4YFVA

X-ray structure of the 4-n-formyltransferase viof from providencia alcalifaciens o30
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
244
structure length
244
Chain Sequence
MKKILVISDNYQLVSYIKNLYLSNEEWSKELFIDYSYSSINRNPQSLIELGMTEIDIKNKNLNELNDYHLIISAHCKQIFPAHIVNNKLCINIHPGLNPYNRGWFPQVFSILNKKPIGATIHKMDSEVDHGEIYCQEEVSILSHETSIDIYNKVIELEKKLIKNNLLKIINNELQPKLPSQEGNYNSIQDFNKLCKLNLEDNGSLREHIDLLRALTHGDFKNAYFYDENNTKVFVKIELSLSQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords VioF
publication title Molecular structure of an N-formyltransferase from Providencia alcalifaciens O30.
pubmed doi rcsb
source organism Providencia alcalifaciens
total genus 82
structure length 244
sequence length 244
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18216 N_formyltrans_C N-formyltransferase dimerization C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 4yfvA01
2GARA 1NJSA 4DS3A 1C3EA 4QPCA 4ZYYA 3Q0IA 4ZZ2A 4ZZ0A 3NRBA 4EW1A 1RBMA 3AUFA 4S1NA 4ZYXA 3LOUA 1YRWA 2BW0A 3N0VA 5J9FA 3GARA 4ZYWA 2YWRA 4ZYUA 3AV3A 4YFVA 1GARA 1JKXA 1ZLYA 2BLNA 3KCQA 3P9XA 1ZGHA 4PZUA 4ZYZA 1MEJA 3O1LA 4ZYTA 3DCJA 2FMTA 5J63A 4ZZ3A 1FMTA 4TS4A 1CDDA 4QPDA 1MENA 1CDEA 4EW3A 3W7BA 4EW2A 3R8XA 4IQFA 4TTSA 4ZZ1A 3DA8A 3TQRA 4TT8A 4Q12A 3TQQA 1MEOA 1RC0A 1RBQA 1ZLXA 1RBZA 1RBYA 3OBIA 4YFYA 4NV1A 4R8VA 4ZYVA 1GRCA 1RC1A 2CFIA 1S3IA 5CJJA 1C2TA
chains in the Genus database with same CATH superfamily
3DMYA 1YDFA 3AYZB 2GPYA 3FWNA 2AI2A 3OQBA 4KQ2A 2J5QA 4R68A 2QQ5A 1GCIA 3MIZA 3PT9A 4Y2YA 4UAUA 4KE9A 5H3CA 2FG5A 3EFEA 3V55A 4A0SA 3RFVA 1H5UA 5KTMA 3H04A 3GLGB 1V3TA 3L9XA 1EVQA 4GD3Q 4DL9A 4V3CA 1JXAA 2QKYA 1BXZA 3EGDB 4GSLA 4OQZA 7GPBA 3U0VA 4E5YA 3SC2B 1SKMA 2ECOA 2OV2A 3FD8A 3MJSA 3EC7A 3LX5A 4HB3A 1E1NA 1H9AA 3PD7A 4RZUA 5CM9C 4I7EA 3GLVA 3NHSA 1IUKA 4D9FA 2E87A 5NLLA 4HAIA 1SELA 3UY4A 3BXXA 4TWAA 1KTIA 2PGXA 4RX1A 4OXIA 3V3TA 1VE9A 4B3DA 5KWEA 1CK4A 3PPYA 3TKAA 3Q8KA 1ACLA 5BSEA 3R7BA 4HQRA 5DXAA 3VO8A 4DRYA 1JT2A 2ZS8A 1ODKA 2NX2A 3MQ4A 4G63A 2VQ3A 5AK4A 4KQGA 5FPHA 1L5ZA 4URZR 5B7NA 3VOAA 1FX1A 1EXMA 2BFBB 3B52X 3Q9SA 3H2HA 5KYYB 4C0JA 1BD3A 3DUWA 4I5DA 1E1YA 4M0LA 3VH1A 3DV0B 1EWRA 2LCIA 3CPJB 4GPAA 3HU5A 2B92A 4G37A 1PJ2A 4PE5B 1E4EB 3REFA 1TUBA 2NW6A 1QE5A 1MAWA 3ADOA 5TQJA 5KREA 2PUFA 2XUDA 3FMVA 3ER8A 4IJ6A 3BYZA 3N2YA 3Q2OA 1LVHA 1UDBA 3L1KA 3KXPA 2CSUA 4L75A 3WLSA 4XQ9A 3MGKA 3PEFA 2QY6A 4FUTA 1SBCA 4UUNA 4U0KA 5C32A 3NORA 1BA3A 4EL0A 3T9AA 1GTRA 3D8TA 1VMKA 3O74A 1CUUA 2G28A 5DNYB 4BKRA 1PR9A 3STXA 4BFLA 2YS6A 2B83A 2N1BA 3NBQA 2ZR9A 5CW2A 5BN1A 4NMHA 1F12A 1DC5A 1HKUA 1XA0A 3L9WA 3HACA 3LK7A 1U99A 2WZBA 1MRNA 2QXUA 5CDSA 2BFAA 1J20A 3EXG2 1G2QA 3QSGA 4GPIB 3HNOA 2CUNA 1Z45A 3MTGA 2QX6A 3AF0A 1TM3E 3M2TA 4L73A 4KQXA 5GOTA 3VZBA 3V2GA 3C7AA 1TLTA 1KYTA 5HTOA 4EQ6A 2J4CA 4LCJA 4DTIA 3L4BA 3CCBA 3EMVA 3KTAB 3PNLA 3PR3A 5C31A 3SYTA 1R6XA 2B2NA 3OT1B 2EL7A 4YRFA 3S2YA 3T15A 2VDKB 4I9UA 1QOZA 5CB4A 3F5MA 4PAOA 1YDGA 1W8DA 4WMLA 4IDCA 2PL5A 3DQQA 4FBLA 4BQEA 4AJIA 4TV9B 1SUIA 3OJEA 1KMHB 3EC2A 5ECDA 4R4JA 1II8A 2HU7A 1YIOA 3I23A 1GKUB 1U9YA 1PWZA 2VLBA 3Q9UA 5ALDA 3RIYA 3DL2A 4MDYA 1M1NA 3CX7A 3IV6A 3RYHB 2X0NA 3HI6A 4MVWA 3KQMA 4YR9A 1K63A 3ZGXA 3KWFA 3IESA 1L4MA 1D8TA 2PZ8A 3ZJUA 3AY6A 3N0XA 5FYDA 1KRXA 2HIGA 4W9NA 3OCJA 3OIWA 1RZ3A 3MINB 5BQ3A 1N2SA 3GGGA 1BOFA 4QPZA 1DOZA 2CNWD 2VYVD 1FIUA 3PFKA 1ZQ9A 3EXEB 3R5HA 2WK1A 4FOSA 3RSFA 4ZDWA 3SG0A 3GLIA 4CN8A 3G68A 2UZIR 3WRXC 1YZ3A 4L5IA 1RWWA 5JI3E 4IXWA 1QZUA 1L6IA 4JJ8A 2A88A 2P2DA 2PX5A 2E89A 4ALLA 4KLRA 1GIAA 4DABA 1TI7A 4HXGA 4MWSA 3GZNA 3HKCB 2P9EA 1V4BA 1VG0B 2X4DA 4IDEA 4WBSA 4BRUA 4YRTA 4DRXA 2UUCB 1B16A 4LHYA 3E15A 1X7WA 2B61A 3RW9A 5K8CA 1CP2A 3IRVA 3H75A 2JFXA 3NHJA 4JUAA 3UWOA 2O2EA 5IVHA 4J3NA 3P2EA 1P9RA 2V59A 5ALWA 3S0JA 4LZZA 5CTAA 2QTRA 3QG5A 1ZM2A 2V54A 5IJXA 4DCGA 4TZTA 3RVKA 3A3KA 2GHQA 2MHCA 1IQUA 1H1DA 2Z83A 3IFSA 4QELA 2VUSA 5JO0A 2FSPA 3OIFA 4DDVA 2YWHA 4EJFA 1T6BY 3VVBA 1C41A 1CQJB 4LVUA 3NZEA 3B7PA 1P7WA 3N8GA 1SQ0A 3LM8A 9LDTA 2B30A 4BKUA 3IPCA 2F8MA 2Q0XA 4Y0AA 3KD3A 5JO9A 2HKIA 3V8VA 1TCUA 4MMXB 3CNQS 4K9KA 3C3MA 4GG1A 4HNGA 4MUIA 3QOWA 3Q6IA 2PSDA 1YK1A 2F7SA 2L17A 3ELWA 4P34A 3WNVA 1WXWA 1D5WA 4FDUA 1F4LA 1J4AA 4OJMX 2CXXA 1RXVA 4PLZA 4JLWA 2AFIA 1XLVA 3IO3A 1QSGA 5E2BA 2QX7A 2P9BA 5D5QA 2CDBA 5JDIA 4GLOA 1ZXXA 3DHEA 4JP5A 5DHRA 3D5QA 3ZK9A 4E33A 4BQQA 3DE2X 3CZ5A 1FYDA 3HB1A 2CXSA 3E81A 1PT6A 5JPIA 2QP4A 5B37A 4Z4QA 3HLKA 1Q44A 4PLTA 1O94D 4RXUA 4OYHA 3U3XA 3BZUA 5K2MA 2WRZA 1O2DA 4UU8A 4QUEA 1K06A 4XYGA 3LBFA 3RUCA 4ZMBA 1JPUA 2GEBA 1P0PA 1JQKA 1TU3A 2ISCA 1SKQA 2H17A 2VRBA 3FPSA 4HO1X 3TQQA 2F2TA 2FW6A 4B43A 2ZSHA 4D3FA 3W77A 2FCRA 2R6FA 1YZYA 5E0OA 1XPUA 4CLEA 2EARA 2C0QA 1UANA 3EGOA 1VE1A 5HR5A 4X90A 5GONF 4TRNA 2YWEA 3WLNA 6ADHA 3CG4A 1AV6A 3CVXA 2XB8A 2AGVA 2EFDB 2WE7A 1F0NA 1HDZA 1Y8QA 2ZREA 3WYFA 2XBLA 4AKTA 4P3XA 1ESZA 2HDHA 2WIKA 2ZRQA 3BL6A 3E2MA 3GGSA 5KYVA 3SGLA 3U7IA 3QP9A 4LJ7A 1XTIA 2IGTA 2R6DA 3NTOA 1GV1A 3WK7A 3LUJA 3RVPA 1M1ZA 3DQPA 5HQJA 5CLJA 4NDAA 2OECA 1S5PA 2PUWA 4HDKB 5E6RB 3DP7A 4JBLA 1NMXA 2XNDA 3MVEA 4Y1FA 3U7FB 3GZTB 3C15C 1P80A 2V03A 1IL0A 4DS3A 1OV6A 2Z3VA 4YY3B 1THGA 3A1VA 2OKCA 5KO2A 3A6PC 1ITZA 4WECA 2D7CA 4BO8A 4C0SA 3UK7A 1VZ2A 4TMKA 5IARA 1B8OA 1QZTA 2H57A 3IULA 4GM4A 4KAFA 1PSWA 4P5DA 4B44A 4TLEA 1H2BA 4EA7A 1WW2A 3PPWA 1F2UB 5IJZA 4GEGA 3G5LA 4FLMA 1T5HX 5ICMA 1JV2B 2C4MA 1FSGA 1E9DA 1NSYA 1DAGA 3DB1A 2HC9A 4MV7A 3CNEA 5IVPA 1CVIA 5LWQA 2WLTA 3KUDA 5AKZA 5FUWA 3X1ZA 5JAHA 4LXQA 1PFVA 5K4AA 2QTZA 2XB6A 4R1SA 2NVWA 4O2LA 2K6GA 2JIRA 3EIUA 5P21A 4F2GA 1P17A 2OWDA 2CEAA 3R20A 3IURA 3L7YA 4I08A 4AICA 2GPTA 4UOEA 1SXQA 3QW2A 4YRIA 3AESB 3BCUA 4K8RB 3JD3A 4OHXA 1RHJA 2GAAA 4X1KA 2GN0A 1JNXX 2Z5VA 3OTGA 1WE2A 4N47A 1J07A 1V3UA 1ZLYA 1GAWA 4X45A 2WIJA 2CK3A 1MW9X 2HD4A 1HEIA 3CBGA 4RIFA 4ZPJA 2AEEA 3DNPA 4IUYA 3SC4A 1GG9A 3KNZA 2B1QA 4JI1B 4MS1A 4RJTA 2X8JB 5JXIA 3U09A 4RHUA 4WN3A 4PPYA 2P1RA 5DO9A 3I32A 1UBJS 2NAFA 3IEXA 4N6NA 3WXMA 4BNMA 4MP3A 2NZWA 3H2JA 4O4JA 4GI1A 2E6UX 3OJWA 1P1FA 2YV2A 1W1IA 4PXYA 1GA1A 4QQRA 2VP2A 3F71A 2EG5A 4CUZA 4X1OA 2RHWA 3PXXA 3TLCA 3AL0C 4UHCA 2Q2OA 4EB6A 2OMEA 2EW8A 1MB2A 1NRJB 3H1EA 1V45E 4I9HA 1EEHA 1WG8A 2XCQA 4MRPA 5DCUA 2X6RA 2R8YA 2ZS9A 2AOUB 2QN1A 3O0DA 4YAUA 3FNQA 4AKGA 1P5JA 2AWOA 3VTFA 3ANLA 1A2KC 2GYWA 3CJRA 1KS2A 3ONNA 1Q1ZA 2C20A 2AF3C 2PUJA 3QXHA 3NBAA 1PN3A 4OHRA 1S2GA 4BE4A 3D3KA 5C46F 4D9NA 1OYWA 2O9JA 1ISFA 1OXKB 1OAKA 1Q22A 5CDFA 3LRXA 1Y8ZA 4N1AA 1Y81A 5JS1A 3IP8A 2FR0A 1E6UA 4AT1A 2VHEA 3S6JA 5BP7A 3QWBA 2ZBPA 1UPBA 3SHOA 4HH4A 4K28A 1Z2PX 1OASA 4L4UA 2QRVB 3EPHA 5F7XA 2GCPA 3C1TA 3DF7A 2DB3A 3A6JA 3WQHA 1IN4A 4WXMA 2PTGA 1FNNA 2EWWA 5EQTA 3RT7A 2PUBA 4KPYA 1T2NA 2O5EA 4MK4A 5KSWB 1B6GA 4WIAA 5KVSA 3HUTA 2Q4OA 3QHAA 1TKAA 1HLDA 1CVLA 2FEWB 1GSAA 1RLOA 3ZWOA 2X8LA 2VAMA 5KTNA 1KORA 2IEIA 3G23A 3A31A 4W5TA 1NPYA 1XCJA 1SXJD 3IKVA 1CUBA 1W48A 1U0HC 3ELYA 4HN2A 3C43A 4EFNA 5HP4A 3R3VA 1VKHA 3E03A 3GP3A 1F17A 4MUXA 4P4UA 2W2QA 2C7RA 2QTVB 3UICA 4ZYXA 2WSSD 5B55A 3HJRA 1NV8A 3BERA 1J0DA 1T9BA 4P5EA 2GEKA 1SHKA 2OCBA 3FDZB 5J2UA 5F77A 5D6OA 1P77A 2XVAA 1ONOA 3EZLA 4BMNA 3PWTA 1WOMA 1OFGA 3G9ZA 4B0OA 1DKLA 1ML4A 5DZSA 4WADA 2BKAA 4IIJF 2Y1LA 5KJ1A 2PX8A 4TTTS 5AH0A 1CY0A 1DJNA 2ORIA 4A1FA 5HQ3B 3JATA 1B7GO 3C98A 1NW3A 2JFVA 1OFHA 1E3IA 2RHJA 1YXMA 4IQ4A 5CJPA 3GJQA 1B0PA 5LCXA 2CLSA 1BWPA 2VT2A 1UAGA 4A3SA 3K0FB 3P26A 1Y80A 2OHXA 5B7QA 4NY1A 1Q92A 2OUIA 1PJBA 1XPJA 1WPQA 3NDRA 1FRZA 4U2KA 4R01A 3QU9A 1GZ6A 4KOAA 3PZRA 1Q3HA 4JYAB 5LNK6 3THWB 1R5OA 2H4YA 3TR6A 5COAA 3OZEA 1XRPA 1MEJA 1UC9A 1YB5A 2HA4A 2PQ2A 3TVDA 1VKNA 5EFZA 5LYJB 4OBBA 1UMCA 2XWBF 3MA0A 1Z2DA 3SQNA 2BH9A 2Y92A 3R7SA 1U4OA 1R9JA 3QFRA 4G0ZA 4IJMA 2V5VA 3TX6A 1IHUA 1K9SA 5C8YF 5THXA 2QT0A 4BAGA 1KJJA 2AJ8A 3HU1A 2F55A 4GQAA 2ZYGA 4BZPA 1QU2A 4QYWA 3ECCA 4LISA 2OSVA 4B3GA 2PQ6A 1UK7A 4BV8A 4JLBA 2C1ZA 2YC2C 3M81A 4GC5A 5GZ1A 2HA3A 4DSAA 1P81A 2PIAA 2EKZA 2FYTA 3KIPA 4CTOA 5K0CA 1VHWA 4WK4B 4J03A 3I61A 1UUFA 3EXFB 3N75A 4LK2A 4DQ0A 2F1RA 4JX9A 4QASA 5JSQA 2VP0A 4F11A 2ID8A 3OP4A 1X77A 5JSZB 2WHPA 4FJ1A 3E3LA 5AI9A 3IUSA 5F1YA 1UC8A 1V96A 3SSNA 1FDVA 2WIGA 3S99A 5A06A 1GTG1 1DLIA 3IAHA 1COWA 3MTEA 5CVDA 2ZSEA 3E1GA 4WJKB 1C4WA 1NN0A 4L0CA 4M0FA 5FOQA 4ETMA 3PU6A 4F9EA 4GFDA 3I5MA 3GEBA 4WLNA 4JHXA 2RE8A 3SYLA 1GQ2A 1W5EA 1ZIYA 2RJNA 2L82A 3C6YA 2HXSA 3H2YA 1KPIA 3K1AB 1KP3A 3NWPA 5AICA 4IGIA 3F7NA 3ZHRA 1DG9A 4MTCA 1SPXA 1Z25A 1ZIDA 3P0JA 3OHSX 1DBIA 3OO0A 4GH5A 5H9VA 4PSAA 3VNAA 1YJCA 1RI3A 2OHFA 3AL3A 3GELA 5KBYA 5SICE 4YAKA 3HY3A 5JD6A 4XD7D 3ECAA 1FDUA 1ZKMA 1O5TA 1WNTA 3PEVA 1A5TA 3VH4A 5MF6A 2AC2A 5F98A 3CMMA 3H0KA 3TUZC 2X22A 4ZVOA 4D7AA 4E3WA 2WSYB 3LBHA 5BUQA 1FFXB 1HQCA 1VE5A 4ZVSA 2A59A 1THTA 3SN6A 3PEUA 5DHUA 1T5BA 1T2CA 5FXMA 2C9ZA 4C2BA 1NJ5A 1LBHA 1ZI8A 3W5DA 5E0KB 2WAAA 3BWVA 3D7NA 3K4PA 3E9RA 1O97D 5B7GA 5FQOA 1NJ6A 3O8BA 1JFFA 3IAAA 1P0QA 2UYGA 5AM5A 4M7PA 2YL2A 4LJ5A 2IYTA 1N8KA 4KN6A 5I9SA 2CL5A 5EHXA 4A0HA 1G8HA 4PO3X 2X77A 2FDXA 2IDKA 2QVCA 4MIYA 3P9CA 4TM7A 1KARA 1JDZA 1FVXA 3H05A 5I4IA 1DC7A 2OCDA 2XA9A 1AF7A 1KZ6A 2Z04A 3EHDA 3QYJA 2DQZA 4A5SA 5I8WA 4YMWA 4QM7A 3PITA 4EG1A 1QFSA 3P4UA 4EF5A 2B1RA 1YRBA 2FR8C 2VSQA 1AZSC 4BU0A 3WHPA 2RGUA 3SDBA 1R9MA 4D5EA 5I47A 1XQWA 1LPMA 2FETA 3R1IA 4D9CA 1B8VA 4DY4A 5GQSA 3BD8A 3QSYA 3HO1A 1DQYA 4BAUA 1QWOA 1ZVKA 3CRMA 1Z18A 1SHZA 1STOA 1DAHA 3CYFA 3AG6A 3NTLA 2ON6A 3PNPA 1EFDN 1EJ0A 2VEDA 1ULTA 1E0KA 2NXNA 1C3OA 2P9HA 3CUEF 2AG8A 5JALA 2F17A 1JVSA 4NP6A 4EJMA 3OH8A 3RDPA 2OORA 2B9VA 1UEXC 2ZVQX 4LQCA 3D0QA 3P0FA 5JSKA 3M34A 3QUSA 1F51E 2YCBA 1DCFA 1C14A 1CJUC 2MMGA 1FNBA 1HNWB 4IV5A 3TG2A 4NLLA 4FGLA 3D8UA 1AGYA 4BGEA 4KXVA 4HQ0A 3RLIA 3TZCA 1OFVA 2BSAA 2WG0A 4M60A 1WCIB 4UHFA 1TYDE 4HZGA 4KXNA 4M1SA 5GZ6A 1YB1A 4IUCS 4WA8A 5HEKA 1KGSA 2JJYA 5FPQA 5K8TA 3ETGA 3DVQX 4XDGA 4Q66C 2GZDA 3KZKA 4Q93A 1Q0PA 2WYVA 5B2ZA 5LBIA 1Z13A 3CLTD 3WGNA 4Q3KA 1YT5A 3BBPA 1ZIXA 1OBVA 3ZWDA 2VP3A 4XPIA 4MO9A 4MR9B 1J97A 1KO1A 2AG1A 4I4CA 2VTVA 4KX5A 4CM9D 5ENDA 5FWYA 3NUZA 4YECA 4TT8A 1MO2A 4JN6B 1SD2A 2WHQA 4JEIA 5KOJA 2VP4A 3JAWB 2CWWA 1J2UA 4DEVA 1Y3BE 2A5DA 2YDYA 1V5GA 5DM70 2IKSA 2OUKA 2IYVA 2I2DA 1XQVA 2R7LA 2ZATA 4AY4A 3N8DA 4NU8X 1U0LA 3Q11A 1TTTA 4KH0A 2A5FA 3G82C 1NSTA 2XJ4A 5DASA 3VV3A 1PI3A 5CLQA 3TJRA 5BN5A 4KGZA 2P3QA 1PSZA 2AOWA 3BD7A 3MERA 3NH6A 4G89A 4JEHA 1Q7BA 4XR4A 2C5SA 2DPMA 3KOOA 3ICWA 4LOIA 1J24A 4DCCA 1X2BA 1XKLA 2JI4A 4PGFA 3P9SA 4RENA 1Y9ZA 2JS7A 4DLLA 3AVVA 1JAZA 3FBGA 5DSTA 3A25A 3CKKA 3EXAA 3LDHA 1FUUA 1TNDA 3VKUA 4HWPA 3S4YA 1M1YE 1N5MA 1T0UA 5AT1A 3WZMA 4CL8A 3GUUA 1JDBC 2R2GA 3QYFA 4LRYA 4F3RA 4M55A 3NR2A 1XTVA 1QHHA 2C4TA 1IN6A 1U2EA 1NV9A 3DVAA 1GFSA 3HRHA 5T4BA 5B1HA 2ZSJA 2BFEA 3B51X 1RWQA 3QPVA 4G4SO 4C14A 3EDQA 3JQ7A 4PHGA 4BN4A 1WLYA 3ROTA 5IC5A 2IXGA 2BZSA 1NYRA 3EWSA 4Z1MA 4PF1A 1LNQA 4FZ3A 4EZIA 3AGQA 1D2GA 4ZV4A 1JG6A 2WJ3A 4OTZA 4C6RA 3OETA 2XRFA 2J3HA 1FLNA 3O38A 5ALXA 3T3IA 4DEXA 4F8EA 5JZ9A 2CB9A 2GJAA 1J70A 1O8BA 3C7CB 3AU9A 3U7EB 3ULKA 4MO2A 2HPHA 2GAOA 4JCCA 3RUAA 1NVXQ 2RHRA 4ENPA 5C5CA 3V97A 3V8BA 2J0UB 3FE2A 4JEMA 2H63A 4LZOA 4B6PA 4H1UA 1U5AA 2EDCA 4FINA 1IOVA 4MVJG 4M6WB 4B4UA 1XALA 2HBQA 4C7XA 2WHYA 3A0UA 4QHTA 3GW8A 5JEEA 3REGA 1H2WA 1ODIA 1QP7A 4RGVA 2ZCVA 3I0ZA 3QPBA 4KQFA 3FZNA 2ZTMA 4GGPA 5JAOA 4BAZA 2NO4A 2WIAA 3V3KA 4OFBA 5JDCA 1WW8A 1BHO1 1KZYC 4Z4GA 3MS7A 4MAFA 3P0HA 1JZTA 5SV2A 5G1OA 4DV3B 1ZL2A 4BNFA 2PMKA 2JHFA 5E9QA 1FDTA 4Q1DA 3HEBA 2XUOA 4UBJA 2DSTA 4WERA 3B3FA 3Q7SA 1B93A 4FDMA 3BUSA 2H5IA 3LWDA 2C00A 2D0PB 5IBPA 3QOYA 5K0TA 5SY4A 4NHEA 3MJCA 4M46A 4EO9A 1AGNA 3OLWA 3G1WA 4HDCA 3B7GA 1PTJC 1QF7A 2DETA 4ZHQA 2IU4A 1VCHA 2PMCA 3NUQA 1UP6A 3KOMA 2HMWA 5IFLA 3CMCO 2BIFA 2O23A 2H2IA 3CNHA 1XMXA 2BFDB 3H5VA 1WB5A 3BE4A 4R9SA 4IQFA 2RGRA 2IU0A 4YEDA 5JQGB 4KR3A 2YXLA 1OYOA 4U7HA 2DPYA 1Y5IA 3ZXXA 5A5VA 2EP5A 2RI6A 5JXGA 1F7UA 1WJGA 3FMGA 3G0DA 3IVCA 4LDJA 1KQGA 2YWCA 1W5BA 1RXEA 3FAKA 2IPLA 2WM9B 4FIZA 1QG2A 3GLHE 2HYDA 2IX9A 4Q9DA 4D44A 1YVUA 1GG8A 4MRMA 1KJ8A 4WESA 4Z8XA 4HNUA 2H0QA 1FNSA 2AWNA 4R9VA 2O2YA 3V80A 1B4DA 3VFDA 4KREA 3KQPA 1GVNB 2OGTA 4UJ5A 2P75A 2X3FA 5FPSA 2QTLA 2YXEA 3BWBA 3DG9A 4O2AA 1XF1A 4U63A 2W2OA 2RGYA 5HG0A 1M75A 3CPSA 5JXJA 1YBHA 5HKLA 2HO4A 1DV2A 3I09A 4QXOA 2C3YA 3O2QB 1RXYA 2IJGX 4DIDA 3CW8X 1N36B 3W4KA 2JHGA 5HZHA 1J22A 3UKDA 3Q98A 4X20B 3OU2A 3T4EA 2I55A 1PGPA 3UV3A 4BX3A 5KYWB 2G9UA 3OFND 5PGMA 1JYSA 3IJPA 4KC0A 1G8KA 4QE3A 3IE0A 1JMYA 1G8PA 4EI9A 2XI4A 3BWYA 4X3CA 4DY6A 2I3GA 2YXDA 1UZMA 4PVCA 1TRKA 5LQAA 1GZ4A 1UJ6A 2H65A 2Q3HA 3CZPA 4HLDA 3KT6A 1NMSA 1NUPA 1PEDA 3D5TA 1T8WA 1KYZA 2BE7A 1UAYA 3PQ4A 4R2KA 1PR5A 1XVUA 3DKIA 4G1EB 1WVGA 1H05A 4I2VA 1N3BA 4M8LA 4S12A 5KTYA 1UT6A 4A8JA 3PI7A 1GSHA 1M1YB 2A1TS 3M1AA 2SCUA 2XVYA 1JL3A 1DRUA 1R88A 1UBHS 2CYCA 3K31A 4TLLB 5ALOA 4J0HA 3A28A 1NPTO 4DE5A 1USUA 1G2OA 5CJ2A 2FN7A 5JCZA 4C7OB 3FTCA 4GAEA 4JUBA 1GPBA 1P9NA 3Q7EA 3DZDA 5DGXA 1T25A 4X93A 2XH8A 3RFUA 1QGOA 2DUJA 1SC3A 2GBFA 4YO7A 3VZCA 3AVYA 1MVOA 1T8SA 3OM1A 5JMOA 1VM6A 1MIOB 4OOEA 4LPSA 4R41A 5EZ6B 3ZTYA 5I8PA 2ZRCA 1XEXA 1ZJJA 3L7BA 2WWWA 1KHHA 2X3YA 2D3WA 1PT7A 1NN5A 3HYCA 4KQWA 3NAQA 3X1KA 5JJ5A 3RC8A 3Q7PA 3V8QA 4PQYA 2CB0A 2O7NA 1P4RA 4MHOA 4F4FA 4UEOA 4RY2A 1TVKA 2BBOA 3PPXA 4XARA 3K15A 4BEJA 1SPBS 1NLZA 4X64B 1F60A 3MB8A 4H7PA 2ODBA 1K8YB 4BNVA 5K0ZA 4CMIA 3FTEA 1TQ2A 5CLIA 2AR0A 1M6EX 2IE0A 3AR4A 4P0PB 3UXHA 4YV7A 1Y82A 4YCJA 1GGNA 4YX9A 2J3JA 3LUAA 1Q7CA 3ZXSA 5IBCA 2YJGA 1FU4A 2C98A 5CR9A 4C0BA 4DG5A 3ADPA 2M1ZA 3OQJA 2DT5A 1SG9A 2FWIA 3WLQA 2W8BB 3LXRA 1E3EA 4EMSA 1JNYA 1BS2A 2Q4TA 4XJTA 2P4UA 1W35A 3I9V1 3RIHA 3WHIA 2D5AA 3WHLA 1P2DA 1UM9A 2I4TA 5FBHA 2WJGA 4FGWA 3SXUB 1G8YA 2WQ7A 3PUKA 2O0HA 3W8FA 1XTKA 3CRQA 4AK9A 5KSOA 1R0RE 2H2DA 1DIRA 5ALGA 4RVCA 5EWMB 4BNHA 1BDHA 1Z38A 3KDAA 5DTRA 3QF4A 4ZVMA 5EE5B 4XWTA 1JQJC 1YQWA 16PKA 1T4CA 1S01A 4YCSA 1FRVA 5CGQB 2FFRA 1K8XB 1Y3AA 2ZFUA 4RS3A 1EK1A 4YRLA 5ALSA 4IIEA 1LQTA 2QZZA 1MQ9A 1Z62A 3A9CA 3QWHA 3SYNA 3TQIA 1GOTA 2MIIA 1NQWA 3H6GA 4GMDA 5LBTA 3SYKA 4CQNA 2GMWA 1NIJA 2J1LA 3U44B 3RYIA 4TMXA 4OX9B 3ETDA 4RMHA 1G3UA 2ZAGA 1N5LA 1T6NA 4QGAA 3R41A 2NU7A 4MRSA 2HJSA 3GGCA 3I37X 2OO7A 1NG1A 3GLHB 4HCJA 4KVAA 2NZUG 3DAYA 4JC5A 3I2IA 3R6DA 2A67A 1JDVA 3H8JA 1ZH4A 4UEJA 3T0FA 4C20A 2V8BA 3KSBC 3EPJA 2UXBB 4PGMA 1GKIA 3C3CA 4P98A 2X6TA 2ONYA 5WRFA 3IEMA 3NOOA 1REQB 5J2TA 3A6LA 3FOFC 1P18A 4RUKA 3JYOA 1JDSA 1GU1A 2WD9A 2TECE 3C8ZA 3KHKA 3HN6A 1F5SA 2WD7B 4J16A 2IP1A 3OLYA 1N0IA 1PFWA 1W75A 1QF6A 3HXOA 4YMLA 3OLVA 3OSZA 1Y5NA 2J41A 3DBHA 3PXGA 1P1BA 3EIXA 3EQ8A 5TQ0B 2ZIXA 5CUQA 1ZM9A 1MV8A 4PYKA 2J32A 4PAGA 2REOA 4Q3DA 4QU8A 2KLBA 4KZPA 1TAUA 3ZY4A 2ZBDA 5JS7A 4JA0A 3CEHA 1Z4IA 4YJHA 5CFOA 3QQ5A 1RI2A 2YFHA 3ZW9A 4HT3B 1NZDA 3MMPA 2JH8A 4U7FA 4TZKA 1BSVA 1PLKA 1H8HD 5FPKA 1XWFA 3I6ZA 4IJ5A 3RTEA 1NVTA 4GL2A 2BMEA 1H2XA 2ECFA 5CA1A 3T5CA 1E6EA 2XY4A 4D3DA 4KXFB 2FN4A 1P5RA 3GDHA 4P5PA 2IUYA 4ZT6A 3RUDA 1J9GA 3C16C 4MWZA 4PC6A 3VC7A 5IZ4A 4DW8A 4D43A 4POOA 3S8YA 3K96A 1K6XA 1M6NA 4BRWA 1ISMA 5LD2C 4CDNA 1PNQA 5EPOA 3VR3D 5A2GA 1PNTA 1WHSA 1X7GA 3EPLA 1X80A 5AMXA 3L7NA 2VPTA 4YCBA 1XQ1A 4JL6A 5EP4A 2AF4C 3AOGA 1ESMA 2Z5FA 4QBFA 1WMEA 2ZT7A 2Y0EA 3R8FA 4US1R 4RD0A 4YMTA 1Y3FE 2AMYA 2NADA 1QNLA 4YJFA 3IH5A 2NSJA 1LDBA 5EJFA 1DDIA 4Q3AA 4BQPA 1KVUA 1NRWA 2VHCA 4E2XA 1RI1A 2AOTA 2I9KA 1V5WA 2IHUA 4JI4B 5AVYA 3KSDO 1RDFA 2I7CA 3AR3A 4OL9A 4CEIB 3B53X 3GNSA 3ZE6A 4BVHA 4DNOA 3WIDA 1RXIA 3UBTA 1FY2A 1T35A 2QVXX 1LX6A 4RU1A 2VJMB 3ES9A 5FYQA 1EYZA 1JP7A 4U9HS 2BRUC 4FNGA 2D1YA 3EDRA 1J8VA 5B6JA 1CY7A 1QQTA 2FMFA 2VT7A 1CY4A 3FNEA 3P19A 4LWPA 4OV6B 1S96A 4UDYX 1LKZA 4LV8B 5C1OA 3ETLA 5JS6A 4WBXC 2X0JA 1KSJA 1L4LA 1AT1A 3FNBA 4OHUA 2XHEA 1YQUA 4WOBA 4C3OB 4KQKA 4BQIA 5CA0F 5J58A 5ARBA 5IC6A 1SB9A 4G25A 1ISHA 2NU8A 5FLEX 1H2ZA 1P4GA 4BO2A 3EOBI 5CH3A 1TM2A 4NMMA 3WYEA 2AT1A 3L8CA 3IEVA 2VYQA 1VPTA 1IY2A 5A3QA 1YI0A 2HTFA 3ZLUA 1CEXA 4V24A 2XUFA 4WBNA 4PFKA 3U17A 1KZ9A 2EFCB 3O83A 1E7MA 1A9RA 3PS9A 4NCAA 2WWRA 2VHUA 1Y9DA 4TL9A 3F6SA 2AQKA 2J3LA 2O5RA 1C9NA 5KOYA 7ABPA 3VVMA 1YDHA 5IAJA 5AVSA 1MZPA 2W42A 4KXXA 3WV4A 1ZGGA 1U2ZA 2ONJA 2W2XA 1FK8A 4ZXPA 1BMDA 5L3VA 1WO8A 2HRZA 3LHKA 2VWGA 1CZRA 1RJEA 2CLIB 1TFUA 3OKCA 1Z36A 1FXWF 1W5AA 4O4LF 1E6LA 1ZK0A 4PRKA 5K3CA 4QWWA 3I76A 5D3MB 1PV1A 4JZKA 2JA2A 1BEUB 1Q83A 4KAJA 3EFOA 4LMBA 3ZNOA 4JLKA 1NKTA 5DU2A 4CHTA 3F73A 4BO1A 5LXTA 1Z3IX 3TAHA 1WA5A 3DV9A 5JAMA 2W6NA 1FU8A 1EE2A 1L3BA 1XA4A 2FG7C 1ZKDA 2Q5EA 1ZICA 3Q0IA 4K8OA 1KXZA 4IH9A 4XYBA 4AMBA 2IK8A 1FZTA 1Y1LA 5KYNA 5F9HA 1AE1A 2R1VB 4AIRA 2KSQA 2RH5A 1TYZA 1KU6A 4RSMA 2NVUB 2R79A 4QJ3A 1Q2XA 2HF9A 2FZ5A 2P30A 4M37A 2ZT6A 3OD1A 3JASA 4PAMA 2D5LA 3CURA 1BKDR 2TMDA 3MXOA 4HX2A 2CJPA 2QV0A 4G0QA 4RZQA 3V5NA 2KBEA 2NZJA 4OM7A 3P9QA 2BUCA 2X5XA 2G17A 2R84A 3GJ7A 3ABOB 1JECA 3JR3A 3CLHA 4RCYA 2UYCA 3IELA 3HU3A 4WLUA 3WADA 2CV2A 3KTDA 1TD1A 5FNVA 5KNCA 1FLDA 4ND2A 4BNZA 5JJBA 3K8ZA 1HH4A 4JWKA 5KINB 4O08A 2B4RO 4TVBA 3R9XA 3B9BA 1Q7GA 4GW3A 3HSSA 4KU4A 4ZRMA 2NMVA 2HV9A 3EA4A 3S7ZA 3W1VA 4MP8A 2JEYA 4F72A 3CZQA 2GA8A 5DN6A 2WWVD 4QM6A 4URYR 3PJDA 2QI9F 4LZNA 5FR1A 4F8JA 3TRFA 4BWVA 5AJTA 2ZWVA 5EVJA 3IXMA 3BAZA 4NX2A 4H15A 2OHIA 4EVSA 2B37A 4OFXA 1IU9A 3SSAA 2VPZA 4MGEA 2PLAA 3G59A 4MGIR 1U2DA 2CCGA 2GLTA 3LHSA 2CE7A 1NC3A 5DWDA 1PZEA 1ODSA 4LZWA 3GT4A 1MUUA 1DC3A 2IYUA 3TAUA 3WB9A 5HKBA 1JMKC 2QU7A 3HY6A 3V6LA 1FJGB 3VJRA 1V11A 5HRUA 4C2TA 2WHXA 3FAZA 1FP7A 3VKGA 1A71A 4HC4A 1LWNA 4LIPD 4S35A 3TEMA 3U31A 3C8MA 5JNVA 1TZJA 4K9NA 3BWMA 1M9NA 4FHEA 4NZMA 4WXHA 2NZXA 1RTTA 3O4HA 5DGHA 1V9SA 5DLDA 2DT8A 5U4QA 1WUJS 1GQOA 2PZKA 1LA2A 1T9AA 3H65A 4YBRA 5KU1A 5LUBA 2QW0X 1BCRA 1U7OA 2V7BA 1T9GR 2ZI3A 3H5OA 4Q1AA 1JHXA 1G7RA 4ROSA 1C8KA 4BZWA 4NEGA 1IUPA 4Q15A 9LDBA 1G291 2DC1A 3RI3A 1QONA 3T1TA 2YJ5A 4YH1A 4EA6A 3VSCA 4DA8A 4GRIA 1RCFA 2J07A 1ATIA 2WHRA 4JKOA 4UMDA 4K9QA 4C0QC 1CDZA 3O31A 5AUQA 2R9VA 2PM8A 8ABPA 4TMTA 1VSVA 3SZ3A 3HWRA 5JCJD 2CYBA 1OWNA 2XDQB 3E82A 4OO3A 4Y9SA 3A4YA 2WA1A 3VR6D 1UPTA 3EXHA 1QQAA 5JOQA 4MGHA 5EE9A 1CJBA 4CMAA 3F46A 3FR8A 2BKUA 3CWQA 1YH3A 1Z8FA 4TLCA 2FPUA 2GKGA 3C7TA 1EK0A 2WB4A 1QOQB 1F0YA 2ID4A 4NBSA 4PW0A 2GNPA 2A86A 4B74A 3Q3EA 1EI9A 1L7MA 2ZAMA 3P2OA 1TO6A 1CUAA 3OQPA 2AJDA 4D42A 4B6RA 4WCFA 2DAPA 2FE4A 1G8AA 4JVLA 3CSUA 1O1YA 1YVRA 4JI8B 1BXRB 1LC0A 4XEHA 1M6WA 5ALJA 3RRYA 3OUZA 1QCYA 5AJVB 4HVLA 5KJCA 3T1NA 3PHCA 4IF6A 1N5RA 1MXFA 4HGNA 4MVJD 1Y1PA 4I4LA 2C0PA 2Y0PA 4YRPA 3RO7A 3D3QA 4ON9A 2MCFA 4N7RA 1HZZC 1UF9A 3PNMA 2ZI5A 1MX1A 2YQ5A 1IK4A 3R5KA 3B7WA 4KK4A 2P6MA 1K5GA 4LS3A 5CT8A 1X8KA 3BSSA 4KNVA 3RD5A 3O8OB 3L92A 3BB4A 4WOKA 1PYOA 1U4SA 2X7XA 3C7DB 2GDJA 2OXRA 1BFDA 1W4CA 3AW9A 5GWXA 5BN4B 1CSEE 1L4EA 3AQIA 1H4SA 4N41A 1U3WA 1UFVA 3O8NA 4I6GA 3TTTA 3EQZA 3PQ6A 4G1BA 4NWIA 2BMWA 2WBLC 2E1RA 2XKJE 3BZBA 5CX1B 3UXMA 4IDAA 3ZCUA 2WTXA 4EKYA 2X8AA 2B6HA 3TTUA 2RG7A 2PT6A 3RV3A 1DPFA 1QPGA 2OBLA 4KVGA 4UNIA 1V7PC 4OHZA 5FRDA 3VU3A 4DIFA 3JW8A 4OGFA 5SZHB 3SC3A 3ZHTA 3RG2A 3EB9A 1W52X 5IJ0B 5EIWA 3V6MA 1Q3TA 4R1MA 2WU0A 1SIUA 1XO1A 4P3NA 4X7PA 2QE7D 5GZ3A 1OB5A 4FGUA 2H18A 2XYRA 3BDAA 2PJDA 3GVCA 4AO7A 1DXQA 2VYNA 5C7YA 3S1SA 3T6KA 3P27A 3CLUC 4KO8A 2VDOB 3ENVA 3EEYA 1JJVA 4PTYA 4QG7A 5C8YB 1OB2A 3FUCA 2VZEA 3PD0A 1U2GA 3OQHA 3PZBA 2F4NA 1UBOS 4CEHB 4AUNA 4FFBA 4LFCB 2ZANA 2ZUSA 1KSFX 4KQEA 3FFAA 3HJBA 4XRRA 3ZX4A 4D2IA 1GYPA 2YYZA 4O1MA 2J9YB 3IQZA 2PUCA 4KVFA 3UGJA 2JGLA 2RB4A 2EZ9A 4BO9A 3DMHA 3BF8A 2GN4A 4B6GA 1GGJA 2WJIA 1G5IA 1VIYA 4GYWA 4PG6A 4QRHA 1AHNA 4FILA 4QOIA 1Z6AA 2DZDA 3K1YA 2PMEA 1NBWB 4DWOA 4FWTA 5F21A 5C3UA 1XLTC 4QDUA 4DILA 4F4CA 3AVUA 2OM6A 3Q40A 1ZS9A 2QL7A 1DZIA 3QLUC 4G01B 5DM1A 3I2YX 1P8AA 4TYMA 1Z75A 4EEZA 1PHPA 5KIAA 3IQEA 3KZOA 3I8XA 1FCJA 2ORWA 3TE7A 4DA9A 3S2GA 4XIGS 2FZGA 4Z86A 2B3TA 2WYOA 2NUPA 3L6DA 5GAJA 4F9FA 4JXXA 3HO8A 4E7OA 1RAAA 1QRTA 2JG3A 5E9AA 2C3UA 1IATA 3QELB 3ZVKA 2GX6A 3LIPA 4Y6RA 3ZYZA 1EJ2A 3KU1A 1NUHA 2PSSA 1FP1D 2W58A 4W5WA 3SX0A 5CFLA 3FF1A 4XJSA 3BH0A 1WKBA 3ZXIA 3E3NA 5LDGA 3VPDA 1PX2A 3DUFA 3WYNA 1JQBA 2D6FA 2QTHA 3QYAA 2BE9A 2AYZA 3C6ZA 4YP7A 1N6OA 4KKVA 3K94A 1SUFA 1AXEA 4I46A 2QMZA 5KHAA 4D4JA 5CBKA 1JAIA 1DT3A 2O0JA 3I2JA 2BFNA 2C92A 4CIWA 3SEAA 1FDRA 1E2MA 3PTZA 2ATXA 4L0DA 3BC1A 2DBRA 4IVPA 2WKPA 4R1LA 1FVFA 2XTAA 3CA8A 1I33A 2IYSA 3F7TA 3UH0A 5GGXA 3UA3A 4IDBA 1CB0A 1DG1G 2WUGA 3AEKA 4AX8A 1ZUHA 3HJHA 4ERXA 2J3QA 4HATA 3UV6A 2W48A 3KYCA 3IQIX 3WIOA 4EGAA 3GU3A 1APBA 3TH5A 3LKZA 1NVAA 1P91A 1C0PA 1NAHA 1NASA 3FVWA 3LOUA 4G0YA 4Y8VA 3VHQA 5KX5A 1R16A 3ZIAD 3U4QA 1EP9A 2FF5A 1OH6A 2XYHA 2XITA 2PWZA 3E8MA 3MUNA 3G2HA 5HE9A 2Z98A 1JDBB 3I04M 1FA9A 1YR6A 2A5YB 1PGQA 4OMCA 4AJKA 4QGBA 3COVA 3JARA 2QTTA 2HB6A 2CCKA 1SZPA 2ZKIA 4I5FA 3S27A 4KMOA 2HRDA 5C35A 4Q48A 5K6AA 1TT7A 4MP6A 4R3UC 3TNLA 5EIOA 3ROXA 4UE6A 4Q9JA 4YAJA 4G1CA 5IEJA 2DG2A 1NXTA 4Q82A 5DHSA 1JKJB 5FB3A 4CI9A 1PW7A 2YJ6A 2JCBA 5FUVA 1WBJB 3E22B 1K88A 4QT0A 3RC9A 3QGMA 3LQ2A 1FS6A 4PSVA 3UENA 3I6IA 3AKYA 1CUJA 1SFRA 4GRAA 1OZ0A 4Q21A 4V0SA 2JKVA 1PW5A 1Y1RA 1EFKA 4YRQA 4GSKA 2BGKA 1H9CA 5F5NA 1HT0A 1Z8NA 1QOPB 3T3MB 3DAOA 1JHVA 2CFCA 4QULA 1JSXA 1VTKA 4PICA 4F6CA 1Y6RA 4RESA 2I2FA 3LDGA 5DOZA 1JAHA 2BMFA 1H8ED 4CHGA 3OOJA 4OQNA 3RCBA 3MPUA 1GQRA 3MSCA 2PTHA 2EKDA 4EHFA 3IBFA 1D2HA 5EJMA 4YQFA 5GM1A 1G7SA 4Y6OA 1RRGA 3PHIA 2QP3A 4C3ZA 2XGSA 2LDXA 3PC8A 4Z49A 3O1HB 2OO5A 4B3MB 3NKVA 4HMOA 2ZDQA 1JHDA 4KO1S 1A82A 3ABIA 4Z8YA 2OR3A 3TD9A 2AN9A 1D2MA 1FFSA 3QIVA 4HXEB 4PBRA 3OQNA 3D3EA 5E6UB 5G3ZA 4A92A 1YHZA 2VRWA 5HCNA 2DECA 5L53A 4JR0A 3A1WA 3IJRA 3UWKA 3FI0A 4WKNA 1E94E 5D85A 2H54A 3DM9B 5DNEA 2EX0A 4M1WA 4BO3A 3FDFA 1J1UA 4PYQA 3ZCSA 2X2FA 1B8PA 3L4BC 3DQZA 1XG5A 5LZ7A 3L7CA 2QG4A 4E32A 1KPGA 5BMVA 3V7UA 4GQIA 3T7AA 4CT4B 1XLUA 1QYVA 2IUSA 1W5FA 4OUDB 2VBCA 5AXDA 3NWEA 1AKYA 3U6KA 4CF3A 3AR5A 1KZ7B 3KDPA 4GR5A 4MTLA 2P2LA 4R8LA 4B48A 2NQ2C 1OSNA 1UKCA 1Q1AA 3ENKA 3QYPA 5IU6A 3B6MA 1GGHA 1POXA 1ZFNA 3CLRD 2IBSA 1RBZA 4B2PA 4NICA 1TU4A 2CBXA 2JFOA 2Y1KA 3ZK7A 2P8SA 4HH1A 1XHEA 2VDLB 1J8QA 3AM3A 3E0XA 3NHWA 2M6RA 3UBMA 1WTCA 1QS0A 1HG1A 1AF4A 2Y4NA 1VC2A 3D3WA 3A4VA 3BHMA 4YNBA 3TDMA 5EJ2A 4WY5A 4W9NC 1VCNA 3ASZA 4N49A 3VHXB 2OCXA 3T12A 5CYGA 1A9YA 4LNHA 3N05A 2J3DA 3EW7A 1MAVA 2X2EA 3FMFA 3KLBA 4RIGA 1FSFA 2QTMA 4ZEXA 1HX7A 1Y34E 5IVIA 3ADBA 3RRFA 2O0LA 3WB0A 1D04A 1KY5A 4US2R 5DGCA 4BS9A 1Y4UA 4HD8A 2PVSA 4MVJE 1OC4A 1SBZA 2CZQA 1E7QA 5HF5A 4ZZ2A 5IN5A 3ZI7A 1BCSB 1KR2A 3HDHA 3DTVD 1JDNA 4WKGA 2ASVA 1Z0UA 2RGEA 3L7MA 3OZXA 3VTZA 4ACAA 4D3YA 4F2PA 1E4OA 1GGVA 1O95A 2VP9A 5KSYA 5E3HA 1IIBA 2H48A 4AJ9A 2EFJA 4ZIRB 3DM5A 1AHPA 1JQEA 2DUMA 4Z4FA 3WKBA 2YHAA 4PV7A 4TOIA 1ZHOA 2HF2A 4OQYA 3HCBA 2W93A 1I6LA 5EIBC 5T67A 4D98A 3KYDB 4S0XA 4FB5A 3FF4A 5B6IA 1MN6A 1D2CA 2C9MA 3BFVA 4TWIA 3RIGA 3RVJA 3KWMA 3BFPA 5BW4A 1YDEA 1VYUA 4RGBA 2VDMB 4IIBA 4MV1A 3BSWA 2UZAA 1JKMA 1FXUA 2OLKA 3ELUA 1HSZA 4IIXA 2DBQA 5HS4A 3RU7A 2IX3A 2QJFA 3NW9A 3IJ5A 1G5HA 4RK4A 4O4HA 4BV3A 1I2AA 3BMCB 1ZMTA 3DZFA 4MULA 4NXNB 2IH5A 4JOSA 4EJ0A 1UFRA 1J0EA 2AX3A 5ALZA 3UK1A 1XCPA 1BDBA 1JDJA 1XZAA 2ZPAA 3FKSA 3FZEA 4BFVA 3TOZA 4Q7QA 4JDUA 1U28C 3WA7A 1VBFA 2PJZA 1XROA 2P3SA 4S2UA 2RGNA 3GK3A 5BXQC 2XODA 1CJTC 3H1PA 4IRMA 1VG8A 4JGIA 4TT3A 1WV1A 3FPLA 5DGTA 3UCFA 1QQ7A 2JLRA 3MWGA 4J0QA 1Z39A 5DYWA 2CMHA 3HL0A 3NNSA 2DR0A 2F67A 2GRJA 2W6JA 1CTQA 2DFDA 1WSBA 3EG5A 3KUCA 2YVLA 3N6VA 4QT4A 1IG3A 3DCNA 5EUMA 1Z2NX 4UNNA 3VNRA 1G20E 2BWJA 4NBLA 3T3OA 2CL7X 2R8OA 5K0BA 2Q27A 3IVGA 1T1GA 4I55B 1KI2A 3TE6A 3N8NA 2F3QA 4TLDA 1M33A 1TZKA 4PFSA 3OOSA 2RHDA 4B4KA 3HWWA 3WYAA 2VCHA 4A8TA 2HV8A 2P5TB 5BSGA 5ES3A 2CXRA 1RWBA 3MBKA 3Q7RA 1YVEI 5A0VA 2YHBA 4UCXA 1J39A 4Q12A 2OFPA 1QM5A 4BECA 3V9AA 1TVMA 1SUSA 3KZ1E 4Y1RB 1Y9EA 5T4HA 2DMRA 1IDN1 2CJWB 2P2CA 3WP0A 5F64A 4I1YA 3PJFA 4KBFA 4COOA 6AT1A 3QVOA 5HIIA 1Y6GA 3ZVLA 2PDAA 3I45A 3JR7A 3LUCA 5LLTA 3P0RA 4HRAA 2R8RA 3TSAA 2ZJYA 2FW0A 2OG1A 3GJ5A 4G4SP 2C99A 5CIYA 4J49A 2FPXA 2XV1A 4L7QA 2P9ZA 4DCPA 5KYYA 1WOYA 1IAVA 4MARA 1OAOA 4HMQA 4L8VA 4KOEC 1JB1A 3RASA 5A1JA 2H8KA 2JC3A 3GFBA 3KWJA 4PNPA 5MGBA 3DV0A 4ZD6A 5SY9A 3KC2A 1YIAA 4DF3A 1R0BA 5LMNB 4HDQB 4B9AA 5U9CA 3IMCA 2BUAA 4M8IA 5EUCA 3UMJA 5JHHB 1R4MA 1ZVVA 4CEJA 3E27A 1NC1A 2B7BA 3HVJA 5E3IA 4B45A 1GPDG 5HOQA 3LOQA 4M8KA 3GA0A 4U6SA 4YPVA 3FA2A 2EU8A 1UZUA 1EFCA 3JV7A 2C4UA 1EVYA 3WK4A 4AN1A 4LJ8A 1YF3A 4ZFNA 2G4LA 4BP8A 2DEUA 4IIFA 2RHOA 2FA9A 1AO0A 5LOVA 4Q00A 1JLHA 4CM8B 1OWOA 1R37A 4EHNA 5JMTA 4Q3BA 5A9SA 4FC7A 4HQLA 1X1EA 2PRJA 4KDRA 4F91B 1EFLA 4RBNA 4AECA 5KUTA 4EIWA 1M2NA 5KVCA 2GK4A 3THSA 3A32A 4L74A 1IZYA 4KPUB 4MYCA 3M4NA 2NACA 2FEMA 4DDWA 2DY0A 2J6CA 1LLUA 3TTYA 4PGGA 3HBNA 5CRIA 3V42A 3KZNA 5DRYA 4R1OA 1IHYA 1KYXA 4UE2A 4E7PA 3AY3A 1J5XA 1JEYB 1E3MA 5ALKA 4FOLA 4ZYZA 5KYUB 5DSZA 3LAWA 4N7BA 1MAUA 6YASA 4U9UA 1DVRA 4C5CA 5J2UF 4YA6A 4YRAA 3TX2A 1RLUA 2AYYA 2YKGA 1PT9A 5HCIA 2XNJA 1ISPA 2QSJA 3WNCA 4RXMA 3C3XA 2Q2WA 4DVJA 1GU0A 1OI4A 4QVKA 1AY0A 2X0EA 3SHFA 2YOFA 1DBVO 1D0SA 1WNFA 2D5IA 2IYNA 3FCEA 2H51A 1EFPA 3G89A 1XAJA 3GEIA 1ZVQA 4JIGA 4P6VF 2XA2A 4HDNB 1SWWA 3P20A 4Z0NA 2Y1CA 4RELA 2WMDA 4ZVUA 3EZGA 4X44A 5JSYA 3IEUA 3Q10A 2VT6A 5K51A 4YV2A 4BZQA 7MDHA 4ND4A 1ES9A 1QAOA 2W2VA 4DPKA 3E05A 4JMPA 4JSRA 4MCJA 2VSYA 1JX6A 1USKA 2DU8A 2ZLBA 2C2WA 4R9UC 4UTVA 5TEWA 1G20B 2H0AA 1J09A 1RWNA 2VI5A 4M38A 4AS3A 3FWHA 1K3TA 4PCLA 2JFPA 3KFXA 3R75A 1SVKA 4F8YA 2V9PA 1AHHA 5CT5A 1CLUA 4MOWA 2C4HA 1TQ8A 2HX1A 1XFDA 3BXPA 5AHOA 5DNUA 3A1SA 1LDNA 1JFRA 2O3RA 2TS1A 3BQ9A 3N2IA 4PZZA 3ZX5A 4MR8A 3D6TB 5B6PA 2HWWA 2WMYA 4LTNA 2MINB 2FFAA 2R8BA 3IP3A 4OI2A 1R3DA 1WR8A 4WK2B 1I6KA 1G63A 2C5EA 1RP1A 1C29B 2VAXA 5T41A 3ECSA 4KJZA 4Q1BA 3UEOA 4R71A 1GRCA 1AA9A 1Z0DA 2MR5A 4JA2A 1LBIA 4BE7B 3QJYA 5IH7A 4OPMA 1ULBA 2CLFB 1LI5A 1E69A 5SYNA 3A6DA 2ZRPA 1J6UA 4KHZA 3PQDA 1EUCB 1ZN8A 1J0XO 4GOOD 1XCOA 4W63A 1A9OA 5CIWA 1DIHA 2QRNA 3KXKA 2QT1A 3ISJA 4PR0A 1Q21A 4W7SA 3QZUA 4UBMA 1Y7LA 4TN5A 4D8WA 1L5VA 2CMFA 2Q2QA 1YQDA 2VF5X 3CM0A 3MJTA 3N2EA 4RORA 4Z2AA 2JIQA 4KRYA 1NQOA 4F5YA 4CEJB 4F46A 1SCUB 3L4EA 4V0RA 3IALA 5CNKA 2WVHA 3ZBTA 2GBIA 2XEDA 4YR7A 1HBJA 4Y2XA 1YFZA 1D4OA 5B1SA 2O8BA 4Y6SA 1SGWA 1NM5C 1KDZA 3HXLA 4AN0A 1KKMA 3COZA 2UKDA 4XCXA 4BNJA 4D4MA 4YAIA 1N7HA 2PYZA 1XZJA 3GUZA 2XNCA 3TCNA 1LBSA 5ADWA 1CZNA 1SC6A 3LUBA 2JAXA 3QXCA 3NYWA 1EGVB 1VL8A 3RSOA 2X8BA 3PXAA 3I1FA 2AQ8A 5DTQA 1SUWA 2WZQA 4FNMA 3TWOA 2XQJA 1A4RA 1KYQA 1VFNA 3H6HA 5FHRA 5F73A 1MRZA 1QLWA 2FW7A 1WUHS 2GTPA 2PCLA 2VTEA 3BCHA 3FNFA 2ZIWB 4KW7A 1VHLA 3W3ZB 5LQCA 1PG5A 2IS1A 1EE9A 1Y48E 2PH3A 2ATIA 2PKQO 2Z2JA 3BA6A 4KUHA 4MWDA 2WUDA 4B31A 4IEEA 1ECLA 1S9DA 3K4QA 1YVDA 2P9TA 2WINI 3ZD9A 1NHGA 1Z5VA 2XOXA 4LMAA 3ND5A 1GPYA 4ECEA 2EJCA 2VS1A 4MVXA 2Q4DA 4JS0A 4IDPA 4N3AA 4MI6A 2PQMA 5CA0B 5J1SB 4KIGA 5BT8A 5FR2A 3FWKA 3FRIA 2PT9A 4ZAFA 4DG8A 1LRLA 3F98A 3QKRA 5I4KA 2NGRA 5JBNA 2IZOA 5LDHA 3UUEA 1QZZA 5ERYA 1MGOA 1SQFA 1U0NA 4X1IA 2WB2A 5L3ZA 2IDZA 3A4TA 3FVQA 2O14A 4KL8S 4I66A 1U80A 1ZRMA 3PGVA 5ILGA 1A95A 5A3SA 4HN4B 2ZUWA 3SLRA 2ZZMA 1MOPA 2N0SA 2ZJFA 1AKTA 1VRWA 3V8EA 4GP6A 4AY6A 2JANA 2W2KA 3JAMA 1X2EA 3KQSA 3BIXA 3KS9A 5BW6B 3E7DA 3V1MA 1PVVA 2C0CA 3V4RA 1Q12A 4P4NA 2JAPA 3D0OA 5BPHA 4GYJA 5DX8A 4BRSA 1QFXA 2QYTA 1PJ3A 1R8XA 2I54A 2OGZA 3G17A 3AKEA 3AR2A 4B80A 4B7AA 2HUNA 4CCYA 3K2EA 1DL5A 1U4NA 1RAFA 1Z6PA 1UJ4A 4I4IA 4C0XA 1W96A 1M0SA 1HR0B 3BIJA 1ZH0A 5HCUA 1QIFA 2ZJBA 1YNOA 3WAKA 1YTLA 3C85A 1PX0A 5LB2A 4BEVA 4CIVA 5BUZA 4EABA 1ECPA 5JANA 4MV4A 3Q3GE 1L7PA 1MH1A 2EKPA 5JD4A 1N4DA 1BW9B 1MJ5A 1SCNE 4R1PA 3QXXA 1MOQA 3H4VA 4NENA 3NHKA 4RANA 5KC8A 1GT91 1O7JA 1IB6A 1XRLA 2UVPA 3ZOKA 4ZYVA 5BQFA 3HCOA 4YUXA 3N6RA 3BL8A 4UXJA 3U26A 5JBQA 4E94A 3KR1A 2JCYA 4M99A 3FPBA 3QY9A 2O59A 1ZM3A 2BFOA 1O4WA 2BV3A 4P32A 1WXFA 2KB0A 1PJTA 5C52B 3N1UA 3K0CA 2CSXA 4HLCA 2IDJA 1WSWA 1JH9A 2JZCA 4CUJA 3A0RB 3R0XA 1H2EA 4QEDA 1F8XA 4LDZA 1B00A 2C2YA 3WK5A 4EGFA 4PHHA 2P6NA 1GN9A 2QL9A 4JOCA 3CCFA 1CE8B 3CLSC 2H7VA 4JLAA 2RCNA 3ZOZA 3OX2A 4JJ6A 1IB0A 4QYTA 5ITWA 1SBIA 4RABA 5B36A 3LZCA 3RYFB 4G5HA 2Q99A 2XUQA 4X8LA 1E4YA 4ZK2A 121PA 2H1LA 1HEYA 3QBVA 4ZRNA 1QIMA 1XMVA 1QR2A 3DKPA 3HU2A 4RAOA 4WQMA 3DWFA 4V39A 4WN9A 1HTTA 3L1HA 2R6GA 4OJKA 1XCBA 2EQBA 3WKCA 4CTNA 2CK3D 4KQMA 5HFAA 2FV8A 1DKMA 2Z1MA 1R5NA 4QDTA 5HNKA 4WEQA 4EWLA 4UTPA 3W5AA 4BFZA 3DE7X 3IBYA 5KI6A 5LZ9A 2DUUA 2J9FB 3LE8A 3OD5A 3H4MA 3AB3A 1QCDA 1HE5A 3OA2A 4ZALA 1X8XA 2HMTA 1C8BA 1KI6B 5ECGC 3HBMA 3KLNA 1MABB 1QGZA 2QN7A 3GXBA 1PDVA 2KYRA 1EFAA 2V0CA 2PFGA 1JG4A 4ISBA 4QDJA 4BNNA 2QN3A 1DFIA 1M2FA 2D4AA 1CQIA 1S4QA 3H42B 1QVZA 2JK1A 4XLLA 2XT9A 1R1DA 4NFYA 3WWCA 4EK9A 1J49A 1D6JA 1GP2A 2V97A 2MOKA 2FQQA 2R47A 3JZFA 2X9NA 3ZWMA 3D43A 4C89A 3WYCA 4KK3A 3A1FA 4PQRA 4YUZA 2XCLA 2JBAB 1Q16A 1YUBA 3O9VA 3RR2A 1DQPA 5EE3A 1JEQB 3MJEA 3WV5A 4WZ6A 4XSHA 1BEEA 2YWJA 3IA7A 1N5KA 4EYOA 4P4TA 5FJJA 1VPDA 2IT1A 1J1IA 3NWJA 4PNEA 1I5RA 1UL1X 4LE0A 5CXQA 1MC5A 3QUQA 4YJGB 1IZZA 4PGAA 4GYKA 1X7XB 4RYDA 1PEYA 1V1RB 3K6RA 2G9NA 5EXXA 5K8LA 2Q5LA 3EK2A 4MYHA 3S2EA 1LV7A 5DCWA 2FUEA 1MEOA 4PZEA 5THKA 1RR6A 4QLAA 3VC2A 2VNAA 5FUQA 2UUAB 2V0NA 4NRDA 4EX7A 3B2QA 1DO0A 3CR7A 1JGTA 3E7FA 4EKEA 1FJXA 4BNGA 2O54A 3TPFA 4KE8A 3NHFA 3OG9A 1HWYA 1D7OA 3A4NA 5DM2A 1N77A 4KWIA 2BCEA 4EOGA 2J4FA 4EY3A 1QHSA 3KT0A 2AJBA 4UOQA 4LC1A 3WDSA 4CU5A 4Q7MB 2JI8A 1R3UA 3O4RA 3D6UA 1IVYA 3ZKWB 1V5IA 3DLCA 2HNKA 2R3SA 2FPIB 1UJBA 3JPYA 1TCCA 2ZZKA 1Z9BA 2ZUVA 4FGKA 3ZYCA 2ZJ1A 2FFBA 1NP6A 3GCGA 3IDOA 1H4TA 1BE6A 4HWGA 5ESRA 4UFNA 3ZU5A 2W22A 1U0RA 1G5RA 1E2NA 4WX2B 3THWA 1D6MA 5E2AA 3R0JA 4DQDA 3CUYA 2QRZA 3HSYA 3F47A 1V6SA 3K9WA 5CDGA 3LUKA 1KY2A 3CEPB 1N7GA 2P40A 4I9FA 2DY1A 4LGCA 4LJ6A 3RJMA 3K09C 3GLIE 1S8OA 2V6IA 3RS3A 1FFHA 3RFCA 3GUVA 1G5FA 4FFOA 4O2AF 5HHTA 2ZQ5A 2NN3C 3GFRA 2YZKA 3SHVA 1N6KA 1FQOA 3HJNA 1I7QB 5JUWA 4N48A 1A04A 1DTWA 1CRWG 4A6XA 1L8XA 2Q3EA 2WSMA 3GAZA 4DMHA 4EI2A 1EFHA 1CW2B 1TZBA 1JSCA 1GFIA 1Z22A 1G3IA 3DDHA 3MHPA 3B9RA 3ZBPA 1RD4A 4OEHA 3WOHA 4FHCA 2AZDA 1YZTA 1R7RA 3PJEA 4RDHA 2V7WA 2Q9AA 3KB2A 4JL5A 4N7MA 2QK4A 4FFLA 2RJ3A 3KUXA 1E0AA 3HB4X 3BN3A 3IDZA 3HQ4O 2FEXA 3H5IA 5B3JC 2AW3A 1WVIA 1XL1A 2D2EA 3AFGA 3BKXA 1WDMA 3ORRA 1NVVR 4K46A 4XQEA 3WISA 3DXZA 4E5SA 1PK8A 4BGDA 1VZ3A 3R6LA 5LN1A 3HO6A 1OPXA 1T9KA 4EF4A 1VLLA 5JDCC 4EPYA 3LCCA 3GEPA 1SCKA 2CFTA 3ABZA 2GGSA 1KJZA 4ZDJA 2WYUA 4HKTA 2EZ8A 5I7SA 2J4DA 4ZC8A 3BHJA 5JD3A 1JR6A 3PTAA 1OLSA 1JS1X 3NCHA 2UZ4A 1EBFA 2XPCA 1R66A 1JHUA 4KXWA 4ASUD 2F1HA 3E48A 4FN5A 4OD0A 1TUBB 1EG7A 4J7XA 4YXFA 1E99A 1GNTA 1EE1A 5IAKA 2QN8A 1KVTA 3NH9A 3PQFA 1IQRA 3F2IA 1IPEA 2XX3A 3DWGA 1IIRA 2AFIE 4RCZA 4AKHA 2DF8A 2V6FA 2NYUA 4GXQA 3WFZA 4AJNA 4QQFA 4CQMA 4F56A 4C5AA 3OQ1A 4BYGA 4DNPA 4WJLA 4E70A 2FW9A 4Z4EA 2A0UA 2XQVA 1CD5A 4JT4A 5IJAA 1FW6A 5BSWA 4B6JA 4MYDA 2C2BA 4WW0A 4HWTA 1P5HA 5ILQA 4J1QA 1MB3A 4IHJA 4C4XA 3EVNA 3SE7A 5HK8A 4BQRA 5B3LA 3NFYA 4MRNA 3ZGVA 1IBCA 4ANFA 4EB8A 5HOEA 3ZNQA 3FLBA 2Z5GA 2DERA 4RDIA 4B7ZA 2AUMA 2DPXA 4NU5A 1G19A 4TVOA 4XLZA 4IZIA 2ZR0A 1XI2A 2YYAA 3CKMA 3KV3O 2QD5A 4AYWA 1DAOA 2JVJA 2QJRA 4DUGD 4TMZA 5BR8B 1MV5A 1JJFA 1T9HA 2VYVA 3H2IA 3HV2A 3HUFA 4KQ6A 3B82A 4UQPA 3P71T 1Z6YA 1COZA 2J48A 3QV1A 2A78A 4EQ6B 1OLXA 5JV5A 3OMLA 1E5VA 4MIEA 2WV9A 1NBEA 3N6XA 1P0IA 3WWOA 3N2NA 3IUYA 1P75A 5TIIA 1PQWA 2WNSA 3MTQA 3ORHA 4RWZA 2OEPA 1ZC4A 4YONB 5CB4B 1NX6A 3WGUA 5TNXA 1X7DA 2X58A 2CFIA 5JJCA 3TMKA 1MJNA 2I9PA 3PFBA 5GMOA 1N6HA 5MHTA 4XFJA 2D7DA 3AR7A 1VG9B 2AL7A 1GPUA 1HPLA 3PG5A 1QXSA 3OPXA 3Q1KA 3W6NA 4CV3A 2GERA 1II8B 5C8ZA 1PUIA 4EG8A 1RMYA 4RKEA 1L5FA 1JTVA 3AM4A 1WPGA 1M1NB 3O8CA 4D3SA 3WBFA 2NU9A 1EVEA 4A8JC 5JVDA 1XCMA 4KXMA 2MSEB 3OZWA 2GQ0A 5FTLA 2PR7A 5FOSA 3ZZ0A 1XCLA 5EJ5A 1K0UA 1XZGA 1S3GA 2Q5FA 4YK7A 2HSJA 2BGTA 3DDOA 3BXEA 3O91A 4JVNA 3ZQJA 2O4UX 3QNUA 3C3JA 1MF7A 4F92B 1FNMA 3T7KA 3L2OB 2QN2A 3H0EA 4QATA 4M1MA 4X61A 3GLIB 3CRZA 5DYIA 1FYWA 4WTOA 1XRMA 5TDHA 5ENZA 5T57A 5KWIA 1P3DA 3FTFA 1NW8A 1CUHA 3A06A 5J2TF 1PL0A 2FWJA 2BMVA 2ORVA 2Y05A 2Y1GA 4KN8A 4CNQA 1MJGM 1Q3KA 4DA0A 1TEVA 4AKSA 1DEHA 3D6NB 4OQMA 4DM7A 1PWYE 3GZNB 2HRQA 3LUPA 3PSHA 5EUBA 4DRXB 2ZBVA 3QVGA 4IDFA 2CL6X 4YAFA 1NOIA 5CFPA 1E59A 4Z3OA 4HOYA 1I36A 3R6WA 1F3OA 1X7WB 3PHJA 3DDZX 1M10A 1HKHA 2ES4A 4M7OA 1H85A 4Y2RA 2RFLA 3KR9A 4R1TA 4ZI2A 4L1KA 3SR4A 3FUXA 4MKRA 3EF1A 4TWJA 3DMFA 3BWEA 3HM9A 1HE1C 4GBED 3JYPA 3O1LA 2BC9A 1HZJA 1Y5LA 3CH6A 4Q4DA 5CA1F 1DAIA 2G9ZA 1O94A 3AK4A 4KQIA 3EUWA 2D74A 4O8ZA 3W6UA 1E6KA 3ZV6A 4UVDA 3PXBA 1VLQA 2YW9A 4EJSC 1W5SA 2KS6A 3HHPA 2W5UA 4LHWA 5HF6A 5BV7A 3C5EA 3LU1A 2DYKA 1QUEA 2Z2IA 3SQOA 2J67A 4DSOA 4FD3A 2HIMA 2JLZA 4GI5A 4EHLA 3IOBA 4MV8A 1CRZA 4DSNA 1EZ4A 1GLVA 3ICVA 1OWLA 4LY0A 4QBIA 2ZULA 1UBNA 3EZ9A 3CH5A 3G79A 1GCAA 3THOA 3FOZA 2PSEA 3KALA 3KKOA 1LBQA 4HAZA 4U7TB 4LBYA 3HE3A 4WNAA 1V3VA 4YROA 1XYYA 2AFIB 1KEKA 4AI6A 4E5NA 5FI5A 1GYRA 1ZEJA 3DEAA 4H4CA 2YASA 2Y0DA 3BG5A 3O90A 4FYYA 4RMJA 3M6LA 3U7GA 4JLJA 2H1VA 1DCMA 4I8IA 2FWAA 3NI2A 1U7DA 1E89A 3NWOA 1V8ZA 9MHTA 1WXXA 2QB5A 2UZ0A 4HLUA 4UNRA 2APJA 3F90A 2G1KA 1VGRA 3IMEA 4RPJA 3T3GA 1QPBA 1YR3A 2A9JA 5CDFE 1YBAA 4ZI7A 1N7JA 4HQNA 1ZK4A 1N9GB 2QUBA 3AHDA 1TCAA 2ERCA 4ZAZA 4NQRA 3HCNA 3GAAA 2IPMA 4D56A 1F3LA 1YL6A 3L8GA 2B7LA 2VK2A 4MYTA 3N8KA 4ARVA 3I2FA 3IUPA 2YHUA 4J16C 4HHEA 1WTAA 1Y1SA 2OAGA 2M98A 2R25B 4IUBS 4QUGA 5EJIA 4Q18A 4KSBA 2D54A 4HGRA 4RLQA 3U49A 1HFEL 3EUAA 1X1SA 5CT6A 1NRIA 1OC2A 1FYFA 1Y8QB 4RY8A 4KE6A 3N7AA 2EF1A 1RLMA 4WBNF 1CKEA 4LG1A 1OU4A 3L3BA 2ZTVA 3CVYA 3ESRA 3W1EA 3K9NA 4OK6A 1EQ2A 2QVBA 3TDKA 4G4IA 3QUTA 1P5FA 3VQTA 3KKPA 3ZDZB 1XRJA 2I3BA 1A9QA 3SEZA 3ZH9B 3U1BA 1OREA 3FFXA 3FHLA 2CNLA 5IDVA 4Z1MD 4C4OA 2YYSA 3H0CA 4CMKA 3JTEA 3RRNA 2XCSB 5TJHA 4J3JA 4Y2QA 2P77A 5EQDA 2VPXA 3WMXA 2YS7A 1J5EB 1L8LA 2I80A 5E1OA 2I3DA 3EEIA 4OKNA 3UYLA 5ALIA 4HS9A 5GY7A 2BFDA 3OY7A 3PGLA 3RVLA 3T3EA 3TLGA 3W7AA 4XWYA 1AD2A 2F9LA 4IJKA 5LXTF 4B6SA 2HHLA 5LQNA 2NO6A 1V4VA 4X7MA 4HGYA 2XGJA 1I3LA 2F3SA 4HXFB 1C9KA 3GJ3A 3EEFA 4RTNA 3AQ4A 3KCNA 3AF3A 4N54A 1T9GS 1U7TA 2RBKA 4FWIB 4ILKA 4P7FA 3UMBA 1MO4A 5IDWA 4ND6A 5E4TA 1BHSA 4UOZA 5K0GA 5T4EA 4A4DA 4M0KA 1J21A 2ZITA 4FBMA 2JHPA 5JS2A 2FG6C 4QDZA 3J80A 4Q7EA 4INPA 4X1KB 2EBWA 3FDXA 10MHA 5I9IA 4WZZA 3D7LA 3RJTA 3VR0A 2Z4TA 2R44A 2XE4A 2LCQA 2A9VA 4M9CA 3BRCA 3COWA 4XGQA 5FNVF 3TSWA 1E77A 4MS1B 4EH1A 1CZKA 1LX7A 5KYWA 3IUQA 4MPTA 2J5BA 4C07A 2HDOA 5IF9A 3FKQA 3ZDBA 3MD0A 3IUMA 2O05A 3KU4A 4HEA6 4HTFA 4NU6A 3VX3A 3AHJA 4LJ4A 4HRXA 3G0HA 4PC2A 3O8QA 4UTNA 2BJWA 4O4JB 4DCSA 1T1IA 3IQDB 3DDUA 5TT1A 2O2HA 4GU5A 4FJ0A 5A7GA 1HF3A 3PNOA 4L6CA 1VJ1A 2PMBA 1JHPA 3F1LA 3BULA 4K1XA 2QTFA 3L43A 3ZDCA 2IEGA 4EB6B 1DAFA 3FB4A 3AG5A 3Q2IA 4LC9A 4IINA 5ALHA 3BWXA 5LA6F 1BEZA 3MTJA 4C7OA 1NI4A 1SO8A 2V58A 4PONA 2PUVA 2V0GA 5AJHA 1IOLA 4DQUA 1Y6ZA 4TSFA 3OTOB 1QDLB 1TMOA 3LRTA 3QLEA 4MWBA 4OK5A 1L5HA 1ZLXA 2XTJA 5JYEA 1SXJA 1JR4A 1LDYA 1CR1A 2AYXA 2FMIA 1JSZA 2VSXA 3E9NA 2VDUE 3I9FA 4KXQA 1HL3A 1RFGE 2L42A 2H4FA 4P3KA 4JI3B 3VV2A 1OWMA 5BWNA 1MP0A 4N0QA 4PPNA 4Y9TA 3P5SA 3NATA 5EERA 1XZHA 2WSSA 3VNSA 4YMVA 3B2NA 3OCVA 1SUBA 1ULHA 1ZUNA 4ZVTA 4V03A 3IKTA 3N2ZB 1B2RA 4YJ2A 2A2ZA 1WSDA 3NAZA 3FLAA 4L9SA 1MNQA 4U3JA 3FYUC 4NNOA 2ZB8A 3FFBA 4EKNB 1JIXA 2HT6A 3TBHA 5BSHA 4DR6B 2OM2A 1QP8A 2EWMA 1HA3A 3OUUA 3BJRA 1F2DA 4TSRA 4XRGA 2VTDA 5SY6A 3PYXA 2JFHA 5DI9A 3EZFA 3IT2A 1ZPDA 1G6HA 2YJTD 1E6WA 1DAMA 3LBYA 4MV5A 3RUPA 3W8EA 4EYGA 4U7GA 5BR4A 4RVGA 1M2VA 3WSVA 3PGKA 3R77A 1YRWA 1EGMB 2BD0A 4ZI5A 2AHRA 1NWHA 4FEGA 1EP1B 1RHKA 1WPXA 2Q3JA 5KMGA 1N1MA 1Z0FA 3NXSA 4K86A 5FX2A 1KXJA 1A4IA 1FX0A 1OY1A 2OC9A 4RWEA 3VUFA 2CXQA 3HYLA 5IABA 4A36A 1GRRA 1PVOA 2CE2X 1TEXA 1L4BA 3DT8A 4AJJA 3D8HA 4ONEA 2XWPA 4PR3A 3ME5A 5J2UB 4LF5B 1GUFA 2W6PA 1HE2A 1OPRA 1QH9A 3AXSA 4YJ3F 1CUZA 4QLBA 4IG4A 4I1PA 1E1DA 3BXOA 4FQ7A 1U2SA 5HBRA 1U2DC 1ISRA 3NVAA 3ZV3A 3CE6A 3JATB 5JD5A 4AFNA 3JVDA 3HNRA 4IHKA 3CH4B 3LWNA 1RLIA 3Q3JB 3A9RA 1CERA 1YULA 5E1DA 4D25A 1PJRA 2IEAA 1UH5A 4NESA 2YWXA 2JFZA 1XNRB 1BVHA 3NPMA 1XTRA 2DPGA 3WWDA 4DV2B 1ISSA 1OH5A 1WEHA 4NEHB 1SCDA 2FZ4A 4AAYA 1WZ2A 2JFWA 1UP7A 3IPLA 3WIVA 1U0JA 2JFUA 4XTRA 3ND9A 3L1IA 1REQA 4U8HA 1EMDA 4G65A 2QPAA 4CL0A 1KJ9A 2D1RA 3BGDA 3P8ZA 1KZ1A 4GL4A 3CB2A 1E2UA 3NXKA 4MQLA 4L8WB 4NBKA 5AJUA 5E7JA 1EGQA 3SMVA 5CB0A 4Z54A 1UMCB 4HNAA 2E4YA 3R8XA 3U2QA 5CEJA 3DZBA 1Y5RA 4FHGA 2ROQA 4MUAA 1NSFA 3ZGNA 3OEHD 1PVDA 4KMSA 2QVLA 3FJYA 3KJNA 1I4LD 2O6LA 3TG8A 1T4BA 1GU7A 3Q1LA 3V4OA 4B8WA 1TADA 1ZUD1 2GRUA 4TLBA 3K9CA 5IYZF 3UH1A 4JOBA 4XD7A 4L72A 3DVRX 1XTPA 4KIJA 4R5HA 1KEZA 4XQCA 1SOWA 5FTWA 3KXIA 3L6EA 1GRNA 2F48A 3O9MA 3Q15C 1H2AS 3G2QA 3ST7A 3M89A 1W59A 2DR3A 1CJMA 2WHPB 3EQ2A 3NC1C 1KDVA 3TVYA 3WA6A 4CKBA 1ADCA 4NPHA 2DH5A 1ENYA 2Y66A 4E5PA 1KERA 1BWSA 1I7PA 4XIFA 4NZYA 3FCOA 1PT8A 3ZVRA 3WWEA 4XFDA 4E13A 3ZWBA 2P5UA 1I4EB 1N5IA 2J6BA 1P9LA 2EX1A 4X0EA 4ZMSA 2IA5A 3CTMA 1ZO8A 4KIFA 3LUDA 4LJSA 3MK31 1JQ3A 2BHLA 3PL5A 2GD2A 4NZ9A 1ZCBA 2X1VA 3GUCA 1L5LA 3UJPA 4JX8A 1B1CA 1M6YA 421PA 3W2EA 1XYGA 4NULA 1R0CA 4PTLA 1AS2A 3IVRA 2WF9A 1U3DA 2WF7A 4J1TA 5GV7A 1WMBA 4FYVA 2OLJA 4IFIA 3GG2A 5H7XA 1U1FA 1CNFA 5D3QA 2H7YA 4K6FA 3TI9A 1KI9A 1NT2A 3EJ6A 4F4IA 1LLCA 1H6BA 4OAPA 3OX1A 1SEVA 4Y2SA 2AS0A 4C05A 3IB3A 3DFUA 3D6JA 4QSHA 2J3IA 5FADA 2QAJA 1GPJA 1N2CA 2JDID 4YP9A 1H1TA 3UVEA 5HPYB 1Q14A 4YHHB 4PNHA 3IVMA 5HJ7A 5A71A 1BA2A 1OKKD 1WWKA 4OHOA 3RG8A 5BV1A 1HDYA 1JFFB 1QYRA 2ZYSA 1F20A 3Q0TA 3T35A 1UIRA 5B4TA 3RKUA 1KEEA 2VQEB 3I4FA 2Q8NA 5BURA 3H11A 1P60A 3B1YA 1XNHA 2XMPA 2HFJA 1N8SA 1URPA 4M76B 3PE3A 5AQEA 1UC5B 3S5JA 2XOEA 1G5TA 1Y4SA 1PBNA 3KHUA 4NAVA 1E9SA 1P7PA 2P7HA 5AJZA 1QV7A 5DP1A 1E60A 2IBMA 1U2GC 4LKRA 1H1LA 1M83A 4J94A 3IMGA 3EX7C 4NHOA 3MG9A 1KWKA 1AKRA 1JFVA 4ENVA 1XDBA 4K6HA 2V1UA 1ZVJA 4DCUA 2WIFA 4PC3A 5DNWA 4NONA 3CV3A 5ABPA 4TQUS 3RRXA 1UBSB 2IPXA 1N5OX 2PZAA 1XJQA 1N25A 3X2FA 4A7PA 3BE8A 3UWDA 3A05A 3OIVA 4C6HA 2REXB 5FEUA 1PGJA 5JCOC 1YB4A 3ZHZA 3AXTA 3LNCA 1FFGA 4PYIA 4EX6A 1W87A 4CNBA 4O63O 1K86A 1SAYA 4B46A 2AN1A 5JRJA 1C3OB 4U7WA 5K3DA 2GZHA 2DBVO 4TX1A 4LYGA 4C06A 4B6FA 3MPOA 4DHEA 3OTWA 4WE3A 2FXIA 4MZXA 4BMYA 5BSRA 4DMLA 4TKVA 2E1PA 2FRXA 2PGIA 2IIVA 4O29A 3SE0A 4HDAA 4M9SA 5KTTA 1TM4E 3DHNA 3KSZO 5FULA 3CZ4A 1K7SN 3V2IA 3TQOA 4BX0A 5EKTA 3DULA 2GEDA 1GZSA 4G5SA 1L7OA 3O7WA 1C1DA 5EMMA 1YTUA 3OWHA 4J90A 3SF8A 1XELA 4YI5A 3CO5A 1S8NA 5LR6A 2EJWA 2NPIA 1UEIA 2GZ2A 4O5OA 4YJKA 4YRGA 3TECE 4NOLA 4AC9A 4HN9A 2GO1A 3U3DA 4XPIB 4N8DA 4B3BA 1T36A 2GM4A 4QZVA 4NK5A 3RSZA 2RCYA 5JRDS 1NW5A 1JH8A 3NNNA 5FWYB 4RV9A 5BRJA 2NXJA 1RT9A 1W2GA 4NU0A 4XASA 3OPVA 5FTMA 4EENA 4W9MC 1UT5A 1XMJA 3FPGA 1BROA 4YRCA 3TGWA 7ADHA 3LECA 5KOJB 5G0VA 4JY7A 4MW4A 2CC2A 3WBKA 2WKRA 2ZYVX 2DH6A 3CZAA 4IJQA 4OFWA 1USVA 5C1BA 5FLYA 1M5RA 2FK7A 3G8DA 3GJYA 4ZO7A 3H3JA 1XXHA 1N2HA 3V2HA 5BMVF 5C18A 2BI4A 2ZJAA 4X24A 4QYSA 1ZITA 1BX0A 2V3WA 4GO1A 2HK8A 3LCRA 5BN5B 5G0SA 4LVNA 2WUWE 5JNSA 1OZHA 2ZE5A 3T4UA 3DAHA 5FL7D 5EJAA 1DSSG 2C9DA 3OHPA 5EXDA 3U1TA 3LPMA 1DG3A 1IULA 4B75A 3R7LA 1A1VA 3WKDA 4BE9A 2QAGA 4ERNA 1QYWA 2QN9A 1SEPA 1EUYA 3IXQA 3UC5A 1I94B 3F7MA 3GT3A 5UKDA 4K1LA 3IMKA 4E30A 3A6GA 3KTOA 1XMQB 1QHHB 2FJPA 1W85A 1P31A 1S2MA 2AVNA 2C2MA 4OHKA 3VOBA 4CWAA 1FMCA 5BSKA 4YAGA 5LLSA 4P0QB 4RQTA 2C5AA 1E3JA 2B36A 2BFEB 3LFUA 5J4KA 5JXWA 3JQ7B 5ICSA 4IVNA 2Y99A 5CBPB 1M2HA 3PK0A 3W78A 3G2KA 4Q24A 2ZK7A 1UWKA 1AU9A 1BGWA 1BU8A 1YOVA 1UOQA 3HR7A 2A1UA 3AIMA 5EXTA 2Y8EA 1GARA 3PC6A 2DWOA 3HV0A 3N87A 4MDHA 2D13A 2OFFA 4ALNA 5DHFA 1TQHA 4QPJC 5CYOA 1IY1A 3LY7A 3OAAA 3UFXA 1XGKA 1R5JA 3K70B 4NJEA 5TGTA 4YP6A 3TJZA 3GLFA 2FF7A 1P4JA 4N12A 1MO5A 4FUQA 3TQCA 2VF4X 4DJEC 4N5NA 3IAEA 3UAYA 3EIHA 3VX4A 2IY9A 3E5HA 4KWCA 5DNCA 1ZZGA 1I1QB 2YVUA 1T9DA 2IXBA 4GDMA 1NAIA 2IHZA 2OO5C 3FYTA 1P0MA 3SVTA 3E6AA 1I3NA 4TVKA 3SQDA 1O9HA 3B6IA 4ESOA 2IHJA 1DDGA 3AETA 1TO2E 1H22A 3RFTA 4WKPA 4RL6A 3AI1A 1Q0UA 3KAKA 1WHTA 3PQ7A 4U2CA 1YBFA 4UU1A 3EMBA 4TXHA 4YTEA 3W2IA 5BV2P 1E9RA 2RI0A 3ZJVA 2AUNA 4FDLA 1DDOA 3WLKX 2L18A 4O4HF 1UJCA 1P1HA 2ZSAA 3LKVA 5D5PA 3EARA 1NMQA 2VRCD 2A0FA 4NOJA 2SKDA 3BIFA 3SKXA 1XQ6A 2FEPA 3WE7A 3IAM6 4A8HA 3KQUA 2ZT8A 1OBOA 1N3YA 1G6KA 3HVHA 3LD9A 4FEYA 4A23A 4AG5A 4C22A 2B25A 4QVGA 4ZICA 5A6SA 3PLAE 3R24A 4MS4A 2JAHA 3RVOA 3UJBA 1HYGA 3G2IA 4CKEA 5IKMA 2HBZA 1U5CA 2H92A 3FSEA 1N3IA 1J0BA 3I9JA 1YQEA 4FCVA 4QXQA 4XIJA 5EP1A 1SHJA 2QIOA 4EAAA 1FDIA 4LSZA 4EVRA 2QSUA 1S1CA 5K7SA 1I4TD 3OWOA 1QR6A 2EFGA 3EOAI 3I28A 3IP9A 3OZBA 2NUBA 2PT5A 3P2KA 4BEBA 3K05A 1T34A 4ZQCB 4IL5A 1GRVA 3DDCA 1HUQA 3IV7A 4JJFA 3RYCA 1MC4A 4MRMB 4WESB 3B89A 3N59A 1I6WA 1B6TA 1KKUA 2CHVA 4J91A 3WWPA 4YDHB 4ZC1A 3JQBC 2KI5A 2K7ZA 3OE4A 4HX5A 4O2AB 2GTHA 2K2QB 2D06A 2YZMA 4WFIA 2PZMA 3EIEA 5DF1A 4BVFA 3RUEA 4WOJA 5FV7A 3K6SA 1SVNA 2J08A 4MRVA 1NU8A 1XX6A 1PD0A 2XVZA 4BJ6A 2H1SA 4PG4A 5LQSA 3T5PA 5KPJA 2WT8A 2XB4A 1GV0A 2W8ZA