4QKQA

Rada from methanococcus voltae in complex with copper phthalocyanine tetrasulfonate inhibitor
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
265
structure length
257
Chain Sequence
SHMDLGFKSGIDLLKQRSTVWKLSTSSSELDSVLGGGLESQSVTEFAGVFGSGKTQIMHQSCVNLQNPEFLFYDEEAVSKGEVAQPKAVYIDTEGTFRPERIMQMAEHAGIDGQTVLDNTFVARAYNSDMQMLFAEKIEDLIQEGNNIKLVVIDSLTSTFRNEYTGRGKLAERQQKLGRHMATLNKLADLFNCVVLVTNQVSAAEQAIGGHIVGHAATFRFFVRKGKGDKRVAKLYDSPHLPDAEAIFRITEKGIQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of an archaeal Rad51 homolog in complex with a phthalocyanine tetrasulfonate inhibitor
rcsb
source organism Methanococcus voltae
molecule tags Dna binding protein
molecule keywords DNA repair and recombination protein RadA
total genus 95
structure length 257
sequence length 265
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2014-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08423 Rad51 Rad51
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4qkqA00
1UKEA 1UEIA 2XZLA 2P6RA 3EPJA 3THYB 2HV8A 1R5NA 3PEVA 3A1SA 4BGDA 2GJ9A 2QMOA 5JCZA 2IYXA 1Z29A 1VCMA 4OK6A 5CJ2A 5BYKA 3KQNA 3B78A 4PTLA 4D4MA 2TMKA 1E99A 4JS0A 4LRWA 3U7GA 3OF5A 2OM2A 1NLZA 1S8FA 2VP5A 1AKYA 1LF5A 2XJ9A 1YZLA 1GAJA 4GOJA 4BLRA 2IYTA 4M22A 5DLQC 4RKEA 3K09A 3L8ZA 4XJXA 3MWYW 1NLYA 4MQBA 4A8JC 3I8XA 1AGPA 4Q4AA 4G5OA 2EFHB 4AKEA 2Q9CA 2C03A 5C4GB 5JMTA 4G01B 1AGRA 2VH5R 4Q47A 2IX3A 4QGAA 3LRPA 3LVRE 1GRRA 1E9AA 1I4LD 5FPYA 2ZRFA 2JAQA 2JDIA 4TT3D 2F7SA 5FBWB 3CNNA 3FKSD 3NG1A 2BWJA 1II8B 1JQJC 2VF8A 1V43A 5GJCA 1TF2A 3S1AA 3SU8A 2IF2A 2C78A 2J41A 2ATVA 4CEJA 4PXAA 1DVRA 3W6PA 4PC7A 4P0TA 3LLUA 5BYJA 1N25A 2IYVA 4IVQA 3T15A 1EX6A 2ZQ5A 3GEEA 5B64A 4I81A 5AUQA 1Z8FA 3ZVLA 1VG1A 2CK3A 2PX3A 5FUXA 1SULA 3U4QB 4OQLA 3GLIB 4FMBB 2N1BA 4PHFA 5JEDA 2IYUA 1UFQA 2F1JA 2CNWA 1N5JA 1EFUA 1F48A 3FB4A 3TH5A 4KCGA 4UNQA 4TYQA 5FBLB 2BVNA 4ESVA 2O8FA 1XPOA 4HZUA 1W0KD 3KKNA 1EFHA 4GP6A 1UKZA 4LJ9A 2PJRA 1BMFA 1T8TA 1EXMA 4F4IA 1XWIA 4CT5A 1N6KA 2VEDA 2O8DB 4BPBA 2WPDA 4K8OA 3QXHA 3UXMA 1F2TB 2H16A 2RCNA 1VIYA 4TL9A 3S1AB 2YWGA 2VP6A 4HB3A 3GCGA 4R98A 5J5CA 3BORA 4IFEA 2WWXA 4A6PA 3FHTA 3ADDA 1R5OA 5CLLA 4ASUA 2V1XA 1Z5ZA 3UIEA 1NVWQ 2BCJQ 1NIJA 4AD8A 5KNDA 5TXGA 4PHTA 1ZUHA 1G21E 4HLUC 1W4CA 3HPQA 4JLJA 4LBZA 2KBEA 1NRJB 5SZIA 1T91A 3CB4A 2Q0HA 1BS1A 1IJEA 1KO8A 1OXUA 2V8OA 3LQQA 1G8HA 4A2WA 1ELOA 4QGHA 2JIZA 1P61B 4NMMA 1OXSC 2WJJA 4LWZA 2BBSA 1OLOA 2VHJA 1Z47A 1BO6A 1KSFX 2WOOA 2ZJYA 3NKVA 5EP2A 1OHHD 4LK2A 1KO1A 3WRXC 1D9ZA 3A1VA 4DUGA 4ZPXA 5F9HA 4TQ9A 2GETA 3AKCA 3C14C 4LYJA 4PZLA 2VL7A 1L4YA 4UJ5A 5AUNB 4DEXA 3THYA 1E4VA 2WBLC 1XTSA 3FGNA 4PC6A 3P27A 4XVQA 4M1MA 5P21A 1F2TA 4ACAA 2C99A 1MR3F 2I1QA 3SR0A 2R6FA 1U2RA 3EZ6A 5LD2B 2BMEA 2WKPA 4WXPA 3TRFA 3BC1A 3TIFA 3RC3A 2Q6TA 2JLQA 3GJ7A 3TK1A 2ZI6A 3WNBA 3QE0A 3X1XA 2GBLA 1G3RA 4LJYA 5LBIA 3AVYA 1F3OA 3EARA 3TAHA 3VHLB 1K8RA 3REGA 3KXLA 1ZM3A 1ZNYA 1G291 1II8A 2ZI3A 2ZVQX 4HAWA 5K8IA 5FTLA 3MJRA 4LBYA 3M1IA 3U61B 2PH1A 1FMLA 3PQCA 1OXXK 2GZAA 3FVQA 4C2UA 4BZXA 3DKPA 4GSYA 1W1WA 2P65A 3BB4A 3LX5A 4B71A 5DN6A 3UMSA 2VHCA 4IEIA 2DFKB 1W0JA 4BLTA 5K8TA 1IY0A 3AP2A 2WZQA 4EJSA 3GLFE 3MWLA 3QSYA 5TB5A 4DBLC 4A15A 1QHHA 2Z4SA 2A2ZA 1T5LA 2D62A 4HUQA 3K70C 1II0A 2YHSA 5GJWC 3AVUA 1E9RA 1KZ7B 1XTKA 1JECA 2QPOA 3LBHA 1E2QA 4LX0A 4RJLA 5E4FA 4HATA 4JL6A 5CYPA 1Z0JA 4TSFD 4DLSA 2EWWA 2IT1A 1M74A 3L0SA 1XXHA 2QRNA 4PPNA 2JIZD 1KK1A 1S3GA 3BAFA 1U0LA 5HCNA 1RE0A 1WCV1 2VSOA 4Q4JA 3QF7A 4ITRC 2OCAA 2VYFA 2A5JA 2LWIA 4HUTA 3F0TA 5DHFA 3HR8A 1LFDB 4FD2A 4OI1A 2QMHA 4Q7LA 4BLQA 1XU4A 4M1OA 1P9WA 1NVVQ 2OBNA 3L82B 3KX2A 4OBEA 5FUWA 3PITA 1KY3A 4IDNA 3FKQA 4FWTA 2XB2A 1XB2A 3B82A 2J3EA 2WAYA 3KJHA 2F3TA 1CRQA 1X8KA 1SGWA 4YLGA 2AN9A 4FN5A 3U7EB 3DDCA 3F8TA 2LKDA 3C5HA 1NP6A 2QT0A 4IOKA 1QHSA 1T3SA 1YHNA 3K8YA 3LX8A 4AKHA 1CIPA 3BD9A 5KTYA 2NO6A 1YRAA 2QENA 1S9HA 2ZM5A 2GXAA 1DBSA 4HI0E 1K5DA 4EKDA 4B2LA 1E9EA 5EJEA 4I1VA 1GWNA 1P3JA 3GEHA 1N3BA 3K53A 5AJXA 3GLGB 1P4SA 3VTKA 2F6RA 2ZSFA 4B3FX 4Q03A 2VHQA 4NBSA 1VYUA 3VQTA 4ZDJA 4LGMA 5JJLA 1KSGA 1JEEA 4BFSA 3R8FA 1HQYE 4PC3A 5B2ZA 2XOKA 3QXJA 2ORIA 1A5TA 4IRUB 1DAHA 4MYUA 2QG6A 4RZUA 4JLVA 2GJSA 2FPKA 2ZE5A 3VU9A 4PAOA 1E0SA 2REOA 4WIAA 1N5KA 5L3QA 3RANA 2QP9X 2IS1A 1LS1A 3QPUA 4AYTA 2FZLA 1GSIA 5EE3A 2FFAA 1GOTA 3T34A 2AL7A 3EIHA 4IHQA 3R7WB 5JFGA 3U6BA 1S0UA 2VQSA 1XJ0A 2BM0A 3FMIA 1J70A 1D2NA 5DYGA 5EQTA 2Q3MA 1Z08A 4URZR 4AYXA 2GK6A 4RFSB 2WJHA 5BQ5A 2BBTA 2IXGA 2ZRPA 4YMVA 3FKSA 4TMXA 3U2QA 2J0VA 4DCSA 1US8A 4NL4H 3QKUA 2RGGA 3V9PA 1XMJA 5KHOC 3EASA 4ACBA 2O0KA 2WSSA 5G41A 1FMJA 3NDBB 5EZ6B 2G6BA 2QM7A 3EWSA 3EC1A 3HU1A 1MABA 2JJ1D 4KU4A 3P20A 2OT3B 2P0EA 4JBXA 2J5XA 4RCZA 5F2EA 5BN3A 3OFNA 2IHBA 4FINA 5K8LA 2ZSDA 5EP1A 4DRZA 1FFHA 4C0QC 2ASEA 1Q1BA 2ODWA 4V0OA 5FBRB 4YXWD 1SHKA 2HLDA 5E3HA 4A4DA 4XSGA 1CLUA 5KDDA 5TDHA 3FOZA 3ICEA 2GNOA 2EYQA 1NVXQ 1Q57A 2ZRJA 1TF5A 2YYZA 5FPTA 1HURA 3RS3A 1TQDA 1SZPA 1ZAKA 4P4TA 2HJVA 3AV0B 1P5ZB 3BOSA 3CUEF 4JYBA 4OI0A 4RFSA 4B32A 2XX3A 4AG6A 5H8WA 3OHMA 3EPKA 1CJVC 1OPXA 4DDUA 1IXZA 1H8EA 2G83A 2VBCA 5ANRB 5EZ5A 1RRFA 3QG5A 4AWXA 1IONA 3W3AA 4PPQA 3ASYA 4PC2A 1W2HA 2C9YA 2QMUA 4LV8B 2IYWA 4M9QA 4DCTA 1ODFA 2HUPA 1DAFA 3SYNA 2ZJZA 1YZGA 1YJ5A 1OB2A 1Y3AA 2ZEJA 1PJRA 4QGFA 1R0ZA 3HR7A 4A1FA 1KY2A 2ZU6A 3A1TA 3GLGA 2DYKA 4XH9B 2FN4A 3QOFA 1ZU4A 1SXJA 2EFCB 3UG6A 3Q5DA 4O2RA 5JHGB 1IM2A 1DTSA 1N0UA 2NZ8A 5KOYA 1BKDR 2A5GA 2DY1A 2GDJA 3ZYCA 2EVWX 2QZ4A 3Q5EA 1NY5A 3H0KA 1YZKA 3H86A 4OK5A 4V0KA 2DWOA 1QBKC 4MITA 2IYRA 2QAGA 4LYHA 2ZRLA 2HXSA 2V6IA 3EW9A 5EXSA 4F38A 2YC2C 4C0AC 1DAKA 4B35A 1JXMA 1LW7A 4F4JA 1JQLB 2D06A 4US0R 4CVNA 4PAMA 3VR4A 5JEEA 3U5ZB 1ZD9A 2ORVA 6Q21A 2JJ2D 4XWAA 4LJ7A 3TUIC 4TQAA 4KLZA 5SZKB 121PA 2FGJA 1JR3A 1KMQA 3DMNA 2WIAA 1P6XA 1KDOA 3IEVA 2OXCA 1VTKA 2XTZA 1NJFA 1HYQA 2VRWA 3GFOA 1P62B 2V4ZA 2EQBA 4J0QA 3VX4A 4B74A 2CVHA 1SVKA 1SQ5A 3W6OA 4XSHA 1CBUA 4B6FA 4WZ6A 2F1IA 5DHAA 2WWYA 2OBMA 1XTIA 1DPFA 3C5CA 3RRNA 4ZDKA 3HJNA 1GDDA 1HV8A 2F1RA 4CGZA 1TU4A 2QGZA 1E69A 2XZPA 2ECKA 1XD8A 4MGIR 3T12A 4RVCA 2J0SA 2ZJ8A 1P2TA 1XEWX 3TSZA 4DSOA 3NH9A 2CLCX 4OHXA 3SJAA 1CU1A 1F5NA 1NKTA 1NMYA 1K6MA 1IOZA 2OCBA 2NO9A 2Q3FA 4LJ5A 3PUVA 4MYHA 1VPLA 5IK2D 2NOAA 4B6EA 4EFNA 2XEXA 1KOFA 2ONKA 2WWFA 3CPJB 4MYTA 2PEYA 4QL3A 4B3DA 3SN6A 3DVLA 2OAP1 4D4KA 1FX0A 3SC3A 4ZIRB 3QI2A 1G4AE 5FOUA 4ZDWA 3DZ8A 1AQUA 1L7VC 2FF7A 1XEFA 2QSZA 1W5TA 1OYWA 2VSFA 3IO3A 5KUTA 1E94E 2QRZA 1OHHA 4HYYA 4JJZA 4YDHB 3QKSB 1KI8A 4DXAA 3R9WA 2KWIA 1R4AA 1MH1A 1TQ6A 2ZSEA 1EFRD 5FTJA 4RKFA 4X8HA 5KSYA 4CF7A 5L3SB 2JLWA 2IYYA 1Z6AA 1XD9A 1CJTC 3CIOA 2X8AA 4D4JA 4BLOA 4JVNA 5DGXA 4EDHA 4O2LA 4MUAA 1FPMA 5FUVA 2XOKD 3PENA 1E3MA 4ZKDA 2ZE7A 4MA4A 3SS8A 2HDNB 3WMFA 1VKJA 3QENA 5DYIA 1JJVA 3IQWA 2ZS7A 1U90A 1P2UA 3W6NA 4POAA 4IOLA 5CB8A 4O25A 4GFDA 3U44B 4BLSA 4PQRA 2W6ID 2H5EA 3KDSE 3CRMA 1XP8A 1AM4D 4JLPA 4Q7MB 1DELA 3W34A 3D31A 2FEOA 1Z83A 2CHQA 4D82A 4OQNA 3PIRA 3KKQA 3TQCA 1MV5A 3OEHA 5G3YA 4R9UC 3QKSA 1Z28A 1CR1A 3MAAC 3WNDA 5M04A 1FUKA 2QORA 2ZANA 4MDFA 2BEJA 3QPVA 1JR6A 4KITB 4RCYA 2DB3A 3KJEA 5JLJA 1T3HA 3B60A 2MMGA 1G8PA 3GD7A 4D81A 4YC7A 4JL8A 2C9CA 2B7BA 2XB4A 4C0BA 5KDOA 4QOSA 5E7MA 2NO7A 1S9DA 2FSGA 4GZLA 2Z6VA 3A36A 3SE0A 5JS8A 1XPRA 2D2FA 1OJLA 1EG7A 2EFDB 2OXRA 2RGCA 3I4LA 1D9XA 1U8AA 4XOIA 2UZ3A 4KVAA 4XWKA 2CMKA 1RC8A 2NPIA 2F43A 4TLDA 4IFBA 2O8EA 2O5VA 3BFVA 1EX7A 3WBJA 1OH6A 4LYFA 8OHMA 3JZMA 3PCRB 3IUYA 4GMDA 2JDID 2GKSA 3HWSA 4TN1A 3U60B 2YWFA 4ZCMA 3EX7C 3G82C 2E87A 4WZAE 4DLRA 2O0JA 1LB1B 1L8QA 1NBMA 2FSIA 4DKXA 3A4LA 4YMSA 2XZOA 2AD5A 2OCYC 2WMOB 3AQ4A 3LQRA 4DB2A 2IWRA 5GJBA 4FMCB 2IL1A 4KYUA 4AC9A 4M1SA 5L3VA 2IUUA 2JLVA 1LVGA 5JJKA 3CRRA 5G40A 2O8DA 1Z07A 3TR5A 4AI6A 2GJAA 4RFVA 3I5XA 4DJTA 3MCAA 2F9MA 3NHBA 2G9NA 5IT5A 2HJGA 4E03A 2CXXA 5FBVB 3ZD6A 4U02A 4Q9HA 1CF4A 3AF1A 1KK0A 1A2KC 3ASZA 3THXA 3H84A 1UEJA 3WMEA 3IPXA 4LV6A 4A36A 5TV2A 2IF0A 3A1UA 4MGZR 2WMNB 4TMZA 1NSFA 2VIIA 4DCVA 4CEHB 3J81k 4B33A 1ZM9A 3IILA 4TMKA 4W5JA 3WMGA 1GKUB 2RKOA 1G3UA 2YJTD 1RZ3A 3QXXA 1R0YA 1C4OA 1N6OA 4P4SB 3WHKA 1L4UA 5BN4A 4OHYA 1PUIA 1KNQA 4TL6A 3VR3A 3K09C 1IQPA 4ASUD 4PZYA 4N0DA 4A8JA 4L5BA 4DCUA 2Q9AA 4DLVA 2QBYB 5L3SA 2D7DA 1JNYA 5TARA 3FE2A 2P5SA 2IW3A 3LY5A 1KO7A 2MSDB 2RAPA 4MRVA 2QQ0A 1IY2A 2RMKA 4NCNA 2Z4RA 5J47A 4I4LA 5J4VA 4HLCA 4Q01A 2A5YB 3NBFA 4MKFA 2DR3A 4NZYA 3WYFA 4QM6A 1EESA 2V7QD 4GL2A 1TQ4A 1TPZA 4UNSA 1M34E 5FOWA 3CKLA 4JLNA 2A78A 2WICA 3UANA 3RS4A 4PHGA 1OXVA 4FIDA 1JAIA 1CEEA 2CCJA 4KFRA 4R2IA 4D4LA 1EFTA 1ZU5A 3QUSA 4DHEA 2RGXA 3PFIA 1TTTA 2B8WA 1GG2A 2I1VB 4MKGA 5KYKA 3A1WA 1ZYUA 3O8BA 2ZAMA 3T1QA 3CH5A 1P2VA 4FCTA 1JBKA 3RHFA 4WBSA 2R6GA 1XEXA 4RD3A 4KFTA 4HLDA 3W8NA 2BMDA 2VF7A 1DG1G 2F43B 1KTVA 2C5LA 1W4AA 5KO2A 2OBLA 4HZUB 4TZ0A 3MMPA 3MWKA 3SDZA 2ZE6A 2AD1A 1HQCA 5E7IA 3LBNA 3K0AA 4XTCS 4TTPA 3VFDA 3U3KA 3D8BA 5AR1A 3WYAA 2WJYA 3FMOB 3GLHE 4TT3A 1J8YF 2GJKA 2EYUA 2R2AA 1W2GA 3L8YA 3KB2A 4UNPA 3LV8A 1E2FA 5EE9A 1JR3E 2IK8A 2PT5A 3H1TA 1GP2A 2J87A 1ESMA 3K0CA 3NHAA 4GZMA 4ZCIA 1RPZA 1X86B 1T8UA 1BYIA 1NLFA 3BB1A 3QF4B 3PJRA 2WOJA 4KYIB 1W7AA 4YQFA 3Q85A 4W5WA 4HLUA 4B75A 1KSJA 1K5GA 4MDEA 3N2IA 2MMCA 3QNUA 3KKOA 4TTQA 4LHXA 4Q4JB 3I1FA 2GXQA 3DL0A 1KIMA 1KJZA 2XAUA 1HE1C 1Q12A 2V3CC 1NVVR 1OKKD 2EU8A 1TNDA 1ZM7A 4RZXA 3FMFA 4A0RA 2QTVB 4DT1A 5CDFA 2FG5A 3D3QA 1JI0A 2EWVA 4KSCA 3UWOA 3OIUA 1XFAA 2NG1A 1OXTA 4LI0A 4DLZA 5JRJA 2PL3A 1UF9A 4IVPA 3N70A 3ND8A 2LCFA 3WXMA 1X1RA 3K9LA 2G1KA 4FMDB 2REXB 3UMFA 4BE7B 3GJ3A 4FCWA 1XXHE 1Z63A 1G8YA 4BEBA 1QDEA 2WJGA 3SFVA 1EWRA 3TUJC 3IKJA 2ZUCA 1D5CA 4BQSA 4AKIA 4B3GA 3KXIA 3NVAA 2PMDA 1NN0A 2XTMA 3U3MA 3LFUA 3W3ZB 4M0LA 2ZI9A 2J0QA 5LDDC 3MGCA 1D6JA 3LDAA 4PQFA 1SHZA 2GZDA 5CK5A 5JBQA 4ZO4A 2QBYA 3KUDA 2NO1A 5EE5B 2ZRGA 1OH5A 1TMKA 4UXIA 3KQUA 2UZIR 3BBPA 2GRJA 4DT1B 1KMHB 4A82A 2GXSA 1YZQA 1OIWA 4FMCF 4EQ6B 1GL7A 4LY6A 4B47A 4C0LA 521PA 2ZE8A 1O3YA 4EAQA 2YKGA 1D2EA 1H8HD 5EP4A 2FX3A 3OAAD 4V0LA 1S2MA 2DFLA 2QI9C 5AUOB 5EP3A 1G64A 1MT0A 5C1BA 4LHYA 2BKEA 2ERXA 3A6PC 3PUZA 3ZS8A 3I73A 1CRPA 2X2EA 2J7PA 3CW2A 3CF0A 3CX7A 2FNAA 4DLYA 1JALA 3KQKA 2F3RA 4C4PA 3X1DA 4LSGA 5D3MA 1VHLA 3B85A 2JJ2A 3TSOA 3ZIAA 1E32A 3MSXA 1Z2CA 3FDIA 1W36C 3H2YA 4Q1BA 4XD7D 2ZSBA 4EPWA 1M2OB 2PCJA 1AZSC 4LBWA 3T5GA 2GTPA 1G5PA 3TW4A 4CZ2A 4D0GA 1OIVA 5K8UA 4TYWA 1CP2A 4DLXA 2AWOA 3TLXA 3AGPA 1G8FA 1G7CA 4PR0A 3ETLA 5C46F 3K0AB 5JSZA 5L8VA 4C0JA 3AB3A 4KBGA 1XEWY 3I32A 1KDPA 2QQEA 1G19A 2RB4A 4Q9KA 4JLKA 3PXGA 2QE7D 4QM7A 1CXZA 2RH5A 2OLJA 3JVUA 4EPYA 1M8PA 3NEJA 1PLKA 5F98A 5G3ZA 3B13B 1QHGA 2IUSA 3X1ZA 4NONA 4OL0A 4Q02A 1N6NA 4ERNA 2X19A 5IDVA 2G0NA 3P26A 1ZUIA 4BZQA 1ZUNB 3AF3A 2RGDA 4YXWA 3TW8B 3FWYA 4HAXA 4PX9A 5JWOA 2OSBA 2V55B 2BCGY 4HSEA 4Q00A 2ATXA 5D3QA 4TMTA 2CE7A 4B48A 4JLDA 1IHUA 4BZPA 3GJ8A 5J4YA 1PVOA 1XDBA 4NYMR 4WZBE 1SVSA 3CNOA 3IHWA 3KZ1E 4URWR 1DAIA 1SKYE 2QT1A 2C96A 3B1VA 5HPYB 4UXJA 1DEKA 3VX3A 2ZITA 3NXSA 1TQ2A 3ICQB 2P3SA 2G1JA 1E2GA 1G3MA 4C30A 4KO8A 1Z2AA 2GK7A 5FFMA 5KNBA 3SHFA 1U9IA 2J46A 5TMPA 5FTKA 2YOGA 2RHDA 4WAUA 2REBA 5CK4A 5J4HA 2KB0A 4QG7A 3BK7A 2DPXA 2GCPA 3B5JA 1GUAA 1SXJB 2ZYTX 1IXRC 3HU3A 3KB1A 4BRWA 2ANBA 3LWNA 1M6NA 1HEIA 5H1YA 3AVOA 3UMRA 3KTAB 4D0NA 1XTRA 5LD2C 1N2CE 4NTZA 1FTNA 4W9MC 4M9SA 2JGNA 4URUR 4MRRA 3Q8XB 2ZRBA 2EW1A 1DADA 2W2XA 4TLEA 4U00A 1G7TA 1AS0A 2CCGA 1N6RA 4FCVA 2ZREA 2AK3A 5FOXA 4ESHA 2A7QA 4QBHA 1E2PA 4NYIR 2PMKA 2YOFA 4HAVA 4S35A 4LYAA 5FTNA 4E5UA 2ONJA 1BH2A 2ZROA 1YR9A 4HZIA 4PO9A 4OHZA 4BWYA 1YKSA 1BYUA 3PUXA 1E79A 3L0PA 3A8TA 2R65A 1Z22A 2IUTA 1RW4A 1OFIA 3A37A 4M1WA 4OQFA 3GLFA 4CIDA 4EPXA 2C95A 1I2DA 2FPMA 4HAYA 3CPEA 2ZR0A 1XBTA 4TL7A 1X8LA 2JLXA 1LY1A 1FNMA 4JSTA 4RY2A 4GI7A 3UK6A 4D25A 4R2HA 5AK0A 1AN0A 2NZJA 3EXAA 4H9GA 4NU0A 2H18A 5LB2A 3KQHA 3QEOA 4HB0A 3W90A 3RWOA 2IS4A 1I4DD 2E1RA 2LKCA 4QFMA 5JS7A 2XITA 3BXZA 1OW3B 5A0FA 3OIVA 1RJ9A 4ZI3A 1II9A 3BFKA 2ZS9A 2XSZA 3GJ0A 4QHSA 1WQ1R 3P1JA 2H7VA 1Z6YA 3B9PA 3QQ5A 3R9XA 3ECCA 5HZKA 4NPHA 3WRYC 3THWA 2CE2X 5JSZB 1FQJA 2ZUDA 2PLRA 4NDZA 1B0UA 2QTHA 2F9LA 5HTKA 2DBYA 3KKMA 3VU9B 4EPTA 2WAXA 1P72A 1AIPA 2BDTA 1FL9A 5IK2A 3OIWA 3GLFB 2QTFA 2OFWA 3QBVA 3RS2A 5CLQA 3SBEA 4Q1CA 3KJIA 3R7WA 2VHTA 3NDPA 2A5DA 3SFZA 2V6JA 3AUYA 3AKYA 1ZINA 2DFTA 3C7KA 4IDQA 3DM5A 5KSPA 4WOPA 2J1LA 3P4XA 3CRW1 3AVXA 2R62A 4UNNA 2FGKA 1KI3A 4G0NA 4B3XA 4DZZA 2D2EA 4V0ME 1G8GA 3AKDA 3T5DA 1VCOA 2FDCA 2OAQ1 5AJYA 3OAAA 2CJWA 3BH6A 4JKIA 4DIEA 1RJ9B 2RGNA 1NI3A 1OT3A 5IRCD 3LXXA 3AM1A 1E6CA 1ZCAA 3EZ2A 2YWHA 5E7JA 3K70B 4Y0VA 3RRMA 4XIGS 4GPTA 1XZQA 2QY9A 1SVMA 4Q48A 3RRZA 4AKGA 4M1KA 3CH4B 4CDGA 3NWJA 1PLLA 2GEVA 2VHUA 1IN7A 2XNDA 4B2PA 3ZVMA 1AZTA 1F60A 2ZJOA 1KZGB 3E70C 3Q72A 4URYR 3GJXC 5LB4A 3LXRA 1G3QA 4NHOA 4II7A 5C2JB 4TYYA 1Q22A 4FW9A 1VG0B 3KTAA 4MH0R 2HCBA 5FOTA 4LJAA 4YMUA 1G1MA 1NVUQ 4EJSB 4L9WA 1CR4A 3O8RA 3PEUA 4G5GA 5H68A 4GP7A 2C04A 2VP9A 2WVJA 1FP6A 3GPLA 2VP0A 1VG9B 4NH0A 1YR6A 4D0LB 4YONB 2BIFA 2KI5A 3IGFA 2QL6A 4G3XA 4Q1FA 3I62A 2ZYUX 5GVRA 5JRZA 1HUQA 2UVQA 3BFXA 1G17A 1N5IA 3QIAA 5UKDA 1DE0A 2GAAA 3IPYA 5TVKA 1IBRA 1QHNA 5DI9A 4DEYA 4RD6A 4EIWA 1GZSA 1Y63A 1YVDA 4Q18A 3GLIE 1G5TA 1ZNZA 4RD1A 3HYTA 1NMZA 3NBYC 3P4YA 4KXFB 1FTSA 2ODBA 4PPFA 1FX0B 4QNMA 1CJKC 1RRPA 2G0TA 1ETUA 4E09A 4QBGB 1S3SA 2OO7A 2HYDA 3FFBA 3GFPA 5DE3A 2JJ8A 2YINC 4KSBA 5C4MA 1I2MA 5FTMA 4BASA 2JA1A 4LBVA 1MRSA 4AYWA 3C4JA 3IBYA 3ZH9B 4N3NA 1GNRA 3UG7A 1E2LA 1S1MA 4TLCA 4QJ5A 4C9BA 1U8ZA 3OEEA 4Q1DA 3SZRA 2WKRA 3CZQA 4B73A 5HZHA 2FFQA 2RGEA 3VNVA 1U99A 2G3YA 1N6LA 1W4RA 1OF1A 1NSTA 1XX6A 1SVIA 4PANA 1RRCA 3EWAA 3SJZA 1ZNWA 2BEKA 3FPAA 3I8SA 1W49A 1NY6A 4BFZA 3EG5A 1R10A 3FHCB 1ZC4A 1PUJA 3QKTA 2EFEB 3THXB 1DO2A 2W6JD 4ZDIA 2ZYWX 2IYZA 3VKWA 4BFTA 2YZ2A 4DSTA 5DSZA 3M4YA 1L2TA 1ZM2A 1XRJA 2VTKA 3M0EA 1FW6A 2EFGA 4MKHA 1Z6XA 1RYHA 2DHRA 3B8HA 2V54A 4JBYA 3O8CA 2BJWA 4P4SA 3QVVA 2OG2A 1XCMA 3AVPA 2W2TA 5IF9A 3TAUA 4NP6A 3TVTA 3B1YA 4K81B 1ZRHA 1G9XA 2ZS8A 2O8FB 2CVFA 3GQBA 3CBQA 1VIAA 4QHYA 2C9OA 2FPLA 1GVNB 3FMPB 2OCPA 1G7SA 4D26A 2PX0A 1H8ED 2HF9A 2BBOA 2AFIE 2YC4C 2J7PD 1HA3A 1WXQA 4LHVA 3AF2A 1Q0UA 4BEJA 2FWRA 4PFSA 4BECA 1NNEA 3QY0A 3RNLA 4TYNA 3BRWD 5JZVA 1ANKA 3VR5A 3BIFA 2OESA 1CULC 2Y8EA 2ZXUA 2GHIA 5FPHA 5ELXA 5F9FA 4S2EA 4CYMA 4FXPA 4GOXA 2QSYA 1QHXA 2A9KA 2J0UB 4JVSB 5FOVA 1NJGA 1Z0DA 4LHZA 1WDTA 1U0HC 4FWIB 2H17A 4UQOA 4Z54A 1OV4A 2GBLC 1A4RA 1FUUA 3QVUA 3ZJYA 2D74A 3DOEA 1NG1A 3IIMA 1G6HA 3V4RA 2G88A 1RYFA 4W7SA 5DIFA 4I99A 2WWWA 1EWQA 3LW8A 3MUFA 1WMSA 3HDTA 4PSVA 3QKRA 2X77A 5HCIA 3TQFA 1Z0AA 1JAHA 1SVWA 3TBKA 1AK2A 1HY3A 4ZKEA 4G5SA 2K5UA 3K0EA 4C7OA 4LDJA 3THOA 2QMEA 3VR1A 2DWPA 2CHGA 2YWEA 4M1YA 1EFCA 1W47A 2A5FA 2W2VA 1D8TA 2J9RA 3QBTA 3VMFA 3RC8A 4QXAA 1UBEA 1TADA 3GFTA 3N2EA 2ZRNA 1N5LA 3U7FB 2H8KA 1N0WA 3A58B 3Q7PA 2ZRDA 4DLUA 3LVQE 4UXHA 3CPHA 5DISB 2GF0A 1S1CA 4IW3B 3IEUA 4NYMQ 1VHTA 2FJUA 4Q1EA 4DWJA 2KBFA 1YZTA 2AHOA 3KUCA 3LW7A 4G5QA 4PAQA 3BERA 1EK0A 1E0JA 5EE1A 1VG8A 1Z06A 3QEJA 1LV7A 1YZNA 3OZXA 3RS5A 1M7BA 2R9VA 2P2LA 2QAJA 2GJ8A 2NO0A 2ZRKA 3GMTA 5KDLA 4B44A 2VP4A 4QKQA 3QPWA 1GKIA 1E2DA 1D2MA 4A8JB 5JHHB 4DB4A 1X8JA 4N0EA 3MD0A 2O8EB 5DO9A 1OE0A 4JYCA 5H70A 3K0FA 4FI3C 3WHLA 1GL6A 3QKRB 3I61A 5EUQB 3F5FA 3OFND 3EZFA 1G20E 2OFOA 1Q1EA 3I92A 4D2IA 4OYHA 4ZI2A 3GP8A 4CEIA 4LC1A 1OFUX 4M9XA 1KKLA 4KFUA 1DAMA 2IEZA 2GA8A 1PLJA 4JJKA 3R8CA 2JASA 2OFXA 1YZUA 3SI7A 3WY9A 3ZD7A 5HE8A 1TEXA 2IYSA 5EUMA 2VO1A 2QN6A 1KJYA 2OLKA 4BFYA 2NGRA 2BMJA 3SJCA 1GRNA 1X1SA 4LJ8A 2R6DA 4OHWA 4I1OA 3L0OA 1E2JA 1E2MA 1PZNA 1Q21A 1YR8A 3C41J 3NC0C 4BRUA 5FR2A 1W48A 1XEXB 5J4LA 2WIBA 3V4FA 4HB2A 5KSOA 1GNQA 4NYJQ 3VKHA 5KPJA 4GT1A 1G5RA 2GF9A 1NN5A 2JJ1A 1SXJC 3AF4A 4RZ2A 4QNRA 4XTRA 5CITA 3RS7A 1KSHA 1NBMD 4KBFA 5FPSA 1UDWA 1COWD 2YVUA 3LNCA 1FQKA 4JSYA 4CRWB 3SHWA 2HEIA 4EFMA 2CNWD 4V02A 3LA6A 3RSLA 3U4QA 4JL5A 3BS4A 4LOAA 3MFYA 3TGPA 1OFTA 2J45A 3QXSA 1AS2A 1LF0A 4HAUA 3Q7QA 1WF3A 3CO5A 3T1TA 5J40A 1WBBA 3W9YA 1KI2A 1KI6A 3DO6A 1OH7A 1QG2A 2R6CA 3RAPR 3E5HA 3Q9LA 5SZHB 1XTJA 1OIXA 3H4MA 2GESA 3IQXA 3K0CC 5AJZA 4QJ3A 4DDVA 3TUZC 4LZZA 2PT7A 3LBIA 3QF4A 2AXPA 1YE8A 1A2BA 2ANCA 2VPPA 4EPRA 4M53A 2ZU0C 4PO1A 3PVSA 2W00A 5D3MB 3LH5A 4ZCLA 2XGJA 2HT1A 1TUEA 3UPUA 1H8HA 3T61A 2BMFA 2GWHA 4BFWA 1R6BX 4ILEA 4EJSC 221PA 4XWOA 2QROA 1N6IA 4GBMA 2HCJB 1DO0A 2Z0MA 3K9HA 1E2KA 3VR6A 1ZBDA 1SXJE 4NYJR 2GEDA 1G3IA 1W36D 1MKYA 4JZKA 3AEZA 4QGGA 4M8NE 3IBGA 5JJIA 2FOLA 3T1VA 3N5CA 4P4UA 3ZVNA 2L0XA 3B1XA 2E9SA 3CWZA 1IN8A 2QPTA 1Z0IA 5JCPA 4L8GA 2GAOA 4ABYA 5EXPA 1LNZA 2P6UA 1XTQA 3AVTA 2Z43A 3AP3A 3PUWA 3ZDQA 2FU5C 4E07A 4KHZA 1I4TD 4JIMA 4JLAA 2C2HA 3E2IA 4NCIA 3K0FB 4Z1MA 1P7CA 3CF2A 1OSNA 4TLBA 1XPUA 1KKMA 1A82A 1JJ7A 2BC9A 3IIKA 1T4GA 3KJGA 4IOJA 1ZD1A 1T0JB 4JLBA 3DKVA 4GMXA 3PEYA 2IWHA 2NMVA 4CEIB 2PBRA 3O47A 4G5RA 1S96A 3B1WA 5JI3E 3CONA 2QE7A 1NIPA 2JLYA 4M1TA 3TMKA 1VYVA 2RHMA 5JI2E 4WW0A 1AA9A 3I72A 4Q66C 4JLOA 4C0SA 1CR2A 2BOVA 4JBWA 4V03A 1S4QA 1ONBA 1KDTA 1G18A 4DIDA 1DS6A 4YDSA 2A3RA 4NYIQ 5SZJA 4DSNA 5KPDA 3GLIA 3GJ5A 4O0MA 4TMVA 5CJPA 2B92A 4F7WA 3ZGXA 2SHKA 1GL9B 1VMAA 4Q4HB 2O52A 1NG9A 2ZSAA 2YV5A 1E2IA 2R8RA 1HTWA 1EFRA 1ZC3A 2QUZA 2P5TB 1T9HA 2BM1A 4UNRA 3NH6A 1Q1QA 2GCOB 2QU8A 2CL6X 2O8CB 2ZAOA 3RDPA 3CNLA 4CT4B 1UPTA 3HP1A 1KYIA 2VP2A 3LD9A 1XZPA 2FE4A 2C8VA 3PG5A 1R5BA 1BOFA 3M6AA 1NKSA 1KAOA 4B3BA 5JECA 3QG1A 4MRNA 5FI1B 2I4IA 4LJ4A 1QHHB 4DC9A 2PLFA 1JB1A 3RABA 4HUQB 3W5JA 4KJZA 2FV8A 1QZXA 5F3WB 4LUCA 1Q3TA 2PZEA 5CYOA 5HR5A 2QAGC 1WBDA 3BGWA 4Z8YA 1ZW6A 3D6TB 3OIYA 1W4BA 4P31A 5FL7A 1UBCA 1Z6GA 1SVOA 1E2NA 2HLDD 1WA5A 4JT4A 5DNYB 3K70D 1G6OA 4IDPA 1ZVQA 1NMXA 2RGNC 1F6BA 4PSAA 3RSOA 1QG4A 4FMDF 1TF7A 3BB3A 2O8BB 4L4UA 5DI3A 3PV0A 4AY2A 4Q4HA 4Q19A 2DWQA 1KI6B 2NPFA 1GITA 2JCSA 4AURA 2MSEB 4M21A 1U8YA 5FOSA 1FZQA 1J90A 3KQLA 4NCKA 2FZ4A 4LPSA 2YOHA 3TNFA 3A4MA 2P6NA 2JLSA 1E9FA 1ZD8A 2WJVA 4KVGA 2ZR7A 2JLRA 3NEYA 4YMWA 3OE7A 3GLGE 1P2SA 2O0HA 3GLHA 2BHRA 5FI0B 4B76A 1GKYA 1QHYA 1YQTA 2W58A 3IIJA 4M4SA 2J7KA 2ZJ5A 1ZIOA 2OE2A 5CB6A 2V1UA 1T5IA 4BFUA 3GJ6A 3P32A 1N6PA 4HB4A 2CCKA 3LLMA 4HDOB 5EE0A 2Q21A 2ZRIA 2R6AA 3DPUA 4HDQB 4CW7A 2JLUA 3NTUA 3SNHA 3AVWA 2ZI5A 2IEYA 2CL0X 5KU1A 2CLSA 4Q1AA 2IXFA 3W5IA 4MUBA 1Z3IX 2ZIAA 4A2QA 4C0KA 2QM8A 4RSGA 2XSZD 2HT6A 3WP0A 2D7CA 2JEOA 3VNUA 1GRQA 4PZZA 1T3LA 3B7GA 4B34A 2IYQA 3AGQA 2ZRCA 1XNJA 3B1ZA 2ZI4A 4DDWA 3EZ9A 1UADA 3SEAA 2IS2A 4A6XA 4GDFA 2Q9BA 3NC1C 4DVGA 4WXRA 1O87A 3LAWA 2QGNA 1T6NA 2AFHE 4TYPA 4B2IA 3G0HA 1A7JA 721PA 1VCIA 2NIPA 4HLQB 3ADBA 1ZJ6A 1TUIA 2CL7X 1ZM4A 3TR0A 1R2QA 2WSMA 4YMTA 1JPNA 2GCOA 3ZQ6A 2ZPTX 4HEJA 1Z6TA 3RLFA 1XD2B 3BH7A 4DSUA 1HH4A 4DUGD 1J8MF 1GNPA 2IXEA 2CBZA 4C0HA 1XXHB 4KAXA 1UBFA 3SQXA 3FHOA 4L16A 2ZI7A 1KJWA 1E9CA 2GCNA 2GZHA 4ZIRA 1DARA 421PA 3K1JA 1NN1A 3ZZUA 2ZRHA 5AUPB 4IVRA 3C15C 4P3YA 3U3OA 3UATA 2B6HA 2AR7A 1KGDA 4JVLA 3JVVA 3VAAA 2P67A 4PPGA 1AKEA 1FP7A 3ND9A 4RZ3A 3RVBA 4OQXA 4ON9A 5GJVC 1E1QA 5EXTA 2B7CA 2GVZC 2XNDD 3X1WA 1MABB 4KI0A 4OJKA 1RFLA 1SVLA 4EFLA 3CM0A 4WA7A 4ARZB 2PEZA 4L9SA 4JLMA 4NCJA 5CIQA 1GM5A 1JPJA 1KHTA 5CDFE 1JR3D 3AKEA 1IN6A 3IHLA 5L3RA 2WM9B 5DI3B 3VR2A 2FEMA 3U6KA 2HYIC 1QVRA 4LPKA 4G1UC 1CKEA 1SKQA 1E9BA 1YRBA 3WP1B 2AX4A 3L2OB 3L43A 1N6HA 1XD2A 1U81A 1SKYB 3KL4A 4EUNA 4I1SA 3THWB 1HT1E 3GJ4A 5JWRA 1QVAA 4R7ZA 3NBZC 3BH0A 3KFXA 4Q7KA 3VHXA 3GLHB 4NKRA 5HE9A 2B8TA 621PA 5FR1A 2O8BA 4OKSA 1W0JD 2QP3A 1ZIPA 2ZJ2A 4EPVA 1W46A 1TX4B 2N46A 4M2LA 3DHWC 3BJIC 3DZDA 4A0FA 4K46A 3OESA 4MRSA 4OJQA 2ZVPX 3ZZ0A 1WE2A 3EA0A 1TL7C 4IOMA 3TKLA 5B30A 4TSFA 4V0NA 5BN5A 1U94A 2OZEA 1QHIA 2ZYVX 4IDHA 3DM9B 3HU2A 4ARZA 1R0XA 2ORWA 1MO6A 2WTUA 2AXNA 2WKQA 1QF9A 5L3QB 2YNMA 1W0KA 3B2EA 5AJWA 3ZZTA 1WP9A 1FOEB 2BBWA 4QJ4A 1IJFA 1G7RA 4NE2A 1WB9A 4KFSA 1BMFD 3RWMB 3SYLA 5A5GA 4QRHA 3DMDA 3TVDA 2DFNA 3K0SA 3NBXX 5DN6D 1KI1A 4URVR 5FBQB 1M7GA 3HYRA 3WNCA 1AJEA 3E1SA 2A30A 2Q3HA 4JT2A 1US8B 3HPRA 2AKAB 2MSCB 4KV9A 2IS6A 3CRQA 4D6PA 1E1RD 2CK3D 2WV9A 4A0HA 4A9AA 1RKBA 5B57C 1KDRA 4QBFA 1C9KA 4OI4A 3AVVA 1KMHA 3B9QA 1TEVA 5FL3A 4R71A 3ADCA 4X8LA 1Z0FA 4N1AA 2XXAA 1NN3A 2QEQA 2IA5A 1IXSB 2IBMA 5LPNA 5FPKA 2PJZA 3Q3JB 1KO4A 4LC0A 2ZJBA 3SYKA 3EZ7A 4XVUA 2D4HA 2V7QA 4QC2A 821PA 1XMVA 1CJMA 4LCBA 4F4CA 2CHVA 3CZPA 1BIFA 3SOPA 4A2PA 1PV4A 1E0AA 2WPDD 2ZRMA 4DLTA 5FUYA 2RGAA 3TJZA 1NF3A 3F3YA 3CX8A 4C3ZA 2IC5A 5FH9A 1ZMXA 4TTRA 4E22A 1KI9A 3UKDA 1JXOA 1AQYA 1VDZA 3OE7D 2RGBA 1J99A 3WYGA 4IDOA 1R7RA 3RS0A 3AH8A 4LV5B 4A92A 1J7KA 4AK9A 2IYLD 3QXCA 3EPHA 3ONWA 2CJWB 4H1UA 5BXQC 2V9PA 3AVQA 2VLIA 2HF8A 3T1OA 5A4JA 2B21A 3CLVA 5BWMA 1OH8A 4TZ6A 2PZGA 1UAAA 2FMXA 2QP4A 5FL7D 1CS4C 2XXAB 1IAQA 1LS6A 3NIBA 5G53C 2ZR9A 4P32A 3B6EA 2R44A 3EC2A 4C7OB 1U98A 1P75A 1NBME 1LTQA 4F92B 3EAQA 4Q9LA 1H65A 4QBIA 1MOZA 3RYTC 1JEDA 2CLDX 4Q9JA 4DLWA 3KFVA 2ZJAA 2WWGA 3FYHA 3DEFA 1GIAA 2GVDC 3FTQA 3VKGA 2OUKA 4IXMA 1OFHA 1Q20A 3W8RA 1W36B 3SQWA 1ZP6A 2KSQA 1YR7A 2PZFA 1P9NA 4JKYA 4MRPA 1P9RA 3T35A 1E4YA 4LHWA 5AWFC 3AF0A 2ODNA 4HDCA 5HKKD 4IKEA 2ZRAA 4OK3A 2G77B 3ZQJA 1NL3A 2WJIA 5KSZA 3U44A 1UBGA 1OKKA 3EA5A 3ZLJA 1ZCBA 3CX6A 4MGKR 2OEPA 2D3WA 2NQ2C 2ERYA 4GOKA 2WWIA 5EXXA 1MO3A 4Q9IA 3MWJA 1E9DA 4US2R 1W5SA 1GFIA 4W5HA 4RD4A 3X1YA 4A0GA 3QJYA 3BWDD 3MLEA 1E2HA 1KAGA 5DH9A 1CJUC 3KKPA 2H1LA 4TMWA 3U7HB 1MO4A 3MJHA 4QHTA 1A1VA 2XTNA 4OHVA 1Q1ZA 2FSFA 3PUYA 4Q7JB 3RRYA 1EGAA 1VYTA 1OB5A 3I3SR 3R9IA 3MRSA 4BLPA 4RD2A 3ZIAD 3C16C 2FH5B 3K9NA 2WWHA 4IXNA 2WHXA 2X1VA 4PSKA 5J4KA 4D80A 3CF6R 1IN4A 5HKKA 5C18A 5IHPA 1SXJD 2W6IA 1G4UR 1B23P 1E0KA 3T06B 3JZAA 4XD7A 1U0JA 1U9IC 4PC1A 3D7MA 1J2JA 1KI7A 2GILA 4BFVA 2XJ4A 3ZVRA 4XVRA 1X3SA 3CWQA 4DCNA 1UM8A 3K9GA 4NCHA 3FFAA 2VA8A 1KO5A 1XJQA 2ZETA 4DDTA 1V5WA 5B58C 2JLZA 2FFBA 1W44A 4X8OA 3OEHD 3IDQA 4PQYA 2Z5FA 1E98A 4Z51A 1ESNA 1FNNA 4MGYR 5TY0A 1M1YE 2H57A 4PO8A 3GEIA 1WRBA 2ODEA 1R0WA 2QPAA 2FFHA 2FSHA 3KXKA 1RRGA 3SJBA 2NTYC 2W83A 2ZTSA 4JMPA 1TAGA 4BUJA 1IN5A 1F2UA 3CR8A 2QA5A 2OHFA 4LJ6A 3ADKA 4HAZA 1G41A 1XCPA 1Q44A 4Q4LA 1E1QD 3V00A 4AG5A 2QAGB 4GNKA 1COWA 1DG3A 1DAEA 1QRAA 1RVDA 3I5YA 1XJCA 2Z83A 1CTQA 3AUXA 1E2EA 2OILA 4OI2A 3R20A 5CIWA 2VSXA 4Q21A 1XMIA 1T0HB 1ZNXA 2GXUA 4Q4AB 2F55A 3EIQA 4F91B 4CEJB 3U3RA 3CRVA 2J59A 1DAGA 5GADl 1R8SA 3UWKA 2CDNA 1KNXA 1X6VA 4TWZA 1GTVA 1OYYA 2BKUA 2OV2A 2KJQA 4H1VA 4CEHA 1KK2A 2C98A 4EQ6A 4GRAA 2WSSD 3CR7A 4IJMA 4P33A 1KK3A 1HT2E 2AKYA 2I3BA 3X2SA 2KE5A 5CM8B 4X8MA 1G16A 2UKDA 2H92A 4I1UA 5JWHA 4AIIA 2HXYA 1HE8B 1UDXA 2AWNA 3L0IB 4Q5IA 4JVMA 1F2UB 3PR1A 3IO5A 2JATA 4US1R 4KLNA 1E1RA 1YU9A 4ZV4A 4PHHA 4MKIA 5GVSA 5CM9C 2BV3A 2X2FA 4C2TA 4U7DA 4UJ3A 2F1HA 4UKDA 2CEAA 1N0VC 4TQUS 1MO5A 2J0UA 4L15A 4O3MA 1UJ2A 2QNRA 3EIEA 3PEWA 3ZS9A 2BJVA 2GEUA 1GILA 3BE4A 1XCGB 3EPLA 2IHYA 4B43A 4OQMA 3AP1A 4WVFA 1XMSA 3OEED 5BW8A 4F93B 1Q3HA 1VECA 2ZUBA 3WBKA 2FA9A 2W0MA 1C1YA 4TL8A 4Y0AA 4Z1MD 2DCUA 3TSWA 1MRNA 5AJVB 5E95A 3SBDA 2PCLA 2W0SA 2N42A 1Z0KA 1UKYA 1E96A 4BFXA 4IEEA 1VCNA 3A4NA 3MG9A 1E9SA 1E79D 4RD0A 3LO5A 4KODA 2W6JA 1IY1A 3O8DA 1KI4A 4MYCA 3G5UA 3DOFA 4TLAA 2XNSA 1DOAA 1P73A 1RIFA 4URXR 4Z8XA 1M7HA 3C8UA 1AS3A 3REFA 5KNCA 2O8CA 4M9ZA 4V0MA 2AK2A 2C77A 1TU3A 1P60A 3U3JA 1XF9A 3TE6A 4B3CA 4U5XA 1R8QA 1CR0A 1UKVY
chains in the Genus database with same CATH superfamily
1O94D 2OV6A 3EMDA 3D8SA 3RVQA 4F3RA 1GYRA 5C1PA 1KEPA 2XZLA 1R5NA 3ESZA 3A1SA 4C6TA 3IBCA 2IU0A 2V7UA 3ILYA 1ULSA 4CG0A 2IP2A 4BZWA 2IYXA 2OVBA 4IUCS 3SM9A 4DNXA 5BYKA 4KR3A 3B78A 4PTLA 4D4MA 1NVEA 2FN8A 3UTDA 2TMKA 1E99A 2DECA 3PT5A 2OM2A 1VIDA 1E6LA 4TX1A 2F48A 4LFAB 2QW1A 1YSCA 2B4YA 3RKUA 1YK1A 4R9RA 4CR7A 5DLQC 4QXOA 2WTEA 3DTVD 4RKEA 5JSFA 3KEQA 3RYHB 5BOSB 2E4ZA 1NLYA 2QD2A 1KMIY 1UAYA 1CF2O 5FNVF 5I7WA 4INOA 2BSAA 1V1RA 2YWDA 3BCHA 3P45A 5BW5A 5JMTA 3EEOA 1I3MA 1JYSA 3D8UA 2VH5R 2VJLA 4QGAA 4E51A 3LVRE 4KWCA 4MPJA 1E9AA 3PLRA 2DXIA 4DCJA 2RJOA 1OGYA 3U3ZA 1AF4A 2BW0A 4C7BA 1N7IA 2F7SA 2WAOA 3H65A 4PYIA 5EZYA 5FBWB 5C8YA 2BWJA 4MUYA 1TF2A 3ZDXB 4CM9D 3S1AA 3ZHUA 3M6VA 3MTDA 4QPNA 4IIJF 2AEMA 1Z75A 5I9MA 2ATVA 3O2JA 2M1ZA 5G4LA 1JAYA 3W6PA 3I2IA 3IR7A 5DW3A 5JNUA 2Q4TA 3DTYA 2IYVA 4IVQA 5G0SA 2ZQ5A 1U7XA 4LDRA 5AUQA 1X7YA 1VGQA 1MW8X 1GSAA 3ERCA 3ZGZA 1U0TA 4ZZ0A 2OXFA 2BEUA 3H4TA 3NX4A 3PRYA 4DGQA 3H5RA 4BKOA 3ZBUA 3V7FA 5CG2A 1K5PA 2GD2A 1BN6A 2ODQA 3V97A 3WGZA 3ZC3A 1XQ1A 1BC5A 3KR9A 4A8TA 3R4VA 3FB4A 2WYWA 1RACA 4MJLA 3TH5A 5JXIA 1C2YA 1PIWA 3GNSA 1RNLA 5FBLB 1I4OA 2AN3A 1XPOA 2HF2A 1BKSB 3G1WA 4N7RA 4MICA 5HM6A 2G04A 3L6DA 3KKNA 4GQIA 3P0IA 3V1TC 3C3DA 2HF7A 2ZIZA 2PJRA 1BMFA 2JI7A 1E5QA 5LQCA 1UQRA 1XWIA 5F51A 2VEDA 1UQUA 1XZ8A 2G4VA 2IQ5A 2WPDA 3CJRA 1NBAA 2QYSA 2AOUA 3E3NA 2HU5A 3M5CA 1R50A 3MLBA 2RCNA 4NJMB 4TL9A 2YWGA 3AR3A 3QBJA 4YRSA 1GXSA 3GCGA 4IZHA 3ZEAA 1MLDA 1AO3A 5TE9A 2H2IA 2WWXA 3GGOA 2Q1YA 4LRTB 4A6PA 4O2AA 2EBWA 3LCCA 2G67A 1T3TA 2HJRA 2Q4BA 2R86A 2VRBA 3L1IA 4K88A 4NBVA 3MT0A 1RRKA 5A4AA 3SMVA 2OHHA 4GG1A 5MN4A 2BCJQ 4PNZA 4CMIA 3LQ1A 4IJ6A 1NIJA 3IA2A 1YOBA 5ALZA 2HCRA 4LRXA 4Z0HO 1O2DA 2GRAA 1T5OA 1ZUHA 2H0QA 3I53A 4HLUC 4NE9A 2I29A 4D7AA 3NFYA 2KBEA 1NRJB 1SCDA 1UFKA 4WEQA 4WDRA 1K1EA 1SR8A 3G88A 3CB4A 4MVJH 1B6TA 3F6EX 4ZT4A 4GM0A 3PCXA 1IJEA 1JDUA 1KO8A 1OXUA 2JRLA 2Y93A 1G8HA 2GPTA 3HXKA 3MS7A 4ZWNA 4JUBA 4QGHA 2JIZA 1P61B 3AY6A 2HMAA 2WJJA 3O84A 1PT7A 4C06A 3QU7A 5KKNB 3PE4A 5KQLA 2VHJA 1KBZA 4CIVA 2HHHB 2WOOA 5DTIA 1J42A 1YRLA 4LOLA 3A10A 2HRCA 1KO1A 4HQLA 3UC5A 3A1VA 1VZ2A 4MPPA 4ALIA 5F9HA 1REQA 4NWIA 2GETA 4LXGA 1T3GA 4PZLA 2HMWA 2C94A 2P6PA 2C3YA 3HB4X 4MS1B 2WBLC 4OEHA 5P21A 5EJ5A 1V16B 3V8RA 5F5NA 1SEVA 1FS6A 1MR3F 1TD9A 1C5KA 3W4KA 3EZ6A 1AURA 2BMEA 2HGSA 1HMPA 3A4VA 2WKPA 3ANLA 1EUCB 4R9VA 3BC1A 3QYAA 2J3JA 4M88A 2Y99A 3TIFA 3HLKA 3GJ7A 4PZ0A 3TK1A 5LZ9A 3H11B 4KGDA 1BTOA 3X1XA 5IW8A 2PRJA 3AF5A 3P0EA 2GGSA 5LBIA 2OPHA 4RACA 4TRMA 2V45A 3EARA 4GLJA 2X5KO 3GFBA 2DVMA 3ZQKA 4BO5A 2PJUA 2Q8QA 4F06A 4B79A 2APJA 5FLEX 4J03A 4B3TB 1QQ6A 4D44A 1KEEA 2V6GA 4UVIA 3CKMA 5THQA 5TSDA 5FTLA 3MJRA 4LBYA 3M1IA 2ZP1A 3PQCA 4CETA 1JE0A 3VKFA 4O4HA 4B8YA 2X9QA 4BZXA 4KUGA 4NOKA 4X61A 2OK8A 3KSBC 3UAOA 3BB4A 4EO9A 3LX5A 4B71A 4BE9A 1TKBA 2JKVA 4D6XA 3LP8A 1P2DA 4IEIA 5A3JA 1O6GA 1B7GO 2WKWA 5JSYA 3SFTA 1UK6A 2Q3EA 4KN6A 5CPFA 3IP7A 4BLTA 4PZ9A 1IY0A 2PE5A 3SC2B 4BQOA 3GLFE 5TB5A 5A3QA 3SG0A 4DBLC 1TYEB 2AMJA 1QO7A 4RV4A 3T9EA 4A15A 1T5LA 1XRLA 4HUQA 4DUYB 1NYRA 2F8MA 1II0A 2PX6A 1N4AA 3BRWA 5GJWC 2PWBA 1VJTA 3T3OA 2H85A 1DGQA 1PT8A 4H4EA 5MFZA 2Q8NA 1HTTA 2R25B 4H2DA 4OGFA 2HR1A 3FFTA 4IHJB 3ABQB 3DGEC 4CQMA 3CUTA 4HATA 4JL6A 5EG5A 1DDOA 1AMUA 1O9HA 3HJHA 4WECA 4GS5A 1TIBA 1PO7A 2IT1A 4AZTA 5I45A 2JANA 4Y6LA 2QRNA 1UMBA 3HA7A 5CX1B 1FSPA 1KK1A 3ET4A 1C7IA 1U0LA 3UJHA 3D1VA 2HBZA 5AIBA 3UBMA 2Z9BA 1RE0A 3JQ6A 2VJQA 4HQ0A 2VSOA 2SCUA 1XHEA 5GGXA 5EJ4A 2IUYA 4Q4JA 5I7RA 3SKXA 4OJYA 4KSYA 3K9FC 2LWIA 2VR1A 4K40A 1H22A 4FQ7A 3D8HA 3IEPA 2DJ5A 1RP1A 4S1OA 3ETJA 4FBLA 4ZI5A 4CQLB 1XMQB 4RHEA 4IKPA 1QKKA 4MWEA 1NT4A 1SK8A 2FPSA 4GSKA 4Y2PA 3IBSA 4N3CA 2PUFA 1YFJA 3PITA 1QH8A 1MTZA 2DY0A 1CC1S 1DWUA 3LUHA 1Z8HA 1YC5A 4U63A 1KRHA 1J49A 1XPJA 2X2OA 4OHUA 5IAGA 3B82A 5LP6B 3KJHA 4OGKA 2F3TA 3A31A 3KZKA 3R3WA 4BFCA 4YLGA 4CM8B 4CQNA 1BXRB 1HFJA 3R77A 4IIJB 5AM1A 4NFHA 3F8TA 4Y2SA 4RTJA 2WF7A 5KHLB 2WHPB 3PXDA 1HTBA 4RNCA 4XASA 4HXFB 5A0VA 1YHNA 3BD9A 2PUEA 2NO6A 1YRAA 2QENA 5ES4B 4N41A 1POXA 2QVZX 3PKZA 3KDAA 1DBSA 3ICOA 1K5DA 4HI0E 3U81A 4EKDA 4E46A 4EX7A 5JNLA 4H6WA 4B3IA 4Y2XA 1GPLA 4IR7A 5EJEA 2OZVA 4MV7A 4GYWA 1DIHA 4YJ2B 2P4HX 4Q3NA 5AJXA 4ZA2A 3LPAA 3X43A 5BSKA 1YCFA 3LHSA 4B3FX 2PUVA 4NBSA 1CFJA 5KYXB 3PNOA 3FAKA 3VQTA 4ZDJA 4LGMA 4F72A 4G65A 5AHOA 1KSGA 1PAUA 4JELA 3BF7A 4O63O 1HQYE 1V7CA 3MJ4A 2XOKA 4PC3A 2IBTA 4W5OA 1A5TA 4IRUB 1DAHA 4IYJA 4PYLA 4D3FA 3BRQA 2VQEB 4IJQA 4K28A 2GJSA 3DLIA 3KT8A 1V7PC 4JR0A 1J2EA 1N57A 3VU9A 1E0SA 3CZCA 3W9UA 1Q7RA 3BGDA 2HWWA 3RANA 1J8QA 2QP9X 1D1PA 1LS1A 2A1IA 3JQGB 3O21A 5EVCA 5K51A 2FZLA 1QVVA 1XLTC 1YTLA 2HQOA 5EEHA 1U3VA 5H16A 4YRTA 2WYIA 3ZGLA 3IIEA 3R7WB 5JFGA 5I6DA 2GS9A 1JVSA 4Q34A 1S0UA 5EUBA 2IZ1A 1XJ0A 4AJEA 2H65A 1B3RA 5DYGA 1RAIA 1HK7A 2I3GA 4LCJA 3IE0A 1DAOA 3I34X 4V2UA 2Z1DA 1B6SA 3IR5A 1JQAA 4G26A 1TK2A 1CUGA 1MEEA 1TA4A 2ZRPA 3ILXA 1VL1A 2J0VA 1KH1A 5AI6A 3IPAA 3HEAA 2WPNA 4FFLA 4DCSA 1O96A 1TJ3A 2BTQA 4BLVA 3K1AA 4MHOA 3OPXA 2RGGA 2XT9A 1Q7CA 3DLCA 5EYPA 3V9PA 3SNKA 4BNJA 5KHOC 3DBRB 2QDXA 3PXEA 1SA0B 4JUAA 2PZKA 3CZ4A 1VL0A 5IJ9B 1IN1A 1YR3A 3NDBB 2PUWA 4GVPA 4BMVA 1E0DA 4RL4A 1I5OA 3HU1A 1HNZB 1LPMA 1LDBA 1MABA 4JENA 1DJMA 2VQDA 2D59A 5BN3A 2BR4A 2J5XA 5F2EA 3VR5D 4DXHA 5KS2A 3OFNA 1XVLA 2ZSDA 4LAFA 1NF9A 3H9JA 4WZAB 4YUYA 4RK5A 2ASEA 2QTGA 2QN8A 1THMA 4BJ3A 5LYJA 5BW4A 4HEA6 2AQIA 1NXVA 3P19A 3L0CA 4FHDA 4H4DA 5TDHA 4A4DA 4CUJA 4Q4CA 4YMGA 3NVKI 1FDOA 3UKJA 2PLNA 3ICEA 4HDRB 4XFJA 1BQ4A 4HD8A 3KELA 4YIKA 5DWQA 4PCVA 2ZRJA 5K0CA 4J16A 2YYZA 3PFBA 1ORDA 1BDHA 3A3PA 4REQA 3CY6A 3GXOA 1ZHOA 4IIBA 4ZCPA 3RS3A 2D2IA 1SZPA 5IKPA 1Z5VA 2HJVA 4RKWA 1LK0A 4KX3A 4K0RA 2CGEA 2HH9A 1WDLA 3BMNA 3CUEF 2E4VA 4Y30A 4D0SA 5HGXA 4QULA 4B32A 3GDWA 3CCFA 3A6HA 5H8WA 3SS9X 4LSMA 3EPKA 1MD9A 2L42A 2V7VA 3V55A 2CUKA 4HYTA 1IXZA 2BLLA 1M5RA 1A9QA 1X38A 1Y9ZA 2G83A 2LVBA 2VBCA 3KU4A 4DHWA 2CV2A 1AHIA 4U6QA 2ZJFA 1RMYA 3DFKA 3EAFA 1R9NA 2WYUA 3LYUA 4X9XA 1L7DA 4I6JA 3TN7A 5JQWA 1UJ6A 3C8MA 3Q3CA 2FUCA 1CSEE 2Q4DA 2VHVA 3IT0A 2IYWA 4M9QA 5HQ3B 1NPDA 1Y3HA 5IVDA 4LGCA 2Y92A 4JUDX 5IZCA 3NHLA 5LP6A 1Y3AA 3RD5A 5GINE 3ZU2A 3MJTA 1NF8A 4D3SA 3HM9A 2OZKA 2O5RA 3A1TA 1QE3A 3AK4A 4M7WA 3SEFA 4XH9B 3GLGA 4MYRA 1RPAA 1ZU4A 1V3UA 3UG6A 1Y4DE 1DBRA 1IM2A 3RSSA 4OLHA 1NVKA 4U1RA 1BKDR 2DY1A 3A1EA 4XYLA 2CJPA 3A3OA 2VHXA 3HUUA 4KN9S 3Q5EA 4NBNA 1DJQA 1EWTA 3PF8A 3ZLTA 2NAFA 1BE1A 3H86A 4KRGA 4V0KA 2JW5A 4RU1A 1H4TA 3HB0A 3AFOA 1U0GA 2YUTA 1XK6A 5B12A 1SURA 1LSUA 2ZPUA 3BDAA 2ZRLA 2FQXA 2HXSA 4FIZA 1UOEA 2JCBA 1IUOA 5JAZA 1XA0A 4KW7A 3NB0A 1Z26A 1BU5A 1JKJA 3L1KA 4C0AC 1HKHA 3S2UA 3GG9A 4IDDA 1H0RA 3B6KA 1YBMA 2IU6A 1LW7A 2AW3A 3IQHX 1JQLB 2XDAA 4US0R 4X1OA 4PAMA 4BBZA 4BVHA 5AM3A 1ZOIA 4AULA 4BO1A 4ZYWA 3HXMA 2JJ2D 4XWAA 4LJ7A 3QITA 3TGLA 3R3VA 1GYQA 1IH8A 1YC2A 2DUMA 1Q19A 2FGJA 1I4WA 3G79A 4BV2A 1HDOA 3O3NB 3U49A 3IEVA 2XTZA 2C9BA 2WD9A 1HYQA 1E63A 2IE8A 2J6HA 2QTLA 3K73O 4P82A 4WGFA 5CBPA 2EQBA 4J0QA 4HOYA 4K9OA 2CVHA 4K6GA 3O26A 1HMYA 1QCZA 4JD5A 1JU9A 2MYUA 4XSHA 3D8RA 3JWEA 4OREX 5EJAA 4E4RA 4HVTA 5LWHA 5DHAA 3I6YA 1ISIA 2AOVA 2OBMA 2RHHA 2VJOA 5KZMB 3IV9A 2FYTA 1IG0A 3I8OA 4HWGA 3DLBA 1EMDA 1G63A 1HV8A 2X9LA 4ZOLF 1YCDA 4ND8B 3V33A 4D92A 4RVCA 2J0SA 4X84A 2ZJ8A 5CJJA 2GLUA 1XEWX 4HRVA 4H7KA 4DSOA 2Y0EA 2QW0X 2CJFA 5EMKA 4ZOEA 4BLWA 4OHXA 4X1YA 2VDLB 4DYVA 1NKTA 4NV0A 3ACCA 2G8LA 5HMLA 1IOZA 2ISSD 3O4RA 4HDKB 3GRFA 3RR2A 1AB6A 3RHZA 3BMCB 1ZLYA 4B6EA 1NAHA 3GEPA 3L02A 3DUFA 2XEXA 1V95A 2WWFA 2IJGX 4MYTA 4IIGA 2EP5A 5DRYA 4QL3A 1DUSA 3HNPA 1FTGA 3KFLA 4Q3DA 3UB2A 1TXGA 1GAEO 3KYCB 5GQSA 1U28C 3TI7A 4D4KA 1VLLA 4N03A 3GDOA 5BO5A 3D64A 4I9HA 1KFBB 3LKVA 3QFFA 4UOQA 4I9UA 1PJ4A 1OWNA 2P2ZA 1W34A 1L7VC 4K9DA 3OETA 2OCXA 2NU7A 1NQWA 1FPQA 5E3JA 5KUTA 4IMJB 3TFOA 3R9WA 4QUEA 1B16A 1LDYA 3EXFA 4JJZA 3QKSB 4L0CA 4BVBA 3RYCA 5CH8A 3ZJTA 4NQZA 3S0JA 3U3DA 3WC4A 4CDRA 1EFRD 1V7ZA 4HHEA 5KSYA 2JLWA 1TEZA 2IYYA 3LX4A 4MIEA 4ME6A 1MEOA 3CIOA 3H5WA 4WL0A 4D4JA 4DREA 1VHWA 4L8WB 4DV5B 5DGXA 4EDHA 1NV9A 4O2LA 4MUAA 3LBYA 4H0NA 4QPCA 3PQ4A 4OF4A 4X00A 2C42A 5AKLA 2C3PA 3SS8A 5B36A 1GA4A 1QK4A 5DYIA 4G56A 3WZMA 2ZS7A 3NEPX 1P2UA 3N7UA 2J3HA 2ZDQA 2AFHB 3DCIA 3RARA 3S8YA 3ZGVA 2PSJA 3VVLA 3UMCA 4BKRA 5K0FA 3LQKA 4QUGA 1UMDA 4KDFA 1L1RA 1W5AA 5KCZA 1AM4D 1RLJA 4HFRA 3IP5A 3V2UA 5EGNA 5IAOA 4GOMD 1A77A 2FZKA 2O3QA 1UKBA 4RMJA 4WCFB 2B2NA 1Z83A 1M3SA 1P39A 3E18A 1PS0A 1ZKMA 4OQNA 4UPVA 3RYIB 4IZOA 1Q74A 1Q95A 1QB8A 3O8LA 3IVAA 2C7BA 4M0FA 3SQLA 3C85A 2C2ZA 3WLNA 3F5SA 4L72A 3H1BA 2ZIFA 3MAAC 3GIDA 1NI4B 3TXXA 3VSCA 5JMWA 4K3UA 3JSXA 2IOYA 2RJNA 1R15A 2O2SA 2ZCVA 3FCUB 1U2ZA 4J7XA 3SP1A 5CB0A 5C7LO 1XUOA 2YMMA 2DB3A 4RJ2A 1T3HA 4B46A 1SC1A 5JD5A 4X95A 3KUUA 1FXWA 2GBIA 4YC7A 1X7ZB 1CUJA 3MERA 4UZSA 1V4NA 1CJBA 2P2GA 2XWPA 3ZW7A 4EHLA 2FSGA 2DQYA 3FSGD 3SE0A 5JS8A 1IBSA 2E21A 2NU9B 2D2FA 1Q50A 4PWZA 3WRXA 1CUVA 1H3FA 1AKNA 5BN1A 4EAAA 2YWRA 2UXBB 3WKAA 2G17A 2VHYA 1EG7A 2OXRA 2GD0A 3I4LA 4G5YA 3ZE7A 1JP7A 2P90A 4ND1A 1UXKA 2FCRA 4XOIA 1TYAE 3WLPA 5BVHA 5HS4A 3NHKA 3AR7A 2CXSA 1XC7A 2LE0A 1EX7A 1I33A 2NV2B 3VSEA 5GIPE 2O5CA 1CNFA 4K9RA 3D5TA 2VK1A 1IWOA 2C2KA 3JZMA 2QK4A 2G70A 2QD1A 3IUYA 4Y9SA 2GKSA 3K1ZA 3VR0A 1CJSA 3OKPA 1OMOA 5EHXA 3N39C 2B20A 3RAFC 1YS6A 5B7PA 3EX7C 1KJ9A 3G82C 3ANXA 3N2ZB 5CEJA 3E5RA 3OUZA 2IZ0A 3T94A 4G0VA 2GWRA 2P4SA 1L8QA 5AP9A 1WZEA 5KAPA 2RGRA 4ZQEA 3LQRA 2RONA 3AQ4A 2PLWA 2X4GA 3I01M 2NZUG 1JMYA 2ODTX 2Q5IA 3BA1A 3EGDA 1UPFA 2C0QA 1H2BA 5COQA 5JJKA 1R74A 3PTZA 4FVTA 1WZCA 2ZJ0A 1PR0A 1MX1A 2D00A 4HADA 3UTCA 4AP6A 1DWOA 4A8HA 5TRTA 1J2YA 4AI6A 2NYUA 1YDHA 1JUDA 1BJRE 2G9NA 2WNSA 6LDHA 1FDSA 2QUBA 2AZ4A 3MRVA 3PQ8A 4Q9HA 3AF1A 1KK0A 1V5IA 2WM3A 4BTEA 1UEJA 5I7SA 3IPXA 4LV6A 2AXQA 3LUFA 1RXCA 4R41A 1XTVA 2JKZA 1W30A 2WMNB 4QDOA 2VIIA 3ZD9A 4G2NA 4YNBA 3SQDA 3IHTA 4TMKA 1E4EA 3WMGA 5JZOA 1IB0A 5FQOA 1DBVO 1GKUB 5FP0A 4GSLA 2A0FA 3KVRA 5CMLA 5AKXA 2IYPA 3N0WA 4BNDB 3NYQA 4ZC1A 3D0OA 1UK9A 1LDEA 1AKTA 4P4SB 1XZNA 1Y3IA 3GAFA 1JJIA 2Q5LA 1PUIA 4TL6A 4BNIA 2IBSA 1B2LA 2P4QA 4ASUD 2IYFA 2H1WA 4S0XA 2O7QA 3W2IA 1IYZA 16PKA 1MENA 1QPBA 2EIHA 4RQAA 2HBRA 4OB6A 1N2HA 3FE2A 4R1OA 2B8EA 2VUHB 3A4YA 3LHKA 2IW3A 3QX9A 2JFVA 1D09A 1KO7A 1B14A 4KQMA 2MSDB 2RAPA 3UICA 4AKSA 4J2OA 4NS1A 3DL2A 4R6XA 1QIEA 2QTCA 4NCNA 3GC6A 4M7RA 3AUFA 5J4VA 4Q01A 2BUAA 8GPBA 5JBNA 4MKFA 4RABA 4ZT3A 1L5MA 2YJGA 1PEKE 2X41A 3WYFA 2JFPA 1QV6A 5LZ4A 5EIFA 1M34E 2PSFA 2PXHA 3CKLA 2VCHA 5K6TA 3UYKA 5FADA 3MILA 1M1ZA 3UANA 1VKNA 3RS4A 3H7IA 1OXVA 1QO0A 4C7JA 1CEEA 4KFRA 2EJUA 4GP9A 4JWKA 4TM7A 1EE1A 4B6QA 4YAKA 2HA0A 4NR0A 8ADHA 1EFTA 1PR3A 1L7BA 3FWZA 1YL7A 2YVKA 4JASB 5MGNA 3MPOA 3P9XA 2PBFA 1GHTA 2Q2OA 3MUEA 3QTLA 5HOEA 4H18A 1E2BA 2I1VB 3OFSA 2WQZA 5D87A 1ZYUA 3O8BA 1K5HA 1ORWA 1OXKB 1ZIYA 2ZAMA 4KQGA 3PE3A 3T1QA 1CZHA 3RHFA 3SHOA 4RK6A 4WBSA 4HLDA 3ZWWA 4DEVA 2I3ZA 1NBOA 3U3XA 2VF7A 1DG1G 1N9GB 2H7YA 5KKAA 3JYLA 5DYYA 2OBLA 3KVNA 3M1AA 3IQDB 3R6GA 3KE8A 4MVWA 2P9GA 2HPVA 3I0NA 4XYBA 3MMPA 3ZI4A 3MWKA 4YP1A 3OSUA 4DAEA 5IM4F 4QPPA 3IERA 1GZDA 4RW0A 5E7IA 1X70A 1ZRSA 2P1ZA 4WCFC 1EE2A 1Y9AA 3V7WA 4XTCS 4B80A 4DIUA 4LQDA 3CTPA 2QVYX 4TTPA 1V35A 4IHAA 4MROA 3D4OA 1ID8A 3WYAA 4QOHA 3SYTA 1SCBA 3DS8A 2ACVA 2PRYA 1E3EA 2RHOA 2ZWIA 1HLPA 3O2SB 2P9BA 2GVNA 5CUQA 1LQUA 3E9QA 3VUEA 5KSWB 1W2GA 3L8YA 2IRWA 3KB2A 3MMZA 5EE9A 4UNRA 4GZMA 3H1TA 3K0CA 4XXHA 4INAA 4ZCIA 5ALMA 4RVGA 3BB1A 1BYIA 1NLFA 3GCWA 1JHUA 4MWZA 2RHWA 5C3UA 3ONDA 3QF4B 2I3DA 3PPWA 2C00A 1CB7A 1PJCA 5CGZA 3Q85A 2IHNA 4GI5A 2AKEA 4HLUA 1KU0A 4L07A 1GADO 1K5GA 3GZNB 2HB6A 1TECE 1BDJA 2GZRA 3HCNA 1PKXA 3OD1A 4IIXA 4K5QA 2Y1FA 1LBEA 4KQIA 4L4RA 1SU4A 2I2XB 4MV9A 3EH2A 2QKYA 4BNVA 4D56A 2AZXA 2YHUA 3ENWA 3NHPA 4UM9D 1OLSB 4ZZ2A 1V6CA 3NIGB 2PZAA 4YCCA 2VSYA 2VHWA 3CA8A 3IUPA 1SUEA 1S5PA 4DT1A 3MIZA 4YT4A 4JBGA 2FG5A 2WU8A 5C8ZA 4H16A 4ZU3A 3GDFA 5J9FA 2H1IA 1JI0A 1I7NA 1W1IA 2EWVA 1JHRA 1QP4A 3WLKX 4DLAA 3GDHA 1NV8A 1L4GA 1N2GA 4UHJA 5HQJA 1ACLA 1DC8A 4DLZA 5JRJA 2PL3A 1UF9A 4TXNA 5CNJA 4IVPA 2YYYA 2YS7A 4XPZA 3ND8A 2ZBRA 3X2EA 3WXMA 4IS3A 2H2DA 3W7VA 1PX2A 3T3HA 1KQ3A 4ECAA 2XA1A 3MS4A 4BEBA 5SYNA 5JDIA 1ZMTA 3MOIA 4BNGA 3AEUB 3IKJA 3T4XA 2B1IA 1T36B 3HKBB 2GN6A 1Y1SA 4R1NA 1V5GA 5EKUA 3VH3A 3RYFA 4BQSA 4E2ZA 2XCUA 1VE9A 2QX6A 5E0KB 2C7OA 4MR9A 4YCDA 1G0OA 1ZA2A 3RU2A 1KAQA 3D3WB 1C9DB 1ODIA 3LFUA 3FIJA 3N1UA 2JIPA 4FE3A 4L8VA 4M0LA 5K0NA 3PPYA 1B15A 3QLUA 2Y4OA 1ONNA 1NOKA 3HKDA 5K0GA 1HEUA 4DV1B 1PDWA 3BTOA 2AW5A 3SKYA 2CWWA 4ZO4A 2YMPA 2II6A 3KUDA 4QQNA 5JBQA 2ZRGA 4W1PA 2VJMB 2PT6A 4BV3A 5CD1A 1F6DA 4EM6A 2WTMA 4PSDA 4UXIA 5ICGA 3C3PA 5TPWA 4CWAA 1PJBA 2I62A 4EBFA 1KVQA 2XKBA 1FK8A 3PQEA 1CUFA 2HDOA 3FPCA 5DHSA 3HGQA 4FMCF 4BYGA 4JEUA 2RI0A 4LY6A 4B47A 4FB4A 2AJLI 3CU5A 5A2GA 4KPUB 4LJKA 1Z35A 2WFZA 4HH0A 4DM7A 1O3YA 1KRXA 4I4IA 1ZZEA 2YKGA 2Y66A 1BWSA 4NK4A 2Z3ZA 4V0LA 4X0EA 3UCEA 2QI9C 3RUFA 3QVJA 1MGPA 3RTCA 2D5LA 3TNLA 4Y0NA 1Y1KE 1ZWLA 2QYOA 3PUZA 4WFJA 3DZCA 5B37A 3I73A 2X2EA 3PQ5A 3H9QA 2J7PA 3PI7A 5JD4A 4YDRA 4DVJA 4K86A 2WUVA 5G02A 5AXCA 3CX7A 2PRZA 2QMZA 5G1PA 1M8KA 2X15A 3F67A 2F3RA 4RSMA 3T0IA 1DC6A 1U0FA 1KARA 5GIOE 2VZ0A 3I1JA 5D3MA 1GJRA 3W05A 2JJ2A 3JAKA 1ORVA 4HFNA 1E32A 5IBQA 3T7EA 4K9NA 4BJ5A 4YV2A 1GEEA 4CLRB 4NICA 4JYAB 3O4FA 4M7PA 3N74A 4XUCA 5EA2A 1SPBS 2AR9A 1M2OB 3SOZA 3BHJA 4I6GA 4BC0A 1XKXA 4LGVA 3U80A 2GTPA 1G5PA 1PK9A 3HDJA 3H8WA 3TW4A 4O5AA 1Z3CA 2WTAA 1OIVA 3CYFA 2HZBA 4O08A 2GI4A 4UU0A 1BQEA 1RJWA 2QG4A 1GPYA 2XGGA 4OGGA 5JAQA 4DLXA 3ROEA 3TLXA 5IULC 1G8FA 1V8BA 1GR1A 3OY7A 1H85A 3K0AB 1IVYA 3COYA 3U9SA 5JSZA 5CTJA 3AB3A 1EZ1A 3I32A 3ND5A 2A86A 3HP4A 1I32A 1G19A 5M29A 3PXGA 3BDVA 3VV3A 1P44A 2CMGA 3CO0S 2RH5A 2I33A 3JVIA 3FF4A 3JVUA 4F5DA 2VTEA 3G5TA 5KU7A 3LHDA 3VNBA 1AH2A 1QHGA 1PJAA 2IUSA 3F78A 2WHEA 3H11A 5IDQA 4OL0A 1KPHA 4XJSA 3AY0A 3D6MA 3E3MA 3H42B 4RHFA 5K3DA 1K2WA 2WE7A 2X19A 3GVPA 3ZDBA 1QF7A 3KT6A 4IKOA 5FA6A 4DN6A 2ADMA 4YXWA 4EJ6A 1CP3A 3FWYA 4YFYA 1ZD3A 1PZXA 1X1TA 3O8QB 4AMBA 2ATXA 1V5EA 3FSEA 3IOYA 5AVUA 1Q2UA 1QFZA 1R1DA 4KMOA 5B2FA 5CVDA 3WQQA 3HL0A 3AR5A 3JQEA 4JLDA 3F3MA 3UQZA 3KKZA 3HWRA 2CLFB 1QHEA 4LQLA 3KYDA 3IHWA 4URWR 2G1AA 1ZH8A 1CDZA 5HPYB 4UXJA 4Y9UA 4KDRA 2GH1A 3CBGA 1TQ2A 2C92A 3FY4A 5LFAA 3PQDA 1RTTA 4BVAA 1E2GA 4C30A 1QIJA 2HJSA 2HO4A 4JGGA 4NE7A 4QWMA 4UBIA 3SHFA 5I4CA 5JIBA 1AQIA 3KEMA 3PHLA 5KYWA 2DPXA 4BE4A 5KWJA 1GTMA 2CDCA 2IUEA 2NP6A 1SXJB 1CY2A 5JS6A 3F9IA 2OBFA 4E3WA 1NMSA 1VFPA 2X8BA 3JQPA 4DQXA 2GZ3A 3S27A 3AEUA 2VLBA 4A2CA 3MAJA 3AVOA 4I9FA 3QBDA 3T0FA 3MWDB 3L79A 2Q46A 1GGMA 1N2CE 3FNBA 4GEKA 1G38A 2I71A 3WYEA 4B82A 3EDRA 3HBMA 3P9PA 4MR7A 3I76A 4HQNA 3BMQA 3Q8XB 1EFLA 1P8AA 4LDZA 3EEBA 1NQXA 3BGSA 1LTHR 1EDOA 1DADA 4MEJA 4R1TA 2PQ2A 5H9VA 3ZK9A 4QUJA 4BQRA 4ENUA 1Z45A 3BA6A 1G2IA 4KNWA 1AS0A 3QEMA 5BMOA 2HV9A 2Z6QA 1N6RA 1KHHA 2Z95A 2R00A 3EG9A 1OBCA 2AK3A 4GXNA 4YWJA 4WEOA 3U1BA 4J7AA 3BRCA 2V6BA 3BGVA 4NYIR 4S35A 4F9GA 5FTNA 5EKTA 5EKSA 3WDKA 1I7QB 2ONJA 2G9ZA 2YMQA 3CGWA 1ZSNA 4HZIA 2WWRA 4Q3LA 4OHZA 4BWYA 1Z4OA 4J4TA 1BYUA 4DG9A 5AW0A 1OOEA 2E6KA 1Z22A 5HIKA 1RW4A 1D1QA 1A9OA 4M1WA 4OQFA 2W11A 2W2KB 4CIDA 4EPXA 2V4MA 2W4MA 5JVDF 4YHBA 2VDOB 3K9WA 1WB4A 2FMHA 2AOXA 3WIOA 4B17A 5L40A 1RXEA 4R0MA 4U0JA 5T67A 3I6BA 3KALA 2FWPA 5ECYA 3JV7A 2R1UA 4TL7A 3RPEA 3U62A 1XR3A 1RXWA 4RY2A 1LA2A 3UK6A 3RTDA 2PXAA 3OTOB 3WDMA 5K3AA 4QEKA 2HCTA 3F2VA 1GT6A 1DFGA 5B1YA 1JDBC 3EPRA 1CUIA 1P9LA 5HJEA 1HE4A 1ZISA 2G0AA 4NU0A 1YBHA 4HB0A 3WJ2A 4MP6A 2VH2A 4ZT6A 5JS7A 2E0IA 2VK8A 1OW3B 3A4IA 3EIWA 1CRLA 1WXFA 1FVFA 3NTOA 3WTCA 5CBKA 4IHKA 4RTKA 4BGVA 1WQ1R 3P1JA 2EP7A 4FHZA 2H7VA 3A0RB 2FWIA 2TMYA 4YAGA 3AM3A 3OJ0A 3R5FA 4H3VA 4DRYA 5ARDA 2A4KA 5AH0A 4RTQA 5HZKA 1ZAYA 2CE2X 2E2WA 4YCNA 2PLRA 4NDZA 2HA6A 2QTHA 1V4BA 5HTKA 1WSDA 4Y2JA 4I4CA 2DBYA 4R2WA 1ND6A 4FOOA 3VU9B 2O05A 1T6XA 2BDTA 4MTLA 3VPXA 4F8YA 2XMRA 1XMXA 1W19A 3KVOA 3OIWA 5I7AA 1CUEA 1H69A 2QTFA 3LJKA 3NRCA 1P1FA 3QBVA 3UHFA 3SBEA 3UK0A 2NYRA 4EVIA 2RHLA 3NV9A 4Q1CA 1SIWA 1E9VA 2GR9A 2VHEA 4OU5A 3R7WA 3NDPA 3SC2A 5F1YA 1NUPA 2YXDA 3AUYA 5ALQA 1O1YA 4JQYA 3AKYA 1N34B 2A0XA 4R1SA 1C1DA 4I36A 2CYBA 2OD7A 1R3DA 3MW8A 4C4ZA 1KIAA 1XLWA 2R62A 4UNNA 1KI3A 3L9XA 3M5PA 1O94A 2D2EA 1X42A 3AKDA 1VCOA 1E8NA 3EVAA 2D13A 4G8DA 2OAQ1 4KPFC 4PR3A 2BFBA 3OQNA 1IBLB 3C24A 2J3LA 1RJ9B 3PXUA 4RH1A 4BVFA 3VZCA 2DKFA 3PZBA 1ZZGA 3WYDA 1NLUA 1T6YA 2V59A 3V9AA 5I8ZA 3VZDA 3NDJA 4MZXA 4QYIA 4WOKA 4GPTA 2X8WA 2R1ZA 4MWDA 3WGMA 1Z56C 4CDGA 1PLLA 4F8JA 1H1LB 2RBEA 1AZTA 4QSMA 5D00A 2ZJOA 3E70C 5FD8A 5LXTF 4DABA 3PGXA 1Z12A 2F90A 5BPFA 1G3QA 2EBHX 1PJ3A 4NHOA 1FFBA 2BFDB 1FIUA 5AVRA 1MZPA 1M83A 1LWOA 2P91A 3DMHA 1YWGO 3QVXA 2O4UX 5IKOA 4FW9A 4FLMA 3E82A 3KWLA 3TQRA 2HCBA 5C7OO 1SFRA 4O4LB 3DCNA 2FDRA 3OC6A 5I4KA 3NATA 1VI5A 1MQ8B 3PNBA 1NOJA 4P5PA 1H05A 1N1EA 2HSGA 2CV0A 4TTIA 5I3ZA 3H75A 1G9TA 2JFZA 2ZOSA 5IAEA 2JK0A 4TUYF 3B12A 3IURA 3OZEA 1DOHA 1VPEA 1YR6A 4TGLA 5AK3A 2QN7A 3OT1B 2QL6A 1P1JA 3ISJA 3IDZA 1HUQA 1TC1A 5LLTA 2W5UA 4FHFA 1R4MA 2RHRA 5TVKA 2X3FA 1RCUA 4ZARA 4GGMX 1Q0PA 4EEXA 1N2EA 2ZYHA 1PVVA 1GGEA 2C2MA 2HLHA 2ZIXB 3GLIE 1RXVA 1IIBA 1NMZA 4PPFA 4ZYTA 4K6HA 2FMIA 1X0VA 3N0RA 5J1TB 3VA7A 1RD4A 3I5AA 4L85A 3PGA1 1S3SA 3DTNA 2OO7A 2YCLA 2ZFUA 3FFBA 3QLEA 5DE3A 2JJ8A 5C4MA 2YJ4A 5FTMA 4ND4A 2KM1A 3W2FA 1EJ0A 5DB4A 4OQ4A 4X20B 4N54A 4BP1A 1QRRA 2BHTA 3N9IA 3R0ZA 1GNRA 3HHEA 2X5NA 1SCJA 5LOVB 3DD1A 5IARA 3LM8A 1S1MA 3LUBA 1Q1AA 3KYIB 1U8ZA 3ZZMA 2H48A 2QZSA 4Q1DA 1ST3A 5BV8A 4P34A 1TQHA 2GBFA 2WKRA 3CZQA 3MRTA 3TTYA 2FFQA 1YVUA 4TWJA 2RGEA 4ZTZB 4CFSA 3WLSA 1U99A 2O3SA 3KBOA 1N6LA 1EVEA 1OF1A 2OGTA 1ZMOA 1SVIA 4PANA 3EWAA 3L4KA 5U9CA 3HXQA 3I8SA 4V3CA 1W49A 1NY6A 1C8LA