2XBUA

Saccharomyces cerevisiae hypoxanthine-guanine phosphoribosyltransferase in complex with gmp (monoclinic crystal form)
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
213
structure length
200
Chain Sequence
b'DKQYISYNNVHQLCQVSAERIKNFKPDLIIAIGGGGFIPARILRTFLKEPGVPTIRIFAIILSLYEVKVSRTQWIDYEQCKLDLVGKNVLIVDEVDDTRTTLHYALSELEKDAAEQAKAKGIDTEKSPEMKTNFGIFVLHDKQKPKKADLPAEMLNDKNRYFAAKTVPDKWYAYPWESTDIVFHTRMAIEQGNDIFIPEQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOXANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
molecule tags Transferase
source organism Saccharomyces cerevisiae
publication title Functional Significance of Four Successive Glycine Residues in the Pyrophosphate Binding Loop of Fungal 6-Oxopurine Phosphoribosyltransferases.
pubmed doi rcsb
total genus 74
structure length 200
sequence length 213
chains with identical sequence B
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 2010-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xbuA00
3MJDA 1BD4A 4RHYA 4QYIB 4TWBA 2PS1A 1VDMA 4RADA 2VFAA 1OREA 2H07A 1O57A 1P17A 1VSTA 1CJBA 2DY0A 1XZ8A 3NAGA 3OZGA 1DBRA 5KAMA 3DEZA 1A96A 4RHXA 5ESWA 4LZAA 4RV4A 3HVUA 1JLSA 4P83A 4PFQA 5BQPA 2H08A 2YZKA 3QW4B 1JLRA 1XZNA 1QB8A 1ZN9A 1P4AA 4P80A 1ECCA 1D6NA 1A3CA 1P19A 2EHJA 1J7JA 4Z1OA 1BZYA 3ACDA 4P82A 4M0UA 2XBUA 5BRNA 3M3HA 1ZN8A 4LZOA 4RQAA 4LYYA 4WN3A 3LPNA 1OPRA 1DQPA 4RAQA 1G2PA 4P84A 5IAOA 5BQOA 1QK5A 4M0PA 1L1QA 2JI4A 1BD3A 3MBIA 1UPFA 2IGBA 4RACA 1L1RA 1QCDA 3KB8A 1GRVA 1QK3A 2GEBA 2P1ZA 1DQNA 1A97A 2C4KA 4P3KA 4PAWA 1UFRA 4P86A 1Z7GA 4FYMA 4P81A 2PRYA 1XTVA 1IBSA 1G9TA 5IPFA 4X45A 4QYIA 1W30A 4MB6A 3OHPA 5JV5A 1XTTA 5HIAA 1XTUA 1WD5A 5KAPA 1P18A 3EFHA 2FXVA 3GGJA 1I13A 3H83A 3ACBA 1TC2A 3O7MA 4OHCA 1FSGA 1R3UA 3LRTA 4QRIA 4JITA 1A98A 4JLSA 4KN6A 1ECJA 5BSKA 1ZN7A 3ACCA 3G6WA 1ECBA 1I5EA 2E55A 5EUCA 2JKZA 4F8EA 1ECFA 2H06A 4X44A 1STOA 5K51A 1QK4A 4S2UA 3N2LA 4LZNA 4RHTA 1NONA 1HGXA 1HMPA 4IJQA 4RAOA 1G9SA 3S5JA 1NULA 2JBHA 4WMLA 5HKLA 5E38A 1U9ZA 1Y0BA 1DKRA 1GPH1 5JSQA 1I0LA 1QB7A 1A4XA 1MZVA 1AO0A 4M0KA 4RQBA 2HCRA 1U9YA 2PRZA 1PZMA 4RHUA 1VCHA 4RABA 1A95A 1DKUA 4RANA 4ZFNA 2AEEA 1ECGA 4LYGA 3DAHA 1G2QA 1OROA 1I14A 1I0IA 1O5OA 5ESXA 1TC1A 1LH0A 2JKYA 1V9SA 3GEPA 2WNSA 3GGCA 1YFZA 1UPUA 1QCCA 3DMPA 3OZFA
chains in the Genus database with same CATH superfamily
2XRYA 1E9CA 4D3SA 4AT1A 3GT7A 4Z2YA 5KPDA 2NXWA 3FFTA 4PZCA 5F2OA 4TWBA 1MV8A 3NYWA 4J1TA 5IF9A 1SZJG 1YQDA 1DOAA 2NU8A 3FDZB 3E03A 5BWOA 2W6MA 5SZJA 2P91A 4M53A 1KDVA 4IYRA 1EWVA 3T7JA 4DM7A 2FPOA 4LRUA 3ZWXA 2F48A 1FBNA 4GGPA 4CODB 1I8TA 3OZCA 4DQDA 2DQSA 1TM2A 1YOBA 3AUYA 3E9NA 4HVAA 4N3BA 3HBFA 4Q21A 2H1HA 3W5AA 3HS3A 3IUYA 4MLCA 3A6EA 1FB5A 2OY0A 2D3TA 1MIOA 3THWA 5FLXA 3JWGA 5FR2A 1IAVA 2R9VA 1RYDA 2AIRA 2IYQA 3HHEA 1M1UA 1ULUA 3GUZA 4I1OA 4KYUA 4F4IA 1ZOSA 1KMHA 1ML4A 3GNSA 3HO8A 5EZ6B 4N4AA 5D2CA 5EERA 1OPXA 1FFXB 4K8RB 1CR1A 4PICA 2O5RA 3OQPA 4OUKX 2FMIA 4RJKA 1DAMA 3DFUA 4IDHA 3X0DA 4B32A 4LRQA 2BM9A 4ARBA 3B9PA 4PRZA 3KFVA 3LXXA 4KXFB 3QX3A 3U56A 2XA2A 4WFIA 5FV7A 5GM2A 2ZZNA 3DO8A 3B9BA 1BDMA 1WBJB 2CWDA 3AXTA 2X9QA 3JD4A 4D8UA 3L6UA 2XYPA 2GD6A 2EG9A 3DW3X 3NHUA 5DHQA 3LRPA 3RF6A 3VSCA 4LX8A 4EABA 2ACKA 2YFKA 2ZM5A 2VP3A 2AOUA 5K8JB 1RHJA 2ONCA 5E6SB 3H4VA 1ZMOA 1PK7A 4LOIA 4PAQA 4QOFA 1X7YB 3H5AA 5J63A 3T3OA 3DCNA 5F2KA 2VCHA 3WGKA 3FROA 3RT9A 2A6PA 1NW4A 1NBMA 2ZETA 5LWHA 4AM8A 1I7LA 1D9XA 3GUHA 5K8CA 5ED4A 1XPJA 2B5WA 4AU1A 5BP7A 2BFEA 1NYQA 2FU5C 1YE5A 2QDXA 1KQOA 4NWIA 3I5MA 3OBBA 4DA4A 3COPA 3F3KA 4NU6A 1T1IA 1AF4A 4U2GA 1TAUA 4EPTA 5C8ZA 2E5FA 1FDOA 3OLCX 1VBFA 2Z56A 2C3PA 4NU8X 4ABTA 4E2YA 1DCMA 1CUHA 3OEYA 3LHDA 1R0YA 3RC3A 2YRFA 5KNCA 2Y1FA 1HDGO 3JV7A 2WYOA 1Q17A 4JFAA 4RPKA 4TV8B 1Z83A 1NF2A 4O5AA 5TGZA 2Y0CA 3ZJUA 3U60B 2WZQA 1IC6A 5EPOA 5FL7D 5AM2A 4NENA 3RH0A 4E30A 3R77A 4QE3A 3KP1A 1WLSA 4HB2A 4JNKA 4Q7EA 1E6LA 1V4BA 3ASUA 4GGOA 2O19A 1NRIA 4MXDA 4RTJA 4OU4A 4D9NA 2JJ1A 4E1AA 5DGCA 2JLRA 3DZCA 3BIFA 4JYCA 1SU6A 2ZI5A 4K46A 2RHTA 3F2IA 4HGPA 4AY6A 3NBUA 2WF7A 5TQ2B 3E9CA 3ETGA 1IZ0A 1YDMA 1IHYA 3RYCB 2H2FA 2P1DA 2QMQA 4XW2A 3SI7A 5C3MA 5T7BA 5CVEA 1B6RA 3M82A 4WXRA 4XIYA 2B0JA 4PC6A 5DIZA 1V9SA 1A8HA 3A6FA 5BSEA 4YJFB 4F3TA 1PFWA 3RKSA 4U2DA 7MHTA 3M6XA 3TBFA 3B6ZA 4L5CA 4B48A 4BFZA 2GD2A 3O1JC 5BQ5A 4J0JA 4EAQA 2R6R1 1RWMA 5D5PA 3SP1A 3N39C 1G3UA 2FPPA 1BS2A 2WUDA 1I3LA 2ZSBA 4WD3A 1FYWA 1GPDG 1BH2A 1A7UA 1Y4DE 4JCCA 4OB7A 5DYNA 1ONNA 4IYJA 2KBFA 3M6LA 3PYLA 4QVIA 2TS1A 1XMQB 3SXUA 4Q1DA 3L7DA 4JGIA 2WT9A 3OJFA 1T0BA 1L6RA 2JFHA 4PLYA 4DMGA 4NKRA 2AQKA 1V11B 2C1EA 1DKOA 1NF8A 5I4BA 3RRXA 3DMNA 3KQOA 3WK6A 4YFVA 4DPMA 3NVKI 4QRHA 3MXTA 5IW8A 1WCXA 1SGWA 4GSKA 3RVMA 4UM9B 1BXGA 1Z56C 3K32A 4HPJB 3MWDB 1TVKB 4BS9A 5C8DA 3DG9A 2A5LA 1TQ8A 1KOGA 1JI0A 1A4UA 1T91A 3I01A 2BI7A 4PAOA 2D5CA 2QMEA 2UVDA 1VPDA 3NIBA 4I99A 4NFYA 5LU8A 4MWCA 4EI9A 3TSCA 5EJGA 2YN4A 3NBQA 1M2KA 3KYCA 2FKAA 4FHCA 4II7A 2OLKA 3EAFA 3HB0A 4MP6A 4F3RA 1JQBA 3OBIA 1GQSA 2RBEA 3PNSA 5CGZA 3RW9A 3EZ6A 3ITNA 1S1CA 1NW5A 5ILGA 4F3NA 1SU7A 1U2DC 3RSFA 1H5UA 2ZJ4A 5AD1A 1AVTA 1NSTA 4V38A 4ZVOA 1QQ6A 4WEOA 2FPSA 3IVXA 3ONNA 3QXHA 4G5HA 2XE8A 1PWXA 1W1IA 1RHKA 1ZQ9A 1N1GA 1W94A 1AMNA 1Z0JA 1U3WA 3FIUA 1YJ8A 4NMHA 3WGQA 2WUVA 3KKMA 4Q16A 4AC9A 3H1BA 2PH1A 1DAHA 4YJKA 4MCJA 3CPJB 4X94A 3EFOA 1W96A 4HRYA 5L7WA 2VDLB 4BLTA 5JS6A 4P08A 4DF3A 4CM8A 4KE6A 1HYBA 1OWMA 1ZNZA 4H6VA 4MVJP 5KVAA 1GYPA 2Q5LA 2X2FA 3IELA 2O7VA 5FO0A 1Q1EA 3OZSA 4TV9A 4U9HS 4EUHA 1F0YA 3UK7A 4ZC1A 5B1YA 3OZRA 4NDZA 3HJGA 1PJTA 4WLFA 4F56A 1CF4A 1G9XA 3I9OA 3HDYA 3N2KA 2DPHA 5IBPA 4GSLA 4EYKA 4EY5A 4KQEA 1O97C 2I7VA 1HWYA 2Q9CA 1NBME 1BS1A 3M1YA 1LV7A 4OTZA 3A05A 4UHCA 3RASA 4GKKB 3BA1A 4R69A 1PZMA 2Y66A 1USIA 1QYXA 4RD3A 3F6PA 1UZMA 1Y81A 2RH8A 3DC7A 2VJQA 3F6EX 3GWGA 3P32A 3T8YA 4CLHA 4O2AA 4CQMB 2GZAA 1LJLA 1TIBA 1ODSA 3CLVA 3R3HA 4C4TA 1Z28A 1U2QA 1IY9A 3PBKA 1G291 4DSAA 4KYIB 4DR1B 2CK3D 3BB1A 4YT2A 4N5DA 3RABA 3NYQA 5FP0A 3UUWA 1RXSA 1VE6A 1YRQA 2IZZA 3ILYA 3ZDRA 2P69A 3FVQA 3FZQA 3GVXA 5C35A 1GZDA 1DGQA 2G9QA 3AJRA 1ENPA 1EYZA 2GZMA 4MEJA 3U0BA 3VR0A 5KEIA 5J9FA 3MHTA 5KTOA 3O0TA 3PNLA 2A2ZA 2D6FA 3EASA 3I6MA 1GU1A 5FTLA 2Z6QA 3OCJA 4RY9A 1SCQA 2PLFA 4BE4A 3T12A 4D9IA 5BNWA 5CDTA 1ETHA 1LJUA 3FTDA 3WGZA 4JU8A 4Y6PA 2EBHX 2FG7C 2IY8A 2G5PA 5AJHA 4IXWA 3INTA 3Q7PA 4OSPA 2P5SA 4BNHA 1SIUA 1Q2UA 2H2WA 1G6OA 1JLRA 3HZHA 3NTOA 3LV8A 4RPGA 2HQRA 3LDHA 4GIBA 1G8SA 1TCCA 1WM1A 3MGKA 4EI8A 2C2MA 1TKCA 3CLKA 4Y2JA 1HRKA 3PE6A 2O3UA 4OP2A 1DI0A 4AZVA 2QTCA 1EVEA 2P4HX 1GG5A 3ETNA 3L4JA 2ZBPA 3GARA 1TYCA 2F3PA 5IFLA 1G4AE 4JROA 3TTVA 4PQYA 3UQYS 1IUPA 1M54A 1PV1A 3H2SA 3ZK7A 4TS3A 3KHTA 4CU5A 4ZTZB 3QUBA 4AJLA 1GUZA 5HOQA 4J1SA 4CQMD 1P2GA 4CIAA 3IV6A 3RYFA 1OFTA 1CRWG 1NSFA 2PD6A 4JX9A 3PTAA 1BGVA 3EZ2A 3FFWA 3FOAA 2ZT6A 5SZIA 3TRJA 4DDUA 3PE4A 4GOXA 3ZDDA 4IJVA 4OJKA 4B82A 3BXEA 3OEHD 2COUA 4IHKA 3RNLA 5F7XA 4QJBA 4B3GA 5KNBH 1PV2A 1R0XA 4DIUA 1ZM9A 1EFCA 1Q0QA 2WPNA 3BTVA 3CONA 3KCQA 1E3SA 1Z22A 4IX9A 2WUGA 3ROGA 4NATA 3T7SA 3KPJA 4J16A 1P6QA 2NUBA 1HE2A 2NNLD 2ZDGA 1VE5A 2ZCVA 3H1AA 4JL6A 3ZE2B 1GEGA 1ODLA 4H4EA 2F9FA 4X45A 2J0VA 4TKMA 4U7GA 3DR3A 1ZK4A 2WW8A 3IULA 3ETEA 3TW6A 1J2YA 1RBZA 1T36B 3IT3A 1FX1A 3R0QA 1TT7A 4NOMA 4A5SA 3HGQA 4NV0A 1T8PA 2FN7A 2YWEA 3GNTA 3H4MA 3ZCSA 1IEVA 1P44A 1S8FA 1GG8A 4C6SA 4C4ZA 5FTWA 4BTVA 4DBLE 1NJ1A 2HMWA 3K5HA 5CIWA 1Y6GA 2PGIA 4V0RA 4C7BA 3R9XA 5ICSA 3R3SA 4K40A 2ID7A 4YY3B 4F2PA 3C6KA 2XZLA 2N47A 1PNTA 1LFDB 1W0JD 3U3OA 3TSWA 2C7PA 4PG6A 3HCRA 4E7PA 1YRYE 3D1VA 1AH2A 1CYEA 3ZV3A 6REQB 1F17A 4QVGA 2Q21A 2I66A 3S5JA 2D8AA 1V8FA 4ZICA 2R65A 2X19A 4WMLA 1F60A 1EESA 1O8CA 2QW0X 4XPIB 1BXZA 1B6TA 2F1HA 4H7PA 5FWDA 5FFFA 3DLAA 2DCUA 1TA0A 2JATA 3NBZC 2QBYA 3JSAA 2JEOA 4QFBA 2CWWA 3QU5A 1N7GA 2CHEA 1ISMA 3NBMA 5D51S 2A30A 1ZJ4A 3ISVA 4JWTA 4AMBA 3EXIB 4CDMA 3EZGA 4OXKA 4KSBA 3W6ZA 3ER9A 1JBQA 1AS2A 3K09A 2PZKA 2X13A 5ES4B 1SUFA 1RWPA 5JD3A 2QG9A 5EGSA 4FFBA 3PTZA 1Z6AA 2FZWA 1GLVA 2C4HA 4LIPD 4TTPA 5AK5A 5KQRA 3HN6A 2G25A 3EEFA 3T7AA 3GEMA 1ZC3A 3LRXA 2RB5A 3E15A 3ZVNA 1DTSA 1CUYA 1D2RA 3C7KA 5LQJA 4YDRA 4Y6LA 4JJAA 1BA2A 4KWCA 4RADA 2AG6A 3TLYA 5FADA 1DXYA 1ZHHA 3AG5A 4GI5A 2H07A 1LUAA 4LSGA 2O5CA 1JU9A 1ZH4A 4WADA 4L5BA 3D3NA 1FP4B 4P36A 3NOOA 4G0VA 2D2XA 1I4OA 3WRYC 5JY6A 1WZIA 5AQ1A 1QG2A 4P34A 4PCVA 3RANA 4DLNA 3EK2A 2MSDB 5HRAA 1Z45A 2JJ2D 4DDTA 2FDCA 1NVAA 2X4LA 4E5SA 3VJRA 3G5UA 1TUGA 3WWZA 1KYVA 3S3TA 1RAHA 1SD2A 3KVOA 3PHGA 1P31A 3Q3VA 1KVQA 2X41A 2YFQA 4P82A 4S1OA 1OCEA 2WY2D 2NGRA 4R2JA 3IAHA 1ECPA 3WR5A 4DA0A 1ZOPA 1KDZA 1CUWA 5BNZA 3ROEA 4ACBA 2HSJA 2XNDD 3PQDA 1WP9A 2IIBA 5EHGA 3HADA 3LIIA 3KDPA 4FKBA 4AJOA 1JEQB 4EL5A 4JSTA 3W3AH 1H0KA 1LNQA 1DAPA 1QIHA 4DHWA 1RYYA 1UUFA 5EKUA 1MFZA 3OOYA 3HRIA 4TQUS 4UCQA 3USES 3OPQA 4C88A 3B7PA 4YBZA 1SQGA 2MOKA 3JQGA 3JVDA 2PH5A 2V4ZA 3HHPA 4P3KA 5T4FA 1UM8A 4KACA 4X91A 5EMLA 3PXBA 3QPCA 4RVCA 1C8VB 3QMVA 2J87A 1TO1E 2R6AA 1ZO8A 1M6VB 2XDQB 4CL3A 3TRFA 5A4MS 5AIBA 2QRGA 5JCOA 5AVXA 5KYYA 2XGJA 1ZCBA 4RTQA 3FYHA 2WFLB 3JRXA 5CBPA 2C9ZA 1BO6A 5JCOC 1H6BA 1D1PA 1JE0A 3HKCB 5LIRA 1SVNA 3AJ8A 4QYIA 4RGBA 2GPBA 5BUCA 4MK4A 1K08A 5JH7A 1TEVA 2PT9A 3GLUA 1CR2A 3RJMA 1PJ2A 3KB2A 3LOPA 2BGWA 2GSWA 3UTDA 4QBKA 4LDZA 5AKGA 3HJAA 2JA2A 1Z5PA 1PL0A 1IYZA 2DBYA 2OKCA 2ZVJA 4QBIA 4L76A 3C4JA 2QSYA 1VG0B 4N03A 2OM2A 2XUPA 4QSMA 4V3CA 4NP6A 5GWXA 3OHMA 4EGAA 3FY4A 5LQCA 2CD7A 4Z49A 3LM8A 4NCXA 5ETJA 5ANRB 1PKXA 3BSSA 3CW9A 3GG9A 4L4YA 3MUNA 3DLBA 1EJ6A 1NNEA 3E9DA 3M6UA 2WWVD 1ZC4A 1UPTA 3COVA 3K8YA 4QEZA 3Q3CA 5BV2P 3MJEA 2XTNA 1A82A 4ZOBA 4EUEA 2JIZA 3HCOA 3EXFB 3TKAA 4O1IA 1SQ0A 4AN4A 4D1YA 4F92B 4ND7A 4A27A 4C4OA 2E3JA 3NLLA 1EFLA 3KJQA 4X61A 3P0FA 4L0MA 1KYYA 5KVVA 2Y6VA 2AXNA 1YB1A 1SXJC 1Z62A 1NZFA 2HU8A 4OJTA 3GVCA 1B1AA 2IKQA 2V7BA 3C6MA 4QOIA 3PC8C 1EGQA 4GM4A 4KQFA 4EHHA 1K63A 1QRRA 1R5NA 3DBHA 4MW5A 4BRWA 1IRXA 2RHDA 4HH0A 4QYWA 3CHYA 3DEKA 5H80A 3T3NA 2C57A 4Q9NA 1Q77A 3A9UA 1WDMA 1Z8DA 3PB3A 4HDMA 2QD5A 2ZS9A 4HUJA 3DVAA 3UV6A 3P2YA 1YOVA 4LJSA 4HDSB 4E12A 4JI5B 1XZPA 2IYXA 4RC9A 3REQA 3TLGA 3K6JA 2QZPA 3L1JA 4ZXFA 3WHLA 2MINB 3F6YA 4TUYF 3OI7A 4R9NA 5D86A 4AF6A 5IM4F 2HBYA 1J21A 3D1JA 3DOUA 3MSCA 3PITA 4WZBB 4ZP1A 5KU7A 3BJIC 3AI2A 4EVQA 1CFZA 3EFEA 1WOMA 2PCLA 1MEJA 3O3NB 4KPEC 2PLRA 2V65A 3UGJA 3D4BA 4PW0A 1A3CA 1P1RA 3CIFA 4YMIA 3C3EA 4HAIA 1W2WB 2OBYA 3SK0A 4W8HA 3W5BA 3T5CA 2O9JA 1TD9A 1LD3A 2MYUA 1O94D 3Q0IA 3A25A 5DHUA 3AVVA 1JFTA 4S1NA 1J07A 1LY1A 5FBLB 3O03A 1F2UA 3BZBA 2M98A 1ADJA 3GMSA 1AUVA 1F2VA 2B2XA 4G41A 4XEHA 1G5RA 3T7KA 4FYJA 3K0CC 2CLEB 2F62A 2IUTA 3H86A 4MR9A 1OBCA 2ZJ2A 2PEZA 5ALNA 5GPBA 2NU7A 2VF2A 1QGDA 2MTBA 3O90A 4DPLA 4E13A 1I10A 1HDEA 4P31A 3AY7A 3TIVA 2B7BA 5MN5A 4C7OB 1KL7A 1HBJA 2XQVA 3F6BX 1E9AA 4XM0A 3LXRA 3NHJA 4OJMX 4O2RA 4FOTA 1F3LA 3AUAA 3W5DA 2BI8A 3K15A 1IBSA 3HGMA 2FKNA 3PXXA 1IM5A 4Q1EA 1ES9A 1J49A 4FB5A 4UAGA 1S4MA 2ZJ8A 3ZCXA 5DN6D 2FMTA 3GGJA 1YDEA 4PPYA 1QQTA 3FCYA 1PT6A 5SICE 4MWSA 2H1FA 1Z75A 3UAYA 1QHEA 1AQJA 2VCEA 4HDRB 3I2YX 4EW1A 1UT8A 4TOIA 3WLNA 5B1IA 1KS2A 3AERA 3JX9A 3D3WB 4FZVA 1G0OA 4MUIA 5FT9A 2Z8XA 4YAIA 3WLEA 4MV1A 1OBOA 2DPXA 4OFXA 4B33A 4BIMA 2JKZA 1YZHA 3VZDA 2ZJ6A 2XMRA 5DSTA 5AJXA 2B4KA 5LB4A 4ZN6A 5EYPA 4N82A 4DIKA 5I9LA 4U7DA 1BDIA 2FRDA 5CTAA 5AM1A 2E5LB 4GKJB 2VZ0A 1TZ2A 2VJOA 2ZFUA 3WQSB 3CNEA 2D3WA 2QB5A 2WM8A 4O4LA 3QXSA 1G98A 2Q7OE 4CQMA 4D0SA 4UFOA 3SPXA 1UODA 5CLLA 3FOEC 4HPWA 1UK8A 1AO0A 1K75A 4PQRA 5BNTA 1ZN2A 2AW3A 1JEQA 2COKA 2HEIA 1GUDA 2XVMA 3LUHA 5LCXA 4UEQA 5TARA 5JHHB 5JJBA 3KTDA 2MSLA 4MVJH 3RAJA 4UBNA 4O4JF 3M1AA 1C3VA 4CM9D 3N2KB 2YZNA 1HYQA 1FZQA 2P78A 3K35A 3O2QB 3PUKA 5JYCA 2JGJA 3OD5A 3UMJA 2GJKA 2WJ4A 2ZBRA 1ZIXA 1Z16A 1KSGA 3B6IA 4JT4A 5JASA 1VXRA 2ZTLA 1ZMXA 5BQ3A 3PRKE 2FGKA 1XTPA 1IQPA 2WHYA 5JTTA 4ZYVA 1UPBA 3KJGA 1EWYA 4CM9A 4EP1A 3LO8A 3QBVA 3DAPA 3CF4A 2C5GA 5KMGA 5GJBA 2WUEA 2IHYA 4GUAA 2V98A 4P93A 4V0MA 4GI7A 4I8DA 4EW6A 5I9SA 2JAHA 1NI4A 2ZIUB 3I28A 4KRYA 3NNDA 5AKHA 3B6JA 3WIOA 4MVJA 3KVVA 3R8FA 3DBOB 2HF9A 4OLJA 5CHEA 4TTIA 4ZVUA 3VZBA 1M66A 1SBIA 2XLBA 1I2MA 4HQ0A 4JQCA 1JHQA 1XO1A 1F6BA 1TLFA 4FMDB 2XF2A 2QP4A 3GDHA 2CUTA 5KDLA 2ZJYA 5KYXA 3V5NA 2AD5A 1P19A 1IWBB 3PP8A 4PYRA 1GUBA 6NULA 5DW0A 1YONA 5E7IA 3JD3A 3TG8A 3OKPA 3GZNB 4CDGA 2WIAA 1ABBA 3ONDA 3A3YA 4LZOA 3MN1A 3G9QA 3PU6A 4B75A 1Q0TA 1JR3E 3JPWA 3FNRA 4ALMA 1WW2A 4MW7A 2XT9A 3D8NA 5FA6A 2WZBA 4WPGA 1C2TA 2ZIXB 3DEIA 4FGUA 5IRCD 1K6EA 1VE1A 2A92A 5JH7F 5DGDA 4LV6A 3CLHA 2O2GA 4YI5A 4XDYA 2D06A 3WRXA 4NAHA 4BNTA 1LF0A 4UUPA 5E6UB 2CZCA 2OGSA 2BF7A 2O14A 1ETUA 1WCIA 2FX3A 2HDNB 2HF2A 4QWMA 4R1MA 4TT8A 1RHRA 3IVAA 3Q11A 1MRNA 4ND8B 4NZMA 3TJRA 3SS9X 2PZMA 2CLLB 1N9GA 3UWMA 3V1MA 5I47A 2NUAA 3M5PA 5D1NA 3MB5A 3I9KA 3H1PA 4CZ2A 4FWBA 4FR5A 1D2GA 1YC5A 5BRJA 5G0WA 4BATA 2JBAA 3JYQA 4X1KB 3QHPA 4MI3A 3JQCA 2OB2A 4QX6A 1B73A 1X70A 2NYVA 4QUHA 4EKIA 3W3AA 3LMKA 2PSDA 1OASA 4P9NA 1VJGA 4KKXB 4D57A 3LA8A 5TNXA 3RBVA 2I4LA 2YIVX 4N6GA 1E2NA 2Z9CA 3DDHA 3UHJA 2X3UA 3UKOA 2IUYA 1SHKA 2JJ2A 1PE0A 2VXCA 2WM2A 3IO3A 4LZZA 3EGXB 3VYVA 1ISFA 1P3JA 1V8OA 4NBTA 5HK9A 5C7LO 4X44A 4B6SA 1WZ2A 1CD5A 4AUEA 4WDQA 4COOA 4JEIA 3GH3A 1IJKA 2OCDA 2DXIA 1Y5IA 5LXTB 1L9XA 3ROQA 2NO1A 4AJ4A 2HZ7A 3ZV4A 2XI4A 4QGFA 4A91A 2OORA 4E70A 1QGZA 1M2FA 2XB9A 3LZDA 1IOWA 1I0LA 1JYSA 3ZHOA 5KTSA 2D1QA 3U9LA 4Q37A 4N5NA 1VA5A 1XMVA 2X15A 1NVMB 3PUWA 3PRHA 4LJKA 2ZATA 3D8BA 4BO5A 3DCIA 1HMYA 2R87A 1GQFA 3GJ8A 4JP5A 1S2IA 3UJDA 1LX7A 4XGNA 1PR9A 3TRKA 3IMCA 4F6RA 3S7ZA 3LNTA 2QT1A 2B92A 2FY8A 2GH1A 3EMVA 3EYWA 3AUTA 4IINA 1ESDA 2PLNA 2R8ZA 2W11A 3BSYA 1I7SB 1GCIA 5GINE 2JKVA 1AMUA 1MABB 3CVWA 2G5GX 1I3MA 4I5GA 1C8LA 5ALHA 1P2UA 5M2QA 1WDKA 3CSDA 2C29D 4WN9B 1X1QA 5L3QB 1O0CA 1CKEA 1B0PA 1GNQA 3PEEA 2X8BA 3M9LA 2IZOA 3K73O 2G06A 4FU0A 3COJA 4W4TA 3OLQA 1VBMA 1UPXA 4YECA 2F90A 1EWTA 3WDLA 2N75A 4EQZA 3MBKA 4A0HA 4D92A 4N18A 3MTJA 3G8YA 1RRCA 1P80A 2QMYA 1G3IA 5HS4A 3HRHA 1DC7A 2I03A 2I2CA 3ZY2A 1UINA 2A5FA 4FDVA 5LLSA 2BLLA 4MRPA 4EARA 4IDPA 2XXBA 4TKVA 5FLKA 2A67A 3KCNA 1E7QA 4QUAA 1AQUA 3WOVA 1RI3A 5B1HA 4IZ6A 2R8RA 5E3JA 5LMZA 1TUEA 3HZZA 1NXSA 3VOTA 3BMOA 2QU7A 1PS0A 2IA5A 3F49S 2EFJA 3ZZ0A 3GLFB 1CXZA 3A6LA 4RVHA 3JALA 1YGYA 4CM5A 2QTBA 1PT7A 2ZRHA 4DQVA 4U02A 1BVRA 3AHFA 3BD8A 3HR4A 3W9UA 2AG0A 2PRKA 5DNDA 5K8TA 1AN0A 1XHFA 1DADA 4BGVA 4KLAA 3IT2A 4IHAA 4YPFA 4IAOA 3A14A 1Y6FA 4BE7B 1PJ8A 4XSGA 1TFUA 3N05A 1L4EA 1UWCA 3IX7A 3NEYA 3ORQA 5DLQC 1CW2B 2BHRA 4W5JA 5JHGB 5KTTA 3KUKA 5IJXA 3BORA 4Q93A 2FZCA 3SXJA 3U3ZA 3USCS 1ILWA 3EUWA 5KHAA 2ZTUA 4C4YA 3K70B 4LJYA 3U48A 1I24A 2X40A 3KBBA 3MTQA 3IP3A 4NDNE 2R5WA 4J4BA 1FY2A 3M3DA 1E32A 3K9CA 5KYUA 2FLVA 1O77A 2WKWA 1N2CA 2DTXA 3QGMA 1U8AA 3GOHA 3TVDA 4QHYA 1QE3A 1PR3A 1U28A 1WD5A 4OQEA 5EIBC 4FCVA 1C3EA 2PS9A 3F7TA 2AKYA 4AK9A 3BM5A 3TS1A 1UFKA 3CS3A 3DF9A 3KKNA 4U9IS 3D02A 1X2EA 3DE0X 4C7KA 4NJOA 2CVOA 5AO9A 5U4QA 3NV9A 4G5YA 4JITA 2DLNA 3REGA 5K0TA 1YR2A 2FN4A 2G72A 2VP4A 3EF3A 3TZBA 5I7VA 1GCGA 2ZWIA 1G20E 2ALJA 3H6GA 4FFMA 2O8EA 1JAIA 2QAGB 2AYXA 1UK9A 4CG1A 1UJ6A 4Q9DA 1ADGA 2BJWA 1US8B 2FUG6 1LB1B 2EBFX 4HK4A 4X5OA 4ZGWA 2JEZA 3NAZA 5DYYA 3NM5A 2VPQA 5IF3A 1T6YA 1XJWA 1GZ3A 1DRJA 1Y6JA 4S1VA 2YV5A 4DCSA 4J16C 1I4EB 1VMEA 4N3AA 4CMAA 5C37A 3FHJA 4LMBA 3PEVA 5EP1A 4XWGA 2QUZA 4JP2A 3KIPA 5DTQA 3ON5A 2Y99A 5HFJA 1I6MA 3C3WA 2DFDA 1A04A 1QQ5A 4R0VA 3SBXA 5KSOA 4CIXA 1XRRA 1NVFA 3DVAB 3V7FA 2HLDA 3AINA 4D5GA 1HE3A 3F3SA 3Q10A 5AUQA 3AR4A 4BQRA 3QMWA 1I1OA 2A1TS 1CR6A 3KZ1E 4Y8VA 4ZU1X 2IP1A 4OJNA 2CDNA 4CQLB 3GLGA 4L9SA 1WE2A 1O4VA 1XYYA 3DUFB 2F1RA 3OZAA 4LQDA 4UU1A 4QYMA 1WUYA 1E1NA 2Y3IA 3I8XA 4G0OA 3OFJA 3RCBA 2I33A 3W05A 1ZM2A 3I2JA 2VRCD 1O87A 4DSTA 4IIDA 1VSTA 3BULA 4HGNA 4EKDA 1A96A 2FAXA 2BL4A 1WXIA 2YJ3A 4QXMA 3THXB 1LQ2A 2KPOA 4ZJYA 3HVUA 3OMWA 3DH0A 2O7NA 1SKMA 1ID8A 5IP5A 1A4IA 1Q6ZA 1C4OA 1TYAE 2AZDA 3GT3A 4UBJA 4WLEA 1N2GA 2PRIA 1YBAA 1DQSA 1UR5A 1GZ7A 1IWOA 5DPMA 3HDGA 4HQFA 1Y4ZA 1LI7A 4M1SA 4GPIB 2ZVQX 1KJWA 1H1LB 1N0VC 2V5UA 3FCAA 3NVDA 3S6JA 3BD9A 4G84A 1L4YA 1NXVA 1QVRA 3DOCA 1AKMA 3JY6A 5DOZA 2WDPA 2PMKA 2OA0A 2O8VA 2VQDA 3DQPA 5HCUA 4RVFA 4DLAA 2PFGA 4DLLA 4B35A 4HB3A 4G0MA 2BDUA 2RHCA 3B3JA 2O3QA 4ZQFA 2VUSA 5E2IA 1M33A 2IGBA 4HGRA 4K6KA 4H0FA 5A4DA 4JR2A 5C18A 3DOHA 1OFVA 1NUSA 2C4VA 1Q3HA 1XJCA 2JDID 3AESB 2AV6A 4C0BA 4URVR 4YRLA 2JFWA 2NTEA 4MO9A 2P6UA 3L8YA 4J94A 4M99A 2YMMA 1TVCA 2XWQA 4QG7A 4S1WA 4BCBA 2VQSA 3FOFC 1DT3A 2C2XA 2IJGX 3DV9A 5G0TA 2YS7A 1N7JA 1FP2A 4QU8A 2CNDA 3PEFA 4OOEA 5AESA 5DM0A 1OF1A 4YS6A 3I2KA 1UMBB 2NU7B 2VJCA 2WFMA 5ARCA 3UPDA 5A7FA 3C2QA 2JD0A 4K9PA 7YASA 2TMYA 1I7DA 1XTQA 1QP8A 4YACA 5FEUA 1J90A 1E9BA 3SZ3A 1FNCA 1A9QA 1S2OA 4HH4A 1GFIA 1SVKA 4I4IA 3X1XA 1T9GR 2ZUEA 3IXLA 3L7MA 3X1YA 3AFNA 1G55A 2JGLA 4EFKA 4PVDA 3VJMA 1UL1X 4FKMA 3T7RA 2HMSA 1KR5A 2GKGA 2GEDA 4ARVA 3PR2B 1MX9A 3L7JA 4EYSA 5D84A 1WB9A 2NXCA 3U81A 2Q5JA 1NYRA 4FK8A 2WTNA 2WWWA 2ZAYA 4G67A 1E0KA 4ILEA 3CUYA 4OHFA 3AM3A 3W6NA 1ZUWA 4PN3A 3MCAA 2CNKA 3C97A 4FZ5A 1BYIA 1T35A 1ENYA 3LDAA 3O8LA 4GICA 3RVLA 1U9IC 3UH1A 1W4AA 1JSLA 5FPYA 4EWLA 2QQFA 4ZYXA 5A5VA 3V8BA 2ZTSA 4LZPA 5E38A 3EG9A 4P1ZA 1O0SA 1XA3A 2P11A 2H5JA 2TMGA 3I1JA 3L5OA 2P6PA 4KWIA 2J9ZB 3SIWA 3GEBA 2DTEA 3MWEB 4KH1A 3EPKA 4YJDA 1VFPA 3ZWQA 3JQAA 1JDVA 2BFCA 3CJQA 1JBKA 1KY3A 4IO1A 1XMPA 3HZRA 2X14A 5LZ9A 3BYZA 4ZZ1A 2R7KA 2POCA 3GMIA 1B8VA 1Q0RA 1VTKA 2YUIA 4QPZA 3AKEA 3KETA 3OF2A 1O6ZA 4FGWA 4N3NA 2CXRA 1HE4A 4XWWA 4RVDA 1APBA 1WUHS 4PX5A 5SZKB 1WY7A 4BB0A 5TPWB 2XNSA 2E37A 2GX6A 2Q1YA 1JFRA 1HG0A 4HNVA 2IXTA 4FSHA 5JYBA 2XVAA 4YXWD 5EXXA 3FOCA 3IOMA 4IVQA 2SHKA 4XR9A 1G0NA 1V96A 2G0NA 2OMKA 3ZDFA 2WHPA 5FXMA 2HWWA 2WIJA 2KI5A 3UWSA 3R4VA 5D3MB 1JT2A 4DCPA 3IMFA 3MFQA 4Y6SA 1CJSA 3ZXSA 1OD6A 2H31A 1GZUA 1VP3A 2Q62A 2LDXA 1AGNA 2WUWE 2WYVA 3DE7X 2QAGA 1DDOA 4HRXA 3WHIA 3CVYA 1MAVA 4YJ3A 3FYUA 4Q5IA 3MOGA 4R2IA 1W5AA 4GPD1 1JA0A 1MC8A 3M3HA 3UQZA 3A7EA 1IHXA 1J0BA 1TCVA 3KT8A 4HAXA 3ZLVA 1G1AA 1J8YF 2RGNA 2H7YA 5HTOA 2J3IA 4L95C 4DEVA 4ZJZA 2Z2JA 3W2FA 2VJYA 5EQDA 1WCIB 1W5SA 2IC5A 1SOAA 4YMLA 1XXHA 1BKYA 2VDNB 3LX4A 4J0EA 1LLCA 3SZRA 4RZIA 3IDQA 1R6DA 1UPFA 4WBNA 3H9GA 3HH8A 1JR3D 1KZ6A 3V55A 4D9JA 4DCUA 1E77A 4KR6A 1YC2A 4HKTA 5A04A 2R6DA 4LE0A 2XGOA 4QBFA 5D6NA 4FDTA 1N2IA 1XU9A 4E3ZA 2EP8A 2BD0A 1V41E 2WD7B 3TPFA 4BIIA 4ZJUA 4MI9A 1HQCA 3HU1A 4YCJA 4NV1A 3VHRA 3EXEA 1YF3A 2J5BA 3UW1A 1JPVA 1EDDA 2IDZA 3DTVD 3F6CA 1XPOA 3AOEC 5DH9A 2VJMA 3A3NA 2YMLA 1RDFA 1G8JA 4RF2A 4YO8A 3I62A 3T7DA 1CZNA 4HY3A 1QG4A 2JLBA 3LLVA 1RC0A 4CT0A 1GA4A 4V3BA 2IH2A 4AP5A 3KHUA 4WFJA 1IHOA 5EJAA 2ONZA 2JD2A 5HW0A 4AJHA 3V3TA 4JBIA 1Z7YA 3AH8A 3KQNA 3UOWA 2YR0A 2ZPAA 3I3OA 4EPRA 2PUTA 3BA6A 4MDYA 4D96A 3AM5A 1Q20A 5F5NA 1M5RA 4ZPXA 3CRQA 1AKNA 5EZQA 2PVPA 4E5PA 4EYOA 3QYAA 2FF5A 3EBLA 4GXTA 5ICCA 4BMXA 1BXGB 1ZW6A 4QOGA 2HIHA 2XB2A 1T4CB 3WZLA 4CMJA 4R01A 2H54A 5T8KA 3WK9A 1O7JA 1PRYA 3P2JA 4H7JA 1H6DA 1EPUA 3L79A 1U7TA 3FF1A 4N3GA 5DV9A 1VCHA 2GS9A 2MJLA 2H1SA 4O2BA 1E7RA 4Y2QA 3C14C 5CPBA 3VZQA 1QTIA 4NV3A 1KZHA 3G0HA 3N6RA 1C7JA 1N8SA 2PR7A 1IZZA 2FZEA 3IAEA 5K3CA 4C7MA 4A6PA 3D6MA 2E4UA 5JCJA 1EZ4A 1ZISA 4NNJA 1T2FA 2CLKB 1P9LA 2PFKA 1ZUNA 4KOEC 3UAGA 1JHOA 1DEAA 4RPCA 2RH5A 2ATXA 2XWPA 5I9MA 5BPFA 2L18A 4UPVA 3GLGE 3TX2A 1IULA 2G7ZA 5AVTA 5J43A 2IV3A 3H16A 1Z26A 1KQ3A 1S9DA 2I3BA 3L8HA 4ENRA 3A4YA 2PH3A 1U5BA 2BEVA 1XAHA 5AVJA 3B48A 3GF4A 3TLBA 2CFTA 4F4JA 4KN9S 4HQ6A 2PV7A 2C88A 3NAGA 3PUZA 4GWGA 1USKA 4JJGA 2ZUWA 4L8LA 3SYLA 4GMFA 1EFHA 2ZUBA 3FOWA 2QT9A 2GERA 4JGGA 4UBMA 1YRLA 3T94A 3SKVA 4KFRA 3C3JA 3I05A 2YS6A 3A1VA 4HNTA 1GSIA 2GCOA 1GGEA 4D9EA 4X1YB 1JQEA 2EHJA 2I65A 3P9SA 2BSAA 5KTNA 3WL3A 1HORA 2SCUB 2VSXA 1J0AA 1T5SA 3SXPA 2O2ZA 4BBZA 2VHYA 1KKUA 3QBJA 4IOMA 3LYAA 4C7VA 1KIFA 1IPHA 1FDWA 2Z3VA 5T4HA 4UUNA 3FNBA 2WU4A 1Z0ZA 3V9PA 5FHQA 3RVJA 4G1BA 4E5UA 4Q39A 1GNPA 1XLTA 1P1KA 2IYWA 3RFVA 3RS0A 2J7PA 4IFEA 1V9CA 1V8DA 2RGBA 1CDZA 3B53X 3OKFA 4GWLA 1T9ZA 3PFWO 4RK6A 3UKDA 4CGZA 4N49A 4YWHA 1G3RA 1XGKA 1T10A 3W8NA 4YAOA 1HNZB 1CUDA 2ZRLA 2JJ1D 3KUUA 3LECA 4RF4A 4RYDA 2JI9A 3EQ2A 3T3EA 2C5LA 3ABSB 3H2ZA 4GO1A 5EHIA 3ASYA 3C8MA 1MX3A 1EJ0A 1N5RA 4FUTA 1M83A 2OL4A 1U1EA 1SUAA 1Z25A 5JWHA 4D8VA 4Y6OA 1E64A 2BMEA 2VXYA 3EF0A 4V39A 2ATIA 4HPXB 4UE3S 3JWHA 4BFWA 4ZGBA 3TSOA 4MRMB 4R3UC 3UJ7A 1J0DA 1HQDA 1XKQA 5B3LA 4L5IA 2CDCA 5F9HA 2ZUVA 3IVRA 4LJ8A 2ZBVA 4NCNA 3WGJA 4RQUA 4MRVA 3QEBZ 1PT5A 2C54A 2H4HA 4QOEA 2QZJA 1NM5C 1S96A 1U5CA 4BJHB 4PG4A 4Q34A 2VS1A 4AD8A 2WJHA 5CM9C 2NO7A 4MJXA 1KAOA 5JANA 3GGOA 3GVIA 3IURA 3OE7A 4NC9A 3GK3A 16PKA 1KDTA 1U81A 3GDGA 4FFNA 2CJXA 4UBKA 2TSYB 3HA3A 1VIMA 2GZDA 4RVOA 4CF3A 4TTSA 3OCCA 5E0KB 2X0KA 1Z2OX 2OP0A 3OD1A 2VUHB 5H70A 5IC6A 4AKEA 2C7QA 3FPJA 2IYYA 4FYXA 3H6KA 2F55A 1JQJC 4L8GA 5BN3B 2AEJA 4OCZA 1VCMA 3ICQB 4MAMA 4CMIA 2HA3A 3DBRB 1FFDA 1KERA 2Q50A 1PSWA 2O0KA 1H2WA 3QVSA 5FBKA 1XXHB 1EZZA 2HPHA 2N1BA 4DV6B 3C3MA 4Z51A 1N9KA 2R4TA 3FB1A 4Q3BA 3R8CA 4RM3A 5IT9A 2QY6A 3E4DA 4X65B 5K01A 4ZALA 2BR4A 2QYHA 4JX8A 4G1MB 4PG5A 3BB4A 4R6XA 3GBSA 2QPTA 3QI2A 1FXUA 3LQYA 3RRMA 2QTZA 2NSHA 5EY5B 4FNMA 5AKIA 2HWYA 2A5YB 4QOHA 4U6NA 4U7TB 1YZNA 2ZDQA 5JZBA 1P81A 1VMDA 2XCQA 5LP6C 3C7DB 3QNMA 2OUKA 4GOJA 4XUEA 1RYZA 3MT7A 1X38A 1ZXBA 3H84A 3QITA 3GP3A 1S2DA 3B1FA 3WQBA 2MYNA 4JS0A 1MB0A 4W9MC 3VNVA 3OPXA 4G0QA 4B4UA 3LC2O 4M1QA 3UXYA 2WBLC 3LXMA 2OCYC 5HJEA 4DQ0A 3AL0C 1XPRA 2QK4A 3LQ2A 4L4RA 4QPDA 1N0UA 5HE8A 3WGLA 4CN8A 1T2AA 4EY6A 3VDMA 3VHLB 1W7AA 3HG7A 2JGDA 1Q15A 4HWSA 1VLJA 2AJTA 2CB0A 5B3JA 2ZT7A 5K6TA 1GNVA 2FK7A 3H5WA 5DASA 4D81A 5M5BA 4Z5XA 3EUFA 1OLOA 5K7SA 10MHA 5LQKA 3V8VA 2XHEA 3DOEA 3MS7A 3TGLA 3A3PA 3GN1A 1QYCA 5HJ2A 1FCJA 2H16A 5KTYA 4BLOA 1Z4OA 4HMPA 1OPRA 1SUSA 1JZTA 1JAXA 1T13A 3BMXA 2HJVA 4REQA 3W7BA 2V74B 3HSSA 4UZFA 3GCXA 4XJTA 3LYUA 4EG1A 1GT6A 4ZIRA 2CF6A 2R1TA 3FPSA 4AX4A 3PPWA 4GUDA 4BHTA 4DLXA 5GMOA 3RSHA 5JTUA 1UBKS 4NG5A 1CUCA 5JS8A 4DQUA 2XTAA 2GK7A 1H3FA 1NJ5A 2Q8QA 1JXAA 1MOSA 3GQBB 4LWPA 4M9XA 4PHCA 5AK6A 5CA1A 4G9BA 4KDCA 1BEUB 3IUPA 5LXTF 2JLCA 1TPYA 2GAAA 2RAVA 2VHUA 1OB2A 4YQEA 5K45A 3I5AA 3EZFA 3V4PB 5F5LA 2CYCA 4GBMA 3WL4A 2ODWA 3EEBA 2PKCA 4BC0A 4RZQA 3A04A 3V4LA 1DC8A 3A1FA 1BE1A 3ENVA 3L0PA 3DV0B 3BDAA 3FNHA 4BZXA 5H4GA 3EVAA 4MVYA 4PBSA 1DRUA 5AOBA 2OECA 2QR2A 4I4TF 3PNMA 3Q9UA 3K2QA 3FSEA 3ABOB 1L4HA 2OK8A 3FMOB 2QL7A 4DR4B 3E70C 2BF4A 3UCEA 4N01A 3SY8A 4B6GA 1TJYA 3ZQUA 3FUVA 3L6CA 4W7HA 3MCWA 3K6SA 2PT7A 1JUDA 1GRRA 1MMFB 2ZJOA 2QORA 4UNQA 4BO3A 3OFKA 4MUKA 2NV2B 1HC7A 1CUAA 2VT7A 3MMZA 3WTBA 4BWVA 5B36A 4X66B 3R7FA 3SU8A 4AYXA 3KR0A 1NGSA 4C03A 2JLAA 1T8WA 2Q0HA 4TWIA 3RS3A 5LMCA 2RKBA 4V0NA 4JJ4A 1P8JA 4UJ3A 2NG1A 4D9GA 2IXGA 3FVWA 2Y2UA 1NM5A 4L5JA 1ZVMA 4OBWA 2Q2VA 4WZAB 5IS2A 4IEEA 2PL3A 3G82C 3OIUA 3VHQA 3OQHA 3NOVA 1NLUA 4Y9UA 2IYEA 3T0FA 5F33A 2EZTA 5H0IA 3CSUA 4TLCA 4C0WA 1MA3A 1N57A 1FFHA 1JLKA 2QI9F 4B2IA 1BNCA 4AG6A 1F12A 1AV7A 3E7XA 3IKMB 4GYWA 4TYPA 1AIPA 2VDJA 4EHBA 1W6UA 1FL9A 3DE1X 2LRHA 4HWGA 3GFBA 1IOLA 1JQLB 1WKVA 3WX0A 4PU0A 4NNPA 4H7IA 3TNJA 3W78A 1Q74A 2XT6A 4CMEA 2QQ0A 4JP3A 1JIQA 1YA8A 1I32A 1EP3B 1TNDA 3R5SA 3AYXB 3QE3A 4MX8A 1Y3DE 2XUDA 4Q4JB 2PQMA 5AJVB 4E31A 5A5DA 4YP6A 4BKQA 2B0CA 4EBFA 4QPJC 3Q7RA 3H5LA 4MS4B 1QYWA 1JU3A 3TG2A 3AM4A 3WK5A 4LVUA 2ST1A 3K1JA 1TUBA 1OV6A 3B78A 3L0OA 3W6PA 4OHPA 5AW6A 2ZYGA 3R3YA 4CCYA 2PUBA 1ZL2A 4MCIA 521PA 2MMGA 1SU4A 2CXPA 1L8XA 2F9MA 2UXDB 1XVAA 1ZHFA 4ENQA 1EUCA 2GZ2A 4P83A 5L4NA 4A36A 3WB1A 3D8RA 5FOUA 2P77A 5AJWA 4XLLA 5F64A 3SJAA 4C43A 2YIMA 1HZJA 4K6HA 3IDOA 1VHWA 4EHDA 1P72A 1N5IA 3PE3A 1T5OA 2G1UA 4O8CA 2H7VA 3C41J 3K05A 2PZBA 2Q8NA 1D0VA 5BOSB 1H5NA 3DHEA 1IHUA 4MUXA 1PUXA 3TLCA 4R83A 1LBSA 1JXQA 3ZGLA 5ELMA 3AC0A 5JAIA 1KAGA 2FR8A 3X1DA 3ZTYA 3KT0A 4J0GA 1O96B 2W6PA 1N3IA 1ULBA 3DBRA 4ZVKA 5CXUA 5D01A 4ZCIA 2G1AA 3ZIUA 5G4LA 4QASA 2XZTA 4HRVA 4QAQA 1FDSA 3VO1A 1OQAA 2JEYA 3V42A 1V5EA 5FUQA 4ZD6A 1KDRA 1T8SA 1V45E 2SECE 3PTLA 3TTWA 4LC0A 2LUOA 2KE5A 2DWPA 3HBLA 4IF4A 5F1KA 5HQ3A 1ZD2P 4JU9A 2XXAA 2P1ZA 5SYAA 5B7QA 2PUFA 2H17A 3EZYA 3K0BA 5LD2B 1Z2CA 2FF7A 3OJLA 2BW0A 2PT6A 1QOQB 1Q0UA 5FNZA 1BG6A 2RGAA 1V7ZA 3JQ9A 1G5TA 1KYWA 4P6VF 5ITWA 3V80A 1Z2EA 4EITA 1OLUA 3FGNA 1FA9A 1VECA 1OGYA 3ZKWA 5AUNB 1N4DA 2FEOA 1N6OA 3SYNA 5HIJA 1PYOA 1QCYA 4OK3A 2GHIA 4EG3A 1UMCB 2A5JA 2BFFB 5JBQA 5A6SB 1W19A 1VE7A 3ZY3A 4UE6A 1ZZGA 3NPMA 2C9DA 5B7GA 1Q83A 3UB2A 4DY4A 5AUOB 8MHTA 2V96A 1X7XB 5LBIA 1PS9A 2BAGA 2O3SA 2V7WA 2CHUA 2R5NA 5LA6A 3OC6A 1QORA 4PLGA 5JDCC 4LOJA 3QUCA 5IVIA 3R6WA 1XDUA 2VPZA 4CHTA 3CU5A 4JEUA 1ZINA 1ZPDA 3KXIA 4ZVPA 4F8EA 4HATA 2QZSA 4OUDA 4S24A 3CE9A 1EK5A 4HAUA 1JMVA 4H1HA 2F7SA 1SJ9A 3ECCA 2HXYA 4WE3A 4K2AA 2HSGA 2QVZX 3ODGA 4R3NA 2CYAA 2XECA 4CLEA 2VOJA 1BEEA 2B9EA 2EDCA 2I2AA 2YL2A 3R0VA 1T4GA 1NW3A 2XV1A 2C95A 4A4DA 2ESRA 1HDZA 3D59A 1PVVA 2HPVA 1IUNA 3RKUA 4RA9A 2FW1A 1JEOA 1DKUA 2OLEA 4DDMA 2HYDA 3W8RA 4XYLA 2XDYA 1GLNA 2I8AA 3K31A 4NLLA 3FYSA 3ZE1B 4W5WA 4DV2B 2Q7XA 1FDUA 1U3VA 2H1CA 4G4IA 2HHHB 1PZHA 2WYWA 2ZSFA 2SBTA 1KMNA 1F4VA 3ELWA 5I7EA 3HJCA 2IUSA 2ZUSA 3IE1A 2VHWA 1CNEA 1UF9A 5DTJA 1E1QA 3W3ZB 3WYFA 4CLOB 1N5JA 4G2NA 4KVFA 1DCTA 1M1NA 1H65A 3EDOA 4PGAA 2O4UX 2CNNA 3DAGA 3S2YA 2QRNA 1A9RA 1KSFX 1XN1A 3UV7A 4TL9A 3G6KA 3CGWA 1E89A 2ZYVX 3A4MA 2GF2A 1PJBA 4PIPA 2GAIA 2NADA 2Q5HA 4YN3A 3S44A 1XA4A 2WKRA 3KYJB 1H1TA 2VTVA 3DZ8A 4LDAA 2FW9A 4DAOA 1TTTA 5FHRA 2B2NA 2YN0A 3C45A 1P3DA 2Y9PB 1PGOA 4MROA 5ESWA 4EJ0A 1LLUA 5ARDA 1ZJWA 1RQXA 3CPEA 1QRTA 4O02B 3N0VA 1RQNA 2K2QB 3CUSA 1QB8A 1GN9A 1XDGA 3IXMA 3WHKA 2CNOA 3AR5A 1JTFA 3RIYA 3ZU3A 2QAJA 3T7CA 2NZ8A 4AJKA 4AAYA 4MW4A 1SVWA 3ABIA 4ARZB 4AW9A 4J43A 1CEEA 4MTCA 3JZDA 4CM7A 2XNCA 1O89A 2QQEA 3AEKB 5ALVA 4Y1RA 4LJ6A 5TJHA 1U63A 3VR4A 2GCOB 1OFUX 1QO7A 4I50F 4UE2A 5K99A 2CBGA 3FB4A 1CQJA 2H3EA 2KW5A 2Q6IA 2ZB7A 3MTDA 3OAAD 1SELA 2CVQA 4CETA 1DX4A 4OBEA 3SQXA 3QFSA 3BH6A 4NBNA 2HNBA 1DO2A 4LZWA 4HC4A 1OR8A 4YX9A 3VZPA 3EY4A 1R6UA 4AWAA 3ZGVA 3JZMA 1DRWA 4ZYWA 1I80A 5GGXA 3IUMA 2WHEA 2H2DA 5JROA 2BCEA 4MZXA 3VBCA 4D42A 2GN2A 4DJEC 2FXVA 5C8XA 1NJ2A 3WP1B 5AW3A 3B7GA 3LT1A 3OCYA 4QTXA 4DABA 1X1RA 3OESA 2MCFA 4PS1A 4C0KA 4GD3Q 3L9XA 1V9LA 3VI3B 2XCSB 1BOOA 5LKRA 1Z88A 2I8LA 2XTMA 2AFHB 1BYUA 3A6DA 3DBLA 5K3FB 5F2NA 4TTRA 1KJ9A 3HYCA 1E61A 1DBSA 2XIJA 2OFXA 2XMSA 1WB4A 1X15A 4QGBA 4FMCF 4E1VA 3AKYA 2W4MA 5CGQB 4G5FA 1QLJA 1XTIA 4DANA 2M2IA 4L28A 1MPXA 4TN1A 4JLJA 5EJFA 1EFPB 5FORA 5CAEA 1PQWA 2FRDC 3PHJA 4ZDWA 2BMFA 4Y3UA 9GPBA 3U7QA 3C1UA 3GD5A 3AJAA 2WYHA 3OFVA 4HG2A 3RIXA 1KJNA 3KVYA 2PY6A 2YQ5A 3CF4G 2I7CA 5AWFC 1U8TA 3CZRA 4RABA 2IQ5A 4DB2A 3HO6A 2Q0SA 3AUSA 3MJHA 2JC3A 4GP9A 3TE6A 3TTYA 5AHWA 2IXAA 4GMGA 4KIGA 1J2JA 1Q22A 5CMLA 4BKMA 3IPYA 2JFXA 3DTNA 3E1GA 1QDLB 2KMLA 1KI8A 4JIGA 2DBVO 4JY7A 5P21A 3T3HA 3N2ZB 3TDNA 2AKAB 2FJUA 2HMTA 4KTTE 3WP0A 5AUPB 1IL0A 3QVLA 3DXXA 4ZARA 1QPGA 4P32A 2AJLI 1QLWA 1PO7A 2C58A 2VAWA 4GVLA 2WSSA 2AA3A 1SC1A 4AJJA 2PS1A 2X0DA 2XWBF 2ZXUA 2PMDA 2M6LA 3PUHA 4D46A 3T95A 4OI2A 3P9IA 4FR2A 3RJ5A 1U8EA 2JHPA 3DHWC 3LHSA 4R1UA 4Z1MD 4CF7A 2P2DA 1AQYA 1CQIB 1S0UA 3C7AA 4L0DA 4E09A 4L4UA 1DZIA 1B15A 3EMDA 3N2GB 3SGLA 3SFZA 4DV4B 4YJFA 4A8TA 2UXBB 3U3DA 1JECA 2A14A 1RJ9B 2RI1A 3N0XA 1MVNA 1Q0ZA 2YZKA 4ZO7A 1MOQA 4WY8A 3FNIA 4WJLA 5E1DA 1G20B 2G09A 4IMPA 2OM6A 3PXCX 3JTMA 3OQVA 2QRHA 4J2OA 1QFZA 4L8FA 1E7WA 1NKVA 4FZ3A 4EO9A 3B1YA 4ZI7A 3CUVA 1EEHA 4C0JA 2X0FA 1QHNA 1L7NA 5DX8A 3Q7EA 3W4JA 2PO5A 3U40A 3ESZA 4HSGA 4C6HA 4OQNA 1II8A 1Q12A 1T9DA 5KVQA 2WIDA 4IOJA 4B87A 1TDJA 3TCNA 5C5EA 2XT0A 3UG6A 2NSYA 3OFSA 4RDXA 3C24A 3SJCA 3OZUA 2NP6A 3IJPA 4I4TB 5CFZA 2P3QA 3BF7A 4JB2A 1UKAA 4IJUA 1V48A 3BHMA 4GE0A 2XA1A 5J4HA 3UMVA 1R8JA 5DHSA 3ER8A 3BMCB 2ERXA 4MGEA 1T4BA 5L3RA 5J2UA 3TTSA 1YTUA 2PBZA 1GQQA 1T5LA 5K6RA 4Q1FA 5LA6F 3RFXA 1SHJA 2GJ8A 4ZOAA 5ESDA 5H68A 2B3DA 3COSA 1T34A 2RKOA 4UEOA 2J5KA 1NP3A 3BHIA 4FN4A 5DRTA 3RGGA 2Q46A 4YXWA 3VPBA 4F2GA 1SB9A 1W52X 2NPOA 4HWKA 3D2BA 3MIZA 4B7XA 4FD2A 4C6TA 4I14A 1ULAA 1P73A 3EDCA 1E96A 1XEXA 3AW8A 3CXRA 5G1OA 4O59O 3U7EB 2CHGA 2X1MA 3IEUA 3LC0A 3NRCA 4OAPA 1V3VA 3K30A 5FWAA 3O7MA 1XSEA 1IAQA 5T4EA 3CJRA 4YLEA 2GASA 4RKQA 1W25A 1Z7EA 3LWDA 5K4HA 3WFJA 1RIIA 3P4XA 4BFLA 4QNMA 1C50A 4R84A 5JNUA 5E1MA 4ZAXA 2F8TA 2AFIE 4LJ5A 4IDGA 4A7PA 5BUSA 4H2DA 2HA4A 5EUCA 4MKFA 1O6BA 2DFVA 2XUFA 1D7OA 3UJHA 3MIIA 2QM3A 4CLRA 4IDAA 2AOXA 4TKVB 4NCJA 3UT0A 2PYZA 5CW2A 2JH9A 6LDHA 3AEKA 4DNPA 5DCUA 5KQGA 3VYRB 5ILOA 4NQZA 5EP2A 4YYZA 2P9FA 1YH3A 4PQGA 1NJGA 4BFXA 2GZHA 1ZUD1 3EEYA 5ALXA 4A8JA 2JBWA 3HXKA 4NCBA 3I32A 2OCAA 2BR3A 2OOKA 2FRVA 5FPQA 1WV0A 1YS7A 3GP8A 4CEIB 3LL4A 2JLZA 1KAHA 4WBSA 4PCLA 5DGTA 1FMCA 2VCYA 4P2BA 5BV1A 1E2JA 2WJ6A 5EUBA 4BWFB 1I7PA 5I7HA 1QP0A 1JNXX 1K8YB 2H11A 1NJ8A 1BWRA 2P65A 3LC1O 4OD0A 5KCZA 3ILHA 3FPKA 1E2KA 4GI2A 4K6GA 4X8MA 4GQBA 4CUJA 2NT4A 1Q16A 1N2CB 1UJMA 1HYEA 3A26A 3QF7A 5AYVA 5LP6F 3WL8A 3WYAA 1SCNE 4U0KA 2JRCA 4AMVA 3O8CA 3TR5A 1U6JA 5BYAA 1DG9A 3V4OA 4E33A 1UJ5A 1E9DA 2GJSA 2BH9A 5I6DA 4JI7B 3PT5A 3PFBA 4X6LA 2UZ4A 3N8DA 4FOSA 3TWOA 4DVGA 4YASA 3FUWA 2ZRJA 1MG5A 1PHRA 4CKZA 4NCKA 4BFCA 1DBIA 3R3WA 1BFUA 1O96A 5FUBA 1GJRA 3DONA 2I54A 4HUQA 3S2SA 3KKQA 3KWFA 1R5OA 4PHTA 2IZ6A 4BX2A 5CITA 2Q5OA 5GV8A 2YNMC 4HYQA 1ZMBA 3QU4A 3ROPA 1NXXA 4KR7A 2P3SA 1CB0A 3IA2A 5AJYA 4E5YA 2I6TA 1IH8A 1WMSA 2FZ5A 4DIMA 4UW9A 1Q1ZA 3JQ7A 5JZ9A 3W04A 1L4KA 2FA9A 3N76A 1EUCB 3IS3A 2BV3A 2ORVA 4UAUA 2H8KA 3KPVA 4B6JA 3MRXA 3AP2A 4BQFA 2XYVA 4JBNA 4OJQA 4WT7A 1NVVQ 1ZM3A 1JHRA 3M3PA 3PC2A 5BQOA 4UOZA 2AN1A 2W2LD 3CINA 1IRIA 5CCBA 2RHWA 1VKOA 2OYCA 1WXGA 2ODTX 3M33A 5HKOA 2PSFA 1GNSA 1GPUA 1OAKA 3V2IA 2GJ9A 5D1HA 4YHBA 3PV0A 2NUPB 1K7XB 3AONB 1MR3F 2B99A 3KUDA 4B84A 2GRAA 1CLEA 2XAUA 2EJTA 3E2PA 3MF4A 1QS0B 4Q9KA 4DQKA 1E9RA 5IXJA 1SQFA 4DUGA 1V47A 3IHTA 1KVSA 1Y3FE 1F6DA 4J1NA 1QG0A 1PYGA 1CRPA 4GW3A 1E4OA 1GZ6A 1KY2A 4I3GA 4NG4A 3PNBA 4WSOA 4RS4A 4DTCA 2ZRDA 3HB7A 4XM2A 2EKQA 1WTAA 4D02A 1EXNA 3E5NA 2ZUUA 1CUSA 1G4HA 1W48A 2APJA 3DFKA 3M1LA 4AN1A 2A33A 3KYBA 1M6NA 2Q1XA 1UOOA 2XW6A 5HKAA 1Q7RA 2DB3A 3MXOA 4YRNA 5ALGA 4AKSA 4KHPB 4S35A 1KYTA 5ITZA 1MZPA 2W00A 3Q5DA 2DUMA 4LHWA 2WIFA 3DL0A 1RADA 4F60A 1IBKB 4QSHA 2TECE 4GHWA 1G20A 1EFVB 1N3YA 2R47A 2VKTA 4E88A 4UU7A 4L7VA 4R40A 2DWCA 4DWWA 4LZNA 1RZ3A 1OXKB 4D41A 5LLDA 5CVUA 3RUHA 1YJXA 5AXDA 1NE7A 4Q6BA 1FJGB 5KC8A 2ILVA 3FDFA 1NQUA 1BMQA 3LOQA 5JSQA 2IVZA 1MZVA 3I04M 2L69A 3FCUB 3L8GA 4IIVA 2P2SA 2OPBA 1PEDA 4IQ0A 3NDJA 1P1HA 1U2PA 1QFMA 1SA0B 3A1DA 2EXXA 1RLTA 2BHTA 2QGNA 4LISA 4J4HA 1GO2A 4PQEA 4B6QA 4C29A 3OU2A 2HSDA 3H0KA 4JH0A 1LX6A 5HQJA 2X2OA 1CY1A 4W1QA 4ZT3A 5ESXA 1GA1A 3T1QA 2QN3A 3VFDA 4ILKA 2NSLA 1QSGA 1EVJA 2ECPA 1T3ZA 3PCTA 2X2PA 4IUDS 3TH5A 1NVUQ 3MELA 1N6LA 3H8SA 3DHVA 3OZ7A 4I81A 1CQPA 2Y1EA 1G2IA 3VQTA 1Q1QA 3HABA 2I6SA 3TW0A 5EWMB 3T3MB 4ZHSA 1Z5VA 3IIKA 4Q15A 3RAFC 4NDAA 3NVMB 3I8SA 4PO9A 4PPNA 2YHAA 3IBFA 2WHXA 4RSMA 3SSOA 3VTFA 1KQFA 4M21A 2JFZA 3GAAA 1QRUA 1HKHA 2UV8A 2W6NA 5BXYA 3Q0EA 4GVPA 4GPZA 3OLWA 1QZUA 1EDBA 2A0UA 3JQ6A 4O0MA 3WBBA 2P9EA 2PZAA 4XB2A 5JAHA 2CBXA 3NONA 4KRFA 3ANMA 4G5RA 5ERGB 2IU4A 2Q0QA 1VCOA 1MB4A 2XUJA 5HF5A 3ER6A 2XWSA 4X6XA 1H8ED 3CV3A 4G01B 8GPBA 3IUNA 3KQLA 2HJRA 3OCXA 3KTFA 4RJIA 2ZSUA 4N65A 4RF3A 2BFPA 2HGSA 1QBGA 2YOHA 3LW7A 1V4NA 1OXXK 4FEYA 3U13A 3O26A 4W1SA 1A4RA 5GONB 1N5MA 3AQ4A 3W2IA 1E8DA 1U1CA 3EE6A 3H9JA 4LVCA 1D2HA 4QQNA 4BMDA 1URPA 3Q0TA 2W6JA 4O29A 4FE4A 3IEPA 3V1YA 3AI3A 1PZFA 2PMFA 4X63A 4ZQBA 5IMBA 3W8DA 4IM7A 5FLYA 3CLTD 3FFAA 4J76A 1CP3A 1U4SA 4GECA 1NVGA 2GXUA 4CE6A 4E32A 4YCMA 2HJSA 3UOAB 2IS6A 2PMBA 5DYTA 1T2CA 1A9SA 3HNRA 4G37A 5CDFE 4NEGA 3R74A 6ADHA 4CL0A 1ZK2A 1U0FA 4Q00A 2CMGA 1JVBA 2YCLA 3TPCA 3P9NA 5K0FA 1U2EA 1X77A 3RU2A 4IPTA 1SXJE 1MN6A 3IUQA 4ZAWA 5IJZA 1D2CA 1MJNA 4NICA 5GIPE 5ELXA 2GAOA 4FXPA 3KR2A 3Q2KA 1XRNA 2PUAA 5A6VA 2R00A 4HYYA 2I7DA 2CXSA 3MW8A 4Q4AB 4MV7A 3RVSA 2QUAA 1TEXA 3LFUA 3VC2A 1FNNA 1YV9A 4PPQA 3LUGA 4M46A 4NBLA 3JASA 4QEKA 3JYHA 3VVLA 4I3HA 4WLOA 2XMPA 2J09A 3UT5A 1HTWA 3L9WA 2W98A 1MJFA 1WMAA 2QL5A 3BS4A 1GDDA 4KXXA 3IQHX 2YVAA 1A9ZA 3WZ2A 4ZKEA 1ATZA 3H9QA 4PVCA 5HDQA 5TF4A 3WWYA 5G53C 5LJLA 1BU8A 4PZPA 4RHTA 4MMZB 3K2EA 1J25A 2WHRA 3UJBA 2VPTA 4ZO6A 3V1TC 3HRKA 1VG1A 2QY9A 4MR8B 4GT1A 2A9VA 5B58C 1C30A 1ZNYA 4HDNA 4Z7NB 2JANA 3FTNA 2BDEA 3TYXA 4POAA 5IVHA 2ZI6A 3CQ9A 3RSCA 1U98A 4K87A 3PC3A 4OHUA 4XDZA 5F12A 5T6MA 5CDUA 5KREA 4GX5A 5KJ6A 1HURA 2OTCA 1U31A 4CKWB 5CJJA 1H2BA 1K7YA 5JEDA 1LW7A 1IU9A 5REQB 3ESQA 1E4EB 4R7GA 3QVVA 1B76A 3A36A 3OO1A 3TKLA 1GNRA 4GLFA 3V2UA 4DT1B 1Z06A 4JA2A 4RJ2A 1I3KA 1NMSA 3HN2A 1YFZA 2DFPA 2YZGA 3BTSA 5ALPA 4NBVA 1EZ1A 4MGYR 4NPHA 4PYOA 4R5HA 3SG0A 1O8BA 3TECE 3DQZA 3E9MA 3HGTA 2GBGA 3TN7A 2PZ8A 3Q2OA 4KE8A 2HTFA 1TW3A 2G82A 2A0WA 2P9GA 2Q3FA 3NWJA 4LQ4A 5EKSA 2QGFA 4IGAA 1V16B 1MA0A 2KSQA 4KR0A 3BXOA 4Y18A 1UKVY 1Z68A 1QGED 1B43A 3K4HA 4FGZA 3ZJYA 2RI0A 1XLWA 2IFTA 5GTDA 4KPYA 2WIBA 4RVNA 5JRJA 5ITZB 2CFCA 2X7JA 3SJBA 2MSNA 4N40A 4ZI7B 4YDHB 5IDYA 4KIWA 1GTZA 1QR6A 1Z4KA 2NTVA 4M9QA 1AB5A 1GXSB 1YOVB 2XR1A 3AX6A 5L3QA 1RRMA 3ZWWA 3IVMA 2B1JA 1EFTA 4I8XA 4E2ZA 5AKXA 1MAUA 2ON6A 1X1AA 2P41A 1Z0IA 2SNIE 3HN7A 3LT0A 4I36A 1E6CA 2IYLD 3G2PA 3P4YA 5CVDA 1Z6YA 3F3MA 1XZQA 3SYKA 1JWAB 4OI1A 3PDWA 4PSVA 3WLQA 5CA0F 2I78A 1C0IA 1SN7A 4Q3EA 1N8KA 4DJTA 2OCLA 1MD9A 1RI2A 5BSGA 3EDYA 5AW0A 1D7AA 2HO5A 4GX1A 3THOA 3M4XA 4CT5A 1NVDA 1RVV1 3QBDA 4IV5A 4CKCA 5IKOA 4Q6WA 3D0QA 1EXMA 4EDFA 1UFRA 1WVGA 3BHNA 3KUCA 2WJAA 3DKVA 1U0EA 1NQWA 4FZRA 3NT5A 3NKVA 3SQOA 1ZUNB 3DA8A 3VOBA 4OHZA 5KKNB 3LHIA 2Y0PA 1WBBA 1OU4A 4H1WA 4JI1B 2V8OA 3OIFA 4US1R 1SG0A 3L4EA 1DRKA 2XODA 2FUEA 3GRPA 3RR2A 1E94E 2XMQA 2QRMA 3C6XA 4MV4A 3L7YA 4X62B 5I4KA 3S0JA 2PX2A 5E9QA 5IK2A 5AKLA 2ISQA 5IANA 5K0BA 1PR5A 1X7DA 3NGXA 1L4GA 1LQUA 2WT4A 3K4QA 1G7TA 3Q8WA 3F97A 1WNTA 1JG2A 3UT6A 4UNPA 3R5FA 1WW3A 2NZVG 1P7ZA 3HKBB 3MTEA 4H1VA 5AOAA 4KQ2A 4Z8XA 3L93A 2BFDA 2OHOA 1WCV1 2A9KA 2P4EA 3SC2B 3STVA 2DG2A 2EX1A 2J0QA 1ZRHA 1A8IA 3MPOA 1H4TA 3O9MA 2ZBDA 3U4HA 1C1YA 2B8WA 4YRSA 4P4SB 3TZEA 1NQVA 1RJEA 1ZGHA 2I3DA 4I6JA 3WLAA 4QO7A 2UYQA 4KJXA 3M9WA 2ETXA 3R9KA 5KC9A 1ZCJA 3O93A 1DBPA 4CM4B 1U9YA 1MO5A 1M2HA 1T3HA 1TCAA 5D3KA 5I8WA 1MX5A 4RANA 3UNXA 2ZJZA 1WQ1R 3LCRA 4DYVA 4EH1A 1T3SA 3UA3A 1MRSA 2XUKA 4IIYA 2PM8A 2QZ9A 4KQHA 4O4LB 4X24A 3KTOA 3SBEA 1Y1PA 4PHFA 2ZRMA 2UYOA 5IM5A 3QEKA 4KUHA 3F2VA 4GBGA 4QT0A 3ZWPA 4LAFA 2RHJA 4R4JA 5CT8A 1SCBA 2FB9A 2AVNA 1DC6A 1YNOA 3E22B 2ZUTA 5KOHA 3FAKA 3TQRA 4KXMA 2IPLA 4OMUA 3QG1A 4RTPA 4TMVA 2EYQA 1TUIA 3QRWA 3OX3A 2CW5A 1KXJA 3NZEA 1GCAA 4X97A 2JGIA 1UXIA 3KJXA 1R0KA 2ETVA 4YRAA 2IHBA 3LGXA 3V32A 4NZNA 5A5FA 3I6QA 4QARA 4UHBA 3E3OA 2MYTA 3QEAZ 3V2HA 4AO8A 4ATNA 5I7WA 4G4SO 3OFND 5IAAA 3QYJA 2DPYA 3R3ZA 1LKZA 1HLDA 3P0EA 5GGYA 1CF9A 2P3OA 3KQPA 4UTZA 4D9BA 1ISSA 1NMZA 1ZA1A 4WNAB 3QLUA 4XYBA 5CB4A 5C7YA 1P62B 3LXUX 3F5MA 4KE9A 2C7RA 5JJKA 1Z6PA 3STTA 1JKMA 4BVAA 2KLBA 1X0XA 3C5VA 5DLYA 4ZK2A 5TY0A 1T4DA 1XP8A 4QWWA 3SF8A 5JMOA 1GY8A 2YHIA 4HN4B 2WZDA 3HUUA 2OGUA 4ARSA 2P35A 2R11A 2QNBA 4RK5A 5JC8A 3P9QA 1QOZA 5ALZA 4ZEWA 1JMKC 5IWAB 3HI4A 1CVIA 3EH2A 4KK3A 2WABA 4A0FA 3OZDA 3QKSA 3ZH2A 1PBTA 3WKAA 5IFKA 2FRXA 3GMTA 1QFXA 1Y42X 2C9MA 3LP8A 4J90A 4KG7A 3HCNA 2ID8A 4OB8A 4YRGA 3H4IA 1K89A 2DY1A 2OV4A 3FYUC 4CG3A 2W2LA 3DHNA 5HBRA 4EB3A 1I51A 4BFUA 1VFNA 2PUCA 1TCBA 3HQ4O 3B52X 5C5IA 4GVXA 3LS2A 1YDGA 3DOFA 3PC8A 5TIIA 4Q3DA 1C7ZA 4Z99A 4GPTA 4MDHA 1AQ6A 2VJDA 2ATVA 1UWKA 4IGIA 3OPYA 1XTUA 2FQ1A 5DVZA 2JFQA 1DC5A 1JFFA 5DW3A 1K27A 2FUG1 3PX3A 5H3CA 4KZKA 5L7YA 4AMYA 5ALJA 1Z7WA 2AUMA 4BP9A 2GM3A 4DIFA 2IKSA 2A88A 3NWPA 1KRXA 1L5HB 1Z0AA 4G1CA 4LY9A 1EH5A 5C34B 4PXYA 4AECA 1CFJA 1ZL0A 2WSLA 4H08A 6CHYA 4GOOD 4M60A 3U61B 3KLMX 1UFOA 1OWLA 1ANKA 4Z7JA 5K8LA 4WOCA 3RS5A 3T34A 1V11A 3UC5A 3LHFA 2XHZA 1QKJA 1AK2A 3NBYC 4X00A 3PUXA 1B23P 3FN4A 4X20A 3KZMA 3CIOA 4BL5A 1L2TA 1VCNA 3FMVA 2BKEA 3L01A 4PO8A 3V4ZA 5I7OA 1QU3A 4A0QA 2NT3A 3M1IA 4EPVA 2ZYTX 3M6AA 4Z4FA 3PXUA 2FV8A 2RK3A 3MT8A 1FNSA 4D4GA 1A69A 4IDFA 2REBA 2ZCUA 3CCBA 2H48A 4H31A 4OXIA 4WXYB 3ZS8A 1KP2A 2NVUA 5JRDS 5K0CA 1UT5A 1EWKA 2Z09A 3ANTA 4PE5B 1FU8A 3DV2A 3GQBA 3KQSA 3QF4A 5E4YA 3ZOZA 5CA1B 2ZXFA 2I9PA 3IB6A 2DULA 2COEA 4R3WA 4CV1A 1YZFA 4NY1A 1THMA 3A1UA 5BVGA 4OHKA 4QQFA 4UULA 1F8YA 1JDBC 1M34B 1K92A 1V2HE 1C7IA 2WWRA 3A6HA 1QHYA 3KQVA 4LY3A 4TV8A 4URZR 4FN5A 2ADFA 1MDFA 2YH2A 1TMGE 1R0WA 1Y6QA 4WACA 4YT5A 4BBPA 7ADHA 4C06A 4R9RA 4TUYB 5BN4B 2XRFA 1A5ZA 1GFZA 1LLFA 3RUDA 2EDAA 4EZIA 1B42A 3LFHA 3JU3A 3KZCA 1YB6A 2YC4C 3H18A 5LYJB 1FVXA 2WKQA 3F73A 1LTHR 3NG1A 4D0GA 3FX2A 4G3XA 2OSBA 1KOLA 3PUIA 3PWSA 3RU3A 3B89A 1CJBA 5CURA 4YAKA 3Q3JB 2HK7A 1WU8A 1NC1A 3S70A 1Y33E 4I8IA 4DXHA 2O54A 3LT2A 1SM4A 2FWIA 3TJZA 2O8BA 5L53A 1B0ZA 1L5KA 3AT1A 3T1VA 4A23A 1E2GA 2CZQA 1Q6YA 2PGDA 2X7HA 4XOUA 2NO0A 1ISIA 4MPDA 1TK3A 2XCRB 3WNZA 4XX0B 1YRBA 2CD9A 3OQIA 4A0RA 1JDBB 3M5CA 4TRRA 3ZJTA 5IM4A 2XOKD 1R4ZA 5CT4A 1MOPA 1FMLA 1P7YA 4INAA 5JY1A 2J4DA 2I71A 5JXJA 1VKJA 1T1JA 1L4UA 4CM6A 1POWA 4J9VA 1RCTE 4DDVA 3UMFA 3W7AA 1TMYA 3LY8A 1V6SA 3HUFA 4HHEA 4TPKA 3H2HA 2EKDA 3D2AA 3U7RA 4EG6A 2HWKA 2X3YA 3RVQA 4C3ZA 1NASA 1GUFA 4M3NA 1DQNA 3DCYA 1P9OA 2RHHA 2Z5FA 1D1SA 1S2MA 3K0FB 1A5BB 1W49A 2QT0A 2CJYA 4MA5A 4NMMA 4X93A 2EEZA 4LZLA 4JBLA 5AI0A 2ZZMA 3M9XA 4JVLA 2X8AA 4TV9B 1PJSA 4DKJA 4M0DA 4QJIA 4JI8B 4QECA 3V8NA 1L8AA 3DWIA 3FHOA 2ZTMA 3V34A 5IASA 1OA1A 3BL8A 5BW6B 2V6IA 3T9FA 3EB9A 3P4UA 4AY5A 2TMKA 2DHCA 2Q5CA 5LZ7A 3ADDA 3PYXA 2J5QA 4FKZA 5EFOA 1W0CA 3T9AA 4A6EA 4UXJA 5KAPA 1EFKA 3X3HA 3A6JA 2JG3A 5K6AC 1WG8A 1UDWA 1SRQA 1XUOA 4NSNA 4RMNA 1SULA 4JOSA 3VR2A 4BVFA 5E6SA 5CDGA 4BMYA 4B44A 1Y5RA 3LWBA 4OK5A 1V71A 1NBOA 4XIFA 3K9WA 5EE9A 3WXMA 2WQ6A 2FSVC 2REOA 3OZTA 5IAGA 1V1RB 1VJTA 4XUGB 5FRDA 3U49A 3C3XA 4BNMA 4AICA 3UMBA 2RSLA 5IKEA 821PA 3M4NA 4LSZA 5JADA 3WTCA 3JAKA 2W2QA 1E5LA 3QPAA 4Y9DA 3TD2A 1R7RA 3AHIA 4R54A 5H82A 3WS7A 3JASB 3K94A 2DHRA 1XZEA 2ZWOA 1T25A 3BIJA 3GEDA 3G68A 4Y9TA 3N1UA 1AOXA 1FPMA 1ORVA 1MO4A 3EARA 3EIFA 1S3FA 4YV2A 3TSZA 4KPUA 5H16A 1G1MA 3C3YA 3UO8B 1NXQA 1NOKA 1XA0A 3LBHA 4ZO9A 5K2OA 2WWYA 1Z6ZA 3CXUA 3V2GA 3DHYA 4BVHA 3I4LA 2H1OA 5HILA 3W1WA 1XOIA 4YREA 3IGFA 3VKHA 4GRIA 4MYHA 4P92A 1IBRA 2J6CA 4NK5A 1DQRA 3DE2X 3AEQA 1ESNA 4LYGA 4MR8A 1VCIA 4RK7A 4WOJA 4G23A 1C30B 4HWPA 3RUCA 1ZD5A 4O6VA 5TF0A 5T67A 3WYDA 2C07A 3AMVA 5F3RA 1XRLA 3TZQA 2A9OA 3K72B 3AHJA 3OZVA 1QVVA 1BWQA 1PTJC 2Z1MA 3X43A 4B3JA 2R4UA 4C5BA 2OGZA 4TWZA 4P0QB 4KAJA 4CKWA 3NX4A 4PGMA 1Q3KA 1CT9A 1F0KA 5IK2D 2ZIFA 4NVRA 4UXHA 3H6HA 4UARA 1WUIS 4G07A 2PIAA 1W4BA 2YMQA 2BI4A 2PUVA 1Z3CA 2TMDA 1P4HA 3G7NA 2JCBA 2ZIWB 3JXEA 1A7JA 4F9GA 3PD0A 4UDOA 2QRVB 5FPKA 2FW6A 2V6BA 3NEPX 1QF7A 1WSAA 5EI5A 1IZ7A 3BN3A 1AU9A 3PQ4A 4KN8A 1FP7A 2R86A 1SKYE 1U7ZA 2HL6A 1K0FA 3AV3A 4KBYA 4XCQA 4JI3B 1M1YE 4B6EA 3I73A 1WPRA 2J67A 3FG9A 4RHFA 4ZA2A 1K68A 2VRNA 1XLUA 3IR6A 5JSKA 4FGKA 3DVRX 1CK4A 1XK6A 1YQ9A 2OSVA 1KDOA 3HY3A 4ZV9A 3SAJA 2QE7A 1AGXA 1F20A 3HR8A 4IS2A 3EC7A 4FINA 5CRIA 3ENWA 4CEJB 5CCXA 1XX6A 3W06A 4Q7MB 3I5XA 2BP7A 3B36A 4I2NA 4KZPA 2CKDA 3SKYA 3UAZA 1SKQA 1FUEA 1SBNE 2VBGA 3DWFA 2VTDA 2DZDA 2H2GA 2ZULA 1AZTA 4LBWA 1PL7A 1KJZA 4LN1A 3B1KA 3UHPA 4B3RB 3PPYA 1PVDA 4C4AA 3C1OA 1S7CA 2BGIA 2O5VA 4ES6A 4WY5A 4EG0A 3NDBB 3QU2A 5B7NA 3U5TA 1SH7A 1GLGA 4MVJI 1YJBA 5JCPA 1CVRA 5GQSA 3SJZA 1PJLA 3LUDA 3DUWA 1ZW1A 1MHPA 1ISGA 2PGOA 3MWLA 3EZLA 2Q9UA 4KXWA 5TSDA 4U00A 3FR7A 3JRNA 4E2XA 4UM5A 4DBVO 1XJQA 5KSZA 1VL5A 3D1LA 3HUEA 3KR1A 4GC5A 3WYEA 2X7XA 2XCUA 3RSOA 4MW1A 2RGEA 1D9ZA 1WA5A 2NZ2A 4PR0A 2C4TA 4MGIR 1X3LA 1JQ5A 1K7CA 1J9ZA 1P5RA 2SICE 2XUGA 2PFSA 2G76A 3QVJA 5CA0A 3TL6A 4E03A 4TSFA 3W5HA 1G7CA 3QWFA 3G8DA 5FA5A 5B2EA 3DL2A 1SBQA 1IY0A 1QNFA 4JLMA 4UTPA 1FSPA 1PJZA 3BWEA 5H81A 1MH1A 4D3YA 3QY9A 1J09A 4IXTA 1U65A 4UHFA 4QOJA 1BCRA 2ROQA 4E5MA 5HZHA 3AP3A 4OYYA 1MIHA 3K4PA 3IQDB 4Z4HA 5ESRA 1IN1A 1U2GA 2GLTA 2G5CA 5T6BA 4DMHA 4F5WA 5H9WA 1P1JA 3E8XA 3IPLA 4L02A 5L3ZA 3GN2A 2A8YA 4RM2A 1H8HD 4PNHA 3SQWA 2M32A 2JAPA 3R6GA 5A5EA 2XB4A 1NBHA 2LE0A 3DO6A 4QGGA 4YRTA 3GNQA 5I4CA 1QHHA 3KJHA 1JG7A 1R74A 2OO5A 5IBQA 1OAOC 4XD2A 4U3JB 1NAHA 3MD0A 3TNYA 1VLMA 2YXLA 4QJ3A 1BA3A 1FS5A 2V9ZA 4CTJA 2WNIA 4W5TA 3P7MA 3OQOA 2BTQA 4OHVA 3NFYA 4LYDA 4QYIB 1VG8A 1FRFS 1M2WA 2GYYA 4HMOA 3WBKA 4AO6A 2BFAA 1LVGA 4OI4A 1SHLA 2GFHA 4E2FA 5HJ7A 1ECLA 5AHXA 2ABWA 4FGJA 1EIWA 1P6UA 1DLJA 2I4TA 3DEZA 3LI2A 2G4CA 1KK0A 3M5DA 1QYIA 3L84A 3OLYA 2HF7A 5LZ4A 2GUGA 5JXHA 4Q3NA 1YVEI 2A7XA 1SZCA 5TPWA 1XVUA 2HA6A 3PDJA 1XQXA 3DPUA 2DLDA 4H3SA 4WAUA 5DU2A 4B4VA 3VPAA 1CVLA 1U8FO 4HZUB 3BXXA 3HB1A 1V3QE 3QBEA 3NHMA 3L49A 4YC7A 3RK0A 1C3OA 3UK1A 3BKWA 2L17A 3TEFA 2ZRFA 5LQAA 3TW8B 1FYDA 1WVMA 4B83A 4GE3A 4IZOA 2R79A 4D0NA 2XNJA 4G6ZA 3FCSB 3OH8A 3CN9A 3L41A 3DMFA 3BL6A 3EXG1 4GLOA 4I4LA 4IJKA 4MWTA 5JNLA 3JQFA 3HMKA 1DIBA 1NVKA 2K87A 4GRAA 4FHZA 2V7XA 1CHNA 3IILA 3P9RA 4QGHA 1ZA2A 2HI0A 1VLQA 3EVNA