4YFVA

X-ray structure of the 4-n-formyltransferase viof from providencia alcalifaciens o30
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
244
structure length
244
Chain Sequence
MKKILVISDNYQLVSYIKNLYLSNEEWSKELFIDYSYSSINRNPQSLIELGMTEIDIKNKNLNELNDYHLIISAHCKQIFPAHIVNNKLCINIHPGLNPYNRGWFPQVFSILNKKPIGATIHKMDSEVDHGEIYCQEEVSILSHETSIDIYNKVIELEKKLIKNNLLKIINNELQPKLPSQEGNYNSIQDFNKLCKLNLEDNGSLREHIDLLRALTHGDFKNAYFYDENNTKVFVKIELSLSQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular structure of an N-formyltransferase from Providencia alcalifaciens O30.
pubmed doi rcsb
source organism Providencia alcalifaciens
molecule tags Transferase
molecule keywords VioF
total genus 82
structure length 244
sequence length 244
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18216 N_formyltrans_C N-formyltransferase dimerization C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 4yfvA01
2FMTA 4YFYA 4YFVA 4QPCA 1ZGHA 4TS4A 3Q0IA 2GARA 3LOUA 4ZYUA 1ZLYA 4QPDA 3OBIA 3DCJA 1GRCA 1GARA 4ZYZA 5J9FA 3TQQA 4DS3A 2YWRA 1RBMA 4ZZ2A 1CDEA 4R8VA 4ZZ0A 1C2TA 4TTSA 4IQFA 4ZYTA 3KCQA 1NJSA 1YRWA 4Q12A 2CFIA 5J63A 4ZYWA 4ZYYA 3P9XA 1RBYA 3AUFA 4ZZ1A 4S1NA 4ZYXA 2BLNA 3DA8A 1FMTA 3GARA 3AV3A 1CDDA 4PZUA 4NV1A 1MENA 3O1LA 1RBQA 3NRBA 5CJJA 4EW3A 3TQRA 1S3IA 1JKXA 3N0VA 3W7BA 4EW2A 1MEJA 1MEOA 1RBZA 3R8XA 2BW0A 1C3EA 1RC0A 4EW1A 4ZYVA 4ZZ3A 1RC1A 1ZLXA 4TT8A
chains in the Genus database with same CATH superfamily
2PCJA 1Y9JA 1VE5A 2XIQA 1Z6GA 4C89A 1GP2A 4UBKA 1JJIA 1K1EA 5JAQA 3BWYA 1IZ8A 1UBMS 2VKQA 3ZWQA 5ELLA 4FNMA 1OLXB 3BH7A 1EWVA 2OZKA 3L7CA 3ISVA 4JYCA 1P17A 4LDAA 4P86A 5E0KB 1QHSA 2BGUA 1R0LA 2AMYA 1ISFA 1LC0A 4GC5A 1KRXA 1ZUIA 4NV3A 2AC2A 2Q1SA 5MF6A 2VK8A 2NV0A 3PQFA 4LAFA 2P3SA 2OY0A 3LDAA 3LLVA 5BR1A 2C4NA 2J3LA 3TLEA 3JQGA 5ESWA 2R6DA 1FP4B 1N8SA 1T5TA 1DLJA 2B8EA 1V3VA 2EZ8A 4MTLA 1HLPA 3Q0EA 1C5KA 4EY4A 1ZCFA 2AT1A 1XYGA 2WWWA 3FPJA 1N0WA 3W5VA 3Q6MA 1UC8A 1REQB 2EQ5A 3DS8A 2W6CX 1E3SA 4XWGA 1VKZA 1X3LA 3R6LA 3V48A 4QQFA 5ECYA 2R7NA 1DOHA 3PSAA 2NTYC 1JA0A 4G2TA 4LYGA 4BX3A 4GI5A 2WY2D 5LXTA 4YEDA 2P9QA 4CI0B 3T3HA 1R0BA 2WNSA 3VMMA 2OENG 4MP8A 3EX7C 1OX5A 3VPFA 3SKYA 2IODA 3KQWA 1ID8A 4BJ5A 1QHXA 1ZONA 3CG4A 3E84A 4CLRA 3QMMA 4INPA 2CSUA 1Q6YA 4F3CA 3MTBA 1VRVA 5H16A 1NJ6A 4AG3A 3GMIA 3B1JA 2XEDA 4MP6A 2WDPA 1M1UA 4Z8YA 3VDMA 2W70A 4ZO8A 1P1IA 4E14A 4M7PA 1H93A 4YRNA 1WG8A 3KKMA 4WAUA 3T5AA 1PWZA 4E3ZA 1DAEA 1J0EA 4AKSA 1IJBA 2F64A 2W6PA 1EUZA 3LQ2A 2C4KA 4ARBA 5CLFA 1GFWA 1YWGO 1GUBA 2JZOA 5KNCA 3O8OB 5FPPA 1I24A 5LR6A 1RVV1 3N58A 5AIBA 3R9KA 4V0NA 4DANA 1IC6A 3ROEA 3L5KA 1VL1A 2R87A 3RJ9A 5DIFA 3ZK7A 1R00A 2JIDA 1IMJA 821PA 1KYVA 4IDQA 3KYCA 1Z13A 2PEZA 2AXPA 1MO3A 3DZFA 3B8EA 1IVNA 4JXXA 2PUDA 3AUKA 2VAXA 1Z0UA 2JGAA 4PGGA 2OL4A 2ZIWB 3F5FA 1Y6RA 1DCFA 1TFUA 2WJYA 3KOMA 1PYDA 4N5IX 2IUFA 3EDMA 4X1KA 2GK4A 3V1LA 1R74A 4WBNA 1FUIA 3MJVA 2QS9A 4N40A 2R66A 1N8NA 3F46A 3KKKA 4NECA 3E4CA 4LVNA 2PMDA 5CNMA 3U80A 4CVNA 4MWDA 2ECOA 1U6JA 2ONCA 2Q2NA 3DL2A 3HB7A 1J06A 4R9SA 4DC0A 3LCVB 5KPDA 3DKRA 3VM6A 3LLCA 4ZI2A 4YACA 3O1LA 4HAUA 4YPOA 2QRHA 4EUSA 2EZTA 4DRYA 3E2PA 1C0EA 3M1YA 3PNPA 3ZE0B 2PX5A 4KOAA 5BUZA 1QIJA 4YRCA 2YFQA 3GIDA 3P26A 4Q9DA 1BYUA 1QRDA 3AKCA 3KB6A 2ZQZA 1W4RA 3L0PA 1LQUA 5ES3A 1GTG1 1CZNA 4XQ9A 1GU0A 4D0NA 2QMHA 3IKJA 1ZVMA 4B46A 3DM9B 1JHRA 4U7GA 4WASA 1JP7A 3WYDA 4P2GA 1AQNA 3OP4A 4MQEA 1P5RA 2CNDA 4NMWA 1AUOA 2EBWA 1L7MA 4ZPJA 5J2TF 2BOVA 1OT3A 1NSYA 2OHJA 3JWJA 3LT1A 4OUDA 1V8PA 1A9TA 1QXSA 2UZ0A 3CX4A 1NQUA 2V4MA 3OKCA 1W36B 4MGHA 2FEOA 3MSXA 4LOIA 2BTQA 4GEKA 5J5CA 5LB2A 4LYYA 3T94A 2G4VA 2C2OA 1VHJA 5KDLA 1XRSB 5A6SB 4JUBA 1S2NA 2XZPA 4A5SA 4E5KA 5K2OA 1VRWA 2GPNA 4F3TA 3V42A 3A6DA 4PRLA 4TWBA 3BICA 4FX2A 5HGJA 3SQDA 2GN4A 1X7WB 1I51A 3GCGA 4NFLA 1E7SA 2WAXA 4WLEA 1XNHA 5LBTA 1M1XB 3ZNPA 2J32A 3TGLA 3FVWA 5CM2Z 2EFCB 1WB4A 3D6UA 2HJVA 5B37A 1T2DA 2VSQA 2KE5A 2FUEA 3DMGA 2EHJA 5KMGB 2GBPA 10MHA 4IIJA 3GG2A 4ND4A 1B14A 1V8DA 1SKYE 4G89A 1TIPA 1TM7E 3D7RA 3AHCA 4QTUB 4UUBA 3S2GA 2JFNA 2XUJA 3ACDA 2Q5IA 2ZAMA 3N0WA 2XT6A 4Z9FA 4K88A 5T41A 1IOVA 2ZM6B 1T8UA 1VPDA 3GGJA 3EQ9A 1KEUA 1JYFA 1U2DC 5BOSB 4BO1A 4MNTA 4DSUA 4YUAA 4PAWA 2VPPA 4LJRA 1ZH6A 5IYZA 4H3KB 2R47A 1CY4A 2NIPA 1BJRE 4KWTA 1ZIOA 4UMFA 3UQZA 2C8KA 2CLCX 3CVYA 4LWQA 4XDYA 4V1CI 3H2YA 4QGSA 1EXDA 2DQKA 1MAUA 4WJKB 5TS3A 5JFGA 4IWYA 3II6X 1X94A 3PFHA 4MP3A 1PGJA 3K70D 4PM4A 1JFTA 2ZE5A 3OZDA 2FRVA 1XEWX 3AK4A 3NATA 3URKA 5ILOA 3BTUA 1M5TA 3UW3A 1F0KA 3NXKA 3H9EO 1TAHA 3GPLA 3V1YA 5IK2A 4C6TA 3QKRA 1EP1B 2H0AA 4IZIA 4AX8A 4ZOLA 4Z9XA 3SGLA 2AJTA 2B4RO 3KSBC 3EQ8A 1XOIA 2I34A 5FWDA 4LC0A 4ECEA 2QOEA 3IOCA 3OX4A 4BXOA 2B8NA 2CYCA 3MIZA 4KN8A 3IUBA 2TSYB 5FA6A 3KBBA 1ZJWA 1NI5A 3IJRA 3W5BA 3FSRA 1OH7A 3NT5A 2XZDA 3WYFA 3ZDQA 1JPNA 1JQKA 2L82A 3TECE 4TYQA 1N0VC 5ISMA 2EBUA 1JWBB 3CH7A 5EZYB 3H1FA 4GQAA 1VPVA 4J0CA 2NU8B 2RIPA 5AW5A 4TQGA 4F6RB 1A27A 4K28A 2DQ4A 2HSWA 4P0PB 1TZBA 1DG3A 3AL3A 3PVZA 2Q3JA 1GG2A 4TTPA 2OR3A 5AW9A 2FU5C 4G85A 1O6CA 3W7AA 3WNCA 2D2VA 1JECA 2EIHA 1E9EA 3ML1A 4Y9RA 3LBAA 3NB0A 4L72A 3W2EA 4BAZA 4Z86A 3BN3A 3ESXA 2HIHA 1R7RA 3LXRA 1QSGA 2EX1A 3JQFA 3VHLB 1D4OA 2GD6A 3EIOA 3EXHC 3L6CA 3GEGA 5CBPA 1ZHOA 1LB1B 3OECA 3WLMA 1CJVC 4CIDA 4R9NA 4LNHA 1YFKA 4HB4A 1KEPA 2CL0X 4NFHA 4Y2HA 1O58A 4YAEA 1DRKA 1GKUB 3E9ZA 2QIPA 2R84A 2ZEJA 3T6KA 2CK3A 3ZI4A 4CHGA 1PFWA 2QTNA 1XZGA 1A1VA 3GXOA 1XZIA 5JH7A 1UXJA 3E7XA 3HYNA 2JIZD 2O06A 2CCJA 2LDXA 4FJ1A 4TN1A 4BNDB 5J4KA 1YJXA 4EBBA 4A15A 2C98A 1X19A 2BH9A 3RYCA 2YUIA 2JFXA 2JLQA 1DKLA 2GETA 1XMOB 1OQAA 4RK5A 3IAHA 3NBUA 3TLGA 1P0CA 1XQWA 1EP2B 4B3BA 1DPGA 3KKLA 1YDWA 4Q4DA 3O4JA 1YTUA 1CEQA 1NHWA 3KR1A 1TJPB 1C3XA 2RGCA 2HTFA 2V4UA 4ZOEA 3LA6A 5K0EA 4FBLA 3TCKA 1F12A 4LXYA 1SUBA 3GI1A 4Y6RA 3FB1A 2OKGA 5M29A 2AI1A 2BFPA 4PXAA 4MVJF 4S1PA 4M1EA 3LFTA 3FDIA 1BX1A 1TYDE 4TYMA 1QORA 2A4MA 1Q20A 3KZVA 2ZJ0A 1DKOA 5I7SA 4DGSA 4OQXA 3FDJA 2GKGA 5IJAA 2GNAA 2V96A 1XALA 1CJMA 3VJKA 4O63O 4X8OA 2NTVA 2ZSBA 3D4OA 3N3AC 4FE7A 1TUIA 1XSEA 2X9NA 3RS4A 2PUJA 2YXNA 1QFYA 5TPZD 3U3OA 4DLZA 1QPBA 2SNIE 1NUTA 2ZUBA 2O23A 3C7CB 3V6LA 2J9FA 1UUFA 4IZHA 4L6IA 1I36A 1M8KA 4IX9A 4L9WA 4P82A 4Q18A 3UYLA 4JJZA 1CZOA 4EFLA 3KEQA 2AMFA 2IYOA 2NP7A 3Q85A 1N6IA 3BA1A 2BI7A 3V8RA 1AMUA 5ULLA 3GMSA 2C5LA 2FZ5A 4CE6A 3WK8A 3CURA 1YQEA 4F84A 1V9CA 2W2LD 4I1VA 4A0RA 2NP6A 3UN1A 2CZQA 5AVOA 5ALDA 4M1TA 4HWOA 4XFDA 3FR7A 4PIVA 2RHLA 5TX7A 1A96A 1IHUA 1LLFA 1TKRA 1UBNA 2BM1A 2WZBA 4OB6A 4D8VA 2I7CA 1FP2A 1GO2A 2HB6A 1G5FA 2IBMA 3BC1A 3L77A 4G5QA 4H7JA 1NVGA 3DL7A 3PHLA 1GUZA 4IS3A 4W5JA 2HU5A 3ZZ1A 3FUTA 4WRRA 2BFCA 2CXPA 2J3DA 5FOWA 3OC6A 4CGYA 3E9YA 5AI6A 1DEXA 1G60A 4MQ4A 5IM4F 1UZMA 2P0AA 5LQUA 2I3AA 1MMFB 4XXHA 3GBVA 2WPDA 3KB1A 4J2OA 4JP2A 4XCXA 5L7TA 3UMBA 3EZGA 3ZZMA 1YS7A 1KJ8A 2B1RA 2V6IA 3IE2A 4EENA 1PWEA 3N87A 3IP1A 1KKMA 1L5YA 2NXCA 2EARA 3DMRA 4NS1A 3CRVA 3C3JA 2NXNA 2DWCA 4WK6A 1NVFA 3ZCXA 3HH8A 3RYFA 1P5HA 2GLXA 4YP6A 2BAGA 2UZ1A 1IK4A 1TAUA 2GM3A 1SXQA 4DQVA 2EBHX 1RM5A 2O2ZA 3IAM6 4B76A 5DM70 1F38A 3RRBA 2O3RA 3IQIX 2XQJA 3H42B 3H8WA 3VRHA 4U8GA 1O96B 1FX0A 2Z09A 3NLLA 2DPHA 3ZW8A 4BQOA 1A9ZA 4FFBB 3FVRA 3VC3A 3QVGA 3KPYA 2V7BA 2OQIA 3K7EA 3AUUA 4QEZA 4F04A 4YMHA 1X8XA 1Z2AA 1SC4A 1IEWA 2WKQA 5BSHA 3WL7A 3PPIA 1RLJA 5BOVA 1QVAA 1SXJD 3AM4A 1PV2A 1R2QA 1KWKA 4JLJA 1E1KA 4M1SA 1BW9A 2OO3A 4DIKA 4QNRA 4K0KB 5DI3B 3RT1A 3N2LA 4UVGA 5L3SB 5J2TA 3S40A 3O8NA 4GMKA 5LB4A 4JLSA 2WSLA 3IRVA 5HE9A 4HI0E 3EG5A 4DGQA 3DMDA 2FN9A 4G0ZA 4GLBA 5HMMA 3SS7X 3AUTA 4OXQA 4H1HA 3TFOA 4CKCB 5BQPA 3ONDA 3EGCA 3HCDA 4J7XA 1D2MA 4Q1AA 3CVOA 3IDQA 1DKUA 4AK9A 2O1SA 4WBSA 3DYBA 4LOHA 1A9YA 4N8DA 1SCJA 3EFEA 4EHBA 4F3KA 2BR5A 4G37A 3TPCA 4E13A 1Z4KA 3P52A 1P2GA 5FORA 1TA9A 2BFEB 4L15A 4KAXA 3TI7A 3VKUA 2XUHA 2F9FA 3NS7A 5DZSA 2B5OA 2Y1WA 5LBUA 4DHEA 2H2AA 3IEVA 4NCKA 6ADHA 3WRYA 2I91A 2XRZA 5IAKA 2AFHB 4KKXB 1MIOA 2VAMA 3QEMA 4RMJA 2ZJ8A 4DR2B 2XMQA 1WZUA 3H9CA 4NAVA 2W8BB 2BV3A 2IA5A 1P19A 4WCFA 2C3YA 1UADA 2XMCA 3FNGA 5HCNA 3WGZA 5CB4B 4AI6A 2NU9B 3UXMA 2Q46A 4RCVA 4BMVA 2H7CA 3MQFA 4KO1S 3OZUA 1V1RB 2O14A 2EJVA 5CHYA 3X1WA 1E20A 5JZ9A 1HDGO 3VR5D 3AKDA 5AW8A 4DSZA 3HA3A 1CUDA 1GPLA 2D1TA 1MEEA 2XYRA 2OHOA 2V9CA 2XYPA 4KLZA 1T0PA 1UJ6A 2W58A 5E6SA 5G2OA 1PI3A 2HIGA 4BIIA 1SIBE 4OHPA 4X00A 3I52A 4DV0B 3TOCA 2GMWA 4KQEA 4ZHQB 3C8DA 2Z4SA 4JP1A 3VR4A 4MVJG 5K8CA 5BY2A 3FGNA 1DU4A 4XWYA 3V8VA 4IY1A 3T7CA 3SVTA 1J1ZA 4QG7A 3NM6B 1J0XO 1U9CA 1J2TA 2AFRA 4QDUA 3VU0A 1DAOA 2FWIA 2Y1FA 3QE4A 4ONEA 4HN4B 3HA5A 4IF4A 4TV8F 4WI1A 3AYXB 1Z7EA 1TDJA 3R7FA 3HBNA 4KMOA 3GHYA 3AV3A 4OYRA 4F9FA 2B35A 3CG0A 2LXNA 2K5UA 3PF9A 5E2BA 2PKCA 2XMBA 5AKJA 4CKZA 4PBTA 1GYQA 2G82A 3M4ZA 4F06A 2V3VA 2C4WA 5HK8A 2ZUVA 3VR6H 4H4DA 3KXIA 2FF7A 3THOA 2JHFA 1HEUA 4IAOA 2LVBA 3W8FA 3U16A 1X74A 2VBFA 5LL6P 1IUOA 1QV6A 4D6YA 2OM2A 2FRDA 5K20A 2VBCA 1XRRA 4FBGA 5IBPA 1UBCA 4QUHA 3OT5A 3HN6A 2JA1A 1RWBA 3AJAA 3CR3C 1M2JA 1T35A 4IHJB 4R83A 2PKEA 1NJFA 1RLTA 3WBFA 3KVOA 3TBKA 4K6CA 4M9CA 2VZEA 3AQIA 3H11A 3ROKA 1K7EB 1BMTA 3DMTA 2A5JA 2FW9A 4MW2A 4O08A 4RD6A 1VHTA 2F1KA 2ECQA 4PX5A 4EZEA 3WMEA 4RVOA 2L2QA 3D3KA 5ICCA 3W5AA 3GPDG 3UYKA 1FJ2A 3HUFA 4O4LF 4A36A 3F4LA 3RS7A 3ST7A 5HJEA 3JWPA 1DKQA 3G2LA 4LJ9A 2GXAA 1I6WA 3WTCA 1VKRA 4PYIA 1NPDA 3TW8A 5CDFE 1N2OA 2RGWA 3CPJB 3DBVO 5ED4A 5BWNA 4HH4A 3A11A 1QO7A 3IP8A 3P4XA 4JSTA 4LHYA 4UOQA 3VDNB 3WIOA 4CUJA 2WJ6A 4UJ3A 1GAQA 5F76A 3I1IA 3S3TA 2JARA 4AKIA 2NO0A 1FUKA 2CVHA 3DEYX 2MMCA 2Z2YA 2NUPB 4IV5A 3M83A 4QRDA 4N0QA 3WLLA 5I9TA 4B6EA 1ISGA 3EQ7A 1D5WA 4KE6A 1EXMA 4EP1A 2H3EA 1T5OA 2EP8A 3OIGA 2O0MA 3OJEA 5HKBA 4J0IA 4QC2A 4DDHA 2R1VB 4F97A 4DDVA 8ABPA 3AO0B 4WJZA 4JI2B 3IPAA 1C3LA 3K30A 1BHJA 2H7XA 1ZZEA 1QFJA 3KOUA 2D54A 4YREA 3HFGA 2C0QA 3OTHA 5JIBA 4P84A 1GAJA 3EPJA 3M89A 4PQFA 5HIMA 2F4VB 1BSVA 3G2PA 1IY1A 4FZ3A 3JWIA 1NXVA 1SXIA 2X42A 3CA8A 4P8RA 4V2IA 1AC5A 5KNBD 5FKJA 4RQAA 2XHEA 4WLUA 4JCCA 1UK8A 3ITNA 3PDJA 3RWMB 4BVLA 5F23A 3ZHOA 3C8MA 2O8DB 1CKEA 3H4TA 3RVJA 4IJQA 3E53A 6AT1A 1NASA 3LJKA 2GEKA 1XD2A 4RJIA 1U65A 1KOFA 3OPYI 3PGA1 4L27A 4QU9A 5A5VA 1FRQA 1EDOA 2XNDD 4HQRA 1RAHA 3T1TA 3HUDA 4JH0A 1PFYA 2XDQB 1OB5A 2ALJA 1R0SA 2A59A 2YN2A 1G21A 1X9GA 1YA6A 1S3GA 3FLMA 1FTQA 1M0SA 3M6MD 3N3BC 3OD5A 3OWHA 4M54A 521PA 4C21A 2AF4C 1KEWA 3C3AA 1ST3A 1MUUA 2QD1A 1YQGA 2D1FA 3LIPA 5JEDA 4KUGA 3AFOA 1SQ0A 2O6HA 2OK7A 3PKIA 5F51A 1T3TA 4PX9A 1BD3A 3TI9A 1N2ZA 3DQQA 3RQSA 3NGMA 2QQ0A 5BN3A 5JCXA 2Q6KA 2FWNA 3Q3HA 3VZPA 4RMGA 4TKLA 5J2UF 1MXFA 1XFAA 3KL2A 1KVSA 2QQFA 2LR0A 1GCOA 1NIPA 3H1TA 4H6WA 3BHJA 4HADA 4LY6A 4NYMR 3X1DA 4B8WA 3RF6A 4C5BA 4CMIB 1USWA 4COKA 3DFZA 4ARVA 1A5ZA 2IE8A 3EXG1 3I42A 3P1JA 1TT5B 4LPKA 4OJYA 2OYCA 3DXYA 2GRUA 1HE5A 3EIWA 3RAPR 3TTXA 2I2BA 2LUOA 4Y6SA 4FYHA 5H81A 1E1RA 5I51A 2CXXA 4PNEA 4JI3B 3LHIA 5CVTA 1XZ8A 3KOYA 2AX3A 2DKOA 4YQZA 1GR1A 2NTNA 3DFUA 5EC8A 2IHVA 3NHAA 4IDOA 5IH3A 2D74A 3EEYA 3TL3A 1WE2A 3K9FC 3AJ8A 4I50A 1KYYA 5CTAA 3FBTA 2WA2A 3PL5A 5ER6A 3WQQA 3ECCA 1Z28A 1TEZA 4N65A 4B74A 3TCNA 5LJIA 2X4IA 1CNFA 2ZIXB 1IFXA 3JZAA 3VI4B 1GZHB 3E7FA 1ENYA 3LX4A 3DEAA 3A6EA 4H6PA 5JC8A 4E15A 4GIBA 4EW1A 4IIEA 3ZHTA 1AOXA 2DBVO 1JWAB 3CNQS 5BQ5A 3TSOA 3UGTA 3AV0B 3BK1A 3RUAA 1VG8A 1G7RA 1KI9A 1LRKA 2I3BA 2JD0A 3OKAA 3RBZA 4Y9SA 1PDVA 2WIAA 4B81A 5E1BA 3TIGA 1AH2A 3MUOA 2Z2KA 3MAAC 1ZICA 3AHJA 3ORQA 4YNBA 3PQ7A 4QPNA 2O6LA 1Z4NA 3LV8A 1YQ9A 3QOXA 2YW9A 1FMTA 1V37A 4OQFA 3UA3A 2IL1A 4LTMA 3VI3B 4AY5A 5LDHA 2ZS9A 3TBHA 1DRVA 1QO9A 1V45E 2ZVDA 3UG6A 3L0ZA 4CEHB 4YRTA 3SM3A 2DR2A 5IK2D 2R7MA 4NICA 2PFKA 3DBHB 4HDOB 2R8XA 2C1EA 3HUUA 4EGSA 2FPSA 2I6FA 2NO9A 2JGMA 4HQKA 3DULA 3ZWMA 3WL4A 2CLKB 3KKEA 2Y2UA 3ZWBA 3LK7A 3MWJA 1VM6A 1TK2A 2EQBA 2FV8A 2WTBA 4J2HA 4JJ6A 5EJ4A 3OTQA 3O8QB 4AY4A 1Y80A 2SKCA 3IBFA 2YMPA 5ICSA 5KTPA 4K26A 2XWPA 3S0JA 5MFPA 3STXA 1LW7A 3MWFA 5DO9A 4AB1A 3KIPA 5K8IA 1I6LA 1OLSB 2DUNA 3O9ZA 5CLGA 4B3DA 4UAGA 5CBKA 2JIQA 1RC8A 5KJ1A 5JG7A 2CN1A 4CMEC 2W4IA 2IZ7A 1DBRA 2X0RA 5PGMA 4B47A 3O03A 2CY0A 3I0MA 1RHRA 4MS3A 4EPVA 3EN0A 4C7VA 2COUA 1VJ0A 5KVVA 1TTPB 2DPXA 4FMPA 4K6OA 1OOEA 3RVLA 4OYYA 1X77A 1U5BA 2J0SA 2OXEA 2HU8A 4PICA 1J07A 1KP2A 3ZVMA 4FCWA 3I61A 2O8BA 4QDJA 2FE4A 3IVRA 3VC2A 3M1AA 5CNIA 4YRKA 1U5AA 3T41A 1SK8A 1SC9A 2ODBA 2BP7B 1EWRA 1BN6A 4IWNA 5CAEB 4BEWA 4EATA 2ZSAA 4K1LA 4IRUB 4UHKA 4MVJE 4KO4S 3ZHVA 4P08A 3TB6A 5ESRA 3QOFA 4F5YA 3C97A 3FOCA 3U6BA 4DCTA 3NUGA 2KLBA 1JBKA 1Y1LA 1JHOA 3BXXA 3RSGA 3GHHA 4YJ3A 4BB6A 4EMUA 1FVHA 2DEUA 1NLYA 1W4AA 2OHVA 4PPQA 3SR3A 3T7IA 2IP1A 5KOHA 5MGNA 1LDYA 1RE1A 2DQYA 4LE0A 1G55A 3DR5A 4HDMB 4OOFA 3O74A 3S2YA 2FQWA 4PPFA 4KH1A 2JFQA 3KLBA 4PRZA 1WAMA 1TCCA 2DSNA 2XNDA 1QNLA 3OMXA 5DWVA 4YX9A 8AT1A 5FCDA 3E9EA 1RRKA 4KWEA 5C1OA 4OSEA 2AJLI 4S1NA 3KFLA 1XVTA 3SZRA 4K8RB 4TL9A 4GBJA 3PI6A 2K7FA 3MGCA 2IOYA 1WY5A 1DC4A 1AQUA 2Y93A 1QGAA 3AR7A 4CV0A 5L51A 2XW6A 1I4DD 2JFGA 5FAKA 2DHRA 2FSSA 1XQVA 2Q8NA 1OZAA 1GA1A 2JH8A 1J7JA 3FMGA 4QHTA 1XWWA 1LX7A 4QFBA 1RI4A 1UPCA 3WWEA 3NDPA 2RHWA 5I9MA 1AXGA 4OAQA 1KJWA 1LSSA 1N2HA 1PJ3A 2DX7A 4O4LA 4HYQA 1GNSA 3EGXA 3A1WA 3K35A 3ETDA 4NBSA 4EKGA 4JC0A 2HCJB 4F71A 4LRYA 3EZYA 4ARCA 5JJIA 1W30A 1B2RA 1YVEI 3RSOA 4MGZR 2FCRA 1EQ2A 2QMUA 5AKKA 4RKYA 3ZNOA 5BWLA 4F38A 3WQSB 4XD2A 1W9HA 3O73A 4JT2A 1BWSA 1D5CA 1QQ6A 2OG2A 5ECGC 4ZT4A 1T5IA 4O0LA 2GDJA 1NQOA 2DOKA 1W59A 2B0CA 4GICA 3V1UA 1B23P 3O0DA 1DSSG 3AEUB 1M72A 3JZDA 5ALUA 3Q1LA 2RKOA 3U17A 3MN1A 5GOTA 3JQDA 4N47A 4PFKA 1FDVA 2C59A 3VV2A 1CRPA 3CIOA 1XA4A 1E59A 1PUXA 1L1RA 1ZJYA 1WRBA 4URYR 2QQ5A 3CF6R 3SDZA 3H9UA 4YROA 5IJXA 2O7VA 3NTOA 1AK2A 2ZI9A 4L76A 3JAWA 2R2AA 1VSUA 2N46A 2J09A 4HRXA 2V7QD 3IHWA 2PGIA 3GAAA 1TCBA 2PSEA 1KMHB 1SOUA 4RWEA 4MQ5A 1PR2A 4AYXA 1TZCA 3T4EA 3Q2OA 2PPLA 1CQJA 3ER6A 4LN1A 5L45A 3B60A 3ZJTA 1I01A 3KE8A 4R8MA 1XI2A 1PGNA 1Q0ZA 1YL6A 2C0PA 2PSFA 4GBGA 4MVJI 4YAFA 4KQ2A 4A6DA 3EYAA 3DAPA 1L5ZA 4I81A 1U8FO 1KI1A 1BX0A 3C6KA 3RT7A 3ZE8A 4D4IA 1O1YA 1QKJA 3LFUA 3OZEA 1NWCA 2ID4A 2FW1A 3COSA 2IYSA 3L84A 1WX1A 2BWJA 4FMDF 3O84A 4LY3A 4EL5A 4DR1B 3NANA 3CZMA 4FJ2A 4RPHA 1KSFX 1CUBA 3QA3E 3DNPA 3L7MA 1OW3B 5BW4A 1DBWA 1RPZA 1UK7A 1VSVA 4LYDA 2UAGA 3DC7A 4HAOA 1ECBA 4KE9A 4YMWA 2JLXA 4CT5A 2BCGY 3OQJA 4HDNB 2GN2A 4EPXA 2QYTA 3AOGA 4O29A 1QE5A 3HY4A 3QKSA 4OEHA 1HDEA 4RADA 2J46A 3KD2A 3ICWA 1VPWA 3H9QA 1FVFA 2FWAA 3KTDA 4EMSA 2VHQA 5SV2A 4IO0A 1A1SA 5TQ2B 4BE4A 3K0KA 4B9AA 4RESA 1G5QA 2Z30A 4DVGA 3RK4A 1BO6A 1U0GA 4ENQA 1ZK0A 1P7VA 4BGEA 2YMMA 2Q4TA 4IIXA 3UMCA 1QGZA 4ZYZA 1DQZA 3RIEA 5EMMA 2PT7A 1UOQA 1GNTA 3GEPA 3K0BA 1YDGA 5GV7A 5HFJA 2XB4A 4KIGA 1B8VA 4GX0A 4YI3A 2UZ3A 1B16A 3MHPA 3THRA 3HNOA 3DGFC 2W42A 1LV7A 2HF8A 4G36A 1RTTA 4KAJA 5JAHA 1SHTX 2YY5A 3KAQA 3UK2A 4CF6A 2Z8XA 1N6NA 3ZHYA 4IEEA 4NMLA 1QIGA 1VP3A 4C7OB 5L9AA 3K1AB 1P5ZB 2ZI3A 1K9VF 3HKEB 2VZ0A 5HF6A 5T4BA 1YDFA 1H9AA 1XD8A 3OHSX 2I1WA 4E88A 5K4HA 2UUAB 1QU2A 2BFBB 2W2MA 3QOWA 1B26A 1YH3A 5AM5A 3QXHA 3VSAA 4BUZA 5CLJA 1I3NA 1D6MA 1MPTA 3ND7A 1XQ1A 1K7FB 3CYFA 1KQFA 3K2QA 1L5SA 2PGOA 4AMZA 3RFTA 1Z06A 3U9SA 3FGOA 2GSWA 1P5JA 2EWWA 4GRIA 2G07A 3R9XA 3BB4A 3VKWA 4Y3UA 2C7BA 1Z4QA 2R79A 5K1ZA 2DJ5A 3H7IA 4MX8A 4NEGA 2HLHA 1K4YA 2QRGA 3KDSE 4AQ7A 5H59A 2IEDA 1SUAA 5KUTA 5IXSA 1T4MA 4NENA 3R3ZA 1ZN9A 2HAEA 4C0WA 4UTVA 3WGIA 4NPHA 4B1FA 5TDHA 1YMQA 1RQGA 4V03A 5K3AA 3R5XA 4ILEA 1PNOA 3WGLA 3QK7A 3B3JA 5FOTA 4FC6A 3TTWA 3TKYA 1B8PA 2AXEA 1NA5A 1G7CA 2RGUA 4HF7A 3KL4A 1HTWA 1HQKA 3NCHA 3LVRE 4I9HA 4RKRA 5KSOA 1QP8A 3X1YA 3GLFA 2O59A 2NO4A 1AF4A 3QWBA 4P0TA 5DU2A 3ORYA 1RRGA 2BJVA 3CRMA 3EZ9A 2XDWA 1KQGA 4M8LA 3KKQA 3LO8A 1P1KA 3P9IA 2PSJA 4U2KA 3DWGA 3UK0A 4UQPA 4DRXB 3ZGZA 2IYEA 1T13A 1OAOA 2H52A 4G1CA 2BONA 4RKEA 4X1OA 3R7AA 2EKQA 3QLUC 1W94A 1XAGA 3PUZA 2H4JA 2WE7A 1L7PA 3M6UA 3R7SA 3H2BA 5HRCA 5LPNA 5H80A 2YRXA 1LTQA 1VLVA 1A4XA 1CR1A 1CQWA 1JYEA 1MG5A 1YIOA 2YFHA 4CIYA 2JLVA 2PL5A 3KKOA 1U6IA 4UEKA 1ECFA 2ZE7A 3JPWA 4UZSA 2IH5A 4GO1A 3FLBA 3MF4A 1IZ0A 1OWLA 1LKZA 2OZLB 3FFXA 1XMXA 4NCAA 1QH8A 3IJ5A 1ZOIA 4KFSA 4L8LA 4ESOA 4PC1A 1ZUNB 3N2NA 4MQMA 2WAAA 3B1VA 3QBTA 3JVUA 4RYLA 3NETA 2IW1A 3FWYA 5DBGA 1ZC3A 2O5VA 5JVDF 3CVVA 1EHIA 3ULKA 2ZREA 2W2LA 2BBOA 1KWGA 1GL3A 1T1IA 1JW9B 2ZS8A 5FUYA 5KKAA 5AM1A 2O52A 4BQPA 2ZYAA 1BDBA 1IY9A 2AOVA 2H0QA 4A5OA 1TA4A 3AUYA 3HWSA 3IAM1 1JHXA 1KYWA 2OBMA 5KYUA 2ZT7A 3F3YA 4IIYA 5GONA 5KU1A 2CFTA 3OKFA 2IP2A 4EKDA 5JJCA 2QEQA 4MUGA 1YULA 5IJ0A 3PNSA 1QP7A 3NHRA 5JJBA 5COAA 3THSA 1WF3A 2G5GX 4XGRA 5KYKA 2A0YA 3E9MA 2OD7A 5CDFA 1F9EA 1P29A 3QIAA 1AKEA 4YT2A 4X60A 5FF9A 4BRWA 4N7RA 1IU9A 1NN0A 3PEEA 5L3VA 2IZOA 3GYGA 2PT6A 3K6SA 3WBJA 2DZDA 2ZSDA 2IY9A 3CMMA 3HZOA 1QKIA 2JVIA 3R3WA 1NI3A 1NN1A 4NAUA 4D0SA 1WDTA 4IIUA 2IYVA 9ABPA 3R5SA 5SZJA 4TLEA 2ASVA 2P2SA 1XTVA 4G23A 1UPUA 4F7DA 2AMJA 4H59A 4O3MA 3BQMB 2JI6A 2PZMA 3VYWA 3Q3VA 3K70B 3JD2A 4L3OA 4N6GA 4R1UA 4QEKA 4I1PA 3RODA 2JANA 2BTEA 1G9XA 1QHHB 2HBQA 3ADPA 3B3FA 4Z4EA 2KM1A 2P68A 5B1HA 4O5AA 2Q4RA 1Q2XA 1D04A 4X61A 3RIHA 5GGYA 4NU6A 5JD3A 1M9NA 1AF7A 1JIVA 2QVZX 2RG1A 3G17A 4RJLA 3VOTA 5L53A 4P3KA 4B7AA 3V7UA 4GRAA 4G1VA 5AQ1A 3ACCA 5C32A 1DBQA 2G09A 2WM2A 3Q4GA 4JA2A 3V33A 1JUDA 1IVSA 4F2WA 4I5IA 4DAEA 1DIAA 2PUCA 4DV6B 4BZQA 2X8BA 2B37A 3A1FA 5D3KA 1WW3A 1SVKA 5DCYA 2VJCA 1R9JA 3T7JA 1XT6A 2QUIA 3HSYA 3UAXA 5CFLA 1U94A 3M82A 1L5MA 4NE2A 1BDJA 4BMZA 3TK1A 3KZMA 3LQQA 3ANTA 5JSZA 4U7DA 1ODFA 1YO6A 1BQ3A 4B6RA 4Q93A 5I7OA 1OLUB 1V25A 2WAOA 2Y6VA 4KOEC 2VNHA 4ERXA 2PUBA 4HQFA 5AKIA 3W2FA 4DMKA 1KR2A 2C00A 2PU7A 2QUHA 5BYAA 1JA1A 1L9KA 3VYRB 3GJ6A 3UH0A 4HGYA 4IQ0A 3TQOA 4BIMA 5HPYB 3V6MA 4AMBA 1W4BA 2VQ6A 1FTGA 5D7NA 3ADCA 2DYKA 3B1KA 3C0KA 3OFND 4JA0A 2YV1A 4CQLB 1NULA 2EYUA 3IQZA 4R1QA 3UWPA 5BN4A 2J7PA 3QU4A 3NC1C 5I5EA 5A9SA 5JSUA 4PC6A 3VV3A 4D26A 3UM9A 3TQCA 4UUQA 3D8RA 3BT7A 3SIXA 1GZUA 3R0ZA 1HY3A 1AGNA 1U4OA 4J9VA 1Z5UA 3ZWDA 2PS0A 4HDRB 2DUMA 1N3BA 1YFJA 2J0QA 4H9GA 3NEAA 3PXAA 1JB1A 1Q0PA 1V4VA 3H0EA 4BGUA 3FZEA 3L6RA 5BNTA 2ZCJA 1EVJA 3MBIA 2J5KA 5EVCA 5EVJA 4DA9A 1TU3A 3FVQA 1P60A 3SZGA 2R48A 3TMKA 4KX5A 4ZJUA 4BNTA 4XH9B 2ZI5A 4GQBA 5K2MA 1S0UA 2GEDA 2XSZD 3GMTA 3Q98A 4EARA 5KOJB 1GEGA 2WTUA 2CLHB 1C7EA 1BXRA 3FRIA 3P2KA 3QPCA 5F2NA 2HHLA 1FYVA 1ZGCA 2FSIA 1OUMA 3O93A 4HK4A 4UTXA 3DZIA 3PQ4A 1EP9A 3FIUA 2QTVA 3Q9LA 2X5NA 3FBGA 3OM9A 2FPWA 3HM9A 1M34E 1I0IA 1WCIB 3JZIA 2J0UA 3TSYA 3TXXA 4C5AA 5HIKA 1C3OA 1M6HA 4CIXA 4EI2A 1CY6A 1N2GA 1SOVA 4WN9A 2C4HA 2FK7A 1R4AA 2QX7A 1BG6A 1JAYA 1XZBA 3OIFA 3ADBA 3GGDA 5U1PA 2VXYA 1JJBA 2CUZA 5JS2A 1O4WA 2YRWA 4P1ZA 3W2IA 4PEVA 4R54A 3PYXA 3VOBA 2IRWA 2QE6A 5A02A 3ZXYA 5JXWA 3BRWA 2YH2A 3UPUA 3NHPA 3LWBA 4F4IA 3NKVA 2ZJOA 1H85A 3S2FA 2P9GA 3HU3A 2VQ3A 1R5BA 3D31A 4GWGA 3K4PA 2PWZA 4I5FA 5TLSA 3P2JA 3KQHA 2AFIE 2VH1A 2GBLA 2ZJFA 3SBXA 3G0GA 3QE0A 1PQUA 2WF9A 2PBLA 5GJCA 4W1SA 1MO2A 3O8CA 3MLBA 2FJ0A 4XDGA 4ETNA 4WKCA 1WULS 1TVKA 5EE3A 4N0EA 5DW0A 3IFSA 1YJQA 2BM9A 4FGSA 3DB1A 4RD4A 2CWDA 1WXDA 4RH0A 4MHOA 3T7AA 3N5CA 4ZK2A 4M46A 3NBKA 2ZYTX 3WSWA 2WYOA 3C3EA 4X8MA 1M0WA 4MHSA 3NHKA 1SHJA 2GZ1A 1PUJA 4NU0A 4JKIA 2LZ0A 5TS2A 3HFSA 2QR3A 1HBJA 1ZQ9A 3HB1A 3TQTA 4WADA 3VR3A 4L4YA 5DBIA 4QPCA 5IAOA 3TBFA 3CRZA 2OBLA 3A6JA 3LUJA 2JATA 5TE9A 5M04A 4IIVA 3SC2A 5EXTA 4C0QC 3SJZA 1U3GA 5ELXA 4BLPA 3EEBA 2QSZA 4O4IB 1T0UA 5JMOA 3E5MA 3MQ4A 4DNPA 1RWPA 4HDQB 4JR2A 4DARA 3E8SA 3ROGA 1G20E 3UJ8A 3RRFA 4LGMA 2WW8A 1XLWA 4MS1A 3LUPA 4CEIA 3B5IA 1SOWA 2PZAA 3EULA 2CW5A 3GFRA 2CVFA 2AQIA 2ENUA 2JCBA 2RHRA 4UEQA 5DGTA 3F6SA 4GU5A 5I4BA 3Q10A 3HCOA 4ZCMA 3HB9A 2ACWA 3JQ9C 4KSBA 4EBFA 1TUBB 3BXZA 4M0DA 3SLGA 2CBXA 1VIYA 2A0FA 4U7PB 4MV6A 1E1CB 2FUCA 2P1DA 5CR9A 1N36B 3H2IA 1XNRB 4NRDA 1HURA 3I1JA 4CL8A 2BGTA 3V32A 4WZBA 2X7XA 5F52A 3WSVA 4EA6A 1TRHA 3DCJA 4OFZA 5E7MA 1VCNA 1FRVA 1O5OA 3TFWA 5LNK6 4AY6A 2F8SA 3HKBB 3G0OA 2GPTA 1MRNA 1Z33A 2QTTA 3QWFA 4IXTA 4QPJC 3QVWA 4POAA 2MDTA 5KWIA 1AGRA 1ISRA 3IKTA 1BCRB 4KK3A 1QGED 1W46A 5UKDA 4YRIA 3CBQA 2YTZA 3HABA 4ZDIA 4AZSA 2WZDA 4LNUB 4W9NA 3HCBA 4CZ2A 4CKWA 1XDBA 1EJBA 2CJPA 4MLDA 1Z3CA 2D1RA 1X80B 4P3YA 4RA9B 4JODA 4UFOA 4ZRNA 1U0TA 5FADA 4L75A 5TY0A 4BKOA 5IUJC 3L92A 1XVUA 1WSDA 1WU7A 3C41J 3OJFA 3OPVA 1A50B 3JTMA 4L85A 3WGQA 3ZDFA 4W5WA 3WL3A 1JEQB 1E79A 1HTBA 1QCZA 3AP3A 1GZSA 2AZMA 2LBPA 3OCVA 2V59A 4RV9A 2Q2VA 4M1KA 3ZVLA 1DAKA 2QL5A 5ALLA 4V24A 4US2R 1CVIA 1K6EA 3P94A 5BV0A 3G2NA 1E63A 4CKEB 3OJLA 4NBLA 3UWSA 3WISA 3KR2A 3C6QA 4KWIA 1BX3A 5CW1A 1MTZA 2JFOA 3H18A 2G9UA 1I3CA 3EBLA 4E1BA 1P80A 4E5MA 2X22A 3BRSA 5DSZA 4QICA 2IS1A 1O0SA 4IH4A 1XAIA 3JV7A 4Y8VA 4YUXA 3W5DA 1JNXX 3I5XA 4DEXA 5GY7A 5EE5B 3A9TA 4GMHA 2Z6QA 1I9GA 2BKVA 3VPCA 3LW8A 2H4FA 2QB5A 3U49A 2XBUA 5JVDA 7YASA 4HDCA 2I6TA 4D9MA 1OXTA 3NIGB 3VZDA 3DDHA 3HM2A 3S28A 1T2UA 4M60A 4XGNA 4BNJA 1TEVA 3QELA 4KCGA 2OC4A 4LRWA 1FQJA 2ZUUA 5IT5A 5D3MA 4P33A 1OBVA 1NBME 4FHZA 3QITA 3W34A 1ODLA 2C2HA 1TIBA 3EEIA 5HG0A 4M55A 2P5TB 1KAEA 1W96A 3A9WA 1FYEA 4IFEA 5AVKA 1OZ0A 1RM4A 3ZCRA 1YR2A 4WSOA 1VCHA 3BH0A 4BN4A 4HV4A 3A0UA 2XNHA 1TJNA 3RABA 4B17A 3DPIA 2G5TA 3MWEB 5C81A 1EVIA 3OTGA 5CFRA 3NH6A 3IALA 3K9CA 3GJYA 3RADC 5HF8A 3TE7A 5GAJA 5A4MS 2E3JA 3AUXA 4P5EA 4TKZA 3T9DA 3C8HA 4WNCA 1R1DA 4P4SA 2AOUB 1AZTA 3W9SA 1QH1A 1TMOA 2GPWA 2IZ0A 3HCWA 4NE9A 3WNBA 3QMVA 4RTNA 1JFSA 3VH3A 1NVVR 3K1TA 4HH1A 4ZJZA 4PR3A 2W2PA 3B2NA 4G25A 2OFFA 4B0PA 1ZVVA 4RELA 5B64A 4LFBB 4RIFA 2BFNA 4GPTA 1JFFA 4Y9DA 1CUFA 4WK2B 3ITDA 4RIIA 3EXEB 3JD1A 3TVYA 1E6EA 1QMPA 3RTAA 3ENVA 2HEIA 2XODA 5TMDA 4GMDA 1U0HC 2YYZA 1F1JA 2O0LA 3ZZUA 4G8DA 4EJ2A 1FK8A 1MO6A 2X9LA 3Q3IA 3HXQA 1E3WB 3EUFA 3I83A 3H99A 3JU3A 2OGWA 5JSQA 5EJIA 3U44B 1U7HA 1YMVA 1YCHA 3H6KA 5JS7A 4UHJA 1PT8A 5JBNA 2XT9A 1G42A 3JAKA 3PDIB 3QI2A 2JGFA 4Q19A 2BIFA 3AJDA 3WXBA 1ULUA 4QT4A 3P4UA 1GKLA 4FUTA 1DXHA 2QN3A 3P5BA 1ZISA 1W4CA 1ZGGA 3WBBA 5I5GA 4X5OA 1FTSA 2AS0A 1U9IC 4ZYXA 1XPRA 2BLNA 1V1JA 3IAAA 4NJMA 2NYVA 1AN0A 2OO5C 2PZFA 1S8OA 2P9YA 2PN1A 3KOZA 4LSGA 1V16A 5KYXB 3ICEA 4JI6B 2HX1A 4L5IA 2RI6A 3EXIB 3M9XA 2IYUA 3DVAB 4BAUA 2PUGA 2JC3A 4JB8A 3FUWA 5EZ6B 1XJQA 1VPTA 4D3XA 4YH1A 2HBYA 1U3VA 4II7A 1RNLA 4MITA 2PKRA 3MT7A 1KVTA 4MUAA 4JGBA 5CDHA 2PUVA 3WRXC 1N2EA 1TKBA 1ZA1A 5DBFA 2XXAA 2X9GA 2BGLA 1S8NA 3G0CA 5D2CA 4F0JA 2OT3B 2C3PA 2LWIA 5HYVA 4FWTA 4WLNA 1A4RA 4NDZA 4IDNA 3F9IA 4Q4AB 1N2CB 5F4ZA 3IERA 3U9LA 1NI4B 2JIMA 3KPVA 3NC4A 4OY3A 1LCIA 3AF5A 4OQ4A 4ZT5A 2PTHA 3OHMA 3PI7A 2ATIA 5IVHA 4XUEA 1M67A 1BOOA 3LKBA 5CX4A 4PS1A 5IMBA 1EEHA 5FWXB 3BTSA 2RHOA 3E5HA 4R51A 2REQB 3EXHA 1JNYA 3EPPA 4J0DA 1I2DA 4FI3F 4ND8B 1LTHR 3AY3A 3UAGA 2IXAA 1BS9A 2YN0A 1YZHA 1F8UA 2A2ZA 1EWKA 1R3DA 2HQOA 4QTXA 4R9UC 1WVGA 2W2XA 2Z58A 2GN0A 1YI8A 2EWVA 1P74A 1Y6QA 2J9ZB 2KW5A 2QG6A 4L0CA 4R6WA 4UNQA 5FI1B 5LOVF 3LCUA 4ESEA 4DZTA 1FSZA 3WFIA 1BXGA 1YB1A 3H4MA 4IILA 5KTTA 1MLDA 3QBVA 1FXWA 1CXZA 4JZYA 4LTNA 4FS3A 5BW8A 3D8NA 4KWCA 4F1KA 5KYYB 4Q82A 3QKTA 4RMIA 4KO2S 1NHGA 1RYEA 2P3QA 2XRFA 3DFMA 1N57A 1W48A 5IXJA 1K92A 2H92A 2Y1CA 4B6SA 1W76A 3DLHA 2LW7A 5K99A 3BXHA 4CR6A 3QXSA 3HU2A 4BNGA 4Z1MD 1XZFA 3MYYA 1XLVA 4FDTA 1NDUA 2ACVA 4XGIA 5DLEA 3WIVA 1HOTA 4U7HA 2I1LA 3G2HA 1SZDA 2CMFA 5DT2A 4URHA 4LUCA 1D0VA 3KALA 1K8XB 3TCXB 2RCNA 4P7JA 4CM6A 1WPQA 1VXOA 4FN5A 3IMGA 3HNRA 3O4FA 5B2ZA 1PZEA 3K3PA 4MQFA 3N74A 4W99A 2WUGA 3G8YA 4ZIRA 5K45A 1E3IA 1KO1A 1BEEA 2X8JB 2REBA 5IAEA 4URZR 4K40A 5A04A 1N3IA 3BMQA 4DRZA 1T3LA 3P9PA 5LXTF 3OY7A 1F6DA 2VDWA 1RZVA 3QKWA 2HV9A 5E4TA 4EY3A 4DSOA 4QSMA 2VOJA 4BNYA 3QXCA 1SWVA 4OXNA 5A5FA 1PT5A 4E4YA 1EDZA 3U5ZB 3VTZA 1CF9A 3G1TA 4EB8A 1U3DA 3U7FB 4TTAA 2F1JA 4Q34A 5DCUA 2A7QA 3HVIA 4MLCA 3ROMA 1OA1A 1WM1A 1XTSA 2QSYA 1I1QB 3Q5GA 4G09A 4YRZA 4PXYA 2H9AA 4JMLA 1GT6A 5F5LA 3GLIB 2XMGA 2YBEA 3B6MA 1QG0A 2YHBA 2B6HA 3LOQA 4MV1A 1UQUA 2C4TA 2PYZA 3KD3A 2KPOA 1HETA 2FTKE 1P0PA 1Y7IA 3GROA 4N7BA 3HJRA 4JB0A 3IBYA 3OA2A 621PA 2HCTA 3JD4A 2R6ZA 2JEOA 1B4DA 3EXFA 1G3UA 3NOXA 3NAMA 2VA8A 4K6KA 1A5TA 3PNLA 4U5XA 1DRUA 4C1BA 3KUDA 1R4MB 3V8BA 5CX1B 3VPXA 1JDPA 3I01M 1FDOA 2JJMA 3TIFA 3TQHA 5CK4A 5T3YA 4BX0A 3ESDA 5K7SA 1I1OA 4D9HA 2CLLB 2IYZA 1J22A 4X3CA 5KC8A 3I9LA 3AH8A 4RGYA 3OLZA 3N8KA 3ZBTA 2IYLD 1L4EA 3H5AA 1X13A 1CX9B 1Z74A 5A3QA 2E4WA 1I8TA 3IUEA 4PO1A 1J49A 5E6RB 2P90A 1CDDA 1PNVA 1QOQB 1C8LA 1KZ7B 4R7TA 5AVRA 1WD7A 3NM4A 4P5DA 3DO8A 1TLLA 5DOVA 5SYMA 3L0BA 4HUQA 1WXIA 1MO4A 2BHLA 3ESQA 4CTNA 5FA8A 2VDRB 4CQNA 2JBAA 1O6FA 1J5XA 2VHCA 3O94A 1E1NA 1JHUA 4MRMA 2BKLA 2XB8A 3I76A 3QPDA 4QELA 3OY2A 3CE6A 1ZGAA 5B1SA 4EO4A 1UL1X 4OGGA 1O8BA 3JARB 3RWBA 3BWEA 5SZKB 2KJQA 2A57A 4RKFA 3ZEAA 1XMPA 5KOYA 1IAVA 2HQSA 3KAJA 4WKOA 5I4KA 3SCZA 3PGMA 1UDWA 5B58C 4IHAA 3UTDA 4GLFA 2WU4A 1Z5NA 2R4UA 1VB5A 2C5HA 3GZNB 2D2EA 4PHGA 3BMOA 4FKMA 3C3MA 3KB8A 1IQ0A 5H83A 3ZWOA 3GRKA 1G5TA 3RC3A 4BX8A 4DYVA 2GCIA 2QRZA 4MYSA 1L5LA 5AYVA 5BSRA 3REOA 4NMMA 3RC1A 4CL0A 2W48A 1T6YA 4PQGA 5E7QA 3DO5A 3VAAA 1Y6GA 1F3LA 1E9AA 5FNVA 5BYJA 5BR4A 3OVMA 4DKJA 3LOUA 1O95C 3U13A 4O2BB 1GGHA 2TMYA 3CH4B 1O94C 2ERCA 1WQ1R 3WG9A 2G1PA 1JMKC 1KI7A 2FSUA 1SKQA 3GRAA 2P11A 4HMOA 4AC9A 4AJPA 4OO3A 4NCBA 2F3SA 4PCAA 5KX5A 4WBXC 5BQFA 5J4LA 1CC1S 3PC8C 1AJEA 1J9GA 2AYYA 3M4XA 2A9RA 1U6KA 1NUSA 2HN9A 5CCDA 4QJ4A 3NJ4A 3B1XA 1JG1A 3LM8A 4C0AC 2O2SA 2XKKA 3O2NA 2BZGA 4QGAA 2UYYA 3P9NA 2A86A 4FD2A 2Y3IA 3S2ZA 3C3PA 3TW0A 5I8PA 5K6TA 1IY2A 5GIPE 1K6JA 4ZEWA 1T36B 2QJFA 3E0XA 8LDHA 3FTEA 1FNMA 2C1ZA 2P3LA 3LCCA 3AUAA 1SCUA 4TQ9A 3Q0IA 1PN3A 3DF9A 3WNZA 5LU8A 2I80A 4D4HA 1EYZA 4X20A 5DSTA 2IU6A 3FMIA 2MOKA 1KZGB 2X8LA 3CTPA 2C31A 2QJTA 1SD2A 1M34A 4JX8A 4A16A 1ZI9A 2OO5A 3DO6A 3RVDA 2LKCA 2HJGA 4X71A 1RKBA 1RXYA 4QOFA 4R84A 5AM4A 3WGMA 5JBIA 3JARA 4OV6B 2JHAA 1KU0A 2O8FB 5E3JA 1C30A 3OZAA 4MXDA 1T2VA 4AJ2A 3TG2A 1I80A 3DUFA 1J21A 1E2JA 2PM8A 3QFHA 5CJJA 1E9BA 4C4PA 1P0FA 1LI7A 1NVWQ 3H3FA 1RZ3A 3L1JA 2WLTA 4ZOAA 4M6WB 4NV0A 1XMIA 2XYVA 5TPWA 4EYQA 1RPNA 5JRDS 1JLMA 2VC2B 2P9BA 5A6VA 2CJYA 3FY4A 3R5FA 3OUUA 1ZD9A 3CUWA 1MC5A 1YT5A 1ZH0A 3AFHA 2ODTX 4M0CA 4MICA 3GT3A 3WLPA 1M5RA 5EJ7A 5JDIA 3IILA 5EA2A 3TEFA 1Z5VA 3SSOA 1URPA 3FCXA 1RM3A 3H5VA 4M3NA 4X94A 3K1ZA 3BE5A 1UFOA 1L5OA 3KYBA 1R50A 1YUMA 1KP3A 1XZCA 1YAJA 3FWZA 1LJLA 1TJ3A 2PVPA 3EW7A 3IE1A 2V6JA 3FTQA 3K71B 2C8LA 2FUKA 1OC4A 1VLZA 4PRYA 2EFGA 4HS9A 3NHMA 4OIFA 3EXFB 3B1FA 1NQTA 3LLMA 2C2WA 2GCOB 2QXUA 4H31A 4YTEA 3T54A 4B3JA 3Q8KA 4RC9A 3DV9A 3WQHA 5IS2A 2C4UA 3BSYA 5KTRA 2PKXA 1MGPA 4N12A 5I7RA 3KUXA 4G0YA 4MS4B 3DXZA 4MUXA 3G9XA 1PGQA 1US8B 4YAJA 4BY9E 1MVNA 1RJ9A 2J4CA 4LI0A 3BS4A 4YRDA 2DLNA 1NW6A 2QENA 1L5GB 1G0OA 4ZYTA 4LNAA 4L8YA 3HKDB 5J40A 3M3DA 5JXJA 1UC4B 2E7ZA 4WCVA 3EMVA 4QRHA 3ONVA 2ZTVA 4I4TF 3DFKA 5CW2A 3V7YA 1OH6A 2DBRA 1DQYA 1XTQA 3WDSA 2VLIA 1Z25A 2WKWA 3CE9A 4KQCA 4KYVA 5C31A 5L3RA 2PD6A 3L18A 3HXPA 1JKJA 4DQLA 1FQOA 4FILA 1GPAA 2VDWB 5ADWA 1B3RA 4RZSA 2GWRA 2YXEA 3IMKA 5F21A 4BRSA 3BMXA 1J0DA 1UEIA 2V0NA 2H85A 4ZO9A 1JDNA 1PTJC 4DMHA 4AQDA 1WSAA 1CT9A 2QPTA 4QYTA 4DYHA 1HM5A 2VWQA 4KTTE 3ZI0A 4FHDA 3S2SA 1X70A 2RGAA 4MQFB 4NHEA 4YJFA 1AD2A 2AR0A 5FOVA 3V00A 1WB9A 3TMAA 2ECPA 2HL6A 1F0PA 3NDJA 3PUXA 4MHTA 2RGEA 5AHXA 2X1HA 2DP4E 2PH1A 2CB0A 3K0CA 2ZG6A 1MP0A 2X76A 4G0XA 4I19A 1G9TA 3VDQA 1K3TA 3PEWA 4B4WA 2RE8A 4KREA 1E1LA 1XCLA 3CT6A 1SQ5A 1CJBA 3PDUA 5D3ZA 3MWDB 4QOEA 4HGRA 2A30A 2X6TA 3OBBA 2WG1A 4D3SA 1SEPA 3VNAA 2YVQA 3H19A 4JJFA 1AGPA 4L28A 4OQQA 4LYAA 2PIDA 3MGKA 2Y1DA 1SUEA 2WZCA 4N8SA 4LV5B 5BMOA 3WXMA 1R37A 5KYYA 1ONPA 2CDBA 1QP4A 1J42A 2OCBA 4E4TA 1BAPA 4X62B 3WL6A 2WKPA 4EA8A 2ECFA 1DINA 1N5LA 4YPFA 5FV7A 2F59A 3EVNA 4GLLA 1YZNA 5AW6A 4LQCA 5EESA 1YR3A 4URUR 5JSYA 1XA3A 2X14A 1B6TA 1CCWA 2YQ4A 1HT0A 4CM9A 4TTSA 4DPMA 2P3OA 1U98A 3N0RA 4XWWA 4TYNA 2XPCA 2QTFA 4R31A 2ZT8A 3U62A 4Z4QA 4MYRA 4AD8A 1H2FA 1NF8A 2IQ5A 4AO6A 4W8HA 4G8CA 2YJ5A 2HMTA 3W77A 3ROPA 4EPWA 4HNAB 2SCUB 4X93A 2ZPAA 3TXAA 1TQ4A 5EQTA 2RHCA 1TM3E 3GG9A 4G1BA 2E2WA 4PSKA 1QDLB 4QFDA 4C07A 3T7EA 1U7TA 2IKSA 2VP6A 4QXPA 5DLQC 4ZREA 2R8OA 3AWIA 3QX9A 4DCPA 3DW3X 3RSCA 5LQDA 4Q4AA 3EARA 1T34A 2CXQA 5SICE 4JB3A 2D2IA 3ZDEA 3RDPA 2WJ3A 2ZIFA 5FL7A 3DZ8A 3U3RA 4YMGA 3X1XA 1K66A 1OE0A 1GPJA 1LVGA 4WFJA 2ST1A 3OJWA 4PFJA 2JGDA 3BREA 5JWHA 3ACBA 4G4GA 3E9CA 3EUEA 2AG6A 4IWXA 4DB4A 1WVIA 4DMFA 2QT0A 4ZKDA 1X1CA 4N3BA 1KFEB 4EW3A 4RAQA 4RABA 2CFRA 3HXKA 1YCGA 4GAEA 2IHJA 3T38A 1V48A 3EXIA 3F3SA 1BWRA 1HORA 4Q21A 4LRXA 3G1WA 1V16B 3N07A 1ZXBA 4DT1A 4MKRA 4OFXA 2EZ9A 5TMBA 4BMYA 1GTVA 4G86A 5K8LA 4OA8A 5FBHA 4ZD6A 4PFQA 2PZJA 2WP8J 5MFZA 3H1EA 2CCGA 3IV6A 1HMYA 1SNYA 2ZROA 3L8ZA 3PUHA 2IC5A 3OLXA 3OTWA 4ZEOA 3D6AA 3GFQA 4CLDA 2FQYA 3R77A 4BBAA 4HNGA 5H70A 3KQPA 4ZFNA 2I4IA 1MC4A 1CF2O 2P2GA 1Z0DA 3HB0A 4Y2QA 5CGZA 2ZPTX 2FSPA 4FW8A 3VC7A 2ZJ6A 3ZDYB 2VJBA 4HNVA 3V8QA 3WOVA 3GQVA 2OXFA 2ZK7A 4H18A 3VZRA 1KERA 2B20A 3QVSA 3RU9A 2PAFA 3JYOA 1J24A 3MWDA 3SDSA 2H3HA 3CNEA 4GPZA 1O0BA 3TNJA 1RWNA 2ZJ3A 3DONA 3I5MA 5FHQA 3ZJ4A 1NQXA 2C29D 4DLLA 3L1VA 1N3LA 3GPCA 4JJIA 3FFBA 2YYYA 3CSUA 1LBTA 2QVGA 3JD0A 4KDFA 4OREX 4TSFA 5FLEX 5DK6A 1TCUA 3TH5A 2PRKA 2ZU0C 5LA6B 5E9WA 4ZQBA 2YXBA 5C8XA 4UUOA 1C0LA 4LYEA 2J0VA 4IYRA 3O38A 3PFCA 3UOWA 2AOUA 5IM5A 4JBGA 3B78A 3UG7A 2ACKA 2FHSA 1FPQA 1Z6ZA 3C3BA 2I2WA 4RZXA 3V4RA 1UBKS 3LVBA 1UAYA 1T0IA 4XGKA 2H11A 3HDQA 4ZO6A 2ZBQA 4HY3A 2JFWA 4Y6PA 1DS6A 3VZQA 1R64A 2Y9MB 3ABIA 2AIRA 2J87A 3ANXA 5FX2A 3Q3EA 2IPOA 2V0GA 4JN6B 4DJTA 1QHEA 1P8JA 2QRUA 4QAJA 1MC8A 5ALPA 2AI3A 4YJHA 5KPJA 3Q7SA 2FZKA 4GNKA 5DLPA 3PX7A 1ZMOA 2XXJA 3PYMA 4FU0A 2IHUA 3RFUA 4TL7A 4UVIA 1COZA 3VJRA 5J43A 1RWWA 4FFMA 5PNTA 1G5HA 2X9QA 3HLKA 2HSGA 4DBLC 5CCBA 2IYYA 1K6IA 1PFKA 1D1PA 2C8JA 2FZGA 3QF4A 1IXYA 1J2EA 4HTAA 4K9MA 4G9EA 4J90A 2F67A 1E2KA 5DEOA 2A9QA 1I94B 1T9GS 1EK5A 3AZOA 5C8VA 1P9NA 3F0TA 2Z08A 5H3HA 4QM7A 1E7QA 5HGXA 4JWKA 2FPGB 1CHNA 3VYSB 1S9DA 3RRJA 4JLWA 3L1UA 5AJZA 3RC9A 2D7JA 2JHPA 4YK7A 1CR4A 2R25B 3LDHA 5L6LB 1P2DA 4NQZA 1AKQA 1T8TA 3K32A 3RYHB 3KQVA 2HJRA 3ISJA 3BXPA 4H6XA 2G5PA 3AFGA 4G67A 3BJZA 4O6VA 3PVCA 4W1PA 1XZLA 1MPXA 5C3UA 3VA7A 3ZNNA 1B15A 2I4LA 4EL0A 1VECA 2SECE 2D0PB 4DYDA 4TTJA 3W5HA 2HIAA 4I1IA 1S2MA 3D7MA 5H4HA 1WLSA 3W5JA 1R12A 2O0HA 2VPIA 1S96A 3BIWA 4L2IA 3R7BA 4J3JA 2N1MA 2DFLA 3DZGA 3DUFB 3OZTA 4LNUA 3OOEA 1T8RA 2FLKA 4Q7KA 4TRJA 3DZBA 2RH8A 1SBIA 3FR8A 4FXPA 4OK6A 3ZIDA 1M34B 2VJAA 1HKUA 3PD1A 5EWMB 3DP9A 3TNFA 5KWVA 3HKBA 5JANA 1J1UA 4XRGA 3V2IA 1EGQA 4R1SA 4CQJA 4H7EA 4UE2A 4AUEA 3A1VA 4BBPA 5GZ6A 5THKA 3K6JA 5BQ3A 3UBMA 4BMXA 5LD2C 3I62A 1H05A 4LZOA 8ATCA 3HBLA 2AFIA 1PR1A 3LQYA 5GOZA 1Q3KA 4GYYA 1TAGA 3PEFA 2X0IA 3IEMA 2BC9A 1KGSA 4YV0A 1G2OA 1T2NA 4GVLA 4U2DA 2V6GA 3LDFA 2H1HA 3HEBA 2PSSA 3QYFA 2XUPA 1RS0A 4P3NA 3RM3A 1EUDB 5KYWB 5FL3A 1AO0A 2BFAA 3CF0A 1U1FA 4LDZA 1DT5A 2PX2A 2VPWA 3MERA 4DAOA 2AUNA 1ZN8A 3AJRA 4HAIA 4UMVA 1E2BA 4TM7A 5AJWA 5FLYA 2R1UA 2Z2IA 2DC1A 4BPBA 3AF6A 4QU8A 1B8UA 1USIA 5AVVA 2BGWA 3DMNA 3TD9A 3R4CA 1XXLA 4B4OA 3H17A 3ZVNA 1ZU4A 1KY2A 2R4QA 4KVGA 4C0XA 1EMDA 2P9JA 3ONEA 3ZDCA 2XNKA 5CHEA 1I4OA 5FNVB 3AQ4A 4YCAA 4B40A 3FSGD 1YONA 1XL1A 5FP0A 2ZSHA 2P1RA 3C8ZA 5TGZA 1DV2A 5A0TA 2PIAA 1YGPA 3PE6A 3RTGA 2WVHA 5LMZA 2P6UA 2IIVA 5DN9A 4BRUA 3VPGA 1YRBA 3VSDA 1HC7A 1KK2A 2OMEA 3S2UA 2ZUDA 2WBLC 2VF4X 2IP4A 2H7VA 1O0CA 3LKZA 4QRIA 3BMOB 4LZAA 4JLAA 3G3EA 1P77A 3AZPA 1P2VA 4KQMA 4LZWA 5ANRB 5FUVA 2FFJA 2R00C 4Q1BA 5BVGA 4DXDA 4E5SA 4XRRA 2A5FA 3CJTA 1SD5A 1AM4D 3WWYA 2MU1A 1S9HA 4HT3B 4X24A 1TA0A 5LU9A 4H35A 4PYMA 4MW5A 1GFIA 4OP2A 2F3UA 2PX6A 1TQDA 4OQZA 1BU8A 2JCSA 3O1IC 4HFNA 1A9PA 1PK7A 4GMFA 3ZD8A 1OGYA 1SVWA 2P9EA 1N2BA 4DBVO 1RAIA 3P0IA 1TJYA 4V0KA 4A82A 4ZDJA 1JPJA 3INTA 5DJ5A 1I4LD 1C3EA 5DWQA 4BVAA 3R6GA 3ZHBA 1IY0A 5IKMA 1E5LA 4QFCA 1BTOA 4D57A 1ZO8A 2LGJA 5LQCA 1M6VB 4DA7A 4DTIA 3QU9A 1V5WA 5D84A 5DM0A 4A8HA 5HBGA 2A4KA 1ZLYA 5E6RA 2X0JA 1RAEA 2JCYA 5J5AA 1JAIA 3KLOA 4PYQA 1Z82A 4UCFA 1W7AA 3IAS6 1PDOA 3OZXA 4ZZ0A 3I6YA 4D8UA 5A1JA 2WT4A 4JJKA 2AK3A 3PPVA 1RJDA 4FTWA 1IQUA 4N3AA 1ESCA 3FZYA 4IMJB 4R0NA 2OCYC 3MIIA 3MOIA 4F5ZA 3DXXA 3UJAA 2Q8PA 5CX1A 4EQZA 2B1QA 3A6FA 1KI3A 4F8YA 2DUUA 2X15A 5CPFA 3D4NA 5EN4A 3STYA 3W05A 2EG9A 3BWMA 1KDZA 3TLYA 4UTRA 2V1UA 3MUNA 2BGRA 4F6CA 5CIYA 1T5BA 2GPSA 1SKBA 2ORIA 3MB5A 3QEBZ 2XUZA 4NJEA 1Q1ZA 2ONKA 2NUTA 1SR8A 3BB3A 3INYA 3L01A 1WMBA 1QTQA 1ISMA 4JP5A 3EGVA 3GH3A 3UZUA 1FFSA 3KVNA 1W1IA 1Z29A 5A62A 4BKMA 3UB2A 3DE1X 3LNTA 2ORYA 4INAA 4URXR 2J3IA 5LMNB 2Q6TA 4Q9IA 4H1UA 4MULA 1XIVA 3L0DA 3QBJA 4KN6A 4KXMA 2ZUCA 4EVQA 3V8PA 2O57A 4JELA 2JGJA 2O8VA 1G1MA 4XQ0A 4Q37A 3T0GA 2EIXA 3HCAA 5EGNA 1NNEA 1KQPA 2PR2A 3BDVA 4ZJPA 2B4KA 1E1MA 4GXTA 1CPYA 2PE5A 1N5DA 4XI9A 3IJEB 5FQNA 4DR4B 2F90A 3M6VA 2EF1A 3R3VA 5F2KA 2GCGA 1K08A 1AQ6A 2X8JA 3FDFA 5JSFA 2QTLA 5FT9A 5G0WA 4UPEA 1XZEA 3DOFA 4NJOA 4KK4A 4A3SA 4M2LA 1SVOA 2IWHA 1FTWA 3JCZA 2GYYA 1ADBA 1R9NA 4BLQA 4IIHA 5FBWB 4F6LA 2NO7A 3IMEA 3NG1A 3QW4B 3KWLA 3UXEA 4BU1A 3KQSA 3QBDA 1VBMA 4H7HA 3SJCA 3ISTA 3ENQA 2A0KA 2PH7A 4NNPA 3CJRA 4MGEA 1GKYA 1XTBA 3N8DA 1KJQA 2PMKA 1C4OA 3IIMA 4M7WA 1U7ZA 4C2BA 5BSUA 2HKIA 1U11A 1EUCA 2IHKA 1E18A 1SOAA 3H2GA 1Q7TA 1CDZA 4XR9A 4IZOA 2YIDA 1QVWA 4HXFB 3WKEA 1BXGB 1PR9A 2FZ4A 3MJ4A 4MJLA 2HDOA 3WGHA 1GKIA 4QOIA 4EJFA 5CFZA 2IXGA 4JITA 2PU5A 3K0SA 3GEHA 1HNWB 2Q5LA 4Y2TA 4AG6A 3BH6A 4GDFA 4G3XA 2XCUA 2A0WA 4W63A 4WXHA 4H08A 4POOA 1N2CE 4RDIA 4EKEA 4PRKA 1MJGM 3SXPA 1QHHA 3EISA 3S68A 2GZSA 2IZ6A 1CRLA 1UWCA 2AJ8A 2HDHA 5T8KA 4XWOA 2EW2A 1P4AA 5FWXA 1J90A 4M1QA 3AR6A 1KC1A 4M4SA 1O6BA 2X77A 5AKLA 4I9FA 1VBNA 2IYTA 4DN6A 3VTAA 4W1RA 3LBFA 4FSHA 1NI4A 3BMCB 2Y0PA 4IDAA 3O82A 3SZUA 1XK6A 4YCDA 5AVSA 1E9VA 5EOVA 3FI9A 1YVDA 2WP0A 2ZPUA 3K2BA 3U4AA 3H1PA 3MSCA 3QOYA 3HSKA 1P61B 2ZE6A 1LTKA 4JD5A 1TEXA 4CF5A 2J8ZA 4M8SA 4QUDA 4X3PA 5CGQB 4YIHA 1QIIA 1R6TA 2ZB8A 5KSPA 4KGVA 4WZZA 4RULA 1YF3A 2OHXA 4Q9KA 1Z6PA 4WA7A 3GNTA 5BSGA 4HXGA 1YR9A 1FVXA 1KO4A 2D1YA 3F7NA 3B8HA 1OFHA 1FSSA 2H57A 3KU4A 4DLYA 3DVAA 1G7SA 2VTKA 2RG7A 3D5QA 3FCEA 4M9ZA 1HE3A 4F3RA 2FSGA 4UAVA 3V8MA 1YKSA 3LCJA 1CE8B 5DGCA 2NZ2A 4NJMB 1Q0LA 4BKPA 4BCBA 2VAWA 4P6VF 5GM2A 1K63A 2XVYA 2G17A 4WWHA 2NW6A 3VR3D 4BDSA 3HDJA 2EDCA 2YQZA 3ZH9B 1ZD8A 4CTMA 4BTVA 1E94E 4DLSA 5CFOA 3JAKB 3A4TA 4D8XA 3MBKA 4B6QA 2FX3A 4UDYX 5M2QA 3QE9Y 1TVCA 1P73A 3DLIA 4RENA 4KXNA 1E8MA 5LYJA 2OOKA 2WHRA 3HWX1 3KJXA 4Z4GA 1E3WA 2Q5HA 5AVJA 3LPNA 4B6PA 5GMOA 3H1AA 2CXRA 1NBAA 1RFGE 2ZXFA 3RC2A 2XD4A 3STWA 1NYLA 1WB6A 2W71A 1IPEA 1KO7A 2OZPA 4YFVA 3KJGA 3ZR4B 2BDUA 3EXEA 3L49A 2OM6A 3QTTA 1QU3A 1T6BY 1YBMA 2ZYSA 1NDHA 2EX0A 5IDYA 1JFFB 1NBHA 2CFSA 2Q1XA 2VNKA 3RK0A 2R1TB 4JB2A 3RVSA 2CLSA 4V39A 3WRYC 5KNBA 4YAKA 1ISJA 4P54A 4EX7A 1PEAA 2GERA 4FE3A 5LUAA 4TQUS 1HLFA 1MRZA 2GJKA 3O4RA 1EE9A 2IX3A 4JQYA 2DU8A 5HILA 2BGGA 3MWKA 1GFZA 4P4SB 3B5EA 4NV1A 1AIPA 3RGWS 4N5NA 3TB4A 1Z38A 4KJZA 3Q8MA 1L8OA 3ANMA 2ZBDA 2YUTA 3DZJA 2ONJA 1C7ZA 4LXGA 3T1QA 2R00A 4HPWA 3CISA 4NHOA 4HLDA 3P9RA 4NENB 3T3IA 4R05A 5DDIP 4AJOA 1MKYA 4CMJA 4EJSC 3KDPA 5TEVA 1PFUA 4Q47A 5LCXA 5BUQA 2J7KA 3NHLA 3PQDA 4RIEA 5EQJB 3SHFA 3R6TA 2QVXX 3VNQA 5J23A 1LFAA 2C4VA 2PUEA 4AJ4A 4D56A 4EVRA 3DOOA 4KBFA 5I9IA 2VP5A 5F35A 4LDNA 4F21A 4GEGA 3N39C 3G5UA 3PEVA 9ATCA 3SC6A 1POWA 4WD3A 5D3MB 5BURA 4CV2A 1BC5A 2CB9A 3ED5A 5C8DA 3INGA 4JEUA 4GECA 3COPA 5DWDA 1PGPA 1PJAA 1EUYA 2BMFA 3V7NA 4IVPA 1VXRA 3STUA 3F1KA 1FPMA 3A2KA 4KYIB 1JEEA 1WPXA 3O21A 5JVDB 3EIFA 5CCEA 3S6JA 4R9RA 1YRLA 3VU9A 1QFMA 1C0IA 3OESA 2O7NA 3MMZA 1ISHA 1Q1AA 1NU8A 4JXJA 3ZGXA 1NW7A 5AKYA 2XCTB 3HVJA 3BB1A 4ID3A 3WLFA 4HQ0A 3ZQ4A 4B2IA 4HFJA 4PZZA 1FW8A 4D97A 2VP9A 2XGGA 1MOZA 4TXLA 2X1LA 3T99A 4EUEA 3E8MA 5LWHA 4NBTA 3T06B 3O9MA 1RE0A 2DR3A 4ESHA 3OQOA 2Z56A 1LK7A 4CKEA 2F6RA 1D0SA 4JJGA 4KN9S 1IM8A 1SC3A 1TADA 2NZUG 2XXBA 4JLVA 4PQYA 4JEMA 3RGGA 5IDQA 1D2RA 3R7DA 1Y5RA 3JRNA 4QZVA 4A8TA 3B7PA 4B4DA 4A4DA 5SY6A 1M2VA 4KPFC 1XN4A 3I2JA 2IELA 1HMPA 3MT0A 3HJAA 3W8EA 2R85A 4ZZ3A 6GPBA 5L3ZA 1L3CA 1U02A 4X3OA 4HN2A 3QKSB 1WWKA 1PK9A 1UM9B 4IM7A 4O0MA 5ALWA 3ZE7A 1KAGA 3VR0A 4HDNA 4D92A 3UB4A 4UBJA 2NPOA 4UREA 1ZINA 2B6NA 4DIOA 1KDRA 4K9RA 4HVTA 3VPBA 1G3RA 1MABB 1T8YA 1JHDA 1VLJA 1ZM3A 5ALRA 4M7RA 4UVHA 3IA7A 4E03A 1OV4A 2JAPA 3LY7A 4GI1A 4TV9F 3U7RA 4F4HA 1YFLA 4G01B 2XZTA 2IYXA 1GGMA 3HBMA 4PTLA 1Y1QA 4OB8A 5I48A 1Y6FA 1GL6A 2ZITA 1GAWA 4TMTA 2XCOA 4FHFA 1VYVA 2WJZB 3L7LA 4DADA 4EPYA 1LSUA 1RRMA 3NWPA 1QIEA 1TUBA 2ISQA 4R1NA 2EDAA 2WUEA 4C7MA 4OQEA 4CIVA 4CKXA 1B00A 2ZTHA 3GA5A 4P83A 1WJGA 3D7NA 3IUYA 3V3TA 2HNAA 2QKYA 5HF9A 2H5IA 5JCPA 4EB0A 4IJ6A 1IBKB 4U3JB 1E4EA 3OURA 2V6BA 1UMCA 2RGNA 4CEIB 1IXRC 3G02A 2NAFA 2ZULA 5DYWA 2BEVB 3LX6A 2GEVA 3IX7A 1QIDA 1ACMA 4GVPA 3HA2A 4GQIA 2HM7A 2QP3A 1YI1A 2BRUC 2QX8A 4UM5A 3UKDA 4B43A 2FPOA 1VSTA 5JC1A 1TZ2A 1XMSA 2IOHA 3DQPA 1W5EA 3P9ZA 3HVRA 2QTCA 3CZAA 1FMCA 3HZHA 5ENVA 5G4LA 1PVOA 3HG7A 3IT1A 4RMNA 4CV3A 4FFDA 1E9FA 2WJJA 3ECSA 2YICA 1GLVA 1N1MA 2YWJA 3PLRA 4TMKA 3CZ4A 3ID6C 4EM6A 3KR0A 4YLYA 2VTDA 1GPH1 1NM5A 1AHHA 2J0EA 4LK3A 1BEZA 1HEIA 1F2DA 2C92A 5FTLA 5KNDA 4Y2JA 1MFZA 2W6NA 4WT7A 2QAGB 1LW6E 3I8SA 2QUAA 1J0AA 4QIHA 2QRVA 1W73A 1YR1A 2G5CA 1T2CA 3BRCA 4YC7A 5F2EA 2VQFB 3GELA 1Y3FE 1M1YE 4S2EA 5D6NA 3ZLBA 5EPEA 3K70C 4ZTUB 3WLEA 3I0NA 4FFLA 1A9XB 1E92A 1MA0A 1NT2A 3JASB 2PG3A 2IUUA 4CHTA 5JD6A 1F1BA 2XBLA 5A5EA 1Z8NA 4UUAA 2CMHA 5MN6A 5ABPA 4BLWA 3ZV7A 1QRTA 1HDZA 2GEFA 1KEVA 4MV4A 3RROA 4OX9Y 4P4GA 1QE3A 3V4ZA 3KJFA 4BNNA 4C4XA 5C8ZA 1IQPA 1T1SA 1DLIA 1VL5A 2DUJA 3EZ7A 4HWPA 2B2XA 4NOMA 5A71A 1KYIA 2F1RA 3EGEA 2F17A 3AF1A 2C2BA 3ZEIA 1ZK2A 3CGWA 5CAEA 1PNQA 1ZD2P 3FOFC 3KQLA 1S01A 1Z07A 3F8WA 4DPLA 3CB4A 4KNYA 3HYRA 5I45A 4HDMA 2A8YA 2J0UB 3DDCA 3PFFA 1IJKA 2ZRKA 2NSDA 2QM7A 2WJGA 2YY7A 5DHUA 1OD6A 2HDWA 2QTVB 4AJNA 1N6RA 3IP6A 3NVDA 4BWGA 3A9SA 5KOHB 4Y1GA 1UXOA 4MGIR 4YJ3B 4US1R 2H2HA 2XMSA 4ZV9A 3A2MA 1FSGA 1ABEA 4NF2A 3CUUA 4TRNA 2CHUA 1DAMA 1XO1A 3F6BX 5HF5A 3LPAA 2GN1A 1ZVJA 4HGOA 3F96A 1NY6A 3RVBA 1FA9A 4DV4B 4BX2A 2QMYA 2OXRA 3C16C 4G84A 4RZIA 3U7HB 2RH4A 1ZD3A 3PFKA 3JVVA 4UCQA 2JK1A 4E51A 4MV5A 4Q1EA 2QGNA 4TX1A 4A03A 1UXKA 3CX8A 1EFLA 3HJBA 1CS0B 3GD7A 4KYTA 4X45A 4D9EA 1WTAA 2J3QA 3MRSA 3MMXA 3BSWA 2YV5A 5CDSA 1JR4A 4S24A 3IAUA 2H06A 4MUJA 1R8QA 1J33A 4HNHA 2RGYA 3NHFA 2EF0A 3GDFA 3EVTA 4K1XA 2HO4A 2GXQA 4GI2A 4FVTA 1QF7A 5BN4B 3R8CA 4BJ3A 5FDFA 3P7MA 2W2VA 4PLHA 3WNVA 3PRKE 2HADA 8GPBA 4B84A 3FPKA 3GX1A 1V2HE 4KIJA 3P0HA 3KEMA 4HAWA 3UWMA 4LVUA 1FDTA 4NBKA 4ZVLA 1D1SA 2POCA 3RV4A 1NL3A 2D0OB 1JS1X 3KYDB 3S4YA 3T1HB 3BJMA 4JBHA 3PFWO 3PQ3A 3LTNC 1PL7A 3O8QA 2VTVA 4QTYA 5DMXA 1MX9A 1LDEA 1NUQA 1JYSA 1VDMA 4Q1FA 2GBIA 2O3SA 1GQ2A 7MDHA 1KL7A 4RFLA 5GGXA 4Q5IA 5FUMA 1KETA 4PYRA 3HYSA 1UBLS 2YS6A 2CYAA 1VGRA 3KZ1E 4BO5A 1ZCAA 5JY6A 1T4CA 3PGVA 3LK6A 2BEWA 2OWDA 3OCYA 1DV1A 4ND6A 4TZ6A 3NP9A 1AURA 3T5BA 3KG2A 1AKMA 3VHQA 4EJMA 2WWYA 1OVGA 5K03A 3NW9A 2BUBA 1F8YA 4XX1A 2DF8A 1C14A 3K09C 1GU7A 1SFRA 2A9JA 5AW0A 3TDKA 1WV1A 1YOBA 4OLFA 3ZTYA 2I33A 2O4UX 3VZSA 1EXVA 3OFJA 3H8JA 2OBFA 3N2KB 1LLCA 3IL2A 2AWNA 2QRNA 1Z45A 3JATB 2JLYA 3WR5A 4TTQA 5AICA 1U28C 3EEQA 5BSTA 1L8QA 3LYHA 3P2OA 5DXFA 2FZLA 3IGFA 2ZZNA 1EIWA 3MC1A 2BDTA 3OCUA 1KK0A 4G0PA 1H4VB 1HUQA 3BHMA 5CJPA 2X19A 3HZRA 4UCXA 3O95A 1VBKA 1JVNA 2VK4A 1ND6A 2P30A 1EFHA 1P2FA 2P4EA 4RLQA 4RVUA 2ZRQA 4YS6A 4NZMA 2J45A 4GOKA 4MINA 3OQVA 3I72A 5H4GA 2XTAA 1OH8A 2BD0A 3PZBA 4FUQA 1U9IA 4ZGWA 2H4YA 5AUPB 2HWKA 4U8HA 1A95A 4YLEA 2XKJE 1D7OA 3QVKA 3WK9A 3ZCQA 4C4OA 3A28A 1OFUX 2PXHA 3NHZA 3PWTA 3F3MA 4MQ6A 2H2IA 2ZJ4A 1E2PA 5AM3A 1J2YA 1V8OA 3BFPA 4CYMA 1EA7A 1NNLA 2DAPA 1Q0UA 2EEZA 3OJCA 3BGVA 5BSVA 4GPD1 5IJ0B 1W35A 3FTDA 3OQBA 5L4NA 7ADHA 5LYJF 4S0ZA 4KIWA 4YJDA 1EA5A 5TQ0B 2QX9A 3WNDA 4ZXPA 3BFXA 4FOLA 5J59A 1XUOA 1KI2A 2Z9BA 2GDZA 1PQWA 2O9JA 1OCEA 1AT1A 3HYCA 3MFYA 5F77A 3WRXA 2R11A 4E3WA 3DUWA 1EBUA 2XD9A 4UE3S 5CDUA 1XU7A 4PLYA 2GN9A 3GIWA 4I0WB 3W4KA 1B76A 4HAXA 3AR4A 5HHTA 1N7IA 3H2KA 4WJLA 5B7NA 2VNIA 2X6RA 1W9MA 5DHFA 4AVYA 4Q05A 5DX0A 2AE2A 4ZYWA 2P69A 4K9DA 5KI6A 5K05A 4JJEA 5DK4A 1P1CA 3F5DA 2YNMA 5BYKA 4C5CA 3EK2A 1TUEA 3R0QA 1G21B 3TYXA 2AOWA 3AXTA 3B6IA 1EJ2A 3D8TA 4QUGA 3A4YA 3CNLA 5E2AA 1KGDA 1U3FA 2RGNC 4G5SA 4YCBA 5DYYA 3SQLA 1LWOA 1JVSA 1NXSA 2QG9A 3PIIA 1P9WA 4PGAA 1SQGA 5K3EA 4C0BA 5DYNA 3GCXA 2WG0A 1ZVKA 2OESA 2G9ZA 2VHJA 1A98A 3QPAA 4O5OA 3CVXA 4TN5A 1PO7A 1Y4ZA 4BB9A 4Z0PA 4LDJA 3ZGYA 1IRXA 5K3OA 3MA0A 4G24A 2JB9A 3W1EA 2M6KA 2ZLBA 1RAAA 3GRCA 4UEJA 4BV9A 1CF4A 2ERYA 1QOPB 1YZ3A 3GVPA 1BHQ1 1M1NA 1JQ3A 1KFBB 3LY9A 4P9NA 4QU0A 5EUCA 4O2LA 2C7QA 2HF9A 3TRHA 1EVQA 2H54A 4HX5A 4CODB 2IHNA 3TOSA 1O97C 2G1KA 1NMQA 4G26A 1S89A 2CUTA 2AOXA 1C8VB 1A7AA 2C94A 4FEEA 4L50A 3IMFA 2FQQA 3NHSA 4C30A 4UQLA 1HOXA 2R1VA 4XDZA 4XJTA 3VU8A 5KWSA 5AXCA 1G41A 1NNSA 5DH9A 2GN8A 3OQMA 2YWHA 2XDYA 3PDCA 1B0AA 1NW3A 4NPCA 1KAMA 4JLOA 1R0RE 1NC1A 3W8NA 5LP6F 3RH0A 4AKGA 1W5FA 5K0BA 5IFLA 1CY1A 1RQLA 3N7AA 3UAWA 3SQWA 4QLOA 2YVUA 1D8TA 4KQXA 5FNZA 1DAHA 1SXGA 2FMHA 1Z4MA 2PYIA 1MU0A 1R5NA 3GMDA 1K2WA 5KVCA 2LE0A 4AFNA 3J81k 4FW9A 1V6CA