4AKEA

Adenylate kinase
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
214
structure length
214
Chain Sequence
MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADENYLATE KINASE
publication title Adenylate kinase motions during catalysis: an energetic counterweight balancing substrate binding.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Phosphotransferase
total genus 69
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 1995-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4akeA00
4D4MA 1JBKA 4FN5A 1T3HA 5E3HA 1VMAA 2V1UA 1E0SA 1SVOA 5FL3A 1GNRA 1TF5A 2XZPA 3CH5A 2PZFA 3QOFA 4NONA 5GVRA 1Z6XA 5SZIA 1OH8A 4ARZA 4HB4A 1IXZA 3RSLA 1DOAA 2REOA 4OJQA 5HE8A 1OHHD 1P61B 1J8MF 5BN3A 1JR3D 1WA5A 2QY9A 4Q47A 2XSZA 1QRAA 4HATA 2OESA 1G17A 3K0SA 2ZJ2A 1UAAA 1JAIA 2F3TA 1ODFA 3T1OA 2QQ0A 4NYJR 1VIYA 3THWB 3VX3A 1JXMA 1N2CE 1QVRA 4CGZA 5D3QA 1IJFA 3K0AA 3NEYA 3C14C 1AGRA 1N25A 4MUAA 4Y0VA 1Z6GA 4ABYA 5FTNA 5K8IA 4PC6A 3AVTA 4AG5A 1R2QA 4U02A 1W36C 5KPJA 3IO5A 1H8EA 2HF9A 2QTVB 4BZPA 4M1SA 4RCZA 5FUXA 2JIZA 4P0TA 4Q7JB 3TSWA 4G0NA 2DWQA 2R65A 1U99A 1PLKA 2NQ2C 2Z4RA 2BMJA 4X8MA 2YWGA 2ZI6A 1QHGA 4P4UA 2ODWA 2ZSEA 3PENA 4Q48A 3AVYA 4D80A 2JLYA 1XX6A 2QTHA 1AM4D 1EWQA 4GOKA 2BBTA 2PJRA 1IN8A 4C0AC 3W8NA 2VH5R 3B1ZA 4JYBA 2J9RA 1GRQA 4NKRA 5C46F 4QJ3A 2OSBA 1N6NA 2XTZA 3BWDD 3SS8A 3AF2A 1T4GA 2EU8A 1OPXA 1P62B 3IHWA 1DAGA 1Z83A 3FFAA 1J99A 3SJCA 3QY0A 4HDOB 3CRMA 4D0NA 4D2IA 1KDTA 1Z6TA 4D82A 4OYHA 5DYIA 2QL6A 3THYB 1OIVA 1OH5A 1R8QA 5CLQA 4G5OA 3BFVA 4ITRC 1NMZA 4HYYA 1G4UR 1BH2A 1I4LD 1AS2A 1G18A 1PZNA 1XP8A 2ZQ5A 2VYFA 3B5JA 4FIDA 4LRWA 2CNWA 3AF0A 1F3OA 3ZVLA 2DHRA 4US1R 1AQYA 1FTSA 3UIEA 4PAMA 4ZI3A 3VNVA 1ZM3A 4LV8B 5HTKA 4AY2A 1P5ZB 1D2NA 4TQ9A 4UJ5A 4XJXA 4B2PA 3ZIAD 3VKWA 2BJWA 2QPTA 4I1UA 3RRNA 2JJ8A 1ZM7A 4KFRA 3FKSD 3SHWA 3OIUA 3K0EA 4GBMA 5F9HA 4OK5A 4WW0A 4OHVA 3DMDA 3ECCA 2FG5A 1OFTA 1S3SA 2CLDX 2GJKA 3UG7A 2CE2X 3C8UA 4NYMR 3UMSA 2QNRA 2D2FA 3EWSA 1JR3A 4GSYA 4JKIA 3W5IA 3EPJA 3TJZA 5KU1A 2QMOA 1Z6AA 3P32A 1VCOA 3B82A 3E2IA 3KXLA 4KV9A 4B76A 1QHHB 3QENA 1UKEA 3QVUA 4JL6A 4LI0A 2TMKA 4ZDWA 2FN4A 2HDNB 4Y0AA 2JGNA 4PPNA 5UKDA 2PBRA 1Q20A 2ZJ5A 4DSNA 5HCIA 3VTKA 1RRCA 2GCOB 5F98A 5JJLA 4E22A 3M1IA 3IIMA 2I3BA 3WHLA 4YMTA 4ZIRB 1AGPA 3VHXA 1UEIA 2A5JA 2A5FA 1CLUA 3LO5A 5J4VA 1F6BA 1XPOA 1K5GA 1V5WA 5D3MB 4L15A 2B92A 2BMDA 3P4XA 1E3MA 2R6AA 4KAXA 3ASZA 5JCZA 1D2MA 2RGGA 3GFPA 3FHTA 4Z1MD 4M9XA 1KDRA 1P2UA 2E1RA 2KE5A 1FFHA 3A1UA 3NH6A 3OEHA 5J4KA 4CEIB 2ERXA 5AUQA 3EASA 4XTRA 3P26A 3EZ2A 1II9A 4URXR 3GPLA 2AXNA 3EPHA 1NN1A 1KJWA 1NIJA 5KDDA 2J41A 4TL9A 2ZVPX 5DI3B 5G41A 3NG1A 2R9VA 2QZ4A 2XGJA 2VQSA 1XFAA 2EFGA 3L8YA 4QBIA 4RZXA 1N5LA 5EUQB 4EAQA 821PA 2RB4A 2OCPA 5IT5A 3ND9A 3U61B 2XZOA 2ODEA 2V8OA 4IDPA 4P33A 2PMKA 4KXFB 3A4NA 1M7HA 3NVAA 1G7RA 2RGCA 3LA6A 2FMXA 5HZKA 1W1WA 3CW2A 2B8WA 2IYYA 1P6XA 1KOFA 1Q3HA 2XNDD 1CKEA 5AWFC 1IHUA 4EPVA 2WJVA 2HXYA 2VF7A 1T8TA 3SYLA 1OFHA 3TW4A 2EYQA 2WZQA 5KTYA 4PC1A 1Z28A 1Q21A 3TR5A 3NWJA 4BLRA 3TUZC 1KSGA 2ZE8A 1M1YE 2EVWX 4A9AA 1F5NA 2REXB 1JJVA 3PFIA 2PT5A 3TSZA 4B48A 3CIOA 2DWOA 2EWWA 3TRFA 4XWKA 3ZIAA 3T35A 1NG1A 2FF7A 1BYUA 4G01B 5FR1A 2C03A 1SZPA 3PITA 2BM0A 1AK2A 3SBDA 3FKSA 3SJBA 721PA 3QF4B 4XVUA 5IRCD 2FSIA 3U7HB 1E2DA 5AK0A 4Q03A 3L0SA 1GILA 4M22A 3SFZA 2D7DA 3CRVA 3I8SA 2WM9B 4GOXA 1LF5A 1KSJA 1OXTA 4Q1DA 4PSKA 1IBRA 2ECKA 2D3WA 1ETUA 4V02A 2JLVA 5L3VA 3CUEF 3QEJA 5ELXA 1LF0A 3F5FA 1W36B 3NKVA 2FH5B 3Q5DA 1X86B 4Q1AA 3CRW1 4Q4LA 2YYZA 2P3SA 4R98A 1C9KA 2ZE5A 4UNNA 3GLIA 2KBFA 2JJ2A 2OE2A 3QXXA 2W58A 3K0CC 4LBYA 4LHVA 4DDTA 2J7KA 3A1WA 4U5XA 1JPNA 4JLKA 3IUYA 1E1QD 3QKRB 5JMTA 4LHZA 5J4HA 1NP6A 2GBLC 2IEYA 3CKLA 4DDWA 1YRAA 3AF4A 4Z1MA 1JPJA 1NBME 5DHFA 3THOA 3TSOA 4DUGD 2O8BB 2J0UB 4B35A 4HUTA 4FD2A 2XTMA 1H65A 2ZANA 3AVXA 2OFOA 3HU2A 2GHIA 4OQXA 4YDHB 5EE3A 2H16A 3BAFA 3K70D 2GA8A 3TQFA 2JDIA 2ZUCA 1WBBA 2P6UA 2QAGB 3QE0A 4AC9A 2GNOA 2CBZA 2IYQA 3OAAD 4IFBA 4PZYA 4JSTA 4PAOA 4RFVA 1DTSA 3LW8A 2LKCA 2HCJB 4C0HA 4DLSA 1ZINA 4B75A 3A1TA 1SXJD 4JT4A 4JVNA 5TB5A 1KI1A 5DN6D 3GLGA 3K0FA 3G5UA 4N1AA 1JQJC 3IIKA 2D74A 5KYKA 4HB3A 2VP2A 2IYRA 2R6FA 4WZBE 4TTPA 4U00A 3PG5A 4IXMA 2DCUA 4O2RA 2G83A 4KJZA 3NXSA 4YONB 3SYKA 1RRGA 1JAHA 3GP8A 3PEVA 4EPYA 2DFLA 5CB8A 3PEWA 4Q9JA 3I5XA 2GESA 3H4MA 5HKKA 4M9QA 2ZEJA 1E1RD 2P2LA 2O8DA 4DSTA 2Q3HA 1JQLB 3BC1A 4DIDA 4ZDIA 5CYPA 4A82A 1O87A 2JLRA 1X8JA 3EC1A 4LY6A 4NHOA 1XMVA 3QXSA 2RCNA 3L2OB 1IY1A 4NZYA 4TLCA 3CBQA 3TK1A 5KSYA 3ONWA 3WBKA 4URYR 5JRZA 3REGA 4ESVA 2GK7A 2GXSA 1VTKA 3QG1A 1XMJA 1VDZA 5FOTA 1OT3A 3DMNA 1ZM4A 4N0EA 2IUUA 4OI2A 2JCSA 4FCTA 4MRSA 1XXHA 3T34A 3FDIA 4C0BA 4GT1A 4ASUD 1E96A 4A4DA 3GCGA 1ZW6A 3QBTA 4MRNA 5E7JA 4TZ6A 4HLDA 3KKQA 3CZPA 2PH1A 3HP1A 5H1YA 3U7EB 4IOKA 3T61A 3CF0A 3U44A 4FMBB 3ZD6A 1VKJA 1E1QA 1XEWX 4AKGA 1P60A 4Q7MB 1KI2A 5H8WA 1L8QA 1N0WA 1CRQA 2Q0HA 3HJNA 5KNDA 4EFLA 4MKFA 4MGYR 1R0XA 1KI7A 2VSFA 5H68A 2JEOA 5SZKB 1I2DA 1KMHB 5KSZA 4JLNA 5FBWB 4EUNA 2F1HA 3ICQB 3IIJA 2IHBA 4DUGA 2WVJA 1Z8FA 2ZJBA 4XIGS 2BDTA 3KZ1E 3AVPA 2XXAA 2GILA 5JBQA 4GP6A 4NYIQ 5HPYB 1COWD 1XTRA 1G6HA 5FPYA 2ZJZA 4PQRA 4AKEA 4EPWA 1U8AA 1NJGA 3SNHA 3OAAA 4W9MC 4IDHA 5F9FA 1OXXK 2V7QD 4FW9A 4QHYA 2J0QA 1GKYA 2GJ8A 4AYTA 2PCJA 4ON9A 2ZIAA 1E6CA 1SXJA 2VSXA 4NBSA 2IWHA 4Q7KA 3Q8XB 2C8VA 3AB3A 4Q1CA 4Z51A 1KYIA 1TMKA 2ODNA 3RABA 3EWAA 4ZCIA 4MDFA 2QMUA 2QN6A 4RFSA 3RANA 5FBRB 2G77B 4NMMA 1HYQA 1TQ6A 4X8OA 3SR0A 221PA 1R0YA 3LAWA 1MO3A 2G1JA 4ZKDA 1JR3E 4RD1A 5JECA 2ZITA 3LQRA 4HB2A 4DSOA 4HUQA 5M04A 4C2TA 3IPYA 1TTTA 4TMZA 3MUFA 1Q22A 2IYZA 1SVWA 2AFIE 1GDDA 2VHJA 5ANRB 2QRZA 2AK3A 3VKHA 1QG4A 4OHXA 4GPTA 5TXGA 1GWNA 4A8JA 1KMQA 4Q1BA 4BASA 1RYFA 4Q19A 3WMGA 5GADl 1FP7A 3KTAB 4Q1FA 2H92A 4WVFA 1W2GA 4GL2A 2WKRA 1HT2E 1SHKA 3IEUA 3MJHA 2BV3A 3GMTA 1UEJA 5JSZB 2PLRA 2QBYB 4DLVA 4LWZA 4PZLA 4PO1A 4YXWD 3M4YA 3CPHA 4TYPA 1LB1B 4MITA 1Q12A 3U3OA 2C96A 4F7WA 2QPOA 4G5QA 4TYNA 4LOAA 4IOJA 5JLJA 2ORIA 4TZ0A 1CIPA 5EZ6B 3RDPA 3MG9A 4UKDA 3GJ4A 1MO4A 1NY5A 2VRWA 4TQUS 2OUKA 4RD2A 1MT0A 4CEHB 4DKXA 4AKIA 4LJAA 4BLPA 3QPUA 1GIAA 2DYKA 5CDFA 5C4MA 1WBDA 2BBSA 2BMFA 3KX2A 4P4SB 3FE2A 3N5CA 3NTUA 4Q4JA 2RGBA 3H2YA 4YDSA 1FUUA 2EFDB 3WMEA 1KIMA 2YJTD 4MKGA 2F9LA 2GF0A 3B78A 2VO1A 5L3SB 4CT4B 1E4YA 2AWOA 1EXMA 1RRFA 3CLVA 4EDHA 3O47A 1G8HA 3LDAA 4JJZA 4MRRA 1COWA 5B57C 1F2UA 4KYUA 5EXPA 2FZLA 4IDOA 5SZHB 4NDZA 2RGAA 3BJIC 2IS1A 1MKYA 2AN9A 2V7QA 3ZVMA 2CLCX 2PZGA 1S2MA 5KUTA 2ZUDA 3NC0C 2GVZC 3QXCA 1UBGA 2GJSA 4WXRA 1HE1C 5CK4A 3EZ6A 2GAOA 2ZSDA 1SVMA 4LYFA 1ZNWA 2J7PA 3KJGA 1OB5A 4CEJB 4QKQA 4K81B 3W34A 1DELA 4QFMA 2UZIR 2QTFA 3HR7A 2LWIA 4JBXA 2YWHA 2IBMA 4P32A 2ZI7A 1MO6A 3GEHA 4DLUA 4LJ5A 1F2TB 4GNKA 521PA 2W0SA 2FEOA 3THWA 4Q4AA 4W5JA 2AX4A 2HLDD 1CEEA 2CJWB 1G8FA 4TLAA 4PTLA 1KK2A 2ORVA 2QAJA 4M9SA 1RZ3A 2IUSA 4R2HA 5BN4A 3VAAA 3SJAA 121PA 3CWQA 3BXZA 4B33A 4DLYA 2CVFA 3W3ZB 4B3XA 2IXGA 4J0QA 4EJSA 4AURA 3FOZA 1U9IC 2J45A 1E9DA 1XZPA 1LFDB 1H8ED 1AIPA 2R6CA 4OJKA 3GLIE 1OB2A 3P27A 4BFWA 4HB0A 1SHZA 3I61A 1ZUHA 2BCGY 1G3QA 3NDPA 1OYYA 1NF3A 2WMOB 4B47A 3SZRA 1IXSB 1RE0A 1XB2A 3C5CA 4RD3A 1A7JA 3H1TA 3T12A 3I3SR 3N70A 1GNPA 4YXWA 1E9BA 2MSEB 1W47A 1AA9A 4D81A 2A3RA 1G7CA 2PX3A 2DWPA 3CX7A 2YC4C 1S4QA 1VCIA 3NC1C 3KKMA 2KBEA 1ZIOA 1X3SA 5CJPA 1FNMA 4L9SA 4QJ4A 4LJ9A 4Q21A 5JWRA 5J47A 3O8DA 4QNRA 2O8CB 4RZ3A 4QNMA 4Q4HB 4FWTA 5CJ2A 4XD7A 2IYSA 1UKZA 4M21A 1Y3AA 2HF8A 3GD7A 1LV7A 1UDXA 2FOLA 4Q9KA 1TF2A 4LYAA 1H8HA 2EFEB 2NO9A 3A37A 4XWAA 1GG2A 1XJQA 3OFNA 1T9HA 2B7CA 1GVNB 4G1UC 5J4YA 3KFVA 3GLGE 4G3XA 1WB9A 3VR6A 2C9YA 2ZR7A 1M74A 4CVNA 4IEIA 3ZS8A 3ZDQA 2BBOA 5AJYA 1XMIA 3TW8B 4B73A 2GEUA 1JALA 5JZVA 1QHIA 1TF7A 3GJ6A 1DPFA 1OW3B 4B32A 2FPMA 4AKHA 2FFAA 4Z8YA 4WOPA 3THXB 4N3NA 4MYUA 2D4HA 4M1YA 1R10A 1D6JA 2XITA 2C95A 2WSSA 3ADBA 2HT1A 4D0LB 2ZI4A 4F38A 1KZ7B 3LH5A 3EPLA 4RKFA 2X8AA 3UWOA 5CIWA 3LBHA 4EIWA 2BKEA 3K09C 2IF2A 1Z08A 1A2BA 4IW3B 3ZGXA 3B2EA 4HLQB 4BEJA 4F91B 5L8VA 2WWWA 1RJ9B 1XD2B 1QHHA 1NLYA 1U0LA 3CNLA 1B23P 5TARA 3PXGA 2PMDA 2OV2A 1Z07A 2HLDA 1N6IA 1N5JA 2KI5A 4KFSA 3IQWA 4NCKA 1E9EA 3C15C 4NCIA 4O25A 4RJLA 2WAXA 4CF7A 1OXVA 4ZIRA 1FMJA 1GM5A 3PCRB 3KXKA 4MUBA 3FTQA 3CPJB 3CPEA 2WPDA 1XXHE 2CCKA 1XRJA 1E2FA 1SGWA 5FI0B 4M8NE 3CRRA 3NBYC 4MDEA 2QEQA 4R2IA 1SVIA 2QROA 4H1UA 1KJZA 2WKQA 1K5DA 1KI3A 2V6IA 3AKDA 1P72A 1XNJA 3KUDA 3EXAA 1Q1EA 2J3EA 2Q9CA 3B1YA 3OEHD 1OXSC 3GLHA 2C2HA 3OZXA 3BORA 1X6VA 1P73A 3UMRA 1I2MA 3P20A 5AUPB 3HYRA 5GJBA 3LNCA 3CF2A 4MKIA 1XWIA 5CM9C 4Q7LA 5TY0A 4DZZA 5DLQC 4GRAA 2Z5FA 1BOFA 1NKSA 4RY2A 4Q18A 2JLUA 1NN3A 1KK1A 1QDEA 4LYJA 1N6RA 2VP0A 3LW7A 2FWRA 2L0XA 1ZM9A 2YWFA 2O8EB 1D9ZA 4OQNA 1G5TA 4FMDB 1MABB 3G82C 4POAA 4JJKA 1E2HA 1IJEA 1N0VC 1XEFA 2NZJA 3AH8A 2ORWA 4RKEA 1IY0A 2QAGC 3CR7A 2ZU6A 4ZDKA 1WE2A 2LCFA 1J8YF 4P3YA 2PX0A 1SXJE 2NPFA 2FX3A 3K9LA 2WIBA 2G9NA 3BOSA 4I81A 2RHDA 1EX7A 3UK6A 1FUKA 5EE0A 2ZPTX 1TNDA 4QGHA 1SULA 4A2WA 4BPBA 1A82A 2IS4A 1KAOA 1L7VC 3W8RA 1QG2A 3KKNA 4OKSA 1E2KA 5AJVB 1CJMA 1EFRD 2AL7A 2VA8A 4LDJA 3KDSE 4LX0A 1DE0A 1W7AA 4WAUA 3U6BA 1L2TA 2PJZA 3QF4A 4YQFA 1XCPA 3ZZTA 2ZSFA 1P75A 2ZS8A 2J0VA 4ZKEA 3OIVA 3HPQA 3MLEA 2G0TA 4Q01A 3QXJA 4HEJA 4X8HA 1ZAKA 3TNFA 4RVCA 1JR6A 3CX6A 2QUZA 3PIRA 5TMPA 3MRSA 1EFHA 3AF1A 4PO8A 3CONA 1UADA 2WMNB 3LX8A 2IWRA 2WJIA 1KI6A 1P2VA 1UBFA 5JS7A 1Q1ZA 3PR1A 1NVXQ 1ZJ6A 5AJWA 3IBYA 1NVVQ 3U60B 3U4QA 3BERA 1EX6A 1KGDA 4K8OA 4BFXA 2CL0X 2RGNC 4AWXA 4RZ2A 4HDQB 2BIFA 1RW4A 5FTMA 2BOVA 3ASYA 4DLRA 3LXXA 2JJ2D 1OF1A 2ZE6A 4MYHA 3TUJC 3NBFA 1VIAA 4ARZB 5JWOA 2FZ4A 2W2TA 1P9NA 2MSCB 3U6KA 2QI9C 1D2EA 4C30A 1ZNYA 1Z29A 1ZUIA 5KO2A 3RS4A 3T1VA 4B74A 2CCGA 3LLUA 2IEZA 5L3QB 3SOPA 1SKYE 3CNOA 2XTNA 4JMPA 4BGDA 2DR3A 2V3CC 3SC3A 4AK9A 1Z06A 3E70C 3RS7A 1Z2AA 2AFHE 2J0UA 1FL9A 3VNUA 1N6LA 1TAGA 4TMTA 1YZKA 2ZXUA 3D3QA 3K0AB 3U5ZB 2ANBA 1E79A 4UNSA 3MD0A 5CDFE 3KB2A 2OILA 4DCTA 1II8A 2JDID 2AD5A 4V0LA 2HT6A 2A9KA 4JBWA 3X1XA 4L16A 2WICA 4PSAA 2Q9BA 1C4OA 2GVDC 3R20A 4DJTA 1OXUA 2RGDA 4PFSA 1W4AA 1IN7A 1BYIA 4BUJA 2AKYA 3F8TA 4DCNA 1OH7A 3MAAC 4D4LA 1L4UA 1FQKA 2H7VA 2VP4A 3H84A 3A4MA 1OLOA 1U8ZA 3TKLA 4DSUA 2AR7A 2OBNA 2Z43A 3X1WA 3SI7A 1KK3A 2ZRHA 2ZVQX 3MMPA 1VCMA 2G0NA 3JZAA 3K9NA 1A4RA 5CLLA 1CU1A 3AF3A 1QBKC 4PZZA 2RKOA 4ZO4A 3R7WB 3ZVRA 3QI2A 4KU4A 2D7CA 5DSZA 3A6PC 2V54A 1HT1E 3Q5EA 4E07A 5HKKD 4OI0A 3D31A 1B0UA 3ZZ0A 2ZRAA 1EFRA 4V0MA 3NHBA 3RRZA 3U3MA 1GOTA 3BB3A 3REFA 4A6XA 4LV6A 2W2VA 4B3BA 3AVQA 3DVLA 1EK0A 5JEDA 3EZFA 3QPVA 2F1JA 1SVLA 3DEFA 1E94E 1CS4C 2ZI5A 4WIAA 4Q9IA 1OH6A 3SDZA 2MMCA 2OM2A 4TLDA 4AD8A 1ZD8A 5BW8A 2NOAA 3VR2A 5C1BA 2VL7A 2QT1A 2HEIA 1RVDA 4B43A 1XPRA 2QG6A 1GL6A 4M53A 4KHZA 4DCVA 3J81k 3CWZA 1KKLA 3L82B 3LXRA 2OBMA 5JFGA 5KHOC 2P0EA 4WA7A 4X8LA 2PT7A 2AD1A 5FOSA 2F55A 1EGAA 1E2PA 4WBSA 3VQTA 5G53C 1ZNXA 2O5VA 3BIFA 3FFBA 2BC9A 5FTJA 2UVQA 2ZI9A 3KL4A 4DT1B 2QPAA 4KBFA 4QRHA 4BZXA 1UKVY 4NYIR 5K8UA 2OCAA 2PLFA 1G7SA 1MRSA 4HAXA 4JLVA 2QU8A 4TTQA 5GJCA 5SZJA 3X1YA 3DOEA 2IS2A 3F0TA 2RMKA 2CHGA 2Z6VA 3SBEA 1Z0DA 2QORA 4AYWA 1CJKC 2E9SA 3K9GA 2V55B 1VCNA 3V9PA 2CL6X 1ESMA 3OIYA 1UM8A 3GLFA 2ZYVX 4D4JA 2C5LA 5EUMA 4TMKA 2AK2A 4Q5IA 2KWIA 3K8YA 3TBKA 1FP6A 3MWKA 4A1FA 4PSVA 1F60A 4FMCB 1Q1QA 4MGIR 1E4VA 1WCV1 2UZ3A 1Q44A 4MKHA 1Q57A 2ZRIA 3NIBA 1EWRA 4LYHA 1DS6A 2CXXA 5JHGB 1IN6A 4LC1A 2PEYA 4D25A 2XEXA 2C99A 1XPUA 4BLOA 4C0SA 4LK2A 421PA 1LS1A 4OBEA 1W49A 5C2JB 1HA3A 1NI3A 3NEJA 5DGXA 3RRYA 2RGEA 1G8GA 1WDTA 2CE7A 3Q7QA 3U2QA 4DHEA 1FZQA 4IKEA 4D6PA 1CJUC 4JZKA 3CO5A 4L8GA 4Q02A 3GJ5A 2REBA 2Q6TA 3AGPA 3SU8A 1JECA 3EPKA 2ZU0C 1XEXB 1JXOA 3DKVA 4LJ7A 1G6OA 4MH0R 1CP2A 1E0AA 2YC2C 2FFBA 2QGNA 1Z0FA 3A8TA 1VECA 3NDBB 2GAAA 4NH0A 4URUR 3AEZA 2ONJA 2ZRNA 3SFVA 2DFTA 1DARA 4RZUA 1P7CA 1TQ4A 1VG8A 4D26A 4PHGA 4A0FA 5FPKA 1LTQA 1P3JA 3RNLA 3RVBA 1KZGB 2QT0A 3K70C 2FA9A 3SE0A 4ACAA 1WQ1R 3RS0A 5LD2C 2IT1A 4F4CA 1WXQA 2J59A 1OKKD 5JI3E 3PJRA 1T6NA 4GMDA 4C4PA 1ZBDA 5C18A 2EWVA 3K0CA 3KTAA 4OHYA 2VBCA 1XTIA 3IDQA 4C0KA 1ANKA 3RSOA 3KQUA 1SXJC 2A5YB 3RYTC 3UKDA 5LB2A 1NL3A 3DZDA 4JLMA 1SQ5A 3Q72A 3IQXA 2H57A 2QBYA 1E0JA 1KI8A 2GBLA 4U7DA 3ADKA 5DE3A 4QG7A 1M6NA 4R7ZA 4HSEA 4XSGA 4B3DA 3WRXC 2J0SA 4G5SA 2FJUA 3BH0A 2GRJA 3W5JA 4EQ6A 4PC7A 1T3SA 1XD8A 2NGRA 1OV4A 4QBGB 3GLHE 1IY2A 3EARA 3LBNA 4AI6A 1A1VA 4A0GA 2H18A 2BM1A 1J2JA 2XZLA 3U7GA 4DB2A 1FPMA 1XD9A 2QENA 2X19A 1GL7A 4DC9A 1AKEA 3M6AA 1FQJA 2N1BA 4Q66C 3PUZA 4IHQA 2O8FA 3B60A 3EW9A 3KJHA 3RC3A 1S0UA 3V4RA 1RPZA 8OHMA 1US8A 3KXIA 3L0PA 2EFCB 1S3GA 4PPFA 2R2AA 4A36A 1U90A 3R8FA 3GLIB 4IVQA 5CM8B 1DG1G 2Q3FA 3FYHA 3FKQA 1N0UA 2YOFA 1W4BA 2VP6A 5AJXA 1FX0B 2A30A 3BFXA 2O0KA 5E95A 4BE7B 3TE6A 1UDWA 3B1XA 2P6NA 2FFHA 5TVKA 3KKOA 2NO0A 3S1AA 1M34E 4H9GA 2QP4A 1D9XA 3QSYA 1IQPA 5AUOB 1YQTA 4HAUA 3RWOA 1QF9A 4QGFA 5EE9A 1NN0A 2GETA 4BRUA 2FPLA 1U2RA 3IO3A 3DL0A 5B64A 3JZMA 3O8CA 2XJ9A 1CR1A 1VHTA 5JCPA 2F6RA 1G5PA 4S2EA 2J7PD 4ZDJA 3C4JA 3AM1A 3PUVA 3NBXX 1W0KD 1IXRC 2OXRA 1XCMA 2FGJA 2F9MA 2OFWA 3SQXA 1UKYA 2A7QA 5J40A 3LX5A 1ZYUA 1YZTA 5KSPA 4DEXA 4NTZA 1T8UA 5E7IA 3BB4A 3IKJA 4B3FX 1CJTC 4KO8A 3W6OA 3K0FB 3CX8A 4TLEA 621PA 3FMPB 4DLTA 2IYXA 3VMFA 1NSFA 3ND8A 1IN5A 4QJ5A 2K5UA 3SN6A 3TGPA 1OKKA 4UXIA 4O3MA 3VR3A 2Q3MA 4CW7A 4ZV4A 1TL7C 2CL7X 3FHCB 1RRPA 4GI7A 4O2LA 4ACBA 4BFTA 3CZQA 5HR5A 2UKDA 2IS6A 1AN0A 2AXPA 1W4CA 2R8RA 4KBGA 5TV2A 3B13B 1BMFD 1PUIA 4PPQA 1CULC 1FMLA 4LJ4A 1W2HA 4W7SA 2O8DB 4IOLA 4BLSA 2ZSBA 3B8HA 3R8CA 4A15A 4H1VA 2NO1A 1D5CA 4LPKA 1QZXA 2NZ8A 4QBFA 4ZCLA 1A2KC 1Q0UA 2D62A 2C77A 5HZHA 1OFIA 5IF9A 1XDBA 2WWXA 3UWKA 1DAEA 1VPLA 1A5TA 1VYUA 4JKYA 1YZNA 2VHQA 2J1LA 1G19A 1UFQA 4NU0A 4F4JA 3W6PA 1GP2A 2OG2A 4XD7D 3AP3A 3ETLA 3FMOB 3WNCA 3WXMA 4HZUA 4TMXA 5FUWA 1EFUA 1VG0B 3IEVA 4JSYA 3W90A 4BWYA 3SQWA 1H8HD 1XXHB 1U0JA 3I72A 1MH1A 1RYHA 4HLUC 2OCBA 2ZROA 4YMWA 1F48A 3TH5A 4KLZA 4WZAE 3OFND 3U3RA 4B34A 3FGNA 3M0EA 2R62A 4UQOA 3RHFA 5EZ5A 5FOWA 4BQSA 2IYLD 3AVVA 1MV5A 1MO5A 3KQNA 1YU9A 2GXQA 2IYUA 1DAFA 4G5GA 1LY1A 1GL9B 3T5DA 2GJAA 2CHVA 1P2SA 3EIEA 1N6PA 1E9AA 3KQLA 2AWNA 5EP4A 1G3UA 3FVQA 5HCNA 4JVMA 2HJVA 2HXSA 5LPNA 3QG5A 1E0KA 2WIAA 1MOZA 2DB3A 3L0OA 2WSSD 1EG7A 3QKSB 2R6GA 4DVGA 2IC5A 3MGCA 3QNUA 4V0ME 3I8XA 4KLNA 4MGZR 3BE4A 2XXAB 2QE7A 1G21E 4DEYA 4E5UA 3K70B 1UF9A 1W0KA 3DO6A 3P1JA 4LBZA 2P6RA 1YKSA 1ZMXA 2FU5C 2EQBA 4FI3C 1YVDA 4LJ8A 5LD2B 1BIFA 1UBCA 3AP1A 1TEXA 1HUQA 3AUYA 1J7KA 1U81A 3B85A 3PV0A 4I1VA 1ZC3A 4PHFA 4B6FA 4DB4A 2GK6A 4HAYA 3N2EA 1K6MA 2FSGA 5TDHA 2A5DA 1SXJB 4MRVA 2XB4A 3JVVA 3BS4A 2I1VB 1XF9A 4UNQA 2WPDD 1IN4A 3W6NA 2J46A 4RFSB 4TL8A 5HE9A 4XOIA 2WWYA 4FCVA 1NLZA 4OK6A 1ZCAA 3VKGA 1W5SA 3BK7A 1OE0A 1EFCA 4ILEA 4Q9LA 1HY3A 2N46A 4DCUA 2WKPA 1BMFA 4JL8A 2YHSA 4F93B 4NCJA 3LQQA 2J5XA 2QM7A 3VU9B 4B71A 3I73A 5GJWC 5FUVA 2H17A 4XSHA 4MYCA 4M1MA 5JS8A 3EA5A 3GLFE 2G88A 2O0JA 4I1OA 4PC2A 1BO6A 5B58C 5F3WB 3E1SA 4KITB 1U98A 1NG9A 1T3LA 1E2JA 2WJYA 4A8JB 5KOYA 2VPPA 1NY6A 3PEUA 2WHXA 1S96A 3WP1B 4LSGA 3THYA 3DDCA 1Z63A 1WRBA 2C9CA 3ZLJA 2QP9X 1T91A 3LV8A 1N6KA 3EZ9A 3HPRA 5IK2A 3AGQA 3HU3A 3PEYA 4DIEA 1TADA 1ZRHA 2BWJA 4I1SA 1E2MA 1ZIPA 2QRNA 3LLMA 2P5SA 3MWYW 4HDCA 2ZRCA 4RD6A 2JATA 4C7OB 3I1FA 2IX3A 1SKYB 2FNAA 4M2LA 1R8SA 4D4KA 3D6TB 1VG9B 4YC7A 4TMVA 1OIWA 1NVVR 1GFIA 1I4TD 2KSQA 2V4ZA 1R7RA 2O0HA 1LS6A 5JHHB 1JI0A 2OO7A 4B6EA 1M7GA 2FE4A 3FMFA 4NCHA 1PLJA 2D06A 2EW1A 2QM8A 1KJYA 3O8BA 2RHMA 3QIAA 4Q4JB 3TLXA 5KNCA 2BCJQ 2NPIA 1NN5A 2QA5A 3DM9B 5EP3A 1KNXA 3UATA 3WHKA 1FOEB 4OQLA 3WYFA 1OYWA 2F43B 5DIFA 2G1KA 1DO2A 2IW3A 1IM2A 3Q3JB 2O52A 2ZS9A 2IXFA 4DDVA 3UANA 1XJCA 2VP5A 1U9IA 1TU3A 3A4LA 3WYAA 3WP0A 2ZS7A 1W36D 3LRPA 1F2UB 4PC3A 3LVRE 4C3ZA 1GNQA 2GDJA 5CITA 4JBYA 3ADDA 4A2QA 2OXCA 4YMSA 1KO7A 1Z2CA 1HTWA 2GCOA 5JWHA 4C9BA 4QGAA 1W0JD 5FL7D 5G40A 3ZD7A 2BBWA 1XTKA 1ZU5A 3ZH9B 3ZQJA 3A58B 4KYIB 3DHWC 3CB4A 4HI0E 4CIDA 4TQAA 3LBIA 3HDTA 3OEED 5D3MA 4TWZA 3PUWA 3EIQA 5L3QA 2WWIA 4HAZA 3T5GA 3R9WA 3Q9LA 3HR8A 3FPAA 3SYNA 1SKQA 4OL0A 3CRQA 2IF0A 3OF5A 2WTUA 5DI9A 4B2LA 3P4YA 2WJJA 2ZAMA 4Q4AB 4CEIA 2CHQA 4TMWA 2VLIA 1EESA 1Z0IA 1U94A 2P5TB 4DDUA 1E79D 5DI3A 1JB1A 5IHPA 2ZM5A 1G7TA 4D0GA 1NKTA 5BN5A 3L0IB 2RH5A 4QGGA 5F2EA 1G291 3UXMA 4EJSB 3TAHA 1W44A 4JLJA 1WP9A 1E9SA 3C5HA 3TMKA 2OAQ1 4LHWA 1XEWY 2Y8EA 4M1WA 4KVGA 1U0HC 4L9WA 4OI4A 1XTSA 2E87A 2PCLA 4K46A 3HWSA 1DO0A 1MR3F 4HLCA 2VTKA 1E99A 5FH9A 2ZRLA 2OAP1 2JLZA 3QEOA 1P4SA 3BBPA 3KB1A 4JT2A 1FNNA 3LVQE 1GITA 4BECA 2GCPA 1N5KA 3R7WA 1KAGA 5CB6A 2GJ9A 3IBGA 4HZIA 5FBLB 4AYXA 1R4AA 3QBVA 4Z8XA 5CIQA 5J4LA 2ZRJA 1KO5A 2F7SA 5FPSA 5EJEA 4EPTA 1AQUA 1JEEA 2NO6A 3RS2A 3K09A 1G64A 1S1CA 1E98A 2ZAOA 1BKDR 1DADA 4PQFA 2PEZA 4BFSA 1N5IA 4URVR 1R5BA 1XCGB 4PAQA 5AR1A 1XTJA 2JJ1A 4KI0A 2G3YA 4BLTA 5KDOA 2IXEA 5FOVA 5JEEA 2BEKA 1DG3A 1R5NA 2BJVA 1KK0A 1P2TA 5FUYA 1YR7A 1XZQA 4FWIB 4M1TA 2QMHA 2QGZA 3MSXA 3CR8A 4XVRA 2ATVA 4DWJA 5FI1B 3A1VA 3O8RA 3B1WA 4B3CA 5K8TA 3CF6R 4GMXA 3EX7C 4LJYA 4B44A 3TAUA 1DBSA 3U3KA 5LDDC 4PHTA 4S35A 1XBTA 4LBVA 4C0QC 4TN1A 4UJ3A 4TYYA 4DT1A 4JLBA 2CMKA 3R9XA 2ZJYA 5IDVA 1W0JA 5FL7A 4XWOA 3KJIA 5KDLA 1ZC4A 2MSDB 3DZ8A 2VF8A 2WJGA 1OHHA 1NMYA 2C78A 3QKRA 5B2ZA 4Q00A 1CBUA 3AKCA 3OEEA 1FW6A 1S9DA 1E69A 2WWHA 2VHCA 2YOGA 3AV0B 3GEEA 3RS5A 1G8YA 1WF3A 2EFHB 2VHTA 3GJXC 3L8ZA 5FTKA 2YINC 4AG6A 4WZ6A 5E4FA 1K8RA 4QL3A 4EPXA 1G4AE 4RD0A 3KKPA 4IDQA 2O8BA 3Q85A 3N2IA 1EFTA 4KFTA 2JLXA 1YR6A 3KQKA 1G16A 2EYUA 3TUIC 3CNNA 2A2ZA 4TT3D 2B6HA 1VG1A 1GSIA 4V0KA 4BFZA 2QAGA 1DAMA 3HYTA 2WJHA 2DY1A 2I4IA 1CR4A 3A36A 4DXAA 1X8KA 4PQYA 1L4YA 4CDGA 1UPTA 1Z22A 2IYWA 2CCJA 4IFEA 4YLGA 3BH7A 2DFNA 3LY5A 4KSCA 2YVUA 3EG5A 2IL1A 2FV8A 2GZAA 4NYJQ 4FINA 4ESHA 2GZDA 2P67A 3GLHB 4C0LA 5GJVC 1AS0A 3QXHA 5BYJA 2X2EA 3UPUA 2FSHA 1YZLA 2GEVA 4RD4A 2W83A 3C16C 1E9RA 1DVRA 3TVDA 1IONA 2V6JA 2R44A 2W6ID 2QMEA 5FBQB 4EFMA 1XEXA 1PVOA 5B30A 1GUAA 1GRNA 2ZRPA 5DHAA 3AVOA 2ZRDA 4US2R 2B7BA 1R5OA 4IDNA 1XU4A 2KJQA 4OHZA 4JLOA 1KY3A 1Q1BA 1KSFX 3MCAA 3GJ7A 4TTRA 3TVTA 6Q21A 1E2EA 4UNRA 2GXUA 2KB0A 1G41A 3WY9A 2HJGA 2RGNA 2GF9A 3TQCA 1TUEA 2PZEA 2WOOA 2CEAA 2FDCA 4MYTA 2OCYC 1HE8B 2ZRKA 4LZZA 1HEIA 2V1XA 3SHFA 4BFVA 3ADCA 5FR2A 1GAJA 1HURA 1XJ0A 1T5IA 3QKTA 1Z5ZA 3A1SA 4MRPA 4V0OA 1ZD9A 1IOZA 3B1VA 4QM7A 2CVHA 2OLKA 2IK8A 4XVQA 1J90A 4PPGA 1CR2A 4O0MA 2IHYA 3AQ4A 1HQYE 4DLXA 2JLSA 3BFKA 1N6HA 1R0ZA 1GKUB 4LC0A 1DAIA 2VIIA 4OQMA 3C7KA 2NO7A 4IXNA 2HYIC 3AVWA 2YZ2A 1LW7A 2XNSA 1N6OA 2A78A 5DYGA 1KNQA 5FBVB 1YHNA 3GQBA 1ONBA 2X2FA 1M8PA 2FFQA 1E2NA 2FSFA 2VHUA 4LBWA 2ZJ8A 1KI6B 3ZYCA 3X2SA 3VR5A 4F4IA 2XAUA 3TIFA 3I4LA 3U4QB 4FMDF 1KMHA 1X8LA 2C98A 2OZEA 1ZCBA 3F3YA 1MRNA 2ZRFA 3QVVA 2NMVA 1TX4B 2X77A 1WMSA 1FX0A 3C41J 4GOJA 5LBIA 5K8LA 5DISB 3UMFA 2IA5A 4TT3A 1OIXA 2GXAA 4NYMQ 4KVAA 2X1VA 1DAKA 1GKIA 1G3IA 1XMSA 2CDNA 3EA0A 3RS3A 5EE1A 2BMEA 1CXZA 3QQ5A 2W0MA 2XOKD 1AKYA 2NIPA 1NSTA 3MFYA 4GFDA 4XH9B 4M9ZA 5AJZA 1UJ2A 4L4UA 1SVKA 2VP9A 1ELOA 2HV8A 4F92B 2YWEA 4RSGA 4CRWB 3E5HA 4Q1EA 1FTNA 1G20E 3G0HA 4R9UC 5CK5A 1YR9A 2AHOA 2W6IA 2BHRA 3MWLA 3V00A 1CR0A 3PUYA 1KO1A 1PUJA 1DEKA 1II8B 5FPHA 3LFUA 1OFUX 2PL3A 1QHSA 2QSYA 2JASA 4XTCS 4BZQA 2WAYA 4JLPA 4TSFD 3DPUA 4BFYA 5EP2A 5DH9A 4JYCA 3H0KA 4TL6A 1TQDA 3BD9A 4GP7A 1ZVQA 2XNDA 4QHTA 4MA4A 1ZU4A 3ZZUA 1HV8A 3EC2A 1KY2A 4A92A 5A5GA 4G5RA 3W3AA 3I62A 4US0R 4GZMA 2WOJA 2Q21A 1GRRA 2F1IA 4A0HA 5FOUA 4LCBA 1TPZA 4TYQA 3QKUA 1ZD1A 1RIFA 4BLQA 1Z0KA 3AKYA 4PO9A 2W6JD 1DAHA 1KTVA 1OJLA 2ERYA 3CM0A 1XTQA 4R71A 1KDOA 2JAQA 3D7MA 5JSZA 1Y63A 2OBLA 2YNMA 3OE7D 5DO9A 3U7FB 2ZRGA 3KJEA 5BXQC 4LGMA 4ZI2A 2IYTA 4CYMA 1NMXA 2BVNA 4P31A 2W00A 3B6EA 4QM6A 1YZQA 1R0WA 1G8PA 3FHOA 3GEIA 2I1QA 3AP2A 5JRJA 2YKGA 2HCBA 3IPXA 5H70A 4ZCMA 3T1QA 2CK3D 1X1SA 4WXPA 1G5RA 4HAWA 2RGXA 2NTYC 4CEHA 3H86A 4PX9A 3EZ7A 1SVSA 4DRZA 2A5GA 1TU4A 2ZJAA 4P4SA 2ODBA 4TL7A 2HUPA 2BEJA 3VFDA 2ZYWX 3AKEA 3LD9A 3GJ8A 1G3RA 5L3SA 1E9CA 2OLJA 4A8JC 5EP1A 1M7BA 3DOFA 4JLDA 3B9PA 1OSNA 3UG6A 1Z0JA 4EKDA 2ATXA 3K9HA 4MGKR 3U3JA 4DCSA 3I32A 4NP6A 4CZ2A 2XB2A 3Q7PA 2JLQA 2WWGA 5EXTA 2XOKA 3OESA 3MJRA 2F3RA 3GJ0A 1TQ2A 4JS0A 5BWMA 3IHLA 3GLFB 1YJ5A 2WBLC 3QKSA 4M0LA 2VEDA 2ZTSA 1VYVA 3EIHA 2HYDA 3OIWA 2C9OA 3V4FA 3RWMB 2QQEA 1RKBA 4IVRA 1NVWQ 4CEJA 1V43A 2FGKA 4P4TA 4LV5B 4C2UA 1RFLA 2QE7D 2WWFA 4PANA 2GCNA 1E9FA 5J5CA 4PR0A 4JIMA 1PJRA 1Z0AA 4QC2A 1P9RA 3GFOA 2H8KA 2V9PA 1NLFA 4A0RA 1F2TA 1NVUQ 1G3MA 1JJ7A 1Z6YA 5EXXA 4TSFA 3K53A 3WRYC 2CJWA 2ANCA 1I4DD 1S8FA 1S1MA 2Z83A 5DN6A 1IAQA 4JVLA 2OEPA 3GLGB 3ZQ6A 5JJIA 1R6BX 2RAPA 3MWJA 2ZRMA 1PLLA 2YOHA 2JLWA 3NHAA 5E7MA 5A0FA 1Z47A 3I92A 5KNBA 3BB1A 3X1DA 2YV5A 2B21A 4C0JA 3OHMA 1X1RA 3NBZC 4YMUA 2VSOA 3DKPA 4FCWA 4NPHA 4DLZA 2GWHA 2B8TA 3DM5A 2Q9AA 1HQCA 1E2QA 4E09A 2W6JA 4W5HA 1E1RA 3T06B 2ONKA 3VU9A 4LPSA 1LNZA 4YMVA 2QP3A 2ZREA 3OE7A 2D2EA 3WNDA 2LKDA 4QXAA 4NCNA 4CT5A 2IYVA 4FMCF 1NJFA 4IOMA 1LVGA 4JVSB 2DPXA 4URWR 5CYOA 5DNYB 1T5LA 4B3GA 1JNYA 5FTLA 1KI4A 4EFNA 4KCGA 2O8CA 4Q4HA 5EE5B 2CK3A 2OT3B 2ZSAA 2R6DA 1E2GA 4M4SA 3RAPR 4IJMA 1KDPA 1BS1A 3ICEA 4JL5A 5IK2D 4II7A 4EJSC 4RCYA 1PV4A 5BQ5A 4ASUA 4IVPA 2P65A 4I99A 2SHKA 4ZPXA 3SEAA 2NG1A 1C1YA 1UBEA 4EQ6B 4C7OA 3IILA 1GTVA 1GZSA 4IRUB 2N42A 3T1TA 1NBMD 4KODA 3U44B 4PXAA 4ERNA 2GTPA 3VHLB 4AIIA 4E03A 4JLAA 3RLFA 4DLWA 3NH9A 2J87A 4GDFA 1VHLA 2O8FB 5G3YA 5C4GB 3THXA 4L5BA 3KQHA 1YR8A 1N3BA 1US8B 1T0JB 2FEMA 3AVUA 3HU1A 2F43A 1TEVA 4FXPA 3KFXA 2CLSA 3L43A 2XJ4A 4QHSA 1G1MA 1ZP6A 4IEEA 5JI2E 1W5TA 3GFTA 3WYGA 4MQBA 4OHWA 1CJVC 1KO4A 1RJ9A 3X1ZA 3S1AB 1XD2A 4QBHA 3FMIA 1TUIA 2ZE7A 2F1RA 2Z4SA 4N0DA 1Z3IX 3D8BA 3PVSA 2WSMA 4UNPA 5KSOA 2IUTA 3EAQA 4URZR 1E32A 4UXHA 2ZYTX 4M1KA 2ZETA 4TLBA 1W48A 2GKSA 1QHXA 2ZRBA 1E2IA 2ASEA 3BH6A 2W2XA 2ZR9A 3TR0A 3LWNA 1CRPA 2ZJOA 2XSZD 2OFXA 1KI9A 1NRJB 3BGWA 4A6PA 3QPWA 2MMGA 1RC8A 1QVAA 1II0A 1S9HA 4NL4H 3ZS9A 4Z54A 3WBJA 5LB4A 2G6BA 4UXJA 1Q3TA 2GEDA 2C04A 3B9QA 2JA1A 3AUXA 1HH4A 4LUCA 4QOSA 1KO8A 4HUQB 2Z0MA 1ZUNB 2BKUA 2FPKA 1W4RA 2WV9A 1AS3A 4B2IA 1AJEA 3SJZA 4DBLC 4HLUA 3PQCA 4OI1A 4BEBA 4Q9HA 5JJKA 5L3RA 2JIZD 1P9WA 3VX4A 4V0NA 2GZHA 4PHHA 3FWYA 3JVUA 3QJYA 3WNBA 1VYTA 2O8EA 2DBYA 1MABA 4KSBA 1CF4A 4I4LA 4OK3A 1AZTA 1YE8A 5FPTA 4TYWA 1KKMA 1NIPA 2H1LA 1W46A 5EXSA 4GZLA 1CTQA 4LHXA 5GVSA 3I5YA 1NNEA 2AKAB 3QUSA 5AUNB 4NE2A 1J70A 5G3ZA 1QHYA 3FB4A 3GJ3A 1YZUA 1O3YA 4M1OA 1ZNZA 3KUCA 4W5WA 5KPDA 5FOXA 4KFUA 3VR4A 2OHFA 3B7GA 5A4JA 2H5EA 1NBMA 2QSZA 2ZR0A 3T15A 4HAVA 1YRBA 5EQTA 1G9XA 1KHTA 3CH4B 5BYKA 1ESNA 1KSHA 3R9IA 4LHYA 4HZUB 2ZYUX 1U8YA 1E2LA 4A2PA 4V03A 1T0HB 5P21A 1M2OB 4BRWA 2ZI3A 2XX3A 3BRWD 3WMFA 3PUXA 4OQFA 2JJ1D 3ZJYA 3RC8A 4BFUA 2ZUBA 2CNWD 5FFMA 1ZM2A 3K1JA 1YZGA 1AZSC 4EPRA 3W9YA 3IGFA 3QF7A 4LJ6A 3RRMA 3ZVNA 1JEDA 1QHNA 1D8TA 2DFKB 3VR1A
chains in the Genus database with same CATH superfamily
4ZHSA 1N2SA 1JBKA 1MAHA 4OXXA 2ADMA 3O0TA 3ZHVA 1HTBA 1E0SA 1GG8A 1SVOA 4AMGA 1GNRA 1TF5A 5B4UA 4OXQA 4BQNA 4WACA 5HMMA 2I67A 2Q2OA 5GVRA 1NBOA 1Z6XA 1OH8A 4TLMB 3HACA 1UINA 4F72A 4QFDA 1CX9B 3RSLA 1DOAA 3OM0A 3AJRA 4GH5A 3BT7A 2WJWA 4EI7A 1WA5A 4MQUA 4YMIA 4AROA 4Q47A 5DTIA 2ENUA 2XSZA 4HATA 2N47A 1LNQA 4B87A 1L1RA 3ICVA 4E4RA 3H65A 1HLFA 3LC1O 5DW0A 1LI5A 1M2VB 3I2GA 4C4OA 1CERA 4NYJR 5ALTA 1JEQB 1JXMA 1KS2A 1N2CE 4UM8B 1W581 3C4VA 2WUDA 3FOWA 3G0OA 1W88B 1IJFA 2GVNA 1BRMA 3K0AA 5BV8A 1DEAA 2HCRA 4B80A 1OLSA 2WTEA 4QGBA 4BDTA 3UTDA 1Z6GA 1V48A 2KQUA 2XCIA 1U3CA 4U2KA 3UAWA 3VI4B 4WBXC 3AVTA 3N74A 3WGGA 4ND8A 1X2EA 4U02A 3TXYA 1W36C 1EFAA 1H8EA 1FLVA 2HF9A 2QTVB 2QY6A 4BZPA 2PUEA 5FI5A 5FUXA 3R74A 3VZRA 4LKRA 4CL2A 3L04A 3D3KA 2R65A 1WNTA 3UN1A 4X8MA 2KPOA 2BMJA 5AK5A 3UUWA 4E08A 2ZI6A 4P4UA 4FIZA 1KF0A 4ARBA 3AVYA 1ISGA 2JLYA 1J20A 1LQ2A 1AM4D 1ODJA 4INJA 2GZMA 4QRIA 4FDMA 4DCGA 4DRXA 1YL5A 2VF5X 3S5UA 4FYMA 3WZLA 3HC7A 3LZCA 1L6RA 1ESZA 1GNSA 1LA2A 2DY0A 1F1JA 2FUG1 2OV6A 1WXEA 2WYWA 3P0HA 4QJ3A 3LC0A 5C46F 3Q3IA 5TT1A 4J94A 3BWDD 5M2QA 3UGTA 3W2GA 1O6FA 5LOVF 1P62B 3IHWA 2NV6A 2I6UA 4HP8A 2AGVA 3LRXA 1OREA 2R1TB 4O02B 4N8EA 4M6WB 4D0NA 3RQIA 1CHDA 3ZXYA 5IBPA 4UW9A 3HUTA 1PFGA 4OHKA 4BP1A 1XQWA 1R8QA 1LEHA 2QS9A 3AR9A 3I01M 3RT1A 2QTMA 2VDUE 2W2NA 1KZHA 4IILA 1G4UR 5I7EA 1I7NA 1I4LD 3B5JA 1PZNA 1Q7TA 2HTEA 2WTMA 1I7SB 4FIDA 2J33A 1VL0A 3KHTA 4CR6A 1CQXA 5KWVA 2DHRA 2D0DA 4JI4B 1FTSA 1A0OA 1Y1LA 2YFQA 4IDBA 4ZI3A 4EY4A 1G5QA 5DBIA 4LV8B 3VC2A 4AY2A 4BKOA 1D2NA 4L0DA 1OX6A 1YL6A 4TQ9A 3C43A 4LJLA 4UJ5A 1XROA 1L5KA 3PGVA 3X44A 3IULA 3PD0A 4FJ2A 2Z04A 3BK2A 1EBBA 3OT1B 4MHOA 3VKWA 4D0RA 4ER0A 3DE3X 3JQ8B 1TUBA 2JJ8A 2A84A 2GBIA 3WKAA 4CMKA 3LHFA 4R6WA 1Q16A 1YL7A 3BE6A 8ABPA 4OATA 3TX6A 4FUQA 1TJNA 4S3MA 4YP1A 1DKQA 4WW0A 3LPMA 3UO8B 4EYOA 2FRDC 3DMDA 3ECCA 1OFTA 2CLDX 2GJKA 3UG7A 2VDKB 3C8UA 3MERA 4K9NA 3W2FA 1KY4A 3QYPA 2BKAA 3VVLA 2QNRA 3QVGB 2ERCA 2VT7A 3DTYA 1X7HA 1L5FA 4D96A 1L0BA 4Y2GA 5EWLB 4CU5A 4JKIA 4YRSA 1MG0A 3W5IA 1CWUA 1CJCA 4KBYA 3WK4A 4I55F 2NXJA 3OMWA 4O4JA 1NP7A 2IDJA 2WM2A 4EB6B 1JFVA 1U8CB 2AFIA 1JN0A 3L8EA 2HNKA 4GLFA 4B76A 1RI5A 3U9TA 4DV1B 4FS3A 2R8ZA 5LQSA 1A8PA 1U6JA 2FN4A 2GFHA 4O3FA 1LVHA 1Y5RA 4Q34A 2JGNA 4PPNA 4Y0AA 2PBRA 2I33A 4XQCA 5UKDA 3VC1A 4RQUA 3GZTB 5F98A 3EYAA 2HWXA 3W79A 3KJQA 3M1IA 4I9UA 4MVJF 3IIMA 5ENVA 2PSJA 4E22A 2I3BA 2YJGA 4MKXA 1NZFA 5AOCA 1OLXB 1AGPA 3ABOB 3WHLA 5I8WA 2A5JA 4F1WA 5KWEA 2R751 4M0CA 5DYWA 5AXDA 2B30A 3NKFA 1XPOA 1K5GA 1Z8HA 5EJ6A 4JQSA 2B92A 2D59A 1PQWA 3ACDA 3HDGA 1VE7A 1L4EA 1D2MA 3G0GA 3W9BA 3KSBC 4XLZA 4Z1MD 1RPJA 4QQRA 5DMHA 2LV8A 1KDRA 1NNUA 1P2UA 2HMSA 3NH6A 1H2HA 4KQHA 3G13A 4M9XA 4CLRB 4CEIB 2UYYA 1KP9A 2ERXA 3RFUA 5AUQA 3EASA 4RGQA 1PG0A 1NYTA 2X3UA 1DXQA 1BXRB 1NIJA 4C6TB 1PGJA 1RKQA 5LP1A 1TYAE 5DI3B 5G41A 3JWHA 3NG1A 2XGJA 4BP8A 2FVXA 1EM6A 1XFAA 1DJOA 2EFGA 5L53A 3E22B 1FS4A 1UBLS 5EUQB 4NIMA 2RB4A 4YO8A 2OCPA 3QMWA 3JU3A 3ND9A 2X86A 5F3DA 3U61B 5E2IA 3IL2A 2XBLA 4JB3A 1YIAA 1VL6A 3LGXA 1MVNA 4I4TB 4F5WA 4N6GA 3AFGA 3PJGA 3NVAA 5I9BA 2I03A 4C89A 5BVGA 4ZANA 4R3NA 5K5EA 1W1WA 3CW2A 4IO1A 1HDCA 2IYYA 4YCDA 1P6XA 1KOFA 3GIWA 4FOTA 5AWFC 5JSKA 4EPVA 2L18A 1NAIA 2AOXA 2HN9A 3ILVA 4QU5A 3HCBA 2A86A 2O2EA 1DC5A 4UM5A 1FDSA 3A28A 1KORA 2WZQA 5F33A 4JWKA 4EG4A 2W8ZA 5A4FS 2ZT8A 1ESCA 3IRVA 3V3KA 2GNPA 3NWJA 4H16A 5I8ZA 4BLRA 3TUZC 1Q2UA 1C30B 1XZIA 1QQ5A 3H9QA 1Y37A 4KO4S 1RQRA 1JJVA 1TLFA 1HI9A 4B48A 3WGIA 5FNVB 3ILXA 1WU8A 4A0SA 4XWKA 3T35A 1BYUA 4BYMA 4ZC8A 5EXEA 3FPBA 4INOA 1H93A 3LGSA 3CUWA 1KAQA 5C1IA 4KXNA 3SBDA 5A7GA 1HLGA 4QUDA 5F5LA 2HQSA 5AK0A 5CP8A 1QYWA 3NI2A 1O6BA 1QC5A 3KWJA 2GUWA 3TFWA 4AM8A 4UU7A 4D5EA 3KVRA 5F7XA 3A6EA 1QBGA 3CRVA 4DHWA 2GUGA 1OXTA 1LRJA 3JALA 1GZ6A 4EOGA 2BFFB 1WVIA 2EX0A 4XLTA 3NX4A 1ETUA 4FNOA 2F17A 4A8TA 2Q5EA 3CUEF 3QEJA 4CN9A 5L3VA 2EZUA 1BHJA 2M1XA 3NHWA 4LVCA 3D8HA 2PNFA 1M73E 2ODAA 1U11A 2FH5B 3MAJA 5CFZA 1I6WA 3Q2OA 4WNYA 4EG1A 5IJZA 1C9KA 3VPBA 3E3MA 1DQZA 4UNNA 3U16A 1Z13A 4ZVKA 2JJ2A 2OE2A 3GNQA 3G5LA 3A6KA 1AUQA 1OVGA 4MUMA 2RC6A 4DDTA 2J7KA 4DMGA 1KFCB 1NRIA 1T8PA 3DZIA 4IIVA 5DIZA 1DGQA 1SU8A 4ZZIA 1JPNA 4YLYA 3GLFE 3CTMA 3DULA 4LHZA 1YS7A 1PL7A 2BDUA 5J4HA 3CVWA 5MN6A 3HXOA 3O1LA 5CFPA 2GBLC 1TE2A 4RABA 3HGMA 2IEYA 4BNZA 3MTGA 4OFBA 4Z1MA 5IDYA 1RT9A 4F5EA 1NBME 2AW3A 3BXHA 1QIFA 2J0UB 2OPBA 2X76A 3GDGA 3R0IA 5BOSB 4B35A 4DQDA 4HUTA 5DNEA 1H65A 1YB1A 2OFOA 3GGPA 5EE3A 4YDHB 10MHA 2AA3A 2H16A 1A69A 1DBPA 1UWLA 3TQFA 3ZOZA 1EGMB 3FTPA 1LDNA 1VA4A 2IYQA 3FOBA 4NE7A 1USWA 1TAHA 1V8FA 3W05A 2QV0A 4PX3A 3MCZA 5LFAA 1YZFA 1EUCA 2O3SA 4DLSA 1XWWA 3MMZA 3A1TA 1A04A 5U4XA 3A2MA 3S70A 2H00A 4JVNA 4WZAB 4OQYA 1R64A 2XWJI 3GLGA 4PY2A 1Z39A 4MVXA 4WT7A 4N1AA 4E7OA 3IJEB 1JQJC 3QTLA 1JHDA 3EDMA 2I1LA 4UMFA 1I4WA 2GHQA 1FTQA 1JHPA 2HLHA 1CUXA 2VP2A 2R6FA 3BSFA 4WZBE 4U00A 3LUCA 3VNAA 3CCCA 4IXMA 3JY6A 3WWDA 5BSUA 3BL5A 3FA2A 4O2RA 5LNK1 1G9TA 3SF0A 1JAHA 4AJ2A 3O1IC 2IEAA 1YU6A 4HDRB 3QX9A 3PEWA 4Q9JA 3I5XA 5AI8A 3K31A 5TQ2A 4J4BA 2CFOA 2H65A 2P2LA 5ECWA 5E4JA 4JCCA 1Z17A 1UJMA 3H18A 4KH0A 2C7QA 3GCDA 1VMIA 3HJUA 5K51A 4LY6A 1X8JA 1ECJA 3QXSA 2HD4A 1UC8A 1EVYA 3C1TA 1IY1A 4NZYA 4WXEA 3U4GA 3CBQA 1A1SA 2XF2A 3OLZA 5IH7A 4HRYA 1NP3A 4OQEA 3HR4A 2D54A 1RWBA 3I2IA 1NNSA 4LKOA 2B5VA 3M49A 3B38A 1ZJZA 2ZZKA 2O4UX 1IYZA 4XIYA 4QVIA 3SJUA 4CM9D 3R6DA 1YQUA 1VTKA 2EIHA 3H9JA 3OOEA 4RKWA 1JQDA 1XMJA 1YUBA 3BGSA 2V4MA 2GI4A 3ZC3A 3JQPA 1P2BA 4LVOA 2IUUA 5GGYA 5IC4A 3AFIA 2H3EA 4FCTA 4MVJD 3GCZA 3UCXA 4ASUD 2NQTA 3MLAA 5K0ZA 3TOVA 1NQUA 3A6LA 3FYTA 1M6YA 5E7JA 3VYVA 3FDJA 4TZ6A 4F6CA 2VDNB 4HLDA 3KKQA 3PQ2A 4MWGA 3R40A 5H1YA 1FVFA 3B6JA 3EA4A 1GLNA 1SURA 2DP4E 3I9NA 2BCEA 3WG9A 7REQB 3ZD6A 3AK4A 1MHPA 3GMDA 2Y92A 3R3JA 2Z8XA 2DBQA 1N3YA 1KI2A 3TZQA 5H8WA 1XVIA 4OHRA 5KNDA 3RV4A 3U48A 4L5AA 2YJZA 4MGYR 1G66A 4W99A 3Q6NA 4RQAA 5CLIA 2JEOA 2ZBRA 3NOVA 4NZMA 3GH3A 1KMHB 3ESCA 1PJ8A 3CXRA 3ESYA 3NIGB 5EJIA 4EUNA 3KYCA 1FLDA 1H9AA 4ENVA 4JY7A 4EARA 2HJ9A 2WVJA 3L79A 3ELBA 4AN1A 1ZR4A 5JBQA 2QYOA 4GP6A 1V47A 5EMMA 1HE5A 3DA8A 4KGDA 5HPYB 4JI7B 1XTRA 4DLNA 4A2CA 1WV1A 3EPRA 4AKEA 3K1ZA 1IY9A 3L40A 3U80A 3UT5A 5L9AA 3SNHA 2ZVJA 3HEMA 1OC2A 1VHDA 5WRFA 2A94A 2O50A 4ZZ1A 2V7QD 2WG2A 4FW9A 3G2IA 2J0QA 3UK0A 1GKYA 1CIVA 4GI2A 4ZYVA 2PCJA 3DCNA 2EGGA 4HDSA 4P3KA 4N18A 1MX9A 2VSXA 2IWHA 5KAMA 3ENQA 3KQOA 1PL6A 3Q8XB 3R7SA 4NJOA 1TKRA 4BNUA 2O2IA 5MGNA 1TMKA 1RXCA 3DUFA 5A03A 1KBZA 3EWAA 4YAEA 3DLTA 1E7QA 4NCXA 2JHAA 3B1KA 4JITA 3RFCA 4AKSA 1U7HA 3DNPA 4WCFA 4F60A 1I3KA 3A1EA 4LCJA 1YAHA 2Z3ZA 4L0MA 4LOJA 3WWYA 2XT0A 2A33A 1RWPA 3LYUA 2QM0A 3DBVO 3LAWA 1MO3A 2C61A 2YIMA 3O84A 5CTJA 3G5AA 3VYRB 4CTNA 4ZKDA 1JR3E 3O8OB 5KIAA 1VB3A 1SEPA 1V71A 4OUDA 1CRWG 5FAXA 3LQRA 1X15A 2ZULA 4NHEA 4BFCA 5KX5B 3HJGA 2X8WA 1VBMA 2YVLA 4ES6A 2QUKA 2DLDA 3MUFA 4PZDA 4TRMA 4PYRA 4G24A 4ZT7A 3WO1A 2CUNA 4MDHA 2AK3A 3EVZA 3VKHA 5B36A 5ALWA 4R9SA 5I5GA 5JAZA 1KMQA 4Q1BA 5AQ1A 1JLRA 1FP7A 2CNLA 4L4YA 3UPTA 3RC1A 4LNUB 3ENZA 3UWPA 4H35A 1HT3A 2PMWB 3VV3A 3C6MA 4U8GA 1JX6A 5DNWA 3QPAA 1SHKA 3BIJA 3IEUA 4N54A 2NU6A 5MDHA 4I2VA 1FZTA 1UEJA 2QMZA 4A8PA 5F3RA 3WB1A 2G28A 4LWZA 4HSGA 4PO1A 4BEWA 4F0JA 2AMFA 4MVJA 3EUFA 1A5ZA 4QYWA 1LB1B 1WZEA 4QUKA 3B52X 2C96A 3ZXXA 2ZBPA 3PX3A 4C2BA 4MEBA 4DR4B 4TZ0A 1N0IA 3K8QA 2HJRA 5EIWA 5KOHA 2IZOA 2Q5IA 4X7PA 4A27A 4QDZA 3BHIA 3WMXA 4AS1A 4B8YA 2WJPA 3G9TA 3KRTA 4IRXA 2OUKA 1WUJS 4MINA 4RJIA 2ZGVA 4LJAA 3B5IA 4NBNA 5DXAA 3QPUA 1YTLA 5C4MA 4UVEA 1WBDA 1PT6A 3KX2A 1GPLA 3QH4A 3NTUA 4W5NA 3CF4A 2B4YA 2I34A 1NBIA 3H2YA 3PFGA 1QS0A 4YDSA 5EIBC 1KIMA 1RQ7A 1RD4A 4YO7A 3ZNPA 1WCIB 3HCCA 3C3KA 3LPNA 3B78A 3HJBA 4OYLA 4PM4A 3Q0TA 3ZWYA 5L3SB 1Q95A 4YRFA 5EQFA 3AF6A 5JQGF 1E4YA 1Z4OA 3CLVA 4EDHA 4QARA 3C39A 3PNYA 3ZWKA 3IESA 5DOVA 1QCZA 1NW7A 3I9OA 3LT2A 3QEKA 5HKOA 2P41A 3P5BA 1F2UA 4OP2A 3RVJA 1SUIA 3JQGB 5SZHB 2IS1A 3BK1A 3DPSA 3GAAA 4IKPA 4JQOA 2V7QA 4RF4A 1IOVA 5KVAA 1RMYA 1XZMA 3SX4A 5KUTA 3NC0C 2JL1A 3S7TA 4QICA 5HQ3B 5CK4A 1HE1C 2GAOA 3P52A 3AIKA 4KNVA 4LYFA 5JJBA 4UHFA 2UUAB 4E5YA 2UUBB 2KMLA 2JKYA 2Q41A 4K81B 1DELA 4MRMA 5JS2A 4EFKA 1HDZA 3F98A 2IEGA 3O94A 4JBXA 4KQ9A 2BEVA 3NXKA 1WZUA 2IBMA 3V8PA 1MO6A 2VKTA 3PKJA 3QSGA 1F2TB 4G1VA 4K9QA 2W0SA 5F1YA 5FLYA 1FXSA 2WG1A 3HP7A 5AP9A 4W5JA 3SHVA 2JFUA 4BNYA 1X39A 3C1OA 3TTVA 1CEEA 2CJWB 5ITSA 1G8FA 2M32A 4BNVA 3R3HA 4N82A 4PTLA 5H9WA 1YBMA 1BS9A 1KK2A 2QAJA 3ELYA 1RZ3A 2IUSA 4HFRA 1U4OA 3VAAA 1WB4A 1WXHA 2GD0A 2OC9A 3MWFA 4KX3A 2BD0A 4EJ2A 2CVFA 1VFNA 4J0QA 2Z1NA 4D9HA 3O3OB 2DUJA 1Z45A 3W8DA 1MOPA 4HBGA 1RLMA 3E7FA 3IV9A 5T8KC 3P27A 5E9JA 3KDAA 3WGUA 3TZLA 1N9ZA 2ET6A 2YZGA 1FSSA 4G07A 4E15A 1J97A 1SHZA 5M7EA 2BCGY 4WASA 3NDPA 3B3AA 2HK8A 3DMRA 3VO9A 2X1HA 3IAS1 5KC9A 4JXZA 1B0PA 3TINA 3J7TA 5LM3A 4B4WA 2GARA 4D3DA 1EVQA 3DD5A 4RD3A 3H1TA 2YUIA 3S28A 3G7UA 3T12A 3N70A 1XA0A 4CMEA 4R2JA 4X1IA 2MSEB 4HGPA 4EYEA 5K3BA 3MWDB 5CUQA 2A3RA 3I5UA 3KD3A 5DGCA 4NV0A 3IPRA 4QBTA 1TT5B 2X9NA 1YC5A 2XYHA 4PXYA 4ZI7B 1S4QA 4GOMD 2C9ZA 1BHQ1 1IUPA 2NZVG 4PLGA 1ZGGA 4L9SA 5CJPA 4LJ9A 4AJLA 5L4SA 1B0AA 2O8CB 1ML3A 4QNMA 3FHJA 3F8SA 2YS6A 4M21A 4REQB 4A8JC 3IBFA 1Y3AA 1ZJJA 3GD7A 1LV7A 3AOGA 2PUTA 2V5AA 3MCUA 4OM8A 1Z2DA 3T9FA 2FOLA 4Q9KA 4BXOA 1TF2A 1ZA2A 1ZOOA 2ZPUA 3ROTA 4YYEA 2AJBA 6GPBA 9LDBA 4NEQA 5KOJB 2EFEB 4XWAA 1GG2A 5ALZA 1IBCA 1NE7A 4L73A 1XJQA 2B7CA 1GVNB 3DR5A 4G1UC 5D51S 3KFVA 3IMKA 1DC3A 5CBKA 1WB9A 3KL2A 3GJYA 1QNFA 2Y76A 2ZR7A 4P7KA 4CVNA 1H66A 3ZS8A 1BX1A 3GZJA 4MUFA 3SM9A 4B73A 2Z5VA 1QHIA 1TF7A 1ZK1A 3DR3A 3GJ6A 3BICA 4FFRA 4MR7B 4OU4A 2OCXA 2FPMA 5DF1A 4AKHA 5CT9A 4LWOA 3E3OA 4UQPA 2A1UA 3I2JA 3MMNA 5JNSA 1QJ4A 5CA0B 1PFYA 4NESA 3SXJA 1DX6A 2QW8A 1W2WB 4HS9A 3AJ8A 4M1YA 4XJTA 5J2TB 1UC4B 2Q50A 3ADBA 1WB5A 1FSFA 1AOXA 4IHKA 1I0ZA 3IVCA 4D0LB 1BDJA 5LUBA 3LH5A 4UHKA 1T6XA 3WGNA 4C6RA 5I7WA 1U5BB 2H2DA 1EJBA 4RKFA 3UCFA 5JSUA 3LBHA 4R2WA 3CPSA 3HE3A 3K09C 1QE3A 4IO0A 2WF8A 4EL0A 1Z08A 2DHEA 2I2CA 1FBNA 4IW3B 3ZGXA 4EEXA 3ZGZA 5LL6P 3T7RA 1RJ9B 2XTAA 4ALLA 5L6LB 4UUMA 3JSXA 2P2GA 4FT2A 1YDGA 2CMDA 3FBGA 2PMDA 3DE1X 3V4OA 4EB3A 1S02A 2XGGA 3WGTA 1CY7A 4M99A 2AE2A 4AQ7A 2AQHA 1E9EA 5AICA 2PZAA 4RJLA 2E4WA 2WTBA 5CAEA 1SMKA 4KNWA 1QP8A 2I8AA 4OAQA 1MFPA 4HX5A 1KFEB 4P34A 2OGTA 3KXKA 4MUBA 4NBLA 5CB4F 4F84A 3WGMA 2AG0A 4FVTA 3DJFA 3WZMA 1XRJA 1CUUA 4G84A 4RHYA 1E2FA 5FI0B 1NVTA 4R2IA 3W0LB 4PNPA 1D03A 2OZKA 1TT7A 4H1UA 1D4AA 2V6IA 5E2AA 4WJZA 5ITZB 4WLFA 1UWKA 1JSRA 3BXPA 3LPLA 4UCFA 2OD2A 3WYDA 2Q9CA 3B1YA 4IIYA 3OEHD 2PRZA 4EFDA 1VP9A 5ADUS 1U28C 4WN3A 1DZ3A 1I3LA 3JATA 1LDMA 1QZTA 2C2HA 1TCCA 3OZXA 3BORA 5EY5B 1J8FA 2QW0X 4WNIA 3IERA 1XMOB 5EHGA 3LNCA 1Y8RB 3G2QA 1XLTA 1LSSA 3ET4A 4XASA 3HSSA 2HPHA 1E6EA 3ICWA 3O91A 4B3MB 2V6MA 2QJFA 2QVZX 2NZWA 1BOFA 4UOZA 4LHSA 4YRGA 4RY2A 2JLUA 1QP0A 1E7SA 4W63A 5B7NA 1QDEA 2A0UA 3H1GA 5B5SA 2ISCA 3T8YA 4MR9B 4QFCA 5F52A 4IIFA 4E46A 2FWRA 2O8EB 4JZYA 1PT5A 3RYIB 3UH0A 2PVCA 1G5TA 3H0EA 3N2YA 4GZ3A 3H8WA 4NFLA 3G82C 2MYUA 5ERGB 2B6NA 4POAA 3RIHA 3U3DA 2ISQA 3PP8A 4L9RA 3IVXA 4CMAA 1E2HA 1K08A 1LU9A 1TVCA 1REQB 2NYVA 2NZJA 1DB3A 2ZTUA 5EQDA 1AD2A 2B1IA 2QAGC 1Y1RA 2J3JA 2ZU6A 1V35A 1M34A 3GRPA 1X0VA 5JEDA 4D3YA 3T9EA 2NPFA 1KGSA 4GR4A 1E60A 3H05A 4DE5A 3MTEA 3KQPA 4YJGA 1A7KA 1LDYA 1KS9A 1RAFA 1J1ZA 4XAQA 3FCCA 1E3TA 4HPXB 4KVFA 5A3QA 1GN8A 2B94A 2VK8A 2XE4A 4A2WA 4BPBA 1A82A 1DSSG 1L7VC 1X8XA 2AI3A 2JF0A 2XVZA 3BXGA 1QO7A 4BQRA 3L6OO 2VUUA 1O6CA 5AFSA 3U09A 1KE1A 3L1KA 4LZAA 1DE0A 1W7AA 3OIFA 1WXDA 1KVUA 3P9IA 4O0LA 1F4LA 1XCPA 3K2QA 2WAAA 2IIQA 4RESA 2J0VA 3VU8A 4JYAB 5A4AA 3UWMA 2I4LA 3HPQA 2PM8A 2G0TA 3H1AA 4CKCB 3W4JA 4G25A 4NMHA 1Q1AA 2YDYA 1FFWA 3Q7IA 1YRHA 1ZSNA 5TMPA 1XN1A 1JDVA 2EGUA 3MRSA 4ETMA 1P1KA 3AG6A 3PXBA 1UADA 1XTBA 3LX8A 2VF2A 5HILA 3CZ9A 3OQOA 1P2VA 5JZSA 1Y8QB 1V37A 5JS7A 4L0CA 1NVXQ 1U1IA 3IBYA 1GY8A 1NVVQ 4JBLA 1QAOA 4OH1A 1E1MA 1B73A 3BERA 3ZGOA 4BEVA 3FUVA 4BFXA 5T7BA 3QM1A 4M1EA 4DM4A 3T6KA 5AOAA 4BY9E 2SNIE 5JVDB 3WGHA 1XXLA 1RW4A 1YJ8A 2BF4A 3DMTC 3VO1A 2BOVA 4DLRA 3E35A 3LXXA 2C7GA 5JDCC 2VSQA 4MYHA 3TUJC 1QU2A 2FX2A 2IUYA 2V3WA 3GWZA 4MLDA 4CKBA 2WM3A 3JZDA 4W9NA 1NJ1A 4D43A 2FZ4A 2MSCB 4FZJA 3CA8A 5FA6A 1N2EA 5A5EA 2R7MA 3KR0A 2C2XA 4LRTB 5KO2A 1RXVA 4N41A 1XV5A 3GT7A 3LF2A 3V7YA 3ZHRA 4CIAA 1FLAA 2CCGA 3ZY5A 2IEZA 3ZLUA 1RZRD 1QPGA 3PFNA 4CL3A 2ZB8A 5BVHA 4KP7A 2LBPA 2X4IA 1PYOA 4GLBA 4FK8A 2DR3A 3SC3A 2BFCA 2I2WA 4AK9A 3BTSA 3TD6A 3HKDA 1FX1A 1Z2AA 2AFHE 4ZVPA 3TS1A 4FYVA 1N6LA 1TAGA 5ARDA 4TMTA 4RELA 3A27A 4Y2UA 3K0AB 4ZVNA 2ANBA 4F7DA 2QDXA 1OLSB 5JPCA 3NBMA 4F71A 3MD0A 4FNMA 4YPOA 5CDFE 1QB8A 1NW8A 2ATIA 2BZSA 3G5MA 3MGGA 5B2EA 3UJ8A 2PWBA 4E2FA 4FGJA 4ZU6X 1A76A 5COBA 2CWDA 4ZO6A 5EGNA 1GHTA 2WICA 2QLMA 2GLUA 3W5DA 2Q9BA 3PNLA 3WFZA 2CW5A 2XPCA 3CLRC 1Z7EA 2VI5A 4BUJA 4ZTUB 1OH7A 2QJTA 2ADOA 3B2NA 1L4UA 1AG9A 1NFQA 2H7VA 2YRXA 3A4MA 4PFJA 4TQGA 5LUAA 1Z4MA 2HZBA 1QZ3A 4DY4A 2OBNA 1NVKA 1QKJA 4BE9A 2EATA 3TZBA 4DIFA 4GS5A 2ZVQX 3LKZA 4MIYA 5LZ2A 1KH3A 3SAJA 2VZLA 2WJAA 1BW9B 3D5EA 4L5IA 4Y6GB 2CVPA 2EEPA 3JZAA 3O3CA 3QV2A 4QA9A 5JQGA 5DM1A 5K0GA 3IE1A 1CU1A 4CG2A 1QBKC 4PZZA 3WFIA 2ECPA 1Q3KA 1LBSA 3UF0A 1GPUA 1XELA 2X15A 1GR1A 3QI2A 1Z38A 2BMVA 2D7CA 2P9HA 4INAA 4MKZA 2M6KA 3A6PC 2RHBA 1PNTA 2V54A 4IF4A 1J8DA 1L5LA 4QEZA 5HKKD 1U7OA 3D31A 2HGSA 4U8HA 3ZZ0A 3UEOA 2X9GA 3U3MA 1ISHA 3UMCA 4QT4A 2FN3A 2HUNA 3D43A 2W2VA 5BV0A 1PK7A 1UXJA 1EK0A 1X9IA 1RJWA 4GECA 1KRHA 1L5WA 5AXCA 2F1JA 4WEOA 1DRJA 1SVLA 5ALMA 1E94E 1G8SA 5BXYA 4DR3B 3BAZA 2ZI5A 4BMDA 3O21A 3M4ZA 4QWWA 4BV2A 1G8KA 3GCWA 5J1SB 2VL7A 2HEIA 4IRMA 1NR1A 2XWSA 1GL6A 4DWVA 3B12A 2QX9A 5HWSA 3I4FA 5ARBA 3C3PA 3H6KA 5JARA 4L6AA 4X8LA 4WBSA 1E2PA 1GA4A 3UOWA 5C8YF 2XWPA 3OZVA 1IVNA 3KLPX 1T26A 3N7AA 2O5VA 4R1LA 2ILVA 2FFRA 3IIEA 2BC9A 1HF3A 1DKOA 1Q7CA 1PYGA 1U3DA 3DFIA 2Q7XA 4WSOA 5FTJA 2ZI9A 3VSAA 3KR9A 4DT1B 3VNQA 3I9MA 1UKVY 1DIRA 3INTA 5I6DA 5K8UA 2OCAA 2VTVA 3IXLA 3IUQA 1T4CB 2Q4BA 2Q3BA 3D7NA 2QU8A 1MC1A 3GRYA 3I12A 4HAXA 4UDXX 4XCXA 2BFEA 3VOAA 3OZRA 1T2VA 2FEWB 2XVYA 4OQPA 4HQOA 1RM4A 4UUNA 4ZT2A 4DUYB 1CJKC 1K7XB 1RZRA 1L7OA 3WLHA 2ZTHA 4YMGA 3MJTA 4O4JB 1VCNA 1CZRA 2FMUA 2WWVD 3V9PA 1ESMA 3DXZA 3GFGA 3H1FA 2F3UA 1XZCA 3JV7A 2JHGA 3V7UA 3WBFA 1T6YA 4K7JA 1WQ4A 1YBHA 4WFQA 5H16A 3TOXA 4D4JA 2D2IA 3TBKA 4Q5IA 4P3PA 3D6HA 1WOYA 1YVEI 1YQQA 4M7PA 1Q77A 4A1FA 5F76A 4JU9A 3ZE9A 3W9SA 1TYBE 4FMCB 1Q1QA 4MGIR 4A16A 4H59A 1NURA 2WT4A 1E4VA 2UZ3A 5TPZD 1NKVA 3M4NA 3G1UA 3PFKA 4IJVA 5AJTA 2ZRIA 4I0WB 5I7FA 1TM3E 1NVAA 4FPXA 1FNCA 5JHGB 1M8KA 3L7DA 2R0QC 2PEYA 1YI8A 2C99A 4C3UA 4GKAA 4MYRA 4C0SA 1CEYA 3GP5A 421PA 5EIOA 3PHJA 3ESQA 2JGJA 2ZB2A 4OBEA 3DO8A 1ZOLA 3GN2A 5DGXA 4RZQA 1SHJA 1ENZA 1WDTA 1EDZA 3NPMA 5FJIA 1FZQA 3IBTA 3JQFC 1YQDA 5SY9A 3UT0A 1YO6A 1CJUC 3QX8A 4QYIA 4L8GA 4Q02A 3EBOA 3GJ5A 4YV2A 1M1ZA 3VBCA 3L84A 3TRHA 2QQ5A 3EDQA 5HXAA 2Q5OA 2JFPA 3TBFA 2PWPA 5KOHB 2ZU0C 3L8MA 4UATA 3DKVA 3NYQA 4I5IA 4MH0R 1G6OA 2AI2A 2VHVA 4ZVOA 3ZBQA 1WEHA 2Q1UA 1SZCA 1O6GA 3N7UA 4H7IA 3IEIA 3NDBB 1F8XA 3AEZA 3GDOA 2ZRNA 2O2DA 1W5EA 4OA8A 4X54A 3LFHA 1DARA 3FUWA 1P7CA 5AVVA 1JJIA 4G36A 2X7XA 1WXFA 1SUDA 4HD8A 5HBRA 4AUNA 3LUFA 4CCSA 1SKMA 4UE2A 4R1UA 5AVJA 3T5BA 3VOTA 4A0FA 4ZK6A 1YRWA 4M0KA 3RNLA 2BF7A 2QT0A 2Y2UA 5I9MA 3W5CA 2FA9A 3CY6A 4ACAA 4QPNA 3ZIDA 1Q7BA 1WXQA 2J59A 1OKKD 2L69A 2ZTLA 5CYFA 5B3JC 2A4KA 2Q0QA 4Y67A 3VR3D 1EEXB 1ZBDA 2EWVA 2RGUA 1DC8A 3KTAA 1RAIA 4MR8A 2VBCA 3HCFA 4P53A 3UKJA 3RADC 5CD9A 2H54A 1K7FB 3HWWA 1ZGAA 2WF7A 3RSOA 3WLEA 5DM70 1I9GA 4G9GA 1Z8DA 2WVAA 1NL3A 2V4UA 4XFJA 4I8DA 4FWBA 4G4IA 3BL6A 3E9EA 3LQ2A 1AO0A 2QBYA 1EJ6A 3AUTA 5FA8A 4EO9A 2NTJA 2HHAA 4QOJA 1MC4A 1OBHA 4NVRA 2FJUA 1BU8A 3BH0A 1P77A 4FGKA 4O08A 5CB4A 1M0SA 1Z5OA 1ZRMA 2ZBQA 3EGIA 2NGRA 4PC7A 4GSLA 5ICCA 1QC5B 3VDQA 3QVJA 4QDUA 3G85A 3CMCO 1PT8A 1RRVA 1H23A 2H18A 2BM1A 2QZ9A 2XUIA 3QLTA 4A0GA 4BMSA 3U7GA 1BX3A 1JTVA 1PZHA 1XSEA 2IPAB 4RS3A 3TGWA 3L06A 3C5WP 1GL7A 3GQBB 3M6AA 1FQJA 3KOMA 4Q66C 4YRRA 3OX2A 2J0EA 1NC1A 1T0UA 2C59A 1JKXA 2VAPA 1VSUA 3PUZA 1BZYA 3MELA 2O8FA 5F7ZA 2YFKA 2HSDA 3B60A 3RC3A 5F78A 2MR5A 4ENRA 3SSNA 1OAKA 3D59A 5ILOA 1A4UA 1RHJA 4TX1A 2EFCB 4DIKA 3E48A 4A36A 2R2AA 2WU0A 2AE1A 3NP9A 3R8FA 5CM8B 3RS8A 1SM4A 1XL1A 2Q4RA 5FBHA 3IVAA 1EZ4A 1MN6A 1FX0B 3I05A 5TPZA 2VHYA 1DIGA 2FMFA 4BNJA 1ZK2A 3HADA 4WBNA 3DG9A 4KPUA 4PSDA 3TGPA 5B1HA 2NO0A 4ND2A 3Q2KA 3WWZA 2FRXA 1D6MA 2ONCA 2BM9A 3WKEA 1L5HA 3S2FA 1YHYA 1D9XA 2XCQA 4HY3A 1IQPA 1XN4A 2GMWA 5H5JA 4F11A 1JE1A 2V5VA 3G9QA 5IUKC 4F1KA 5CT6A 4HAUA 1QF9A 2VJBA 2VYCA 2EJBA 4LWPA 1OYOA 1U9YA 4NJMA 5E7QA 4XA8A 2FPLA 2FKNA 4OXIA 1JB9A 3DL0A 1JEYA 1A7UA 4G0UA 3M6UA 1CR1A 2AN4A 5JCPA 4E88A 1UM9A 2EFYA 1DJNA 2J7PD 4S2EA 4AB1A 3AHHA 5B6PA 3KJXA 4DR6B 3C4JA 1EXNA 3AM1A 4OV6B 3BCHA 2QTGA 3E8SA 1U1CA 1X7YB 4LQ4A 3INGA 4WXHA 3SS7X 4Y2SA 5DK4A 1WUYA 5B1DA 4RTKA 2A3NA 4JR1A 1T1GA 4O8ZA 2PGLA 1NF9A 1HRDA 5JMPA 5K0EA 1PJCA 5KSPA 1EUCB 3CH7A 3OURA 1CR6A 5K6TA 2NSYA 3R24A 4HQKA 4AY6A 4FEYA 2PKCA 4XQGA 5CLGA 1PZGA 3KYJB 3AO0B 4CU2A 3W7BA 4ZJUA 3EIUA 1K66A 1DXOA 4PZCA 3DAFA 3NDJA 3L7OA 2QXUA 2R96A 1B14A 3L6CA 4XEUA 5DSTA 5KAPA 5TS3A 3VMFA 2FI1A 3TL3A 3PPWA 1NSFA 4JBHA 4DCOA 4DLTA 1IN5A 1C3OB 1M33A 1YKGA 4ZD6A 1PG5A 3TKYA 2HDWA 1OKKA 2WU3A 4N48A 1T6BY 4W7HA 3VR3A 2PLWA 1I4OA 3WNVA 4DGSA 2PT9A 2DULA 1TL7C 2C88A 3KPJA 2CL7X 4GI7A 1P17A 2G5GX 1ZSVA 2UKDA 2ZSIA 3CZQA 1XZKA 2BFNA 3PE4A 4ROSA 2R8RA 4KBGA 5ALXA 1U6KA 4S1OA 4PPQA 4CDMA 1FMLA 2V98A 2P5YA 3H9GA 4MRAA 5TQ2B 3D3JA 1CDOA 2IPXA 3A3NA 1GPBA 4GHWA 4CG0A 3QMMA 3R8CA 3Q6IA 4YRZA 4H1VA 2D0IA 1D5CA 2NO1A 4LPKA 1JDPA 1NDUA 3ROEA 1J00A 4GXNA 2OENG 5MN5A 3PC7A 5DYNA 1OFIA