2XBUA

Saccharomyces cerevisiae hypoxanthine-guanine phosphoribosyltransferase in complex with gmp (monoclinic crystal form)
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
213
structure length
200
Chain Sequence
DKQYISYNNVHQLCQVSAERIKNFKPDLIIAIGGGGFIPARILRTFLKEPGVPTIRIFAIILSLYEVKVSRTQWIDYEQCKLDLVGKNVLIVDEVDDTRTTLHYALSELEKDAAEQAKAKGIDTEKSPEMKTNFGIFVLHDKQKPKKADLPAEMLNDKNRYFAAKTVPDKWYAYPWESTDIVFHTRMAIEQGNDIFIPEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords HYPOXANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
publication title Functional Significance of Four Successive Glycine Residues in the Pyrophosphate Binding Loop of Fungal 6-Oxopurine Phosphoribosyltransferases.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 74
structure length 200
sequence length 213
chains with identical sequence B
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 2010-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xbuA00
5JV5A 4LZAA 1V9SA 1ZN9A 1XZNA 2PRYA 4PFQA 1DQNA 1G2PA 1I13A 2FXVA 3O7MA 4P82A 5BSKA 1XTTA 1VCHA 1L1QA 1A98A 4TWBA 5JSQA 4QYIB 1PZMA 3ACBA 1G2QA 1OROA 1AO0A 5KAPA 1HMPA 3LRTA 3GEPA 2YZKA 3OZGA 4RHTA 1Z7GA 4JLSA 3LPNA 4WMLA 1I0LA 1P18A 4LYYA 4RHXA 5ESWA 1UPUA 2EHJA 5BQPA 1W30A 1L1RA 4RHYA 1A97A 1I0IA 1P17A 5KAMA 3OHPA 1FSGA 3OZFA 2C4KA 1D6NA 1DKUA 4M0PA 4RAOA 1OPRA 1BZYA 4OHCA 3NAGA 2P1ZA 3N2LA 2AEEA 1U9ZA 5K51A 1HGXA 5HKLA 1A3CA 2WNSA 3MBIA 1VSTA 4P81A 1QB7A 4LYGA 2IGBA 1A95A 1BD3A 3MJDA 4QRIA 1Y0BA 3GGJA 3S5JA 2JKYA 4KN6A 3EFHA 4MB6A 4Z1OA 2PRZA 3QW4B 1DBRA 1NONA 1ZN8A 1YFZA 4RAQA 4IJQA 1XTVA 4P3KA 2H08A 4WN3A 3M3HA 1QK5A 3GGCA 4RHUA 1I14A 4JITA 2JI4A 4X45A 5IPFA 1G9TA 1QCDA 4M0KA 3ACCA 2GEBA 1JLRA 1TC2A 1QK3A 1QK4A 1ECFA 3KB8A 4P86A 4RACA 1A96A 5BQOA 1GPH1 1JLSA 4M0UA 4X44A 2PS1A 1O57A 1DQPA 3DEZA 4P83A 1QB8A 4RABA 1ECBA 4ZFNA 4RQAA 4F8EA 4P84A 1BD4A 2DY0A 1XZ8A 3HVUA 1J7JA 1U9YA 4LZNA 1P19A 2E55A 4S2UA 1UPFA 3G6WA 1ECGA 4QYIA 1P4AA 3DMPA 1ECJA 1XTUA 1TC1A 1I5EA 1VDMA 1ZN7A 1QCCA 1IBSA 1GRVA 2H06A 2HCRA 2H07A 1WD5A 1LH0A 1MZVA 1UFRA 2XBUA 3H83A 1A4XA 4FYMA 5BRNA 5ESXA 5IAOA 4LZOA 5HIAA 4RANA 2JBHA 3ACDA 2JKZA 1STOA 4RV4A 4RQBA 1R3UA 1CJBA 1NULA 1OREA 3DAHA 5EUCA 4PAWA 4RADA 1ECCA 2VFAA 5E38A 1G9SA 1DKRA 1O5OA 4P80A
chains in the Genus database with same CATH superfamily
5I7OA 3ECCA 5TX7A 2Y1GA 3ETJA 4UPEA 1J42A 2WSIA 1SM4A 2JH8A 2D0PB 3CSDA 3EIFA 3S2ZA 4CHTA 2X9GA 2V5AA 3VZQA 1G8PA 3TR5A 2ZEJA 1ZOPA 3EEFA 3ZIAD 2GN1A 3N8IA 4DLNA 1EGMB 1X77A 1FQJA 3P26A 3AFHA 3B70A 3JWPA 4XJTA 1AY0A 1FFEA 4U0KA 3NBXX 5FKJA 1C9NA 4OJNA 1W36B 2HK9A 2XTMA 2RDMA 2GK6A 2ZB2A 2VHTA 4NBVA 5AW5A 3H86A 4JDUA 1EE9A 2A0FA 4YT8A 1JR3E 1N2CE 1YS7A 2GRAA 3WBFA 1DC8A 3EXAA 1G0OA 3LXRA 4MRPA 1D04A 4G01B 3SNKA 1JJBA 2IS4A 5JYBA 1P0IA 5G53C 3OF2A 4C7JA 4F9FA 1EVYA 1HQYE 1TCAA 3ESZA 2MSCB 4G23A 1BJTA 4OKIA 3QQ5A 4WZAA 3IP7A 4RA9A 2ACKA 1FRFS 1MXFA 1BAPA 1QHSA 1RYBA 2GASA 3D43A 3EFOA 2HHCA 2B2XA 3OJFA 1KZHA 2YW9A 3N2KA 4BYGA 3GUHA 4PLPA 5KBYA 1GJRA 4C1BA 3K6SA 5J5AA 4BQRA 5H3CA 2PD4A 1UZUA 2IQIA 2NU9B 3RS0A 3H18A 4R1OA 1THGA 1W2WB 2FR1A 2H1IA 5IC5A 3BFXA 4K81B 2XUDA 2V3WA 4IMPA 3D6VA 3HCOA 1XRLA 4XJVA 4OQPA 3AVPA 1FW6A 2OV8A 5AD1A 1CF4A 3AVOA 4AS1A 1W46A 1USWA 3SC2B 1HNXB 4FBLA 2HLNA 2XQGA 3DAPA 3NB0A 1Y7HA 1GTZA 4HNAA 4X93A 1XTIA 3RVPA 3W79A 5M7EA 1LBEA 1QGZA 2D06A 3KQNA 5LDHA 1CULC 3EHEA 5B3LA 4CT4B 1BWPA 1KGDA 1XK7A 1W4BA 4KUHA 3VPFA 1E8NA 3JZMA 5AKKA 4GH5A 1RR6A 3NKVA 5LZ8A 2FPWA 3B7PA 5CXUA 2Z3WA 1XV5A 1L7VC 1RM5A 4RLSA 3UY4A 3BMQB 4F96A 5CIQA 1NUSA 1B7GO 1E94E 4KPEC 1VYVA 2IYRA 4G85A 2HOQA 2Q2QA 2PA3A 3QBVA 1Z29A 2NTVA 3AJAA 3UWKA 3VDMA 2KHZA 2JFOA 4DNFA 2C95A 2C58A 3BREA 5EIWA 2YWDA 4DT1B 2YYYA 4RVHA 1NPYA 3A3NA 3KSBC 5HE8A 1A9ZA 4N9QA 5INTA 4Y2RA 3ZY5A 4AG5A 1RXSA 1P2FA 3VDXA 1QRTA 3ZD6A 1AV6A 1CUDA 4UXIA 4CMAA 4ZHQA 3ZHUA 1U2EA 1LPPA 1ZR2A 1MZVA 4KFRA 1V16B 2R47A 1U0RA 5BSEA 3KWMA 3Q3VA 4G81A 3OX4A 5BMVF 1AA6A 3OM0A 1ATZA 3CXUA 1S7GA 2FHSA 4W99A 2AOXA 2JL1A 1HL7A 2NZYA 2XB4A 2FEMA 3EAQA 1ZSNA 1PYGA 3JASB 4MMZB 3WLNA 1JDUA 2HBYA 2WW8A 4GOND 3W8DA 1HLPA 1PSDA 3TL2A 5KWVA 1CX9B 4KBYA 5E6SB 1YR6A 1OI3A 3BZUA 5ER9A 1NNSA 1UBJS 3ILXA 2FRXA 1GCGA 1FU7A 2VZ0A 1ISGA 4FKZA 4FOLA 4AZWA 3RG8A 5CD1A 3KXKA 3EA5A 3IE0A 2VPXA 3ILVA 3OFSA 5D7BA 3H5NA 2J7KA 1AQYA 1U7DA 2L69A 4BTEA 4PN3A 1ODIA 1GTJ1 2GWRA 1N75A 3ZCPA 4EQ6B 3TEFA 4IM7A 2JI6A 2QTBA 2YZMA 4JUBA 2HPAA 1LQTA 1ULUA 4I4LA 2QIOA 5P8WA 3A6DA 3W6UA 1D8TA 4G5HA 5ANRB 1HDEA 5F1KA 2PR2A 3KYDA 2G72A 4EHDA 4JR0A 1JG7A 2XMQA 3H3JA 4ZJYA 3BT7A 1G4AE 3NJRA 4DSZA 2MSDB 5C81A 1Y5MA 1Y4DE 1YNSA 4GI1A 4EYKA 3CPEA 2J7PD 3G9TA 3E9EA 5AW7A 4LISA 1DRKA 1Z3IX 4OBBA 1HG1A 2NG1A 5EHIA 3Q9LA 3L9XA 3PC4A 3WZ2A 3DW1X 3L1VA 1GR1A 2I76A 1NVVR 4Q3DA 3DC2A 5AHWA 4EOGA 4ODIA 3TEJA 1ZEMA 2X5JO 2Z3ZA 4WVLA 3CWCA 2IYWA 4MUYA 4B7CA 4I4CA 3R40A 4JENA 5TMBA 3P8ZA 4AS3A 3ZH2A 3ORRA 1R3DA 3GQBA 3N2LA 4J7AA 3RHSA 3KLMX 2HWXA 4Q19A 4FOPA 3GLFE 1U8FO 4CT0A 2IEZA 4RENA 2FV8A 4Y1RB 4ROSA 3WBBA 2ZJ0A 4CUJA 1NDUA 1MABA 1PL8A 1V1JA 3CUTA 1QGOA 3DWFA 3DV9A 5IBPA 1K89A 2WUWE 5BMVB 1KSGA 1WCIA 5EA2A 3TZQA 1C9EA 2UU9B 2XDQB 5AW6A 2UUAB 2I8AA 4KU4A 3TLXA 3T9FA 3QYAA 3QKSB 3U39A 1W0JA 4DHWA 2PKWA 3LHSA 4KPUB 4S1VA 4X00A 2F43A 4C05A 4KACA 2TECE 3LT4A 3NOVA 3WGHA 3N2NA 9GPBA 4RHUA 3L84A 5HK9A 3U61B 1XWFA 2BD0A 1G9TA 1S5PA 3ACCA 5J5VA 5BPHA 3KKMA 2O0LA 4LCBA 4J2HA 3DXYA 4FC6A 2X8JA 3KLBA 3ZH9B 3H0KA 1QK4A 3H5RA 1UZMA 1XYVA 5FLXA 5JJLA 2JFNA 1ZJYA 2VK4A 1C7QA 1KAHA 1ZGAA 3QVGA 2XNKA 3W6NA 5LOVA 3PGMA 3Q7QA 3KQWA 2HADA 1UM8A 4V2UA 4ZVNA 4IG4A 2MYTA 4R2JA 3C6KA 4QEDA 3T9BA 1F60A 1PQ4A 1RJEA 2XRYA 4MGZR 3VC2A 3PUKA 4LA4A 4CU5A 1M2VB 3CEPB 1QP8A 5ERXA 2Q0SA 3AG5A 4TS4A 1H8HD 5EUBA 5K6RA 2CBGA 1NUQA 3BICA 3W2TA 3LJKA 2OORA 1LK5A 4YDSA 4HDSB 1J8FA 4N0DA 3TUJC 2AEFA 5KC9A 4DXAA 3KO8A 3UGQA 3JD2A 3LTEA 4DMRA 3EIQA 2AT1A 3P94A 1KYYA 2PUHA 1Q84A 1QNLA 3IUBA 1RWMA 2BBWA 1EDOA 1GQQA 1OU4A 2GEUA 2P2ZA 3HH8A 5ECWA 1DAFA 1AA9A 4P54A 4UVHA 4AC9A 1FYDA 2X0IA 1AV7A 5FAKA 1NW9B 4GQBA 1OZHA 5EI5A 4B6SA 3OQJA 2P9QA 3RVOA 5AKJA 2DULA 2X0KA 3KHSA 4JIGA 4CUKA 1KJZA 2I9KA 2J3EA 1UBMS 2DBQA 3L82B 4BGDA 4XYEA 7REQA 2EF0A 3D5TA 4RK5A 4RF5A 3FZGA 1GPKA 1BS1A 2QR2A 3SICE 3CRNA 3JQDA 4OHVA 5FQNA 4B1FA 3KZ1E 3OJ0A 4E33A 1O96B 5L3ZA 5DNVA 2O6HA 3OZ7A 3IXMA 4CW7A 4EW6A 2YWBA 4DJ5X 5GVSA 3PHLA 3AP2A 3WLFA 1D4FA 2WKQA 2CYBA 4LZJA 4ZVVA 4KR7A 1EZ4A 4NBLA 5TRTA 1RWVA 1B0ZA 1ADBA 1AO3A 4OK6A 3LPNA 2G0TA 2NTEA 3GRAA 3TQRA 2W2PA 1OXTA 4ID3A 5CVJA 3WP1B 4FI3F 3AF3A 2XD9A 4BX2A 5BUCA 5PGMA 2XXJA 3IAS1 1M7GA 3OX3A 2CLCX 3AQ4A 3DD5A 1RWNA 4BFVA 5JFGA 1VG9B 3SM9A 1EXWA 1HZZA 3ANTA 3H13A 2VTDA 4QLOA 2AW5A 3KTDA 3GEDA 5FWDA 1JHVA 2GPNA 4JCCA 2AG5A 5K8CA 4LJSA 4LOAA 4YONB 3T7EA 3OZCA 4AI6A 4Z4QA 3HDQA 1EAYA 5DV9A 1ZCZA 3EZ6A 5H9VA 5HKLA 1A3CA 2QAGC 1YI1A 1B42A 1QYWA 2H9AA 3CPHA 3QX9A 2C84A 5L95A 4J3FA 1NVXQ 2HF7A 3R5JA 4R5HA 1EFTA 2OLJA 2IZOA 4YA6A 1FFXB 2Y05A 4JSTA 2AW3A 1W0CA 2F7SA 4KR2A 1RQ2A 1NF2A 4FGLA 3D5QA 4BATA 3QW4B 1TPYA 2JGDA 3LLVA 2PLFA 3NP7A 5G0SA 1Q22A 3FPAA 4IV8A 4DADA 4DWOA 2WJIA 1WHTB 3IRVA 3WYFA 4DR2B 1EHYA 2Y0DA 4LXTA 4ZO7A 2YXNA 3U3ZA 3ZZUA 4YLYA 3JRNA 4ZYZA 5J4HA 1JLHA 3TX6A 1Y34E 5HCUA 3IQWA 5LDDC 3JPYA 5JCPA 2QP3A 4MRMA 4RZQA 3UKDA 1J4AA 4FBGA 4U0JA 1E6CA 4M1KA 2WUVA 1HURA 1BEUB 1LY1A 1VM6A 1ZCAA 2JJQA 2VP2A 3TLGA 2HJSA 3I92A 3DL7A 5H81A 3R0VA 4YRJA 3RVSA 3UC5A 2HQSA 2B25A 2FWRA 1KVQA 1P5HA 3FMPB 3SQDA 1Z36A 1K8XB 4GYKA 2QN8A 4BO0A 4MPTA 4EG3A 5LBTA 1ZD1A 4XRRA 4KLNA 4TL8A 4AMUA 4CCAA 2LGJA 2MR5A 1E3JA 4DQUA 3TL3A 4EKNB 5HNKA 2V7VA 4KEAA 5I8ZA 5GGYA 1ONNA 3S7TA 2HA5A 2Y1KA 4EM6A 3FHOA 4JLMA 3WFJA 2J0SA 2RAFA 1H22A 3WWDA 2IRWA 4BJ6A 1A2KC 2HKIA 2YMPA 3O82A 4XQGA 3VYVA 1ENZA 3C41J 4PVCA 5KTTA 1VI6A 1T9ZA 1NBHA 1RM4A 4N6NA 1UBTS 1QLWA 1Z39A 3OU6A 4ZAVA 5AYVA 2GJSA 1PSWA 2Q49A 1HWYA 2I2AA 1FFSA 1MOZA 2VL7A 3DTYA 2FUG1 4L8GA 2BEWB 1GLGA 2C04A 4Q6WA 5HKAA 3KKEA 1DXYA 1JEQA 1XU4A 5FV7A 1V8BA 1WLSA 4A2QA 4KFCA 4FIDA 4MQFB 4OV6B 1COWA 2P6MA 1J1IA 3PVSA 4OXNA 3S2SA 2Z1MA 1QIJA 4PNPA 3RT1A 5HF5A 2YH2A 2HU7A 4Y6LA 5JC1A 1JN0A 5JI3E 2ADFA 1ZOLA 2ODNA 2VJAA 3KXDA 4J2OA 5BY2A 1QRSA 1Z4JA 5JY1A 2CE7A 3EZFA 4FU0A 5IKEA 1Z7BA 1FX0B 4LC1A 4YPFA 1WAMA 2FP3A 4LBZA 1NJGA 4H3SA 1U4SA 4N1AA 4DMLA 5CLIA 4QKQA 2Q1XA 2CJPA 3QE3A 2VAPA 3T4UA 3PXEA 4IDBA 3RTEA 5EKUA 4QVKA 3FDZA 5AW2A 1I0IA 2Q3LA 1DNPA 2HPHA 4IL5A 3ROTA 2IYUA 3I2IA 1BMFD 2YJTD 3UPTA 4X6XA 1TK2A 1OLSA 5BSVA 1JYSA 4B43A 1B14A 1K8ZB 1VJ0A 3G7SA 4TM8A 2JRCA 1A4RA 2Q2WA 3OIVA 4KGDA 4OB8A 1GAWA 1RADA 2CLHB 3IERA 4CEHB 3WL4A 1S3GA 1P5RA 1FB5A 4QDJA 3GG9A 3GGDA 4L4YA 1GNVA 2VRBA 2P6OA 1YVUA 2Q99A 3P20A 2JFBA 1U2GC 2E1PA 2GN9A 2Z1NA 3GFQA 1XB2A 1Z4KA 2PQ0A 4HTFA 2R5FA 4K9KA 4N8SA 2R7KA 4PZPA 5TQ0A 4KO4S 4S1WA 3S68A 1L4GA 4HDKA 4XIIA 3N0RA 4PX5A 4JYAB 3DOEA 2SNIE 4P7GA 3RYIB 3DM9B 2AIRA 5F7ZA 3CBGA 3SIXA 2EFJA 4QXRA 4A2CA 5A9SB 5LNK6 4FZJA 2GHIA 4G0OA 5I8PA 4ZGBA 1M1YB 4NH0A 5KNDH 4CIBA 1I7LA 2OC9A 4GRAA 1QHGA 3D1JA 4DRZA 2C59A 2FP4B 2MYPA 3LUGA 1RT9A 3G1WA 3MTGA 3HG7A 3ASYA 3I8SA 3HA3A 4G8CA 3TRDA 2LW7A 4Y0AA 1G63A 1TTPB 4MJ3A 5HX7A 1DGQA 1MC4A 3GRCA 2P11A 4JASB 3ZCRA 5B6PA 1R0BA 2ZRCA 4I50A 3HKCB 3W3AH 2ZE7A 3RIHA 4GBED 3MMXA 3SR3A 1DKOA 3O9ZA 5AM1A 3JD0A 1OB2A 2Y2UA 3UBMA 5A5FA 1N34B 1JH9A 4L72A 2DWPA 3FVVA 621PA 5DIZA 2BH9A 2ZAYA 5CH3A 2QYSA 3P0IA 3FCSB 3ZE1B 1OWOA 1IEQA 3KP1A 1IQ0A 4YJ3F 4RF2A 1Y33E 1BKDR 3GNTA 4J3NA 5K0CA 4RSMA 3MGKA 3K0CC 4PO1A 4E5KA 2H1WA 2XTAA 3GT0A 1FVXA 2X5OA 4TTJA 2Q46A 1E2JA 4DMMA 2B61A 4PYMA 2QR3A 4PRZA 2XXBA 5CG1A 1PN3A 3TG8A 3NDIA 3OQOA 3SXUB 2WIJA 3A70A 4U63A 2BN4A 4HRXA 4XGRA 3T7TA 3W04A 3THWB 5JXHA 4B3MB 4F85A 4Y18A 4V38A 4KR0A 4J0JA 1RJDA 4DG8A 1EVLA 2C31A 2OV3A 2J6HA 5SZHB 3EGVA 2G9RA 1TVEA 2WHPA 4X64B 1I2CA 1Q5PA 1HTTA 1NVGA 2IWRA 1UK7A 4A8JC 2ZJZA 2Q6OA 1XIVA 4OM8A 1NPDA 2VH1A 4JBGA 4FMCF 4J03A 4MICA 1E2FA 3M4JA 4QT4A 1IBMB 5LLTA 5GONF 2Y66A 1CZOA 1NXQA 1X7ZA 1XZNA 2DHDA 2GA8A 2IDZA 3GP3A 1Y82A 3SF8A 2KX7A 3S8MA 1NZDA 1QAMA 1ISPA 4RCVA 3G5UA 5E6RB 3VV2A 4ARVA 5FO1A 3P9PA 4E5SA 4MLDA 1KY4A 1OIXA 3AEUA 3H65A 4ZCPA 4CG0A 4EBFA 4F7WA 5DBEX 1E3WB 1UBKS 3EWAA 2C77A 3OPVA 1E2KA 2IKQA 4JJ6A 2ZYHA 1N2EA 4TKUA 3IOEA 3JAMA 4ARCA 1K2VN 2VDQB 3G88A 3RBVA 3WLOA 4YV7A 5DU2A 3FROA 4MTLA 4P4NA 1WVGA 5B55A 2QUJA 1YZHA 1UBHS 3ZVKA 2GBLA 1K8QA 3T41A 4EENA 1G3IA 1XMSA 1D2GA 1RXIA 1S01A 2LPMA 2ONKA 4FMDB 1N6NA 5BSGA 1DJNA 1FTGA 1NSTA 3A36A 2P41A 3ICWA 4UJ3A 3K05A 4ETMA 4CKCA 1W85B 5AO9A 9ATCA 2ONYA 3AB3A 2WJZB 1FTYA 3IUPA 4G9EA 3J7TA 5HCIA 1KZ7B 2R5WA 4QPNA 4YJ3B 2J30A 4O33A 5C52B 2HQBA 4D0LB 4YRPA 3RVMA 4EK9A 1MJHA 3BCUA 4TXJA 3JAWB 4EFKA 4KQHA 2HR1A 2FVXA 4ZTZB 1HE4A 2BM8A 3EF3A 4RZHA 3CUVA 2OCPA 3B1YA 1W1WA 1I0ZA 2GJAA 2QNRA 3CEMA 4K86A 2CXXA 2JHCA 1LFDB 3C6MA 3G82C 4KBFA 5DI3A 1V25A 4N40A 1MOPA 3VO1A 2JDIA 3K3PA 2FQQA 1U8YA 4A7PA 4W1PA 2OV1A 1DTWA 4LKOA 1GTSA 1TL7C 1DEOA 3MGGA 2FEXA 4OHZA 1UC9A 5ADWA 3U7FB 3NFRA 1L4LA 1T9BA 1EQ2A 2JGRA 2PGNA 4UTPA 4LRQA 3COJA 2HWYA 1IONA 2DQZA 4X63A 5CDHA 3LUKA 2HHHB 3LC2O 3PWZA 4PZDA 4FMCB 5CW1A 5ICFA 3G2NA 3G2JA 4X94A 1T36B 5GONB 2QAJA 3TTTA 2SCUB 3PA8A 4RNCA 3P96A 4QRHA 4ZALA 4C7OA 4KQXA 4ZZIA 4EGAA 4YMSA 1TJ3A 5KOJB 1YVRA 1Q0SA 3FIJA 3OIFA 2CNWA 1JG3A 2KMLA 4TQ9A 4YP7A 1Y9JA 4MUNA 4PX9A 1Z2OX 4TRRA 1WZUA 3TMYA 2IHVA 4F2WA 5AVXA 3DC7A 1PS8A 4G0WA 2X6QA 1JSLA 4WX2B 2V7GA 3CGWA 3ICOA 4G1BA 4MKZA 5EXTA 1HNZB 1HDRA 3EG5A 1IC6A 2PGXA 1UPFA 3H1AA 3IH5A 1H2ZA 3FUCA 3IQFA 3IPCA 3GARA 1VG8A 3PFFA 3OT4A 3FFWA 4Z51A 1NDHA 4I4TA 2AOTA 1M3SA 4BAZA 4FNMA 1EJ2A 1PJCA 4MKIA 3ED1A 2ISSD 3EJ6A 1CRLA 1V48A 4IGIA 3GFGA 4QU9A 4DIMA 4HT3B 2YIVX 4HNQA 4M87A 2CY0A 4QJBA 4IO0A 1KFEB 4Z86A 1AN9A 2HV8A 4D57A 4RKEA 2Q0XA 5U9CA 1WDLA 2R96A 1DRVA 3L79A 1N4DA 2WAOA 3KYCB 5H5JA 4LYHA 3C1OA 3MD0A 1RYNA 2FPGA 3DOFA 4CL2A 5IS2A 1P0CA 4DLTA 4MW0A 1HLGA 1NLMA 4PZEA 4MRAA 4C6RA 4GOLD 3UQZA 4HP8A 4PC3A 1Y1LA 5LSAA 1ZESA 4ILKA 4O1HA 4REOA 1OH8A 1XI2A 4URFA 3R5FA 2GLUA 5DWVA 2Z09A 3MAGA 4V24A 1CY0A 4UM7A 2DRIA 3NBYC 4YS6A 3I9V1 2IOFK 4DRXB 4DSTA 3FRIA 1JILA 5L4SA 3DCIA 1BOFA 2C00A 2CL5A 2DM6A 3EVNA 4ZCLA 3PDCA 3RIMA 4QPPA 5HP4A 4BQFA 3N6XA 3IPYA 1J49A 1JWAB 2P4QA 1MOQA 3ELYA 2FPLA 5MN5A 1VRWA 4QQ8A 4CR8A 3RJ9A 3GLGA 3WLPA 1XP5A 3H2IA 3W4IA 3BB4A 3JPWA 4ITVA 4YO7A 5JBQA 3TXAA 2FMXA 1Z6AA 3I6BA 3P45A 4LYAA 1FOEB 3WGGA 3K2EA 1G18A 5HSGA 1QQAA 4KG7A 5A04A 1P17A 2C5FA 3L5KA 4LFAB 4UEWA 4AJIA 1XAHA 4EA6A 3ZN2A 5KYKA 2J0UA 4BMZA 4YCJA 3OMWA 1WVIA 4MGIR 3JQBA 4NHOA 4CF3A 2O2YA 2M32A 3TOZA 3ZLJA 2X3YA 4Y6RA 3ZKWA 4GLFA 4FYJA 1E9DA 2KI5A 2O1WA 3CW8X 3I3SR 4J49A 4NOKA 4EHLA 1HGXA 1DCMA 1XXHB 2Y0PA 4H7IA 3QOWA 1RW4A 1SO8A 1YV9A 4W4TA 4IDHA 4EHHA 5DCYA 3NO4A 4DV1B 1VSBA 4QUDA 2JD1A 5KQRA 4I1YA 1YB7A 4MUAA 3LOUA 3QE9Y 2FFHA 2AK3A 2HN9A 4MRVA 4MVXA 4A1FA 2XKKA 4F4UA 1PK7A 1XWIA 1JBKA 1AURA 1YKFA 3JR7A 4GLJA 3U4DA 2MR6A 1T2FA 3E7DA 2N47A 2OFOA 2FUCA 2ZT7A 1LDGA 2R25B 1GDTA 3DO5A 2C2WA 5FWAA 1WX1A 2AI2A 2XH8A 5LWQA 1Q3HA 3EZNA 4M8NE 1NIPA 3D4BA 1R18A 5SZKB 1OYWA 2IUFA 1PAUA 1XZBA 5F9FA 2E5WA 3BZBA 1WHSA 5E95A 1L6RA 1WDWB 1F8XA 2QA5A 1ECBA 1IBCA 2KW5A 3BXZA 4PQYA 3OM9A 2I29A 4FVTA 1H65A 1KYWA 1J2TA 5C34B 2IF0A 2PQMA 4BNMA 3ZWNA 3MJEA 4BNNA 1WBJB 1KIMA 2ODAA 4UMVA 2C4HA 1N6OA 1YOVA 5IUJC 1NMQA 4FHZA 2VUSA 1F6WA 4GP7A 3C48A 3EWNA 1W7AA 2B5VA 1SOVA 3BYZA 5AIBA 5JJ5A 3RVDA 1TE2A 3DZDA 3BH7A 1VIMA 3SDSA 4TMXA 1U3CA 4QL3A 5JXGA 3WLQA 2REOA 1BW9B 3UMRA 4HXFB 1H85A 5AJTA 1KWKA 2FMKA 4L95C 3E35A 2BT4A 4JVOA 3ZHCA 5IRCD 1PNRA 2PRKA 5I4BA 1D4ZA 4KW7A 3HFJA 2QIPA 4C6HA 4AICA 4DNXA 5BYBA 1ESCA 1OXVA 1CB0A 3B51X 4R01A 1DP4A 3EIWA 3V2GA 1GUBA 2FUNB 5HA5A 6CHYA 3L2OB 4NFSA 2O1SA 4BFZA 4RLQA 5UKDA 2Q5LA 4GVLA 5CEJA 3U7EB 1WXHA 2YYZA 2GO1A 3H99A 3QPBA 4ISCA 4QOIA 3R7FA 5K3BA 4YRKA 1HFWA 2I55A 4D9HA 1AHPA 5JLJA 1FLVA 3QYJA 4FIZA 1A98A 3HKDA 4WGGA 4JBXA 3BCSA 3ACBA 3GLSA 2QVCA 3RSOA 3QENA 4XQCA 2NYUA 1OTHA 1TKBA 4YJGA 4F3KA 3KZVA 1UKZA 1OFHA 3H2BA 3LLSA 3QZUA 3KB1A 1S8AA 2NSLA 3VR0A 4QOHA 5D2CA 3G2HA 1OF1A 3IQGX 1XQ6A 4AP9A 4B2PA 5F12A 4ZJZA 3OBBA 4DXHA 3M6MD 3SKXA 5F76A 1A9XB 1DU4A 3W5DA 3VPAA 4DTCA 1TPZA 3FMFA 2BTQA 4ONEA 2V7UA 2BF4A 4JB3A 5EXPA 2D5BA 4D02A 4PANA 3LDFA 4IDEA 3MILA 3TLCA 1WPRA 4HO1X 3ZDQA 1WW2A 2QV7A 1R74A 2AHOA 2CUZA 1ZRHA 2FOXA 4L0CA 2BKEA 13PKA 3C1AA 1B8VA 3KAKA 4RJKA 1H2YA 2GLTA 1JEDA 4UNPA 2ZSJA 1ZU5A 2YOFA 3KQMA 4MYRA 3HUDA 1CV2A 1FP2A 3L40A 3RBZA 5A4AA 5BWOA 4U6NA 5L4NA 1I3OA 1KORA 4N5IX 5C1PA 4FUTA 2AMYA 3TNDA 1J8VA 4DA0A 3G6KA 3WQBA 1AB5A 2PX0A 4EY8A 2GDZA 4JVNA 4TWZA 1HFKA 5KKAA 3B85A 4UARA 2GILA 3LP5A 3OLWA 5AW1A 1H3NA 2I7DA 1IMOA 5CVUA 1L1FA 2HXYA 1SIOA 4DNPA 5JD4A 3SHQA 1CZKA 1V3TA 4C5AA 1XKLA 4D4HA 4ZVSA 4QBIA 1X1CA 4PGGA 4YECA 3RUPA 2JAOA 1E9SA 3STVA 1XHFA 3BFKA 1WMEA 2F48A 3OP1A 3K0SA 5JS1A 2QU8A 2BF7A 1I33A 3DLIA 2AMLA 2R60A 3OKPA 3RS9A 1N78A 3ANYB 4Q9NA 4F2GA 5EIAA 4AJNA 4GYWA 3H16A 4ZAWA 1QX3A 3PNPA 3H04A 4N0PA 3V4LA 1GTRA 1RTTA 4P0PB 3SLGA 2X7JA 4J91A 2FKAA 3VNBA 2NVUB 4MZDA 1SVIA 1RFGE 1ADCA 2ETXA 2IYFA 2QD4A 4WWHA 5DK6A 5HS6A 4FFMA 4K6FA 1OZ0A 5AK6A 4DV0B 3DVRX 1XTRA 2BMJA 3LVRE 5LUAA 3H5TA 4Z2YA 1E1YA 2NXEA 4J16A 5CXQA 4C07A 2XA2A 4I9NA 3QXSA 2PWZA 3HI6A 2Q29A 3ZNOA 1FNNA 4BC0A 3S27A 4UUQA 2J5RA 4D9FA 1JSRA 4PGMA 5C8DA 1T9KA 2RI6A 3EEQA 4MR8A 3NKFA 2DMRA 4JUFA 5HPYB 2UDPA 1F4LA 4OLAA 4X41A 3LHFA 2WF8A 1LNQA 3NEJA 1C1DA 1UJ5A 2FG5A 4NPHA 5I9MA 5EP2A 4LNAA 3AL0C 1J1UA 1G66A 3F1KA 3KDPA 5KVAA 1GG5A 5KYNA 1R1DA 2JHGA 5F2NA 2BPOA 3LCCA 3ZV3A 2INGX 4RHXA 3RU7A 4S12A 2DWUA 4KN9S 3EQ9A 2NSDA 4B3TB 2E7ZA 4AL4A 1SC1A 2UUOA 2OB2A 1WCIB 2HWWA 4KV7A 4HVLA 1XTTA 3ER6A 4FOSA 2N9UA 4IDOA 1YQ9A 1GTVA 4XYMA 5FUBA 3AKCA 4W5RA 3OX1A 2P40A 3FLAA 4MUEA 4OF4A 4DDWA 2QRUA 2PJRA 3EGDB 2GDJA 1FXWA 2EFEB 4X7PA 1ZMXA 3GVIA 2F43B 3BMCB 5J3JA 1E0SA 1TDJA 4YLEA 1Z7GA 3F6PA 3L8FA 3BTUA 2VWQA 4MO9A 4BFTA 2HA6A 1YQTA 4W7HA 1E7RA 2IIVA 4X0EA 4HX2A 1GZ7A 5D5PA 2QNIA 2XMBA 3DOUA 1KSFX 2B4AA 3EN0A 3QMVA 3SQLA 2P6NA 2KM1A 4ZQEA 5DRYA 1BXRB 2HB6A 1O94D 4UU8A 2XMGA 5LZ7A 3IHTA 1D09A 1C0LA 1ANKA 2ZXEA 3V1UA 2QD1A 3LS2A 1O6BA 1R0SA 2XEXA 4GO1A 3C3KA 1SXJD 3MINA 3C8DA 5DHRA 1DX4A 4G1CA 2CC2A 4Y2UA 3EZGA 4W7IA 4BVHA 2ZWPA 2FZVA 5FUQA 1T29A 3H2ZA 3QP9A 5EIOA 2VCHA 2QW1A 1HYBA 1Z0IA 3ITNA 1LZLA 4UNSA 1JWBB 1ZJZA 5CJPA 3KJEA 4BFLA 1WZ2A 1GNLA 2DFKB 4WK0B 3F98A 1H8ED 3AJDA 3HWWA 2O2XA 1QSGA 1WZEA 1TIBA 1X87A 2HCBA 4IJUA 4J6FA 2FZ4A 3USES 3A9TA 1SKAA 2Y8EA 3OJCA 4S05A 2QMZA 2V6JA 3WMEA 5IAKA 4EZEA 1SUWA 3ICEA 4Q3CA 3RC2A 5LN1A 1EX6A 1FNCA 5FTLA 3DDNA 4QYXA 5A7GA 1Y4AE 1Q19A 3D2AA 4WXMA 1PUJA 1KR5A 1Q15A 1TK9A 2XYVA 3WGZA 5IDQA 3AF6A 2ZUEA 1DWUA 1TM3E 4EJ2A 1QDLB 2MMCA 1PWYE 1GL7A 5D3MA 3ZXYA 1ZJ4A 2JFUA 2ZUTA 3B1VA 4GOXA 1W8IA 3EIXA 4FWIB 4JP1A 4QBHA 2WVJA 1ZGHA 3WB0A 4OHWA 1Z5PA 3H9EO 5KHLB 3VHQA 4WDQA 3R7SA 4A73A 3N3BC 2GARA 3NHMA 1G2OA 4IOKA 4PCLA 3OZDA 4AY5A 1WMDA 2IHZA 3AV0B 2O0JA 4E5NA 3FYUC 2GAJA 2K7ZA 5CCBA 4EL0A 4EG1A 3QEMB 3OA2A 2IS1A 5DIFA 1CRPA 5BSRA 4DANA 4HSGA 2IYPA 3OZXA 4RXUA 4F60A 5EUQB 1S2NA 5GIPE 2X5KO 1V3VA 4URVR 4KNYA 1VL0A 1WW3A 1WF6A 2G08A 2QN1A 2YZ7A 5HIKA 2GN4A 1RHRA 5L40A 2R6R1 3FAZA 4FCCA 2BISA 1M10A 5FJIA 4ZN6A 1JEYA 3HB0A 2X3FA 4HEA6 2C97A 3BXHA 1LTQA 1PJRA 3PT5A 4HUQB 4KXWA 4X7BA 1FUUA 3ODPA 1XD2B 4HHEA 4FGUA 4JKIA 4M9XA 2C3OA 2WV7A 4RD2A 3RLIA 5KWIA 1KJ9A 4CQNA 4Z4EA 4ER3A 4LC9A 1NXOA 1DBQA 2VCYA 3MMPA 2VFAA 1HH4A 4FP9A 2Y99A 2HW8A 1G20A 2NGRA 1RZRA 3KR0A 4R8RA 4Y2TA 1PDVA 2EBWA 3E3AA 1MRNA 2H5JA 1G6HA 3GU3A 1BU5A 1KDOA 4M53A 5G4KB 5K09A 3CG0A 3HYSA 5EHZA 2YWRA 4RMJA 1M1XB 2NZXA 3E5NA 3P4YA 5CPFA 4BBPA 4MVJG 4OQDA 1W48A 4EHKA 2P78A 3URKA 5L9AA 3PNVA 1WKVA 4P7FA 2CF5A 5LP6A 3COVA 2FW9A 2JLQA 3LV8A 2OQVA 1Q0ZA 3AWDA 2HA7A 3JALB 1HDZA 3NC0C 4FJ0A 3H17A 5EQJB 1M2KA 1UWKA 2PTHA 2Q5JA 2QMEA 3GWZA 3NCHA 2HF2A 4NQRA 4BV2A 4E7PA 1ZOSA 3SZUA 1DPGA 1VJRA 3O83A 1PS9A 4RY2A 1AKMA 1RM0A 3QF4B 5BN5B 1TQ2A 2GD6A 4HL6A 1ZXLA 3VNUA 4TYPA 1WBBA 2P9FA 4PICA 5ITVA 2J46A 2YV2A 3H2HA 4N18A 4V0NA 4BWVA 2PXXA 4F7DA 4E94A 1W8DA 1J7KA 3ODGA 4OHCA 4V0RA 3PXDA 4IXWA 5AJWA 3W2GA 2C2XA 4E21A 2WIAA 1HNNA 4NCKA 1QTIA 1K08A 3MBKA 1UIRA 1U1CA 1YSCA 2FA9A 3G79A 8ABPA 2O8DB 1BVRA 2J9FA 2ZKLA 5CA1F 3LFUA 5C1OA 3NWOA 2OG2A 1D2HA 3I9KA 4YAJA 2SHKA 4MUIA 2B1JA 1W96A 5FP0A 2J9YB 1E62A 1O6CA 3JTEA 4BP3A 3C4QA 5KNCD 3F3YA 4W7SA 3K9HA 3IMFA 4NR0A 4M1MA 4QHYA 1KS2A 4ZRDA 5KINB 3CUYA 4DUPA 4HNHA 5IU6A 3OT1B 3PENA 4IKOA 4EEZA 3NHBA 4DMKA 1VIAA 1ZJ6A 3OQNA 2XCSB 3BN3A 4YRBA 3RU2A 3VZPA 3QXCA 5H7XA 4GG1A 3PDIB 3TLKA 4CFSA 1LPNA 1PR0A 2RAUA 5FAXA 1OCEA 3VPHA 4L27A 4QTXA 5TARA 4M88A 3ML1A 3UF0A 5GWXA 3C6YA 1GUZA 4B4KA 3MT7A 5DLYA 1IEVA 3R7LA 4UAJA 3ZWMA 2XCLA 5B7GA 4QICA 4BN0A 2PS1A 1CW2B 4D25A 1QAQA 2HK8A 3EOZA 4TV9F 3HJNA 3NV7A 4WLOA 1POWA 2CXNA 4RY8A 1E3SA 1IXZA 3FGZA 3GT7A 3MWJA 4ZO6A 3OY2A 4LWQA 3GUUA 2HNBA 2X4DA 3PUVA 1VBFA 3ZLUA 1OVMA 2FFQA 2LZ0A 3HN7A 1N2ZA 1TU4A 1JU9A 1HFEL 5DM2A 3BMNA 1EA5A 3O8QB 4O59O 4M0EA 2LCQA 4PLGA 1I4LD 3FUWA 1KI9A 4OQ4A 1RZVA 2C7RA 2UYQA 3HSSA 5IJ0A 3EMVA 4XLLA 1Y6ZA 1DX6A 1IHXA 2B6HA 2V8BA 1PLJA 4OY3A 1J23A 3D7MA 3IS3A 1ZMRA 2X3UA 5K6AC 2NWQA 5EWJA 4KNVA 2PZKA 4BQEA 3QJYA 2J07A 5KZMB 3UWOA 3LQRA 4BKOA 2PKQP 1XN4A 4JI5B 5K05A 5AMXA 3CLTC 5CA1B 4MIKA 5JVDA 3GZNA 3YASA 1R4MB 5TPZD 1QS0B 4TRMA 4C4OA 4O5OA 2ZS8A 4HNSA 1IBKB 1M7BA 1A7AA 4QT0A 2P3OA 4AUKA 2YVAA 2PKEA 3K15A 4YMHA 3TSZA 3M4ZA 1OX5A 3VKWA 4HNVA 1N8SA 5ADVA 4YK7A 1B8UA 1T9DA 2YXEA 3R77A 1KARA 1PJBA 1LLUA 3FMOB 3LSYA 2XHZA 4HGZA 5HQ3B 4X65B 4E51A 5IK2A 3D2CA 4YWJA 4O1MA 1WDMA 1JIVA 2EGHA 4UVEA 3G7NA 4H1WA 2QMQA 3M6XA 4I5DA 3KL4A 1G7RA 1S0UA 4I50B 1AXGA 1CJTC 4AJPA 4LY3A 4TV9B 4EA7A 1ZK1A 2BTEA 1TA0A 3SZMA 4NOMA 3RF7A 1NVWQ 3C3EA 4BNYA 3WNZA 2W22A 5FOWA 4EHNA 3LTNC 3IKJA 1P0MA 1EXMA 2P9GA 5GJBA 4QC2A 2IX3A 1WMAA 1ZFNA 2G5TA 2ZSDA 3RFUA 1JG1A 1SR8A 5C5IA 3ZDXB 1C4WA 1YKSA 4CV1A 2HZBA 5FI3A 1N5DA 4G25A 5ECYA 4LF4B 2PSEA 2DFTA 3AESA 3C45A 4H1HA 4UKDA 3C1TA 2JAHA 1CRZA 1I1OA 3SIPA 1L3IA 3AM1A 4TQUS 3K09A 2H54A 2P90A 3CN7A 1K7YA 1YZQA 3V7FA 3VRHA 3VX3A 4D98A 1XRJA 4U7PB 5JAQA 5KYWB 1YTUA 4LQLA 2JLWA 4K05A 2V55B 3D3WA 5GZ1A 1C7FA 4TVSA 2YIDA 4G8DA 4IMIB 3T61A 2H16A 2YC4C 3M3DA 2QVXX 2HSWA 3KR1A 5CITA 2ZIGA 4N6GA 5LQNA 3R2JA 2OV6A 1H6AA 1PKXA 4DGSA 4PFJA 1KR2A 1NM5A 2I2BA 3JQPA 3QK7A 3V42A 1NG1A 3IXQA 2Q07A 3M81A 2BGMA 3FUXA 5TGDA 4PZLA 4QELA 3T4XA 1X14A 3CUUA 3SF8B 2PU5A 4GI7A 3Q2IA 3HA7A 1DUSA 2ZJOA 3TE6A 1RRVA 4KQ6A 1XVAA 4GBJA 3FNIA 3K6RA 1KBQA 5BWCA 5LYJF 1VHWA 3RI3A 4QECA 1ST3A 4WAUA 4O1IA 2WYVA 2LVBA 4XGNA 4B6RA 5U4QA 1ZIOA 2CJYA 4PQEA 3MS7A 1TMYA 2TRSB 1GEGA 1IJKA 1B6GA 5MFPA 4E88A 3CA8A 2H06A 5AHRA 2HCRA 4UE3S 2FKNA 2G83A 1FFCA 2JGJA 3BD7A 1MV5A 3I28A 2CT8A 2JFXA 3LPDA 4RTNA 4BAUA 5IJXA 2MMGA 4DC1A 3LFTA 1EH5A 1L4KA 2AZXA 4Z7JA 1JKXA 4ZU3A 1LSOA 1R3UA 2FF7A 4QTZA 5L7TA 4DQDA 2DERA 2XW6A 4F97A 4IGAA 4IRMA 2J48A 5CB0A 3OURA 4RDXA 2FSSA 5JZ9A 4L02A 3GFVA 2QJOA 4JMLA 2HXSA 2J0VA 4ZV9A 3KS9A 4PNZA 3CLRC 3IE1A 1OGIA 3D4PA 3T9DA 3L1UA 5COQA 3LPMA 1E2UA 3K5PA 4HNGA 1B8NA 1H2RS 1NZJA 3VU9A 3WK4A 1A1VA 5HXAA 1U31A 5H83A 2EKLA 2I80A 2FAXA 3KTFA 2VPWA 4I4NA 4JEMA 1DAHA 4CMJA 4CQJA 3NEAA 2OXFA 2PLAA 4GLBA 5K2MA 2WQZA 4RK7A 1OI4A 2HO5A 2R84A 2BONA 1CY4A 2ZJ4A 3BJIC 1DBVO 1Q7TA 2D5IA 1DMRA 2W43A 4IRXA 1B8PA 4G5QA 4XWYA 1RS0A 2EYUA 3E3LA 3K96A 4HMPA 1JU4A 4P3XA 1H0KA 4C7OB 2ZQYA 1AJEA 4JKYA 1XUOA 2V6MA 3AO0B 1THMA 1FVHA 3ND7A 3RS4A 1Y3AA 2PT9A 3F4LA 3HCDA 1PFUA 2C5HA 2YW2A 2YICA 4UNNA 1T15A 1IVNA 1Z74A 2IQ5A 5LYJB 3Q8WA 4CKYA 2ZUFA 4N4AA 2IW3A 2Z6QA 2A84A 1P7WA 3H4IA 3M4NA 5I7VA 4YV1A 2O2IA 1RXEA 1QFZA 2Y9MB 1KO8A 4DVGA 5JFOA 5EJ5A 1A2QA 1YK1A 2VP5A 5L4LA 3G0HA 1NQUA 4I5FA 2B99A 4P81A 2VDNB 3T1NA 2R7AA 3T34A 3IX7A 1GIAA 2D1TA 1QONA 1Z4IA 2V7EA 3ZI0A 1E58A 3B89A 5B1YA 3D0KA 3RAPR 1C3OA 3VKHA 3GFSA 1DWQA 2K2WA 2W4QA 3L4SO 3LY8A 1QOQB 3MOSA 1R8SA 1QHXA 1NFRA 3NDJA 4OM7A 4PR3A 1NT2A 1YAJA 1T8UA 3A1CA 3C3WA 3I09A 2OAGA 3IAM1 4MV7A 1E3MA 4XFDA 3E1GA 3PIRA 4QATA 4M9SA 4RE6A 3LIIA 1U1IA 1E6EA 4FT2A 5AI0A 5JOQA 1OZGA 1NUPA 2AMVA 2GN8A 4Y0NA 1J6UA 4LY6A 1TYZA 2IUYA 3A31A 1G6KA 3MEQA 3DZIA 5CVDA 4K6HA 5CX4A 5ICMA 3NDBB 1BC5A 4UE2A 3SC6A 3PUIA 4JVLA 3Q87B 1RAFA 2F3PA 2FPIB 1B26A 1JLSA 5IAEA 2IGTA 1MX9A 1Y6QA 3O8OB 2HEGA 5HFAA 1G8JA 4BB6A 4LPKA 2CD7A 3PV0A 3BXOA 2I34A 1U7UA 3NOXA 4PO8A 3HM9A 2PN1A 1D7OA 4KXNA 3SHVA 4DCCA 4K87A 3LA6A 3C5CA 5HDBB 1L3BA 4IZOA 2ZRDA 2WSMA 2G70A 1T8YA 4IJWA 1Y6RA 1QGUB 3HYLA 1YWGO 2EIHA 3D6TB 5EEGA 5BOSB 1AK1A 1CUJA 2C20A 4WI1A 1B74A 1GPLA 4V03A 4LTDA 3HGMA 2NUPB 1OBFO 3WYNA 4D56A 1WSAA 4TTPA 3CHYA 1QLJA 3PC6A 1XDDA 5KJ1A 3KFLA 1TW2A 1TZMA 2C9ZA 4AJ2A 1ZGJA 1T91A 2DJIA 1QV9A 2GBCA 3ABZA 4ZIRA 4Q7QA 2YIJA 2J0UB 1E2DA 1EAMA 5IT9A 3WJAA 4CLRB 1UPBA 3CZAA 2UZ4A 4UATA 4X92A 5DISB 1AHIA 1DO2A 5E2BA 5CX1A 1Q2UA 2AX3A 3MCZA 2VIIA 5C3UA 3A05A 3M34A 3N7UA 3FGOA 1W44A 3SFTA 4EAQA 1CWUA 1WE2A 5CAEB 3ANXA 2AJCA 3DLAA 1F0YA 3OCJA 3ZI7A 4EY3A 2OORC 1O03A 3PQ5A 1OU0A 2R6HA 2Q3DA 4D9GA 2QQFA 2VXOA 3IOMA 4ITRC 4ZEOA 1RAGA 3JWIA 1N1EA 4AY4A 4XIFA 4U2FA 4WSOA 3VNRA 5IWAB 4TVKA 5FLEX 1U0GA 4MI9A 4W5TA 5IFLA 4I1IA 3WDLA 3W7AA 3CYFA 1P61B 2G5PA 1RXYA 1TYAE 4X95A 3BDIA 1JJIA 2LDXA 4WZ6A 3SYRA 1R66A 4IIJF 3WOVA 5JEEA 5EXXA 4D3DA 1SCNE 1AN0A 3A4NA 3LGAA 4F1KA 1ZUD1 3BQNB 4HRAA 3P4UA 3EPLA 5LXTF 1Z56C 3HU3A 4UTZA 2CL6X 1ONPA 3F9RA 2H9IA 2J8ZA 5AI9A 3E48A 4KUEA 2E87A 3DF7A 4IDCA 3TQOA 5EKXA 3TPFA 3ETCA 4XTRA 1R4NA 5DO9A 1SCUB 1ODCA 1WUHS 1XTJA 2GEDA 3UAOA 1RI4A 3EPHA 5ALFA 2R6DA 3CNBA 4D4LA 2WAMA 3RJ5A 1YE3A 3NHUA 4RVOA 5K9ZA 4FD2A 3AUFA 4DB2A 1ZKDA 4BB5A 3HSYA 3MNFA 1OWPA 3WRYA 2QUBA 4ZARA 2QMYA 3HM2A 3I9NA 3EXHA 1XYGA 1AXRA 8OHMA 5I3CA 4YMVA 4EA8A 2WHXA 4LDJA 4JI8B 4LDRA 2XWQA 4CTNA 3GJXC 3DM5A 1NUTA 3LL4A 4KIWA 4KXFB 3X43A 2WHQA 3I4CA 5D3KA 1FSPA 1ZLXA 4IJ5A 4OYRA 4H1UA 5ABPA 1ZX1A 1D1PA 1KVTA 3EEIA 5DTIA 5B7NA 1GKYA 1LDMA 4UD2A 3ZDFA 4BWFB 1Z12A 4QVIA 3LF2A 1HZZC 4PFSA 4J6EA 1GRRA 1L5ZA 2NO0A 1Y37A 2VEOA 1A0OA 3O4IA 1U02A 3B38A 3PJFA 4J0DA 5EJAA 4M54A 1GGHA 2IS2A 4NY1A 1GARA 1NQ5A 2Q50A 3KQPA 3TZBA 4KYIB 3A3PA 2X6RA 3RRYA 5CLQA 1URPA 1CVRA 1RD4A 4KIGA 2L18A 1W76A 2COEA 5JDCA 4MYHA 3VGPA 1P1BA 3V6MA 4EMTA 4ZDWA 1YONA 3KYJB 2FRDA 4AX8A 1U99A 2PEYA 3WNCA 3ID6C 4H3VA 2AFHA 4IIJB 1ZVQA 2FFBA 4KQKA 1V7QA 4RW0A 2DWCA 2WC1A 4Y2JA 3EGOA 4R9VA 4PWZA 2PPVA 1QMPA 3NANA 2QUZA 3WL3A 1N8TA 2IYEA 4I6JA 4PG6A 4TOIA 1CCWA 2IHBA 3N75A 3VU1A 4DN6A 1J5XA 4R2XA 3V8EA 3K0FA 5JD5A 2R9VA 1WUYA 3GXBA 4CKBA 1LBQA 1JI0A 3C16C 2D2IA 1DTSA 1X80A 4CM8A 2JFGA 3DPIA 1C3LA 2XYQA 3F78A 2OCDA 3ZPXA 1B6SA 2V7XA 2JFWA 3WTCA 1OJ7A 1QORA 4G8JA 1MFZA 5G3ZA 4CDNA 3Q3JB 4RHEA 3WGMA 2HSGA 4C0AC 4Q93A 3KL2A 4LF9B 4TYQA 3IAAA 3V8BA 3DF9A 1Q12A 5DM60 4U2CA 4UCFA 3SMVA 1XTBA 1O5OA 4Q4HB 4Y1EA 1U11A 4BV8A 3UAZA 2H1OA 3X1WA 3K9QO 3SM3A 3L7KA 4EVRA 2BGTA 3TAXA 4IFIA 4BBAA 1DJPA 4GHWA 4PYRA 2ZJBA 3V9PA 1U65A 3Q5GA 3OF3A 3PGA1 4IXTA 1NXVA 3ZS8A 2DTXA 2JIDA 3CLKA 1JIIA 1DWOA 1IN8A 1CZHA 1MJ5A 3C70A 1QRDA 3BUSA 5AJUA 4RIIA 2I91A 3I23A 1ZA2A 1AM4D 1C4KA 4XQEA 2ONZA 3AKEA 3OFKA 3DOCA 5AWFC 5EINA 4CLEA 3WGYA 3WGJA 2OMKA 4C7BA 1BXZA 3JQGB 3QWFA 4I55A 4F6RA 5K3DA 2HBZA 1VL5A 3IPRA 3SAJA 3UNXA 2VOJA 2QOEA 2O8CB 1YCGA 1FSGA 4EKEA 3GEHA 3ZWVA 4DF3A 3T9CA 4X1OA 2FMUA 2G71A 3GD7A 2XUHA 3IB6A 4Q1EA 1G5QA 2PY6A 5I8WA 5K3EA 1SZPA 5GM1A 2ZPTX 5DFAA 1IN1A 4XSHA 1KI6A 5IW8A 3H5IA 3SXPA 8ATCA 2JIOA 2OYSA 1GAXA 2EKDA 4D6YA 2AX4A 1WU7A 2VJMA 4ZCQA 1B73A 4M0DA 4GE3A 4M36A 4KB5A 4UAGA 3HLKA 4JMPA 1RWKA 4L2IA 2FE1A 1X1EA 2FRVA 4EW2A 1Z2DA 2IPLA 1KEEB 2NU6A 2VZEA 2W90A 2AI3A 3FUUA 4MV0A 5BT9A 4BZXA 3OX2A 1DOAA 3MQ4A 3D7SA 3VPDA 1SXQA 4MUMA 4DQXA 4E31A 1QH8B 1Z83A 1IOWA 2RKOA 2ZZKA 4MB0A 3D3NA 3QGMA 4YDHB 2BGIA 4YMIA 5YASA 1C1DB 2RHWA 2AN5A 5BWMA 1I94B 5CLGA 4FPXA 5ALSA 1M2HA 2KS6A 2X14A 5A7FA 3IQZA 1KAQA 2C2BA 2HMVA 2EC5A 5IANA 3T5TA 1ZM2A 5KCMA 3B7GA 4KITB 2WIBA 5DEOA 5K0TA 1AUVA 4ZEXA 3SVTA 2VK1A 1L9KA 1SXJB 3VC1A 1JXOA 1DEAA 1V41E 2VBFA 1SPBS 2FWBA 2WMOB 4Z4CA 2OQIA 2W70A 4US0R 3MRXA 1HF3A 1I51A 1U28A 2OAEA 1QIGA 3QU9A 4YP9A 3CVJA 3U4CA 1JDTA 4RIEA 3SOPA 3MWDA 5DMHA 1ZCJA 4ZOLF 1V96A 4KH1A 4XWAA 1LI7A 4P36A 4IHQA 1RFLA 1VDZA 3WMWA 3MT0A 2DBZA 3GAMA 3GGSA 3G2LA 5JZMA 1YJAA 2VEDA 3QU5A 1Q20A 2JI8A 1CR6A 3QPVA 4Z9FA 3TUIC 5J43A 5EE9A 1I6LA 1SUFA 3V97A 2BMFA 2W2KA 2W6IA 3H19A 5JWHA 2OBBA 3VPCA 3WYAA 1SG6A 2Y1OA 4D8YA 1R8YA 4F12A 1FFBA 5EKDA 1GTG1 1N1MA 1XJ0A 3ROMA 4UOZA 3R3XA 1TF2A 2ZYSA 3NTUA 1ZUHA 4MVJA 3VBEA 1Y81A 4FHFA 4PAWA 4UZEA 4HN2A 2ALJA 1I01A 1R0ZA 2XWJI 2XQIA 3T5CA 1WKBA 4NPCA 4BCBA 5GMOA 3V8QA 3DWIA 2WFLB 3IAFA 5AVJA 3KSZO 4L78A 1U2ZA 2YZ2A 3TIVA 1EFPA 1L5QA 3CLUC 2ZWOA 1F2UB 2HU5A 1BROA 2EJBA 2WD9A 3D7KA 4G84A 2Q1WA 5ALQA 5JNWA 4CLDA 4J7CA 4ASUA 2COKA 3C87A 5JASA 1K27A 2VT6A 1YFJA 3RUHA 2I4MA 3TD2A 5JSZA 1GWNA 3MWEB 3G5LA 3PZRA 3I52A 2FQYA 4Y2PA 3JCZA 4BVLA 4Q4CA 5JY6A 3UHFA 3WNBA 3K1AB 5F5XA 4J1TA 2R0QC 4Z1MA 3R4VA 1N1DA 4A03A 7MDHA 1W9MA 2WLSA 4BIMA 1D5WA 5AKIA 3IA2A 1DIOB 5G3YA 3TM4A 4N12A 4EF5A 1OPXA 3C5HA 1UK9A 4N7JA 4B76A 3OFNA 2FOLA 2ZYGA 5D3MB 2G0AA 3HUUA 3NBZC 2Q3CA 1C7RA 1PL6A 2BCGY 4NV0A 4BKQA 4TGLA 1J21A 1BE6A 2O05A 4ZOLB 3DYBA 3L5OA 4UPDA 2R8EA 2J3IA 3I2FA 1G1AA 1EJ0A 2W6QA 3DL0A 1NJFA 1EUZA 4K6OA 4TYMA 1PJ2A 3PC2A 1XZEA 4YRDA 1NVTA 1SBYA 3EPRA 3V2IA 1MDBA 1OUMA 4R1UA 1AVTA 3B78A 3L3BA 5FF9A 2IXAA 1Z5NA 4L4ZA 2REBA 2GBLC 4HJXA 5LQSA 1G3MA 4V2IA 1N2OA 4KE6A 3ZGYA 4LSGA 1KH2A 1Q17A 1WUJS 2IH2A 2CNBA 3BA6A 3EFHA 1JEYB 3DOJA 4Q7EA 3N2GB 1E4EA 1MAAA 4HYEA 1XZDA 3X1XA 4AZ0A 1PDWA 4DHEA 2LTAA 3NDRA 1Y4ZA 3QPDA 1CVIA 1PW5A 2NLOA 1NIJA 2P5SA 3COSA 3FPCA 4J8PA 4RVUA 5EWLB 3EQ8A 3CV3A 4NEHB 3W1WA 3N0VA 2G4LA 2YFYA 3PQ2A 2OWDA 2QTCA 3IPLA 4R1SA 1YZGA 2ZUCA 1A8QA 3LRPA 4PC2A 1FDOA 2BM1A 1UINA 3WHIA 3S2EA 2O06A 1FYXA 3GH3A 4GZLA 3TDMA 1X1DA 4RABA 1KPIA 1VGRA 3MELA 1Y3HA 1OGYA 4W5HA 5EUMA 5HWSA 2H7XA 3N7TA 4OLHA 2PUEA 2GPJA 4G0VA 4I08A 2UUCB 4Y0VA 2QLLA 3ITEA 4RFSB 4ZVPA 1XVIA 3PUZA 3Q5DA 3ECSA 3MIZA 5A6SB 3WLSA 5LP6B 3H0CA 1JT9A 2Q4BA 3TPCA 2AC4A 3PQDA 1KDTA 1T35A 1E5XA 4ZYXA 4MGYR 4YWHA 3P9KA 4OHPA 2W11A 4FINA 5E2AA 1QVVA 2HL6A 5IJ9A 1JG2A 3IV6A 2DXIA 1SQGA 5JSKA 3KSMA 3SWWA 4RQTA 4WCVA 1JXAA 2YV5A 1XNJA 1XMJA 1I3KA 4GNKA 2L19A 3ZX4A 5D5QA 4OQEA 3W5IA 1V2HE 5TDHA 5CA0A 4RD1A 1E1LA 2I3DA 1L5HA 1KI1A 1TZ2A 3L93A 2WVHA 5FWXA 1PGPA 3ETLA 2WF6A 3T7CA 4BNDB 1EK1A 5E6UA 4WXPA 1N0HA 3E2PA 4LXIA 1Y8RB 2ZVPX 1JAIA 4DCMA 3K1YA 4E2ZA 5JO9A 4HQFA 4K7JA 5BV2P 1ZW6A 2CEKA 3WQHA 1QANA 3BA1A 3PCTA 2II6A 2BSAA 4LZAA 1DBIA 1UBCA 2D1QA 3AC0A 1E8DA 5CB4A 1PRYA 2YY7A 4BV3A 4L5CA 1DQNA 3GRFA 2NYVA 1TQ6A 4ZVTA 4OMUA 1R2QA 2B92A 3IAXA 3S1AA 5IDVA 2IIBA 1VCHA 2XNCA 3LIPA 1NTOA 2WWFA 4IZHA 5EPUA 2KLBA 5LYYA 1U8UA 1AHNA 3HBNA 4NCIA 4LNUA 1UUFA 3ZCXA 2WFZA 3IURA 1O3YA 5CIYA 1ISRA 3AVWA 2C3YA 3DBLA 2Y67A 2F8TA 5KYXB 4AKIA 4TMWA 1U3TA 3BFJA 1GGEA 2ZR7A 3GMIA 4RHTA 2A9FA 3RU3A 4C4TA 1AQJA 2C7QA 4PYLA 3R3VA 1OH5A 4R69A 1K6XA 2HBRA 2VDWA 2YNMA 3A1UA 4X97A 3URMA 3VU0A 4K0RA 1F48A 1QGYA 4FDVA 3FRHA 3ELUA 2DWQA 4PHCA 4R1PA 1W6RA 3NRCA 3G85A 1MHPA 4OGLA 5AUQA 2ID4A 3PQEA 5I4IA 4RELA 1JHRA 1T43A 4M0PA 1VJ1A 5F2KA 1P80A 1U8TA 4KJXA 2FEAA 1XQYA 4HGRA 4I8IA 4KQGA 4WN9B 3KJZA 2O2ZA 1X7GA 4KV9A 3GOQA 4BFYA 2BY4A 2IUSA 2EG9A 5D3ZA 5DP1A 1OFVA 4YMGA 4HQ6A 4TSFA 5K51A 2ORED 3DE5X 4BUJA 1QTQA 3RYFB 3KTAA 1ZXXA 4ER6A 4BNGA 3UFXB 4OIMA 4G0UA 1YBMA 1NBMD 4YASA 1VSUA 2UZIR 4J1NA 4BQNA 5CU7A 3MG9A 3PE3A 4PO3X 4Q3AA 4RPCA 5ELMA 1CFZA 4IUCS 5F98A 3S44A 5JANA 4LDPA 5EJMA 4D97A 3LWZA 1L9XA 1O97C 1A9YA 3NIGB 1L8OA 4JJKA 3A6PC 2EFCB 2DUWA 3KOUA 1X7XB 2ZLBA 1CZUA 4C9BA 1QBGA 1P2GA 1G17A 4XQ0A 2R1TA 3N86A 5LQAA 4JS0A 4X8MA 2P3LA 1ONSA 1VSVA 1V8FA 5EWJB 5FL3A 4FTWA 3NGXA 2EJWA 3LDAA 3JQBC 3EISA 4DVJA 4O02B 1MRSA 2RGGA 1Y5IA 2IYZA 2PWBA 3TKYA 2PKXA 4CIWA 1IXRC 3LI2A 1OFGA 3GZNB 5EL0A 4ZVQA 3P97A 5JVDB 1Z15A 1RI5A 1TO1E 5FR1A 1KHHA 1OBVA 1CNEA 1SKQA 1V5IA 1EUCA 1WXFA 2V54A 1TM4E 3DEZA 2D54A 2WU3A 2Z4TA 4MGHA 3UHJA 4QOGA 1QCZA 3U7GA 3ONNA 2XQJA 3NMUF 4YRCA 1B41A 4FOTA 2C57A 1HC7A 2ZBRA 1YO6A 4O4HA 1XZIA 3UCXA 3GV0A 3VDQA 6LDHA 2HT1A 3DHVA 1GKLA 2R62A 4D41A 1R27A 2G5GX 3FR7A 4G36A 1ZH2A 3I34X 5ALEA 4LEIA 2YY6A 3CB2A 3VVMA 2QM7A 2GJKA 4MIOA 4HB4A 4P53A 5DYYA 2A0WA 1UFRA 4RIFA 4PY2A 4A0FA 2ZTLA 2F59A 4G5OA 5FNVF 1O9GA 1K86A 2KSQA 1E1KA 2WIGA 3TZ6A 5EXEA 4XB2A 3IBCA 4PX2A 3R44A 3I9JA 1GN9A 4R0MA 3CG4A 3O47A 3WAJA 2B9EA 3NPAA 4LMAA 3A4TA 5LR6A 1ZVJA 1K5GA 4FN5A 1JEOA 3E7XA 4GRIA 2DT5A 3VOSA 4MLCA 1JBEA 3C4VA 4INAA 4JY7A 3PQ6A 3IJRA 2JRLA 1MP0A 3N3AC 1MCZA 4W8HA 4ZOAA 4AJEA 1EDDA 3X1ZA 4JVSB 2EZTA 1Y89A 2Q1YA 3VPSA 1VLMA 2BL4A 4DWJA 2MYNA 4MINA 1XNQB 2WJVA 4IBOA 1C7JA 1CEXA 1G42A 1R5NA 1Y1SA 4M49A 5ADUS 3GLIB 3RVNA 4IUYA 1CTQA 1U3GA 3FUVA 3KZXA 1M8PA 3BDAA 3MWYW 2G6BA 3D3WB 2J9ZB 3OPYA 2PIDA 2VTBA 4AY2A 3F6BX 4G0YA 5CBPA 1UBUS 2R48A 4Q6BA 5EE1A 3BQ9A 2PANA 4HQ0A 4NZOA 3J81A 3A1DA 4JLSA 4DLBA 1SA0B 3WSWA 1MH9A 1UK6A 1YZYA 2JLUA 4CM4B 1TIPA 2WKWA 2Q41A 4PIPA 1CR2A 2C4KA 4D8XA 2G7MC 2I6TA 2QROA 2A8YA 4GW3A 4MS4A 2W6JD 4MITA 4AXBA 4YCSA 2JZOA 4JN6B 4OJQA 1Z0ZA 1ZI9A 4DMCA 2V59A 3W8FA 2FGKA 5DXAA 1UBSB 3OAAA 1MPTA 1F4PA 3EOAI 3JQ8B 3PWSA 4A82A 5C5EA 1M34A 2WP8J 3K0AA 1JP7A 3CWQA 4XEUA 2H3HA 2V7BA 3HHPA 5SZJA 2ON6A 2Z5GA 5FR2A 4BFCA 3EUFA 5LLDA 5C80A 1E8MA 3MXTA 4H31A 2FN9A 1TGYA 2P2CA 3JQ9A 5FNVB 4EI9A 5B2FA 5EKTA 4MJ7A 2YHSA 1JL3A 3V2UA 3BJRA 2RKWA 3ZE7A 2QVGA 3JWEA 5T6BA 2ZTUA 3PNLA 3BWXA 4V0ME 1H2HA 3QEJA 2CCKA 3WO1A 4JI3B 4AECA 3T7KA 1HEIA 4RPGA 3G8AA 2AVDA 4R3UC 4Z8YA 2IH4A 1RCFA 1R0KA 4RZIA 5K3SA 1KYTA 3VNSA 4QYTA 1GPDG 1BJKA 3DZCA 3UB2A 3AEQB 5IMSA 1EZZA 1UWLA 4AQ7A 4Z7OB 2FWJA 2Y6UA 5FOUA 5TMEA 3GCZA 4BE4A 2GSDA 4QULA 5DX8A 4LSWA 1E63A 2XJ9A 1UEJA 4Q4JA 4QPCA 3ZE0B 4E5DA 4NBTA 1W5EA 2WJ3A 4GZMA 4JYZA 3WKDA 1R0CA 4EUHA 2VPYA 3OAAD 1FF9A 3F8TA 3L1KA 4HAVA 4B6PA 3EIHA 2OQRA 3PIIA 1YQWA 1T1GA 1PJAA 2DHCA 1WR8A 2WE8A 1E1CA 5IF9A 4XVHA 2QMOA 4KWTA 221PA 5TE9A 3R0ZA 3MPUA 2VHEA 5F23A 3COWA 5JECA 1XTUA 5JHHB 3BE6A 5MDHA 2QW8A 3SX4A 3CSUA 1GKUB 1TQDA 5C2JB 1SGWA 1AK2A 2NT4A 1TJ5A 2FTKE 1YAHA 1QKIA 3Q85A 3SS7X 4B3FX 2EL7A 4ZZ3A 1DXOA 2QXUA 3H0EA 4MQUA 4TVBA 5A5VA 1JU3A 2P5UA 2F1OA 3MUOA 1FVOA 4BO6A 3UB3A 3VC7A 3ADOA 3LQQA 4CCYA 1GNQA 1OFUA 3TJRA 3N9IA 2X76A 3A6ZA 1C30B 3R5XA 4IQ4A 1OXUA 5BWNA 4PSDA 3GMDA 3OG9A 1VCOA 1W6UA 1RHQA 3I83A 4PCAA 4BNLA 3HY4A 2QSZA 5EYPA 4A8TA 3DHWC 4FOOA 4X3OA 2M6SA 5E38A 3FPHA 3KZCA 4BDSA 1VLLA 4IDFA 4C3ZA 2O48X 4B71A 4GL2A 4RPLA 1XQXA 3I12A 3PXBA 1KYIA 4ZQCB 4KQFA 2PDAA 2Y76A 1O58A 4F38A 2O7QA 3IOBA 4P34A 1LX7A 4YFYA 3GA0A 2PJUA 4J16C 1PF7E 2FN4A 5EG5A 5IEJA 3B1JA 3H9GA 4C0BA 1GFIA 4N54A 3K9WA 1D2MA 4PLFA 3BZWA 3GPIA 3MCUA 4LHVA 3O90A 4V0OA 2GYWA 1VPLA 4TMVA 4WGFA 4YP6A 3NBUA 2OLEA 3DZGA 3W5UA 3HJCA 4NZ9A 2R65A 1JJAA 1GPBA 1JR3D 4R9SA 3WZLA 3ZJVA 2GAOA 1P9WA 2P4EA 2PKYX 3CE6A 3IIEA 4EZBA 3P5BA 4PG5A 3MCAA 3OOSA 4EEXA 3SS8A 4EW1A 3U44B 1ZJWA 2VYFA 2ZIXB 4AT1A 1F17A 3TH5A 1NJ2A 1VL1A 4GSKA 2EWMA 4GWGA 3ULKA 2X58A 3OEYA 3P0JA 2C82A 1TFUA 1V1RB 4FQ8A 2PO5A 3UK6A 4E03A 3EAFA 3O26A 4BP9A 4YAGA 1CRWG 1I3MA 1K6EA 4UBOA 2Q3EA 4KYUA 3CLHA 4P4LA 1T8WA 3R7BA 4EUKA 3PR3A 3SVLA 4HXEB 1UPAA 3G5MA 3IUEA 3L0YA 1ZNQO 4OHKA 5DM1A 3VVCA 2NP7A 3O21A 1E1QD 2Y1XA 3Q3EA 3SMQA 1GNPA 3T12A 2JKYA 3R6DA 4ZVOA 2WPNA 2XB6A 3B2EA 1RTKA 2GBIA 1MEEA 4YDRA 4B6JA 4L4UA 2O59A 2GHTA 2JA1A 1T6XA 2FCRA 2J41A 3SEFA 3WP0A 1QOZA 3X44A 4R2WA 4ESHA 2JBAA 1JFSA 1I6MA 2OZEA 3CC8A 4OSOA 4NXNB 4L1KA 4IINA 1QZ3A 2OT3B 3VR4A 4IS2A 3L8MA 4FQ5A 4JJIA 3IJPA 1CJSA 2CDAA 2RHRA 3OKCA 1FMLA 2VSXA 2GCOB 4IQ8A 1IUOA 5HF8A 4A3SA 4RCZA 4OK3A 4V3BA 1JKJA 3AI3A 5LXTA 3D64A 1RBZA 3QTLA 4N6OA 2WSYB 3GA5A 1DC7A 3ZVLA 5L3QB 4KOAA 4PYJA 4P4SB 3EARA 2ZT8A 1NKTA 4NBUA 1VJGA 4DABA 4IKPA 1XHLA 1JKMA 3FNBA 4Z3DA 4W9MC 1W49A 3FHJA 5J23A 3HFRA 3OQPA 3HTXA 1D8AA 2P2LA 1XCGB 2PQ6A 2XOKA 3BB3A 3P9NA 3R3HA 2DFPA 1Y9EA 1YR3A 3D2BA 1YGPA 1LH0A 4LHSA 5TJHA 3RG2A 1NQTA 3A26A 3FCAA 1V4VA 2I7VA 1ZPDA 3CZQA 1Z0DA 3OMLA 1O5IA 5KU7A 3D4OA 1DIGA 4PYOA 3V3KA 1PJ3A 5JQGA 4B3HA 5IAGA 1RYHA 2CJXA 3PCXA 4O5AA 3L41A 3DH0A 4MUBA 2KB0A 3FWKA 5JC8A 1RRGA 1PHPA 1V2GA 3I42A 2FMIA 2C5BA 4R16A 1ZRNA 1XTKA 1GPWB 2Q9CA 3WLLA 1VP9A 3LQYA 2HQRA 3KAPA 3TKAA 1RJ9B 4DLYA 3GDGA 1C2TA 4BB9A 4FJ2A 1SXPA 1EX7A 3FD8A 3EXHB 4CMCA 2PUBA 2BEUA 1JEEA 2G09A 4RO0A 4S0ZA 3U7IA 4WEQA 5JBIA 3M3PA 4KWHA 4XD7A 1FX1A 2H1FA 2DR3A 3HEMA 1XTQA 3QU7A 4AN0A 1M72A 2PBFA 3LCMA 4NULA 2FSFA 4LRXA 4H7KA 2WVGA 3AERA 1SC9A 4RU1A 1UOEA 2BFFB 4D3ZA 2IA5A 3J81k 3C3BA 821PA 2PU7A 1OH6A 1VKRA 3CIFA 2IE8A 1UMBA 3SIWA 3D4LA 3ZKAA 2G9NA 1OASA 2DHRA 1NTRA 4DILA 2R6ZA 1N7IA 1Z33A 3O3MB 2HXGA 4R98A 3U5ZB 2Z58A 3JYLA 1ABEA 2VF4X 3DMNA 4X20A 3ICVA 2EHJA 3BFVA 2CDRA 3L04A 1SUDA 2W6PA 3W5AA 4LYDA 4BUZA 3ZTWA 2BGJA 4TTSA 4E07A 3GPDG 3HR8A 1UDXA 1Q50A 1J9EA 2G77B 1WV0A 1TYEB 3MJ4A 3D59A 1XFDA 1IOLA 4JB0A 4W8OA 4ZZ2A 1TW3A 3H97A 3JARB 4LNHA 3E9DA 5LMZA 2F1JA 1I3LA 2BMVA 4HUJA 3O4JA 5F3RA 2BLLA 2NSHA 5BVGB 3E4CA 3SZRA 2P2GA 5LP6C 4TKLA 1E2QA 1U2QA 4MIYA 3ZTYA 5LD2B 4XR9A 5BN3B 3HXLA 4DUGD 2EZ8A 1MQ8B 3GGJA 3LP6A 4CKBB 2JIZA 3BAFA 5D85A 4ZWNA 1O8BA 1KAEA 3GFRA 4DEYA 1CB7A 2ARKA 5KJCA 4KWIA 4AU1A 3E0QA 1LPOA 2RHCA 1NKVA 4PYNA 3ZLBA 1NVFA 1USVA 3CEJA 1KXZA 2PX2A 3BWYA 3PKZA 2D1SA 3QWIA 4Y2QA 3UB4A 5ESDA 2AHRA 4YJ2F 4FCTA 3RJMA 1ZWKA 2JCXA 3HRHA 2WV9A 3OZRA 1AS3A 1QTRA 3Q3GE 2GEVA 5FUWA 2OQ2A 4QOFA 5LUBA 4DBLC 4Q37A 3BXEA 3B9QA 4DQ0A 1SQFA 2WFAA 2XVMA 4MV9A 2OP1A 4Z53A 5LQKA 4BO8A 5EHGA 4L7VA 4P8RA 1PX0A 1VA5A 4HWGA 4Q3EA 5T3YA 3GRYA 4L76A 4NZMA 4WPGA 1GQFA 3OZUA 3ADPA 1VJCA 1VKNA 2XQVA 1QWSA 2GAFA 3AI2A 1L4MA 4POAA 1C0IA 3VYRB 4CI9A 4YUVA 4OHUA 4DV5B 4FZ5A 5HJEA 3HJTA 2NM0A 1SOMA 2B7BA 4RVGA 3T5PA 1WETA 4GR9A 3OWHA 1WB4A 4ISBA 4I55B 4YAFA 3UKJA 3ZY3A 4YROA 1QO9A 2O5EA 4BRWA 3EY4A 5G2OA 4GM0A 4DB4A 3PQ8A 2WU8A 1ISIA 5HW0A 2HFJA 4DJJA 2CWWA 4P08A 1RYMA 5CHYA 3FWPA 4WRRA 1K92A 1UXJA 1Y7IA 2ZSEA 3C85A 3MT9A 2F3QA 4R84A 3I01A 2QUAA 1SWWA 2WUGA 1OWLA 1AUPA 5EPOA 1KI6B 4M89A 2I1LA 3F2IA 3LLUA 3X2FA 2HSEA 2QM8A 3ET5A 4C14A 4P38A 4RYDA 3ZWBA 2CHUA 3T3NA 2EJTA 2VJMB 3AY0A 3OC6A 4LQCA 4EDHA 4QOEA 2H31A 3LOPA 1W75A 4D9NA 2AR9A 4KMOA 1SXJE 5I48A 2IYYA 4KN8A 4HPJB 2CN1A 2HA2A 6PFKA 4OLBA 1CDDA 2EQAA 1Z7EA 1JLLA 3O91A 3ONVA 1G2QA 2WTEA 3I1FA 4Y2GA 1P9LA 1CERA 2XGSA 3SVZA 3NWBA 3Q6MA 4DCSA 5KNBD 3PI6A 4CF7A 5KCZA 1T5BA 2ZSAA 2FPPA 4LY9A 3JQFA 4QNRA 1KDZA 3QELA 4EUEA 2BH2A 2P4UA 4L4SA 2BR3A 1KO7A 3UMYA 4JBWA 4KQEA 2Q9AA 1J0DA 1ZJ5A 2EJCA 4EFDA 1PQYA 1W0KD 5ENVA 1IN4A 2LIVA 2ID8A 1JB9A 1T8TA 2OHVA 3I64A 4JOCA 3EGWA 3RSZA 1L4NA 5TQJA 3JAKB 4G4GA 1NQAO 3HYCA 3LYAA 1P7CA 1IM5A 4NU8X 3LDUA 1KOLA 3SZ3A 3V4ZA 1E3EA 4TXNA 4OXIA 2VNJA 3BXGA 2C7BA 3MWDB 3H11A 4D9BA 3W9BA 3SHTA 1DAKA 4OQLA 3IR6A 2QKYA 4RULA 1PVDA 2HLDD 1ZUWA 2NO9A 3IPAA 1IQUA 2QL5A 3F7OA 4B3XA 4MWBA 2YWXA 2PUGA 4LYJA 4MGEA 1IPFA 3E7FA 2H1HA 1H3FA 1UXGA 2A4MA 2YHBA 2RGCA 3PHGA 4N3AA 2M2IA 3ETDA 3PQ4A 1XJQA 3KUDA 3MCVA 4TTTS 4DXDA 4L3WA 2HA0A 3AXSA 4K3UA 1AKUA 4R2LA 4I19A 2RJOA 1NE2A 1T6NA 2FSHA 4D0GA 5K0SA 3DLTA 3LQFA 4TS1A 3UHOA 4AG3A 5DBIA 3E03A 4WCFB 1J0BA 2DBRA 5IVDA 3UENA 1QCDA 4XDGA 4BAGA 3IO3A 1DVRA 3K70C 3A9WA 4BKMA 2NTYC 3D7NA 1KIAA 4PRYA 1RKQA 3Q2KA 2Y4NA 3C7KA 2FPUA 1TUGA 4MUHA 1W1UA 2ZVDA 3EDCA 3AUJB 4HF7A 3AVQA 4Q3OA 1IBLB 2AFIA 4JP2A 1ND5A 3B1ZA 1PD0A 4KBGA 1IEXA 2I4TA 3HCPA 5AKGA 4G5XA 3HB5X 3W2IA 4IO1A 1OX4A 3VDNB 3K09C 3KPWA 1CIVA 4KRFA 5IN4A 1US8A 3AKZA 3DA8A 3C97A 3R0JA 4G4SP 3IULA 5H1YA 2RBKA 3PJGA 1X1BA 1FJGB 3WMXA 1EI9A 1ZHFA 2BDTA 2YINC 3DS8A 4WKNA 4HSEA 2UXCB 5GZ3A 2O1XA 1H2WA 2ZB8A 2QTMA 1Z18A 5EJFA 5FYDA 3RNLA 2V7QA 1WMFA 3UXHA 2H65A 2HHJA 5GQSA 5I9TA 1X9GA 2QLTA 1D3AA 5AW8A 3CRZA 3PXUA 3DQPA 3OIWA 1U1EA 5JNTA 1AIPA 1NM5C 1AF7A 4AUMA 3UV7A 2IF2A 4TLCA 2R4TA 3CW9A 4OP2A 3MUNA 1II8B 4KI0A 4QOJA 1FFYA 1CP3A 1TM2A 2FY8A 1TAUA 2VJQA 3RARA 1C50A 1DIHA 5DYIA 2QGFA 2PUCA 4IDPA 3AYZB 4L28A 3OZBA 1QJ4A 2MSNA 1ULZA 4MLPA 3BCRA 1MGOA 4EG0A 1D9XA 1T9GR 1Z8HA 4H1TA 1G20E 1EB9A 2XKJE 2AKYA 3PPYA 2JATA 2PX3A 3HVKA 3N8HA 2G36A 1W19A 3OE7D 4RS3A 1DAGA 5E1MA 3UA3A 2VSQA 4IHAA 3QXXA 4DIBA 4ZI7A 1G16A 3LL7A 4MVJM 2XXAA 1W52X 1FYVA 2PG3A 1LS1A 1QYVA 1UKEA 3OZVA 3C74A 4LXXA 3WAKA 1T6BY 4NZNA 4P93A 3IAHA 5B7PA 1EM8A 3OE4A 4WADA 2V7QD 4EG6A 4WECA 4J0KA 1DLIA 1GFWA 2A5JA 3C3JA 3CT6A 2XA1A 5E4TA 5KMGB 3EPPA 4ETIA 4XOIA 4ZAYA 1B1CA 5JAUA 2VO1A 2BFDB 2IBMA 1EUDB 2XUOA 3IVGA 2W0SA 2D59A 3EE6A 4CKEB 2H1LA 2RI0A 2W00A 1N6KA 3H8VA 3KALA 3D6AA 4KQIA 4AIIA 5EOVA 4BBJA 3KWLA 4UCXA 3I76A 1SZDA 2Z6UA 3R4CA 3PLRA 3DO6A 2I4OA 4WHMA 3A9VA 1XZHA 1UKAA 1P0PA 2H2AA 2YCLA 3AHDA 4I1UA 3PRKE 1JAYA 4JR2A 4DBLE 3PXGA 4BFXA 2DBVO 3D0RA 1PQWA 4ACAA 3NRBA 1GOTA 2IP1A 1J39A 1AMNA 3C43A 3OU2A 4XAQA 5D01A 3PEFA 4RJ2A 3DT9A 1JQ5A 1BFUA 1WRBA 2DKNA 2AXQA 2Q27A 2XVAA 4PC6A 3OFJA 3DLBA 4D81A 1ONOA 2FUEA 1PDOA 2VKQA 3OEWA 4JD5A 3RVBA 2FGJA 4K9NA 1D9ZA 4F3YA 1KOGA 1ISHA 2VSYA 1KL7A 4NDAA 5K01A 3N8NA 3NONA 3KZNA 4ME6A 1FDUA 2C9DA 1L5HB 1YB6A 2QGZA 2XGOA 3F90A 1ZUNA 3PPWA 1OBHA 4DLPA 2H18A 3DLCA 4CDGA 1V37A 4D3FA 2Q5CA 1OVGA 1XO1A 2ZT6A 3TS1A 3T3GA 4IP0A 2C8JA 5GTDA 3TOVA 3VOAA 2ZI4A 4OVKA 1P9NA 3E70C 3TUZC 1Y6JA 1COZA 2YVLA 2ODTX 1TA4A 4FN4A 1EJBA 1DFGA 1E7QA 2WK1A 3O2QB 3DB1A 1WS6A 4LMPA 3A2KA 4E5PA 1RABA 2PRSA 2VH2A 3OEHA 2QL7A 1SBTA 2YWJA 4F56A 4PONA 4XPIA 1M6YA 2IDMA 3RRJA 4HV4A 4IWXA 3TXYA 4DG9A 5LQCA 2AF3C 4HATA 1F2TB 2OHXA 4LW8A 1OTXA 4J75A 4WK4B 3NASA 3DBLB 5DTQA 5I4KA 1LSJA 5FYQA 3FYCA 1PLLA 2B4KA 5JAPA 1VDMA 1IVYA 4MEJA 1GG8A 2W2LA 2B35A 2CDCA 2QRZA 2VDWB 3ZWYA 3RKUA 3ZLVA 5JW6A 2J6BA 3TECE 5KNLA 1DAMA 4Q03A 1LQUA 3WZMA 1BEEA 3BERA 3ZVMA 3OUUA 3RWMB 3GPCA 1O0BA 2Z2JA 3TQCA 1LEHA 1STOA 1H1LB 2AN1A 3GJQA 4QU8A 4TV8F 4CNBA 3CTMA 5BUQA 1GG9A 2WMNB 4QE3A 3CIOA 5DT9A 1CE8A 1GDHA 3V1YA 3QRWA 3G5TA 2B37A 4LI3X 1J2YA 5B36A 1I7PA 1B23P 4DNOA 3DDSA 3ZE8A 1P0QA 2CUTA 4NZYA 1I36A 3TZLA 1DQSA 1TJ4A 2FVYA 2VF8A 2OFWA 3M1IA 1V6CA 3HB7A 1SCBA 4RDCA 4ND8B 4N5HX 2QSUA 4Z54A 2A30A 3JRWA 1RHUA 2QYOA 5CGZA 1UFQA 1V5FA 2SKDA 2P2SA 4REQB 4MAMA 3RTBA 3JZIA 1VE9A 5C7OO 1AUXA 1KXJA 3E5RA 1R6TA 5BNZA 5HJ7A 3ZD9A 5BYKA 3GMTA 2QZZA 1L7DA 2W48A 1CNMA 1L7AA 1YA4A 2OGSA 1P4HA 3AEZA 3AETB 1NW4A 3H7AA 1VLJA 4ZKEA 3AG6A 4AG6A 3RANA 3DGEC 3O8BA 3V7YA 3AR3A 1P2TA 5HM8A 2E5FA 2VS1A 4L85A 5KYUB 3GBVA 4U7HA 1P9OA 3CZCA 3SLRA 4Q3NA 1AKVA 3V8NA 5SY9A 5KVQA 4TWIA 1FCJA 2A1IA 4DCPA 5HKKD 4E30A 4JP8A 4MYUA 3D1LA 5J47A 5CDTA 3ITDA 4BCCA 1ZMOA 1KZYC 3RRZA 2UYCA 1DKLA 5HGJA 5BYJA 3ZBUA 4UNRA 4R83A 3S1LA 3H5WA 4G3XA 3RU9A 2D7JA 5F3WB 3LRXA 1QFMA 1K98A 4FGKA 4XJXA 4CTJA 2PL3A 4MVJP 1HTBA 3ZZTA 5L3SA 3QFHA 3MYYA 2ASEA 2RGYA 4DIEA 1HT0A 1W87A 2DH6A 3K5WA 1ZK0A 2ANBA 4F5DA 1H23A 4K9RA 4UE6A 2XIQA 3RSGA 4GOJA 3EH2A 5K99A 1RP7A 4B2IA 4LTMA 4HRVA 1FE8A 2JPDA 1E2EA 1E69A 2QE7A 1Z7YA 4PYQA 4TV8B 3G5AA 3RC3A 1C3JA 4K6GA 1MDFA 4UVIA 5CNMA 1RMYA 1DXHA 5FL7A 4BIIA 3OLYA 1TD9A 5DMXA 4LOJA 1VE1A 3LUPA 5A1JA 4ARIA 2CXRA 4G0NA 3G0GA 4FLEA 3A3YA 5TV2A 3EG9A 1IRXA 1HTWA 2VBIA 4X84A 3TSOA