4QKQA

Rada from methanococcus voltae in complex with copper phthalocyanine tetrasulfonate inhibitor
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
265
structure length
257
Chain Sequence
SHMDLGFKSGIDLLKQRSTVWKLSTSSSELDSVLGGGLESQSVTEFAGVFGSGKTQIMHQSCVNLQNPEFLFYDEEAVSKGEVAQPKAVYIDTEGTFRPERIMQMAEHAGIDGQTVLDNTFVARAYNSDMQMLFAEKIEDLIQEGNNIKLVVIDSLTSTFRNEYTGRGKLAERQQKLGRHMATLNKLADLFNCVVLVTNQVSAAEQAIGGHIVGHAATFRFFVRKGKGDKRVAKLYDSPHLPDAEAIFRITEKGIQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA repair and recombination protein RadA
publication title Crystal Structure of an archaeal Rad51 homolog in complex with a phthalocyanine tetrasulfonate inhibitor
rcsb
source organism Methanococcus voltae
molecule tags Dna binding protein
total genus 95
structure length 257
sequence length 265
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2014-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08423 Rad51 Rad51
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4qkqA00
1ZUNB 3P27A 1E96A 1HYQA 2D7CA 3AVPA 4P0TA 4BRUA 4PAMA 1LY1A 1N6OA 4CZ2A 3UPUA 1H8HD 2O8CB 1N0VC 2NPFA 5F9HA 1AS3A 1Q3HA 2KB0A 2X19A 3U6BA 1KI7A 4AG6A 2XTMA 1AA9A 3B13B 3BERA 3H1TA 1BH2A 1FUUA 1VYVA 4MRRA 1S2MA 1M7HA 2QBYA 3UG6A 2F1RA 5TY0A 1AKEA 3TAUA 4BEBA 1U98A 1KY3A 2J59A 4UXHA 2YOFA 2J3EA 2QI9C 2ZRHA 2JDID 4Q19A 2XZOA 1V5WA 1A82A 2VHUA 4N1AA 5DNYB 4L4UA 1NIPA 4KSBA 3ZVRA 3OE7A 4RD3A 3CPEA 3UATA 1DAKA 3L43A 1CS4C 2V1UA 3F3YA 4B47A 2CHGA 3A1SA 4CEJB 3AM1A 3AF4A 3JVUA 3VFDA 1VYUA 3PEUA 3L2OB 3PR1A 2REBA 3T1VA 2QTHA 3C16C 4A6XA 3VR6A 3GFOA 1ZMXA 1E9SA 1KI8A 3GJ6A 3C4JA 1E9RA 3RC3A 2F3RA 2IYYA 1E0AA 4LHZA 1UBCA 2VSFA 4OK5A 1U94A 4W5HA 3ZD7A 2PT5A 5K8LA 1EX7A 5JEEA 2CCKA 3DPUA 4H1UA 1X8KA 3WRYC 1B23P 3U5ZB 1BMFA 2XEXA 1SVOA 3X1XA 3BFKA 1P9RA 1KSHA 5AJZA 5FTKA 1OFHA 2KSQA 1D9XA 2G1JA 2FPKA 5HCIA 1DAGA 2OV2A 2F1JA 1UDXA 2IF0A 4O2LA 3RRZA 3VX4A 2VIIA 3RAPR 3CX7A 3L8ZA 3QE0A 2FSIA 4B76A 2DFTA 3J81k 4IOLA 2W0MA 3KQKA 3HJNA 4FD2A 2QAGC 3CNLA 2EVWX 2PJZA 1CJMA 2IYWA 2NZJA 1IONA 3NTUA 3DMDA 4TT3A 1NVXQ 3KFXA 2GVZC 4LHYA 4TYQA 5AR1A 3H86A 1XWIA 2GK7A 4QL3A 2C98A 1UEIA 4NDZA 221PA 4NCJA 1KJYA 4CEHA 3AVUA 4WAUA 5EZ6B 1UJ2A 3TUIC 1UEJA 1ZYUA 2O8EA 2GILA 3B1VA 1Z0IA 1W36D 3LQQA 2Z83A 4DLXA 1SULA 1XD2A 2ERYA 3GLIE 4H1VA 1PVOA 1XNJA 4HAYA 4LJ7A 3DOEA 4Q21A 2EFDB 4V0LA 1SHKA 4J0QA 2MSDB 4KSCA 5KPJA 3Q7QA 1UFQA 2VP0A 2BBTA 1DAIA 2HLDD 2ZRFA 4IOMA 4NPHA 4LY6A 4S2EA 4LPKA 2IW3A 3A1VA 3CWZA 5KU1A 1KGDA 3QPWA 4TTRA 4M1MA 3PCRB 4G5QA 5BN4A 1ELOA 4I1UA 4UNNA 1NLYA 3Q9LA 1NG9A 5FUXA 1QHGA 1SXJB 2ZJBA 4JLNA 2CXXA 2BMJA 2JLZA 2H18A 5GJVC 3OHMA 2QE7A 1E79A 4U7DA 2W2VA 4FCTA 4PR0A 4WOPA 4DCTA 1CR0A 1U8YA 2FH5B 1SZPA 3K70C 3U3KA 4K8OA 4GOXA 1G3QA 4TMWA 1Q1QA 2ODNA 3THXB 4DJTA 2LKCA 2D06A 4LV8B 3U7HB 3MWKA 2RGXA 1HURA 2BMDA 2NO1A 1JR3D 3IKJA 2WIAA 1S1CA 4QHYA 2QA5A 2FGKA 2QP9X 2ZR7A 4Z54A 4ZKEA 3PXGA 4ZV4A 2J45A 4MYCA 4US2R 2GXAA 4MYUA 2UKDA 4MKGA 2WTUA 3EZ2A 1NSFA 1W0KA 2Q3FA 5ANRB 4BLPA 1OIVA 2AK2A 3QKSB 2PMKA 5FFMA 5HTKA 1DAEA 2EYQA 3A4NA 1QZXA 2Q9AA 4C30A 5FR2A 2B92A 3IQXA 3LQRA 5DHAA 4M9QA 4TMXA 5SZHB 2RGCA 3L0OA 4DXAA 1QVRA 1TF2A 5FBLB 2WWWA 1GG2A 5GVRA 2J0VA 3OIUA 4HLQB 2AN9A 4DLYA 721PA 1UAAA 3E1SA 5AUOB 1VPLA 1QHXA 3KTAB 5LB2A 2Y8EA 2W6ID 4B32A 4CT4B 3FE2A 2O8BA 1G41A 2R6GA 5CITA 4F91B 3UKDA 5CDFE 2O8DB 3B9PA 1JAHA 2Q6TA 2I4IA 4R9UC 1BO6A 1CJVC 1G291 2IWRA 2YVUA 4D0NA 3R7WB 4W5WA 4P4UA 1VHLA 1ZD1A 4BFUA 1N25A 1OKKA 4X8MA 3TE6A 1WRBA 1X8LA 3GEEA 2AWNA 4LBVA 4JLVA 1JBKA 3FYHA 1Z2CA 1AK2A 4JT4A 3FMOB 3GLFB 1XXHA 2QM8A 1NP6A 2LWIA 3DM5A 3WMEA 1Q20A 4B3XA 5H1YA 1NG1A 4IVPA 4YMVA 3CX6A 3BH7A 5HE8A 4OYHA 2Z6VA 1T5IA 3BE4A 1QHHA 1QHNA 2J7KA 4D4KA 2QQ0A 5EXPA 2PMDA 3L0IB 4JMPA 1W0JA 3QBVA 4RKFA 5KNBA 4PO9A 1UKEA 1KMQA 1QVAA 3TSWA 4URUR 4DIDA 4HAXA 2GTPA 5IK2A 1SKYB 4JYCA 2DR3A 2ZRMA 3OIWA 3GLHE 2CNWD 2X2EA 4RSGA 3CZQA 3IDQA 3O8DA 1ZNWA 4Q7MB 5UKDA 1J8MF 3OF5A 4KVAA 4XVUA 3PIRA 3MFYA 3CF2A 3C5HA 2BBWA 3GEHA 2A5FA 2FZ4A 4MDFA 5CB6A 3K0FB 1RZ3A 1GILA 4Q4HB 5HPYB 2F9LA 4BLTA 2OG2A 4E09A 3T34A 2FEMA 3K09C 4LBZA 3WP0A 5B64A 1JPJA 1CRQA 1DO0A 2GCOB 2QZ4A 2C9OA 1RYFA 1UPTA 4ITRC 1XDBA 2ODWA 1Q1BA 1XTKA 1EFTA 1VDZA 1T8TA 2E9SA 1D6JA 3TUJC 3C8UA 5JZVA 3M1IA 4C0JA 5G41A 2WWIA 2VRWA 3VR5A 4XJXA 2CJWB 1XEWY 1KHTA 3D7MA 1GKIA 2YC4C 4FMDB 4GFDA 2RHMA 2AK3A 1P60A 2IYQA 4O2RA 1F60A 1G5TA 4G5GA 2OSBA 1Z6AA 1NMYA 4YONB 4DRZA 3V4FA 3QVUA 3ZIAD 3Q3JB 3ZZTA 4BUJA 4D6PA 5ELXA 1LS1A 3DEFA 2FFBA 5IDVA 1P6XA 1G7TA 1TQ6A 4GZMA 4WIAA 4NZYA 2XB4A 2IYXA 1MRNA 4CRWB 5FBRB 1GWNA 4C0BA 4D0GA 3DZDA 3SJCA 5EE3A 2OBMA 4A9AA 1UKVY 1EGAA 3A4MA 1P4SA 2VPPA 3K8YA 5J47A 4Q9LA 4MITA 4YXWA 2XOKD 3T35A 3K53A 2CHVA 2CK3D 3GJ0A 4A2PA 4XTRA 4H9GA 1T0JB 4V02A 1XZPA 3GJ7A 3F8TA 1NNEA 4NYJQ 3NG1A 4BECA 1IY2A 1PJRA 4IHQA 1ZM2A 1AN0A 1G4AE 1R5OA 3S1AA 3LWNA 1CRPA 4AK9A 4AWXA 2OBNA 2ORWA 2EWVA 1NN1A 5BQ5A 2AWOA 5KSPA 3GJ5A 4BEJA 1JB1A 2XX3A 1E2EA 1HUQA 1G3RA 5G53C 3SYNA 1AS2A 4C0QC 1JR3E 3V4RA 4YMUA 5KSOA 1Z0FA 2V7QD 4ON9A 4DUGA 2CVHA 1SKQA 2O8CA 2HV8A 1NI3A 1ZP6A 2VO1A 2REXB 1TUEA 4RCYA 3C41J 3AVOA 4JJZA 2J46A 4WA7A 2RGNA 4IFEA 1FQKA 2R9VA 2QAJA 4DEYA 3FFBA 5AWFC 4O3MA 3UK6A 2JAQA 3ZS9A 4JVLA 2GF9A 4Q9HA 2ZRBA 3U3JA 1GM5A 1XCPA 3LVQE 1WE2A 1S4QA 2IL1A 1W47A 3T1TA 4Y0AA 1AGPA 1OYYA 1X1SA 4YMWA 3FPAA 2OCAA 4TLDA 1Q21A 1QDEA 4OJQA 2VF7A 4HB4A 2ZJYA 5FPTA 5D3MB 4EPWA 2QAGB 1WBDA 4UXIA 1PUJA 1ZCBA 4RFVA 3OEEA 3RRYA 2CL0X 2OLJA 4Z8YA 3PEWA 4QGAA 3GEIA 3O8BA 1HEIA 3CZPA 1QF9A 2ZEJA 4CEJA 2ONJA 4PHTA 1FP6A 2PH1A 3SFZA 3NC1C 4JBXA 1G16A 4M9SA 1Z2AA 5KSYA 4EJSC 2OCPA 1E9EA 4P33A 3BBPA 4HAZA 1OHHA 2BM0A 1BYUA 1W48A 2NIPA 4PC3A 5LBIA 4NMMA 3T1OA 1YZKA 1QG4A 1LFDB 2QGZA 2VHCA 3OE7D 2BIFA 2C5LA 3KXLA 1NJGA 3OIYA 4N0DA 4C4PA 4P4SB 3VMFA 3VKWA 1IAQA 4LUCA 4RD6A 2AFIE 1CEEA 3VQTA 2CEAA 2A30A 1XMIA 2R8RA 2RH5A 2ZRDA 2ZSBA 4JLMA 5SZJA 1G8GA 3CRMA 4YMTA 1X6VA 3CPHA 5H70A 3RS5A 3QXCA 4XOIA 4PPNA 1IN7A 2C03A 2AD1A 3RS3A 4CIDA 3PJRA 2QMHA 1GZSA 1X1RA 2JJ8A 4NL4H 4RD4A 5FUVA 3VNUA 2F55A 3I4LA 4NBSA 3TSZA 3PQCA 2P5SA 1N3BA 2QG6A 4DIEA 1SGWA 1SXJE 1II9A 621PA 3ADDA 4OK3A 3N5CA 1LV7A 2ZTSA 1E94E 1VCMA 4F92B 3FHCB 2A5DA 5E7MA 3EG5A 4IDPA 4M1YA 1D2MA 3AF3A 1E2MA 4YLGA 4GPTA 4P4TA 3R9WA 2ZRCA 3TAHA 2VP4A 3IBYA 2YWFA 4YDSA 5AK0A 1KSJA 2P6NA 4KFSA 1BMFD 4BWYA 3TUZC 4NYMR 5M04A 4PZZA 4JLBA 3PITA 4MUBA 3NKVA 1KK1A 2ZE6A 4XWKA 1XPUA 2PZEA 3M6AA 2QTFA 5EP3A 2GEVA 5JI2E 4POAA 3I8XA 3I61A 1P9NA 4V0OA 4XWAA 1ANKA 5FBVB 4HLUA 4DB2A 1G17A 2DHRA 4MKHA 1XFAA 3MSXA 3GJ3A 4FINA 4BFTA 5HKKA 4ZCIA 5HZHA 2FOLA 3IIMA 3PEYA 3IO5A 1LW7A 3O8RA 2QPTA 4XVQA 3UIEA 2GZHA 1E69A 4CEIB 4GP6A 4L9SA 3BB3A 1DS6A 2WSSA 4PO8A 3RS0A 4OQNA 1ZRHA 1RJ9B 2ERXA 3I3SR 4AYWA 1G64A 5DIFA 2HF9A 2NZ8A 2NO9A 5KO2A 3P20A 4QHSA 4A92A 1SXJA 2QNRA 4UNPA 4A82A 2QPAA 2VSXA 4A2WA 2JJ2D 1OXTA 1J70A 5E7IA 2Z0MA 4YDHB 1NY6A 3UMRA 2Q21A 4EPYA 1VG1A 3AVYA 4Q03A 4GOJA 1A4RA 5IF9A 1TEXA 2CE2X 2QQEA 1XBTA 1AQYA 2Q9CA 4B43A 3NHAA 4TTQA 2IS6A 3THXA 4GMXA 3U44B 4XTCS 3U7GA 5JJIA 1A2BA 3MCAA 2ZXUA 1Z07A 2G6BA 2QM7A 5J4YA 1IN4A 1VCOA 3GJ4A 3IEUA 3UWKA 3AVVA 5TVKA 1G8PA 3HR7A 1MRSA 3P1JA 3UXMA 2QE7D 1E79D 1WP9A 5J5CA 4ESHA 3SYKA 2J0SA 3QXSA 4PZLA 1R8QA 4AY2A 2XXAB 4M1KA 4BFXA 3REFA 4M2LA 1E2GA 1S0UA 1KO7A 2IXEA 2JLQA 3QKSA 2ZE5A 4UNRA 2DFKB 2BKEA 4NTZA 1IJFA 1OJLA 3ADKA 1KSGA 1N5LA 2OFWA 2Z4RA 4URWR 5H68A 1AGRA 2QPOA 4M4SA 5FL7A 1KTVA 3AH8A 1GITA 4PXAA 5DI9A 5FOSA 1SKYE 3AGPA 2FE4A 3HDTA 1R6BX 3U6KA 2PT7A 3FKSA 2XZLA 3MWYW 2FFQA 3A1WA 1XTIA 1OFIA 1XTRA 2ZE7A 3SJBA 3GQBA 2PX3A 2IS2A 4C0KA 1W0KD 1E32A 2LKDA 4JVMA 1XD9A 1L4UA 2QMUA 4RZ2A 2BVNA 3KTAA 3W6NA 1ZINA 3DDCA 5J4HA 1YVDA 1AM4D 1KSFX 2PL3A 4D2IA 1F2UB 4MGZR 4DT1B 3SHFA 2O8DA 2CBZA 1ZUIA 2REOA 1XJQA 1PLJA 2ZR0A 4PSKA 1VMAA 3R7WA 3HWSA 1S8FA 1LTQA 3EXAA 3KX2A 4PQRA 4YMSA 1NVVR 4IDNA 2GEDA 3I62A 1XEFA 3ZLJA 2DBYA 1G6HA 1NBMA 1ZW6A 2J5XA 5DHFA 5B2ZA 2MSCB 3U4QB 3B85A 3GLFA 2PZGA 2CK3A 3AUYA 3LW7A 3CH4B 4Q4AA 3KQHA 1GRNA 1IXZA 2F43B 4HYYA 1KKMA 2D2EA 1CULC 1GSIA 3CF6R 5AUQA 3TH5A 2A2ZA 1G8HA 5JSZB 2ZI3A 1Z83A 2ZPTX 3VR4A 2AD5A 4GZLA 5CM9C 1G3MA 2ECKA 2R6CA 3ZVNA 4G5RA 3KUCA 3OAAA 4UJ5A 3ICQB 2IS1A 3TQFA 4LYHA 1KIMA 5TXGA 1NVUQ 1W4CA 1RIFA 4MRPA 5KNDA 3UWOA 2ZI5A 2VH5R 4MGYR 4E5UA 4LBYA 3W6PA 2G83A 1T0HB 2K5UA 1IJEA 4EFLA 2VQSA 4OBEA 5DYIA 1UKZA 3K0FA 1W0JD 1HH4A 2O8FB 2QT0A 2V6JA 3BC1A 4Q4HA 5G3ZA 3VKGA 3LO5A 2DWPA 1CR1A 2ZAMA 3ECCA 1U9IC 2FJUA 3NBYC 2FX3A 5IK2D 4MRVA 2GCOA 2CMKA 2V54A 4DVGA 4A0GA 2DCUA 2GBLC 4FCWA 2FV8A 4A0FA 3WNDA 4HZUB 4PC7A 4BFVA 1J8YF 1X3SA 2C95A 2OBLA 3AKYA 3B1YA 2WJJA 3X1YA 4KBFA 3PUYA 3R9IA 4U5XA 1US8B 2YYZA 1EWQA 3EPJA 2PLRA 2IYUA 3A36A 4C9BA 5BWMA 2CJWA 3N2EA 5FUYA 2WAXA 1I2DA 4HB0A 3R8CA 1NKTA 2ZS8A 3DZ8A 1GTVA 4JKIA 5AJVB 2XGJA 4DSOA 1K5GA 1YR8A 3NDPA 3T1QA 2RKOA 4OI1A 3AQ4A 1GVNB 1Q1EA 2G0NA 2QRZA 1BIFA 4WXPA 4JLOA 1KK0A 2C9CA 3AVXA 1E98A 1VCIA 2RHDA 3W5JA 3FMPB 1LF5A 4EFNA 5FTJA 2GHIA 3QI2A 3SQXA 3FOZA 1N0WA 3CKLA 3NVAA 1OIXA 5JCPA 1XJ0A 1G7CA 1XCGB 4IKEA 1G3IA 3ZQ6A 3BH6A 4OQLA 1TQDA 1CF4A 2BKUA 3R9XA 5E95A 1CBUA 2NO0A 2Z43A 3K9LA 4URZR 2G77B 3IIKA 2JLUA 1OIWA 3AVQA 3QSYA 1N2CE 4MA4A 1U81A 4AIIA 3B9QA 4IOJA 4JSTA 3RHFA 1E1QA 3SFVA 5LD2C 2BJWA 1OFUX 1YRBA 2ZSDA 2GJ9A 1EFHA 4TYPA 1Z6TA 4Q4LA 3L82B 5C18A 5L3SB 4LHWA 2ZJ8A 4A1FA 1HA3A 5EE5B 3PVSA 4M0LA 2ZRJA 2J7PA 3CH5A 1LS6A 4YXWD 3MAAC 3THOA 3SC3A 3BOSA 4PHHA 4R71A 2GEUA 2B8WA 2GETA 1NF3A 1XD8A 1EWRA 2WWXA 3IEVA 2QGNA 4A36A 2R6FA 2B7BA 4NYIR 3LLMA 1G21E 2YOGA 1KDPA 1UADA 1KI6B 1OXVA 3GFTA 5KNCA 3EPKA 3OFNA 2XITA 3EZ7A 2ZU6A 4AG5A 1RRFA 4FI3C 3ZH9B 4QM6A 4JVNA 1R10A 1SHZA 3HPRA 3BAFA 1FZQA 5J40A 3V00A 4KJZA 2E1RA 1E2KA 5TMPA 2ZM5A 1WA5A 4I81A 3CB4A 1YZUA 2IA5A 1ESNA 2E87A 2VHJA 3E5HA 4V0NA 3NH6A 4DUGD 4US0R 3Q5EA 1UDWA 2AX4A 2IF2A 2PEYA 2QAGA 1N0UA 1ZCAA 3QIAA 4PC1A 4TN1A 1KMHB 3GPLA 4O25A 3TR0A 1Z08A 2CCJA 2JJ2A 3RS4A 1DBSA 4HSEA 3P26A 1R2QA 4RZXA 4MUAA 3TLXA 4JL5A 2Q9BA 3BS4A 3W8RA 4BASA 4OHZA 1T5LA 4URXR 2WPDA 1EX6A 2VHTA 4B44A 3THWB 3U2QA 2IEYA 5L3QB 5CLQA 2VTKA 3AP2A 3FMIA 1PLLA 4DB4A 2IEZA 4JYBA 4KAXA 4G3XA 2AFHE 1G4UR 1Q12A 5C4MA 4MGKR 3GJ8A 1G3UA 5F98A 1O3YA 5DLQC 3THYB 2CE7A 3BGWA 2R2AA 4KLZA 1DADA 1OH8A 3OEED 4P4SA 3LBNA 1OH6A 4ERNA 2ZRGA 3VAAA 1GNRA 3IBGA 1JQLB 3WYAA 4KCGA 1XEWX 4RZUA 5CIQA 4QGGA 4OQMA 2O0JA 3DM9B 2J9RA 1KZGB 1OHHD 3K9NA 3BB1A 1L7VC 1OV4A 1G1MA 1II0A 3BFVA 5JWRA 3KQUA 5GJWC 1NSTA 5A5GA 2ZS9A 4O0MA 1MT0A 2WBLC 1DOAA 1YR6A 3B6EA 3WP1B 2VBCA 2VLIA 2O52A 4URYR 3B2EA 4KHZA 1DG3A 1XCMA 5BN3A 4HAUA 4LWZA 2HXSA 1JR6A 3ZZ0A 1XX6A 1XXHE 3DVLA 2J41A 1OXSC 4JLJA 1NL3A 4LJ6A 2J0QA 3I72A 3GLGB 1U0LA 3KKQA 2R65A 1G5RA 4HUQB 2WJYA 4LK2A 1WF3A 4BGDA 1VTKA 3DO6A 1TQ4A 4Q1EA 4IW3B 3NWJA 1T3SA 1Z22A 4BFSA 2JLVA 4HDQB 2FA9A 2KBEA 5DISB 1ZIOA 3QENA 4M1TA 821PA 1TU4A 4CEIA 2FPLA 1U8AA 2BCGY 1N6HA 4PZYA 3T12A 2G0TA 5FR1A 3LW8A 1S1MA 2DFNA 4Q1DA 4DLWA 1FNNA 4OI0A 3FGNA 2IXFA 1XPRA 1AS0A 1RJ9A 1TNDA 1QBKC 1RW4A 4Z8XA 1XTJA 4GBMA 3MGCA 1B0UA 2ZI9A 4Z1MA 2WWFA 3V9PA 2GJKA 5KHOC 4DCUA 1P3JA 1K8RA 3AKDA 4X8HA 4F7WA 1IXRC 1Z0JA 2QU8A 5HKKD 4W9MC 1XF9A 2F6RA 3QXJA 1ZC4A 2XZPA 3CRVA 2QP4A 1SVKA 3MWLA 4QG7A 1FQJA 3SHWA 3CM0A 3A1TA 1DAMA 2CDNA 2ZS7A 3KXKA 4HAWA 2WAYA 2WJVA 3U44A 2WSSD 4B3BA 2AHOA 2EW1A 4KYIB 3EIHA 1TX4B 5FTNA 5FTMA 1IOZA 1BYIA 3KJHA 4JBWA 1SXJD 1RVDA 4XH9B 5FPSA 5CYOA 2FFHA 5K8TA 1P72A 2DFLA 4EQ6B 3QXXA 2ZJ5A 4PPGA 2ZANA 5JBQA 5FOTA 4ZI2A 2ZI4A 3LXRA 1W4RA 3KB2A 4Q02A 1MV5A 3T61A 5C1BA 5EQTA 2DWOA 3H4MA 3EAQA 1GNPA 3F5FA 3H84A 3VR3A 3EPHA 4QBFA 1VYTA 4TSFA 1DO2A 5F3WB 4DHEA 5HE9A 1LNZA 4FMCF 2Q0HA 2KWIA 4R98A 2NG1A 3QNUA 1DARA 3NEJA 3QEJA 2D3WA 4Z51A 3Q5DA 2GJ8A 4P32A 4JIMA 3IUYA 2ZJZA 2HT1A 3AGQA 3BFXA 4Q4JB 5FBWB 2JIZA 2NGRA 3BRWD 3WHKA 2UZ3A 3RWMB 3K1JA 3FVQA 1CR4A 5JS7A 4TLAA 4TLBA 1NMXA 1Z63A 3I1FA 3QG1A 4Q47A 2MMCA 2YOHA 2QEQA 1KZ7B 2ZI7A 4OL0A 2LCFA 2RGAA 3CIOA 1PZNA 4QBHA 4QGHA 1RFLA 2OE2A 2QN6A 3L0PA 1XRJA 4IVRA 5JHHB 1F2UA 3L8YA 4DT1A 2FDCA 1U2RA 5JI3E 5JHGB 2JGNA 2YWEA 3QPVA 5FL7D 4ZDJA 2IS4A 1DG1G 4OI2A 3K09A 2IUSA 5L3RA 3OESA 4TL9A 4BLSA 1DVRA 1YR7A 4G1UC 5JLJA 3FKSD 1W5SA 2YZ2A 2P5TB 3U4QA 1Z5ZA 1Q0UA 1S3SA 3AKCA 1H8EA 1TTTA 1YU9A 3QKTA 5KYKA 2F43A 4ZCMA 5KUTA 3QOFA 5A0FA 2WWYA 4MH0R 5JSZA 1DAFA 2F1IA 2GXUA 2F3TA 4LJYA 3AF1A 2BMEA 1OYWA 4HLCA 4Q66C 2EFGA 3C14C 2ZI6A 3C5CA 2WKRA 2C96A 4JS0A 4LI0A 1S96A 1COWD 2V4ZA 4MYHA 2QBYB 1NBMD 1FX0B 3BD9A 4M1WA 2ZRAA 4C0LA 3FWYA 1JQJC 3L0SA 3TW4A 5AJWA 2ZJAA 3IILA 2QMOA 1W44A 4IXNA 3W34A 3TK1A 1H65A 1PLKA 4WBSA 4DCNA 5B30A 5EP2A 3I5XA 3VX3A 4D4LA 1U0HC 1QHIA 5C2JB 4FWTA 2A5JA 4TLEA 3ETLA 1NIJA 4PFSA 3FDIA 1BOFA 2O8FA 1PV4A 5BYKA 1R0ZA 1UBGA 1FP7A 3ONWA 4BLOA 3VTKA 1JAIA 3OAAD 1YKSA 4DEXA 2GESA 521PA 2WSMA 2OXRA 5JRZA 4HZUA 4XSGA 1M74A 4IOKA 4LJ8A 2O0HA 2ASEA 3ICEA 5LD2B 1S9HA 2OLKA 4IEIA 1HTWA 4LRWA 4BZPA 4MRNA 1US8A 1RC8A 5C46F 1AIPA 5AUPB 1BS1A 2CCGA 3VR2A 2FF7A 4I4LA 3RLFA 1L4YA 4B33A 1SVMA 4PSVA 1W36C 4LJ9A 3OIVA 3SS8A 3CBQA 3ADBA 3LBHA 4TMVA 2WJHA 4ZO4A 2IYZA 3AKEA 2IYLD 4KI0A 5HCNA 4TL8A 3PG5A 5AJYA 4JL6A 3ZYCA 5FOXA 1JPNA 1N6KA 1E2QA 4XIGS 2EQBA 5DH9A 4DKXA 3I73A 5TDHA 2ZUDA 3MLEA 5DE3A 3KJGA 2IYTA 4IDHA 4B2PA 2PLFA 2QP3A 1Q3TA 1NLFA 4DSNA 1ZM4A 2WIBA 1CR2A 4GNKA 2DYKA 3VHLB 3QKRB 3P4XA 4EPRA 3REGA 2HJVA 4C0HA 2H92A 1W5TA 3HU1A 5DSZA 5CYPA 4MYTA 1QG2A 3NXSA 1XU4A 3WYFA 1WXQA 4CEHB 1LB1B 4XWOA 3T06B 2QROA 2FN4A 2VEDA 4NCHA 4D81A 1YZLA 1DE0A 1T6NA 4PAOA 3ZVLA 1JALA 5SZIA 4M22A 2AKAB 3EIEA 2FNAA 1Z47A 3MG9A 5L3SA 4R2HA 1E0SA 1E2NA 2YWGA 1VIAA 1KI3A 3E2IA 4OQFA 3W9YA 4JBYA 3AB3A 3WYGA 2J87A 121PA 4DZZA 2RB4A 4TLCA 6Q21A 2V3CC 3QPUA 2C9YA 1VG9B 3LXXA 3ND8A 3PUVA 2KBFA 4KO8A 1S3GA 1SQ5A 1O87A 1G7RA 1T8UA 4Q9IA 3KL4A 4LC1A 1E1QD 1KI6A 4R2IA 4ZDWA 5J4LA 2BEJA 2XB2A 3CRQA 4IJMA 1VHTA 3K70B 1T3LA 4X8OA 1G5PA 1XZQA 3TSOA 1II8B 1N6RA 4TYNA 1SVSA 2J7PD 2MMGA 1EG7A 3TNFA 1CIPA 3GFPA 4EDHA 3K0CA 2ORIA 3U3RA 1G20E 1JXMA 3K9HA 3N70A 3I8SA 3E70C 3B1ZA 1KMHA 2F7SA 3OFND 4AKHA 2AXNA 3G5UA 1MO5A 4QJ3A 5KOYA 3GLIB 4FXPA 5SZKB 1GUAA 4HLUC 4D25A 1JECA 2ZRKA 3SBDA 4D80A 3THWA 1E2LA 5L3QA 2WV9A 4XD7A 3MJHA 5B57C 1DTSA 1R5NA 1DEKA 4ASUA 1KO1A 5FI0B 2ZQ5A 2OILA 3A1UA 1GDDA 1TF5A 2IHYA 2IUUA 2V1XA 3KB1A 3THYA 1YHNA 5FOUA 4B35A 3D3QA 1CTQA 4QNMA 1P73A 3LBIA 4TQ9A 2PEZA 3QF4B 4ZI3A 4C0SA 3FTQA 3ND9A 4RD2A 4NH0A 3EA5A 5JS8A 4NONA 3SYLA 4FIDA 1SXJC 1E9AA 3K9GA 2WPDD 4OKSA 4PTLA 4DDTA 3P32A 4RJLA 1GRQA 4W5JA 3SI7A 3NBZC 1IM2A 5HZKA 3MUFA 2DB3A 3KZ1E 5DN6A 1K6MA 5KPDA 2EWWA 4IFBA 1DAHA 1OE0A 4LDJA 4DBLC 2W6JD 3IHLA 1ZVQA 4TQUS 5HR5A 3DKVA 5LB4A 1MABB 1AQUA 3AV0B 2PJRA 4ABYA 3RVBA 1P75A 4TMKA 4ARZB 4HI0E 1NBME 4Q1CA 1TL7C 4D82A 1HE8B 3GLFE 5BXQC 1G7SA 1W2HA 1GRRA 3BXZA 1WB9A 4CT5A 5EE9A 2C99A 2BJVA 4WZBE 2RCNA 2A9KA 3GD7A 1Q1ZA 1AZSC 2FSFA 4HZIA 3ASZA 2WMOB 2WOJA 4ZPXA 3GLGA 1IBRA 3QEOA 4JZKA 2R6AA 1KYIA 4KFUA 2EU8A 2P6RA 3NIBA 4HUQA 3B60A 1AKYA 5EZ5A 2BM1A 1MO3A 3HU3A 3SJAA 4C0AC 1E2DA 1V43A 2TMKA 3K70D 3R8FA 1KO4A 2G1KA 4R7ZA 3VU9B 1KDRA 4I1SA 2N46A 3KJIA 4LYJA 5EXSA 1C1YA 4V03A 4M21A 1TPZA 1XEXB 3RRNA 1R0YA 3LX8A 4RD0A 3RSLA 1G9XA 2GDJA 5JEDA 2Z4SA 1E9BA 2NPIA 2OXCA 3GJXC 4NCIA 2GWHA 3SZRA 2CVFA 1XMSA 4QGFA 4A0HA 1XB2A 4Q01A 1FMJA 5L8VA 2BV3A 3JZAA 4A8JC 4QM7A 4PPQA 4DLTA 1KNQA 4Q18A 1HY3A 4V0ME 4C7OB 2NO7A 4KVGA 4GT1A 1ZIPA 3NC0C 4TWZA 4PHFA 4WZAE 1IN6A 1COWA 1E0KA 2WJIA 3TVTA 3X1ZA 1TUIA 2NMVA 3EZ6A 1W4AA 1D8TA 3KQLA 1XPOA 4KXFB 1OB2A 4FMCB 3D31A 1E6CA 1MH1A 4Z1MD 1G19A 1Z0AA 5F2EA 3EIQA 1W49A 3KJEA 3ZQJA 2WZQA 3RYTC 5F9FA 4EQ6A 1FNMA 1M2OB 3LFUA 4RVCA 1SVIA 4GRAA 1F2TB 2D62A 1Z6YA 4CVNA 3B1WA 1GL9B 3TJZA 3RS7A 2DPXA 5CJ2A 3DOFA 3UANA 2J1LA 1OF1A 2FZLA 3GLHB 3G82C 2OM2A 1FW6A 2JLWA 2G88A 3M4YA 4B6EA 1F5NA 2P0EA 3DMNA 3AVTA 2FG5A 5DGXA 1KY2A 1Q44A 3QF7A 4CF7A 5B58C 2GKSA 4Q4JA 3LDAA 2RMKA 4DCSA 5EP1A 2QY9A 2C77A 1JJ7A 4V0MA 2F1HA 1NY5A 2BMFA 2I3BA 4IDOA 4PAQA 2ANBA 2YJTD 2I1QA 1W2GA 4ACBA 2X8AA 2R44A 3NEYA 4Q00A 2BBSA 4TSFD 2CLSA 3UMFA 1W46A 4BZQA 1FL9A 2VP5A 2EFEB 1KAGA 2GXQA 1I2MA 1ZNXA 4NYMQ 3PUZA 4RFSB 2HT6A 2RGGA 1Z8FA 2OUKA 4B2LA 4HATA 4MKIA 3AEZA 1M7BA 1OXUA 1YZTA 2AXPA 1F3OA 4DWJA 2JIZD 5TV2A 4LJ5A 1S9DA 1R0WA 4JSYA 2W0SA 2RGBA 2YC2C 1ODFA 4L16A 2BC9A 1N6NA 4L5BA 4LYFA 2PZFA 2XSZA 2IYVA 4JLAA 3SNHA 4LSGA 1E2IA 5TB5A 3EPLA 1KDTA 2CLCX 2ODBA 3AF2A 4KV9A 4D4JA 1KKLA 1OW3B 2XJ4A 3H0KA 1YZQA 4L8GA 3CWQA 1A7JA 4OHYA 4HDCA 1W36B 1MO4A 4LGMA 4OK6A 3AUXA 1J90A 2P65A 2D7DA 1N6LA 4BRWA 1XTQA 2HDNB 4B6FA 5FOVA 5EXTA 3I5YA 4CGZA 2YINC 1FX0A 1Z3IX 2SHKA 2H5EA 1CXZA 1CKEA 3CO5A 1H8ED 2XNDA 1KOFA 4LJAA 4Q5IA 2ZYTX 5FPHA 4LHVA 2ZVPX 4G01B 3U60B 1JJVA 2VSOA 2ANCA 3BH0A 2VP6A 5FPKA 2ZSAA 3BK7A 4QRHA 4LHXA 2V8OA 1ZNZA 5JWHA 4B71A 1KJZA 1E1RA 4JJKA 4RCZA 4Q1BA 5CM8B 1JEDA 3VKHA 4EJSB 2IYSA 4PC6A 5FH9A 1J7KA 4KODA 3WXMA 1IN5A 3MD0A 3RRMA 1YZNA 2JEOA 5GVSA 3JVVA 4Q1FA 3WNBA 1CLUA 3FMFA 2XTZA 3IQWA 1GKUB 4KFRA 4RZ3A 3SBEA 4EIWA 1YE8A 3LAWA 1NLZA 1U99A 4W7SA 5DI3B 4P3YA 1KK2A 2GAAA 2FPMA 4GDFA 2CL7X 2AR7A 1ZNYA 1E2FA 3CRRA 4KITB 1PUIA 5IT5A 1OT3A 3VR1A 3RDPA 4F38A 4DLUA 2GCPA 2FEOA 2G3YA 3QG5A 4XVRA 1G8FA 2A5YB 2JCSA 4Q1AA 2H1LA 3HP1A 4NE2A 3FFAA 3KFVA 1Z0KA 1NN5A 5BYJA 4OQXA 1N6IA 2GJSA 1TF7A 3MRSA 1MR3F 3IIJA 1WMSA 4M53A 3DHWC 2FGJA 3B1XA 2ATVA 1Z06A 1OSNA 1HT1E 3RABA 4DDWA 1E4VA 3RS2A 3QKRA 2VYFA 2VF8A 4P31A 1FTNA 3MMPA 3H2YA 1D2NA 1R4AA 2W2TA 1E2PA 3GMTA 3FKQA 2W6JA 5FOWA 1P2VA 3CX8A 1Z28A 1NVVQ 3W5IA 2XNSA 1EFRA 3CLVA 1I4TD 4C2UA 5JCZA 1J99A 3KDSE 2UVQA 4Q7LA 1E2JA 3PUXA 1QHYA 3SE0A 1KI4A 3TR5A 1ETUA 1W1WA 2HUPA 2JJ1D 2QENA 4TL6A 4PX9A 5BW8A 2W2XA 4D26A 1HE1C 4WW0A 3ADCA 4LV5B 4FCVA 4LOAA 1CJTC 4F4JA 4S35A 2PCJA 1U0JA 3WNCA 4WVFA 4UNQA 1NMZA 1WCV1 3FB4A 3Q85A 1OB5A 5K8UA 3VHXA 3AVWA 1E9FA 5GJBA 5IHPA 4EFMA 3UG7A 2WICA 3X2SA 1X8JA 2O0KA 4HLDA 4M8NE 4NYJR 4HB3A 1IY0A 4PQFA 1N5IA 1KAOA 1II8A 2HF8A 2D74A 2ZIAA 1VCNA 2C78A 4ESVA 4PPFA 4QXAA 2QUZA 3AF0A 4UNSA 3OEHA 4GSYA 5LPNA 1TQ2A 1MO6A 4BE7B 2OESA 5D3MA 2JLXA 1GOTA 2A5GA 3HR8A 2H8KA 4ZDKA 8OHMA 1IY1A 5JRJA 2IC5A 4ILEA 2ZYWX 5LDDC 1FTSA 4M1SA 5DO9A 1R8SA 2ZITA 2A3RA 3IPYA 4NHOA 5FBQB 3KQNA 1QHSA 3G0HA 2D2FA 1JEEA 1D5CA 3GLIA 2IUTA 4LYAA 4E22A 4Q7KA 4LX0A 5IRCD 2AKYA 1GIAA 4A2QA 1A2KC 4HDOB 2VP2A 3EC1A 5FUWA 3GP8A 3PENA 1W4BA 4A0RA 4C2TA 4BLRA 3TBKA 4UJ3A 4TMTA 5H8WA 4QJ4A 3OZXA 3TKLA 4BPBA 3VNVA 3QF4A 1VECA 2IHBA 3BJIC 2JATA 3TW8B 1Q57A 4M9ZA 1RE0A 2QL6A 2IXGA 3BORA 4XD7D 5EUQB 5KDOA 3U61B 2PCLA 2GK6A 4ASUD 1X86B 5KDLA 2RGDA 1AZTA 1NN0A 5C4GB 2HYDA 4LPSA 4A8JB 4GL2A 3RSOA 2GZAA 1P9WA 1MABA 3W90A 1RYHA 2XTNA 4NP6A 1CJUC 3O8CA 4ARZA 1P2SA 3LV8A 2GJAA 1XTSA 2J0UB 1C9KA 5FTLA 4TZ0A 4UQOA 2HXYA 2XXAA 3EARA 1ZM7A 3TQCA 5DN6D 1G6OA 5J4KA 3EX7C 3LVRE 5CJPA 1Y63A 3LY5A 4Q4AB 4N0EA 3P4YA 2WJGA 1RKBA 1ZUHA 2EFHB 2GRJA 3K0AB 4DDVA 4I1VA 4EUNA 1UKYA 1RPZA 4G0NA 3CR7A 2OFOA 2UZIR 5EUMA 2QORA 3TRFA 1R5BA 3VU9A 3A58B 2Q3MA 4MDEA 4MKFA 1ZU4A 2I1VB 3NDBB 3NH9A 4XSHA 3W6OA 3KXIA 4II7A 4JT2A 5EP4A 2RGEA 1XEXA 4NYIQ 2V55B 3D6TB 1GAJA 2HJGA 1F6BA 4LCBA 4NCNA 5GADl 2ZJ2A 3WMGA 4ZIRB 1H8HA 1A1VA 2ZRLA 1NRJB 2R62A 3HYTA 1I4LD 2VHQA 3N2IA 3T15A 4BFZA 1Z6XA 5CDFA 3QQ5A 3UMSA 2YKGA 4C7OA 5G3YA 2C04A 4TTPA 4K81B 2JLYA 4JLPA 4NU0A 2JLRA 4RD1A 4IDQA 1Z6GA 2B6HA 5KSZA 1OH7A 2H17A 3RANA 2QMEA 4ZCLA 4IXMA 4NCKA 1JNYA 2JDIA 3SEAA 2ZU0C 1K5DA 4QNRA 1KO8A 3QBTA 2IT1A 2B8TA 2DY1A 3SJZA 3EZFA 1D2EA 1P2UA 4YQFA 1NN3A 4PC2A 4Q48A 1KI1A 1MKYA 2CLDX 2B21A 3B5JA 2Q3HA 3QXHA 1Q22A 3MWJA 5EJEA 5FL3A 1P62B 1HV8A 1F2TA 2EYUA 2MSEB 1Y3AA 2ZUBA 4QBGB 5AJXA 4KFTA 1Z0DA 1OH5A 1JI0A 4IEEA 2IX3A 3LX5A 1ZD9A 3GLHA 4DDUA 5E4FA 4A6PA 2N42A 1C4OA 4AURA 2OCYC 2ZUCA 1EESA 2BWJA 2OHFA 4L9WA 1RRGA 5DYGA 4B3DA 3EASA 3EC2A 4Y0VA 4QFMA 3WBJA 3WRXC 4BZXA 4OJKA 2JASA 3LD9A 3KUDA 1NKSA 2X2FA 3ZGXA 3W3ZB 2PBRA 2H7VA 4NKRA 4E03A 2WKQA 3B78A 2GF0A 3DL0A 3TGPA 1W7AA 2BOVA 3T5GA 3ZD6A 1GKYA 5CK4A 4RFSA 4U02A 5EXXA 4A15A 1GL6A 4HUTA 4B74A 1BKDR 4GMDA 2XAUA 1KO5A 3PEVA 2W00A 1QRAA 5G40A 2NO6A 4DLSA 3RC8A 1AJEA 3ZJYA 1T3HA 4EPXA 2RGNC 5CLLA 5EE0A 3W8NA 1N5KA 5GJCA 4DLZA 3LH5A 4US1R 4F4IA 1TU3A 2R6DA 1ZJ6A 2WOOA 3WBKA 3KKOA 3A37A 2ZREA 3DKPA 3I92A 4PQYA 3NBFA 3R20A 3RWOA 1KDOA 1R7RA 1DELA 1KK3A 421PA 3LRPA 1G8YA 2OEPA 3U3OA 4D0LB 1J2JA 4F93B 4OHWA 2V6IA 2YV5A 1E9CA 3EW9A 3U7EB 1SVWA 4F4CA 2IK8A 1SVLA 2JJ1A 2L0XA 2ZRPA 1E99A 3EWAA 4LZZA 3ASYA 1M34E 1G18A 2HLDA 3IO3A 3IHWA 1HQYE 1YJ5A 5E3HA 3BB4A 4K46A 2KI5A 1FMLA 4JLDA 2XSZD 2ZJOA 1CP2A 2ZVQX 3BWDD 5EE1A 3D8BA 1WDTA 1A5TA 4PO1A 2O8EB 1NVWQ 5E7JA 4FMBB 4QHTA 5TARA 1XD2B 4AKGA 3I32A 4EJSA 4EPTA 2A7QA 2ORVA 5P21A 4DLVA 2NQ2C 2ZR9A 5CK5A 4BFWA 1TAGA 2EFCB 3X1WA 1NJFA 1T9HA 2WKPA 1UF9A 1OPXA 2XNDD 3SR0A 4N3NA 3A8TA 2D4HA 2P6UA 3BIFA 2IWHA 1ZC3A 4U00A 1IXSB 1JR3A 2ODEA 3HYRA 5JMTA 3Q72A 3IPXA 3QUSA 5DI3A 2PX0A 2ZSFA 1E1RD 2CL6X 4KYUA 3F0TA 2WVJA 4MGIR 3B82A 2V9PA 2YNMA 3K0EA 3TVDA 1FOEB 2OZEA 5KTYA 3K0SA 3C7KA 2GZDA 4L15A 1ZAKA 1UM8A 3TMKA 2OAP1 2ZRIA 1E3MA 5JJLA 2KJQA 3ZZUA 3SOPA 3JZMA 2ZYUX 5JJKA 3CF0A 1FUKA 1N6PA 3SQWA 4OHVA 4B75A 2ZE8A 3LNCA 3CUEF 5J4VA 2VL7A 3TIFA 1E0JA 1KNXA 3K0CC 2QRNA 3M0EA 3RNLA 1U8ZA 2FSGA 4HEJA 3PUWA 4LBWA 4PSAA 3U7FB 1WBBA 2O5VA 1P7CA 2FMXA 2N1BA 3C15C 3WHLA 1EFCA 4KU4A 4E07A 2WWGA 5A4JA 3ZDQA 1M8PA 4BQSA 1XMJA 4D4MA 2ZAOA 3CNOA 4G5SA 2H16A 1YRAA 4AC9A 2WM9B 3KKNA 3GLGE 1EFUA 2NOAA 3EA0A 4B34A 1KI2A 1ZD8A 3B7GA 3ZS8A 2RAPA 2C2HA 4LJ4A 4ZDIA 5AUNB 2W6IA 1YQTA 4PHGA 1P5ZB 2FU5C 1R0XA 2WHXA 3QY0A 4B73A 4B48A 1XJCA 4V0KA 1GL7A 2HEIA 3Q8XB 1DPFA 4LC0A 1ZM9A 3CW2A 4JL8A 1Z29A 4B3CA 1EK0A 2W58A 2OT3B 4IRUB 2BDTA 1MOZA 1VG8A 4WZ6A 4AKIA 4G5OA 1M6NA 4TT3D 2IYRA 1OFTA 2VA8A 2P3SA 2WMNB 4TQAA 2GXSA 3WMFA 2ZROA 4LV6A 4M9XA 3QVVA 3O47A 4IVQA 2YWHA 3NBXX 2O8BB 5BN5A 4DCVA 2A78A 3KKPA 1EFRD 1VG0B 3Q7PA 3FHOA 5JWOA 2BBOA 1E9DA 2W83A 3B8HA 3ZVMA 1VKJA 3AP1A 4UXJA 1XMVA 4X8LA 2OFXA 4QJ5A 4DSTA 2JA1A 1ESMA 1E2HA 4I1OA 1YR9A 1XXHB 2CNWA 4DLRA 2NTYC 5JFGA 3CNNA 2Z5FA 3CONA 3KKMA 1P2TA 4YC7A 2VP9A 4QC2A 4DC9A 2GCNA 1OLOA 3SN6A 2H57A 1WQ1R 1GP2A 1QHHB 2GAOA 4AYTA 2HCJB 4B3FX 2ZETA 2KE5A 3NHBA 4I99A 4GI7A 4OI4A 1YZGA 2OO7A 5KDDA 2CHQA 2GNOA 3A6PC 3MJRA 4MRSA 3SU8A 2ZYVX 3W3AA 3OEHD 1UBEA 2BCJQ 3PFIA 1HQCA 1IHUA 1FPMA 1T4GA 2B7CA 3QJYA 2QSYA 4EPVA 2X1VA 1TADA 1TMKA 2GA8A 1IQPA 1FFHA 2QT1A 3PV0A 3FHTA 1L2TA 2ZSEA 5JECA 4A4DA 4EKDA 3CPJB 5CIWA 4JVSB 4UKDA 1XP8A 1ZM3A 2OCBA 3IGFA 2FSHA 4C3ZA 4QBIA 2QTVB 1ZBDA 1UBFA 4WXRA 5CB8A 4ACAA 4B2IA 4URVR 1IN8A 1JXOA 1LF0A 4KBGA 2P67A 2ONKA 3HU2A 3ZIAA 1LVGA 4A8JA 4JKYA 1VIYA 1M1YE 3A4LA 4TL7A 4CYMA 2OAQ1 3LA6A 2P2LA 1EXMA 2GVDC 2AL7A 2J0UA 5D3QA 4HB2A 2HCBA 3QKUA 1RRCA 2G9NA 2HYIC 1I4DD 2F9MA 2XOKA 3EWSA 4AYXA 3X1DA 1KI9A 2BEKA 4GOKA 2YHSA 4JLKA 4AKEA 5K8IA 1HT2E 2DWQA 1D9ZA 4PANA 3LLUA 1GNQA 1E4YA 3T5DA 3CRW1 1GFIA 1CJKC 1ONBA 1TEVA 1N5JA 2FWRA 2WWHA 3K0AA 4TMZA 4KLNA 1U90A 4Q9JA 4EAQA 4QOSA 4FW9A 2JLSA 4TYWA 1F48A 4TYYA 1OKKD 4FMDF 4FWIB 4BLQA 2ZRNA 2ATXA 3HPQA 3AP3A 4GP7A 2BHRA 4Q7JB 4CDGA 4B3GA 4OHXA 1RRPA 4Q9KA 3U3MA 4RKEA 2X77A 1M7GA 2V7QA 4HAVA 4CW7A 1P61B 4ZIRA 5L3VA 4RY2A 2IBMA 4ZKDA 3CR8A 3EZ9A 3WY9A 4TZ6A 5FPYA 4DSUA 4M1OA 2FFAA 1ZU5A 1U9IA 3S1AB 4BFYA 4AI6A 5FI1B 3GCGA 4AD8A 2GBLA 1CU1A 2QSZA 4QKQA 1KJWA 2XJ9A 1T91A 4MQBA 3SDZA 4FN5A 1L8QA 1OXXK 2C8VA
chains in the Genus database with same CATH superfamily
1C2YA 3P27A 1LDYA 1C8VB 1E96A 1HYQA 1TZBA 3AVPA 4MKRA 2VTEA 3NWEA 4ZA2A 4AZVA 4YUXA 1KJ8A 1XCOA 2CXTA 3F7NA 3SEFA 3H5OA 2BGWA 2O3TA 3ZDBA 3O03A 4EI2A 2O8CB 4KXMA 5LLDA 1G5IA 4B1FA 4IIFA 3U6BA 2V5VA 1KI7A 2HMUA 3NHJA 4AG6A 2XTMA 1CW2B 1PK8A 1BH2A 1VYVA 5IJ9B 2PPLA 1QRRA 1RWWA 3S68A 2QBYA 4R8RA 2Z3WA 3H9JA 2Y2VA 1ZHHA 2H1CA 1LK5A 4OAQA 1AKEA 2GJ4A 5GONF 1RXEA 3T6KA 1KY3A 3DYBA 2I4MA 2ZRHA 4IO1A 3QA9A 1M6YA 2XZOA 2IY9A 5JNWA 4N1AA 3WK6A 4DQ0A 4L4UA 1NIPA 4KSBA 5KJEA 4E2ZA 1XAJA 4LGYA 5IVKA 2A9VA 2H7YA 2RKWA 3DYVA 2RGWA 1DRJA 2FPRA 2NT3A 3NP7A 1DDGA 1CD5A 4JOSA 4RORA 3UATA 4YLYA 2CHGA 2RIRA 3A1SA 5HW0A 3ZTYA 4Y18A 1IYZA 4IQ0A 4XFJA 3E58A 4NAHA 3NIWA 2IV7A 1PR3A 2D13A 4LYGA 3ZJVA 2BFFA 4MUJA 3C16C 1O95D 4NZMA 4ND1A 2VDWA 1J49A 3GFOA 1ZMXA 3PNSA 2VNSA 3PPVA 4XW2A 1M2JA 1DQZA 2EP5A 4FN4A 2NTVA 3E82A 1UC5B 3GJ6A 3KFLA 5EJ2A 4QDTA 1E9RA 1CZUA 1JDPA 2IYYA 1EGVB 3RSCA 3UH0A 3ZE0B 5MFPA 5LQRA 1JFLA 2QRVB 4IPTA 4QYMA 2ZWIA 5IN4A 2I3DA 2W8ZA 3PS9A 4W5HA 3FVTA 1HOTA 1T3GA 4FKZA 4ZOBA 3HNRA 2Z8ZA 3FAZA 4RAQA 2CEKA 5JEEA 3DPUA 4FSXA 4K6HA 5JXHA 4XM0A 1CUHA 4YRLA 3V7FA 5CG1A 4YRRA 3IOMA 1T4CA 5CLHA 3O91A 4BNWA 3IDZA 3X1XA 4JYAB 5IYZA 1MIHA 4FOLA 1D4OA 2KSQA 3WYBA 4JXJA 4N5LA 1D9XA 1LU9A 1NATA 4NICA 4DNXA 5HCIA 2OZPA 5GIOE 1YQ9A 3GG9A 4Z4IA 3K8ZA 4R81A 2F1JA 1IQ0A 1UDXA 1U0RA 4O2LA 3RRZA 3KKZA 3ESYA 3TLZA 4DMKA 1PGOA 2FSIA 3HQ4O 4PNZA 2UYOA 4ZU3A 4DN6A 3J81k 4IOLA 3N28A 1T8YA 3HJNA 4R68A 4GC5A 1THTA 4Q1VA 2HZBA 1A8HA 4MVJD 3VBCA 4W5NA 3LF2A 2IYWA 2DZDA 3NXKA 3WLOA 2H3EA 3KFXA 4LHYA 3EBOA 3MK31 3OCJA 2P2DA 4UZEA 5DZSA 5BVHA 2A9PA 4GYWA 1FYVA 1XWIA 2GK7A 2ZUWA 3LF1A 3HZRA 3LLSA 3C1OA 4KRGA 4MB2A 1AU9A 1UEIA 3N87A 4KYTA 4QL3A 2BGIA 1THZA 2H54A 4CLRB 1TAQA 3AVUA 3MZ0A 4IBOA 3JRXA 4B7XA 1ZYUA 3RJ5A 1K7YA 3CVWA 4G2NA 1QS0B 1WSDA 2UXDB 1XD2A 2ERYA 2AQHA 1XNJA 4HAYA 4G9EA 4Q21A 4V0LA 1SHKA 2MSDB 4ITUA 1A9XB 2OG1A 3QFFA 1J2UA 4Q0MA 1SBTA 1XQXA 1JE1A 3KAJA 1UFQA 2VP0A 2BBTA 2FPWA 2KYRA 4UM9B 3D6MA 2A58A 1TQ8A 1OU0A 3G1WA 4NPHA 4Q39A 3T3IA 3U1TA 5IW8A 3ZGVA 1XCLA 2ECFA 4LPKA 5PGMA 4TXHA 1EUCA 3PNPA 3GJZA 3M1AA 2G07A 5BN4A 5EXEA 4WCDA 5ALFA 1NURA 3PNLA 4I66A 3ZV4A 1DV2A 3OZ7A 1LFAA 1TEHA 4HUJA 5FUXA 3ETCA 4EF6A 1DGQA 2OV6A 2ZJBA 2W2LA 1P5JA 2NZVG 4ZYTA 2BSQA 1G21A 1Y8RA 3OHMA 1DKQA 2BM9A 5CD1A 4FS8A 2SICE 4RF5A 2CZCA 2W2VA 5KKCA 3A6EA 4EHIA 4AN4A 1OC2A 1DKLA 3DCNA 2B4QA 3BREA 3MLAA 2XA9A 3ONVA 3U3KA 3UKOA 3S6JA 5FUQA 2FQQA 2E6KA 2IX9A 1J8VA 3E81A 3TOCA 2GTHA 4FEYA 1R4NA 1VLHA 4NMXB 4D4JA 2Q1TA 4LV8B 5CUQA 4D46A 3MWKA 2RGXA 3D3WB 3OT1B 1CQPA 3IKJA 2NO1A 4O0LA 4P8RA 2PX5A 1QP8A 2WIAA 1G20B 1P4HA 3ICWA 1MJ5A 1HSOA 4QHYA 2BKAA 2PS3A 2ZR7A 2VBIA 3RT9A 4Z54A 2XA2A 1K86A 4ZKEA 3PXGA 4GG1A 5I7UA 1IZYA 4US2R 2GXAA 2DPHA 4OOFA 4H4CA 3OTHA 1JQ5A 1RHKA 1JUDA 1PGJA 4RSHA 5K3DA 1HMYA 1J8DA 1MOSA 3IJEB 1JKMA 3UV3A 4Z4FA 4HGPA 1M8JA 4MKGA 4RHYA 4WFKA 2P78A 2YZNA 1RQLA 4X90A 2DPYA 4WTOA 1NSFA 4BLPA 5ANRB 1OIVA 2HC9A 2PMKA 4NZNA 4LZOA 1N1GA 1MA3A 3NETA 3CLUD 1DAEA 5DTQA 2JB9A 3LLVA 4XB2A 1Q0QA 4C30A 3DZIA 2B92A 4G0PA 1LLFA 3A9VA 3AERA 3EVFA 4PX2A 4RM3A 2RGCA 3L0OA 4DXAA 3R3SA 3WWCA 1TF2A 5FBLB 2G28A 2FN8A 3UMJA 1P0CA 2FX2A 1NUUA 3CS3A 4KWIA 4JP3A 2I99A 1XC7A 4D6YA 721PA 4KV7A 5HJEA 1UAAA 3E1SA 1C3EA 1GUYA 4N6GA 4XYLA 3KTAB 3ED1A 5G02A 4G0VA 4XUGB 4YJ3A 1KERA 3I6ZA 5CDFE 3UKDA 1NQOA 9GPBA 4RHEA 4MB6A 5BUQA 3W4JA 3LT5A 2IWRA 2COUA 1YI0A 1QQTA 1ARZA 4LF5B 3L40A 1GZ3A 3OU6A 4PONA 1MUUA 4QRDA 4XPIA 2PUGA 3NOVA 1ZD1A 3T7CA 4BFUA 1I6MA 4X8MA 3DT8A 1WRBA 1Q95A 3GEEA 2ADFA 2AWNA 4F6RB 1NQTA 3I4CA 1Z2CA 1AK2A 5HJ7A 4IWXA 3Q8MA 3KQQA 3IVRA 5A3SA 1TDJA 2JJQA 4TVKA 3GARA 3R0ZA 4KEAA 4QXMA 3K6SB 2Q6VA 1QX4A 2Z9BA 3QTTA 5JBIA 3WX0A 1QGUA 3HBMA 4U2CA 1U3GA 3G8CA 4OYHA 2DH5A 4F3RA 1L9XA 2XVZA 4J1NA 1PYOA 4DCJA 5A9RA 2J7KA 1H93A 1N2ZA 4KXWA 2UZ1A 4Y6OA 4E1AA 4EKNB 4RKFA 2C8KA 5BMVF 1QYDA 3BSWA 3L41A 5CM2Z 2HQ1A 5BV2P 1BVHA 2FHPA 4RPGA 4C4ZA 2JGLA 1JQAA 1NOKA 4Z0HO 5IK2A 1SKYB 4UCXA 3RHZA 3HJCA 3OIWA 3E7DA 3GLHE 3SZLA 3T41A 1YQDA 1BXRB 1I3LA 3AINA 4D9JA 4FEAA 4L50A 3A3KA 4E31A 2F90A 3OF5A 3NCTA 1YOVB 1YHZA 3A9RA 4RTKA 4WCFA 3NM6B 2XGMA 3WMFA 4RULA 3C5HA 4YCJA 2BBWA 4CDRA 1U1CA 2XYVA 1CZNA 2FZ4A 2XHZA 4L8WB 4MQ6A 3RQIA 1CUAA 2HO4A 2Q3BA 2IE8A 2FEPA 3BTOA 1GILA 2DT8A 3GJSA 2P5UA 1LD3A 2RH8A 2WM8A 3OKAA 3SIPA 3AIOA 2BZ1A 2OG2A 2W48A 2XADA 4RV4A 3V8RA 4BX3A 3V7UA 3L4SO 5HIIA 5T3YA 4C08A 1R0CA 2BEUA 2FEMA 4I14A 1EJBA 1Q6YA 2AJDA 3D54D 3BZUA 2GCOB 2QTVA 1DO0A 3DVAB 2GR9A 3LUAA 4LBZA 1NQ5A 4G4IA 1ZGAA 1ABBA 4BNTA 1EFVA 4ITRC 2ODWA 2N1MA 1T9ZA 4LECA 3QYPA 1EFTA 4D97A 5AM0A 3D4PA 1BHJA 1KZ1A 3IS3A 4TS9A 4LE0A 4XM1A 3K9CA 4P6VF 3TUJC 1RMYA 3M1IA 1GO2A 5G41A 1NP3A 4UTOA 2VRWA 3KQPA 4GBJA 4JH0A 3FIUA 1GRCA 2IXTA 1LLQA 5P8WA 1O9GA 3DXFA 1XZDA 3L6UA 4MQFA 4QUJA 4RXTA 1W19A 1F8UA 4RK5A 2REQA 5EZYA 4HVLA 4D45A 1P60A 4LF6B 3U3ZA 5F52A 3RFCA 1QH1B 4DV1B 2OSBA 5L4NA 2WAAA 4A23A 4DADA 1Z6AA 3HYLA 2QZPA 2JGDA 3QVUA 5JH7A 3Q3JB 3U1VA 4CT0A 1EG2A 3IMKA 1LS1A 3DEFA 2FZKA 2VJMB 2QN9A 5IDVA 5LP6B 2FYTA 1OU4A 4WIAA 1TQ6A 4BUZA 4NZYA 4EW3A 2IBSA 5DOZA 2XKAA 1U0GA 3WWDA 2QU7A 5FBRB 1GWNA 2X6RA 4C0BA 4B3MB 3DAPA 1AUVA 2OBMA 1XSEA 1T6ZA 1EGAA 2PQMA 3NCHA 3RSZA 2AOUA 3DE7X 4MW5A 3OLXA 5BQOA 5HIAA 5GM1A 5H59A 4UUBA 1SQGA 3L7CA 4EO9A 3GJ0A 2BDEA 4TN5A 4JENA 3BM5A 4H9GA 4Q3EA 2O5RA 4BB6A 5IBQA 1JFRA 2NUAB 1I9CA 4D6XA 1UT8A 3R4CA 2NWQA 3RYCB 1NNEA 3EUEA 1U7WA 4DGQA 5AOBA 1IY2A 5ABPA 1PJRA 4IHQA 4R8KA 6GPBA 1EQ2A 1Y7LA 1OREA 1ZM2A 4IHKA 4YV1A 4E5SA 4EHFA 1R5OA 3DB2A 3DCYA 3K2QA 3VZCA 2X5JO 1G55A 5C5IA 4FEGA 4OHKA 3WO1A 1UXHA 1G5QA 2CNLA 2C82A 1DXYA 1K7FB 5BQ5A 3VHQA 2UAGA 3GJ5A 4BEJA 2YIJA 4XAQA 3GJYA 1JNXX 4JR0A 2B9VA 1DC5A 4YRCA 3EXFB 4XLZA 1QOZA 1D6SA 3AZQA 2PMCA 3LJKA 3GFBA 1ENPA 4RHTA 4BNYA 4C0QC 4ZT5A 1JR3E 4Z9XA 1YTUA 1XRLA 1U5BA 4ON9A 2BEWA 3F98A 4HWTA 2CVHA 3TRJA 4CI9A 1SKQA 2Y4OA 4WXEA 4ZYUA 1NI3A 1ZP6A 5K0NA 4MR8B 2REXB 4P4GA 3C41J 3AVOA 4KAFA 4TS4A 4IFEA 2R9VA 4DEYA 2XR1A 5AWFC 2HY7A 5ULLA 5ECYA 5ICGA 4JVLA 4S0XA 3ZWXA 4G1FA 3UH1A 4JVOA 5IAJA 2XOEA 4FVTA 1RR6A 5A4DA 3ZCPA 1V47A 4GICA 3WYNA 4JEMA 4NULA 5M7EA 3FZQA 1W47A 1X9GA 4Y0AA 4N39A 2FETA 1UFRA 5KTKA 2ZT5A 4OJQA 2H5JA 3JSAA 4UXIA 4LZNA 3GYBA 4N3CA 1N2CB 1CWUA 1EWTA 1QKIA 2PZJA 1NVFA 3E7PA 4ZV7A 1A88A 4NJOA 4RK6A 1C9NA 1QF9A 1J5XA 2VHVA 4CEJA 4D96A 4PCUA 3D6FA 2PH1A 3EGOA 2FQXA 3GRYA 3KZNA 5AVJA 4ZVVA 3SFZA 1AKRA 1R9GA 3OQVA 1G16A 4O4IF 3IODA 4YO8A 2OCPA 4P33A 4S1PA 4HAZA 1OHHA 2JIQA 4QO8A 1I4WA 1PJSA 1J5PA 3AL2A 4QPZA 4PBRA 3RK1A 1YV9A 4WBNF 1E1CB 3ML1A 2GBCA 3IOCA 3OE7D 1NJGA 1TIKA 3IR5A 2J3JA 4P4SB 5EG5A 4ZMRA 4ZQFA 2P11A 2VJNA 3VKWA 3JATB 3JY6A 3L8MA 1PZEA 5KJ1A 2O7QA 1XUOA 3QE3A 3I6BA 3AEUA 3NBKA 1Y1TA 2ODAA 2VYQA 4RTNA 1F8FA 1UPAA 2WUFA 3RS5A 3U80A 2HA4A 1P17A 3AESB 2CUTA 3PQEA 1K6IA 4IDCA 1DIOB 3C43A 4UC0A 5C8ZA 1SCUA 1X1RA 4NL4H 4X20B 2YNMC 1QHFA 3VNUA 1Q11A 4OQ4A 3PQCA 3ZY4A 4V1CI 4P9NA 4UCQA 2QG6A 1SGWA 1II9A 2JHAA 4CM5A 2VSYA 3R5HA 2OUIA 2VXBA 4X54A 2BKLA 2P4UA 2ZJ6A 3R3JA 4FDUA 1GFZA 1VCMA 3I6QA 2JF0A 3DEYX 4G0XA 3ZTWA 3FHCB 5JXJA 4Q3KA 1A0OA 4M1YA 2ACKA 4RF4A 1ECBA 2ZRCA 5HRAA 3CZ9A 4R7GA 2YWFA 2FW1A 1WCYA 4Y1GA 4TKVB 1TKBA 1EI9A 2ZSUA 2R1ZA 2QRMA 3RT7A 3HWWA 1B6SA 5BV7A 3PITA 1QZ3A 1IU9A 3NKVA 3LXUX 1HKHA 4BVBA 2VFAA 2X14A 4ALNA 4HGYA 5JZOA 3M9LA 5FCDA 1UK6A 3MTEA 2IPLA 4RESA 3I8XA 4H60A 3GGOA 3AY7A 1NQVA 2E4WA 2NQ8A 5FBVB 4HLUA 8LDHA 1ZD5A 1G17A 1U5CA 4MKHA 1UZAA 1XFAA 3ZDDA 1T10A 1YL5A 1QH9A 3W04A 3ST7A 5HZHA 2IOYA 3NYRA 4BLVA 4UZFA 4ZCIA 2FOLA 4FZ5A 3T7EA 2ZYHA 2DUJA 1TCBA 2BEVB 3A9TA 4NEGA 2B2XA 1L6IA 3G0GA 2DQKA 2XUJA 1JFFA 1PWHA 3IEXA 4HSGA 5FWAA 3E9CA 4FE3A 1E69A 1UJ5A 2GZHA 4CEIB 3ILVA 5HM6A 1FJGB 3OUZA 3AJAA 2C20A 4PO8A 3EF0A 1FJXA 3RS0A 3JQ8A 4OQNA 3Q2KA 5DNWA 3EGCA 2P30A 2P62A 3I3SR 4ZI7B 4N6OA 1G64A 4MR9B 3KKKA 5D3ZA 1K98A 3CUYA 3IA2A 2QNRA 4A2WA 4CJXA 1OAOA 2VSXA 4A82A 2IY8A 7MDHA 5LQDA 1OXTA 2P5YA 3UC9A 4QTUB 5C37A 2Z0MA 4YQEA 2YV2A 3QVGB 1BU8A 3O3OB 1PJ2A 3AR7A 3V2GA 3AVYA 3I1JA 4J90A 1UBKS 1TECE 2BY4A 1A4RA 5EIXA 3OFKA 1N33B 1LZLA 3NHAA 3RV3A 2HRBA 4TTQA 1IK6A 2IS6A 2P75A 1ZCJA 5GV8A 4X7MA 4ALKA 3U44B 3FJOA 1AKVA 1PR4A 1W5FA 1U1GA 4FKMA 4R2LA 3HCNA 4HNAA 1UOQA 3FGPA 3ABOB 5KQMA 1H22A 4FDTA 3L8FA 4XJTA 4TUYB 4HEQA 2F62A 4UM8B 5TVKA 1MRSA 2G6TA 3HXPA 3P9RA 3D4BA 1QG0A 2ZTHA 3EVGA 4IAOA 1XZFA 3H2BA 2FQYA 3PX2A 3ZHOA 2HA0A 4CLDA 5J5CA 2X22A 1NLMA 2YXNA 4K3UA 4OQPA 5JDCC 4ESHA 5JASA 2J0SA 4GQIA 3DWGA 2FRVA 2PBFA 1WMFA 5E38A 4EITA 3AM5A 3N2YA 5I9NA 4H18A 1T35A 1NVEA 2UVPA 2XUDA 2CSUA 5J4LA 2XBMA 3FNBA 5LQMA 1VKNA 4DHWA 1EAMA 4NTZA 5BYBA 2PSDA 3UBMA 3W7VA 2V8BA 2OFWA 5H68A 4RKQA 4MEJA 1DLIA 4QOJA 3CUKA 1SC4A 1BOOA 1RKUA 1J97A 1FS6A 1KFBB 1PR1A 5IKEA 5DI9A 1UZLA 3UA3A 1BE6A 3OZTA 1PCXA 1VYHA 3E35A 5J2UF 1J0XO 3EGDB 2FI1A 2GYWA 3IRUA 4URFA 3QFRA 4QELA 5LZ7A 2ZE7A 5DHPA 4D4GA 3SJBA 3BCUA 3DBLA 1N5MA 1QIEA 2ZXFA 3GQBA 4C0KA 2QF7A 1D2GA 1PQUA 2TMGA 4RZ2A 5C8XA 1ZINA 5ALNA 4X00A 4UTPA 3QU9A 1KPIA 3WB0A 4MGZR 2NU7B 1M9NA 2C9DA 3DNPA 2O8DA 3NJ8A 3C3JA 2WTAA 1V35A 5IC4A 1DOZA 4EF4A 1VMAA 3LO8A 4MUHA 3HJFA 3LP6A 3UFXB 4L8FA 2KX7A 4OU5A 1XEFA 1UODA 4L3VA 3SXUA 2VNIA 1T5BA 1MQSA 2GYYA 2J5XA 1TTHA 4X71A 3DLHA 3ESXA 3S27A 5LDGA 5BVGB 2CK3A 3LW7A 5K0JA 5KYXA 5D8DA 4ND8A 4LTNA 3KQHA 1ZH6A 1Z5OA 3FZYA 4R01A 4O5AA 3ISTA 1CULC 1PTJA 3CF6R 5JJCA 2QDKA 1EFKA 2V7PA 2FZWA 4KXXA 3TI9A 5LZ8A 5J5VA 2AQ8A 3IJPA 2ZI3A 4C7KA 1SG0A 4XX1A 4DMFA 2ZPTX 2EHDA 2W8BB 2AD5A 3MTBA 3A06A 4RVGA 2GN9A 5CTAA 5IN5A 3UMBA 3DNMA 2ECKA 1Q7EA 2R6CA 4MWGA 3ZVNA 3NTLA 2VRNA 2OPHA 2XUZA 2XMGA 3AEKA 3NHRA 2FWNA 3QWHA 1XFDA 4MJ3A 4W9NA 3TQFA 5EJMA 1W4CA 3WZLA 5BRAA 1XRQA 1Y4DE 1RIFA 1RTKA 3BXFA 2ZBUA 3GELA 4IFTA 4PVDA 2BONA 4FIZA 1TA9A 1B0PA 2BRUA 4MGYR 1SPBS 5HIKA 4NARA 5TPWB 1T0HB 3AW9A 1IJEA 2GPBA 5FBZA 3UA4A 4QOHA 4PLFA 4P4LA 4UULA 5C5CA 4QGSA 3HGTA 1SXQA 3UYLA 1W0JD 2ONCA 1VKRA 2QT0A 4JJIA 2V6JA 5G3ZA 3ZBTA 5KNBD 3VKGA 5CT6A 5B3JC 3AL0C 3BQNB 3HEMA 3ECCA 4DR1B 3NBYC 3HCBA 4WK0B 4DNOA 3DBHB 2QTLA 2E2WA 2G80A 4L74A 2IXAA 4F84A 2FV8A 2B8NA 3E53A 4PFJA 4HZUB 3ABSB 4TZTA 4RPKA 3BXEA 1JTEA 3S28A 3AKYA 1PU2A 5JJ5A 1KP2A 3LL7A 4GI3A 3BVPA 3ESDA 3T7RA 1US8B 2DWUA 5HOEA 3SLGA 3EPJA 3HSKA 4C9BA 1NM5C 4YBZA 3VR0A 4BTEA 4B8ZA 1ZGJA 2QD3A 1CIJA 5EYPA 2AR0A 4BWFB 2KHZA 3R8CA 1GNTA 4F4HA 1XZBA 1FMTA 1NKTA 3F6PA 1M66A 4JKIA 5AJVB 3HJGA 2EX1A 3NAMA 4DSOA 2AEEA 2ORYA 3DF7A 3NDPA 1BW9B 2JL1A 3HFGA 2DQ4A 2JLCA 1FXWA 3H8WA 3GA7A 1G38A 4LSMA 4RV5A 3UK1A 4UHHA 1BIFA 2X8WA 2ZTUA 1OZFA 2DTXA 4JLOA 2C9CA 1CY0A 3KAKA 4MUMA 4UBOA 4EELA 5IASA 3AVXA 4PR3A 1ILEA 2H07A 4KWCA 5AVWA 1WR8A 1U7DA 1IIRA 4MAMA 2NVBA 2HNAA 3TTUA 1P29A 4WNAA 1NW5A 1EUDB 2I7XA 4BTVA 4YCCA 4AY3A 3FOZA 4PCVA 2G36A 5JCPA 1XJ0A 1VPTA 1G7CA 1I32A 1XCGB 4XIJA 1TD1A 4P3OA 4OQLA 5I4KA 5M5BA 1I1QB 3R9XA 1WBJB 2QQFA 3KEFA 3K9LA 2PBZA 3LTNC 5D1HA 4N76A 3AVQA 3O1IC 4HGQA 3PU6A 4MV5A 3V8NA 3QSYA 1U81A 3U7QA 3E7FA 4JSTA 1JU9A 2I55A 4FLFA 3UC5A 4D8XA 1S6YA 1ZD2P 3SHQA 4BQOA 1NX6A 2VTBB 4EATA 2B4YA 2UYQA 4L9RA 2R66A 4TX1A 1QFSA 1FCJA 3KR2A 2ZJ8A 2Z8XA 2JFNA 2OO5A 4I6GA 2EBHX 4M0LA 1WCIA 1FFSA 2ZRJA 4IIJB 2GM5A 4YJDA 5ER6A 4ZVSA 3MAAC 3SC3A 1FNDA 1Y3FE 3DMGA 4RXUA 3CPSA 1UPBA 2GETA 2GEUA 1NF3A 5THKA 3HP4A 3AF6A 3HCEA 3TLKA 4MAFA 3NO4A 4QPNA 4J4TA 2B35A 4RIFA 3TLGA 1G21E 2QTWB 3BMNA 3Q6MA 3OJWA 3WRYA 1WV0A 1LWNA 5EA2A 5KHLB 4AG5A 4ZZ1A 1RRFA 1UJ6A 2IJGX 1Q0TA 2F3UA 1Q7GA 4R31A 3VU0A 5LVAA 3H5TA 4UCFA 1OZ0A 2HZ7A 4X6LA 5A5DA 2MINB 1M1NB 3H9EO 1YE3A 2XRMA 3FYUC 5J40A 3QVOA 1L4KA 1T6BY 5G0TA 3LBAA 1WA5A 2B36A 3CB4A 3NRJA 1ZR4A 4DWOA 6YASA 3CQ9A 2P41A 1ZVVA 3CF4G 4V0NA 1WLSA 1V3VA 3NH6A 3T9BA 4DUGD 2IEAA 2IF2A 4PC1A 3JQFA 1KMHB 4DOMA 1GG8A 1M76A 2CCJA 1BZYA 1DXHA 1JG7A 1WPXA 1Y6RA 1ZI9A 3KVYA 4HSEA 5U4XA 1LPOA 5F12A 4ENQA 5F64A 4DNQA 1KQOA 2JKZA 3BS4A 3V4OA 4HN4B 4OHZA 4BV3A 2ESRA 3THWB 3U2QA 2ZVJA 5L3QB 5CLQA 2VTKA 4FC6A 3AP2A 2VDOB 2XMSA 3FMIA 4BQNA 4E32A 4MUXA 4LQDA 4IHAA 2FLKA 1R4MA 1QIKA 5FKJA 4CNBA 1C5KA 4GQBA 1FMCA 5EMNA 1DT3A 1SR8A 1T6XA 2RHTA 5K3SA 1QGED 5DVZA 1V11A 4JD5A 4DTCA 1I2BA 5DLQC 5FQOA 4CKYA 5ADHA 2RARA 1C1XB 4AJ1A 2JLAA 2OBBA 3G2IA 3D0RA 1JQDA 5I7AA 1JHRA 1T5OA 3VAAA 1EVJA 2V7TA 4N47A 3WLIA 2POCA 3RC2A 1V1JA 2PH5A 1JIXA 2PSFA 3NTRA 4QPDA 4BATA 4JYMA 4POOA 5CIQA 2NU9B 4EG8A 4C2BA 2PUBA 4Q3NA 1JQEA 2IKQA 3QZUA 2XYGA 5DGDA 3K9NA 1J0CA 3I6YA 1L7VC 4U7PB 4MQUA 1DRWA 1NOIA 1G1MA 1II0A 1YQUA 3DAFA 3E7XA 2GVNA 3FDFA 4R1QA 1NSTA 3AUTA 4UBKA 4YS6A 2ZS9A 1QV6A 1LH0A 1MT0A 1ORDA 1Z25A 2PRJA 2WA1A 2Q6OA 1DOAA 1YR6A 1P7YA 4IUBS 1A7AA 4KI7A 4BMDA 5IAGA 4DL9A 4ZALA 2WF6A 2BZGA 3FPBA 1XCMA 4X5OA 2CLIB 2RC5A 1RHUA 1JR6A 2QUHA 3ZHRA 3GT3A 5KYUB 1TTPB 1OXSC 3MJSA 4YCNA 1G98A 1NL3A 4LJ6A 5HKAA 3PKZA 3DFFA 4PZEA 4AM8A 4LOIA 3G9UA 4R5MA 3CRNA 3PGLA 2AC4A 4E14A 1U0LA 1V3UA 3E9RA 5DYYA 1Y9EA 4ZRDA 3TQOA 2DOKA 2VUSA 3V1NA 4ZGWA 5JNTA 2P9QA 5L9AA 4LK2A 3UF0A 1JI3A 1GTL1 4RAOA 4HY3A 3OOHA 1T34A 1Y82A 4Q1EA 3NWJA 1Z22A 3FXAA 1N7HA 4BFSA 1O6FA 4HDQB 3P52A 2G63A 2KBEA 1ZIOA 3Q6IA 4WZZA 4XDYA 3SZUA 2FPLA 2H2FA 2QG4A 3T12A 4CTOA 3AFHA 1L4EA 3LW8A 1J4AA 1CHNA 1FSPA 4PS0A 1AS0A 1RJ9A 1QBKC 1RW4A 1X7ZA 4LMAA 4GBMA 4Z8XA 1IDOA 2JAOA 4JIGA 3MGCA 4O5OA 1F7UA 3RR2A 4RTJA 1T2AA 3V9PA 2GJKA 3NBAA 3ZWDA 4CU2A 3AKDA 3KZKA 3SZ3A 1PGPA 1Z0JA 1ODTC 3E23A 3T54A 4AMBA 4MJLA 3DT9A 1IM5A 2QX4A 2YHAA 3OM9A 4N0QA 2IDKA 3C98A 2C42A 3AFNA 2VRCD 3G7SA 3A1TA 1DAMA 2CDNA 2CF5A 4UM9D 2ZJFA 4Z7QB 2R1TB 3E0QA 1U8XX 2WSSD 3P2JA 4F2DA 2ZWOA 2EW1A 4KYIB 2A67A 3EIHA 1TX4B 3T4XA 2C2BA 3C7AA 4F85A 1C1DA 3AC0A 3KJHA 1TKAA 2PJUA 4OQYA 4ZAFA 3ACBA 3WDLA 1H2WA 1VL0A 4G4GA 2RHRA 4BQPA 5K8TA 1SB9A 1GJRA 3AJEA 5FORA 4PPGA 1RKQA 1W85B 2RBGA 2AMYA 2ZTLA 1Q7TA 3OX4A 4NEQA 4RNCA 4C20A 3I52A 4LVCA 3DW1X 4ZI2A 2AOWA 3LXRA 4GGOA 5C34B 3KB2A 3T61A 1MV5A 2VWPA 5KTSA 2HFKA 2V59A 2C7VA 2ACWA 3SZOA 4AP9A 2JD0A 4OP3A 3F5FA 1D2AA 2EBUA 3H84A 4QU5A 3VDMA 1PX2A 1VYTA 2HSJA 2VDJA 1TYDE 3DVRX 4QBFA 2YMQA 5HE9A 4DHEA 2V58A 3KQYA 4H2DA 1UBMS 1LNZA 1VI6A 4ZK2A 3BXPA 3QNUA 4I9HA 5C1PA 4Z51A 5DM1A 4HDNB 4WCFC 4ETWA 2FZEA 2QVZX 4ZAGA 3BFXA 3CEAA 4Q4JB 4BMZA 3TIGA 3R7DA 2JAPA 3BFPA 3ETEA 3RWMB 4O4LB 4LRYA 3FVQA 3HFSA 2VHZA 2OQRA 5EMHA 3ZU6A 5JS7A 1GZ7A 3I34X 4TLBA 4AQ7A 1AF7A 3N8HA 5EEHA 1M5UA 1U2GA 1FFGA 3A1NA 1QAQA 2ZI7A 4NG5A 4OL0A 3S29A 3M6XA 1PZNA 3RU9A 4WT7A 2OE2A 1QNLA 2FW7A 2I1LA 1XRJA 2QN6A 4JC8A 5I7OA 4DT1A 2UUAB 3M9WA 1U2RA 5B1YA 2GX6A 5JHGB 2ZJ3A 1DIGA 3GDGA 5E6SA 9LDBA 5FL7D 4ZDJA 3GPCA 5IAOA 2R6ZA 5L3RA 1YCFA 3OESA 2I6UA 4TL9A 5BMVA 1EUQA 1IHOA 1JDJA 2CYAA 4IEEA 3SZGA 2ZPUA 1OQAA 1JG3A 5JLJA 1BS9A 2H5LA 1GT6A 1N2OA 1RIIA 1W5SA 2EJWA 2GH1A 1DJMA 2YZ2A 4QOIA 3U4QA 3MS7A 1H5NA 2PVCA 2C58A 3H5VA 1BFUA 3COPA 4EABA 3KT8A 2WA2A 4AQDA 2O3SA 1AUQA 2GM9A 5FFNA 2I22A 4GMFA 3VYRB 2GKGA 4J0GA 3QOFA 1J42A 2WWYA 4B8WA 4IV8A 5KJ6A 3DWFA 2EKBA 4YROA 3V6LA 4UBNA 4Q34A 1VGRA 4Y6LA 4HLCA 1UMCB 4ZV9A 5DM70 1MP0A 2EFGA 3CY6A 4GRDA 3W6ZA 4RZSA 4G86A 2WKRA 2C96A 5E6UA 4MX8A 1COWD 4BNKA 3PWZA 5THXA 1FX0B 2JD1A 2P2YA 3F46A 3L93A 4UU0A 5TQJA 2ZRAA 3TW4A 1JQJC 3L0SA 4YRJA 1W581 2BI8A 3Q15C 1JDNA 1D03A 3ZV6A 1W44A 3K6KA 4RKRA 4URHA 3TK1A 3NOQA 3WLRA 3DUFA 3U31A 4DCNA 5EP2A 4BO2A 3HVRA 2FVYA 1QQAA 1CQZA 3ITEA 4PZCA 5CB0A 2RJ3A 2ZJ4A 4YRBA 4B2LA 5B6JA 4X6YA 1MC1A 1J2EA 4JEIA 4OHRA 3SVTA 4PFSA 4B6PA 2BM8A 2J9XB 3FDIA 3F7TA 3VR4D 1CZKA 2LR0A 2AQIA 5BYKA 2OQ2A 1R0ZA 4ISBA 4YTEA 3RIXA 2DECA 3ONWA 2AZMA 2R68A 5IX8A 4ME6A 3LSTA 1YKSA 1LV8A 4TRMA 4M38A 1KF0A 3QVMA 4C5BA 1YJ8A 1ZL0A 1ZUNA 3LUPA 1Z13A 1XMXA 3A10A 5KNDD 2BFWA 4XSGA 4LJ8A 2O0HA 3LBFA 3SOZA 4EY5A 1S9HA 2GPTA 2OLKA 3MC1A 3ZE6A 4FCCA 4EJ2A 5C46F 1I36A 1AIPA 1Y7HA 3B89A 1O8BA 3QY9A 4I55B 1VBNA 3AU8A 3HCDA 5WRFA 2QV0A 3E8XA 5MN4A 1UJCA 2CCGA 2IU0A 3VR2A 5CIYA 3PLAE 2WAOA 3RLFA 5DBEX 2IYOA 5A9SB 2AOTB 4KE9A 4DYHA 3OIVA 3U16A 2H52A 5I7FA 3CBQA 2B8EA 4ZO4A 5FUBA 1SO8A 1WO8A 1C1HA 5A2QA 3DE0X 5B6IA 1CRWG 4J6EA 2OBXA 2BUCA 1S3IA 5ITVA 1LK7A 1O8CA 1EGMB 2FPPA 2HO5A 2EQBA 5DH9A 4N5DA 5CDUA 1LUAA 4Z4GA 4PIVA 2G17A 1JWLA 2IYTA 2JHGA 2XMDA 3B7WA 3BE8A 1WS6A 4WXHA 3EXHB 2I7CA 3UWDA 1E9VA 1F5SA 1ZM4A 1BE0A 4DSNA 1N2BA 4E4TA 2WIBA 1CR2A 1J9ZA 4GNKA 1DKOA 2C9MA 3TXYA 5FI3A 1EJ6A 4L75A 3VHLB 4EPRA 4BTLA 4C0HA 5AOVA 3DHYA 3N6RA 4L9AA 2A88A 4ND6A 1QG2A 3LC1O 1EK6A 4D0SA 4CEHB 2VS1A 4DQXA 4KMSA 2RK3A 5EMMA 1YL7A 2Q3LA 3T06B 4LYEA 2VEDA 4ZK6A 1GPWB 2DFPA 4PAOA 1AUPA 1FJ2A 1TIPA 4C6RA 4IXWA 2XWPA 3BTUA 1L9KA 3MEQA 2FP4A 4ZC1A 3EIEA 4J4BA 4PRKA 2FNAA 3MG9A 1Q0PA 3UT0A 1E0SA 5CG2A 4FGUA 1KI3A 4OQFA 4PN7A 4KPGA 3CEJA 4NCXA 3VDNB 2WTBA 4U2KA 5CNKA 5KAPA 1ZJYA 1JLHA 4TLCA 1QDUA 2V3CC 5A7HA 1M33A 2OKGA 1OGYA 2XQKA 3LXXA 3PUVA 3T7JA 1Y9JA 4RA9B 1CUGA 4AZ0B 4LC1A 3GCZA 2D5CA 5CVCA 4NJEB 3GRPA 3CRQA 1VHTA 4NVRA 4ZVQA 2NUPA 1T3LA 2FJPA 2XUQA 3IUPA 3PQ7A 3NPMA 1I5OA 4X8OA 4AJOA 4NBNA 3VNBA 2Q5IA 3ORSA 1II8B 3ZJ4A 5BR8B 1RCFA 2LDBA 2J7PD 4B7AA 1KR2A 3BBLA 4O4IA 4EDHA 3K0CA 2PRSA 2EIXA 3PQ3A 5IJZA 4KQHA 2YS6A 2PZBA 3OURA 3K9HA 3N70A 4HXFB 1OI2A 3I8SA 3NKFA 4WBNA 3PHLA 3B2NA 3PL5A 4X60A 1GQOA 5KNCD 5ILOA 4WVLA 3FVVA 3OFND 3AJDA 1LDMA 3MUOA 4LQLA 3G6WA 3UAGA 2QZ9A 4A8TA 1L8AA 2PV7A 2W6ZA 3C3EA 3INGA 4QJ3A 4MB0A 4FXPA 4ZCPA 4HLUC 1JECA 4K9OA 3SBDA 4D80A 1E2LA 4BJ1A 2WV9A 1L7BA 1ESEA 1DTSA 2VJOA 3PQDA 5DHRA 1JKIA 4H08A 3F4KA 2ZQ5A 2OSVA 4L8VA 1JHOA 3CG4A 5L6MB 2IHYA 2FFRA 3PFFA 2IUUA 2V1XA 3WBBA 1G6KA 3I0ZA 1U0TA 2OD9A 2XGSA 1ORTA 4V2IA 3UHFA 1P73A 2XRZA 1DHRA 1QU3A 4UOQA 1YMUA 3BX1A 5ILGA 1FRNA 2KW5A 3EFOB 2M1ZA 4PWYA 1FRZA 1RXUA 3MA0A 4JHLA 2DPMA 1JU3A 2PUTA 1U0EA 1MGPA 1TD9A 3IP5A 4FXOA 4NONA 1L5KA 4IZHA 1XEAA 3SYLA 3Q3EA 1V5EA 4PTLA 1TKRA 5DHTA 3V4VB 4W5JA 3DC2A 1Z4KA 3NBZC 3AUKA 4L0DA 5ERXA 3DOJA 4UUAA 1EUZA 2BGJA 4K88A 4ITVA 4KXQA 1JHMA 1OE0A