 3GMIA 1CKEA 2O8DB 2F9LA 2R1VB 1WLSA 4P7JA 3VTFA 4Q9NA 1C4XA 1Z06A 2XMQA 1EVZA 3LA6A 3W2TA 3HP4A 4QXQA 1JDVA 3V8NA 3PC4A 5KYVA 1FCJA 4DLVA 1XQYA 4HT3B 3VTAA 2GNOA 3MYRA 1XVVA 2WSLA 5TNXA 1QDUA 2JAXA 5KQLA 1Z2OX 1L4KA 4KKXB 1Q77A 1HE5A 3EISA 4M87A 1JPJA 4Q15A 1VMEA 1O96A 3BWCA 3LHSA 3IMKA 4K0RA 1AHPA 3R0JA 5AW9A 4HEQA 3B53X 5JJBA 5K9ZA 4JT9A 2AMYA 1R64A 2ZJ4A 2YMLA 3PE6A 4GMHA 4E09A 3TLZA 4NPCA 3VTKA 3JASB 4DADA 2W6JA 3IB6A 4FINA 3FH0A 3ZBPA 1ZWKA 1CZNA 1NUQA 1Z15A 3OE1A 4OXRA 3ZLTA 1LTQA 5DW3A 1O95C 5ENVA 2A2ZA 2LBPA 4QHYA 4YPFA 5K3AA 2ZAMA 1C9DB 1NHGA 1WW8A 2A3RA 3H19A 5LC1A 2ZTHA 1GFWA 2E89A 3PPVA 5D5HA 5TGZA 5ALRA 3UMJA 3N05A 4E11A 1NVBA 4CNQA 4FHDA 2XZOA 4FFNA 1HZZC 1JQDA 5ICGA 3COYA 3OU2A 1A9TA 1WXFA 3W2HA 1DQYA 3S8YA 1JKIA 1U8XX 5FLXA 4EA6A 4QOHA 2Z1DA 3MJTA 1V41E 4BVKA 3GLGA 3TL3A 1H3EA 1B8OA 1N25A 1DXOA 2CE7A 3ETLA 4A8PA 3OZDA 1YNSA 1XCJA 1DAEA 1XVIA 1O97D 2ENWA 2PS1A 1VBNA 4DJAA 2HRZA 1NJ5A 4MVJM 4U8HA 1WULS 3LV8A 4V24A 2AWOA 1KK1A 1NF3A 2YJ4A 5YASA 8LDHA 1PJCA 5T4HA 3ONVA 4QWWA 1L5SA 3DKVA 4WLFA 4O2BA 1THGA 4OHWA 1UDBA 3V1YA 1H42A 3KXPA 3I0MA 3MG9A 3JWIA 1ZN9A 3DOOA 5LU9A 4B32A 4RFLA 1VQ1A 2C2BA 1PK7A 1RWMA 3O4VA 4X93A 3WKBA 3A0RB 1YB6A 1PR4A 4JIGA 3O75A 4BO9A 1WQ1R 4TTJA 5A4KA 1CY4A 3RABA 1ODCA 3CO0S 4C5CA 1NFFA 1Z6TA 4AK9A 3NX4A 3T3MB 5KYNA 5CA1A 1CFJA 1VSVA 2IW3A 3RKUA 1A8IA 2XZDA 1ATIA 3CVJA 4XVRA 1AGXA 4WADA 4LOJA 3IAM1 1FSGA 3PA8A 1NOJA 4E2YA 4LYEA 3G8AA 2FUNB 5DWDA 5LOVB 1ML4A 1BH2A 1WW2A 1BHO1 2IVFA 4PTLA 3LC2O 4MRAA 3IB3A 6YASA 1M0EA 1U31A 1WS6A 2VP4A 4LSGA 2XB2A 4MKHA 2JIOA 1GZDA 1YDGA 3R3WA 3GUVA 4XWYA 4MW5A 3ST7A 3ZY3A 2Z8ZA 1KTIA 4Z4IA 1SUSA 1T6YA 2QN9A 1N2ZA 4MVJG 3OLWA 3ZUPA 5JSZA 3PZRA 1EK5A 1PBTA 3TN7A 1I3CA 3PWSA 4LNAA 5C31A 1YJ8A 1VLVA 2VHUA 5FL7A 2FPLA 2XQIA 1XD9A 3SOZA 4B09A 3QZUA 4DQKA 3UFXA 2CFOA 1SBHA 1YRWA 4MULA 4WK4B 3IS3A 3SQLA 4MAAA 2QN7A 4QT4A 2BEWB 2AH5A 1DQSA 3ZU6A 5KTTA 3WWOA 1DCTA 2J3JA 1SHKA 3LL7A 1LD3A 2YN2A 4IZIA 4LHXA 3OTQA 1YSCA 2OL4A 1Q0LA 1RDFA 2J3KA 4IDEA 3ZN2A 3QEMB 2XWPA 5ITZA 3IEVA 2O59A 2ZG6A 3OFVA 4R1OA 3RRBA 3WFIA 1L4LA 5TIIA 1JWAB 4Q4AA 3GJ4A 4KZPA 2CVQA 5DNVA 1PHPA 4C4OA 5BOSA 2ID4A 1T0JB 3VO2A 2I4NA 1GR1A 2BKXA 3P2YA 2YWJA 1DRWA 3E53A 2BBOA 1EK1A 3OKCA 1ABEA 4MS3B 1N6OA 2C2ZA 4O2AA 3WLQA 3A1CA 2C99A 4DR6B 3EWSA 4IXDA 4ZOLA 2OZEA 1K88A 3A6DA 1T4CB 1FFSA 2F9MA 1HKUA 1NX6A 3HH8A 4TV8A 5LNK6 1C1XA 1RTKA 5ADHA 7ADHA 2OGSA 3V5NA 4FS3A 2PX8A 4ZU3A 1EBUA 3MTIA 2WOOA 1L5NA 2AR7A 2WBLC 3F5FA 4BX9A 2BDUA 3HVKA 3U7FB 2WSSD 5KSOA 3AZPA 1M2VA 2BCEA 2VJAA 3ZU4A 1VPWA 4ZU6X 2LUOA 3B9QA 1IN8A 2JGKA 1P60A 4KXXA 4S35A 1QYDA 4OYLA 5IN4A 1RC1A 2V1UA 1E64A 4QOSA 3CZPA 3TD6A 1VE6A 2WZQA 4MO2A 3QPBA 4ZEMA 1F0YA 3HXKA 1MTOA 3NKVA 3PQ7A 2GD2A 1ID1A 2MT9A 2FQXA 3I9MA 1B14A 3EMVA 1K4KA 2ZIXB 1Z7WA 3BCRA 5IC6A 2GILA 2BY4A 3DMGA 3JYOA 3PPWA 4GPD1 4R40A 2O3TA 1N9KA 1RJFA 4DZRA 3PTAA 3SX2A 1TRHA 4ZT5A 2JG3A 3O8CA 3IPAA 3TEMA 4DDKA 2NVUA 1I4OA 1DIBA 4WEQA 1VMDA 5JJ5A 4M99A 3TFQA 1V5EA 1KNXA 2A9QA 4I6JA 1GZSA 4OI2A 1ZBDA 4G9EA 3L7KA 4FQ7A 1FMFA 1CJSA 5A2QA 1SBCA 1WMBA 1X14A 4YJHB 1Z5VA 1RW4A 3H75A 4ESHA 1DIGA 1KC3A 4PG6A 4JBGA 4BJ1A 3OLQA 4L74A 5ADWA 3O8OB 4FEYA 2DPGA 5B58T 4URXR 4KZKA 3PL5A 1K92A 2GA8A 3CIOA 3O74A 1U7WA 2AG6A 1DZIA 3JYLA 3KT0A 4DLBA 1CCWA 1G3IA 4UU1A 3REGA 3ZVKA 2VVTA 1DP4A 2QJRA 4IRUB 1QOZA 2WP0A 3KKNA 2B1JA 2YS6A 1U1IA 2WD8A 3CRW1 4GLLA 3EXIB 4NJMB 4CKCB 4E0BA 4NZZA 3ZIUA 5GM1A 4MEBA 3DCYA 5FTKA 3ISTA 4OQXA 3KKZA 5GADl 4JZYA 4D41A 2FWIA 2I6FA 5M2QA 2JW5A 3G1UA 5A3JA 2Q9UA 3NFYA 3EBPA 1YS4A 1YTLA 1XVTA 2G1UA 3GFOA 3MAAC 4CEHB 1P31A 2MMCA 5FYQA 4KXWA 3IDQA 5IC5A 1RLOA 3TXYA 3O3MB 3RK0A 3RHFA 4DKJA 1XAHA 5HIJA 5IDQA 3FUWA 4XFJA 5HF8A 4NY1A 5HEKA 1Y8CA 1U8TA 2YWBA 4M8NE 2OAEA 4EENA 1KA9H 3MQ4A 2ORYA 4HLUA 5GGXA 4X3PA 1MXHA 3IP8A 4GX0A 3LCVB 1CIPA 3H9EO 5C8XA 4H3VA 4Q4HB 3AW9A 5A62A 5D51S 1EQUA 1Y42X 2WF9A 3HWX1 1F7UA 3SLKA 1GFSA 1U0TA 2OCLA 5H4GA 5HZMA 2PZBA 3TG2A 4OF4A 3VH3A 4IR7A 4LDNA 1TZCA 3TSZA 2VJQA 3QX7A 2ZVJA 3M2TA 1JSLA 4DN6A 3KD3A 4IO1A 4J0KA 1PFGA 5LZ5A 1FQKA 4YEDA 3LLVA 3TSYA 2AYYA 4EIWA 2BGNA 5DV9A 3RC8A 1E7YA 2GZ3A 1VKZA 3W77A 4EUHA 4MTLA 1KZ6A 1K86A 2DHEA 1A2QA 1OOEA 1UKAA 4LYFA 3N75A 2JHFA 3W9SA 3ZHOA 3A9TA 1DIAA 4O2LA 3W9BA 4GLFA 5EIFA 5J1SB 4D43A 3E58A 3WLJA 5EKSA 5HQ3B 1GTG1 5KCMA 4RIEA 1N0UA 3D7RA 4UHBA 3T7IA 3W06A 1CVLA 1KF0A 1SJ9A 2ZR9A 2SKDA 2ZBFA 4HSEA 4YWHA 5BWNA 4LNUB 5MF6A 1QC5A 3D6FA 2ZZNA 3D6TB 3G0HA 3HDQA 1YI0A 1E2FA 3I1JA 1I6WA 2BGUA 2QJOA 2OYRA 4GBMA 4PC1A 5EKXA 1A04A 3FXAA 3TKYA 4NXNB 1B73A 1BFDA 1NQOA 2HBQA 2VF5X 4Q93A 4QOFA 3SD7A 3MFQA 4MUAA 4FZ3A 2TRSB 4Z99A 1CVRA 1EFHA 5A9SB 1NZDA 2FUKA 4L22A 1ZPDA 3VMFA 5DBEX 1NVUQ 4O2BF 3TRHA 4V3BA 1CJKC 4AX8A 2VF4X 4UEKA 5EHZA 4WXYB 4DDVA 2DSNA 3S70A 1SZJG 3OZGA 3LVRE 3RFXA 3UWMA 3O94A 5FH9A 3OCVA 3ROMA 3B36A 5KTMA 4NOKA 3FYDA 1MORA 2IFTA 4G09A 4LHSA 4ZA2A 2REXB 2F3TA 8AT1A 1YVRA 1RPNA 3H84A 3BD6A 5TMPA 4V2UA 3ZHCA 3R75A 2G88A 4NYJR 3AL0C 4MINA 3B5IA 3QKUA 5AXAA 1U81A 4OLHA 1NPDA 1JG3A 2GPSA 3H83A 2YL2A 4FNAA 4A8JB 4JNCA 3SSAA 1VLHA 2BMJA 2JGIA 1RHUA 4S05A 4OL9A 4ILEA 1F8GA 1ZC3A 3WB1A 1AG9A 1HYQA 5L3SA 1RZVA 1J90A 2BHSA 3IA2A 1DRKA 2IZ0A 2ZT7A 1ZD1A 5CVUA 5BSWA 2HC9A 4BVFA 2B1RA 3RGGA 1MAVA 4ILKA 1RI4A 3PB3A 4XYMA 3OWHA 1W0KA 3MEQA 1IL0A 1Q1AA 3BSYA 4IIDA 4EKNB 3N0VA 3ZIDA 1ISHA 5LBIA 3EWIA 1AO3A 1X6VA 1CZLA 2IKSA 3CN7A 2GCOB 1H4SA 1PEDA 1GKYA 1ORRA 4HYQA 1N3LA 2VHZA 4YQYA 3RSFA 1EX6A 3RHTA 2R68A 1E1RD 3Q7SA 1GCAA 1IUNA 2HLDD 4HAXA 5HK8A 1Y7HA 2DBVO 2B99A 1UFOA 2HXYA 3GGJA 1KH2A 1AUOA 2C1XA 3I6YA 4JHXA 5M34A 1SXJB 2YVKA 4D7AA 4DLAA 3A4VA 5EOVA 1VYHA 5FB3A 3JWPA 4HH1A 1JKJB 3QXXA 2OENG 3NU1A 4FPXA 3Q40A 3TQFA 2QY9A 3A3YA 4DJFC 2Z04A 1XSEA 1Y6FA 4MI3A 2VSOA 3Q0EA 1U7UA 4ATNA 1V47A 3GLUA 4IQGA 1BMFA 4CFYA 1B7GO 3VJRA 2Q99A 3RLIA 2OPBA 3EGWA 4PPQA 1RFLA 4EGQA 4JGBA 2AN5A 4QULA 1FRZA 1HQKA 5I7UA 2FN7A 1M1YB 3GXBA 4JL6A 5E1DA 3D1VA 2IHUA 2JH9A 2X2FA 3Q9SA 4KOEC 5IWAB 4ANFA 1IE3A 1YXMA 5KOHA 1ULTA 3DBRB 3M4XA 3G9ZA 1G41A 1ZQ9A 3FYUB 4YA6A 5KWEA 3EAFA 3TBFA 2UYCA 3FSEA 1PFQA 1R1DA 3W8RA 3HRIA 2DY0A 3L0SA 1H85A 1SQ0A 4HDSB 1YE8A 1YQQA 3E3LA 3O8RA 3RAEC 3IBGA 4UVGA 1RIIA 3W2FA 4LBVA 4MPTA 3GPBA 2HIGA 4BFYA 3C97A 3JQRA 1LFAA 2R6JA 2JFNA 1ZH8A 1FRFS 3L8MA 2FSSA 4KLRA 3U3XA 4DBVO 3HBJA 5KC9A 4TM8A 5IUNC 1DRJA 3CF4G 1PU2A 2Q2WA 2X9GA 4RY8A 4FEGA 3UJDA 1U0RA 1PJ3A 4MQBA 4QFCA 2FW1A 2YW9A 5KOHB 5DHQA 5EYPB 2VP0A 4BV3A 1W59A 1GKIA 1M1XB 1C7QA 1U8AA 2UYOA 5K3SA 3SXPA 3VC1A 2G28A 2LR0A 1VG1A 2BMFA 3ANNA 4AMYA 3IHKA 4Z0HO 1TYEB 2IYRA 4NMLA 3P96A 5AJYA 5PNTA 2G5CA 4NFSA 2M6SA 2EHJA 3BWVA 5G4LA 3WLIA 3CUEF 4D0GA 3ROFA 2VG8A 1RKXA 2HRBA 5C1BA 4YACA 1PYDA 2JBWA 4B8WA 5CA0B 2X0JA 3RT9A 3HCOA 5E6UB 1XJQA 3SZ3A 3ZG6A 1PJAA 3VR2A 1ZI9A 3WLFA 4DVGA 4D4HA 4G65A 3RSHA 5KOJB 1XCBA 4X97A 3S55A 4MUHA 4WZAE 1G60A 1R3UA 2J6IA 2ZYHA 1R4AA 3PRKE 1Y1TA 2FMTA 2EZ4A 3OJLA 1U4OA 2C58A 2PKXA 2RAUA 1VI6A 5CM2Z 5HCNA 5AIBA 1RBQA 2DCMA 3HDHA 1GPBA 1QK4A 3A04A