4QKQA

Rada from methanococcus voltae in complex with copper phthalocyanine tetrasulfonate inhibitor
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
265
structure length
257
Chain Sequence
SHMDLGFKSGIDLLKQRSTVWKLSTSSSELDSVLGGGLESQSVTEFAGVFGSGKTQIMHQSCVNLQNPEFLFYDEEAVSKGEVAQPKAVYIDTEGTFRPERIMQMAEHAGIDGQTVLDNTFVARAYNSDMQMLFAEKIEDLIQEGNNIKLVVIDSLTSTFRNEYTGRGKLAERQQKLGRHMATLNKLADLFNCVVLVTNQVSAAEQAIGGHIVGHAATFRFFVRKGKGDKRVAKLYDSPHLPDAEAIFRITEKGIQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of an archaeal Rad51 homolog in complex with a phthalocyanine tetrasulfonate inhibitor
rcsb
source organism Methanococcus voltae
molecule tags Dna binding protein
molecule keywords DNA repair and recombination protein RadA
total genus 95
structure length 257
sequence length 265
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2014-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08423 Rad51 Rad51
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4qkqA00
1LS6A 2IXGA 3DMDA 1S4QA 1G3RA 2ZI7A 4LV8B 3WY9A 3GJ3A 2GF0A 1QF9A 4OK6A 1NVXQ 3BB4A 5DNYB 4DSOA 1ZM9A 4M53A 1K5DA 1YU9A 2Z0MA 1NLYA 4IOKA 3VR2A 3K0SA 3MWYW 3GJ8A 3K70C 3A36A 4ASUD 3DDCA 5AWFC 2CHQA 5JWRA 2RMKA 2OCYC 2XX3A 4JVMA 4AYXA 1CLUA 4B34A 4B75A 4L9SA 2HT1A 2IXEA 1D5CA 1XJCA 5KYKA 1OE0A 1OKKD 2CBZA 2FNAA 5JMTA 5JS7A 2YOGA 1F5NA 1BH2A 2GXUA 3MGCA 4OI2A 4TTRA 3U7HB 4RSGA 1T91A 5B58C 5KSPA 1E2HA 4BECA 2F1HA 1XPUA 1WBDA 2VHCA 4RD4A 4JLKA 2ZRKA 1W0KD 4XVRA 1ZNXA 3K0EA 2YNMA 1WP9A 2IUSA 1E32A 3C8UA 3KTAB 4KBGA 2NPIA 5EP2A 1U94A 3VQTA 2X2EA 1XTSA 2IC5A 2AXPA 2FPLA 2X19A 2RH5A 1OH6A 4LHYA 1DOAA 1U8AA 4IOLA 3B78A 2ZRAA 4DLTA 1NKSA 2OILA 5EZ5A 1NSFA 5AUQA 3PUYA 3ASZA 4DB4A 4TYYA 1OHHD 5FR1A 5AJVB 2CDNA 3B1XA 4Q9JA 1AIPA 2GCPA 1PLJA 1CJTC 3X1YA 5CK4A 1SXJA 4FMDF 3NBFA 3NHBA 1G5PA 4KLNA 3AVWA 4DVGA 1JBKA 1X6VA 1CKEA 4JBWA 2ZITA 5D3QA 1HT1E 3KJEA 3TUZC 3M4YA 4YXWA 3ZZ0A 2JLQA 4BLQA 4D0GA 2XGJA 1G9XA 2F9MA 2IL1A 2ODEA 3VU9A 2ZSEA 1XNJA 3U4QA 5SZKB 2GXSA 4L4UA 4JLPA 3GLGB 3ND8A 3WNCA 5FL7A 4Q7MB 5LD2B 1S1CA 5D3MB 3NXSA 2EFCB 1AKYA 2ZI4A 4BWYA 4TTQA 4Q1DA 4M9XA 1RZ3A 3U3JA 2AWOA 4RZ3A 1R8QA 1DARA 3A1VA 2Z43A 4BASA 3TRFA 1OLOA 1UDWA 1QRAA 2EWVA 421PA 1KNQA 4DC9A 3IBGA 1W2GA 2B6HA 1LS1A 3A6PC 2WOOA 3TJZA 1U90A 2IT1A 4BUJA 2WAXA 4UNPA 2ORVA 4A9AA 1U0LA 4TL7A 1NLZA 1G41A 2OXRA 4RCYA 5HE8A 2ZRCA 4KFUA 3AQ4A 3VNVA 3KFVA 3SBEA 1KK3A 5KPJA 1M74A 5KNBA 2FZLA 2XJ4A 3FMFA 3KZ1E 3ND9A 4ZIRB 5L3QA 1Z63A 2ZTSA 1UKYA 2AFIE 2ZEJA 4NYJQ 1P9WA 4BLRA 1KHTA 1E3MA 2IEYA 5CDFE 4ZIRA 2YINC 1NRJB 2Q9BA 4FD2A 1EXMA 2RGCA 5CM8B 4GNKA 4F4CA 3VX4A 1SVWA 3NG1A 5H1YA 3B9PA 2XSZD 3OEHA 4B3FX 5ELXA 1W4AA 3IEUA 4UXIA 1J8YF 4JJKA 4PANA 1M8PA 1CS4C 3FB4A 4PZZA 3EPLA 1OH7A 1SVIA 2O8EA 1D2NA 5DO9A 3EWSA 2OT3B 1GZSA 1MO4A 4LHVA 1E2MA 1YR7A 2AD5A 3L0IB 3ADKA 4C0HA 1KO4A 4DSTA 5FUVA 1E0JA 4Q5IA 3ZZTA 1X8LA 2XTMA 2EFHB 2BMEA 1U98A 3VX3A 3K8YA 2RGAA 2H18A 3QJYA 2CHVA 3T06B 3EG5A 2QORA 4NHOA 4EFLA 4ZKDA 3UIEA 3E1SA 5JECA 1N6RA 4PR0A 3IUYA 4YMUA 4I4LA 2CLDX 1W36B 2BC9A 4UJ5A 4LUCA 5FPTA 2G88A 2NO1A 2XZLA 1Q1BA 4DLYA 3C15C 4HAWA 4QXAA 2RGXA 4PSVA 4JMPA 2VA8A 1E2JA 1ANKA 4KSBA 5BYKA 5FTNA 3GLFA 4A2QA 2IUUA 3K09C 1KI1A 2ZSBA 2FSHA 1E9AA 1WCV1 2WJGA 3DPUA 3SE0A 1RJ9B 4A2WA 1XCMA 4V0NA 1GNQA 2VP6A 1JB1A 1XD2B 3OIUA 2VHUA 5EP1A 3CH4B 3U5ZB 3SJCA 3TNFA 5KO2A 2AKAB 1UPTA 2Q21A 1OYYA 4QJ4A 1YZTA 1OFUX 3RS2A 4AK9A 3LX5A 3ZIAD 2FFQA 2F3TA 1OB2A 5L3SB 4X8OA 4NYIR 3VR4A 5AUPB 1ZM3A 2R6CA 5EE0A 2N46A 2DFTA 3GLFB 1UKEA 4A8JB 1KDTA 1N2CE 4TLDA 1LY1A 5CJPA 3TW8B 2G1KA 1W5TA 2ODWA 4F38A 3I32A 1YZGA 1CU1A 1PLLA 1SHKA 2WOJA 3KL4A 3LV8A 1LNZA 2D2EA 4RZUA 4YC7A 4DT1B 3PEYA 3LW7A 1FL9A 4CEHA 1A2KC 2ZREA 4FI3C 1SXJC 1ZMXA 1N25A 3THYA 1YRBA 1CXZA 1C1YA 1XTQA 4LYJA 1DO2A 3WNBA 2QT1A 1W2HA 5EXXA 1CTQA 2QENA 2ZETA 1DVRA 4RKEA 3BFVA 3LW8A 3NH6A 1XEWY 5FTMA 5G40A 1G20E 3KB2A 4KV9A 1NN0A 5AUOB 2XZPA 1E2NA 4FMBB 3W8RA 3GJXC 4MDEA 1Q12A 2OAQ1 1VHTA 4OI1A 5JWOA 2G77B 4V0MA 1XJ0A 4G5GA 2I4IA 4GI7A 5EE3A 1AZTA 3K0AB 4PO9A 5DHAA 3AVTA 3D31A 5JSZA 2XEXA 3FDIA 4ERNA 5JI2E 2ZXUA 2W6IA 4OQXA 1U99A 3M0EA 4MH0R 4Q1AA 4NH0A 3DZ8A 3CNOA 2MMCA 3TMKA 4WXRA 1WRBA 2R62A 2EVWX 4TL9A 4DT1A 3HJNA 4BPBA 4LJ9A 4JLDA 2OXCA 3A8TA 3L43A 4C7OA 1A2BA 3LQQA 1S3GA 1VTKA 2ZJ5A 3IEVA 1OIXA 4B2IA 5JHGB 1CR2A 4GFDA 5DH9A 1RYHA 2ZYVX 1OFHA 1QHHB 4KODA 1Z06A 2QMHA 1YR9A 2JDID 3UMSA 3U60B 3CRW1 1BMFD 3PFIA 3NBYC 1KZ7B 2QMEA 2GCNA 3K70D 4C0BA 1QDEA 3BIFA 3GJ0A 4TMKA 3CB4A 3W8NA 2CLSA 1IJEA 2QAGA 2ZRBA 3AVPA 1P2TA 2EW1A 3V4FA 4P0TA 1G8FA 4PO8A 4LJYA 1G8YA 821PA 2R2AA 1E9BA 4KBFA 2Q3HA 3LBNA 3U2QA 2ODNA 3QNUA 2OLKA 4AWXA 4B43A 2KBFA 4BFZA 4RD6A 621PA 4KXFB 1WQ1R 1JR3E 3BJIC 4M1OA 4XSHA 2F6RA 2JJ2A 2HYDA 3FKSD 3V9PA 1NY6A 4JS0A 4L15A 2H8KA 4M8NE 1W5SA 2EFDB 4Z1MA 2CCKA 2WSSA 2YWFA 1Y3AA 1Z0AA 1U0JA 2K5UA 4YDHB 3FHOA 2BHRA 3AF0A 1LV7A 4KYIB 3DOEA 5IK2A 4D4JA 4Q7KA 1E79A 5J40A 1CJKC 1RW4A 3MLEA 4KFRA 4Z1MD 5TVKA 5DN6D 5IRCD 5LPNA 4MGIR 2WIAA 4W5WA 3PEUA 1T6NA 4HYYA 4DLWA 4BFYA 1ETUA 4J0QA 2CNWA 4X8LA 4NDZA 4Z51A 3NC1C 4U02A 1G8HA 1WE2A 2FSFA 2R6FA 4DCSA 3WP0A 4AKEA 2OFWA 3D3QA 3IKJA 1E2QA 1IM2A 4NYJR 3UMRA 2IYXA 2FGKA 4PXAA 2VRWA 1EFRA 3BGWA 2RGBA 4K81B 4JLJA 1XB2A 4G3XA 4CDGA 4QGFA 4LJ5A 5IT5A 4CYMA 1TNDA 1W47A 2IA5A 1G64A 2JJ1D 1R4AA 4CEJA 3P4YA 1G3IA 4LJ4A 4PQYA 3FVQA 1OFIA 4QL3A 1VG9B 4HB2A 4CIDA 1J70A 1VYUA 1OB5A 3GLIA 2GBLC 1G4AE 2OFXA 1M6NA 2ZI6A 4H1VA 3TK1A 1I4DD 2D74A 3AVUA 1G3MA 2QPTA 2OBMA 3AF1A 2REOA 4LHXA 3LO5A 1NJFA 2IYRA 1KJWA 2CCJA 2LWIA 3CF2A 1KTVA 5J5CA 3UPUA 4N0DA 3O47A 4EPTA 3BH6A 5BXQC 3SHWA 2V54A 4AYWA 3OIYA 3U44B 4CEIB 4PHHA 1LW7A 5IDVA 4EFNA 2CL0X 3L8ZA 4IDPA 4QHTA 3PJRA 3RRNA 1WDTA 3K0AA 1FUKA 2VP5A 4EPYA 3U3KA 1FP6A 1KDRA 3EA0A 3QXCA 5JI3E 4DUGA 5GJVC 2VSFA 2NO0A 3Q8XB 4WZAE 1YKSA 5KSYA 2IX3A 4ESHA 2NMVA 2QE7D 1PVOA 5FUWA 4RD0A 1WMSA 4QBIA 3T15A 2R44A 3FKQA 5JFGA 2VSXA 1KI6A 4B2LA 2VHQA 4URZR 3EWAA 3VNUA 3FOZA 1XZPA 4P31A 1D9XA 4Q4HB 5F9HA 1H8HD 3N2IA 3OFND 1J99A 1TPZA 3TUJC 1JAHA 1ZRHA 1ONBA 1AS0A 4IDNA 3A4MA 1P9RA 3SBDA 4D4KA 1C4OA 1RC8A 1Q1EA 3HU3A 1EX6A 4HUTA 4CW7A 2R65A 1GKIA 4Q01A 5GJCA 2Q3FA 4L8GA 5JJKA 1CJUC 3Q9LA 1Z29A 5AJYA 3WHKA 2XITA 4ZI3A 4KFSA 1T0JB 2NQ2C 3CNLA 4LZZA 2G0NA 2ZYWX 4WAUA 1QVRA 1E1RD 4HAZA 2KJQA 3GMTA 2Q9CA 2WWHA 1D2EA 4LY6A 1NMZA 1XD2A 2P3SA 1HURA 2ZVQX 5CIQA 4YONB 1YZNA 4M1MA 4NONA 1KI4A 1ZP6A 2RAPA 1E0AA 2ORIA 3I1FA 1JR3A 1KSJA 3CWZA 2HJGA 1EG7A 1LFDB 1X8JA 3UANA 2ZUDA 4R2IA 3CM0A 5L3SA 2J0UA 1GG2A 5SZJA 3VTKA 3HP1A 2QT0A 2P67A 2UVQA 1CJVC 4A0RA 2WTUA 2KBEA 4OJQA 3ZQ6A 1II0A 2IUTA 1AA9A 2QZ4A 2PZFA 2PMDA 3KUDA 2JIZD 3QXHA 1KIMA 2GNOA 3PENA 4XJXA 2WKRA 5E7JA 4BE7B 4TYPA 1UKZA 3TBKA 1EWRA 2ZRHA 3EZ2A 5L3VA 2NZJA 4M9SA 4OK3A 2ODBA 2GETA 2CE7A 3AKEA 4HLQB 4DLSA 1M2OB 2QM8A 2RHMA 2BBWA 1P60A 3SFZA 1KDPA 2BIFA 1Z22A 4GZMA 5JCPA 3TKLA 1P9NA 2IW3A 3HYTA 2RHDA 1K8RA 1I2DA 3UWKA 4ZCMA 2JLSA 4QC2A 2GEUA 4BGDA 2XB4A 4KU4A 4EDHA 5GVRA 3ONWA 5FBRB 2I1VB 2YC4C 2GCOA 2B8WA 5FOVA 2XB2A 5CB6A 2WHXA 2MMGA 2QMOA 1OXXK 3KQUA 4A92A 1ZIPA 4V0OA 2J5XA 2UZIR 4M1YA 2W6JD 2ZJZA 2QM7A 2HDNB 3AUYA 1QHIA 4LBWA 3VU9B 1J90A 1F60A 2OESA 3CZPA 2QSZA 4B32A 2WWXA 2W58A 1ZINA 1FW6A 3AP1A 2WWIA 3A1WA 4HUQA 1R6BX 1Z07A 1Z3IX 2QTFA 1F2TB 2HXYA 1XRJA 3QF4A 3AKDA 4A1FA 3GEHA 2A7QA 3PQCA 4B44A 3QF4B 1G7RA 3LX8A 1DEKA 3PEVA 1GM5A 1MKYA 3CW2A 4FCWA 2P5SA 3K70B 1OKKA 4HEJA 1BYUA 1E2LA 5AK0A 4NMMA 2DPXA 3IIKA 2ZIAA 4JVNA 5DIFA 521PA 5BN5A 4I1SA 1GIAA 2IYUA 2KWIA 3WXMA 2JLZA 2ZJ2A 1YZUA 1QZXA 1JPNA 4OK5A 4OYHA 1GKUB 1NLFA 4B76A 3GFPA 2XXAB 3R8CA 1T8TA 1JEDA 1W0KA 2BJVA 3CPHA 3GD7A 3MWLA 4LCBA 5FOTA 1D8TA 4PPFA 4PZYA 4URXR 5D3MA 3KFXA 4MGYR 4HAVA 3BOSA 3AVQA 2OE2A 3W34A 3EPKA 1GILA 3NWJA 5BWMA 4EFMA 4A0GA 1GKYA 4DWJA 2HLDD 2EFGA 1YE8A 4R98A 4E09A 1GWNA 2NOAA 2Q0HA 3A1TA 1G17A 4M1KA 4Q1BA 1E2DA 1COWD 3EAQA 4BFTA 2XTZA 2QA5A 1SXJB 1AQUA 4U00A 3U7GA 2BVNA 1LB1B 3Q3JB 4IDQA 4IEEA 3DO6A 3ETLA 1G8GA 4BLSA 1V5WA 5C1BA 5P21A 2AWNA 2F7SA 3QG5A 1YJ5A 5BN4A 5LBIA 3QPWA 3GLGA 4I99A 2ZU0C 4IKEA 4DSNA 1PV4A 4TZ0A 1V43A 4YLGA 5BQ5A 1JJVA 5G53C 3ZD6A 4XVQA 4B35A 3FMIA 1R0XA 5HR5A 3T61A 3WBKA 1NN3A 1W0JA 3IHLA 3KKMA 2EWWA 2X1VA 3BC1A 1Z6XA 2BBTA 1W4CA 3IIJA 2B92A 4MRSA 4ZDWA 2CXXA 5HKKA 3F0TA 4IVQA 2FN4A 3RSLA 5L8VA 3SS8A 4WZ6A 2OCPA 3SYKA 4N0EA 1U81A 2E1RA 2DB3A 2FA9A 1S8FA 1KY3A 1EESA 3CH5A 4Z54A 3WHLA 2VIIA 4ZCLA 3U3MA 1T3SA 1U9IC 1ZM4A 5FPSA 2RCNA 2V8OA 3BRWD 5FPYA 3EX7C 1AGRA 1OF1A 4XVUA 1W48A 3AVOA 3NKVA 4C0QC 2J0VA 3NDBB 3R9XA 2YC2C 2JLRA 4QGHA 2ZM5A 3FYHA 3TSWA 4FWIB 3LBIA 5KUTA 2QTHA 3EPHA 4O25A 1LF0A 2GEDA 5FOWA 1GL6A 2JJ1A 1DELA 3GQBA 4BQSA 4XTCS 3EZ9A 3QF7A 2GZDA 4X8MA 2Q6TA 3RDPA 5TV2A 1P2UA 2ATVA 5LDDC 3GLHB 4HATA 3CRVA 3EIQA 1AQYA 3B1ZA 4QNMA 1EK0A 3OESA 2EYUA 3KJGA 1I2MA 1Q44A 1F3OA 2QPAA 4IJMA 1E9EA 1B0UA 2IYTA 2F1JA 3MSXA 3THXB 2P5TB 3RABA 3CRRA 1GL7A 1ZYUA 4LOAA 5JRZA 2I1QA 2QAJA 4KVGA 1E6CA 4MKIA 4PZLA 4PHTA 1Z6AA 3CUEF 5JZVA 1XXHE 4Q4JA 5H70A 4UKDA 3KDSE 2EQBA 4TMXA 3K9NA 2OUKA 4LDJA 1YR8A 2IBMA 2YOFA 4OHXA 3Q5DA 4JKYA 4HB0A 4RKFA 5DISB 5LD2C 3O8CA 2JGNA 4DUGD 4YXWD 4FCTA 5IHPA 1U0HC 3D8BA 4WXPA 2XZOA 1VHLA 1RFLA 4MDFA 4HLDA 2C2HA 4UQOA 3F8TA 1JALA 1T5LA 2JCSA 4JLMA 3QVVA 3ZQJA 4EPWA 2EYQA 4JSYA 5DI9A 5KTYA 2FEOA 5A0FA 5GADl 1Y63A 4QFMA 3AF2A 2PL3A 1QVAA 3QXSA 5FTLA 2A5GA 4PAMA 4HAYA 5FH9A 1GOTA 4GP7A 2QPOA 4DDTA 4KI0A 4D26A 3CRMA 3MD0A 3LWNA 4PC1A 2OCBA 3Q72A 4JLAA 3SHFA 4PAQA 2JDIA 2VPPA 5AJWA 1XEXB 1T9HA 4LJAA 6Q21A 3T34A 4ON9A 2D7DA 3UKDA 3PVSA 2HT6A 3RS5A 5A5GA 1UJ2A 1IN8A 2ERYA 1Q57A 4HUQB 4HB4A 1FQJA 3RRMA 4BZXA 2O8CA 1LVGA 2PX3A 1W4BA 2PCLA 1KJYA 1G6HA 3H4MA 1T3HA 2P6UA 5L3QB 3MG9A 2PEYA 1W1WA 4I1UA 4PC7A 1JEEA 1MRSA 2D2FA 3A4LA 4GDFA 1KKLA 2VP0A 4IEIA 1XEFA 2CL7X 2O8FA 3T1TA 4C4PA 1SKYB 1JR3D 4YMTA 2REBA 2RGEA 2Z83A 3AH8A 1IOZA 1E99A 3UK6A 4F4JA 1AZSC 3ADDA 3KJHA 2JLYA 5HE9A 1G3UA 4RFVA 3GJ4A 2WPDA 4HDQB 3KUCA 2BBSA 4H9GA 4EKDA 4FINA 4UNSA 1DBSA 3R8FA 1ELOA 2ZRNA 1IAQA 1KMHA 4XWAA 3WRXC 2JLWA 4RY2A 4F92B 1CJMA 1PUJA 4D6PA 4LSGA 4F7WA 1P5ZB 2J9RA 4JLVA 1UEIA 1EFCA 1FP7A 2BEKA 2OEPA 3CO5A 5BW8A 2W2XA 1JQJC 2IWRA 2D3WA 4OQMA 5CYOA 4EPXA 4HZIA 3CNNA 5A4JA 4ABYA 1OFTA 1DAEA 2NO7A 4MGZR 3KTAA 5KHOC 1US8B 4C3ZA 2O5VA 2OLJA 3RWMB 1ZNYA 4C0AC 2J7KA 2ZROA 4UXHA 1GRNA 5KOYA 3NTUA 4PC6A 4OJKA 1Z8FA 1Z0KA 2IYVA 4AKGA 3L0PA 2O0JA 5HZKA 3P27A 1AS2A 4D2IA 4B2PA 5B64A 3I5XA 2J1LA 1NL3A 4MGKR 2FZ4A 1E94E 3ZJYA 1ZU4A 3T1VA 2QG6A 3CX8A 4Q9IA 2HYIC 3D6TB 4Q7JB 5EP4A 3IQXA 4JT2A 4EQ6B 3JZAA 3TE6A 1JNYA 1XFAA 2DFNA 2WAYA 4JVSB 4NCHA 3FMPB 4BFSA 2H7VA 1E69A 2WJVA 4D82A 3ZD7A 3TIFA 4BRUA 3NH9A 2QP9X 1W36D 1KAGA 3B82A 4ESVA 1O3YA 2QBYA 3ECCA 2P65A 3DHWC 5J4HA 5F2EA 4A0FA 2A2ZA 4UXJA 2DR3A 2Z6VA 1JAIA 1TEXA 3B85A 3DOFA 4BZPA 4DLVA 1M7HA 2UKDA 1KI2A 3FE2A 2ZSDA 4OHZA 1S0UA 4TT3A 1JI0A 4EJSC 3A1SA 5EUMA 4P4UA 2B7BA 5K8LA 4M9QA 2P2LA 3DMNA 1ZUNB 4TYNA 1O87A 1EFUA 1J7KA 4PX9A 2CJWA 3H84A 4PSKA 5JSZB 4MKGA 3THXA 1NMXA 2CVHA 5TY0A 1TMKA 3REFA 1KDOA 2HLDA 2QMUA 3MJRA 1GITA 2Q9AA 5GJWC 1F6BA 4BRWA 1HA3A 5FTJA 3FTQA 3X1ZA 4M22A 2W2TA 3TH5A 1U8YA 3FPAA 1IY2A 1F2UB 1XZQA 2FPKA 3WMFA 4HDOB 3N70A 2YHSA 4NBSA 1G16A 3CPJB 3HWSA 2ATXA 3HR7A 2JJ8A 2C96A 1WXQA 2PCJA 2PT5A 3F3YA 2WWYA 1W7AA 5TXGA 5F9FA 3O8BA 4C30A 4EQ6A 1RRPA 1A82A 2DFLA 2E9SA 1TF7A 1XP8A 4MRRA 4XSGA 3OAAD 4ZDKA 1PZNA 1TQ6A 2OG2A 2VLIA 3IILA 5FUXA 1L8QA 2WBLC 3AVXA 1T5IA 2ZANA 4EUNA 5BN3A 2A5FA 3KXIA 3MUFA 3PEWA 1Q3TA 4G5SA 3MCAA 4NCKA 4ZDIA 5FPKA 4KJZA 5GJBA 4NYMR 1XU4A 1TU4A 1N6IA 5HKKD 1U9IA 2AXNA 4PAOA 1GSIA 1G291 2AL7A 1IY0A 2JATA 4DCTA 4MKFA 3TVDA 1KK2A 3WYFA 1BO6A 3T35A 1Z28A 4PFSA 1A7JA 1NG1A 1FQKA 2BWJA 3O8RA 2QUZA 2BOVA 1SHZA 4HZUA 1NI3A 3HU2A 4DKXA 1E98A 1GNPA 3NC0C 4A6XA 2ZAOA 1HH4A 3EPJA 3AP2A 1ZC4A 1NBME 2V6IA 1YQTA 3QUSA 4CVNA 1IXSB 3RHFA 2D4HA 3GLFE 3I5YA 2ZPTX 2OBNA 4TMVA 4GOXA 3PUZA 3AP3A 4BLTA 3QIAA 2C03A 3SDZA 3CRQA 3DL0A 3THOA 5AUNB 1E9FA 5FR2A 3DM5A 4XOIA 1ESMA 5DGXA 1G5TA 2QQEA 2J41A 3I4LA 5DYGA 4BEBA 5JBQA 1HY3A 1OW3B 4Q9HA 2VEDA 1CR1A 3SC3A 1KY2A 3M6AA 3VAAA 2IYQA 3B5JA 1E2EA 2B8TA 4V0ME 1DS6A 4TMTA 2VQSA 1E0SA 4Q1FA 5EE1A 1OXUA 3KQLA 2WPDD 2BCGY 1JECA 1QHGA 2J3EA 1U8ZA 4MYHA 3QY0A 3QENA 3GJ5A 4E07A 2ZS9A 2JLXA 2VBCA 3FGNA 3SOPA 3OEEA 2XAUA 3IGFA 3E2IA 4V0KA 2Z4SA 1Z08A 5TARA 4Q9LA 4LC0A 3GJ6A 1OHHA 5FBLB 5EJEA 2AK2A 2LCFA 1NIPA 1A1VA 2ZE5A 1N3BA 1KI8A 2G6BA 2GWHA 2QNRA 2MSEB 2MSCB 1M7BA 2PJZA 2WKPA 3LY5A 4A8JA 1KOFA 1JJ7A 1KK0A 4I81A 1HUQA 4FN5A 4MKHA 5FOUA 2H17A 4B3GA 4QOSA 4JLNA 2NIPA 2CL6X 5F98A 2I3BA 2VO1A 2IHYA 2GDJA 1GNRA 2IS1A 1QHSA 1XCGB 2NZ8A 3O8DA 2GJAA 3GLIB 1CULC 3PR1A 4NE2A 3LBHA 3NEYA 5HPYB 2DYKA 2GXAA 2V9PA 5E95A 2C9YA 2QGZA 4AY2A 2FH5B 4Q1CA 2QAGC 5JCZA 4LBVA 4PC2A 1GRQA 4DXAA 2IYYA 4U7DA 1AM4D 2W2VA 3H1TA 4XIGS 4US2R 1XTRA 4URWR 3NDPA 3NEJA 4Q66C 2R6GA 4CF7A 3X1DA 1SVSA 2CVFA 4KO8A 2HJVA 3ZVMA 4UNRA 1FMJA 4ZPXA 1N0WA 3JVVA 4XWOA 2JJ2D 3CKLA 1QHXA 5DYIA 2OFOA 4HLUC 4G1UC 4ZDJA 2IYZA 3L8YA 3SU8A 1KI6B 4RCZA 4AG5A 1DO0A 3GFOA 4TT3D 3R9WA 2JLUA 3LAWA 2OZEA 1KSFX 3EARA 3FHTA 1H8ED 3B7GA 1W4RA 1YHNA 2ZYTX 4GPTA 1NMYA 4PO1A 4FW9A 1ZAKA 4TL8A 3R7WB 5FL3A 4IVPA 4DLZA 1A4RA 4TQ9A 2CNWD 1VKJA 5DE3A 2WKQA 3VKHA 2WVJA 1N5JA 1L2TA 3RS7A 5DSZA 1P6XA 3GJ7A 3Q7PA 1PUIA 1QHYA 1Q20A 2KB0A 3PV0A 3T12A 4HZUB 3QSYA 4KAXA 3QKSA 3RC3A 4V0LA 1NY5A 5JRJA 4RD1A 1SXJD 2KE5A 2ZJAA 4G0NA 2BKEA 1S96A 1E1QD 3C5HA 3OE7D 1W49A 1VG0B 3V00A 4QNRA 3X1XA 2C77A 3QPUA 3GPLA 1D2MA 4KITB 4BFVA 1GRRA 1GVNB 4H1UA 4JT4A 4RD3A 2JASA 3THWA 4CT4B 3KQNA 2QBYB 2CK3A 1MO5A 1XX6A 2CHGA 3B60A 4HDCA 4PPGA 5FI1B 3ZVNA 5HZHA 2BMDA 1XPOA 2GK6A 3RS3A 2PZEA 2GBLA 2IYLD 1EFRD 5FBWB 5K8IA 1H65A 1E9CA 2RKOA 2V6JA 1IJFA 1ZW6A 1P72A 4BLOA 1WF3A 1UADA 4A15A 1QG2A 3N5CA 4Q7LA 1VCIA 4IXNA 1R0YA 2KI5A 1N5IA 4DCVA 4DDUA 3VKGA 1IHUA 1AGPA 3FHCB 2WJIA 3NHAA 2QROA 4ZV4A 3AVYA 4DB2A 1G21E 1KO1A 1HYQA 4CGZA 1TU3A 1BIFA 3S1AB 2SHKA 2F1IA 3AF3A 4OI4A 5KSOA 3I61A 5CIWA 3LNCA 4F4IA 2C98A 3K09A 2PZGA 4C9BA 5FOXA 1NF3A 1SXJE 2GEVA 5UKDA 4BZQA 3KQKA 3GCGA 4DCUA 4XTRA 1E2IA 3TAHA 1VYVA 2AX4A 3EC2A 1M7GA 1TUIA 1P75A 4G5RA 3B13B 5EE9A 4EPVA 3TQCA 2GJSA 1VG8A 2PJRA 5C4GB 1ZCAA 3RYTC 1UBEA 1S9DA 2YV5A 3BXZA 2A5YB 2ZRPA 1E9SA 3E5HA 1E2KA 3VR5A 4JYCA 1H8EA 2FOLA 1S3SA 2R9VA 1VDZA 4NYMQ 4DEXA 3ASYA 2WSMA 1KK1A 1RE0A 4GMDA 3RS4A 3WBJA 4AG6A 3U7FB 2VTKA 3MJHA 3D7MA 4LGMA 1VCOA 1KSHA 3W90A 5C2JB 3RLFA 4TMZA 4GZLA 5F3WB 3U44A 4IDOA 5CDFA 1Q1QA 2O8FB 3FFBA 1T4GA 1YZKA 3EZ6A 5KDOA 3PUXA 3LA6A 3PUWA 2DFKB 1DPFA 1U2RA 1DAFA 4G5OA 1ZCBA 3BK7A 3N2EA 4QKQA 3BD9A 2FGJA 1LTQA 3U7EB 2AK3A 3EIEA 1DAIA 2FWRA 1QBKC 2D7CA 2KSQA 2V4ZA 2YWEA 3AGPA 4R71A 4B71A 2IS4A 1XTIA 2BBOA 1MV5A 2DHRA 4JBYA 2JLVA 2WMOB 3MFYA 1DAMA 4ZKEA 1Z6GA 2GJ8A 1XMIA 2FSGA 2YWGA 1GDDA 3OZXA 1UBGA 5FUYA 1N0UA 4NCIA 4WOPA 4B3XA 2EU8A 3UMFA 1Z0JA 2FFHA 4JJZA 1FX0B 4LPKA 4O2LA 4YMWA 1HQCA 2B21A 3ZS9A 5EXTA 4B73A 1KNXA 3I8SA 4V02A 1X1SA 2ZRIA 4M9ZA 2FG5A 4KSCA 4UJ3A 3QOFA 5C46F 2UZ3A 2V1UA 3L82B 2OV2A 4Q4HA 4B6FA 3A4NA 1KJZA 2QGNA 4TWZA 2V7QA 2LKDA 4LBYA 2WJHA 3K0CA 4JL8A 4TSFA 1VMAA 3U6KA 2ZSAA 3SZRA 3Q85A 4FMDB 1NVVQ 4N3NA 2BV3A 2DBYA 2FX3A 3NIBA 2HCJB 4EIWA 4M0LA 4TSFD 1W46A 3LVRE 5K8TA 1EGAA 1IONA 2E87A 3TR0A 1PLKA 4WIAA 5M04A 2ZS7A 3R20A 4NZYA 3ZDQA 2OM2A 4XD7A 5EXSA 3CIOA 5CLLA 3W9YA 2HUPA 5EUQB 1HTWA 5J4VA 2AR7A 4IRUB 2WZQA 1ZUIA 4M1WA 3C41J 4PQFA 3RSOA 1UBCA 1YRAA 1QHHA 3THYB 4IFBA 4L5BA 1VPLA 3BE4A 2W0MA 5CITA 4ITRC 1XTKA 4LRWA 2BCJQ 5BYJA 3UG6A 3W3AA 1P61B 2YZ2A 2HEIA 2O8DA 3C14C 4LPSA 2ZUCA 4URYR 2QAGB 2A9KA 1ZC3A 3KKOA 3QBTA 4HI0E 1NVUQ 4QRHA 3J81k 5LB2A 4FCVA 1BYIA 1UFQA 4GMXA 1NBMA 5C18A 3BS4A 1Z0DA 4HAXA 1KMQA 2IYWA 3GEIA 3K0FA 4DDWA 3X1WA 2VP9A 3IHWA 4UNNA 3BWDD 2IEZA 2ZVPX 3BAFA 3THWB 4FMCB 3I92A 3BFXA 3VHLB 3ZVLA 1VCMA 2W6ID 2V1XA 5G3ZA 1UBFA 5EZ6B 1WA5A 2ZRJA 2O8DB 4F91B 3SYLA 2JEOA 5KDLA 4C2TA 1MRNA 3FFAA 1E4YA 2R6DA 1MO3A 1SKQA 2CJWB 1BKDR 3E70C 5TMPA 1K5GA 1ZJ6A 1X86B 1F2UA 1DADA 4HSEA 2PEZA 1R10A 1OXTA 1GFIA 4P33A 1TQDA 2O0HA 3QXXA 2ZUBA 1NN5A 2RGNA 4ACBA 3TAUA 3CX6A 5CLQA 1BMFA 4OQFA 4D81A 3EA5A 1IXZA 3P4XA 4BFUA 1T8UA 4NKRA 5AJXA 2IS6A 1ZD8A 3S1AA 2NO6A 2X77A 3VR6A 4O3MA 1ZD9A 1Q22A 2PBRA 2GVZC 3RWOA 3F5FA 4P4TA 2FV8A 2NTYC 3AKYA 3KQHA 2V7QD 3QI2A 4RZXA 5JS8A 1RYFA 2O0KA 2VF8A 4RFSA 2GJ9A 3VR3A 1YZLA 4TL6A 1IN7A 1DG3A 3FKSA 3WP1B 4JYBA 4AYTA 1P7CA 1DAHA 3HU1A 4Y0AA 2WSSD 1C9KA 1XJQA 4OI0A 2QRNA 1M34E 2DWQA 4JBXA 3ZH9B 1H8HA 3OFNA 3MWJA 1FX0A 1DAKA 1E79D 1P62B 3PITA 2QRZA 5E7IA 3SJBA 5JEDA 3KX2A 1OV4A 1JPJA 5J47A 3W6OA 4US1R 2DWPA 2QN6A 1TADA 4U5XA 1UAAA 1ZVQA 4CZ2A 1TL7C 4A6PA 4C2UA 3C5CA 3SNHA 4A2PA 1PJRA 3LFUA 4KFTA 1ZIOA 4M1TA 4BLPA 1ODFA 4GSYA 4NPHA 3LD9A 4ACAA 4JL6A 1NSTA 3RS0A 2HCBA 1G6OA 1XMVA 2G3YA 3TSOA 2OHFA 4DDVA 2P6NA 1Z6TA 1G5RA 2C95A 2IF0A 2V55B 2VH5R 3H0KA 3WYGA 1E4VA 1DAGA 4GRAA 3AUXA 3SQWA 2IYSA 2BDTA 3H2YA 3FWYA 1KGDA 3ZZUA 5JWHA 4UNQA 3LH5A 1IXRC 3SEAA 2BJWA 4TLEA 4HAUA 4JL5A 2A3RA 2Q3MA 2GVDC 4EJSA 1XD8A 1G3QA 4QGGA 2VL7A 1IN6A 3AVVA 5G41A 4IXMA 5DI3B 4AC9A 4EJSB 1XXHA 3LXRA 5H68A 4DSUA 3IIMA 3OHMA 4KCGA 3FMOB 1DG1G 2ASEA 2ZRMA 5FI0B 1R2QA 3QKRA 3BORA 3MMPA 4Q4JB 4TN1A 4D4LA 2G83A 2PMKA 4W5JA 4B3DA 3DEFA 1CRPA 3OIVA 4NCJA 5E3HA 1L4UA 3EXAA 4TLBA 1Z0FA 1SULA 3NVAA 4I1VA 3WRYC 3U4QB 2GILA 1E2GA 1Q3HA 1VECA 4CT5A 3KXLA 4OKSA 2F9LA 4GT1A 1G7TA 3VR1A 2AHOA 2O8CB 2ANBA 4ILEA 5B2ZA 4MRVA 3U6BA 2J0UB 2CCGA 2QE7A 1N6PA 3UATA 2ZYUX 1COWA 1N6KA 3OIWA 4HB3A 1NG9A 3ZIAA 2A78A 2F55A 1X8KA 2C99A 2Y8EA 3OAAA 3HR8A 1FZQA 1RRGA 4DLXA 3QVUA 4YMVA 1OSNA 2NGRA 4PTLA 1UDXA 2JAQA 4LJ8A 1J2JA 3L2OB 4URVR 1TEVA 3EC1A 3JVUA 3BERA 2GRJA 1P4SA 2N1BA 2P6RA 4C7OB 4MUBA 4MYCA 1MOZA 2PX0A 2QI9C 2H5EA 5JHHB 5JJIA 2WWFA 3B9QA 1RPZA 2ERXA 1XD9A 4OHVA 4RFSB 1W0JD 1MR3F 5AJZA 1FNNA 4IOMA 2X2FA 1RJ9A 4LHWA 3MWKA 2ZE6A 4IFEA 5J4YA 4TTPA 1MO6A 3UG7A 5L3RA 1OIWA 3MRSA 1KKMA 4E22A 4QG7A 4ARZB 4D0LB 2O8BB 3P32A 2ZS8A 4NTZA 3CZQA 3B1WA 3PCRB 4JIMA 5FOSA 5G3YA 2ZAMA 3UWOA 3PXGA 4QJ3A 3QKUA 1KSGA 4M2LA 5KDDA 4PC3A 3ZYCA 2A5JA 4MYTA 2NPFA 4FMCF 2ZRGA 1NJGA 2O52A 4TYQA 1AS3A 3T5GA 3ZVRA 1Q1ZA 3REGA 3DZDA 1RRFA 2VYFA 1EWQA 2WICA 1JXMA 2FFAA 4GBMA 4URUR 2BM0A 1HT2E 1UKVY 1GL9B 2GJKA 1EFTA 3B2EA 3SJAA 3AEZA 4C0JA 3QXJA 2J45A 4QBGB 5KNCA 2NG1A 3G82C 2EFEB 3CF6R 2R6AA 4OHYA 1GP2A 4QBHA 3K9HA 2CEAA 3EASA 4I1OA 4CEIA 2FF7A 2YYZA 1G18A 3OEED 2RGNC 2VHTA 4B3CA 2A5DA 1LF5A 4QM7A 3LRPA 4R2HA 4CEHB 2G1JA 2XXAA 3IPXA 3B1YA 1ZBDA 3K53A 4PPQA 2XNSA 2F3RA 4B3BA 2XNDD 1E1QA 3OE7A 4P32A 2J0SA 3KXKA 5FFMA 1P2SA 3MAAC 1I4TD 4XD7D 1KI9A 5CM9C 4ARZA 3DKPA 5EP3A 4G01B 3C4JA 5IK2D 2H57A 3TVTA 3W5JA 2C9OA 2YVUA 4CEJB 4MYUA 1KI3A 1R5NA 3WYAA 2F43A 2IS2A 1Q0UA 4LHZA 5HCNA 4WW0A 1GUAA 2WIBA 3EW9A 1G8PA 3AF4A 5B57C 5C4MA 2Z5FA 4A8JC 2IHBA 3W5IA 4A0HA 3ZLJA 3TR5A 2C78A 1OIVA 2PT7A 3A1UA 4M4SA 4KVAA 1HE8B 2PLRA 3TGPA 4TLCA 2XOKA 721PA 2QU8A 3GFTA 3QKTA 2XTNA 2GTPA 2OO7A 1SKYE 1JQLB 2NO9A 4LBZA 4BFXA 5FBQB 1J8MF 2HF9A 2BKUA 1Z6YA 5DN6A 2FDCA 2WMNB 4PSAA 4A82A 1XCPA 4DIEA 3ICQB 1DE0A 1XTJA 1CEEA 1XDBA 5KU1A 4X8HA 4AD8A 1FUUA 4BEJA 2GXQA 4Q47A 4Q21A 1G19A 2D62A 1KO5A 4M21A 4K46A 2OAP1 3Q5EA 1SVMA 4TQUS 5ANRB 4EPRA 2WWWA 2GF9A 2OSBA 2IF2A 5HTKA 1L7VC 2AN9A 5KSZA 4LYFA 2ZI9A 3KKQA 3WMEA 1BS1A 2QY9A 2J0QA 1Z2AA 5HCIA 1R5OA 4HLCA 1CBUA 2GZHA 4P4SB 3W6NA 1MABB 3K0CC 1Z0IA 2FEMA 1JR6A 4US0R 4AI6A 4DCNA 1CF4A 4TLAA 4QM6A 1Z83A 1KI7A 2O8BA 3SI7A 1G4UR 4O2RA 2F43B 2ECKA 1Q21A 2YJTD 3IDQA 1IN4A 4PHFA 1XMJA 4OBEA 2H1LA 1CIPA 221PA 2GESA 3BB3A 3WNDA 2DY1A 2ZR9A 1MT0A 2WJYA 3NBZC 4MUAA 3ZS8A 4AIIA 2HV8A 2A30A 1N5KA 5LB4A 1TUEA 4GP6A 5IF9A 4B47A 4F93B 2WM9B 2VF7A 1ZM7A 4P4SA 4Q03A 2VSOA 4BFWA 4JLOA 4W7SA 1HEIA 4O0MA 5DLQC 4OQLA 4L16A 2QL6A 3DKVA 3B8HA 2OBLA 2N42A 4Q00A 4L9WA 2FSIA 2WWGA 1XEXA 2GHIA 1HE1C 1SVKA 4IHQA 2CE2X 1KO7A 4WVFA 5FL7D 3A37A 1OPXA 3QPVA 1UEJA 1VIYA 1W44A 3RC8A 2ZSFA 1D9ZA 3GLHE 3P20A 3GLGE 4S35A 1ZU5A 2QSYA 3CLVA 2BMFA 4MRNA 4JKIA 1IQPA 2PLFA 1GTVA 2Z4RA 1I4LD 3QBVA 3CONA 3AKCA 3HPRA 4NL4H 4MA4A 3RRZA 2GCOB 2YKGA 1IBRA 1N6LA 1GAJA 4JSTA 1K6MA 1ZD1A 5EQTA 3VFDA 1VIAA 1AKEA 2GKSA 3T5DA 4DIDA 4DLUA 5SZHB 4QHYA 1P73A 1E1RA 1OXSC 4Q1EA 3GLHA 1NIJA 2AD1A 1RKBA 5EE5B 3ADCA 1P3JA 3RANA 1TQ4A 2ONJA 4DJTA 3TW4A 3W6PA 4DBLC 4NP6A 1FTNA 1NN1A 3I3SR 2GAAA 4KYUA 3T1OA 2VP2A 4P3YA 3I73A 5KNDA 1II8B 1FFHA 3SFVA 4IDHA 4C0LA 2TMKA 4B74A 3G0HA 1E9RA 1T0HB 3QG1A 1SVOA 2XSZA 3OEHD 2R8RA 4LI0A 3I8XA 1AN0A 4KHZA 4M1SA 1HQYE 5DHFA 1SGWA 3DM9B 3TQFA 1UF9A 2GK7A 4JZKA 1CP2A 4LYAA 1KZGB 1RRCA 2C8VA 1SZPA 2FFBA 3M1IA 1SQ5A 4FXPA 4JVLA 4AURA 4DHEA 4MQBA 3KB1A 4V03A 4LX0A 1XBTA 2QTVB 2XNDA 4LYHA 4POAA 3GP8A 4B33A 4DRZA 4QBFA 3WMGA 3G5UA 1FTSA 4Y0VA 2J87A 3KJIA 3R7WA 3K1JA 1YVDA 5FPHA 1E2PA 3A58B 1CR4A 2G0TA 2ZJBA 2BM1A 2GAOA 3CX7A 5E4FA 1S1MA 2DWOA 5SZIA 4K8OA 4LC1A 2W6JA 1TTTA 5TB5A 1R8SA 3AV0B 3KKNA 2J59A 1EFHA 1R7RA 1UM8A 3IO5A 4ZCIA 1E2FA 2ZI3A 4IVRA 1R0ZA 3PG5A 2ONKA 1XF9A 1ZNZA 4II7A 1FMLA 4A4DA 4Q4AB 3U3RA 3SR0A 1AK2A 3QKRB 4G5QA 2QP4A 1W36C 4LK2A 1R0WA 2XOKD 3LDAA 2IWHA 5AR1A 3P1JA 5J4KA 1A5TA 1OYWA 1SVLA 2AFHE 3L0SA 4TMWA 4WZBE 3TLXA 1TX4B 3SQXA 4RD2A 4PHGA 3Q7QA 4LJ7A 4RVCA 4R9UC 3IPYA 2H92A 4ASUA 4B48A 1HV8A 1WB9A 3I62A 5JJLA 2V3CC 3X2SA 3LLUA 3RVBA 4OQNA 4FWTA 3K0FB 1VYTA 5GVSA 4FIDA 1NBMD 1QG4A 2JA1A 4ZO4A 1NNEA 3IQWA 4LV6A 1KMHB 1IN5A 1NVVR 1OXVA 2HF8A 3PUVA 2RB4A 2YWHA 1VG1A 3AB3A 1T3LA 4PPNA 1II9A 3CBQA 5TDHA 4DLRA 2RGDA 1N6NA 1Z2CA 1OT3A 2FJUA 4Q9KA 1KAOA 5FBVB 1R5BA 4YMSA 4TYWA 2ZQ5A 2CLCX 1NP6A 2RGGA 3HYRA 1JXOA 5B30A 3GLIE 5CK5A 3H86A 3NBXX 4B6EA 4ZI2A 1IY1A 4C0KA 4Z8YA 3QE0A 4AKIA 1US8A 2CMKA 3K9GA 4Q18A 1X1RA 4XH9B 3U3OA 3U61B 1ZUHA 1ZNWA 1RIFA 1N5LA 4D4MA 1E0KA 2CK3D 2GZAA 4IW3B 3CWQA 2C04A 3SJZA 2J46A 3EZ7A 4W5HA 1CR0A 2AKYA 3QKSB 4DZZA 1B23P 3HDTA 4GL2A 2QEQA 3QEOA 1II8A 2L0XA 2ZE8A 3SYNA 3VKWA 1E9DA 3ADBA 1OH8A 1N6HA 2J7PA 2VP4A 2WJJA 3DVLA 4RJLA 3VHXA 1AJEA 1FOEB 5KPDA 1TF5A 5E7MA 4IOJA 3GEEA 4MITA 1TQ2A 4OHWA 1F48A 3JZMA 3OF5A 3EZFA 4LJ6A 1X3SA 5DI3A 2ZR0A 1MH1A 2OCAA 4A36A 4RZ2A 1MABA 4MRPA 4R7ZA 1Z47A 2O8EB 3BH0A 2P0EA 2D06A 1XPRA 4WA7A 3IO3A 1QHNA 4DEYA 1ESNA 5CJ2A 2ANCA 1Z5ZA 3TUIC 1G1MA 2LKCA 4JLBA 4Q48A 3BBPA 4OL0A 3QQ5A 5H8WA 3I72A 2MSDB 5CYPA 3BB1A 1OJLA 3LLMA 3AM1A 2ZJYA 5JLJA 4C0SA 2ZJOA 4GOJA 3ICEA 3LXXA 2BEJA 2YOHA 4QGAA 3P26A 5JEEA 1S2MA 1L4YA 4CRWB 4YQFA 4E03A 1VCNA 4LV5B 3SN6A 1KO8A 2ZJ8A 4XWKA 121PA 2FE4A 2HXSA 3RAPR 1NVWQ 4TQAA 4GOKA 5K8UA 1D6JA 2W0SA 3VMFA 2W83A 4S2EA 1NKTA 4HLUA 1CRQA 3BFKA 2W00A 4E5UA 2IXFA 2QP3A 3PIRA 3C16C 2FU5C 4NU0A 3W3ZB 2GA8A 2ZRFA 3ZGXA 1TF2A 5FTKA 2PH1A 1M1YE 1RVDA 2ZU6A 3IBYA 1YZQA 3AGQA 3CF0A 3V4RA 1DTSA 3CR8A 4W9MC 3CPEA 3L0OA 2FPMA 2XJ9A 3R9IA 4YDSA 4NCNA 4PQRA 4QJ5A 1EX7A 3LVQE 3K9LA 2C5LA 2REXB 2FMXA 4D80A 4Q4LA 1TAGA 4QHSA 4AKHA 2BMJA 4EAQA 1XEWX 2QQ0A 4LWZA 1F2TA 4D0NA 1XWIA 1P2VA 3QEJA 1ZM2A 3LQRA 3UXMA 2ZR7A 2ZRLA 4TZ6A 5J4LA 8OHMA 1E96A 4KLZA 2G9NA 1FNMA 2ORWA 2F1RA 1WBBA 4NYIQ 3B1VA 1G7SA 2H16A 4Q4AA 2VHJA 3KKPA 4N1AA 1G7CA 1S9HA 3TSZA 3CR7A 2J7PD 4D25A 2ZE7A 4Q19A 3B6EA 3BH7A 2C9CA 2ZRDA 3RNLA 2B7CA 2X8AA 3EIHA 3HPQA 4WBSA 1BOFA 1XXHB 1OH5A 2DCUA 3RRYA 5CB8A 2JIZA 3T1QA 1KYIA 1FPMA 3C7KA 1N6OA 2WV9A 2ZI5A 2IK8A 1XMSA 4Z8XA 4Q02A 5EXPA 1YR6A 1N0VC
chains in the Genus database with same CATH superfamily
2M98A 4UM8B 4K6KA 3NBUA 2VNSA 3KE9A 2VF2A 3SSAA 2PUCA 1T36A 3PU6A 2ZI7A 4MJ7A 4LJKA 2EHDA 4YV1A 3OVMA 2IVZA 2QN7A 1PUXA 2WVGA 3HB9A 1YU9A 4IOKA 1M0WA 3HEBA 3AM3A 3K70C 4WN9A 2IZ1A 1QANA 4X6XA 1WM1A 3RJZA 1XRNA 4GX1A 1C3OB 1CLUA 1F8UA 1IWPB 3E22B 4FGZA 4L9SA 2YFKA 5JZSA 5KOHB 2IXEA 4LQCA 1D5CA 3LYHA 4CMAA 3HLTA 2VT2A 4OI2A 1T91A 5B58C 3N74A 3ZX4A 5G4LA 1ADJA 4UTOA 1HEYA 1XPUA 3L41A 1AUXA 4HMPA 1FDUA 2QZJA 1O77A 5JXJA 1W1UA 1W0KD 2J8ZA 2XOEA 3K0EA 3GDOA 4WD3A 1A8UA 4MR7A 3Q4GA 1H3NA 1P44A 2BGRA 1KL7A 1XRMA 1N2JA 3I0ZA 4G5FA 3ZHYA 1G6Q1 1U94A 2P1DA 3EXFA 3HUFA 4QOEA 3AR8A 3KSUA 4BO4A 2X2EA 5KOHA 2P4QA 2IC5A 1ZR2A 2FPLA 3CZMA 2RH5A 3KQTA 5IBPA 1BDIA 3IT0A 1DJOA 3EF1A 3T7SA 3JWGA 4MV7A 4IZIA 4DLTA 2OILA 1ENYA 1QS0B 1MF7A 2NXNA 1OHHD 4L5IA 2QQFA 1NDHA 5B7GA 2CMHA 3T0GA 3PHJA 1SHLA 3PI6A 3DEHA 3X1YA 4C4OA 1PZFA 3C98A 1KH2A 3DBRA 4FMDF 2QR5A 1C8VB 1P7VA 3G88A 3AY6A 4KLNA 5KAMA 4HNAA 3R7NA 3SM9A 1WUIS 1X6VA 2QIOA 3JYQA 4OLHA 4YFYA 1ATZA 1DI0A 4V3CA 3ONVA 5EOVA 1BHJA 2QV7A 5D3QA 3JRWA 3R9KA 4UAUA 3U49A 4BLQA 4TTAA 2IS1A 3SXUB 3SC6A 2ODEA 3DS8A 2CLFB 1KIFA 5BSEA 3MLAA 5KVSA 4LMBA 3U4QA 1QONA 4H0CA 3TM5A 1D1TA 2GXSA 2Q2OA 3E53A 3HRKA 3I64A 4HWRA 4JLPA 4L4UA 2Q2NA 3PNMA 3WNCA 5IZ4A 1MD9A 4ESOA 4Q7MB 5EPUA 4YMHA 2RD2A 1SZJG 1WVMA 2H3HA 3UJ3X 4WERA 2AOXA 3IMEA 2ZI4A 4E5SA 1JG4A 4DQKA 1DAOA 4Q3KA 4TTQA 5DTJA 3I23A 2GX6A 2SCUB 3MINB 1ICEA 1RZ3A 1XAHA 2IE8A 2IU3A 4Q1DA 3UKOA 1D4FA 1YE5A 1E5DA 1DARA 4OHUA 1RTTA 3TRFA 5B58T 1OLOA 1N2GA 1XQ6A 1HYEA 2EWVA 3BJMA 5AHRA 1WV0A 1WETA 4JBGA 2G06A 4MVJD 1NJ1A 3TTUA 3EVTA 4JVOA 3UJAA 2B94A 4R8RA 2H00A 3WJ7A 2WOOA 4RHTA 2YJ3A 4G56A 2H4ZA 4D45A 4HVLA 4A9AA 4Y9RA 3ZCRA 1U0LA 2DUUA 3ZNNA 4Z53A 3AQ4A 1QK3A 3JQAD 3F73A 4MCJA 4Q9NA 3NXKA 3HDVA 3FUUA 1USUA 3ND9A 1I1OA 2OZPA 1T2DA 2ZTSA 3GWZA 2HLNA 2AFIE 4FYVA 5GGXA 2EX4A 1P9WA 3IDZA 3KM0A 5SV2A 5D5HA 4UE3S 1PO7A 3B36A 3MYYA 5LKAA 1QB8A 4UMEA 4CF3A 4ZIRA 5DWDA 3QX9A 1A3CA 1HFWA 1NRJB 4MI1A 3MS2A 3QLUA 1EXMA 5BOVA 4LOKA 3CJQA 1J0XO 2QRHA 1BGVA 1AGXA 1RM3A 1M2KA 5H1YA 2CEKA 3V34A 3B9PA 1Y8AA 5K3OA 1AV6A 3IEUA 3BTUA 3FB4A 1CS4C 4ZXPA 2WD9A 4PZZA 4RMGA 4HEA1 4NBTA 1SVIA 3GRPA 5ULLA 3OKAA 4YWJA 4YR9A 2CLKB 5CB6A 3D3EA 1XUOA 4RE5A 1DC6A 4BXOA 1Z34A 1E2MA 2VZ8A 1M2GA 3VU3A 1E3SA 3DMGA 1Y42X 1V39A 5EFZA 3RHTA 2R66A 3B48A 5FUVA 3ORHA 2JK0A 1MW8X 1RAEA 3NCHA 4HDMB 2FAXA 2V9CA 4EM6A 2WF6A 3IP6A 2PU7A 1AXRA 3QJYA 3I9NA 3L18A 4DV0B 2CHVA 4EFLA 3GVPA 5CXQA 1P0MA 5IAAA 3Q11A 2CLIB 4PR0A 3ONNA 3SMQA 2BEWB 2CLDX 4OLBA 1GAEO 4IXDA 2B1GA 4J03A 4MQLA 4PGAA 1ISHA 3TRKA 1VRVA 4E7PA 2CB0A 2DM6A 3D3KA 4ZGWA 5KOJB 3RI3A 2C84A 1Z7BA 4G36A 1FXWF 4XGRA 5T6MA 3ZEIA 2O8VA 1ZI9A 1F7UA 1NF8A 4HXFB 4JMPA 4KMOA 2VA8A 3IV6A 1RP1A 2HLHA 4KSBA 2GDZA 4ODIA 4NF2A 2WMDA 2HSJA 1SXQA 5FTNA 1DZIA 1EZ1A 2ON6A 3GLFA 2W6ZA 3TIXB 3N2KB 3FN4A 1WCV1 5CXUA 3SE0A 3STWA 4TMFA 4A2WA 1YIAA 1SG6A 4IJ5A 4N7RA 4WWHA 1CV2A 2OB2A 1PYOA 4YJ3F 2LDBA 4AN1A 4YO7A 1RBMA 1M0SA 4K6HA 5DP1A 2P27A 3CH4B 2R4UA 4NPAA 2R5NA 3SJCA 3FNBA 4B46A 5KO2A 4WCFA 2AKAB 1UPTA 1OYYA 1T5HX 2PGAA 4BLWA 1OFUX 3DVSX 4OB6A 1YR2A 4O4HA 2FFQA 3E8XA 4GPAA 2B0CA 4ZOLB 3CE6A 3DXYA 2QVCA 3VC2A 4LDAA 4ZJPA 4X5OA 4OQPA 4PPYA 5EWJA 1LC0A 2HZ7A 1ZN9A 4EGAA 5K20A 2N46A 3GLFB 3PC6A 1CUHA 3K70D 1N2CE 2JBHA 4R0NA 1LY1A 2IQIA 4M0DA 1SQ6A 1FSGA 3QLUC 2YH2A 1W5TA 1CZNA 3I32A 1FCJA 4P58A 1UCFA 1CU1A 3OE1A 3EVNA 4K9QA 4TVBA 2D2EA 1QPBA 1EUCA 1JTVA 2P3QA 3KZMA 4O1IA 4RZUA 2QF7A 5FWYB 4XOUA 3D7RA 4ZYWA 2VUTA 3OE5A 3BWCA 1G59A 3IMKA 3L06A 1GPH1 5FFNA 2VXYA 1YMUA 4QG3A 4MWEA 5P8WA 4H7PA 5KNCD 4U9HS 1LK0A 2POQX 1CXZA 1TZCA 4EKGA 3H8SA 2ZWIA 4M54A 2OY0A 4IJUA 5FWNA 2QTMA 1KDZA 4YREA 3RIGA 1HLGA 4EI8A 1NLMA 3UUFA 1G20E 4TOIA 2CVZA 2OENG 1KARA 2WDPA 1U1CA 4MTLA 4RJ2A 1SH7A 1ZIDA 4RNCA 5EZYB 1JPVA 1Q12A 1GA4A 3VU0A 5CCBA 1PQUA 2OAQ1 5JWOA 4V0MA 4G5GA 1CIJA 2I4IA 2QLJA 3G85A 5EE3A 1AZTA 3GBVA 3K0AB 4MWTA 1KZYC 2W5UA 2ZBPA 1RYDA 4ERNA 4JP3A 1R1DA 1X3LA 3QYAA 4KR3A 4C2AA 3E9ZA 5I6DA 2FZVA 2HIAA 1U99A 3O2QB 2JFWA 4OQXA 2ACKA 2Z2KA 4MH0R 5L53A 1DX6A 4AWAA 4J0JA 4BTEA 3EQ8A 3WLMA 1WRBA 2WIJA 5DM0A 4PLWA 5JNLA 2R62A 2EVWX 5MFPA 2BCEA 1VIDA 4BPBA 2QX8A 1Y9ZA 3O1IC 1S01A 3A8TA 3LQQA 1RWKA 2MINB 5H81A 2ZJ5A 4MAAA 1J8DA 5AI8A 2HA2A 3FDXA 2NZWA 5J1TB 4B2IA 3IE2A 3U48A 4BC1A 1IPHA 5EJ4A 1QX3A 1U6JA 1F1JA 3RAEC 4IF6A 1QHHB 3LWZA 3GRUA 3BSSA 3UHOA 3VNRA 3INTA 5CVTA 1BMFD 3A6FA 3PFIA 4WOKA 5IUKC 3NBYC 2CDCA 3FHJA 1P3DA 2NXCA 4S3MA 4B40A 5PNTA 1EE2A 1UBLS 4RL4A 1DLJA 1EEXB 2WE7A 3R6TA 3W8NA 2C0CA 2HI0A 3O0DA 1T2FA 2QL9A 2Z5LA 1YMVA 3HCCA 5DIZA 4DUYB 1WZ2A 4HQLA 4IHKA 3OTQA 1K7SN 1E9BA 4KBFA 3M6LA 3GDGA 3LBNA 5IH7A 2J0EA 3FFTA 4MHSA 3Q3CA 3VYSB 1XQVA 2QW0X 5JVDA 1ORWA 2RC5A 3AIIA 3D2AA 2G76A 3QVGB 1OFGA 4Y1RB 1OGIA 3QU4A 4P36A 3M83A 5IKOA 4F3CA 4KXFB 1JR3E 3BJIC 1YB2A 1XDGA 1NZJA 2SKDA 3R5SA 5LYJF 5ILOA 3NT4A 1DCTA 1ODCA 5C37A 4EY8A 4ZVRA 3KTDA 4O2BB 1QLJA 3PHHA 1Z0AA 3DBHB 3X1JA 4NOMA 4OJYA 2K5UA 2ODPA 4IIDA 1CQJA 2BHRA 3KJFA 2RI6A 4HGNA 4KYIB 4II3A 3L4KA 5IFLA 1RJWA 1CJKC 2IU4A 5ALNA 3ZI0A 1RW4A 2AMYA 3TWOA 3MLEA 4U7GA 4OGFA 2HK8A 1DRKA 3GA7A 4PSCA 5TVKA 4Z1MD 4D8WA 5DN6D 3U7JA 2JKVA 3I05A 2C61A 1Z73A 4YP5A 5HMLA 2WIAA 1TO6A 2ZJ6A 2D8AA 1YFLA 2V7UA 4HYYA 3CV3A 4XUGB 4BB6A 1H6AA 2W6QA 4C7VA 2D2VA 2AI1A 5JSHA 3TZ6A 4J0QA 3G7NA 3IH5A 2C9DA 2E82A 3M4XA 4Z51A 4DWOA 1G8HA 3O0TA 4DCSA 5HKAA 2OFWA 3D3QA 3IKJA 3DBHA 2VRCA 3BQ9A 4ETMA 2OZVA 2FGKA 2PLAA 4PXAA 1EFRA 5KYYB 1FNSA 4FYMA 4JLJA 4G3XA 2F00A 4ZT5A 1NNI1 3OCJA 4CYMA 1TNDA 5HYVA 1W5AA 1DDGA 1KPIA 4G8DA 1NTRA 1G3IA 4C07A 5J3JA 2QR2A 2G5PA 4LJ4A 1U3TA 2Q5LA 3BE5A 4ME6A 4TMYA 1I0IA 2Y6VA 2ZIVB 3MT7A 2Z8XA 3OE4A 5GM2A 4CLOB 4I5FA 5BQPA 4FYHA 3NYQA 3BXGA 5I9BA 4CIDA 5JDIC 1VYUA 4IP0A 4RZIA 4J2HA 2GBLC 1G5FA 1G4AE 1AUPA 2OFXA 1Z15A 2Y1LA 2HMSA 4MVJP 3TK1A 2QPTA 4GGOA 3AF1A 4ITUA 5TNXA 2YXDA 3B3QA 4OHFA 3LO5A 1DIBA 4ZOEA 2ERCA 2CV0A 4GUAA 2UYOA 1PR1A 1KTVA 1PWHA 4UCWA 4N0DA 3EXEB 3O47A 5T7BA 3BH6A 2Z2JA 3DTNA 1XELA 1VKZA 2YQZA 3FCSB 1HXHA 1OXMA 4N82A 2QOEA 2VWHA 5AMXA 2JFYA 5C34B 2NADA 3WSVA 5L7TA 2P5YA 2CF6A 2OZLA 2VPYA 3GLVA 3H83A 4TUYB 5FWXB 3KUUA 2VNJA 3RRNA 1O6CA 2IX9A 3H17A 4MUIA 2CXPA 2UXCB 1DTWA 5GONB 1C3XA 3UTDA 2A94A 3BG5A 4DQDA 4AO8A 4DUGA 6NULA 5A0VA 3R3XA 5K3SA 1BE8A 1I4OA 4FT4A 5FUWA 1QC5B 5FLEX 3DDZX 2R44A 3NOXA 4HAIA 4OBWA 1KI6A 5JFGA 2VHQA 4RVDA 3HB5X 2V5AA 4URZR 3UY4A 1CETA 4XPZA 3VNUA 3FOZA 2X5OA 5EKUA 5E6SA 1R74A 1DDIA 3ORQA 3OFND 1K6XA 1TIPA 3DWFA 3W5AA 1BC5A 4FDLA 1J99A 1NATA 4JNKA 5DF1A 1T5SA 5DCUA 3V6LA 1O97D 1NVGA 3L1JA 2JI7A 1V5IA 4IQ8A 3TUJC 1ZRHA 2ZBFA 3X2EA 5KVAA 4AS1A 3PFWO 4IDNA 3QMMA 3J81A 2QLLA 1RQNA 2WU3A 1LJLA 3DEYX 4OPMA 1KFCB 1C4OA 4L85A 3SBDA 5L3ZA 3TRHA 3WGJA 1OYOA 4DJFC 5JAHA 1CY2A 2I34A 2XRMA 2GAJA 3OX4A 4H6PA 3HU3A 1Q0TA 3DMHA 4EYKA 2E4VA 2R65A 3OCCA 5T8KA 3UTCA 1DWOA 4CU5A 2Q3FA 2GYUA 2C29D 4AF7A 1UIRA 1XKTA 4AX8A 2XITA 1IEWA 1HG0A 3FOBA 1M2VB 2HRCA 2NQ2C 1ORVA 1Z82A 2ZYWX 3O4IA 4DR3B 2XZDA 4JI4B 4HAZA 4V38A 3NMUF 1BVHA 4OGWA 2Q9CA 5DNWA 5J5VA 4F3YA 3TTYA 4BVKA 4DOMA 4EITA 1LXCA 2YYYA 4L0QA 4P7FA 3TQTA 3LCCA 3LM8A 5DLPA 3L02A 1V5FA 2P3SA 2ZAIA 3D6NB 3GBSA 3OC6A 2DLDA 3PDIB 4YONB 3EZLA 3H9QA 5B7NA 1ZP6A 3I1FA 3F2IA 2K2QB 2Q1XA 3OZAA 2C2MA 2CNNA 4AUMA 2YVKA 1WW2A 2ILTA 4GG1A 4JI1B 1U8CB 2CWWA 4RIHA 4A3SA 1GG2A 4BFCA 3OX2A 3RD5A 1B0ZA 2D0PB 4E08A 4MV1A 4OUKX 2X1HA 2WP0A 4A0RA 2WTUA 3MMNA 3N39C 3NBMA 2FN7A 3FPSA 2IUTA 2O1EA 2NUPB 4QIHA 1R4MA 1SC3A 1RJGA 2ZVDA 3Q7TA 4IUDS 4MICA 2EKZA 4YI5A 3T3NA 4OHPA 1RZRD 5ENDA 5FBKA 1F1BA 5B36A 4J9VA 5E7JA 4D9BA 1Y3HA 4TYPA 3UC9A 5L3VA 3SX4A 3IUJA 1WU8A 4MS4A 1TJ4A 2I3GA 2PPLA 3D54D 3VV3A 1KH3A 4GVXA 4JI2B 1XIVA 4MUYA 1G5IA 3AKEA 5ALJA 5F9MA 2Z2YA 2FPUA 4FNOA 5DGCA 3IBCA 4DLSA 2UYYA 1KYVA 3SFZA 5IUJC 4DHWA 1KDPA 3BHIA 5JCPA 4B3TB 5LP6C 3HXOA 1T3TA 2IFTA 3HYTA 3F7TA 1K8RA 5A3SA 3U37A 4LY9A 4KXXA 1KR2A 3EEQA 3PDUA 2QJWA 3ZWNA 2RK3A 5GVRA 3ONWA 5FBRB 2I1VB 3QA9A 2EZTA 5ARDA 5A3VA 2WHXA 2GPYA 4N4AA 5CB4F 3PXDA 5FUQA 1UBKS 3KQUA 3ROEA 5ER6A 4V0OA 4EVSA 2FTKE 3B6JA 3C0KA 2UV8A 3IQFA 1SCJA 2UZIR 3COSA 3IT2A 1L4EA 2W6JD 3JSAA 4IJVA 2ZCVA 4JEIA 4EGFA 5LBTA 2HDNB 3AUYA 3WK4A 3ZWXA 4U2CA 1NE2A 1UXOA 1X14A 2VTBB 1THTA 4H6WA 3ROXA 2NUTB 4UM9B 3RBXA 3UMVA 2QSZA 4EHBA 5M7EA 3TZEA 2UDPA 2XZTA 4UREA 3RC7A 4MKZA 1FW6A 1N9GA 3A1WA 1XJ5A 5FNZA 1OLXA 1Z07A 2QTFA 1DUSA 3LL4A 2QPLA 4H7KA 1F2TB 3PZBA 2IZ7A 4AICA 3DNFA 2ZK7A 3TIVA 5F76A 4E0BA 1BE1A 4MVJI 3I2HA 4RIGA 1P2FA 1K1EA 1DEKA 2RBEA 5JALA 1L5SA 4DV1B 2G40A 2XT6A 5TEWA 4FCWA 3NRBA 2PH5A 4NBWA 4ID3A 2B0JA 2DPXA 5AK0A 521PA 2VDOB 4B2YA 1GIAA 3N05A 2ZJ2A 1QZXA 4RZHA 1V8FA 4OYHA 2GN2A 4DMKA 4NCAA 4B76A 3L8GA 4X45A 2LTAA 1O03A 4DG8A 3LQKA 4FB5A 1EQUA 4LCBA 3WMWA 3CNBA 4IV0A 3ICWA 4ZQEA 5D3MA 4IIBA 2XKJE 1WXWA 5LDGA 2ACEA 4HAVA 4NDAA 3V1TC 4FWBA 1E8DA 3P9IA 3U39A 3WOHA 2A0XA 5DBFA 1PWXA 3SZLA 4TV8F 3T7IA 2VBGA 4EFMA 2JS7A 2HJHA 5CW1A 1NT2A 1K92A 2HLDD 1U7HA 4DWJA 1YE8A 4LC9A 3AEUB 4R98A 1G17A 1UQTA 2XTZA 3PQEA 5CX4A 2QA5A 2H2FA 5D5QA 4Z49A 1SXJB 1XZNA 4GLFA 1DAPA 4EVIA 5JZMA 3S70A 1CZRA 5A5DA 3OFKA 5ADWA 2VSYA 3DO6A 3E61A 3DCIA 2F3PA 3HFGA 5P21A 5BN4A 4U2BA 5AXCA 1GGJA 1PF7E 3HXKA 3DEJA 4LZAA 1RHQA 3WBFA 4ENRA 2ZU0C 2X41A 1V43A 4YLGA 1RI2A 1JJVA 4H7HA 3H9EO 2BEUB 4XVQA 3RUPA 4B35A 2RJOA 3FMIA 1GADO 4RF3A 4B3RB 1XC7A 2OHOA 2ZP1A 2BUCA 1EINA 4LRYA 1QCDA 2ISCA 2Q4RA 2XDQA 4ZVSA 1L5GB 3A14A 3BC1A 1EXVA 3OSZA 4YRSA 1V48A 1L1QA 2BBTA 3G2OA 4M8LA 2HGSA 2AXEA 1Q50A 4YIKA 2KPOA 3IUQA 3UMCA 1M1NA 1U2DA 2CXXA 2OQ2A 3K16A 3PL1A 4RVFA 3RVPA 3SJUA 4FW8A 4PIVA 3AEKB 3RSLA 3SS8A 3I1YA 4Y98A 2JI9A 5F52A 1N7HA 3NC4A 5IBRA 1U2PA 2VIIA 2J6BA 5JE8A 3W2TA 4DCMA 4NJOA 4HG2A 3RREA 3ITKA 2IZ5A 3Q0IA 1KRWA 2W48A 2O1SA 1CVIA 2J0VA 3NDBB 2YC2C 2B8NA 3OY7A 2ONCA 3TW0A 3FYHA 3OM1A 3LBIA 3LUPA 3NRCA 4OA8A 2DH6A 3VR0A 2XHEA 4XTCS 4BQSA 1VB3A 4IQFA 4JB2A 4OSEA 5MN5A 3T99A 1BXRB 3OSUA 3RJMA 3VR4H 5E38A 1P2UA 4QEKA 2BTQB 1TXGA 3GLHB 4ZJUA 2POCA 3EIQA 4QNMA 1JTEA 4WBXC 3FIJA 3OESA 4UBMA 1CY4A 1YASA 1RPNA 2D2XA 5ITVA 2JGDA 3D8TA 3KP1A 1F3OA 4YCBA 5DCLA 1VHWA 3T3PB 4HPJB 2ZXFA 1E9EA 1SBQA 1B0UA 3GMSA 3JTEA 3VRHA 3EF3A 3CG0A 3THXB 2FSVA 3SQDA 3VDQA 2C7PA 2V65A 1FU8A 2L2QA 2GBIA 4IHJA 1ZYUA 4P35A 4LQDA 3QTTA 5IEJA 1PR6A 1S3FA 3CC8A 4KVGA 5JRZA 3QWBA 4G26A 4MKIA 4UMDA 4IAOA 3Q8LA 2QSJA 1CB7A 3KDSE 3ETGA 4TMXA 3B9RA 2WQZA 1B0AA 5JO0A 3K9NA 2XDQB 1GZDA 1YR8A 3M5CA 4OHXA 2ZT8A 3UHFA 5DISB 1U0EA 3E5MA 1CQJB 3IPAA 1HLPA 3WGKA 1YCDA 3D8BA 3E9EA 1SKUA 1ULSA 2IEAA 4WXPA 5T41A 2QZ9A 2WM3A 3F4BA 2I2BA 1U3UA 5G2OA 3UF0A 4UQOA 3F8TA 4RABA 3GJRA 2XBLA 1B6SA 2DFPA 4W99A 2AJCA 3AZPA 1XDSA 2HPAA 1F17A 2ZYRA 4JSYA 1UWLA 4TKMA 1Z68A 2ZUTA 3WLOA 5C7OO 4Z4QA 1JJIA 2G67A 2YRWA 1BE6A 4NS4A 5HIIA 1P19A 3WKEA 2VNIA 5FLYA 2KLBA 1ISSA 1JJBA 4BB0A 2IBSA 2AYXA 3X43A 5EXEA 3OQ1A 4JOCA 2XUOA 4TM7A 4Y1EA 2DCMA 5D6NA 3D8HA 1GOTA 2RJ3A 4XJVA 3T4XA 4D26A 2BE9A 4NEQA 2Q1YA 5K3AA 3LWNA 3DT8A 2E5LB 3DL7A 4D46A 2OCBA 3Q72A 4JLAA 3L0YA 3RFTA 3FLEA 2FKAA 3CGGA 4OHCA 3F7OA 3RR2A 1RQGA 3N0TA 1T9HA 3HYNA 3PB3A 4PLGA 4OMDA 4R68A 6Q21A 4ON9A 3QVKA 4V0RA 3DBVO 4XUCA 2BTEA 3RS5A 1SCKA 1O9BA 1IN8A 1BMDA 1JF8A 2ERYA 4HB4A 3RRMA 4BZXA 5I4CA 2O8CA 2E5WA 2J3IA 2ODQA 2PX3A 4TKLA 1OILA 4CM3A 1XZIA 2QX9A 4S1WA 4HDNB 3MGGA 3N2YA 4HN4B 3G8YA 3ESQA 4HHEA 3A2NA 4I1UA 3FSJX 1QFJA 5CLIA 4ND2A 1MRSA 1DKRA 2NM0A 4YQFA 2UUPA 2RSLA 3F46A 3EGWA 4FR2A 4OP1A 1B73A 1XEFA 2OFFA 4DTIA 3IR6A 2R8BA 4UBLA 1YDWA 4FGJA 4L02A 3WTCA 2O8FA 1SKYB 5HFJA 4ZGBA 1YUBA 5MDHA 3OQ6A 2HM7A 4REMA 4RJJA 4CKBA 1WUJS 4FMPA 4CT0A 1AZSC 3K9BA 3ADDA 1PNTA 2GF2A 3EFEA 3KJHA 4LNHA 4MZXA 4PV7A 4WACA 3RG8A 4CV0A 5HE9A 4ES6A 4WLFA 3I9V1 4K6OA 3L7IA 3UAXA 2WPDA 1Y8ZA 2H85A 2BBSA 3KT0A 4RF2A 4U7TB 3FVRA 3NBQA 4F21A 4UQLA 5JSUA 2DTEA 4KMSA 1FDTA 1Y5RA 2OBFA 3HJUA 5HIJA 1WCIB 4JT9A 1IAQA 1B6TA 2B5OA 4I6GA 3DP7A 3HV0A 4XWAA 4GYJA 3WRXC 1ISIA 1CJMA 1Q74A 3FZNA 4NFLA 5A0TA 3P71T 3K5IA 4PYNA 2BF4A 5EFOA 3CZ4A 4K6FA 4RU1A 3GN2A 4OAQA 1EFCA 1NV9A 3L1UA 4IH9A 4JOQA 3IVXA 3DE1X 2PKXA 2K6GA 2IWRA 1QV7A 2C4VA 4HZIA 4I66A 4DC1A 2I2XB 2V6BA 2ZYDA 1CS0A 4OYRA 1LPNA 4WN3A 2NO7A 1E1KA 4HGOA 4KMRA 5K1ZA 4R9NA 2PXHA 2ZWOA 2Z5GA 2O5VA 1ZNYA 3ANXA 3DHEA 2QLMA 3H18A 3PI7A 3VVLA 4C0AC 4CQMB 3LCVB 4HNTA 2J7KA 2ZROA 3QEKA 1GRNA 3UJ8A 4D8YA 5KOYA 3CXUA 3C3AA 3NTUA 1ULTA 3W04A 5CNIA 3HSYA 3K8OE 2B83A 3OPVA 3OPYA 4AKGA 2GTHA 3GAFA 3ZQ4A 3UGQA 1DJMA 3HJCA 4PX3A 1BVYF 3LVBA 4F97A 3IP8A 3KS9A 2C57A 1NC3A 4KUGA 5ELMA 2PBLA 3RBAA 2WYWA 4EB6B 4RTSA 1IAVA 4LDZA 1MB0A 3ZJYA 1KZ9A 4LIPD 2M2IA 1N57A 3ILVA 2ZUWA 3T1VA 1YBAA 1MA0A 3GPBA 4MX8A 4Q9IA 3H6KA 3P0HA 4YASA 1JG2A 1G5QA 3PXXA 4JT2A 4OY3A 3DZJA 1WTCA 3L9XA 1UBTS 4NDNE 1JNYA 2GTIA 3PEFA 2PH3A 1YA4A 1U8FO 3FMPB 1TKCA 1VJ5A 2X14A 4O29A 3NETA 3TIFA 5KIAA 1MC1A 4LXXA 3N8KA 3NH9A 2QP9X 3ZY2A 4UCQA 1DQPA 3E3LA 2Z8YA 4EX6A 3UHPA 3K72B 1VGVA 2P65A 3AONB 4Q6BA 5ESRA 2WYUA 1LI4A 4AU1A 2VDRB 1P9LA 5K3FA 1RM5A 1RU3A 4UXJA 1KBQA 1L4HA 1QYDA 3K6JA 3QWAA 3C1OA 1GGNA 3DOFA 2MWMA 2O4UX 1KQFA 2OGZA 3FE2A 3I9JA 1DBVO 1S0UA 1JI0A 3DLBA 1HTBA 4R1OA 2C92A 3HCPA 3ZNOA 1JSRA 3TTWA 4KIJA 5EUMA 5JPIA 4C4RA 4JWKA 1IL0A 5K8LA 3OTOB 2I4LA 1D4AA 2CKMA 3UAWA 2J4DA 2P91A 4EB8A 4EGSA 1RJDA 1GUYA 1I01A 3MIZA 1O87A 1EFUA 1GYRA 3QBEA 2CJWA 2VTVA 3QWFA 1JMVA 3M34A 4JHXA 1TZKA 3FPHA 3H84A 1MB2A 1ZCZA 3D1VA 4PSKA 4Z3DA 3ZHBA 2GZ3A 5JSZB 4MKGA 3HCAA 4RHXA 3M3DA 3THXA 1YKFA 1ZXXA 4YP9A 5TY0A 2WG0A 3G5LA 5DT2A 2WD7B 3OT1B 4W8HA 1KDOA 3O9ZA 4ZHQB 2VCYA 3DEKA 3TX6A 4EHLA 2QMUA 2ZJFA 1R66A 2FW1A 3M2TA 3MJRA 3UJBA 1EP2B 3TNJA 1RLTA 2Q9AA 4IIEA 4NEGA 3ZV6A 2XTJA 3WB1A 4DCOA 1B1CA 4LOIA 4Z9BA 1IB0A 3FTQA 3X1ZA 3VKFA 3NEAA 4HQFA 1IM8A 1E62A 2W2TA 5DLYA 5E6SB 3MWDA 1LDNA 1O4WA 2IHNA 2JH3A 4IJ6A 4NBSA 4KO4S 4FKMA 3CPJB 2P78A 1GZUA 3HR7A 2C96A 3W79A 1NP3A 5F9FA 4KWIA 1E3WA 5TXGA 4JB3A 3UMYA 1R6TA 2G7ZA 1TF7A 4YT8A 1I7PA 1MT3A 2FMUA 1PZNA 3RWBA 1AHIA 4B81A 2WBLC 5K05A 1T5IA 2L42A 4NMXB 5BN3A 1DC4A 4GVPA 1FJHA 5ILGA 2A5FA 1XQXA 3KXIA 2JPDA 4X91A 5HJEA 1KQOA 4FGLA 1ZH8A 2JFQA 3GG9A 4WK6A 1Q3TA 2Y1XA 1UK9A 2Z3WA 3PX3A 4NCKA 1P7YA 2WUEA 3U4CA 4Z0NA 4ZYTA 1CZHA 1G8AA 2Q99A 1QWSA 1XU4A 1YFKA 4PICA 4RVGA 4WZAB 5E1MA 1XNGA 3SEFA 2AXNA 3GIDA 3UUEA 1VBMA 2NVBA 3ONDA 4E15A 1G291 2C9ZA 3U3XA 1IY0A 3L6DA 4FDVA 1T0IA 5E4JA 5J2TF 4CKXA 1XKLA 3S6JA 2QZPA 4JUIA 5ALVA 2XMDA 2OP1A 1LRLA 4MMYB 3QX3A 1TD1A 2BEUA 1A7JA 1UANA 2ZBGA 4BIMA 3MUOA 4INAA 5FIUA 3ITNA 4BNNA 3IPRA 2W7TA 4H60A 2QUZA 3VPSA 3NUQA 1C30B 1UBHS 4HZUA 5CBPA 3HN7A 3HU2A 4S2UA 4DKXA 3CJTA 1E98A 1GNPA 4KYVA 4A6XA 2ZAOA 1HH4A 2DEUA 5HJ5A 2H59A 3AP2A 4OP2A 4CVNA 3F8SA 4JI7B 1AUVA 4P86A 1YIOA 3GG2A 3RHFA 5E9JA 3GLFE 1Z0UA 4FYXA 3JYPA 4XR4A 2JGLA 2HMUA 1IB6A 1UZUA 2OBNA 1X8XA 2QTAA 4GOXA 2DQSA 2FWJA 2BGJA 1XO1A 4DLKA 1NULA 2FPXA 3LECA 3AP3A 3PUZA 3VDRA 2GPBA 1WPGA 3RK4A 2WJAA 3GJTA 4D8XA 2ECQA 3AEUA 2AQHA 3CRQA 3NIFB 4CHGA 2V97A 1CUDA 3RARA 5AUNB 1ESMA 5DGXA 1Z37A 2QQEA 3IE1A 2J41A 4FFWA 4ZAYA 3DLHA 2NQTA 5U1PA 3O1LA 3H4IA 5F12A 5ITZB 3SC3A 1KY2A 2RHBA 3WQBA 1Q0RA 3QNWA 3VAAA 5BUCA 3SF8B 4TMTA 5K8VA 3OG9A 4Q1FA 2RI0A 3PDWA 3NGXA 4BO3A 1PK9A 1E5TA 2F1KA 3O1HB 1BHO1 1DBIA 1JECA 1D5WA 2XMRA 1U8ZA 3L7KA 1TM1E 3QENA 4REQB 1FBTA 3QX8A 1TQ8A 3IUSA 3D7KA 3RHZA 1DQYA 2YY5A 3FGNA 4PBSA 3SOPA 2XAUA 2YQ4A 4YJGA 4HRYA 2GN0A 3HA7A 4LE0A 3VJMA 1ZQ9A 2H7CA 2WSIA 2Z4SA 3W4KA 5TGTA 4J4BA 1HTTA 4WFIA 2B1RA 3C3CA 2B2CA 3GJ6A 3LT1A 4PINA 1SCAA 2HQBA 1SU8A 2LIPA 1NIPA 3CLRD 1Y1TA 3E8SA 3K2EA 4KNWA 5I7HA 3ZHCA 1N3BA 1KI8A 4ZCIA 4PGHA 2FX2A 2MSEB 2QNRA 1M7BA 3ABZA 1N7GA 3EVEA 3EH1A 1XCLA 1KOFA 2MSNA 1KK0A 4PWZA 3WMRA 1OZGA 1HBJA 1HUQA 1RJEA 4FN5A 4I81A 4ZCQA 2QM0A 3CLUD 4F96A 4Y6QA 4Y1FA 3RVSA 5CVEA 3SIXA 4MW5A 4AL4A 5EMMA 3WGVA 1RVV1 2Q1TA 2FVXA 2VO1A 2ZQYA 4TGLA 1DXHA 2FFJA 4NLLA 1QHSA 3ZE2B 3CVUA 3F6CA 1TPYA 3GLIB 5DBHX 4ZRMA 1CULC 2IOQA 1RAIA 2GAFA 2SBTA 3PR1A 4OQ4A 4ZV9A 5KMGB 3HL0A 3SP1A 3IEKA 3V4VB 4D79A 1UOQA 3MQ2A 2H1HA 1LFAA 2DT8A 3HB0A 4W1RA 1B42A 3ICOA 3ZJTA 1MXFA 4AMUA 5KQSA 4CV3A 2PNFA 1B14A 3H1EA 4E12A 4DXHA 5EVCA 2G9ZA 2W9XA 4Q1CA 2CW5A 2XMQA 2QAGC 2HBYA 5JCZA 2XQFA 2JGFA 3OQMA 3CVWA 1IDN1 2I6XA 3KKKA 1N92A 1U6IA 4A0SA 2IYYA 4MV8A 1EDZA 2F3UA 3C7TA 4AF6A 1AM4D 2O3JA 4US2R 1XTRA 4UM9D 3NDPA 3NEJA 2HSZA 3ZIDA 1IVYA 4C3UA 1K3FA 1D2HA 4G09A 4PHCA 1V9LA 2HQ1A 3D4NA 2WJWA 4AVYA 2GO7A 2QDXA 4KE8A 5CFPA 5I47A 3CKLA 1EVEA 4HEA6 4L8YA 5BN4B 4DR2B 3HVIA 4GKVA 2Z56A 2AN5A 2FW0A 3SU8A 2NW6A 2CXQA 4ZTBA 5KNBD 1C2TA 3AI2A 5JDCA 1TVCA 5HJ7A 4AG5A 2CT8A 1DO0A 1JFFA 2WSBA 1ONSA 2AG6A 3PFFA 1BDHA 1KSFX 3EARA 3K0BA 4TN5A 2QLNA 1FXWA 3GF4A 1ARZA 4YQYA 2GI4A 1MQ9A 1YHNA 1GAQA 4YUZA 1WB5A 1ZJ5A 3ZXYA 1QLHA 5KTTA 3GCWA 2OYSA 5T3YA 5B2EA 1M5TA 2FOXA 3SNKA 3GROA 4J6FA 4LQLA 2K2WA 3RF6A 4N76A 1VKJA 1Q6YA 2WKQA 2Q6KA 1VIMA 1L2TA 3KAJA 4IL5A 3LF1A 3TJMA 1B43A 1PUIA 3Q7PA 4PS1A 2FWNA 1MB9A 3HABA 1QTQA 3T12A 2VXCA 5HQTA 3QKSA 4F3KA 4UVIA 2C2KA 1V6SA 1SXJD 1NMSA 2ZJAA 3GZJA 4KWHA 4C20A 2BFFA 3WBBA 4G0NA 5THXA 2KLHA 2BKEA 5FWYA 3Q6IA 4E1BA 1M5RA 4YRTA 5CD9A 4QNRA 2C77A 1SRQA 4XKJA 2VXBA 1X80B 2H31A 1T0PA 3PGA1 4KRFA 3KQNA 5GONF 4B7UA 2CK3A 2FN8A 4NU5A 4WTOA 4UU1A 3LC7O 4J0GA 2CHGA 3B60A 3BA1A 4PPGA 4BO6A 3ZVNA 1Z63A 2BMDA 2GUWA 4CIWA 4NU8X 3F67A 3W5DA 4RFLA 1L7EA 4MVJF 3G9XA 1P7WA 1XU7A 4KPUA 1EFRD 4RDIA 4X85A 1KP9A 1ZVVA 3VHRA 1E9CA 4WLEA 3I9MA 1FLAA 4HXYA 4KOEC 1E66A 3VYWA 1P72A 1A8HA 1WAMA 4A26A 3OMLA 5KKNB 4D1YA 3C3KA 3P0RA 2H1IA 4NZOA 3LPDA 1A7AA 3QBJA 4C0WA 1N78A 4IXNA 4W7IA 3KVVA 3NJ4A 1UMDB 4MS1A 2IZOA 4OMCA 3T8YA 3WLIA 4DCVA 4DZTA 3VKGA 2F9FA 1Z12A 2FPWA 7AT1A 2FHSA 3BDIA 5FA6A 1FDSA 1H5UA 4EF6A 2YV4A 4DB2A 5NLLA 1HYQA 1C1DA 2AC4A 1BIFA 4C1NA 2BGUA 3ZCVA 5KSOA 3I61A 4K9PA 2JAPA 4MLZA 1I94B 5CIWA 3WMXA 1RKXA 2P9JA 1A7UA 2IZ0A