4QKQA

Rada from methanococcus voltae in complex with copper phthalocyanine tetrasulfonate inhibitor
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
265
structure length
257
Chain Sequence
b'SHMDLGFKSGIDLLKQRSTVWKLSTSSSELDSVLGGGLESQSVTEFAGVFGSGKTQIMHQSCVNLQNPEFLFYDEEAVSKGEVAQPKAVYIDTEGTFRPERIMQMAEHAGIDGQTVLDNTFVARAYNSDMQMLFAEKIEDLIQEGNNIKLVVIDSLTSTFRNEYTGRGKLAERQQKLGRHMATLNKLADLFNCVVLVTNQVSAAEQAIGGHIVGHAATFRFFVRKGKGDKRVAKLYDSPHLPDAEAIFRITEKGIQD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA repair and recombination protein RadA
publication title Crystal Structure of an archaeal Rad51 homolog in complex with a phthalocyanine tetrasulfonate inhibitor
rcsb
source organism Methanococcus voltae
molecule tags Dna binding protein
total genus 95
structure length 257
sequence length 265
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2014-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08423 Rad51 Rad51
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4qkqA00
1WMSA 1CULC 3FPAA 3TSOA 2ODNA 3NHBA 1QG2A 3BXZA 2ZR0A 1MO4A 2D2EA 3BE4A 4XWKA 1ZM9A 4K81B 4CT5A 3REFA 2F43B 3GLGA 1KO1A 1RRFA 1TADA 3QY0A 3MMPA 5E7IA 2OBLA 2HF9A 4ARZA 3QEJA 1GKUB 3GJ8A 4EAQA 3I62A 2DR3A 2XJ4A 2E87A 3B78A 2OEPA 1XMIA 1JECA 5CIWA 3IHWA 1QZXA 4LPSA 5DLQC 3ZD6A 1M7BA 2AWOA 2C98A 2IXFA 4MH0R 4DRZA 1Q12A 2OG2A 4MGIR 1UKVY 4PO1A 2J0QA 3AVXA 1HE8B 3Q7QA 3I72A 1VECA 2QT1A 3TKLA 4WA7A 1IN4A 4LC0A 1XP8A 2FPMA 4JBXA 1GNPA 4QG7A 1GWNA 3PIRA 2RGXA 1ZW6A 3U5ZB 1N6NA 4P4TA 4MKFA 3CWZA 1TU3A 3EZFA 4PC3A 3RAPR 3CX7A 2RHDA 4DLYA 4DCNA 1ZRHA 1GRNA 2F7SA 1FP6A 2VO1A 2YOFA 1EFCA 3BB4A 3TW8B 3KTAB 3GEIA 1U99A 2JCSA 4A0GA 1MH1A 4RD2A 4MYTA 2C04A 4D0GA 1IONA 1KYIA 2VSXA 4FCWA 1L4UA 2AK3A 5JS8A 1IJEA 4KVGA 1UM8A 1R10A 2VP0A 5FBLB 1TEXA 1Z0IA 2FNAA 3KXIA 3K0SA 3NHAA 2YC2C 4XVUA 3ZZUA 1JJVA 3LXXA 3B7GA 3QXXA 1KGDA 4PPQA 1SXJB 2ZAOA 2VF8A 4D81A 4LBVA 4HZUB 4BECA 3CF2A 1UDWA 2WM9B 3DM9B 1FX0B 3NDPA 2QZ4A 1XNJA 2W6ID 3EIEA 1KI6A 1E1QA 2AKYA 4PO9A 1WXQA 1JEDA 2GKSA 2OCYC 3QVUA 4O2LA 1IQPA 4TYNA 1EFHA 4KLZA 2VRWA 4HAWA 1HT1E 1UJ2A 3D31A 3ADKA 5CK4A 3ZQ6A 1P9WA 4KO8A 4P4SA 2AK2A 3CNNA 2ZRAA 1NSTA 2FWRA 2ZITA 3FMFA 1LV7A 2XNDD 2ZRHA 1E9BA 4QHTA 4CVNA 3W6OA 4V0NA 2CLSA 4DXAA 1F2UB 1EXMA 1R8QA 4E03A 3PEYA 2F1IA 3B1XA 4O2RA 2VQSA 3G5UA 5EUQB 4ITRC 1NVVR 3RSOA 1WBDA 3K70B 4NKRA 2F3TA 2N42A 4C7OA 1VPLA 2WJIA 3ZVLA 3CRW1 4OQXA 4CIDA 5FL3A 2QMEA 4IVPA 2A5YB 1PLLA 2XB2A 1G8GA 3WNBA 2ZUCA 4PHHA 3AF0A 1X1SA 4F4IA 5J4HA 2QEQA 1JR3D 4II7A 4NYJR 4OHWA 4ZKEA 1T8UA 2JASA 3B13B 4C0SA 2F9MA 4PPGA 1KI4A 3WP0A 4KFRA 3D6TB 5E95A 5TB5A 4EPXA 2CEAA 2QROA 4Q4AA 1OIWA 3Q7PA 1YZTA 4NE2A 1X8JA 3I1FA 4EFLA 2GNOA 1KO7A 1QDEA 4IW3B 4HYYA 1E0AA 5F3WB 1G6HA 3LVRE 1FFHA 1II8A 1T9HA 2JJ2A 2Z0MA 2WIAA 2EFCB 1AS0A 4WXRA 2QMUA 3RC3A 2FSIA 4ACBA 2IF0A 2FU5C 4LYAA 5FPHA 1XMJA 2V54A 4I1VA 2HLDD 5GADl 4M9XA 1SVOA 4MGKR 1K6MA 3I4LA 4GT1A 5JWOA 3QE0A 1AQYA 2ZQ5A 3QVVA 3QXJA 3I61A 1IHUA 1S1MA 4GPTA 1KSGA 3UANA 5CM9C 3THYA 5KSZA 2WMNB 4LJ6A 4LYFA 1XJQA 3PUVA 3VQTA 2B8WA 1OF1A 1YZUA 3AEZA 1IY0A 1P62B 2QP4A 3J81k 1W0KD 3BBPA 1ZD8A 1KI8A 2IYVA 2LCFA 5EXTA 2H1LA 4XVRA 1G7CA 2XX3A 4ASUA 4AY2A 3AVPA 2B21A 5D3MB 2VHTA 1DS6A 4B3XA 3EXAA 5J5CA 4OBEA 1FNMA 5LPNA 4TMWA 2PLRA 4LHYA 4UNRA 2ERXA 5AJZA 3X2SA 1N25A 5DSZA 1CR1A 4NL4H 5EP4A 4B6FA 2L0XA 3M0EA 4Q1DA 1BO6A 1YJ5A 2Z43A 4LC1A 3AH8A 1D8TA 4D4KA 3TGPA 5J47A 5DO9A 1E9AA 4GZLA 5AWFC 1A4RA 2ZIAA 4JLMA 4B44A 4CEJB 2F3RA 3KUDA 4BFYA 2ZTSA 1WF3A 4D4LA 2WSMA 2JIZA 3WYAA 1M8PA 2GK6A 2VTKA 3GEHA 4PAOA 4TMKA 2OILA 4M21A 3RYTC 1QHIA 2B7BA 4LHWA 4A8JC 521PA 3QJYA 1X3SA 2IYZA 3BFKA 2XOKA 3QEOA 4BLSA 2YYZA 2ZETA 1HEIA 2HCBA 1YZLA 1CR4A 4G01B 3FGNA 4AKGA 3D7MA 1L7VC 4JLPA 4DSTA 3C8UA 2ZI9A 2QU8A 2DFLA 1ZUHA 1OE0A 5DIFA 4TYYA 4OQLA 2YV5A 4MUBA 4H1UA 4QOSA 2X1VA 3FTQA 5JLJA 3AP3A 4Z1MA 5TXGA 1XTIA 3HYTA 3SJBA 4HDQB 5TY0A 4F38A 5JWRA 2HDNB 2D74A 2QSYA 5KNBA 2PMDA 5BXQC 4MDEA 1KTVA 2GRJA 2LKCA 1GM5A 4Q1AA 1ZM3A 4TWZA 4EPRA 2FFQA 2CHQA 4CRWB 5E7JA 2FFHA 1SXJD 4HAVA 2QP3A 4XVQA 3TVDA 4AKHA 3UMSA 3OIWA 4P32A 1JALA 1IN5A 2Z83A 4M1TA 2NIPA 3LDAA 1E2EA 2IT1A 5CJPA 4JMPA 2QG6A 4DDVA 4GFDA 3OESA 5JJIA 3NWJA 1TEVA 3IBYA 4WVFA 4XTCS 3W5IA 2ZSDA 4B76A 4BRWA 2E9SA 4LJ5A 3ZIAD 4HATA 5AUPB 3RC8A 2J45A 1JEEA 2FZLA 2RGDA 2O52A 4A0RA 2OESA 2ZE5A 3HPRA 4W5WA 2IF2A 1E2MA 2ZI7A 2RCNA 2VP4A 3L43A 2Q9CA 1HT2E 5G53C 3EW9A 4MRNA 4N0EA 1P3JA 2PEZA 3NC1C 2HT1A 3SNHA 3PV0A 1T3LA 4A4DA 3SBEA 1S96A 1HE1C 2BEJA 2Q3MA 3PUZA 2IXGA 3IEVA 3AVWA 1Q1ZA 3DZDA 4TMZA 2KBFA 3IQXA 2WICA 4JBWA 3K70D 2CJWB 1J7KA 4EJSA 1P2VA 4HAUA 1OH8A 3BK7A 3U3MA 1DAEA 2ZSEA 4Q9HA 4HAYA 3SFVA 1R0ZA 3FB4A 4URUR 3ICEA 3ASZA 4I99A 4M1WA 1KI3A 1W46A 4V0KA 2BDTA 4M1KA 4C2TA 4I4LA 1BIFA 2MSEB 1UAAA 1Q1BA 1G7RA 2GZAA 4B32A 1CRPA 1ZUNB 2OFXA 4FWIB 3B8HA 4Q4JB 4MYCA 1ZC3A 3RANA 3KXKA 2W6IA 2W2TA 1XEXB 2GVDC 3SYKA 1SGWA 3P4YA 5FUYA 4I81A 5JHGB 4BEBA 1MABB 4R2HA 1E2IA 2CMKA 4Q00A 2ORVA 1BMFD 3C5HA 4A15A 2KI5A 4BFXA 1FOEB 4JSTA 4B75A 1HTWA 1CU1A 4WZ6A 1G8YA 4ZDJA 2OLKA 1G5PA 1N5JA 2H8KA 2QBYA 2OE2A 3RS2A 2XNDA 5IF9A 3AVVA 4CGZA 4MKGA 4Y0AA 2O0HA 2B8TA 2JATA 3GCGA 1OV4A 4HLUC 4OQMA 1T0HB 3NBYC 1JAIA 2IYXA 1VTKA 2ONJA 1F3OA 2PX3A 3TBKA 5AJYA 4JLVA 5FL7D 1D9XA 3HDTA 3LX8A 4F4JA 1Q3HA 1VDZA 3CRRA 3LBNA 4P33A 1JQLB 4PPNA 2BHRA 1QHHA 4LV8B 4A0HA 1YRAA 1TNDA 2QUZA 4FXPA 2ZS7A 2G0NA 4QFMA 2FPKA 1Z0FA 1JR3A 3S1AB 1NKTA 3FMOB 4HDCA 3RABA 1NJGA 4A36A 1KKMA 5CB8A 3FHCB 4HB3A 1P75A 3K0AA 2GCPA 1K8RA 3BH7A 5GVRA 2ZYUX 1Y3AA 3NBFA 4KU4A 3T5DA 4AWXA 2O5VA 1RYFA 2ODWA 2R6AA 3PVSA 2XZLA 1N2CE 1PLKA 3WHLA 4D4JA 2GTPA 1XTJA 5J4YA 4HUQA 2J0UB 4LY6A 1XZPA 3SE0A 3SI7A 4AYTA 4BFVA 3U7FB 1QF9A 4DLWA 4W5HA 1Z0AA 4L9WA 3I32A 1XEWY 4BLOA 1XD9A 1R2QA 4QC2A 2ZSFA 4ZI2A 2WSSD 4EKDA 1Q57A 5FTLA 1A82A 2CHGA 5G3YA 3V9PA 3CPJB 3CPEA 5LB4A 5FBQB 4L9SA 2IWHA 2GXUA 1NKSA 1IBRA 4ESVA 3OFND 4TQAA 5JMTA 5LD2B 4X8HA 4PO8A 4Q4HA 4UNPA 1GNQA 4YLGA 3A4MA 2HLDA 5FBRB 4WIAA 2QRNA 2IXEA 3LH5A 3U44A 3QKSA 4OHXA 3CNLA 4Q9KA 2ECKA 3O8RA 2WJYA 1N6IA 2FZ4A 4FD2A 3W34A 3ZS8A 5DYIA 5CYOA 2VP6A 3DM5A 3R7WA 4Q1BA 5TV2A 4UXIA 2W2XA 3M1IA 3BS4A 4ZCMA 4QRHA 1W0KA 3BB3A 1KOFA 2WAYA 4UNQA 1N6LA 1Z2CA 4Q03A 1E1RD 2AD1A 4JLBA 3BH6A 1GKYA 1R5BA 4PC7A 4HLCA 4DIEA 2GDJA 1G4AE 3AF2A 4QBIA 3GJ7A 2NGRA 1W2GA 1W4AA 3B6EA 1P2UA 3KKNA 1SVMA 2JLRA 4LJ7A 2O8FB 1XXHE 1NN3A 3TJZA 3UMRA 3OF5A 2AD5A 3U6BA 3DMNA 3TE6A 1NLYA 2OFWA 1FQJA 2AR7A 2F43A 4ZIRB 2GF0A 2IYSA 1Q3TA 2WWHA 4RD1A 4AD8A 1LNZA 3UKDA 1R4AA 2GAOA 2FOLA 1U81A 5M04A 3SJCA 2B92A 3WXMA 2Q6TA 1G41A 2R6DA 3IIJA 4LSGA 5IRCD 1NVVQ 3OE7D 2O0JA 4DCSA 3VR1A 4Q01A 4V0MA 4A82A 1G8PA 4A0FA 3FDIA 2K5UA 2C2HA 2J0VA 4YDSA 2QAGC 1WA5A 3DKPA 2GXQA 3IGFA 2QQEA 4QBGB 3L8YA 4GP7A 2HJGA 4LJ9A 4URXR 3BOSA 4TL9A 3HU3A 1E2FA 5DN6D 2PZEA 1CF4A 1DOAA 1NVXQ 3B1WA 4H1VA 2EYUA 4RD0A 1P7CA 4QBFA 3I8XA 4GDFA 3O8DA 2IYLD 4DKXA 2BMEA 2NG1A 3PUWA 2RKOA 1NF3A 4KHZA 4H9GA 3TAHA 3KTAA 2CVHA 1KJYA 1NN0A 3VR4A 1IN7A 2DFNA 1AZTA 3QXHA 5K8UA 3C41J 3N70A 3WHKA 1NMYA 1JXOA 2DWQA 1XCGB 3MJHA 5AJWA 1B23P 3O47A 1UPTA 1M7GA 1N6RA 1CTQA 2GK7A 2H57A 4PC1A 5LB2A 2ZI5A 3TR5A 3X1YA 4DUGD 3UMFA 1SXJA 4AYXA 2WJHA 4HZUA 4IDNA 2ZI4A 1FX0A 4B2IA 2X2FA 3ZQJA 4DDWA 2R62A 4Q5IA 3PXGA 2WTUA 3ZYCA 4RKEA 1U0LA 1NP6A 3ZIAA 4EQ6B 3Q8XB 4IRUB 5DH9A 2DBYA 3MUFA 4GMDA 4HDOB 4AG5A 5EJEA 3CW2A 4JZKA 4TMXA 4PQRA 4D6PA 4RCZA 2YHSA 1U90A 2ZRIA 1MV5A 1ZBDA 1G3RA 1GIAA 2NPIA 5CDFE 1GFIA 4IDHA 5DE3A 5HCNA 3RS4A 2FDCA 1F2UA 4MRSA 2WVJA 2IUTA 2ZJAA 4XTRA 2HV8A 5DHFA 1EGAA 4F92B 4M9ZA 4TMVA 1KI9A 5L3RA 2ZUBA 3F0TA 3P4XA 4MITA 2ZYVX 4DSUA 2B7CA 2HCJB 5SZHB 4YMSA 3QPVA 4UJ5A 3ZJYA 3KKMA 4TL6A 2R6CA 3RHFA 2XTMA 3B1VA 2ZANA 1CP2A 1OFTA 5HCIA 1NIPA 3A1SA 5G3ZA 1N3BA 4MRVA 3LNCA 2RMKA 1RZ3A 1W2HA 2FX3A 3NIBA 4QHYA 1I4DD 5D3QA 1UBEA 2V55B 4HLDA 1N0WA 1P73A 4LX0A 1GDDA 2ZYWX 3T12A 1E9SA 3U4QB 4Q7JB 3MFYA 5GJVC 3QSYA 4O3MA 3Q72A 3GPLA 2G0TA 3K0CA 1BMFA 3RS5A 2XGJA 1QHSA 5IDVA 1NY6A 1J70A 2ZE6A 4ZDWA 1XPUA 4MKHA 2QGNA 2FFAA 3EZ7A 2ONKA 2R6FA 2DPXA 4KI0A 3GMTA 4D4MA 4CF7A 5KUTA 2PMKA 2FJUA 4X8LA 1G6OA 2I3BA 1P5ZB 5JWHA 4D0LB 2O8BA 3B1ZA 3AKCA 3VHXA 2I1VB 4MYHA 1EFTA 2WKRA 5LBIA 2DB3A 4JSYA 5BYKA 1E2PA 3Q9LA 4OK3A 1OH7A 3CWQA 3AB3A 3AF3A 1W0JD 5FL7A 1Z06A 4A2WA 4AKEA 4QGAA 3R20A 1M6NA 3UG6A 1Z6XA 3W6NA 3X1WA 2AN9A 4DDTA 4FINA 1Z0JA 4Q9LA 2W83A 3CONA 1IAQA 3EC1A 4K8OA 3C15C 2P5TB 4C4PA 2VHJA 4OHVA 2XB4A 3EC2A 3I5YA 3RS0A 4PZZA 2H18A 3LFUA 5EQTA 4NYMR 1FTNA 5FOVA 3RS3A 3Q85A 3AF1A 1SHKA 4IOMA 2CDNA 2JGNA 4KSBA 3WNCA 1Z6TA 1U9IA 1OKKD 2C9CA 3LD9A 3BFXA 3SR0A 4UXHA 3WBKA 1JQJC 3RLFA 2BJWA 3BFVA 3GJ6A 3SC3A 1WB9A 2Z6VA 1GG2A 1ZAKA 2GESA 2VP2A 8OHMA 3SZRA 4GOJA 2WJJA 5E3HA 2MMCA 4GBMA 4BFTA 5JJLA 4G0NA 1OH5A 2WSSA 4G5SA 1OFIA 2EFEB 5JSZB 3C7KA 1XPRA 2WJVA 4CEJA 1R0YA 4D26A 1NI3A 3IBGA 3ZZTA 2IS2A 4EJSC 4DVGA 4LV5B 3K09C 3OFNA 5FTMA 3H1TA 4Q47A 1XXHB 2ASEA 4JKYA 4YXWD 4LPKA 1W36B 3I5XA 2ZRCA 1XEWX 4HI0E 2IHYA 6Q21A 4ZV4A 2CHVA 2OCBA 2G1KA 3IILA 4DC9A 1G3MA 1G18A 1VIYA 2XXAB 3BORA 4IFBA 5ELXA 2OT3B 1G21E 2EW1A 1AQUA 3B82A 4CEHB 3JVUA 1EFRD 5EXPA 2V3CC 3K9GA 1R0WA 2YINC 1BYUA 1IN6A 1DADA 1G7TA 3I92A 3THWB 2XZPA 3IPYA 4CDGA 1E1RA 1GOTA 3TUIC 1DARA 3OIUA 4R71A 2QTHA 5AUOB 1G9XA 4RFSB 3MWKA 1CJVC 1P9RA 5CLQA 2ZE8A 2ZJBA 3OIYA 3Q3JB 3ZVNA 1KSHA 1M1YE 3GLIE 2R65A 4B3GA 2DFKB 4C9BA 5FTKA 3KFXA 4Q02A 1U0JA 2QTVB 3R9WA 3U3OA 1ESNA 821PA 3KZ1E 4UNNA 2PLFA 3K0FB 3RS7A 3TR0A 4BRUA 1R8SA 2AWNA 1N6PA 3CNOA 4JVLA 1KNQA 4IXMA 4BFZA 3U7GA 2GA8A 4XSHA 4B73A 1G64A 2GHIA 2OM2A 1CJTC 4DSNA 4MKIA 2ZJ5A 2ZR7A 4HSEA 3DMDA 3OE7A 1K5DA 1VG8A 1XF9A 3G0HA 5A4JA 2IWRA 4KLNA 1KY2A 1N5IA 2PJZA 4JIMA 1DBSA 2XSZD 5AR1A 3GJ4A 3UWOA 4AYWA 3TQFA 1X1RA 1E9RA 3VNVA 2A7QA 2UZIR 3T5GA 4MRPA 4ZDKA 3I8SA 1KK2A 2OXRA 2QORA 2ZRBA 4AC9A 1FW6A 1IXRC 4W9MC 2F1JA 1UBFA 1Z8FA 2EFDB 3CRMA 1TUIA 2RAPA 5DN6A 5CYPA 1KSJA 3FVQA 1HQCA 4B6EA 4LHXA 1ZM7A 4Z51A 1D6JA 1JXMA 4Q1FA 1AKYA 2YNMA 4KV9A 1SHZA 4YMUA 3TLXA 4TSFD 2O0KA 2CJWA 2D3WA 2VLIA 2ZAMA 1DAIA 4MQBA 2V6IA 3P26A 1EESA 1I2DA 2HXYA 4D25A 1MRNA 2EVWX 2UVQA 3U61B 1YVDA 1AS3A 3KB2A 1Z2AA 1L4YA 1YR8A 1E0KA 5SZKB 4IEIA 4Q1EA 4HZIA 4DUGA 1XBTA 3OZXA 1Z29A 2WAXA 4Q4JA 3VKGA 2IYTA 4DBLC 1XJCA 2CLDX 2CK3D 1G3QA 3BIFA 3CR8A 3EARA 2PH1A 3PENA 5KPDA 1JJ7A 1XEXA 5L3SA 1G3IA 2B6HA 4LOAA 1EFUA 1G20E 1MABA 4EPVA 4UQOA 3QG1A 2ODEA 4LBZA 2BEKA 5DHAA 3FMPB 4G5GA 4AURA 1RFLA 3AUXA 1W44A 2FG5A 4TZ0A 4XJXA 1EX6A 3NBXX 2IHBA 3WMGA 5EE3A 2C95A 1COWD 1KSFX 2W6JD 2OAQ1 4RFVA 5EE5B 4F91B 4N1AA 5EXXA 1G1MA 2X77A 3QF7A 4QBHA 1DG3A 4TYPA 3QF4B 2Z4RA 2F1RA 1AS2A 1E32A 1P2SA 1N6KA 4PPFA 2W58A 1Q21A 4V0LA 5F2EA 4LYHA 1F2TB 1BKDR 3Q5EA 1T0JB 2D2FA 2DHRA 5F98A 3U3JA 3QUSA 4FIDA 2IL1A 2QMOA 4NH0A 5GJWC 1EG7A 3QOFA 1KMHB 2YOGA 2W2VA 1Q20A 1HQYE 1G3UA 1GKIA 1KZ7B 1N0VC 4RZ2A 3BC1A 5JBQA 4GZMA 2MSCB 3C4JA 2PT5A 3HPQA 3S1AA 421PA 5BN4A 4JVMA 1OJLA 2QGZA 2Q9BA 1VCIA 2AX4A 2DYKA 4OKSA 2EYQA 4MUAA 4R7ZA 3RVBA 2ZROA 1NNEA 1QG4A 2QPOA 4O25A 2PCLA 5JCZA 2O8CB 1D5CA 2J0UA 1F60A 5BQ5A 3T1TA 1AKEA 3E70C 2I1QA 1X86B 4A6PA 4IHQA 4Z8YA 3T06B 2OLJA 3FMIA 1XD2B 1TUEA 2D7DA 1NMZA 4ERNA 1H8HD 3CX8A 1YQTA 2RGAA 3FFAA 3HU2A 2GILA 2ZU6A 2CCJA 3CZPA 2G1JA 3IO3A 4DLTA 4ILEA 2QQ0A 2GVZC 3PG5A 3MSXA 4BLPA 2JDID 1GVNB 4Q66C 3RRNA 5LDDC 4KYUA 4F7WA 2V4ZA 1ODFA 4NBSA 4XD7D 4W5JA 2ANBA 1W36D 1W0JA 1AM4D 4BZXA 1PVOA 5HKKD 4RD4A 5A0FA 4DZZA 4TN1A 1U94A 1OFHA 3R9XA 4BFWA 1SXJC 3L0IB 4NMMA 3V4RA 1T4GA 3KDSE 4M8NE 1UKYA 3OEHD 3HWSA 5DI9A 5FBWB 1II9A 4QNRA 4TQUS 1W4BA 4F4CA 2VSOA 3VKWA 4QM6A 4OI2A 2BOVA 2QTFA 1DELA 1OKKA 4LYJA 4PSVA 3WRXC 2ATVA 3REGA 2P6UA 4AKIA 3HYRA 1OXVA 1S2MA 3QBVA 2FPLA 2RGGA 5FPKA 1C1YA 4LJ8A 3LA6A 2O8FA 1GILA 4L16A 2CBZA 1M74A 4U7DA 2C03A 1FL9A 2NPFA 2QM7A 3AKDA 3GLFE 2HF8A 2BMDA 4ZIRA 4LZZA 4DLVA 3ND8A 3P27A 2Q21A 1WE2A 4QM7A 3A1VA 2HJVA 3U7HB 4B71A 4IOLA 4BZPA 2QAGB 1NBME 3K70C 2C78A 5FR1A 1KI7A 5IHPA 3AF4A 4HB0A 4JJZA 4KYIB 3GLIB 1ZNXA 2D7CA 2GJAA 2IYQA 1OT3A 1DG1G 4B74A 4YXWA 1CXZA 1A2BA 2WWFA 4L8GA 4BQSA 3ND9A 5JRJA 1TPZA 621PA 4TLBA 2CE2X 2QSZA 5KTYA 1T91A 2A5JA 2RGNA 1ETUA 5J4VA 2BBSA 3F5FA 4TTQA 1LF5A 3A37A 4E5UA 1MO5A 1EFRA 3EPKA 1P72A 4PSAA 4EFMA 1KDOA 2BWJA 3U3RA 1SVSA 3MJRA 4DCTA 1JPNA 1DAFA 1KDPA 3K0CC 1CJKC 4GRAA 4JLAA 4C3ZA 5AUNB 5C18A 1OHHD 4DHEA 1OW3B 4Q9JA 2XAUA 1DTSA 2ANCA 4UNSA 5FUVA 3U2QA 2R8RA 2VHQA 4QGHA 4AI6A 1N6HA 4JKIA 2AHOA 1VG0B 5KPJA 3NC0C 3IO5A 4Q48A 4A6XA 1ZUIA 3THOA 2YWGA 2V8OA 2YKGA 1Q22A 1TQ6A 3FHOA 4POAA 1MO3A 4NU0A 4BLQA 3R8FA 3K8YA 1IN8A 3QBTA 4PQYA 1P4SA 1TU4A 2WWGA 4R2IA 4M1SA 2WKPA 3VTKA 3N2IA 4ON9A 1X8KA 2ZS9A 4QGGA 2NO6A 3FFBA 3RWOA 1U8YA 2CVFA 2Q3HA 4NPHA 1LVGA 1QRAA 2GAAA 4BGDA 1GTVA 5FTNA 2P65A 2H92A 4IDQA 4F93B 4D80A 4WAUA 4EQ6A 4I1OA 2XSZA 4ZCLA 1XCMA 2YJTD 2ZPTX 3KQHA 4Q18A 3WYFA 4NYMQ 5BWMA 1SKYE 1DO2A 2OAP1 4N3NA 4P3YA 2G83A 3HJNA 2AXPA 1AGPA 2EFGA 4WZAE 5EE1A 4ABYA 5KSPA 1KO8A 5CJ2A 5B64A 5JEEA 3QG5A 2ZRPA 1Z3IX 3EZ9A 4TLEA 4BE7B 2EQBA 5JJKA 3DOEA 5KDLA 1UADA 5GJCA 2ZJYA 4A9AA 1HV8A 3E2IA 4P4UA 3L8ZA 3NKVA 3TRFA 1A1VA 5KDDA 4TSFA 1WDTA 1EWQA 2QAJA 2NO7A 2CE7A 3KB1A 2OO7A 4GOXA 1J99A 4TMTA 1KNXA 3DO6A 2VPPA 5FUXA 3TUJC 3ETLA 4PSKA 4NP6A 3I73A 1IJFA 3GD7A 5DISB 1PLJA 3W90A 5F9FA 3CBQA 1CJMA 1XX6A 2P2LA 4QJ4A 1JR6A 4FMCF 3CR7A 1S1CA 2QRZA 3TW4A 4YC7A 1E6CA 4I1SA 3A1WA 4C2UA 5AJXA 2OBMA 1KJZA 1XFAA 1AGRA 4G3XA 4JL5A 5SZIA 3TVTA 1ZIOA 4EIWA 2CK3A 2ZRMA 2PT7A 2ZRLA 3U4QA 5B30A 3VNUA 4HAXA 1E96A 1FP7A 4NYIR 1Q1EA 5BN5A 1TL7C 2V7QD 5HE9A 5DYGA 4ZPXA 3TSWA 4C0KA 1CIPA 1YZGA 5P21A 1UEJA 2ZUDA 1PJRA 4RZ3A 3IIMA 1COWA 2W6JA 3EASA 1JAHA 3CRVA 2BBOA 3DVLA 3SHWA 3DDCA 3DL0A 5UKDA 4US0R 4DEYA 2PX0A 1S3GA 3PUXA 1E0JA 1TQDA 3NTUA 1YE8A 3KQUA 3A4LA 4M1YA 1O87A 2HXSA 1BOFA 2ZYTX 4Z54A 2NO0A 4M0LA 1OXTA 3NH9A 2E1RA 1XZQA 1KZGB 5C2JB 3LLUA 1WQ1R 1LW7A 2VHUA 3KKPA 2QI9C 5FI0B 4JL8A 4DEXA 2OXCA 3NH6A 4NCNA 3CH5A 3KX2A 1ZU4A 1ZCBA 1KIMA 2IS6A 3N2EA 2IEYA 4MGZR 1GZSA 3LQQA 2ERYA 2IYWA 1J8YF 2V9PA 2WWWA 4C0JA 1R5NA 5FI1B 4RCYA 4US2R 1XWIA 4G5OA 2IX3A 2WWIA 5EUMA 2G9NA 1XMSA 1C9KA 1Y63A 2ZRGA 3LBHA 3AVQA 4NYJQ 3SQXA 1NLFA 2IUUA 1RJ9B 1ZM4A 3DHWC 5ANRB 2IK8A 4LK2A 2KB0A 3V4FA 2ORIA 4UXJA 1X6VA 3CLVA 1V43A 1H8HA 221PA 3TH5A 5JSZA 4M2LA 3KQNA 4E07A 4KBGA 2BJVA 4DB4A 5BN3A 3UIEA 1L2TA 3O8BA 1WBBA 2YC4C 2D4HA 4JYBA 1G291 1MOZA 4RD3A 2JDIA 1TX4B 1XXHA 2ZJ8A 1TAGA 3Q5DA 4XD7A 2GCOB 4LJAA 4TTRA 3QXSA 4LRWA 3GLFB 3QENA 1ZC4A 5HKKA 1LY1A 2UKDA 1OIVA 2XXAA 2W0MA 3DEFA 2ZREA 2BCJQ 4MRRA 4CEHA 2QP9X 1C4OA 1PV4A 1J90A 3AGQA 3OEHA 3CRQA 4HUTA 3JZMA 3JVVA 5KOYA 3NG1A 1E2JA 3CO5A 3H84A 4G1UC 2PL3A 4BEJA 5J4KA 4NTZA 4RFSA 1ZCAA 1PUIA 4C30A 1JB1A 3SQWA 1XEFA 5HZHA 3THXB 4B2LA 4URYR 3CIOA 3VMFA 3PCRB 4GNKA 1OFUX 1Z0KA 3K9HA 5KDOA 4Q19A 3B1YA 2CCKA 3GLHE 4Q1CA 1S9HA 1ZVQA 1AK2A 1GNRA 1N6OA 1YRBA 2QPAA 2YWEA 3CX6A 3CM0A 3K0FA 3SBDA 3VFDA 1GRRA 2W0SA 1GAJA 3GQBA 2QPTA 4M9QA 4BZQA 1T5LA 1E2LA 4LBWA 2FH5B 4US1R 5H68A 4PZLA 3LXRA 2BKEA 2HUPA 2WJGA 3OAAD 5DI3B 3IHLA 4RZUA 4KJZA 3U3KA 1OXUA 3KKQA 4PTLA 5DGXA 5FR2A 5FOXA 3W9YA 5C1BA 2OSBA 3G82C 4DLSA 2I4IA 1VYTA 2GF9A 4B48A 2JLVA 2P67A 1VYUA 5G41A 2J46A 4ESHA 1XU4A 5HZKA 2XTZA 2WPDD 3GLGE 4B3FX 3MWLA 4N0DA 3QKUA 5KYKA 5C46F 3PQCA 5BYJA 5JCPA 5JEDA 5JZVA 2BV3A 1ZD9A 1OHHA 1XB2A 3KQLA 3BB1A 3R9IA 4RVCA 2DWOA 2A3RA 2KJQA 1NVUQ 3TSZA 2MMGA 3LWNA 5FPSA 1SKYB 5JI2E 2C99A 3IPXA 4W7SA 2G6BA 5CDFA 3B9QA 1Z22A 1NVWQ 1NN5A 4LHZA 1KK1A 2FSFA 4XSGA 2JJ8A 4JLNA 3AKEA 3U6KA 2ZEJA 1SVIA 3LQRA 1KAOA 1TF2A 3CPHA 3IIKA 1SQ5A 3FWYA 2REOA 1KAGA 3I3SR 4G5QA 4RZXA 2P6NA 2WHXA 3HR8A 3QNUA 4C0HA 1A2KC 1FPMA 1NSFA 1QBKC 2ZSAA 4EPWA 2BIFA 2Q3FA 4YMTA 5F9HA 4L5BA 3B2EA 4BLRA 4D2IA 1W48A 1DPFA 4KXFB 3AP1A 1YZKA 1ESMA 1DAKA 3UXMA 2BMJA 4A1FA 1SVLA 5JECA 5D3MA 1NG9A 2X2EA 2XTNA 3EZ6A 2N1BA 2YWHA 3KXLA 4C0LA 1E98A 1M2OB 4TYWA 4MGYR 4KODA 3EIHA 4HLQB 3AQ4A 1TQ2A 1UBGA 3QF4A 1Z6GA 4OQFA 3L0SA 3GJ3A 1M7HA 4CEIB 2C8VA 1XMVA 2KSQA 3T1OA 1UBCA 1ANKA 1GITA 1S8FA 2FEMA 1N5KA 1F2TA 4UJ3A 3VU9B 2BBWA 5HPYB 1E3MA 5KU1A 2IA5A 3BJIC 3RRMA 2P6RA 4L15A 3BWDD 2O8DB 1RYHA 2FN4A 1KMHA 2ZI6A 4B2PA 1WRBA 4R98A 2GJ8A 2IYYA 1ZNYA 1QHNA 4LUCA 4ZDIA 5L8VA 1OPXA 2P0EA 1ZU5A 1US8B 4MA4A 4A8JB 2D62A 4NDZA 3RDPA 3P20A 5B58C 1G4UR 4WBSA 3NDBB 1Z47A 4TLAA 4TLCA 3NXSA 1D2MA 3WMEA 2ZVQX 3PUYA 3WMFA 2O8CA 1AZSC 1S0UA 4QXAA 3AVOA 3AGPA 1VCOA 3BD9A 5GVSA 2J5XA 1KMQA 4TTPA 121PA 3RNLA 2ZRKA 1GL7A 5H70A 1L8QA 2PJRA 2RGNC 5FUWA 2V7QA 5TMPA 1AN0A 2BMFA 4WW0A 1AA9A 1XD2A 4FMBB 5EZ6B 4IVRA 1DAGA 3AM1A 1K5GA 5FTJA 2GZDA 1TMKA 2V1XA 5CM8B 5JHHB 3T1QA 2EWWA 2GEVA 4LWZA 1R7RA 3GFOA 3K0EA 3U60B 1JBKA 3MCAA 1IXZA 1E69A 4TT3D 1OYYA 2ZS8A 4IDOA 4EPYA 4Z8XA 3ONWA 2A30A 3DOFA 1G17A 4RSGA 1ZNZA 3X1DA 1XD8A 2CNWD 2FFBA 2JLSA 4M22A 3A6PC 1VCMA 4OL0A 4OHYA 3AVYA 3QKRB 4DT1B 4OHZA 2QL6A 3PJRA 4KBFA 2WOOA 3UG7A 3EA0A 4KVAA 1NL3A 3AVUA 3T15A 2A5DA 3L0PA 2NOAA 5K8IA 1OSNA 4I1UA 5L3QB 4FN5A 2XNSA 4EPTA 4TYQA 1NBMD 4NONA 2BM1A 2VIIA 1I4TD 1CJUC 1NG1A 2QT0A 3GJ0A 3CB4A 5H8WA 2GEDA 1CRQA 2XITA 1E9CA 3A36A 2JLQA 4TQ9A 1H8ED 2O8EB 1QVAA 2PZGA 2ZXUA 3PITA 1VHLA 3HP1A 1W7AA 4PXAA 4RY2A 2VP5A 1B0UA 4BWYA 3BRWD 2HEIA 4B3DA 1T3SA 2NQ2C 2LWIA 1RVDA 3K9LA 4K46A 1GSIA 2G88A 3M4YA 1Q1QA 1NJFA 4OK6A 4DJTA 1U0HC 5E7MA 1KI1A 1RKBA 2C96A 2EWVA 3EPLA 4U02A 3SHFA 2GXAA 3A1UA 1P61B 1E2GA 2QE7D 1QHGA 2Z5FA 4B3CA 4D0NA 4QJ3A 2R2AA 2EU8A 1TTTA 4PFSA 1YZNA 2RGBA 2QAGA 1T3HA 4EUNA 4DSOA 4XH9B 3O8CA 1KK0A 1VG9B 2X8AA 5FOWA 4RJLA 2NO9A 2EFHB 3GLIA 1T8TA 5B2ZA 4NCJA 5TVKA 3GLFA 2OHFA 3MWYW 4AK9A 3B5JA 3HU1A 1J8MF 2IYRA 3WY9A 1MRSA 3GLHB 2PEYA 3W3ZB 3KJGA 3L0OA 4KSCA 4YMWA 4PAQA 5CIQA 4DCVA 2NO1A 3TNFA 4B33A 1G16A 2KWIA 1IY2A 2OCPA 2A5GA 5TARA 1DVRA 4JYCA 2GBLA 1U2RA 2PBRA 2QA5A 3K1JA 3LAWA 3P32A 5FPTA 3RRZA 2J41A 3SS8A 2W00A 721PA 4FMCB 3LO5A 3W5JA 2RHMA 4NYIQ 4NCKA 2IYUA 2O8BB 3KFVA 1D9ZA 1U8AA 3NBZC 4D82A 3ADBA 4TLDA 2D06A 2F6RA 3RRYA 1YU9A 3A4NA 3M6AA 4CZ2A 3VR2A 3NVAA 2CLCX 2ODBA 4NCHA 2Y8EA 4X8MA 4FI3C 5JS7A 4B35A 2LKDA 3ADCA 4HB2A 1NRJB 2WIBA 3GLGB 5BW8A 1BH2A 3B60A 3H86A 5EP1A 3WBJA 2JLXA 3V00A 1VG1A 5FOSA 3SU8A 4ARZB 4JVNA 2JEOA 3KJIA 4V03A 1W5TA 1UKZA 4FMDB 4PR0A 1Q0UA 3OAAA 2QNRA 4IJMA 3GFTA 3ZLJA 2HYIC 2Q0HA 4EFNA 1E9EA 4LJYA 1CEEA 1IY1A 2C9OA 2MSDB 3ZH9B 2ZVPX 3ASYA 4V0OA 1CR0A 2R9VA 3U7EB 4IKEA 1LFDB 4XOIA 2VSFA 2CL6X 1ZM2A 3RWMB 5EE9A 2PZFA 3EPHA 2ZJ2A 1HH4A 2WPDA 4OI0A 2AFIE 4FW9A 3ZZ0A 3RSLA 5EP2A 4Q7LA 4QHSA 1FNNA 4JL6A 3LX5A 4B3BA 2J0SA 3F3YA 2AXNA 4YONB 3EWSA 1SZPA 5KNDA 1KY3A 1P60A 2DFTA 4OI4A 2CL0X 4LJ4A 2GETA 4NCIA 1F5NA 4IOJA 3FOZA 5K8LA 1XTRA 4LGMA 4O0MA 3FYHA 4XIGS 2A2ZA 1Q44A 4X8OA 2J7KA 4LHVA 1KDRA 2J7PD 2RGEA 3QIAA 4BPBA 3BH0A 3H2YA 4U5XA 1LF0A 3B85A 1ONBA 3P1JA 1MT0A 1OXSC 4OYHA 4TZ6A 1E94E 4URZR 4M1OA 1W36C 3UATA 5EP3A 3H0KA 1E99A 1GRQA 1KI6B 4BFSA 1UDXA 1OYWA 1Z83A 2ZRJA 3CF0A 3MLEA 3N5CA 2JLZA 4BUJA 1UKEA 5HE8A 3FKSD 2FE4A 1XCPA 4R9UC 2XJ9A 3ZVMA 3C14C 3T61A 5SZJA 4YQFA 1Z08A 2VL7A 5FOTA 1YR6A 3EWAA 1ZYUA 4LBYA 4P4SB 1H65A 2F1HA 4Q4LA 4MYUA 2P5SA 1E79D 1SKQA 3BGWA 3JZAA 1FZQA 4KFTA 3EZ2A 4YDHB 1TF7A 5CK5A 4C0QC 2J9RA 4WXPA 5C4GB 3VKHA 4DLRA 3A8TA 3LLMA 3SN6A 4AIIA 4GMXA 4YMVA 4LI0A 1VIAA 1D2EA 1YR7A 2J59A 4OJQA 4M1MA 4C7OB 5JRZA 1CBUA 5IT5A 3OIVA 2A9KA 4QGFA 1F48A 4OQNA 2DCUA 4C0BA 4IOKA 3CF6R 2AFHE 3MRSA 2WKQA 2F55A 3D8BA 2JLWA 1FTSA 2YZ2A 2V1UA 5EE0A 2RGCA 5TDHA 4GL2A 4FCVA 1TQ4A 5FFMA 3GJXC 4LDJA 2QENA 2X19A 3BERA 2OZEA 2ZE7A 1J2JA 2H17A 2J87A 1NMXA 1E2DA 2HT6A 2ZU0C 2AL7A 2JLUA 2NZ8A 2VH5R 1G5TA 3LBIA 1RRGA 3QXCA 4GSYA 4Q4AB 4DWJA 1AJEA 4ZCIA 3DPUA 2F9LA 3AKYA 1RJ9A 4A2PA 3TK1A 2BC9A 2JJ1D 4PHTA 1E2QA 5JFGA 3IDQA 3X1ZA 4NHOA 4JLKA 2GCNA 3MD0A 4LCBA 4RD6A 1RC8A 1RE0A 3K09A 1II8B 4PANA 1JR3E 1T6NA 1IXSB 1NY5A 2OBNA 2VYFA 1QHYA 4TT3A 2BBTA 2ZI3A 3NEJA 5HTKA 4B34A 1RRPA 4G5RA 3R8CA 1IM2A 1TF5A 3OEED 2AKAB 4J0QA 4ZO4A 1RPZA 2GCOA 1CS4C 2CNWA 1OXXK 3AP2A 3SJZA 1HUQA 1QHXA 4JT4A 1DE0A 3L2OB 4E22A 5A5GA 2A5FA 5EXSA 1KO4A 1ZMXA 2C77A 2YOHA 3LVQE 4QJ5A 4JJKA 4U00A 4A2QA 5IK2D 5L3SB 1GP2A 4FWTA 2ZM5A 1AIPA 1SULA 2H5EA 4JT2A 4MDFA 2WV9A 3THYB 4A92A 2R6GA 3QQ5A 1RW4A 1UFQA 1FUKA 1NBMA 2OFOA 2ZSBA 1XTSA 4WZBE 1S4QA 1UEIA 1H8EA 3C5CA 3QPWA 4Q9IA 2QY9A 2VEDA 5B57C 4QL3A 1YR9A 3W8RA 1KJWA 2FV8A 2GJ9A 2VHCA 5CLLA 5FPYA 2FA9A 2J3EA 2TMKA 1ZINA 2C9YA 1W47A 5AK0A 3THXA 1GL6A 2C5LA 1KHTA 1DO0A 1F6BA 3NEYA 4QNMA 1U9IC 4HEJA 4TL8A 2BCGY 1E9FA 3ADDA 2R44A 4RKFA 2VA8A 4IXNA 2N46A 1SVWA 3C16C 1E9DA 2QE7A 2OV2A 2FF7A 1S9DA 3LY5A 3TMKA 1JI0A 2YWFA 4PC6A 2JAQA 4URWR 1FQKA 4GP6A 1FUUA 4UKDA 1E2HA 4V02A 5DI3A 1P9NA 2NMVA 3A58B 3K53A 1CLUA 3PEWA 5H1YA 3QPUA 4CT4B 2QM8A 1CR2A 1XTQA 3IQWA 4XWOA 3EX7C 4GOKA 4URVR 2WBLC 2J1LA 1YKSA 4OK5A 1U8ZA 5E4FA 4C0AC 1W1WA 4PX9A 2BM0A 4PZYA 2WZQA 1LS6A 2CXXA 1E4VA 4Q7MB 1ZJ6A 3EG5A 3KKOA 1XJ0A 2PCJA 2VP9A 5C4MA 2H7VA 1UF9A 1XTKA 4FCTA 3PR1A 4CW7A 1OLOA 1E2KA 2G77B 5DNYB 1W4CA 4JLOA 1GL9B 1U98A 1ELOA 1W5SA 4XWAA 1GUAA 4V0ME 2H16A 2IEZA 3MAAC 2IS1A 2RH5A 1CKEA 1E2NA 1OH6A 3KJHA 3ZVRA 1Z63A 4PHGA 5FBVB 3E1SA 1II0A 4OI1A 1EWRA 4FMDF 4M9SA 5JI3E 4ZKDA 1MKYA 1Z0DA 1Z6YA 2BKUA 2GEUA 1EX7A 2ORWA 3BAFA 3W8NA 4ACAA 4E09A 1LS1A 5G40A 1JPJA 1E1QD 3EAQA 4KITB 1RRCA 3L82B 3MWJA 4DLZA 4JLJA 5FH9A 3WP1B 3PEUA 3KJEA 1G8HA 4DLXA 1HA3A 3TQCA 4Q21A 3SJAA 4B43A 3EPJA 1FMJA 3QKTA 3PEVA 3A1TA 3ECCA 1YZQA 4PHFA 2SHKA 2CL7X 3CH4B 3GP8A 5J40A 1WP9A 3KL4A 1ZP6A 3SOPA 2BVNA 3SYNA 3GJ5A 1ZIPA 4JLDA 4CEIA 1KKLA 1KK3A 1SXJE 2YVUA 1IOZA 4NZYA 3LW7A 4GI7A 5AUQA 2HYDA 3VX4A 2REBA 3DZ8A 1VMAA 3TAUA 3TIFA 3VU9A 3TUZC 2O8DA 3EIQA 4JBYA 3VR6A 4EJSB 5KHOC 3SEAA 1FMLA 1G8FA 2P3SA 1KDTA 3SFZA 4KFUA 1I4LD 2ZJZA 1US8A 4PQFA 4A8JA 5KNCA 1Z28A 4Q7KA 2GZHA 1HYQA 2J7PA 2WOJA 1QVRA 4KCGA 4KFSA 5KSOA 3LV8A 3LW8A 2Q9AA 5J4LA 1WCV1 1Z6AA 1E0SA 2VBCA 2FGJA 1O3YA 2FEOA 3ZDQA 2OCAA 5CITA 4B47A 4CYMA 1V5WA 4DCUA 2IBMA 1LB1B 3PFIA 4Y0VA 3CKLA 2KE5A 3GEEA 3FKSA 4P0TA 2XEXA 2ATXA 1NLZA 2WWXA 4HAZA 1VKJA 2IC5A 1P2TA 3ZS9A 2GBLC 4S35A 3SDZA 4BASA 2JJ2D 4HB4A 1N0UA 4P31A 3KUCA 3X1XA 3IEUA 3THWA 2QBYB 2ZRFA 1E79A 2IW3A 2JA1A 3SYLA 3T35A 3AV0B 2FSGA 4DIDA 1M34E 2ZRDA 4WOPA 1Z5ZA 5CB6A 3D3QA 2Z4SA 1E4YA 3CUEF 1KO5A 4IDPA 3AVTA 4IFEA 3QKRA 1PUJA 2V6JA 4DT1A 4ZI3A 1NIJA 5AJVB 1DAMA 1PZNA 1BYIA 2NZJA 3MGCA 2QN6A 2OUKA 5FOUA 3E5HA 5KSYA 1QHHB 3HR7A 4JVSB 2ZRNA 5L3QA 1A7JA 3UPUA 2IUSA 3WRYC 3LRPA 3ZGXA 2GJSA 1MO6A 1G5RA 3KQKA 5EZ5A 1VHTA 5K8TA 1SVKA 2IS4A 5HR5A 1XRJA 3FHTA 2CCGA 4ASUD 1T5IA 1LTQA 2O8EA 4QKQA 1R0XA 2ZJOA 1YHNA 3DKVA 3OHMA 3K0AB 5L3VA 3VHLB 2JLYA 3B9PA 3WNDA 2VF7A 4PC2A 1BS1A 4OJKA 3IUYA 1XPOA 1S3SA 1JNYA 4HUQB 4TL7A 3UK6A 4LV6A 1Z07A 2ZR9A 2RB4A 3VR3A 4M53A 5GJBA 2JJ1A 1D2NA 3FKQA 2XZOA 2GWHA 2DWPA 1MR3F 5KO2A 1N5LA 3T34A 1R6BX 3QI2A 2DY1A 1DAHA 1I2MA 1OIXA 3T1VA 3FE2A 4L4UA 3VX3A 3VAAA 4PAMA 1W49A 1A5TA 1RIFA 1XDBA 2JIZD 4AG6A 3CZQA 4M4SA 1NN1A 1P6XA 3OEEA 4Q4HB 1OB2A 2GXSA 4IEEA 1X8LA 3EA5A 1ZNWA 2FMXA 3UWKA 1VCNA 3F8TA 1EK0A 3U44B 3H4MA 3GLHA 2XOKD 3QKSB 1HURA 5IK2A 4IVQA 1KI2A 5LD2C 1G19A 2QMHA 4EDHA 4DDUA 2KBEA 3MG9A 1W4RA 3K9NA 3R7WB 1HY3A 2FSHA 4DLUA 2GJKA 4DB2A 3WYGA 1VYVA 2A78A 2NTYC 1ZD1A 2REXB 3GFPA 1DEKA 3W6PA 4BFUA 1R5OA 2WMOB 3W3AA 4KAXA 4Z1MD 1OB5A 2UZ3A 3IKJA 2G3YA 4JS0A 3ICQB 2FGKA 4HLUA 3VR5A 4BLTA 2WWYA 3ZD7A 4S2EA 3AUYA 1G7SA
chains in the Genus database with same CATH superfamily
3S2ZA 3DUFB 2DHCA 2C07A 3M5CA 1QO0D 4PU0A 4XX1A 5DWQA 3TSOA 2ODNA 4K03A 2MTBA 3RM3A 5KNBD 1VSVA 1XZ8A 1MO4A 2D2EA 3TL2A 4K81B 4CT5A 3REFA 1LSOA 4RETA 2AI3A 3V1UA 4HDKA 1ZOIA 4F3CA 2GWRA 1EE9A 4BU1A 2C5EA 3CVXA 3FWZA 3ZDAA 4CMKA 5C35A 1ADCA 1N2JA 4ARZA 3VO9A 1LPOA 3QFRA 3GJ8A 4B84A 4H7IA 1T10A 2GCGA 2Q29A 4O4LA 3ORYA 3V2UA 4OH1A 3NOOA 5EMLA 1KU0A 1EINA 1RD4A 3SXPA 4LFCB 4RDHA 5IFKA 2WFLB 3ZD6A 4JQCA 4KXQA 4KN5A 5EN4A 5KX5B 1K0UA 2IXAA 4XE5A 5DHSA 5LXTB 2HRBA 1QK5A 4PM4A 1I0ZA 4Y9RA 2NTJA 5ER9A 4ZVTA 4BVBA 4XYGA 3AVXA 1D2CA 1SH7A 5K0SA 1VECA 3ESYA 4LC0A 1XP8A 4ND3A 3VH4A 3ZZMA 2XIQA 4JMLA 4KX3A 5BV1A 1I9GA 3GNTA 4HGQA 4RESA 2W6QA 5E3IA 3IDOA 4M76B 2H5JA 1WXHA 3H3XA 3U5ZB 4P4TA 1KYQA 3ZHZA 2ZSJA 5HJ7A 8ATCA 1U7ZA 2Z30A 2ZYGA 3WGNA 3EZFA 1RQPA 1ZVJA 4DLYA 4DCNA 1T5OA 5BMOA 5CB0A 1XK6A 1Z4NA 1UK6A 2XYHA 2ZRQA 5BN3B 2PZBA 1U99A 1OXMA 2AZTA 2WSLA 2PZLA 3RSZA 1SUIA 3Q15C 5T8KA 3SICE 2NSHA 2O5RA 3IUMA 4FCWA 1NW6A 4QUGA 5FLXA 2ZULA 4DREA 4RPHA 1TEXA 3CX4A 3E3AA 4BX3A 1L5WA 4MROA 4EHAA 1UUFA 3NHAA 5HVNA 3KSRA 4WN3A 5IFLA 1EDDA 1UC8A 5IJ9B 5JBQA 3C39A 4EMBA 1KA9H 2JLBA 2YHUA 1KGDA 1B7GO 2EZ9A 4D81A 3DTVB 2M2IA 3EB9A 4HHEA 2WM8A 2I3ZA 1UDWA 1DC7A 2IE8A 2A9OA 2WM9B 3ZHOA 2H1RA 3EIEA 2QLNA 4FZVA 5E6SA 1E1QA 1JXQA 1ZD4A 8ABPA 3MJSA 1JIVA 1WXQA 4PO9A 5M29A 3QVUA 3NDJA 4O2LA 2Q0QA 1MB4A 4WA8A 2KQUA 2XADA 1KR2A 3NPAA 5E9WA 3DOOA 1MUUA 3R76A 3WK8A 3L7YA 5HUHA 3IL2A 2FEXA 3Q3VA 4Q12A 4Q15A 4FP9A 5ADVA 3E9ZA 5CK4A 3S81A 1P9WA 4H6XA 4KO8A 1QM5A 5CJJA 3W5SA 2RJNA 4NXNB 3TEFA 1ZJYA 4CR8A 4E5PA 1RCFA 2FWRA 3ZY5A 1I7PA 1LV7A 1IRXA 4EY6A 1ENYA 3LUCA 2B5OA 4B2YA 2H4HA 2HA0A 5DB4A 1RWBA 3LT5A 2C94A 1IMOA 1GCGA 1VP3A 5DEOA 1EXMA 4KZPA 3HN7A 4DY6A 5I5GA 2Q1TA 4NC9A 4R0NA 4BQQA 5ADWA 1KFJB 1BJKA 3LUAA 3IBFA 2VQSA 4CWAA 3FCUB 3D8NA 3RSOA 3DEZA 4GR4A 4I08A 3VR6H 3RGWS 1LC0A 3ZVLA 4ZYLA 2QN8A 4ZQCB 5F76A 5H16A 4CIDA 4CI0B 1PWYE 3O8QB 2QMEA 4WECA 2XB2A 5EWMB 5AM0A 1V4NA 2YN2A 3VO8A 3WNBA 5J4HA 1Q2XA 1JR3D 4B1FA 3G88A 4PLWA 1TB4A 4OHWA 5EWLB 1T8UA 1M0SA 3IQIX 3VTFA 2GK4A 2FUG6 4C0SA 5JMOA 3ZDZB 3OJLA 4EUEA 2NW6A 1W96A 4INOA 2ZBQA 4F12A 2EERA 1E2BA 2GM3A 5E95A 5JZMA 1CY4A 2Y68A 4N0PA 1N8TA 2BISA 1H4SA 3I9MA 1ZCFA 3LPNA 2AMFA 1OIWA 3RF7A 4NE2A 5IM4A 1TJNA 1V4BA 4C89A 3DMPA 3FVRA 1ID1A 3QFSA 4M7OA 2W6MA 5C3UA 2D0OB 1IBCA 1QDEA 1GYRA 2J07A 3W2GA 2OOSA 4ETWA 4ZU6X 2WAMA 2WVGA 2DBVO 2FPXA 1MJGM 1YCDA 3BIXA 3W1EA 1ZY2A 3LVRE 1FFHA 1T9HA 2GFIA 4RF4A 1QFXA 5E8RA 3GFVA 2EFCB 1AS0A 4CCSA 1U11A 3HKCB 1KY4A 1ABBA 2O2SA 1F8XA 1U7OA 2QTWB 4X9XA 4M7RA 2F1KA 5FEUA 4MRMA 3B38A 2FU5C 1DU4A 5FPHA 3TDMA 3P9QA 4YJHA 4GKBA 2V54A 1NQWA 5IXYA 3PGXA 3HVJA 2HLDD 4NR0A 1VGQA 2GLUA 3PHCA 4NE9A 4MAMA 4GT1A 5EGSA 1E3TA 3EWIA 2ZQ5A 2VNHA 5FLYA 4EITA 1IHUA 4RMGA 3I61A 3UT0A 1KSGA 3ZGVA 5CM9C 1I7LA 5JSYA 3HA3A 5EMJA 5A3JA 4XQCA 1XJQA 3VGPA 3VQTA 2DHDA 3F1LA 5H59A 4BLVA 4C4YA 1YZUA 1NBOA 1IY0A 1P62B 2QP4A 3NATA 4K8RB 4GGMX 4KR0A 3BBPA 1BRTA 2IYVA 2LCFA 4EABA 5HIKA 4V0RA 2FQ1A 2XX3A 4XVRA 1J20A 5E9AA 3T0IA 3PQ6A 3F7MA 4ASUA 5LFAA 5LMUB 3M6XA 4N5DA 1U5BB 2J6BA 5D3MB 3WB0A 3I05A 4L6AA 4B3XA 3EXAA 2WU0A 2A9PA 5J5CA 4BLWA 4CDNA 3IBTA 1RADA 1O94A 1XUOA 1XCOA 2VRNA 1U0OC 1TC1A 4OAOA 3DAGA 5CBPB 4LF4B 1OASA 4ARVA 1CQIB 1W59A 2PY6A 3DMFA 1CR1A 4YDQA 2V7GA 3V8VA 3WFJA 1L5VA 1A9QA 1CVRA 3CY6A 3E6AA 3FDZB 5ELMA 1E8NA 3FRJA 4Q1DA 1YOVB 3OEYA 1BO6A 4YECA 2VJKA 3IUJA 1WXIA 2NZWA 4ZI5A 3AH8A 4NAHA 2C7OA 1WPGA 1D8TA 4JQZA 2ZWOA 4D4KA 3QTBA 3TGPA 4FUTA 1H9BA 1E9AA 4H3VA 4JLMA 5DN9A 3UAYA 4QUIA 2I22A 5MDHA 3SX4A 3FGPA 4E4RA 4BFYA 2R68A 1J97A 5TE9A 4LZAA 4D4LA 1YIDA 2X6QA 1M2VA 3FTCA 1SHTX 4RPJA 3KAQA 2ONCA 1M8PA 2QD2A 3BF7A 3L18A 3I3OA 4PAOA 4M21A 2XQVA 1NTRA 1YQ9A 3PHIA 1T2NA 4PZEA 4EX7A 5F35A 2JGEA 3QJYA 2IYZA 1WULS 2GPSA 2VCHA 2YH2A 3PHGA 3EA4A 1PE0A 7AT1A 3M6IA 4I3FA 4B17A 4G01B 3N74A 3M2PA 3ZTTA 4AKGA 2I6FA 3AUAA 3DFMA 2DUNA 3V4VB 4FI3F 4L78A 2Q5EA 4QU9A 4Z9XA 2ZI9A 4CM8B 5LMCA 1Q84A 4N7BA 5JADA 3PI6A 4P1ZA 3AJRA 3ZN2A 1Y34E 2B0CA 3FTQA 5JLJA 2IELA 1P0CA 3ZY6A 4NZMA 1XTIA 4YAKA 3VR4D 3ZW9A 1AE1A 4MWEA 4U2FA 3L4BC 4HDQB 2IEAA 5TY0A 5JWRA 2OB2A 5C5CA 1BU5A 3WGMA 1OZFA 2WTEA 5FI3A 3OPVA 3QJGA 4I3GA 3SZ3A 1QO0A 2PYIA 1E92A 1FBTA 2OXEA 1KTVA 1DBIA 2GRJA 2WSBA 3N6RA 4J6FA 1RWWA 4MJ7A 2ERCA 3QWHA 1NBEA 4YAOA 2OPHA 1GTSA 2N0SA 2WJPA 3LKBA 4LK3A 4YYEA 1V9SA 4KL8S 5CDGA 2B4TO 5K6TA 2AFIA 3ZCVA 4QDJA 5ICMA 4Y1GA 1HOTA 1QH8A 5IUJC 3AO0B 5EWJB 3TVDA 2HMVA 4MLZA 1YWGO 2E4YA 1EK5A 1IN5A 2GLXA 4XKJA 1DWOA 3NPMA 3SYMA 4I66A 4DMRA 2Y9PB 4JMPA 5CJPA 1MD9A 2EL9A 3T4UA 3ZPXA 3AHIA 4AXXA 5SV2A 3NWJA 1DDOA 3IBYA 1Q7BA 2CZCA 4WVFA 4GZ6A 4B76A 4WQMA 3ICWA 1NONA 2O50A 4HATA 1CRWG 3RH0A 4FMPA 1JEEA 5CA1B 2HREA 4C6SA 5D01A 1D6MA 2ACKA 2O52A 3TN7A 4DHWA 4EA6A 5CEEA 2IZ6A 2OV3A 1AXEA 3IMGA 3IR6A 4UUMA 5LP6B 4JCOA 4C6TA 4DV0B 2CJFA 1AMOA 5HFAA 2IF2A 3EOBI 3JAMA 5ARCA 1X1DA 4QELA 1E2MA 2QX9A 5BXYA 4MV6A 3UUEA 5G53C 1HT2E 4MRNA 4QXPA 1YB1A 4KAFA 3H7IA 4P38A 1BZYA 3QA9A 3SNHA 5KIAA 4BO7A 4XJVA 1HZZC 3UAOA 1KMCA 1S96A 2PSDA 3PUZA 3IEVA 1KEEA 4O59O 5B5SA 1TKCA 3NNNA 3AVWA 3DAHA 4JBWA 3I9V6 1K3UB 3CO0S 4YPFA 3ZKWA 1FLAA 3BRQA 4DCCA 1CY8A 1N4DA 2CJWB 2PWPA 2PGJA 5DX8A 3RJTA 3TVYA 1QLJA 4XQ0A 3KWJA 5ED0A 5I7FA 2HU5A 1T24A 3H2HA 2ZSEA 4RV4A 4Q9HA 4G2NA 5TQJA 1MEEA 1SC1A 2FZ5A 4QLAA 2VJAA 2QMYA 1KJNA 2EKBA 2DSNA 2FPSA 5D1HA 4M1WA 3REOA 1W46A 3JQ9C 3IRVA 4MUMA 1BIFA 1UAAA 5ELLA 1PSWA 3MWEA 4M3NA 1G7RA 3TSAA 3C1UA 2R7MA 3PPVA 1NDHA 3B8HA 4RACA 3R7LA 1MQ8B 2FW7A 1G63A 1X80A 1K5HA 2QTMA 3AT1A 2W2TA 3X1JA 1TLFA 2EDCA 5AVWA 2OV8A 3DVRX 2JIBA 3GNLA 4WK6A 3KT3A 3NOVA 4I81A 5JHGB 4BEBA 4R2HA 2K4MA 2VFAA 4P86A 1YMQA 2CMKA 5E7QA 5JQGF 3AZOA 2HZBA 4X54A 5K09A 2W48A 3A1DA 4FD3A 2WW8A 4YA6A 1FOEB 1NZJA 2FYTA 1PR5A 2Q99A 4JSTA 4MPTA 4NCAA 3WGOA 1CU1A 1HTWA 4PG6A 4YMLA 3UWPA 3T1YB 3R7DA 3Q3EA 4NZNA 1OY1A 3C6YA 4MV7A 3CLRD 3CMCO 1EHYA 1B73A 3AVVA 4KLAA 3OQOA 2A0UA 2O0HA 4ZVMA 3KSAC 1H6CA 4YCDA 4OQMA 2IYXA 2D5LA 1N8KA 2B82A 2BKLA 1ILEA 1F3OA 1M6YA 2VDUE 4TS1A 4HS9A 4JLVA 5LNK1 1CUYA 1MXFA 3G0GA 3GRYA 1O03A 1UDRA 2GX6A 1QNLA 4KLCA 3VPAA 2XVXA 3LBNA 3CRZA 2BHRA 2ZVDA 3GCWA 3NC4A 4LV8B 3TL6A 1TNDA 2VJOA 5I8PA 1EB9A 1ISGA 5FUMA 4WT7A 3ENZA 1Z0FA 1JR3A 3DOUA 3FUWA 3PFKA 3FMOB 1T1IA 2X15A 4L4SA 4XR4A 4A36A 5I48A 1KKMA 1W93A 3PUJA 4AMZA 3FHCB 3ZCQA 3L7KA 5JFTA 5ICFA 4QXRA 1M0WA 4RH3A 4K86A 3K5PA 3AFOA 4KU4A 3ODPA 3T5DA 4CIYA 1EH5A 2VZ0A 2XMSA 3EDQA 3MGGA 4AUEA 2Q50A 3BG5A 4LY6A 2J0UB 1C3XA 2P9EA 3DKIA 4DANA 2VJBA 4ZRNA 1U7UA 4HDAA 5KTOA 4W5HA 2I4NA 1ICEA 3HKBA 2C00A 2I6UA 3SCZA 4BLOA 1LJUA 1JHPA 1XD9A 1GL3A 1BXRA 2IIVA 4U8HA 2HBZA 3Q40A 2W6NA 4EKDA 4DV4B 5FTLA 3GFBA 2DAPA 3V9PA 2RI0A 5LB4A 3LUBA 2WD9A 4JKOA 1U8EA 1FEZA 3FBWA 2YJGA 4L9SA 4X6XA 4RJTA 1IBRA 4PYNA 1T8YA 3TGWA 1R18A 3A6HA 5L3ZA 3OZUA 4KDFA 2HB6A 2ZVJA 4FN4A 5T8KC 2EFYA 5LD2B 4YLGA 2IXDA 4UNPA 5CVJA 3BGDA 3V1KA 1KEKA 3A4MA 1Z2OX 5ILGA 4LF9B 3AB8A 4CU2A 5CHEA 2XMGA 3GLTA 1WF6A 2HLDA 4WIAA 2G7MC 2QRNA 1NJ2A 4A03A 1V45E 3MUNA 3NHRA 4O2AB 3QKSA 4PY2A 2P9QA 2PS3A 3HY3A 4EF5A 3CNLA 4YCSA 4RMJA 3R9XB 5I7WA 1T2DA 1N6IA 4FD2A 3W34A 5IJ0A 4KXYA 3HCPA 2JAPA 5DYIA 1JKFA 3P71T 1JVSA 3R7WA 5TV2A 4OGGA 3IHKA 2EJCA 3ABIA 5CH5A 1ST3A 3RBZA 5K3BA 4OF4A 3BB3A 1KOFA 2PGOA 3WLQA 1ZSYA 4DV5B 3BXOA 2PAFA 2ZUTA 2C61A 1GKYA 1R5BA 2NSJA 2XUDA 4DIEA 3ORHA 2MWMA 3PWZA 5BVGB 4LECA 4YP7A 1CNFA 1W5FA 3G7UA 2BSXA 1AKVA 1E6KA 3BHMA 3DUFA 4LJ7A 4LRQA 4B7UA 3W5CA 2QHXA 4IJUA 3UMRA 2AD5A 3ZGLA 3TE6A 4Z5XA 2VJQA 2OFWA 3E2MA 1FQJA 4BE4A 4F46A 1SQGA 4XM2A 3PWSA 5I9NA 1JJFA 3SP1A 1N8SA 4KEAA 1ZMBA 2NVUB 4ZQHA 2YJ3A 3UHJA 1X7DA 3U62A 3NAMA 1TTPB 3TTWA 2JL1A 1OAKA 1D5WA 3BWCA 4GEKA 2OQRA 1G41A 2Q6TA 5DKFA 3SS7X 1L4MA 2R6DA 4LSGA 5IRCD 1NVVQ 2W2PA 2O0JA 3GAFA 4DCSA 4QLBA 4A82A 1VZ3A 3FDIA 1U8FO 5KX5A 1JX6A 2O2IA 4YDSA 3FDJA 5LXTA 1YQGA 3L06A 4RKWA 4Z4EA 3MT7A 1Z45A 4U63A 3SZOA 3L8YA 1QH0A 4GP7A 2Q5CA 5EIBC 1B16A 5DGIA 4E6EA 2Z3VA 4LJ9A 2PU7A 1ULUA 2F67A 4IFTA 4L28A 1VFPA 3BOSA 2YBDA 4O8CA 1WZNA 4B6RA 3HU3A 5CXUA 5CDTA 4ZK6A 1C9JA 1HLGA 2PZEA 2RHBA 1DOAA 4AAYA 3RYIB 1O4WA 4H1VA 2EYUA 3SXUB 4ZCQA 2BHNA 1T8SA 2AR0A 2GYUA 3GN1A 1WL8A 4QBFA 4IGEA 1I4OA 2IYLD 1JIKA 3O8DA 3T3DA 2VCEA 2J3DA 1L7PA 2RKOA 3HJTA 2E48A 4X3OA 3VR4A 4KV7A 3QITA 3LKDA 3QMMA 4A0QA 3KV1A 2R1TB 1GZUA 3TIVA 4QUAA 1Z7BA 4L73A 3WHKA 4O4JF 1R4NB 1ZGJA 2ZIUB 3NKLA 3CSUA 3MJHA 3F73A 4KPYA 4OQQA 1M7GA 4KNYA 3VYWA 3S3TA 5IJ9A 3RG8A 1EXDA 3KUXA 3VHRA 3HJFA 3T5CA 1CK4A 1K08A 4V3CA 1IZ0A 2G9ZA 3WHPA 4AN1A 4N3CA 3ZKAA 5CA1F 5CDUA 4GI3A 3NJRA 1MA3A 1UJCA 4JEUA 2X2FA 2UUAB 3E03A 4EOGA 4JSRA 1DC5A 1E5LA 3JPWA 4FYIA 3UB2A 2C3OA 4R84A 4C76A 3FSGD 3LYHA 4ZEOA 1C3LA 1DNPA 1PVDA 4EQ6B 4XLZA 4ES6A 4D8XA 2Y9MB 4MAFA 3MUFA 4M98A 1I6MA 1LQ2A 4AG5A 1M1ZA 1Q17A 4AMBA 1JZQA 2BF7A 1ZBDA 2AMLA 4C5BA 3L93A 2WLTA 2X1LA 1OLXB 1TMGE 1U0RA 1JIQA 4BO1A 2NU8B 3L46A 4JGGA 1TEHA 3KQVA 5CDFE 4IDHA 2UYYA 3WX0A 1O94C 1ZRSA 4I5IA 5HCNA 4KPUB 1YBFA 1G6Q1 2WVJA 3ZZ1A 2ZJAA 1RZRD 4D98A 3NDRA 4CHTA 1EGAA 3TLAA 1DIRA 3HA7A 1U4SA 3QVSA 1K8QA 1X7ZA 2R6R1 2JI7A 3IBCA 1RE1A 3PA8A 4OQEA 4ALNA 2PKCA 2PFSA 3F0TA 2DVMA 4C0WA 2HDHA 2JJMA 4GKVA 2OG1A 3P4XA 4DSUA 4FYWA 2I7DA 3O2JA 1ULAA 2ISCA 4FB5A 5AOBA 2D54A 3MTQA 3CXRA 1KF0A 3O8QA 1JWAB 3RVDA 4MMXB 3W7VA 2F64A 3WQHA 3I9NA 3KQWA 5EWMA 1SN7A 3KKMA 5KEIA 5JS2A 3WAJA 1EA5A 4ZVOA 4DR4B 5E38A 2XCSB 3RHFA 5LL6P 3HDQA 4Y2YA 1NIPA 4KQMA 5EWLA 1VLQA 4HDNB 4FFRA 3J81A 4G97A 4K9RA 4KB5A 5DYNA 1EZ1A 4LYGA 2BE9A 1XZMA 1N0WA 4HLDA 3ZY3A 3ZW7A 3LHKA 4ZYYA 4IQFA 1L4HA 2HDWA 5JPDA 2H11A 2M6SA 2X14A 5AYVA 2OBYA 2P79A 4Q7JB 1N57A 4U7GA 4YGXB 3T7JA 3MFYA 3QSYA 2RGRA 4O3MA 2LXNA 2G0TA 1G1AA 1FDOA 1NUQA 2EX0A 4D6XA 3UT5B 4Z4QA 1K0FA 1Y8CA 5LWHA 2A4MA 4I4TF 3CEAA 5B6PA 1QHSA 2Y4OA 3BTVA 5LBUA 4ZDWA 5TSDA 3OP1A 2AQ8A 4MWSA 3BSFA 1XROA 2J4CA 3NMUF 2RBGA 2WK1A 6YASA 3HKCA 4IUDS 5JWHA 3OLYA 4D0LB 4MUIA 3EAFA 1N2CB 3I52A 5LBIA 3MJTA 3KD2A 2DB3A 2XA1A 4OK3A 3EIOA 3CWQA 4UULA 4ZA2A 2CD9A 1NF8A 2V97A 1Z06A 3LUDA 4K0KB 1QIDA 2AJLI 4QGAA 3R20A 1M6NA 2ENWA 2YRXA 2QTRA 4N6OA 3W6NA 3X1WA 1OR8A 3TRIA 1L7AA 4FCCA 5JTUA 4CLRB 4KR9A 1Z0JA 2AG5A 1AUOA 2H31A 3CONA 2PIDA 2M6KA 4I2VA 3EQ8A 3CZ5A 1L5SA 2Q1XA 1MFPA 3ILSA 5FWXB 2WFMA 1UBOS 4GUDA 4OLHA 2HSWA 2PZKA 1C3OB 3L40A 1P0PA 3PQ7A 4QA9A 5EQTA 2EKZA 4NYMR 3DL7A 3WOHA 1EQUA 1NI4B 3HACA 1X1EA 1FDIA 1R64A 2I62A 2I87A 4J9VA 3AF1A 4X85A 5L4LA 1U5BA 4F45A 1Z6TA 1OKKD 4PG4A 3MB8A 2VJMB 3OU2A 4YJ3F 1EZZA 5CXXA 4MVJM 3ZE1B 3S8MA 1M8FA 5CBPA 3T9AA 2J9XB 4CNBA 3EY9A 2AOXA 2I2AA 3BFVA 1CQIA 3OO1A 3OZAA 1ZAKA 4YCAA 2XXBA 1ZKMA 3MMNA 5EZYB 5IDWA 2VP2A 3FDZA 8OHMA 9LDBA 4NK4A 1AHHA 1TT5B 1YOVA 3PT9A 4GOJA 1AT1A 4GBMA 3FN4A 2HWKA 5EZQA 3VH2A 2JG3A 2GD0A 3GIDA 3JQEA 2V98A 1P1HA 3ITKA 1Q5PA 4IMPA 1G8SA 1UBTS 1RBQA 4F9EA 4BXOB 5EKSA 1NI3A 2IV3A 1SRRA 3ZZTA 1GQ2A 4HH0A 5JSQA 3TEJA 2O05A 3EEBA 5T4EA 4H0FA 4YXWD 1ULBA 4LPKA 4S0XA 4FE4A 1I6LA 4WY2A 3I5XA 2V9CA 2CLHB 3AIKA 4M9RA 4XWGA 1E62A 1VL5A 2P11A 5EHQA 3U7IA 4B7AA 3LUJA 2XT9A 3IUEA 4QPJC 5GZ6A 4PX2A 4DC9A 5CD1A 1LQUA 2JFYA 1VIYA 3A3KA 5AESA 1ZN8A 3ORRA 2XQKA 3BORA 4J2HA 3I6BA 3UFBA 3DLPX 5ISMA 4PS0A 2V3CC 4WOCA 3EGIA 1R0WA 1C1XB 3HCRA 2JD1A 1XA0A 1E89A 3AV3A 2P6MA 1ONOA 3I92A 3UN1A 2OECA 2XZPA 3DEAA 3THWB 2JI9A 3KTFA 1GOTA 1R0CA 2CFOA 3EVTA 4Z0PA 2QTHA 1G9XA 1SUBA 2ZPAA 1G0OA 2X4GA 3LRXA 5CLQA 4WX2B 4HVTA 1T9ZA 1I1NA 2ZDGA 5HWSA 4B3GA 3FPEA 1W19A 4REOA 2AZDA 4Q02A 4H1HA 1XK7A 3R9WA 3T52A 3ACBA 5U4QA 2PLFA 3CPSA 3GGOA 4CMHA 4YPOA 4Z7NB 2QAIA 3ELYA 1H4QA 3P2KA 4JOQA 5EWJA 1HWYA 4KPEC 4BFZA 1P2GA 3Q0TA 3GQBB 3SC6A 4IL5A 4D3FA 1SU8A 4B73A 4DMKA 5JNUA 2L18A 3RROA 1CJTC 5T3YA 3UH0A 4XYBA 5D5HA 4DSNA 5TT0A 3I01A 1MOPA 5BWBA 3E27A 4HSEA 3A31A 5FIUA 1V6CA 1ZXBA 1K5DA 1VG8A 1ZD2P 4MEBA 4ADSG 5A4JA 8GPBA 2AG0A 3G0HA 2BGUA 2K87A 4GPAA 1DBSA 2XSZD 1S8OA 4AYWA 4FNGA 5CA1A 3GHYA 2I6QA 5KNCH 1U02A 4ZMRA 2A7QA 2UZIR 1FTYA 3ANTA 3T5GA 3ZOZA 3C3JA 3TPFA 3RT7A 1DQZA 5LP6A 1FW6A 1NR5A 1T1RA 3GLVA 4W9MC 4OFXA 2F1JA 1UBFA 1Z8FA 1QTNA 2EFDB 2R5FA 3FNEA 3OY2A 3UZUA 4Y1RB 5AM1A 3WDLA 4BGIA 3WTCA 1JLHA 1JLSA 4F3YA 4KRFA 5CTAA 4LHXA 3ZE9A 4JBGA 1CD5A 1EE2A 3DKRA 3VJRA 1G2PA 4RSHA 4Q1FA 5C5DA 3H2ZA 3HH8A 4PWZA 1X9GA 5DBIA 1Q7TA 3O5AA 5FADA 3TW0A 2Y27A 2JEYA 3TLXA 5F3DA 4LHSA 2CJWA 2FUNB 2VLIA 2ZAMA 1EESA 1XG5A 4BJ1A 2UVQA 3LX6A 3WIVA 1FY2A 3L7MA 2VT7A 5SICE 1X1CA 1HKUA 1EYZA 5KHLB 1YVDA 1L4YA 3GIWA 3NWBA 3P97A 4KOAA 4YAGA 5AKLA 2TYSB 4EG4A 5SZKB 5BNIA 3NETA 3HK2A 4H1TA 1PYGA 2BZ1A 5T6MA 1ZQ9A 1Z29A 3PD7A 2J0EA 3DVSX 4LKRA 2NU6B 1FXUA 5K8CA 3LS2A 3PENA 3CR8A 4GXRA 5KPDA 1OGYA 5F7JA 1VBMA 4AJKA 3V42A 3PP8A 1YU6A 5L3SA 2WUDA 1O9GA 1BD4A 4M8LA 4UQOA 3FSGA 4NCBA 1HG0A 5DHAA 2BEKA 2MYNA 4IJ5A 1RFLA 4YJ2B 3X0DA 1Z56C 1RM4A 4B8WA 4CQMB 2BKAA 4AZ0B 3NBXX 2IHBA 3WMGA 3OKPA 1YKFA 2C95A 1COWD 2YXDA 4EMSA 3A3OA 2GA9A 4F8YA 1YDMA 2OAQ1 4Y7DA 4RFVA 1K4YA 1RXCA 4PF1A 4P7GA 2CMGA 3V2HA 3G2OA 2N9UA 1NMQA 2A86A 1Y42X 3BK2A 3QF7A 4QBHA 5EQDA 5JOQA 2Z4RA 1H85A 1IZZA 4WE3A 3DLIA 1P2SA 3PYMA 2YASA 1RZRA 4IGIA 4GC9A 1PR6A 3LI2A 3OOWA 1B76A 2YRWA 4GLOA 4MUYA 3PHLA 1KPIA 1T0BA 3A26A 2C3MA 1K89A 1K06A 1QAQA 1AKTA 1ISPA 1SK8A 2IYAA 2JNWA 3GUYA 3IA2A 3NIDB 3QUSA 4NH0A 5GJWC 1AN9A 2YOGA 3GFSA 3WZMA 3KAPA 3OPYB 2W2VA 5B53A 1HQYE 2XYQA 3GRPA 3BC1A 3AUKA 2WSYB 3N8IA 4J76A 2WAOA 1WWKA 2EKDA 2XYPA 4OHCA 5AW2A 3K5WA 1Z9BA 3KOXA 1CWUA 2AYXA 1BE6A 4BC0A 2V7EA 1N5OX 3ASVA 3BWVA 3PT5A 4RIEA 3NGLA 2IY8A 1LDEA 2WPNA 3LT4A 4MUAA 4R7ZA 3KR9A 4ZK2A 1QG4A 4MQ6A 1VHQA 1AMNA 3C43A 2PCLA 1HLPA 1NYRA 3HN6A 4JUIA 1L6IA 2QGFA 5JCZA 2O2GA 3USZA 5IKMA 3VOAA 1VL8A 2NVBA 3CC8A 2J0UA 4MX8A 1UP4A 1F60A 2XRFA 2ZIZA 4OB7A 5BQ5A 5ADUS 3T1TA 3HR4A 4IG4A 1X86B 5LOVA 4RM3A 1JA1A 4RA9B 1LVUA 1N2ZA 1SB8A 3DD1A 1XD2B 4F5DA 1GA1A 1M2WA 3G3EA 1KEWA 1P4JA 1VIMA 1H8HD 3A32A 3R44A 1H94A 2L42A 4XQ9A 2RGAA 5E1BA 3OD5A 3HU2A 3RFTA 5GONF 1KQOA 2ZU6A 3QVKA 2CCJA 3CZPA 5A5VA 3N6VA 3NCHA 5BV2P 3PG5A 3MSXA 2FQWA 2WTMA 1GVNB 2ADMA 3NALA 1C1DB 3BL8A 3LF2A 1D0IA 4ZT2A 3TD6A 2X8WA 4COKA 1J23A 3B5EA 4NBSA 1J33A 4A3SA 2ANBA 1MHTA 3KD3A 5CXSA 3UV3A 5I5EA 3AU9A 3G49A 3RREA 4OYRA 4O2AA 1Q0PA 1R9NA 2B30A 3C6ZA 4DZZA 1OGIA 1UOEA 2G70A 4XUDA 1OFHA 2VT6A 3D1JA 3R9XA 2AH5A 3KO8A 3C97A 3NT5A 4OAPA 3TLMA 2A67A 2QM0A 3LDFA 1T4GA 2Q45A 4R8RA 1UKYA 3VYSB 1BH6A 1L9XA 1I2AA 1NASA 1T4BA 3HWSA 3K16A 3L8EA 3NFYA 4G9EA 1T4CB 4TQUS 5EZYF 2AE1A 1U5CA 3AHJA 4N8SA 1TK2A 4N5NA 3VKWA 9LDTA 1OKKA 2HJSA 2Z2IA 4LYJA 1TZKA 5AI0A 2ATVA 5BVGA 4EYSA 1CUJA 2HEGA 3VBCA 4N6NA 4RFLA 1UT8A 5D00A 4HNUA 2RGGA 1N2IA 1C1YA 1NWCA 5FPKA 5I4BA 1GILA 4JH0A 1ONSA 2QUHA 3LUFA 4PG7A 4U7DA 3AHFA 1FL9A 4WD3A 2QM7A 4TRRA 1G21B 3AKDA 5GZ3A 3KOZA 1VL6A 4KQ6A 5B1SA 4YRSA 3GLFE 4RE5A 2BUBA 3ER6A 2O14A 3Q1LA 4LZZA 3ND8A 4DLVA 4UAJA 1WE2A 1LV8A 4QM7A 4LJKA 3MCUA 5AW6A 4BZPA 1QVVA 2QAGB 3HHPA 1XZGA 4HFRA 1MJNA 4MV0A 4HGYA 5IMSA 3KYDB 3LDUA 4L72A 2C5HA 1TUGA 5AXBA 3ZH2A 3AF4A 1M1YB 2QW0X 1J49A 1K5PA 5T41A 3YASA 4PN7A 6ADHA 4X91A 4WEOA 2ZM6B 2GJAA 1OT3A 2IYQA 2BFCB 2O3UA 3OFSA 3PGVA 4YXWA 1CXZA 2JCXA 3WIOA 1SC6A 1A2BA 4YIHA 3GUZA 5HYVA 1J1IA 3ND9A 2NTEA 621PA 1B8PA 2CE2X 2E18A 2QSZA 3A05A 3FVWA 4X97A 5IJAA 2ECOA 1JHQA 3F2VA 3LOQA 1KKUA 1USKA 3R6LA 3F5FA 4CXMA 3ESQA 1BAPA 4GPD1 1RLTA 4JWTA 1ISIA 1DPGA 3RYIA 2OHHA 2ZBRA 4B6JA 4QO7A 3SXUA 3L6BA 1SVSA 3ZBQA 3T41A 1B15A 1Y1TA 5EJ4A 3MTDA 4GRAA 4HPJB 1RWVA 4Z4GA 3PK0A 2ENUA 3NU1A 3GRVA 5BQFA 2XAUA 1PFQA 1DTSA 1LRJA 4UOZA 1H3NA 1NV9A 2ANCA 2R1TA 3K31A 4KO4S 4UHHA 2R8RA 1CQJB 2FZVA 2VHQA 3U2QA 1KEPA 4HCJA 4HY3A 4AI6A 2YZMA 3UY4A 1CY1A 1N6HA 2LVBA 1KERA 3RTDA 1R4NA 1Q7RA 3CLRC 3S7ZA 4UTNA 1JSXA 2N1MA 2V8OA 3P2IA 2YKGA 1Q22A 4POAA 2DWUA 2Q5QA 3R74A 1QU3A 2GMWA 2ZJ7A 5FUQA 4BMXA 3QBTA 1PUXA 1Z16A 1FQOA 2GPTA 2WWGA 4R2IA 3VTKA 3N2IA 3W7BA 1LU9A 1Z8NA 2JJQA 3JV7A 5A5FA 4BNMA 2R84A 4GLJA 5F64A 4CN8A 4L07A 2M9MA 3WFIA 2I91A 1NW8A 3UMMA 1LVGA 2GAAA 1YH3A 4EG0A 1GTVA 4YB8A 1ESCA 1UXOA 3O75A 2H92A 4IDQA 3JYPA 4D80A 4WAUA 4EQ6A 2JHGA 2XSZA 3ZX5A 5ILOA 2H48A 2YJTD 4ZCLA 3C3CA 3ROMA 4CQMD 4OHRA 2RIPA 1JGTA 3AJ8A 3M33A 3F6CA 4I50B 5LLDA 4RGBA 2O2ZA 3KQYA 1G38A 5DASA 4YRKA 3WYFA 3UWSA 1OLXA 2NU8A 1R3DA 16PKA 2QVXX 3VDMA 1UJBA 5T64A 4E33A 5KKCA 2G83A 4LDQA 1CQZA 1Y3BE 2ATCA 5ALIA 4Q82A 5EE1A 2VQ6A 4KPUA 5KSPA 1YBAA 2ZRPA 3PRHA 1AHIA 2OKGA 4BE7B 3BHJA 3DOEA 3GZNB 3CA8A 5GJCA 1N2HA 3E2IA 5EHIA 3L8ZA 5J1TB 5B7NA 2QQGA 3SHTA 3BREA 1UJNA 4OP2A 1E7SA 4AN0A 2HA2A 2JIOA 1LBHA 2QV0A 1TZBA 1GT91 2V0CA 2OO7A 4W1QA 1J99A 5TC4A 3LC2O 5LM3A 3RI3A 3K35A 2ETVA 5IF3A 3UK7A 2JGAA 3ETLA 2WZBA 1X1QA 2W4IA 4K3VA 4RTRA 1FTWA 1PLJA 1RJGA 3PD0A 4A6EA 4IDAA 2C2OA 4HDNA 5I9MA 1CJMA 3OFJA 1XX6A 2WQ6A 2QYHA 4QJ4A 1JR6A 3NHPA 4N7RA 2JAUA 4YC7A 3OVMA 2C5AA 3E4CA 3OCZA 4YJ2F 4DJJA 4KIGA 1KJZA 3RSSA 1AGRA 1CSEE 4G3XA 5IMBA 2HSEA 4YRAA 2PT7A 4LXTA 3U4QA 5B30A 3VNUA 3L92A 1HNNA 3ZU2A 1NI5A 4NYIR 1E8MA 2WNIA 3UT5A 1Q1EA 1XRMA 3O83A 1ZG3A 1KYYA 5DYGA 1QAMA 4ZPXA 3RAFC 5KVVA 3WWOA 4C0KA 1CIPA 2ONZA 1LNSA 2RK3A 5P21A 4AZTA 1AO0A 2IUFA 3V55A 1KTIA 2ZUDA 4BVFA 2YXBA 1QBGA 5BSGA 1COWA 2Z9DA 2O2YA 1M5TA 1TRHA 1XZKA 3Q3IA 3FI0A 3SHWA 1O0CA 5CX4A 4PYMA 2X42A 3UGKA 5I9SA 3VZRA 4EB3A 1A4XA 2BI8A 3D1VA 4RQTA 1L7QA 4MWBA 3KQUA 3A4LA 2BLNA 4M1YA 3K20A 1BOFA 1GG8A 2NO0A 4Z54A 1EB8A 4M0LA 1XAGA 3N86A 2JARA 4K5QA 1OXTA 3H83A 3NH9A 4FGSA 1PRYA 1KJQA 1WUTA 5FFFA 1K75A 4CLRA 2VJDA 3COYA 1WQ1R 3GCXA 3WDKA 1Q0ZA 4MWDA 4G36A 3TB4A 1NLUA 3WSTA 1WW2A 5FI0B 3G9TA 5FWXA 2IH2A 3AF6A 4DEXA 4TSKA 3N53A 5AW8A 2VXOA 2FEWB 1C3OA 2FDXA 1L1FA 4PN3A 1FRQA 3GMSA 2HHAA 3EBOA 5AT1A 4CFSA 3V8MA 2IS6A 4ZO6A 1NI4A 4M49A 2X9QA 1GZSA 3TXYA 4DMCA 4ZYVA 2JFUA 2A4KA 1J8YF 2WWWA 3R5FA 4BMDA 2VJMA 1T2FA 2G36A 3EGVA 4CU5A 4NENB 2WWIA 3BTUA 3RKSA 2NXCA 1M76A 1C9KA 1Y63A 2YN4A 5LP6C 2F4VB