4AKEA

Adenylate kinase
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
214
structure length
214
Chain Sequence
MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Phosphotransferase
molecule keywords ADENYLATE KINASE
publication title Adenylate kinase motions during catalysis: an energetic counterweight balancing substrate binding.
pubmed doi rcsb
source organism Escherichia coli
total genus 69
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 1995-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4akeA00
4NCHA 3U7GA 2NZ8A 3SZRA 4ESVA 4M4SA 3SU8A 2GJKA 2HXYA 2P0EA 1P3JA 1W49A 3TSOA 1CKEA 4FCVA 4MYTA 1J7KA 4PPQA 4CVNA 4DXAA 5IK2D 2W0SA 4OQNA 3K9HA 3RANA 1M6NA 2PMDA 3BFXA 1PZNA 2IUSA 4LV8B 4B48A 4M9ZA 2J41A 1Z29A 2DB3A 3QQ5A 3W6PA 1NMZA 3QXCA 3CNOA 1A1VA 1CJVC 1ZC4A 1XX6A 4GSYA 3OFND 1L4UA 1G291 1Z6AA 2WVJA 3UPUA 3OE7D 4C7OA 3BOSA 4DBLC 1UBGA 2QUZA 4P31A 3K09C 1TUEA 3B85A 3IBYA 2W6ID 1GAJA 1G1MA 2GAOA 2GA8A 4O2LA 2CL6X 2Z43A 2GESA 5DGXA 2NO1A 2OILA 3V00A 4DCTA 3AF2A 3KQUA 2XITA 1W47A 3FOZA 1E0JA 2VBCA 3THWA 5B58C 1P4SA 1DPFA 2G77B 4LBYA 5E95A 1JAIA 3OIVA 2ZQ5A 2AD1A 4MRRA 2ZROA 1IM2A 4PAQA 1VYUA 3QVUA 4V0OA 1KJYA 3VR3A 4TYWA 3EASA 1S4QA 1R0XA 3RSLA 5KYKA 3RRNA 3GLFA 3AKEA 1KHTA 4CT4B 4MA4A 2DHRA 5F98A 5KDDA 4P33A 2HCBA 3K53A 4M2LA 4KFUA 4JS0A 2OCAA 2WIBA 5EE5B 5LD2C 1WBBA 4IKEA 4UNRA 2O8CA 2RCNA 2Z5FA 1SXJA 2H7VA 1R0YA 3NEYA 3HWSA 4I99A 1N2CE 2KBFA 2GJAA 3SEAA 4LOAA 2JJ8A 2ZRFA 1GKYA 1NJFA 1NLZA 2F7SA 1G3RA 3C5CA 2ZI9A 1ELOA 221PA 2YVUA 3ZGXA 2W2TA 1G64A 1ZVQA 2OO7A 4ZDWA 3IGFA 1P60A 3OHMA 1RRFA 1GWNA 2OESA 5EE3A 2VF7A 3QKTA 1PVOA 2ZSEA 3U6BA 2PBRA 4HB2A 1TQ4A 2XNSA 2OHFA 1VCMA 2WKQA 1KI6A 1NIPA 5UKDA 3A1SA 2GBLC 2GHIA 2GWHA 3RS7A 2OE2A 2YZ2A 4IDOA 2IUUA 1UM8A 3F3YA 5FTMA 4A2PA 2BM0A 3VX3A 2WWYA 5BQ5A 5HCNA 1KI4A 3QOFA 4QJ4A 2W2VA 1DO0A 1DAHA 4JLAA 1MH1A 2F43A 3WHKA 2IEYA 1GNQA 2X77A 5IK2A 3I62A 1NG1A 1HQYE 4PHHA 1P9WA 4FMDF 5JMTA 2ZRDA 1S3SA 1XP8A 3K0EA 3OFNA 1E2LA 4KO8A 2BIFA 4UNQA 2WBLC 3OE7A 1II0A 4GBMA 2UZIR 3B1WA 5H70A 3IDQA 1E2EA 2RMKA 4C0HA 2CVHA 1VPLA 2CLCX 2VRWA 2W6IA 2G9NA 3A1VA 3K0CA 1TADA 3T5DA 1EFHA 1BS1A 4KCGA 4TMXA 2IK8A 3FE2A 5KSZA 4LI0A 4PQFA 2Z4RA 3A37A 3LQQA 3GLGE 2AKYA 4NYJR 4XTCS 1Y3AA 4IOLA 1XTKA 3B1ZA 5HZKA 2QORA 2AK2A 1W4CA 3GP8A 1IY1A 4Q4AB 1W36D 5B64A 5KDOA 1K5GA 4NU0A 1Z6YA 1ZUHA 2IXEA 4BQSA 3VFDA 3JZAA 1NLFA 3AF3A 2IYQA 1TQDA 3GQBA 3T12A 2G0NA 3FWYA 3SQXA 1E2KA 4A0HA 5DI3B 3MFYA 3PIRA 4Q47A 5G41A 4NCIA 2FPKA 3K0AB 2JIZD 3B9QA 4WIAA 3QSYA 5AUQA 4ZDJA 2G83A 1AQUA 1YZNA 1XJCA 3IQXA 4M9QA 1X1SA 4F92B 2REXB 4LX0A 4OK5A 2BMDA 2PZFA 2ZU6A 4WXPA 1Q3HA 3DMNA 2IS6A 1CR2A 1O3YA 2GRJA 3CNNA 5L3QB 3DHWC 1J8MF 4KV9A 1S96A 4QJ5A 3IBGA 3T1TA 3WNBA 2D3WA 3HPQA 4LYAA 3W8NA 2ZRLA 2EQBA 4ACBA 1NP6A 2FMXA 4PSVA 2ZS7A 3CPJB 1I4TD 1A2BA 2F1HA 2JLWA 2ZI5A 1XXHE 1GNRA 2QQ0A 3KXLA 6Q21A 3AF4A 2CK3D 3R7WB 1U94A 2GXAA 2PT7A 4KFRA 3VR5A 3VNUA 2R6DA 3DM5A 1D5CA 3BGWA 3UXMA 2YOGA 3W34A 4MGIR 2OAQ1 2AFHE 3Q3JB 2EWVA 2FFQA 2F1IA 3RS4A 5L3VA 3LWNA 2GCNA 4JKIA 4P32A 1WDTA 1GL7A 3VU9A 1C4OA 2GZDA 3AVQA 2ZJAA 2J46A 5AJWA 2FNAA 4OQLA 3SHWA 4DEXA 1SQ5A 3LXXA 2FH5B 1GVNB 3QKUA 1W1WA 1XEXA 3WP0A 4JLDA 4CEIB 4Z8YA 4FXPA 1NKTA 4B3CA 4HB0A 5KSOA 3GJ8A 2FFAA 4C0LA 2IT1A 5BXQC 1HT1E 1KJZA 2UKDA 4URVR 4A0FA 3MJHA 1J8YF 1P6XA 4KVAA 4RD6A 4RFVA 4W5HA 1E32A 5CB6A 1ANKA 4GZLA 4KSCA 4ILEA 4TLAA 4C0KA 5C1BA 3RC8A 2WSSD 1J2JA 1YZGA 5EJEA 1A5TA 2B7BA 2ERYA 2VLIA 4OI1A 5J4VA 4R2HA 1SGWA 1E1QD 4CF7A 3A4LA 1SXJC 3CNLA 2IYRA 2FFHA 4DEYA 1F60A 2QQEA 1N5LA 2RHDA 3PITA 2JLQA 3EARA 4QOSA 1M7HA 3TUIC 1KIMA 1NSFA 2N1BA 4Q48A 2J0SA 1W48A 1B23P 2Z4SA 4BFWA 1TAGA 4CZ2A 2JIZA 3W5IA 2YC4C 3KKMA 1Z06A 4V0KA 4DRZA 1VCIA 3FYHA 5F2EA 1SXJE 1P7CA 5JZVA 1KZ7B 4PO9A 2W58A 3AEZA 1Q1QA 3GLHA 4PPNA 3CBQA 2OCPA 1TTTA 2GVDC 3FHTA 1E9RA 5FOXA 5J4YA 3ICEA 3QKSB 2AKAB 2H17A 2BOVA 2W83A 721PA 2HDNB 5L3RA 3S1AB 3KXIA 3QJYA 5FPTA 1D2EA 2O52A 2C8VA 4PHTA 4WZAE 2CK3A 2PCJA 3MWKA 2XXAB 4RD2A 2K5UA 1F3OA 1WXQA 1KYIA 4LHZA 1ZNZA 3PEUA 2JASA 1DOAA 5LB2A 5CLLA 3PUWA 4QRHA 5EE0A 3QXSA 4DVGA 1T8UA 3FMPB 4M9SA 2Q9CA 2O8EA 2FGKA 4TYYA 2MSEB 4A8JB 1XBTA 2AK3A 3K0CC 2F1JA 2BVNA 4HDCA 5FPHA 4M21A 4ZCMA 3TKLA 4RFSA 2V9PA 1MO5A 3L0IB 2Q0HA 4EPXA 3UIEA 4NE2A 2E87A 2KE5A 3A58B 4DLRA 4EPWA 1EGAA 1JR3D 4HLUA 3AGQA 1XTSA 1CP2A 1OJLA 1ONBA 3CLVA 3SYNA 4X8LA 4HLDA 5IT5A 4L9WA 3TGPA 1OKKD 2X8AA 3KQHA 3AVYA 4BRUA 1FX0A 4OHYA 2HLDD 1W46A 4EJSB 4M0LA 3TW4A 2X2EA 1LVGA 2QT0A 2RGCA 4NYIR 1R2QA 1VYVA 2A9KA 3LDAA 4FWIB 1VECA 4X8MA 5FUXA 2WSSA 2YC2C 2UVQA 2FJUA 3KL4A 4Q4JB 2YWHA 4M1MA 2XZOA 1E1QA 4Q21A 1LF0A 1DS6A 4TL7A 1XTQA 2ZE5A 3QF4A 5J47A 3GLIE 4GMXA 2O0HA 3IHLA 3LX8A 2WKRA 2J0UA 3WBKA 4DHEA 2ZJ5A 2Q3HA 4QHYA 5HPYB 3UATA 2FGJA 3TR0A 4B6FA 1RVDA 4DLVA 3IIKA 2IS1A 2REOA 3AVXA 3W3ZB 2BJWA 2CLDX 4HZUB 3EZ6A 1F2UA 1AK2A 2XZLA 2GXSA 1Z3IX 2WJHA 2HJGA 3BE4A 4KXFB 1G21E 2A5FA 4RKFA 4PSAA 2QG6A 2ZSBA 1G4UR 4B3XA 1N6NA 2ZVPX 1DAMA 2FSGA 2QPOA 1S9DA 1ZM2A 2ZJYA 2J5XA 1TL7C 1II8A 4G5SA 1G3MA 2V8OA 3P26A 5HZHA 4B75A 1UBCA 1QHHA 1VDZA 3I8XA 5BN3A 2QROA 2JJ1D 1MV5A 1EFUA 4Q1AA 3QKRB 4TL6A 2ATXA 4WXRA 1KI1A 2VP9A 1E98A 2G1KA 3BERA 1VG1A 4LK2A 3O8BA 3BJIC 2NIPA 3LBHA 4BFZA 4Q02A 1E1RD 4NYMR 3AH8A 1SULA 2OFOA 1Q21A 4HAUA 4TYPA 5M04A 3QPWA 3BB1A 1R8SA 4OQFA 2D62A 4AIIA 1DAKA 2CJWB 1RC8A 1JR3A 4B76A 1GOTA 1FP7A 3DOFA 4DDVA 1OB2A 3CZQA 1Z0IA 5BWMA 3DO6A 1GG2A 1OKKA 1PJRA 5JS7A 3WRXC 4ESHA 1YR8A 1P75A 3TIFA 1NKSA 1FMJA 4C0BA 1R0ZA 2HLDA 4WZBE 3VHLB 3KX2A 2ZR0A 1FZQA 2N46A 3P27A 4HDQB 1XEWX 4H9GA 2IYYA 1BOFA 1NSTA 3TR5A 4TQUS 3MRSA 2IYSA 4QBHA 4URXR 3R9WA 1KK0A 5KDLA 3K0FA 4CEHA 4QGAA 2ZETA 3BIFA 5DH9A 2ZR9A 4HSEA 2O8FA 4MGKR 5HE8A 3EA0A 1EG7A 3TRFA 2QAGA 2CHQA 1G8PA 2ASEA 4BASA 1E79D 4F7WA 1S1CA 1UBEA 1OXXK 2GTPA 2WOOA 2ZRMA 5KSYA 4AKHA 1G3IA 4S2EA 821PA 5KNBA 1E2FA 1KNQA 1D9XA 1UPTA 2UZ3A 4FIDA 3PUXA 1NIJA 2CMKA 4JLMA 1OHHD 2R65A 4LHVA 1QHSA 1VIAA 4JJKA 2HYIC 3PCRB 1HTWA 2ZJ2A 3L2OB 4RD4A 5FOUA 3HYRA 4OQMA 3NDPA 4PANA 4Q7JB 3WYFA 2WJVA 2IF2A 5L3SB 4H1UA 4EPVA 2GKSA 4A82A 4KLNA 2ZRKA 3IQWA 3GLHE 5LB4A 4CIDA 4AY2A 1W5TA 2EWWA 2ANBA 2RAPA 1JI0A 2J7PD 3L43A 2NZJA 1KO8A 4B33A 4N0DA 4GOKA 1RJ9A 2FPLA 2Q9AA 5H8WA 2FG5A 2WJIA 3P20A 4PZZA 1P2TA 2JJ1A 1OB5A 4HDOB 3EWSA 3W5JA 1W0JD 1TUIA 4NYJQ 2YV5A 3LX5A 1FOEB 1HQCA 4J0QA 4D0GA 1AS0A 4HLUC 1E1RA 3B1XA 3JZMA 1G6OA 1G20E 3AVPA 3PXGA 3VMFA 1Q22A 4K46A 2WMOB 2IL1A 2A7QA 2WZQA 2CCKA 1DE0A 1DG3A 1NVXQ 3CB4A 3AKDA 4L4UA 1KMHB 4II7A 1P62B 2QM7A 3VAAA 1K8RA 1M7GA 4ZKEA 2JLZA 4V02A 4A4DA 3H0KA 2V55B 2BM1A 3FPAA 4AKEA 4GPTA 1N6OA 1UJ2A 2AWOA 2VL7A 4L5BA 3LRPA 1Z83A 1K6MA 2HXSA 1DARA 4JYBA 5J40A 1F5NA 4D4KA 1KK2A 1U8YA 2C2HA 3ZS9A 3A1WA 1Z6TA 3HYTA 1IY0A 1EFTA 1W5SA 5FOSA 1M8PA 1Z0AA 3FHOA 1FFHA 4NP6A 2ZSDA 1E79A 3SYKA 4DC9A 1E2MA 3C41J 3TMKA 1RPZA 2O8BA 2H18A 1NVWQ 2QNRA 2F3RA 3KXKA 3E70C 2QEQA 3ZS8A 2DFLA 3F5FA 5FI0B 1DAFA 1ETUA 1ZYUA 3GJ3A 1OHHA 2PX3A 3LVQE 3Q5DA 1LV7A 2RGNC 1CJTC 1KAGA 2XX3A 3KKOA 1KSJA 2IBMA 2WWWA 3HU1A 1MR3F 3DOEA 3EIEA 1MOZA 1EFCA 3NBFA 1G5TA 1XZQA 3GLGA 1AZSC 3KQKA 4KI0A 3LD9A 5HCIA 1R0WA 2GDJA 2QT1A 4O0MA 4BEJA 3D6TB 3F0TA 5CDFA 1GITA 1E2NA 2J7PA 1NRJB 3KTAB 5FBQB 3EXAA 4DUGD 4N1AA 1XCMA 1U9IA 2FN4A 3TSZA 2P3SA 3CPHA 2HT1A 5K8LA 4OI2A 1FW6A 4QBIA 3RHFA 1NN3A 4A0GA 1HEIA 3L8YA 3NG1A 2ZXUA 1OW3B 2O5VA 4EPRA 2WWGA 1KI8A 1W0JA 1Z22A 5A0FA 1XMSA 8OHMA 5DNYB 2IF0A 3NC1C 3R20A 5FUWA 1Y63A 2VIIA 3PUYA 3PJRA 1G9XA 3DDCA 5AJZA 1YZLA 2QP4A 4F38A 5KNDA 2VYFA 3QBVA 5IF9A 2D2FA 1TEXA 2W00A 4JLPA 4ZI2A 1DEKA 4PSKA 3VR4A 4LV6A 2PL3A 3MGCA 4OBEA 1BH2A 1ZNXA 2VH5R 4EPTA 3O8RA 4RCZA 2I1QA 1OFUX 2VTKA 1OIXA 4BLOA 4LJYA 4UXIA 2ZAMA 1TU3A 2B21A 4UKDA 4XD7D 5AR1A 2RGXA 2GJ8A 1TU4A 2QAGC 4JVSB 4DSNA 2LKCA 1KY3A 5DIFA 5CK4A 1AGPA 2EFEB 3X1DA 4XWOA 2VP6A 5FR2A 2F55A 4FN5A 4LPKA 3R9IA 4EQ6B 1MO4A 1US8B 2DWQA 4OJQA 1WRBA 4AYWA 3WRYC 3LBIA 4QBFA 3SJZA 1SVLA 3K1JA 1GNPA 4LYJA 4FCTA 2GF0A 1HV8A 1UBFA 4AKIA 5SZJA 3CX7A 3DEFA 5DI3A 4LBWA 2C03A 3H4MA 1A4RA 4CEJB 1GSIA 3GJ4A 2OBNA 2PEZA 2IHBA 1GRNA 3C8UA 2QTHA 3WHLA 1D2NA 1TPZA 4Q01A 5B57C 3ZVLA 3OF5A 1SHZA 2PLFA 2FA9A 3U7EB 1QRAA 4E07A 2CHGA 1QHGA 2NO9A 2QAJA 3TBKA 5E3HA 5LD2B 4C0AC 3I73A 2DFTA 4BRWA 4ZIRA 4M53A 4QBGB 4DUGA 1R7RA 4QC2A 2BMEA 1F6BA 4JLJA 4MUAA 5E7JA 3OEHD 1P9NA 4D0NA 1XCPA 4QM7A 2O8DA 2BV3A 5HTKA 4A36A 3FMIA 1ZM4A 1NY5A 2BBSA 1PV4A 3AVWA 5FBVB 4ZDKA 3R7WA 2P65A 3ND8A 4HAZA 3ZZTA 2ZRHA 4C2UA 2CXXA 1Z5ZA 2Q21A 2RGGA 4NYIQ 3FB4A 2DBYA 1OYYA 1XD2A 4EFMA 1VYTA 3DM9B 2OSBA 3BS4A 2IXFA 2WPDD 3UK6A 2PLRA 1ODFA 4ARZB 3W90A 3AB3A 4EFNA 3THYA 3K70C 5F9FA 4Q4LA 1ZU5A 1I2DA 1M34E 1GKIA 1MABB 2OXCA 2R2AA 4H1VA 4PC3A 3OIUA 1GDDA 2JDID 1I4DD 1ZINA 3P4YA 4BFXA 4YDSA 1NVVR 2VEDA 2QBYA 4PHFA 1NN0A 4LHXA 2W2XA 2QGZA 1FNMA 3KQNA 3BH6A 2GCOB 2B8WA 5GVSA 4IXMA 5BYKA 3QENA 1E2HA 1S3GA 4IFEA 4QHTA 2JCSA 2P67A 1U2RA 3TQCA 1JR6A 4XD7A 2V6IA 1W4RA 3SNHA 4E09A 1EWQA 5DI9A 3ZD6A 3RS2A 4JLKA 4D25A 5DISB 3VR2A 1MRNA 3QXHA 4PFSA 3ICQB 3T5GA 5DLQC 3SOPA 1QF9A 2C77A 4ZCIA 4NHOA 1IN5A 1JNYA 2WKPA 3IKJA 5DE3A 4TMZA 1L7VC 1E4YA 1S1MA 1WBDA 1G8FA 2XTZA 3FTQA 3SC3A 3SN6A 4KODA 1Q1ZA 3QI2A 1HYQA 4LC0A 4MYHA 2YJTD 4NTZA 2MMGA 3QBTA 4DLZA 5JWRA 1YRAA 1EXMA 3U3MA 1Q57A 4IEEA 1HE8B 3B5JA 3LFUA 1NJGA 3SJAA 2NO6A 2I4IA 4FW9A 4PPFA 4M1WA 4V0LA 3DL0A 1EESA 2R9VA 1U9IC 1S0UA 2PEYA 2NPFA 1Z0KA 3OIYA 5FL7D 1XD9A 2YWEA 1AS2A 1R8QA 4PX9A 4I1VA 1D8TA 2ORVA 5CDFE 1OT3A 3RRZA 1N6RA 3OEHA 4X8OA 4B47A 2G0TA 2IW3A 3P4XA 4HYYA 3GLIA 1XXHB 4LJ5A 2GNOA 3W3AA 3MLEA 5GJVC 5JWHA 4DLWA 2A5JA 1IONA 5D3MA 3EZ2A 4JVNA 4AKGA 2FPMA 5JEDA 1N6HA 2ERXA 3UMRA 1RW4A 2BHRA 2FX3A 4DWJA 1EK0A 4BZPA 1NL3A 2ORIA 1HE1C 2A30A 2HCJB 1KY2A 2PX0A 2WPDA 4M8NE 5IDVA 5FFMA 2IYUA 3CR7A 5JBQA 1KKLA 2Q3FA 4A6XA 4OJKA 5C4GB 2RKOA 4XVQA 4HUTA 2JDIA 3GFOA 4IDHA 3LW7A 2WIAA 4C7OB 5FOWA 3ZZ0A 5KUTA 4K81B 1XTJA 1G7TA 1GRQA 4UXHA 1W2GA 4BEBA 3O8DA 4XSGA 1XPRA 2Z6VA 4GP7A 3PEWA 3I1FA 2ZM5A 3THWB 4IFBA 4BFUA 4UNNA 4GP6A 2EYQA 5KO2A 4HAXA 2NTYC 2IHYA 1Z47A 2GJ9A 1QG4A 2AN9A 3B60A 1XTRA 1BYUA 4A1FA 3CX6A 2J45A 2BWJA 1QHIA 4LBZA 3EIQA 4Q4JA 2MSDB 1RYHA 4HB4A 2C9CA 5SZIA 4Q9JA 3GLFB 2OM2A 3EZFA 5G53C 3H86A 3ETLA 2NO0A 3Q8XB 2VHTA 1ZCAA 2BBWA 4R9UC 1D6JA 1COWD 1H8HD 2QSZA 3GFTA 2D7DA 1X86B 3BH0A 1ZP6A 2ODEA 2P6NA 2EFGA 3AUYA 1J90A 4Q5IA 4DKXA 1FTNA 2QPTA 3PENA 1UDWA 3MMPA 3MSXA 2F1RA 1SXJB 1CS4C 1HT2E 1I2MA 3DKVA 3G82C 3ZH9B 1AGRA 3B8HA 4LUCA 2PJZA 3CM0A 1ZJ6A 1TF5A 3DPUA 2ZEJA 3IO5A 5FL7A 5TY0A 4C9BA 2FZLA 3EZ9A 1UDXA 2HEIA 3M1IA 5E4FA 5EXPA 5F9HA 1E3MA 3ZJYA 1G8GA 2VHJA 3EC1A 2VO1A 4TL9A 2PCLA 4HUQA 1OH8A 4CT5A 1FUKA 1KI6B 3QEOA 5FH9A 4LJ7A 4W7SA 4XSHA 4A2WA 1G7SA 1BMFD 1KI3A 1GP2A 1P73A 5FBWB 2WM9B 1KSFX 2O0KA 2N42A 2XTNA 2IYZA 4JZKA 1CU1A 3T61A 1ZM9A 1PUIA 1S2MA 5FUVA 2HYDA 5J5CA 4WOPA 3TE6A 3L82B 3A36A 1CLUA 4FMCB 1IJEA 2F43B 3E5HA 4E03A 4DB2A 5LBIA 2HF8A 5KPJA 1E2QA 4ZO4A 1M74A 2OUKA 1U98A 4R7ZA 1UKVY 4KYUA 1WQ1R 1P2VA 4TQ9A 2AL7A 4IDQA 4DJTA 3NBXX 1TQ2A 1DG1G 2W0MA 1SKYB 5DYIA 3UWOA 5KOYA 5E7IA 3ECCA 5C2JB 1GILA 5FTJA 3DZDA 1YZUA 1ZNWA 3KB2A 4A92A 4LGMA 4DCSA 3FFAA 5JS8A 5AUNB 4EPYA 1XTIA 4MRPA 1G4AE 4Q9HA 3ZD7A 1Z2AA 3PFIA 2V54A 4GNKA 1O87A 4TT3D 2NQ2C 2ZRBA 3N2IA 4TYQA 5IHPA 2VP5A 4MQBA 5G40A 4BLTA 2J0QA 3CZPA 3QEJA 1DTSA 3TK1A 1UFQA 4WW0A 5HR5A 2PH1A 2NG1A 3FKQA 4DLTA 3U4QB 3NH9A 3KQLA 3W6NA 5CYPA 5BN4A 1COWA 1H8HA 2W6JD 1AKEA 4OK3A 2CEAA 1Q1EA 3EA5A 2D74A 3U44A 1E4VA 1VG0B 1U99A 4G3XA 4PZLA 3KKPA 2V1XA 2DR3A 1Z08A 3OZXA 1AJEA 4A2QA 2O0JA 2VSFA 1FPMA 2D4HA 2C9YA 3R8FA 4I81A 5JHGB 1OV4A 3Q72A 4Z54A 2OBLA 2DCUA 3NBYC 2ZYVX 2WJJA 4PC1A 3U3JA 5ANRB 1SVIA 2C99A 2FSFA 2OT3B 3SE0A 2H16A 3LA6A 2ZRAA 4DCNA 1IAQA 4Z1MD 4ZV4A 3WNDA 5L3SA 1WA5A 4KBFA 4B43A 1L8QA 3LV8A 2ZITA 1DADA 2FFBA 4QGGA 3GEIA 4KSBA 3U7FB 3EPHA 3FVQA 1IY2A 1JJ7A 1KKMA 3PEYA 5CIWA 3RS3A 1J70A 2EFCB 4EFLA 2Q9BA 4FMBB 4L16A 4DSUA 1BMFA 1ZRHA 2CL0X 4LHYA 3D31A 4JBXA 1E94E 1KI2A 5JJLA 1Z6GA 1XEFA 3N2EA 4DLUA 3TVTA 3ASYA 1KDTA 3OAAD 4TMWA 1G7CA 1LF5A 3RABA 4ACAA 5JCPA 3A4MA 4RJLA 1F2TA 1KDPA 1EFRD 2ZRJA 3Q7PA 4LPSA 1C9KA 1E2DA 4G5RA 4MUBA 1OFIA 3VU9B 1X8JA 2AXPA 1U8AA 3U6KA 1WP9A 1YJ5A 3BFKA 3C4JA 5EZ5A 4ZPXA 2ZYWX 4JLVA 5JI2E 1XEXB 5CIQA 1DAEA 3KB1A 1KMHA 2RB4A 5TV2A 2IX3A 4GDFA 1ZNYA 1T8TA 3O47A 1UAAA 3QY0A 1IXRC 3MD0A 4Q1BA 4PC6A 121PA 1IXSB 1ZIOA 4G5GA 3X1XA 3AVOA 3IIMA 1G17A 1QG2A 4TT3A 4TLBA 1NN1A 2GF9A 4B32A 1IN8A 3PQCA 2I3BA 1XPUA 5JCZA 1MO6A 1W4BA 3FKSD 4URYR 2QP9X 3ZVNA 1P61B 5FBRB 2B6HA 5K8TA 3M6AA 3HDTA 1NF3A 3CRQA 1FQKA 2ZUCA 5DO9A 3H2YA 5JSZA 4U7DA 3T1QA 1EX6A 2OZEA 2W6JA 3K9GA 3MJRA 3WP1B 1Q44A 4AG5A 3DVLA 1YR7A 2PZGA 1E9EA 2ZRIA 3HPRA 3NEJA 2QTVB 1HH4A 1P2SA 3A1UA 1OPXA 2DFNA 4IOJA 2GEVA 2C98A 3UMSA 4GFDA 1XDBA 3A8TA 5JWOA 1YU9A 4ZDIA 3QG1A 2RGEA 4D0LB 1W36C 2JJ2D 1OH5A 1T5LA 4QL3A 4MGZR 4Y0AA 4NKRA 3LY5A 3UG6A 4MYUA 3E2IA 1G5PA 4Z1MA 2EW1A 3GLHB 4BPBA 3PV0A 4ABYA 3CH4B 1R5OA 4OI0A 1CJUC 2VHCA 3LBNA 4DT1B 2QRNA 2NMVA 4IVPA 2ZRNA 3CWQA 3HU2A 3LVRE 1NVVQ 5FPKA 3CRRA 1RRGA 1XNJA 3V9PA 1G41A 4UQOA 4IOKA 3A6PC 5EE1A 3AGPA 4F4IA 3TAUA 4YXWD 3OIWA 1XJ0A 2KSQA 2QM8A 1FNNA 2KBEA 2ZANA 2BEKA 3OAAA 5H1YA 4D82A 1JXOA 2JLUA 3VX4A 5GADl 3RVBA 1XU4A 1EFRA 1QHXA 1N5JA 3RNLA 2V6JA 4X8HA 4B35A 2GXQA 4P4UA 5CITA 3SFZA 1SVMA 1IN6A 4L15A 4RZXA 1WMSA 3BC1A 1J99A 5A4JA 2XSZD 2V3CC 4XWKA 4AK9A 4RFSB 4M1SA 2JLSA 2JLVA 1AKYA 1T0HB 3MUFA 4W5JA 1E6CA 1TQ6A 3CRW1 3U2QA 1G5RA 3U5ZB 4C0QC 2P2LA 4HZIA 1CR4A 3MAAC 1VCOA 3B1VA 4OHZA 3AKCA 4QFMA 5AJVB 2VPPA 2VP2A 5AUOB 3SQWA 2WWFA 4JT4A 3I61A 2QGNA 4MKHA 1KDOA 1U0HC 2FWRA 1KSGA 3VQTA 3K9LA 4RZ2A 2ZUBA 1RRPA 2Z0MA 3VR6A 1T3LA 2GEUA 2QMOA 3RAPR 1T5IA 1ZUNB 4RD1A 3RRMA 3WMEA 1OXSC 5JLJA 1T0JB 4AG6A 5CJ2A 4UJ5A 2ZI7A 3FKSA 3AVUA 3E1SA 4EKDA 4JVMA 3WBJA 1FQJA 1OFTA 1SKQA 2ZS9A 2ODBA 3VKHA 4IEIA 5EP1A 2XAUA 2IYTA 3KZ1E 1LS6A 3Q85A 1JBKA 4YONB 1NBMD 4O3MA 2IXGA 2J0UB 1EX7A 3Q7QA 1AQYA 1T3HA 1T4GA 4M9XA 4KFSA 1MT0A 4PQYA 1JECA 2B92A 1XFAA 4EAQA 1YQTA 3V4FA 4ZKDA 2GETA 1N3BA 3HJNA 5JFGA 2QZ4A 1XPOA 2AHOA 1NMXA 4IJMA 1JB1A 4KAXA 5GJCA 2DWOA 2JJ2A 1TX4B 2QPAA 4URWR 3SDZA 3WMFA 3B7GA 4NZYA 4JYCA 1E9DA 1I4LD 1F2UB 1FMLA 4QJ3A 1OXVA 3T06B 5GJWC 3IEUA 1PLLA 2OEPA 1KI7A 3EX7C 1SVWA 1N5IA 1G3QA 5AJXA 3REGA 4BFVA 1RKBA 5JECA 4Z8XA 2IS4A 1GZSA 4L9SA 4WVFA 3GCGA 4YXWA 1X1RA 2J87A 2ZI3A 5DN6D 4RVCA 4D26A 5JJKA 4C0JA 4NCNA 5B30A 3SBDA 3CF2A 3L0SA 3LAWA 5TVKA 3RSOA 4PO1A 1RFLA 2FZ4A 2CCGA 1ZD9A 4IW3B 5JHHB 2C95A 3VHXA 1QVAA 3FGNA 2L0XA 4B71A 4V0NA 5EP2A 5FOTA 4C3ZA 1K5DA 2YHSA 4RD0A 2BDTA 3SBEA 4BE7B 4XVUA 5EXTA 1GTVA 5GVRA 2XSZA 4ARZA 5EXXA 4L8GA 4LJAA 3DKPA 1OE0A 4KHZA 4PAMA 4US0R 4LJ6A 4MKGA 2ZI4A 1JJVA 4XVRA 2WOJA 1Q0UA 3U61B 2FU5C 1CBUA 1IOZA 1UEJA 3LLUA 4QNMA 4P3YA 3ZVRA 4AURA 1NY6A 1CIPA 1E69A 1HURA 3NKVA 5JRJA 2ZYUX 2ANCA 2WMNB 2VHQA 3KUCA 3W9YA 5FI1B 1D9ZA 4W5WA 3FFBA 1OH7A 1N0VC 3GMTA 4F4CA 1R10A 1NVUQ 1LTQA 4TQAA 3X1WA 4GRAA 1AIPA 2F3TA 1Z6XA 4B74A 2OFXA 3TJZA 2XB4A 4CEHB 4N3NA 3WXMA 3CX8A 4BLSA 2O8FB 2X19A 1AZTA 4XOIA 1Q1BA 1D2MA 3M4YA 2WAYA 2QAGB 3C7KA 1LFDB 1NBMA 2BKUA 2QN6A 2QI9C 2ZPTX 4HI0E 3THXB 1XWIA 4KJZA 2GZHA 3PVSA 3CWZA 4Q4HB 4B3FX 1ZW6A 4DCUA 2F6RA 2OG2A 1ZAKA 2BCGY 2ECKA 2J3EA 4XJXA 2VSXA 1DAGA 1XCGB 5EP3A 4DIEA 3GPLA 2VF8A 4DDUA 2AR7A 4B2LA 2ZJBA 2IA5A 3N70A 1A82A 1CJKC 3GJ7A 1VKJA 4PHGA 5D3QA 1AN0A 1E9BA 2R6CA 4QXAA 5EXSA 4JLNA 5K8UA 3LXRA 1P2UA 1S8FA 2ZS8A 4K8OA 4RCYA 4Q9LA 4GZMA 3ZQJA 5K8IA 1QVRA 4R2IA 3RYTC 1ZIPA 5TXGA 3LLMA 3QXJA 5BN5A 1VMAA 2D06A 4Q4AA 1OF1A 2OCBA 5G3YA 1U8ZA 3BRWD 4Q1DA 1RYFA 2IWRA 5DN6A 1Z8FA 1RJ9B 2YKGA 4POAA 1XZPA 4URUR 1N6KA 4FMCF 5DYGA 3NHBA 1DELA 2KJQA 5FBLB 4E5UA 2XGJA 4DLYA 1ZMXA 3AUXA 3K0AA 4Q03A 2FEMA 1AM4D 4US1R 1M2OB 5ELXA 1E0SA 2YOHA 1BYIA 1SVSA 3D7MA 3SJCA 4Q1CA 2ZSFA 3TLXA 1G19A 3EWAA 1Z2CA 1LS1A 2OCYC 5AUPB 4Q18A 5DSZA 3U3KA 1G8YA 1OSNA 4C4PA 4DZZA 3WNCA 4F4JA 2EFDB 3WYGA 1UKYA 1YZKA 1OXUA 3T35A 2A78A 5L3QA 4BUJA 3HP1A 2WTUA 2QE7D 3REFA 4PC7A 1W0KD 3K70B 1PLKA 3AP3A 5J4KA 3NTUA 4Q19A 3KFXA 3AQ4A 2LKDA 4OHXA 3TSWA 3SJBA 1Q3TA 1LW7A 4ITRC 1V5WA 2IYWA 1JEEA 3L8ZA 1N25A 3A1TA 4B3BA 1GKUB 4YC7A 3L0PA 4IDNA 1FTSA 2V7QD 4LHWA 2ZU0C 4A0RA 5HE9A 4TZ0A 5FTKA 3R8CA 2HUPA 1LY1A 2ZJOA 4NONA 3UMFA 4EDHA 3EIHA 2Q6TA 1CEEA 4LWZA 3C5HA 3B13B 1KO5A 2ZRPA 3QVVA 1P9RA 2O8BB 4CW7A 4US2R 2CLSA 1E9AA 2ZIAA 1CR1A 4RD3A 4LRWA 4CRWB 1VIYA 4ON9A 1LB1B 2NO7A 1P5ZB 2HF9A 3GEEA 4A15A 4CEIA 1JPJA 4GT1A 2AWNA 2B7CA 2I1VB 1XF9A 2H8KA 3QPUA 4BFTA 1PUJA 3NXSA 5L8VA 4RZUA 4HAYA 2P5TB 3GLGB 1E9FA 3TNFA 3X1ZA 4JLOA 3IILA 4XIGS 1T6NA 2QMUA 4JVLA 2VA8A 4YMWA 4P4SB 3IUYA 1WF3A 3QF7A 3NIBA 4MKIA 2G1JA 3BB3A 1RIFA 3SHFA 2JEOA 1CULC 3IPYA 5F3WB 1N6IA 3OEED 5FL3A 2ZR7A 4GL2A 3HU3A 2F9MA 2ORWA 3MCAA 1Z28A 4Q1FA 2DFKB 5CM8B 2QMHA 2C5LA 2D7CA 2WV9A 4JLBA 3LNCA 5FOVA 2XEXA 4B3DA 2QRZA 1BIFA 2ZREA 2WAXA 4AC9A 4G0NA 4MDFA 2FDCA 1JAHA 1CJMA 1U81A 4TMKA 3I4LA 4M1YA 1DVRA 3ZVMA 3UWKA 3VNVA 2BC9A 2LCFA 2HJVA 4D6PA 1HY3A 2VP0A 4TTRA 2SHKA 2ZRGA 3LO5A 4D2IA 1E2JA 4FINA 3BORA 4NYMQ 1JPNA 2ZYTX 2FOLA 2OLKA 3KFVA 2GEDA 3CW2A 3GJ0A 3ADCA 2WWIA 3QKSA 2H57A 2QE7A 2ODNA 3RS5A 1W0KA 3RS0A 5JEEA 1JALA 2X2FA 2MSCB 2DPXA 2NPIA 3C14C 1IQPA 5FUYA 3TUJC 1KOFA 3S1AA 1SHKA 2PZEA 3O8CA 3FMFA 1N6LA 2J7KA 4UJ3A 1KSHA 2YNMA 2Z83A 1FL9A 3AF1A 1QBKC 3BWDD 2XXAA 4QM6A 1ZC3A 2V7QA 2XOKD 3IHWA 4M1TA 4QNRA 4IDPA 4MITA 4JJZA 3C16C 1X8LA 1M7BA 2AD5A 4JKYA 5A5GA 1JQLB 1V43A 2V4ZA 4LCBA 1CR0A 4NCJA 4A8JA 2EYUA 4DSTA 3BBPA 1R4AA 4JL8A 4PR0A 3U3OA 2GILA 1ZD8A 1KJWA 3U4QA 5KHOC 1NBME 1VG8A 1QHNA 2C9OA 4OYHA 2BMFA 4OL0A 3SS8A 1AA9A 4C0SA 4HB3A 1OIWA 2CBZA 3BAFA 4LYFA 5SZHB 1E9CA 4Y0VA 3RDPA 3IPXA 1YR6A 4QKQA 2GJSA 1E0AA 4RKEA 4DSOA 1RRCA 4BGDA 4LSGA 1YE8A 2HT6A 4JSYA 4QG7A 4YDHB 1NMYA 2IS2A 4EJSA 2G88A 3GJ5A 4LJ9A 1W2HA 3TQFA 2QL6A 1DAIA 3BK7A 4YMTA 3AP1A 5FTLA 4ZIRB 4PAOA 4C2TA 4B44A 1LNZA 2EVWX 2ZE7A 4B34A 2PJRA 2CHVA 1XJQA 2PMKA 3KJIA 4LV5B 4B73A 3OEEA 1Z0DA 4KLZA 2O8DB 4HATA 1QZXA 4XTRA 4B2IA 3T1VA 1KO4A 2HV8A 4NMMA 1ZM7A 5KTYA 2A5DA 3M0EA 5EUMA 1E2IA 4FD2A 3NDBB 1W4AA 2ZAOA 2O8CB 2CDNA 1DBSA 4LJ8A 5JI3E 1XD2B 2BBTA 2WICA 4PZYA 1GRRA 3L0OA 2D2EA 2EU8A 1NG9A 3THYB 4HLQB 3KDSE 2ATVA 3KKNA 4HZUA 2P5SA 4LBVA 3B9PA 421PA 4TSFD 3K8YA 1KMQA 3BB4A 4PTLA 1E2GA 4KVGA 4DDTA 2DWPA 2XJ9A 1G6HA 4JSTA 1VHLA 2QBYB 4PQRA 3EG5A 5KU1A 2IWHA 5CB8A 2BJVA 3N5CA 1IXZA 1QDEA 2B8TA 4IHQA 4NCKA 1AS3A 2YOFA 2Y8EA 5BW8A 2R6FA 4O25A 5FPSA 3WYAA 4GI7A 3I8SA 4ZI3A 1G8HA 1VTKA 3X2SA 2J0VA 2FEOA 2XOKA 2AXNA 2GK6A 4P4TA 4YQFA 3EPJA 3QKRA 2IC5A 4I1SA 4Q00A 2REBA 2R6AA 4BLQA 1JXMA 5H68A 4M22A 2A5YB 1XMIA 3AM1A 4MRVA 4OI4A 4MRNA 3TAHA 5EE9A 4C30A 3GLFE 1N0UA 3MWJA 1H65A 5HKKD 2CJWA 3A4NA 4F91B 2P6UA 4TL8A 1IJFA 3CUEF 5JRZA 2DYKA 2FSHA 1KK3A 1E99A 2VP4A 4IRUB 3PEVA 1ESMA 3RC3A 4XWAA 2QY9A 2FV8A 2X1VA 2YYZA 1NI3A 1KO7A 1E2PA 1OIVA 1Q12A 3QIAA 3RLFA 2QMEA 2WWHA 1XB2A 5G3ZA 1YZTA 1BKDR 2J59A 4DT1A 3GLIB 3KJHA 2F9LA 2ZI6A 4TTQA 2OAP1 4LZZA 1E0KA 4UXJA 2PT5A 4NPHA 4U00A 4JBYA 3NVAA 4WBSA 3W8RA 4D81A 4AD8A 1MKYA 2IUTA 3QG5A 5D3MB 3VKWA 3CH5A 3FHCB 4URZR 1OYWA 1UEIA 3B2EA 3TVDA 4ERNA 1L4YA 1U90A 5CJPA 5C46F 5EQTA 5FTNA 3G0HA 2ZTSA 3EAQA 4AYTA 3T15A 3AF0A 3PR1A 2BCJQ 3RWMB 3KUDA 3MG9A 3F8TA 4TSFA 1CRPA 1TEVA 1VHTA 3G5UA 4TZ6A 4V0MA 1QHYA 1CTQA 4N0EA 3NC0C 4TMTA 1YZQA 2XB2A 2KB0A 2JLYA 1XD8A 3T34A 3CRMA 1SKYE 1R5NA 3EW9A 1KDRA 2R44A 4FWTA 4Q9IA 3CKLA 4S35A 4WA7A 1XRJA 3AVTA 2GZAA 1E96A 1KZGB 2FF7A 3UG7A 1N5KA 1ZM3A 4A8JC 2LWIA 4CYMA 2CE7A 3AVVA 2CE2X 5CLQA 4UNPA 4XH9B 3LQRA 3SYLA 1YRBA 4EIWA 1NNEA 1NLYA 2CCJA 2IEZA 4G5OA 4LC1A 4HEJA 4JL5A 3ZYCA 4FI3C 1MRSA 5TMPA 1TF7A 4MGYR 3P1JA 3I5YA 2QSYA 3H1TA 1XMVA 2XTMA 5C18A 2BMJA 1M1YE 4MH0R 4FMDB 4EJSC 4EUNA 4Q7KA 5HKKA 3ONWA 3TW8B 3AKYA 3VR1A 1OXTA 1C1YA 4GOJA 4TWZA 1CXZA 2ZE6A 4YMSA 5IRCD 3QPVA 4D4MA 2A2ZA 1OH6A 3OESA 1EWRA 5FPYA 2NOAA 4LJ4A 2ZVQX 1R6BX 1T91A 2VQSA 1RE0A 1IHUA 5KNCA 3ADDA 3I32A 2P6RA 2RGNA 3B82A 3DZ8A 1W36B 1SVOA 4TLEA 2A5GA 1GL9B 2CNWD 1T9HA 2R6GA 4M1OA 4GOXA 1G3UA 2G6BA 4HUQB 3K9NA 3BH7A 1ESNA 1ZU4A 1SZPA 3GJXC 3ZIAD 4TN1A 1YHNA 4BLPA 4BZQA 4ASUD 3W6OA 2J9RA 4NH0A 1U0LA 4OQXA 3V4RA 1HA3A 3BFVA 4LY6A 4TMVA 4AWXA 2VSOA 4FCWA 3MWYW 2WJYA 3QE0A 4BECA 2RGAA 3QXXA 2DY1A 2OV2A 2BEJA 1KI9A 2IYXA 1TMKA 3GJ6A 2QA5A 2GAAA 1KTVA 2QU8A 2R62A 4DLXA 4HLCA 3ASZA 1WCV1 2WHXA 1OLOA 2C04A 4RSGA 2XNDD 4YMUA 1HUQA 3QNUA 5J4HA 5E7MA 2YINC 4NL4H 4TLDA 1TNDA 4JT2A 2V1UA 3UANA 2OXRA 2RGDA 4RY2A 3MWLA 4G5QA 4TYNA 3KTAA 1E9SA 2RHMA 3PUZA 2OBMA 2JLRA 1RZ3A 4PXAA 3K70D 1DO2A 5KPDA 3C15C 3THOA 4W9MC 4I1UA 4KYIB 5EUQB 1VG9B 3B1YA 3JVVA 4QGFA 4DB4A 5FR1A 4B6EA 4A9AA 4CDGA 4IVQA 1X6VA 1JEDA 4D4JA 3ZLJA 3R9XA 1IN7A 1KO1A 4O2RA 4WZ6A 3SFVA 3ZZUA 2O8EB 2BBOA 2ZRCA 3NWJA 1GM5A 4WAUA 4E22A 2YWFA 3B78A 5TB5A 3J81k 2JGNA 3PUVA 5CM9C 4BFSA 3THXA 2QP3A 3IO3A 3NBZC 5TARA 4NBSA 4Q4HA 4Q7MB 4B2PA 3U44B 1X8KA 3FDIA 1UKZA 4U5XA 2QENA 3ND9A 3X1YA 3GEHA 4V03A 5LDDC 4PO8A 5BYJA 3B6EA 1IBRA 4ZCLA 4DLSA 1II9A 3KJGA 4JL6A 2ZSAA 3HR8A 1GFIA 4YMVA 1FX0B 3AV0B 1UKEA 621PA 1H8ED 4DCVA 1GIAA 2KI5A 1Z0FA 3Q5EA 1W44A 2G3YA 2EFHB 1YKSA 2GXUA 5J4LA 5DHAA 4F93B 5SZKB 2GVZC 1T3SA 3EC2A 1CF4A 3K09A 1XMJA 2CNWA 4R98A 2E9SA 2YWGA 3UKDA 3Q9LA 3NH6A 1SVKA 3FMOB 2QTFA 3KJEA 1YVDA 3QF4B 3ZIAA 3P32A 2WWXA 2CVFA 4ASUA 1JQJC 2C96A 4EQ6A 4G1UC 4D4LA 1US8A 3EZ7A 1N0WA 2NGRA 4IOMA 2ONKA 5AK0A 3U60B 2R8RA 3VKGA 2AX4A 4AYXA 1YR9A 4U02A 4BWYA 1ZUIA 1S9HA 1P72A 3I72A 1IN4A 1KNXA 1F2TB 3U3RA 4CEJA 2IYVA 4BZXA 521PA 2WSMA 3BXZA 4M1KA 4OHVA 3TH5A 2JATA 5CYOA 2XNDA 4TLCA 1KGDA 1FUUA 1Z0JA 4KFTA 2ZE8A 3LH5A 4QHSA 5KSPA 1A2KC 4I1OA 4V0ME 4UNSA 1U0JA 3JVUA 2RH5A 4IXNA 2AFIE 1G7RA 4R71A 3CO5A 3CF6R 3CONA 1II8B 1KAOA 5B2ZA 4TTPA 3BD9A 1W7AA 1N6PA 1G18A 1QHHB 1NN5A 2VHUA 3IEVA 1F48A 4MYCA 1ZBDA 4DDWA 3CF0A 5CK5A 3D8BA 4JBWA 4JMPA 3RWOA 1MO3A 2OLJA 4OK6A 1Z63A 3SR0A 4GMDA 1UF9A 2GBLA 2ZJ8A 3HR7A 5DHFA 5JSZB 2KWIA 2C78A 2TMKA 3QUSA 1MABA 2ZUDA 2XJ4A 2H1LA 2H92A 5EZ6B 3T1OA 4BLRA 3DMDA 1L2TA 2E1RA 2BKEA 4CGZA 1PLJA 3CPEA 5GJBA 3U7HB 1KK1A 4P0TA 2CL7X 2GCOA 3IIJA 4JIMA 4LYHA 1GL6A 2WJGA 3GD7A 1Q20A 3I92A 4KU4A 1H8EA 4Q1EA 2ONJA 1FP6A 2Q3MA 5EP4A 1CRQA 3WY9A 4G01B 5TDHA 2JA1A 1ZCBA 4OHWA 5C4MA 2OFWA 1OFHA 3I5XA 3K0FB 1B0UA 3VTKA 3WMGA 1GUAA 4IVRA 4AI6A 4P4SA 3ADKA 2H5EA 4OKSA 3TUZC 2GCPA 3NHAA 4A6PA 4D80A 5JJIA 3KKQA 3I3SR 4RZ3A 4LDJA 1G16A 3CRVA 5AJYA 4Q66C 4PPGA 3D3QA 2MMCA 3ZQ6A 5AWFC 3ADBA 2RGBA 2ODWA 5P21A 1UADA 1A7JA 1WE2A 4BFYA 3H84A 2FSIA 3AP2A 3EPKA 4Z51A 4KBGA 1SXJD 2FE4A 3EPLA 4PC2A 1VCNA 2JAQA 3CIOA 4MKFA 1Z07A 2IYLD 4Q7LA 3LW8A 2ZJZA 4NDZA 4MDEA 2J1LA 3SI7A 3RRYA 1R5BA 5LPNA 1BO6A 3CR8A 2XZPA 2GK7A 2A3RA 3GFPA 1JR3E 1ZD1A 3K0SA 1X3SA 1XEWY 1XXHA 4HAWA 2JLXA 4HAVA 4B3GA 4MRSA 4YLGA 4KITB 3PG5A 1TF2A 4Q9KA 4I4LA 3ZDQA 4QGHA 1WB9A 4DIDA
chains in the Genus database with same CATH superfamily
4J76A 4JX8A 4NCHA 4O4IF 3OA0A 4K9NA 1UBMS 3ND6A 4EY7A 3E9DA 1PS0A 1IIRA 2VT2A 4KQ6A 4L28A 2ZVDA 2HXYA 4AWBA 4YMLA 2P0AA 2P0EA 1P3JA 5DW0A 1VIDA 2VK4A 4HWKA 2O7QA 1H9AA 3TSOA 2CFSA 3FNBA 2VDQB 4LE1A 2ABWA 3DB1A 3AHIA 1PD1A 3DZBA 1I8TA 4LTMA 3TTWA 3OPXA 3U49A 1RQNA 3KBOA 3EVAA 5FHRA 3RG2A 1PZNA 3ZV6A 4LY3A 1A69A 3ZKAA 3GFQA 4M9ZA 4R83A 4B48A 4G4JA 2WT4A 2CVZA 1ZWLA 3QQ5A 1NMZA 3W6PA 3CNOA 4J1TC 4BB6A 1CJVC 1ZC4A 2C7RA 4KMMA 1G291 4CPDA 1Z6AA 4N5IX 5JZMA 3OE7D 3UPUA 4C7OA 2QRLA 1SCUA 2DUWA 1BNCA 2L18A 2XODA 3AMVA 4RA9B 4JVOA 4F0JA 5ALGA 1WUTA 3OUUA 4Q0MA 1TUEA 5JISA 5CVCA 1MOSA 2C94A 1VE3A 4L2IB 3BTVA 1G1MA 2GA8A 3UUWA 3C4VA 4ENRA 1GNSA 4Y1FA 4FHEA 4DDKA 2P41A 3WDKA 1W29A 2OILA 4DCTA 4CODB 3AF2A 1ULHA 1BE6A 1I24A 4HTFA 4XE5A 2NUTA 2IOHA 2OORC 4LBYA 4R01A 5B58C 3SEFA 4YRAA 1YFJA 2OVBA 4J1SA 2AD1A 3QV1A 4PAQA 2H3HA 4M83A 2NM0A 1GZUA 3N8KA 5F2NA 4U2DA 1VYUA 4FS3A 1KJYA 1XLWA 2JEZA 3EASA 4K0KB 2ZSIA 2GS9A 4E5VA 1RAEA 3DQQA 2OV1A 3K1TA 2GCIA 1ZK4A 3OJ0A 3CWCA 2JFNA 1ISMA 2PZAA 4OJTA 1KZ6A 2D54A 5IBQA 4P33A 4M2LA 4HDMB 4JS0A 3I30X 3MUNA 4DRXB 5CH3A 2C8KA 4H35A 1WBBA 3O94A 4QPPA 2O8CA 4XUEA 1UBUS 4RO0A 5DHTA 3FVTA 4ODIA 4UVGA 1JFFA 1R0YA 3NEYA 1LDBA 2Q6KA 1JEQB 1K6EA 3GT3A 2GJAA 3GJZA 4G1FA 4TM8A 1VJGA 2C82A 2JJ8A 3KEOA 3WJAA 1ENPA 2R96A 1NJFA 1YIOA 4B83A 3C5CA 4F84A 3RODA 3SQDA 5JC8A 2E48A 1ZVQA 4BC0A 4ZDWA 1WQ3A 2PMEA 3K0KA 1P60A 3HFGA 1RRFA 2G07A 3WQRA 1A9YA 5EE3A 4ZXFA 2VF7A 3F6BX 5HW0A 2IDJA 1MPXA 4MGHA 3D6NB 4C7KA 1TK3A 3W5VA 4B1FA 2GMWA 2IEDA 4JUCA 3RK4A 2H1SA 1VCMA 1KI6A 2BFWA 2QTLA 4I8DA 1W87A 3BCUA 5UKDA 4HPWA 3RIXA 4MPTA 3F73A 3A1SA 2MOKA 3O2NA 1RXWA 5ALSA 3RS7A 2OE2A 1VI2A 2YZ2A 2IUUA 2OTCA 4A2PA 2I99A 2Q3EA 3GP3A 3VX3A 2ZUTA 5BQ5A 1JI3A 4XQEA 1MAAA 5LQRA 3COWA 1W75A 2CMDA 5FA8A 2F43A 2J67A 1Y7TA 4KDCA 5IK2A 3G1TA 3DHNA 1UDAA 4YAKA 2ZJFA 1B6RA 5D85A 4AS1A 3M4XA 4PHHA 2VNKA 3VZQA 1P9WA 5BSGA 2A14A 1WOMA 2FMKA 3JTMA 4FMDF 3TPFA 2QTAA 1YE5A 3N0RA 1V71A 1S3SA 1IAVA 2YWDA 3D7KA 4R0VA 1QB7A 2FUCA 4K1XA 3RTCA 4FK8A 3ZI7A 1M5RA 1E2EA 2RMKA 2CVHA 4WUVA 4TN5A 4M0PA 2G9NA 4BDTA 1ZX1A 1XUOA 3M8KA 3N2KA 2RAUA 3T5DA 1EI9A 1BS1A 1L6IA 1Z68A 3LT4A 4KCGA 3E1KA 2W70A 2GF2A 4XI9A 3QLTA 3WIUA 1BXRA 1QR6A 2BFCB 3GLGE 5I8PA 3LQQA 1C8BA 2OL4A 3CZMA 4YRPA 4EUFA 5AKKA 4OQ4A 3VM6A 1PZMA 2X0RA 1BQ3A 2B4RO 2N0SA 4HRXA 1YZHA 1VLLA 4IOLA 5CPFA 4DDMA 1TJPB 4CHGA 3B1ZA 3GP8A 1V6SA 1W4CA 1IY1A 2X8WA 5DEIA 3PRKE 4YNBA 1DU4A 2FWJA 1LI4A 1Y3DE 2VF2A 4YIHA 3IMEA 3QRWA 1ZUHA 2RFLA 1QUFA 4UDOA 3RVLA 1GZDA 3VFDA 4ENVA 1GLGA 3AF3A 3WSVA 5BWBA 1L1QA 1SC4A 3S2YA 3F5QA 3GHHA 2JBAA 3T12A 2J4FA 3HDJA 1DQNA 1PIWA 3BMOB 4RVDA 3PIRA 1AGNA 4EGAA 3JASA 3Q41A 5CD9A 3M6WA 2OHVA 4BAZA 5CCBA 4Y30A 1HE5A 4A03A 1WL8A 2ZPUA 2G83A 2YBDA 1YZNA 3OKPA 1JH8A 1BC5A 3CSUA 3L0BA 4M7PA 3AHEA 1U3DA 1G21A 1JPUA 2RI0A 3I01M 5THXA 4JI2B 1L7XA 4F92B 1QMGA 3VV3A 2BMDA 1R12A 2ZU6A 3PSAA 1H6BA 3D8SA 4CLEA 1ZKDA 3DHWC 3EZXA 2VTDA 4QQRA 4U2CA 4UHDA 3T1TA 2J48A 2QZ9A 4KUHA 2D3WA 3HPQA 4MDYA 1IRIA 3W8NA 2OMKA 1ISFA 1RWNA 4ACBA 4EZIA 1NP6A 1I3NA 2Y1FA 2ZS7A 3CPJB 3VPHA 5ER9A 4GM4A 2JLWA 4ESEA 4NV0A 5CR9A 3TI9A 4YUWA 5KTRA 4RL6A 4Y6RA 3R7WB 1Y8QA 4IVNA 1U94A 1GU0A 2PT7A 3UYLA 2FRVA 3VR5A 2R11A 2I34A 2EBFX 2R6DA 3R8XA 4BJHB 2BYTA 1ZVMA 3O8OB 1U9YA 1RPJA 3W34A 2ZLBA 2FFQA 5ALIA 3ZWCA 1I3CA 1NW7A 3JYLA 4DEVA 1ZH6A 4U4AA 5JRDS 2C4KA 1AMUA 3ZX5A 2NZ2A 1C4OA 3AVQA 1SNYA 5IABA 1T9CA 2P91A 2DG2A 4YEDA 2DPLA 4IJVA 4P82A 2D1YA 3G9QA 4OQLA 3T9BA 4UOEA 3UPTA 1GVNB 3L8HA 5AK3A 1TJ5A 3WP0A 1V8BA 1SK9A 2B37A 6ADHA 3ZK7A 3E9NA 1NKTA 3NUQA 4CDMA 4CEIB 2HSJA 4ZN6A 2FWBA 2Q0XA 4OYYA 3UBTA 5HVNA 1U11A 2BMVA 4ZAFA 4PBSA 4ZT4A 4U8GA 5BXQC 3H42B 3QA3E 1MZVA 5ITZB 2I6QA 1NOKA 2IIQA 4ZHQB 3WJ1A 4KVAA 3IBFA 3KV3O 4RD6A 4ZFNA 1USWA 2R8OA 1UOOA 5IAEA 3GZTB 4R51A 4ALNA 7YASA 3LKVA 4I3FA 1Q2XA 4EX6A 5CB6A 3AERA 2XQVA 4OHBA 2QUJA 4C0KA 1Y33E 2JHPA 3ZW9A 4LSZA 1J2JA 1YZGA 4EATA 3KG2A 3DE6X 3N9IA 3R6TA 4CQLA 4FB5A 5EJEA 2Y1DA 5IFLA 4KE9A 5IUNC 4OI1A 3LHSA 4R2HA 3TEMA 1SGWA 5I9BA 1P0CA 3G5LA 2VH1A 2IYRA 1WB4A 3R3JA 1F60A 1KAQA 4QQFA 4DNPA 4M1ZA 2W6QA 1KIMA 1NSFA 1CVLA 4EABA 5BRJA 1W48A 4RLFA 2J0SA 1V9SA 5F1YA 1TAGA 4Y2TA 3UFBA 1VJDA 3LVFO 3NX4A 4DRZA 1D03A 2C3PA 3JQ9C 3D1JA 1PNVA 4IHKA 1P7CA 5CDYA 1FVFA 5IXJA 3R3SA 1GZ6A 2X0JA 4IF4A 4NPCA 1N2HA 3OMXA 1IZ0A 3AETB 5D3KA 3QTLA 4COOA 2PS3A 2GVDC 1M3SA 2G1PA 2PIDA 5J4YA 4D3DA 4JEMA 1YS4A 4H7JA 1BS2A 3BHMA 1N57A 2BOVA 2UYYA 3WAKA 3GFVA 1YRLA 2GBPA 4I3HA 4KW7A 4L1KA 2PA3A 1JTEA 2HDNB 5K0JA 4ALMA 4X1YA 2IHUA 3TQQA 5C5DA 1P81A 3CT4A 3STWA 3QJYA 1ZA1A 4Y6QA 1I1OA 3NNNA 2O52A 5I9MA 4ZOLB 3MWKA 3NT2A 4JCOA 3SZLA 1HLFA 2K5UA 4G0XA 1OASA 4H3VA 3PE3A 2WD9A 2FZ5A 5I4CA 3PEUA 1Z6ZA 2V7GA 3EQ7A 4O4HA 4NMWA 1AT1A 2ZWPA 1CUJA 5DX0A 4BWVA 1DDOA 3PUWA 5EE0A 4DVGA 4UU8A 3OQ6A 2QMYA 2ZYHA 4AU1A 1C0KA 2G70A 3AR4A 1MDBA 3VMMA 4C7BA 2MSEB 4LK3A 1BDBA 2BUAA 3DAHA 4A8JB 1MAVA 2IE0A 4EENA 1J23A 2DCMA 3FWZA 1SC3A 4F2WA 2P4UA 4HDCA 4M21A 3G0DA 3N07A 5KVQA 3GFRA 2B25A 1EJ0A 1MO5A 4RVFA 5IKPA 1KXZA 3L0IB 4UMFA 2RHJA 1P0PA 4EPXA 1AUPA 3A58B 1N34B 2QI9F 1NV9A 1C7JA 3AEQA 3AGQA 4IIXA 4AO6A 3J80A 1B3BA 3JATA 1CJCA 1LDGA 2J07A 1ONBA 3C6ZA 4MUMA 4UM9D 3FCXA 4HLDA 4FS8A 3TGPA 3O3OB 3QPDA 1GUBA 1XR3A 1YS2X 3JVIA 3KQHA 1Q84A 1XQWA 2HJWA 3ISVA 2V3WA 4LTNA 4E1BA 2QZJA 4GF5A 4M0LA 1LVGA 4DAOA 1L5SA 5BQXA 3UJBA 1DI0A 4WJKB 4BWGA 1J5XA 1EEHA 3IT0A 5BR1A 3A4YA 5FUXA 2WSSA 3MRXA 1T9BA 5FWYA 1TJNA 2ES4A 3KL4A 3NWBA 2E21A 3QFCA 2F8MA 4Q4JB 3F97A 2CD9A 2YWHA 4YP9A 1O4VA 1JDNA 1EE1A 2WP0A 3HSYA 1DS6A 1XMXA 3HWWA 4F21A 5KTMA 5HTOA 5B3AA 2O14A 1NBOA 3LPCA 1WV1A 4GMXA 3UYKA 3GLIE 4MW7A 1SZCA 1WHTA 3A6EA 1C81A 1N8TA 5JG7A 3WBKA 5LOVA 3SE7A 3HHEA 4YRZA 2Q3HA 4QHYA 3TRDA 4W5QA 3UATA 1FFCA 1OGYA 2QRJA 4P7FA 3AW8A 3IL2A 2Q50A 5FTWA 1Z4OA 2REOA 2D5IA 5IZ4A 3AVXA 2GHTA 1ZW1A 2CLDX 1OZFA 2HPZA 3JQPA 5K09A 5J2TA 3INTA 1AK2A 2VDMB 2XZLA 3OMWA 1XNQB 1G21E 2WFZA 4PSAA 1N2JA 3F6EX 5CT4A 2QG6A 3LRXA 4OY3A 3KWFA 3OFVA 5COAA 4EQZA 4YAOA 2O1EA 3SKYA 5B3JC 1V4BA 1VDMA 2GN0A 2HRZA 1GPUA 1I14A 1U0OC 3KYDA 4JEIA 5CT8A 5NULA 1OI2A 3S7TA 1UT8A 4YP7A 4EBFA 1KU0A 1OREA 1YB5A 1TL7C 4RZIA 3G2QA 1VGQA 1G3MA 3L9XA 4G5SA 1YC5A 2V8OA 3KP1A 4MEJA 2AZTA 3P26A 4MHOA 4OMDA 1IPHA 1OI7A 4JELA 5DYNA 4B75A 4D9HA 2I4NA 3EXIB 1SBZA 3D5EA 1BWQA 4WXRA 1FZTA 1NURA 2ZATA 1A4IA 1KI1A 1L5OA 2VP9A 2WUGA 1Z2PX 3HCDA 3NRCA 5JSUA 5I5GA 5JDCA 4GW3A 2WNHA 2EF1A 1XHLA 3NWOA 2NIPA 1JAXA 1B26A 4NYMR 1HI9A 4LGCA 3AH8A 1SULA 2PKXA 3K4HA 4U1RA 3H87A 5SY9A 2POCA 3PGKA 2OCDA 3TLAA 3RYIB 4BQOA 3H5VA 1XQ9A 4JXKA 5HK9A 4YJKA 2CDAA 1TYZA 2I3GA 3DMGA 5F1KA 4NOLA 1TM7E 2C42A 4Z4CA 4TQGA 5AOVA 1GVHA 1F8XA 2O5RA 2I6GA 4PYOA 3HBMA 4Q9AA 1GOTA 3DOFA 3GEBA 4N7RA 1G8AA 3DAOA 1OB2A 1Z0IA 3DO6A 1GG2A 1PJRA 4RY8A 4ESHA 2WWRA 3AFNA 2ETVA 3TIFA 4QJBA 5JFTA 5GOTA 2ZR0A 3G8DA 4ZODA 1PZXA 2WDPA 1OBFO 1X7XB 4H9GA 4OMCA 2XUPA 1L7EA 2YJ5A 2IYSA 1OX5A 4TQUS 3U81A 3MOSA 4E14A 3D1VA 2CUTA 3VR5H 4R40A 1GRCA 1SOUA 3E3NA 2P0YA 1TOAA 3DO8A 2LRHA 3L7AA 4QGAA 5DH9A 4ZAYA 2I22A 4CMKA 2ZR9A 3LQ2A 3O91A 4JENA 4PYIA 1M9NA 5AD1A 2EEZA 4MGKR 1O5TA 3D6JA 1EG7A 4ZYUA 4D9KA 2I80A 3HVKA 2QAGA 1KAMA 1M6YA 1LBHA 3RASA 2ASEA 4DAEA 4F7WA 1S8AA 1M2NA 2PWPA 4D5GA 3WR5A 3OP4A 4RJTA 3EUFA 1KNQA 4F8YA 1PWHA 3CNQS 3OT1A 4ENTA 1C7ZA 2E18A 4QU0A 5K05A 2R65A 2DTEA 4KIGA 4LHVA 2EBHX 4NEHB 1X80A 2BFDA 3D3JA 1CY1A 4IINA 1XZDA 2I7VA 3TSWA 3HYRA 5GINE 3LXUX 5LM3A 2VUSA 3ETEA 3C2QA 1IUNA 1UCFA 3WRYA 3CVWA 2BGJA 4ZHSA 1WCIA 4JJ4A 3HZHA 2JAHA 3MELA 3PNYA 4ZAVA 3GAZA 3G49A 3M33A 3UVEA 4KLNA 3OJXA 3ZGZA 3L05A 1MZPA 3IQWA 4UEQA 5BSHA 2PA0A 2ZBDA 4J0IA 4C29A 4MMXB 2RAPA 2JCGA 4CETA 4Q3LA 4DV6B 3WISA 5ICCA 3JQAA 5LP6A 3IP9A 4AN1A 4A8HA 4R3WA 1S3IA 4BVLA 5CM2Z 1B3RA 1MD9A 5LWHA 2FPLA 3Q1KA 5H8WA 1ZN8A 4EHJA 2QX7A 4GEKA 1C7EA 1S8NA 1TCVA 2H1IA 3NOVA 4PZZA 4WXMA 5TQVA 1OB5A 4HDOB 4WOKA 2G7MC 2WVHA 2A4MA 4HLNA 3WQSB 1TUIA 2Q5QA 1SD2A 4WINA 1TIKA 1IHPA 2W6PA 3PGMA 1ZGZA 2JRLA 4WGFA 2GO7A 4J0QA 5F7OA 1M2OA 5KSWB 3COYA 4U6QA 3TBFA 2QD2A 3VI3B 8MHTA 2X23A 3GT7A 4NY1A 1G6OA 4BB0A 3VMFA 2AG6A 1NW8A 4HZGA 2WYOA 3ER8A 5CBPA 1VI5A 2A7QA 3IAXA 1DG3A 1NVXQ 5DYWA 1CQJA 5JUWA 5EIBD 3SICE 1L9XA 1GADO 1KMHB 3EGXB 3LKBA 4REMA 4II7A 2QM7A 2A1UB 3VAAA 2BHSA 2IW1A 1ORHA 2VYNA 4ZKEA 4LZLA 3ZU3A 4H15A 3TLYA 4B0PA 3RJMA 1ZK3A 5A9SA 4OA5A 4EHNA 3WICA 4EY6A 4FDTA 2V55B 4H31A 3KEGA 4GPTA 1N3IA 3O3CA 4OHMA 4JIGA 1MQSA 3GRFA 3FRHA 2PY6A 4FDVA 4PLPA 3R7BA 3T4UA 5KTKA 1N32B 1NUTA 3EQ6A 2VJAA 1DARA 1Z7BA 1QG6A 3OEWA 4IGEA 4XLLA 1F5NA 3TOZA 3W1VA 3QX3A 1UDRA 2HHLA 2HZBA 3A1WA 3HEBA 3ON5A 3HYTA 1CSEE 1TCCA 4DUPA 5FOSA 4P9NA 3RRXA 3UKJA 4DZRA 1WXHA 2WIJA 3E5RA 1E79A 3AUAA 2I2DA 3PC7A 3TMKA 2XF8A 4Y2VA 3JZIA 1UEXC 2Q62A 4FXOA 3E70C 2WWVD 3ZS8A 4C4SA 3GJ3A 1MJHA 4G9GA 2NSHA 3Q5DA 4JT9A 4B9AA 1Y3BE 1KAGA 2XX3A 5DMHA 4FFSA 1P5JA 3CUUA 1T29A 4FSDA 3AL2A 2B3DA 4HWGA 1PJLA 1P2GA 3B70A 4MXDA 4D96A 1VLJA 2EAUA 2VHXA 2GLUA 5F9MA 1ADCA 1IHYA 5IJ0A 3PYMA 3KQKA 4BNGA 3R6GA 2I62A 2E2WA 2YFKA 3HL0A 5HCIA 5AK5A 1R0WA 1N1MA 2YV1A 3M4NA 3QNMA 4BEJA 3D6TB 3BA6A 4F96A 2Q2VA 1KPHA 3RYCB 2ZYIA 4X0EA 2BW0A 1J9ZA 4KQJA 4LISA 1U5CA 5KYUB 2J7PA 3HSSA 1E92A 3ACBA 2PKYX 3DDWA 4N1AA 4EY3A 3U7IA 3GGSA 3U0BA 3V6MA 4D8XA 2HT1A 1HL3A 2IZ1A 1FW6A 1FBNA 4Z3OA 1NN3A 2CJPA 1P8JA 4A0GA 1IK4A 4P3PA 1Y42X 2R1TB 3DAYA 4LNAA 5I7HA 2CB0A 3NG1A 3W2HA 2O5VA 4EPRA 2WWGA 4BTLA 1L5WA 2CF6A 2E6UX 1VRCA 1Z22A 4GMKA 5A0FA 3KJZA 2GKGA 2IF0A 4ZQEA 4V1CB 2X9VA 2TMDA 5IC4A 2HWUA 3S2GA 2WWTA 5FUWA 1YK1A 4B6OA 4CF3A 1MP0A 1Y63A 1PS8A 3PFFA 3PUYA 4CLRA 1PGNA 3DDCA 4F38A 1OOEA 2YJGA 4DPKA 4HRYA 5ISMA 3PJRA 1ES9A 1H05A 2ZBPA 2IHJA 4R16A 1G59A 2W00A 2R6HA 2GBIA 1VB5A 4JLPA 3GN1A 4R8RA 4CCYB 4ZI2A 1VC2A 3VR4A 4E70A 1PYOA 2PL3A 3DOJA 3HG7A 4NC9A 4QSMA 5B37A 2WJPA 3K6JA 4OBEA 2VH5R 4EPTA 3LY9A 4E33A 4ZEVA 1RQXA 3O8RA 4RCZA 2I1QA 1JA0A 5AXAA 1N9ZA 2VTKA 4W8OA 3C3JA 3EIFA 1N77A 1ZCZA 3GDGA 3T6KA 1EQ2A 4HS9A 5DT9A 5ECWA 1BFKA 4JR2A 2O1XA 1M2HA 1KL7A 1XTPA 2COUA 4RK1A 4UKDA 5EMLA 4FYIA 1XRMA 1TU4A 2QAGC 2PMBA 3PXBA 1CJBA 3U7QB 1QF6A 4BHTA 2ACWA 4E4RA 1C9DB 1KBZA 3U19A 4CKYA 2VCEA 1JSCA 1Q1GA 1DOZA 4LA4A 1DXOA 3CEPB 3GVHA 4OXIA 3S2FA 1NUPA 4J29A 3X1DA 3DCIA 5HQJA 3ZHRA 1KA9H 1YMUA 4OB6A 3E3LA 1DV1A 3A05A 1D6MA 5IW8A 5JNRA 3V33A 2HRDA 2WK1A 4TXMA 4BWFB 4CMJA 3DDSA 4RESA 2P68A 4HRAA 5J63A 1U3FA 1U7ZA 2P77A 1WRBA 4I5FA 3WRYC 4AYWA 4ZJPA 1W8DA 3FWHA 3K1JA 4I0WB 5EKTA 4FCTA 1UBFA 4HQNA 3KO8A 2TMYA 3CX7A 2GSWA 4RC9A 2OA0A 3TSCA 5BNZA 3HVJA 5KQSA 1I0LA 3H4MA 1A4RA 2ZP1A 1GSIA 2XMCA 3VOSA 1F0KA 1UXOA 1I4OA 1O9GA 1YRQA 3ZE8A 1V4VA 2H29A 5LP6C 4K87A 4K3UA 1Y8RA 1UMCA 1V9CA 3FH0A 3I9NA 1A9XB 1SHZA 3O4FA 4FOLA 2C4NA 2PLFA 4IWXA 5A0TA 3K2IA 5HA5A 1QRAA 2GEKA 2NO9A 1QHGA 2QAJA 2PRIA 3HBFA 1WV0A 4M7WA 3STVA 3VDRA 4A6EA 4BX3A 4YUAA 1G63A 1HSZA 3I73A 4H6WA 4BRWA 4M0DA 4KR7A 4G4GA 4N0QA 4JP3A 2OP0A 4MUAA 2DRIA 4QGSA 4RA6A 5HCUA 1SC1A 3NV7A 4C2UA 4D0NA 4PVCA 1QUEA 4PZ9A 1D2AA 2BV3A 5HTKA 5DHUA 3EF0A 1ZM4A 2QB5A 1QU3A 4A5OA 1PV4A 2EGHA 3H11A 3AVWA 4F3NA 4RXTA 2OHXA 3WS7A 1OGIA 1IL0A 4RTKA 3PXDA 3ND8A 3MILA 4UE6A 3D3WB 1Z5ZA 3TOCA 1F8GA 4NYIQ 3ZUPA 2DBYA 3IV9A 1E5VA 1M8FA 1U2DA 3DM9B 2OSBA 1NW3A 4YCJA 3LUGA 1M5UA 3QA9A 2YWXA 4XA8A 1OTXA 1EQUA 4GAEA 4X7BA 4H17A 3AB3A 2Y4OA 1D7AA 1U04A 3TZEA 4EFNA 4EO7A 4QZVA 5EJ6A 1USUA 3IDZA 1I2DA 1M34E 5JQGB 3WA7A 1NXOA 4JQYA 1QFMA 3Q2IA 2OR3A 1PGQA 1GDDA 1T9KA 3NOOA 3LUDA 3M3DA 1OLSA 1GZHB 3IQIX 3MWEA 4L08A 2ZBQA 3T5PA 5HP4A 4FUQA 4PHFA 1NN0A 1R4ZA 3DF9A 4LHXA 1AGXA 2QGZA 1FNMA 3CZ4A 3I45A 4IIYA 4Q3KA 4GH5A 1R9JA 1C4XA 4IXMA 3SYRA 3U7RA 1E2HA 3F4BA 2V6BA 3DE2X 4XD7A 1I51A 5EUBA 1PG5A 4EBBA 3ORHA 1IEVA 2UV8A 3VPCA 2CVPA 3EFOA 3NDJA 4O6VA 1TYAE 3TCNA 3W5BA 3ICQB 3ECAA 1PR9A 1QO0A 5H9WA 2R47A 1QF9A 3BSYA 4NHOA 2LIPA 4N40A 4O4IA 4TMZA 2NXWA 1L7VC 1Z74A 1E4YA 1S1MA 1RWVA 4FPXA 3SN6A 4QJIA 1AQLA 3LOUA 5AKXA 4LC0A 4MYHA 1K66A 5J3JA 2QTGA 3OLZA 1WX1A 4HQOA 4IYJA 3OOWA 4ROTA 3RAGA 3VZBA 1ND6A 2JAOA 1L5MA 3QBTA 5JWRA 4OP3A 2RI1A 1RHQA 1U3GA 4M0CA 3RBAA 2MWMA 1EXMA 1I10A 1Q57A 2OOSA 2HRQA 1N5DA 1HE8B 4YBZA 5TPZD 4TOIA 4EVRA 1DJPA 3LFUA 3QMWA 2F67A 3D9QX 5ARCA 5JMPA 4GC5A 5E9QA 2BCEA 4BBJA 4AT1A 2R9VA 2A0UA 3AG6A 1QIKA 4J7XA 1JP7A 1ZXXA 3AM4A 3PPIA 1XELA 2NVBA 3A9VA 1SHJA 2NPFA 2QD5A 5FL7D 4CMBA 1BROA 1SBQA 1NX6A 2YV4A 1AS2A 5ALLA 1QYWA 5D00A 1EHIA 3CUTA 3IESA 3IURA 1T2FA 2C9DA 3C0KA 4KIWA 3D0OA 3ZHZA 2WJWA 3GBSA 2G0TA 1WU8A 1HF3A 3NDIA 3H9EO 3P4XA 5ESWA 5B1YA 5A5VA 1GPMA 1P1BA 1Y5IA 3IP3A 4LJ5A 1NUHA 1LPPA 3K5HA 1EJBA 3ADPA 3MLEA 3W3AA 2P2YA 4NWIA 4OM8A 4Q3NA 5GJVC 2HI0A 3L7IA 2OV6A 4DLWA 1T10A 4HNVA 4OH1A 5CNMA 4JVNA 2P9HA 4KAFA 1PJQA 2FPMA 1N6HA 1EFDN 1F12A 1N5OX 1YASA 2ERXA 2GZSA 2XT0A 3Q3GE 3G9XA 1VE1A 4RH0A 1U9CA 1NL3A 4D3XA 4QG3A 2SBTA 3LS2A 3R40A 2PX0A 2WPDA 5DTMA 1UZUA 3T4PA 4CL8A 2CFOA 1XZ8A 5DBEX 4XJTA 5JBQA 2FMUA 4PXYA 1ZN7A 2HSEA 2Q3FA 3TFQA 4FUTA 5DNAA 1LVUA 2AJTA 3BTOA 2JDIA 2WI8A 4QTTB 4WJZA 4IDHA 1QX3A 3LW7A 4TVBA 4HUTA 4C7OB 5LMCA 1QTIA 1SCUB 2DECA 2X7HA 3OIDA 3ZZ0A 3CLTD 1D0IA 1PR5A 2WYIA 2ZW9A 2WF9A 4JEUA 3UA3A 1GRQA 5KUTA 4RL4A 1NFFA 5T4EA 4Z0TA 3JAMA 1AB5A 3ZWOA 3O8DA 2H9IA 2YY5A 2GK4A 1XKQA 2Z6VA 3E84A 4DXHA 1CQZA 4V38A 4BUZA 1W5BA 4G56A 3WB0A 4DCCA 4I1IA 3AL0C 2NUTB 4GP6A 4RPHA 2NAPA 5CVDA 2YCLA 3RWBA 1Z47A 1GPLA 1DRKA 2ZGVA 1NZFA 3B60A 1NP3A 4AP9A 3FMVA 3NI2A 4JSRA 2NU6A 3D2CA 2J45A 4TKLA 1R9NA 2FPUA 4UAJA 1PL6A 1E5XA 3EIQA 2Q2NA 5GONA 4EHBA 2MSDB 4BMSA 1RYHA 5JZ9A 2X6RA 4L95C 1QIHA 1CG6A 4IJQA 3ZWXA 1RI1A 1HC7A 2JH9A 3G8BA 3H86A 3U0VA 2AA3A 2EKZA 1ZCAA 2FXIA 1B6GA 3GRUA 3GRVA 3S28A 3TQOA 2E6KA 1JE1A 2D7DA 3T95A 1NWCA 2ODEA 2P6NA 2WU3A 4J0CA 5ALXA 5FQOA 1UBTS 2EFGA 4RK0A 3TW8A 4DKXA 4TM7A 4GEGA 2OPHA 1JSRA 1XCLA 3I6ZA 3KUUA 3MSXA 2C1XA 1CDZA 1JFFB 3INYA 3D7LA 3M3HA 3U5TA 3MQ4A 1K2WA 1VGRA 4M9UA 1AGRA 4BNZA 4LUCA 1Q0RA 3W4IA 5TY0A 3NBAA 4H27A 4DCJA 1DBQA 1UDXA 2HEIA 4MV8A 4R7GA 1E2UA 4NOMA 5E4FA 4DGQA 5HMMA 5IKEA 2VHJA 2C1ZA 3I8OA 4JI5B 4N54A 3EC1A 3HNPA 3BMQA 1CJSA 2QVBA 4D41A 4HUQA 1E77A 2C2YA 1U2DC 3P71T 1Q95A 3Q11A 1KI6B 4NE7A 3PC2A 3VU0A 3VJRA 4PYQA 3D54D 3IRVA 4FR0A 4XSHA 9MHTA 1GP2A 4CM1A 3K0BA 4GG1A 3RVSA 4JZKA 2N42A 2JGIA 5JNTA 3QU5A 1Y0BA 2R6JA 3TE6A 1PUIA 1S2MA 1UOEA 1PV2A 4FLMA 3SR3A 4CNBA 2OB1A 4HWSA 1IJEA 2F43B 3DULA 2I3AA 3E5HA 4KPGA 4E03A 1K89A 2HF8A 4DA4A 1V7CA 5BSRA 4DB2A 5EFOA 3KM0A 3QWHA 3UOWA 1M74A 1MW8X 2OUKA 1U98A 4MS1A 4BKPA 5BWLA 2BL4A 3EYAA 3F90A 3HUDA 1WQ1R 1YIAA 1P2VA 4AJJA 4TQ9A 3K1ZA 2AL7A 4DJTA 3DS8A 1Y6GA 2HWKA 1G55A 5DHRA 4BU0A 4NF2A 4FNOA 4K2AA 1SKYB 3P4UA 4IWNA 3COZA 2W2KA 1YB2A 3LUHA 3P5SA 3HZRA 4EOGA 4G1CA 3ICPA 1ADJA 2V6MA 4A92A 3N2KB 4QOHA 5B3KA 4IRMA 1KE2A 5CBKA 1G4AE 5JAIA 1A4XA 4AS2A 3ZD7A 1BXRB 2V54A 1IZ8A 2BSQA 1NU6A 4NSNA 3ZJ5A 4ND8A 3TF5A 3OZTA 1G1AA 3FUXA 5HOEA 5BWOA 2NQ2C 2ZRBA 1JBQA 3E48A 2PBLA 3ZC3A 1H3EA 5I9IA 1WXIA 1G38A 3W5DA 1YTUA 1FFGA 1UKBA 3R5HA 3FD8A 1SZJG 4YRCA 3X3HA 1N2XA 2O3QA 1SUEA 3F67A 2XPCA 4NHEA 5HR5A 3G02A 3MCWA 5GIPE 1HNZB 2O6LA 2I91A 3I4CA 3VKFA 3OFKA 5T4BA 2JBAB 3WKEA 1AKEA 1FQOA 4G07A 4C4TA 4XYEA 3CJTA 2CEAA 1Q1EA 1GGHA 4KXVA 4DREA 4F6CA 1Z5GA 2HQOA 4HDAA 4H6VA 1KP2A 3IC5A 1U99A 2IOFK 2Q6LA 1RC0A 4KGVA 3SK0A 4MAMA 4RMNA 3OZXA 3ZHQA 1AJEA 2O0LA 2O0JA 1ABFA 2C9YA 5EJIA 1OV4A 3BGOS 1O96A 4R4JA 4DJJA 1G21B 4PC1A 3TXYA 1VHDA 4N5DA 2QN2A 2WJZB 2BHLA 3K5IA 3SE0A 3LA6A 4X91A 4DCNA 4MUHA 1J8FA 1E5TA 4C3VA 4TTAA 4Z1MD 4YRNA 5L3SA 4ND2A 2XV1A 3LV8A 2ZITA 1ZICA 4KP7A 4BRZA 5CB0A 1SPXA 2FFBA 4CLHA 3L6UA 5EIWA 4F4HA 3LLSA 2WA1A 3N6VA 5DWQA 5IC6A 4MS3A 3FVQA 3IE2A 1IY2A 1JJ7A 1H94A 1RZUA 4IPTA 4OJYA 5LZ7A 1WCWA 3PEYA 4DA8A 1KZYC 1PWZA 2CYAA 3QWIA 2EFCB 1SCAA 1K63A 1C1XA 2IPNA 4GX5A 4L16A 3QEKA 3I12A 4Q9DA 1ZRHA 4O59O 1UJCA 4DR6B 3L6OO 1Y8QB 2X0KA 4F06A 1PSWA 3T9CA 1N2GA 3I39X 2P2NA 5JO0A 4IHAA 4EHDA 1XEFA 3H4IA 3N2EA 3UC9A 4J7UA 1QAOA 1TKBA 2DHQA 3CY6A 4IDAA 1OX4A 3QYFA 3ZXYA 4XW2A 4ACAA 4WXYB 4CF4A 4YPOA 5ITSA 3RFUA 5DV9A 3RYFA 3U3XA 3N6RA 4QDUA 1ZIXA 2HY7A 3GCDA 3E8MA 4XWWA 5G4KA 3U6KA 1WP9A 1V9LA 3BFKA 3C4JA 3NP9A 5KYTA 3A9RA 5EZ5A 3FGZA 4DC1A 2Y67A 5JI2E 1S01A 1U3WA 4WMLA 3DO5A 4PTZA 5CU7A 5T64A 4B81A 4GGOA 1ZONA 5E6SB 2PUVA 3V2UA 4WGGA 3DEIA 2KM1A 1ML3A 1L8LA 5LMZA 4DQKA 1Q5PA 4ZRDA 4Q1BA 3I2GA 5JTUA 2PSJA 1OWOA 3UCXA 5AVQA 2VUTA 4G5GA 1LV8A 4RAOA 3SC2A 3X1XA 2X86A 2PBFA 1H4QA 1G17A 3PFKA 1PFUA 3W3AH 3C5VA 1UFOA 1M8KA 2AEFA 2GF9A 4B32A 3AERB 1C2YA 4X7MA 4O4JF 5CLFA 2ICAA 1W4BA 3VTZA 3FKSD 2JD0A 2Y1XA 4CQLB 4RPGA 5LJIA 4LZOA 2LUOA 4Q7EA 3HJFA 1LWOA 1WF6A 1WO8A 1IQUA 4BNKA 2ZUCA 2CXRA 5JSZA 4WOBA 2A58A 2AVNA 2I4MA 2OZEA 3K9GA 1Y3FE 3D4PA 4FYVA 5ER6A 3W7VA 3DVLA 1PI3A 4OH7A 3WK5A 4AKTA 1RLMA 1YR7A 1E9EA 3IA7A 4M54A 3GVIA 2M6KA 3Q87B 2ZTMA 3E27A 4FYYA 5CFZA 8AT1A 4B80A 1VXRA 2GEVA 4OHKA 3MWDA 1YU9A 4MV9A 1Z2NX 3SLKA 2JJ2D 1ZSNA 2Z6UA 1X7ZA 1MGPA 4MGZR 3TTTA 3EGDA 4OMUA 3LY5A 4F9FA 3UG6A 1QONA 4HWTA 4DNOA 2EW1A 4BPBA 3PV0A 2QVLA 4O33A 4YRFA 2YRXA 4S1VA 3LBNA 3CXRA 1ZK0A 4HPXB 4IV0A 4DT1B 5LKAA 3OO1A 2NXCA 4F11A 2RHTA 1B93A 1KU6A 2UYQA 3A04A 3FCCA 2QN8A 1WLYA 2YRFA 3HU2A 2NV2B 4IVPA 1NVVQ 4R31A 1UJ5A 1YV9A 1RIIA 3HV2A 1XNJA 1C0EA 3IT2A 3JWIA 4OU5A 4X1YB 3TOXA 3UH1A 2A1IA 2FLWA 4IOKA 5EE1A 2QMQA 5K0NA 4FNMA 2FEAA 4F4IA 5I7VA 2G36A 3OIWA 2PD3A 2KSQA 4K6KA 1QNLA 4J6EA 5AW3A 2Q7XA 1GPWB 3OAAA 2BEKA 4O4HB 3V4SA 4MUIA 1L3IA 5H1YA 4EYSA 4GRIA 1RBYA 2CLKB 4W9RA 4TX1A 2VK1A 5F35A 3RVBA 3WQBA 1HXHA 1VHJA 1YUMA 1IE3A 1NQVA 2V6JA 4I19A 2NVWA 3Q40A 4P4UA 3RNLA 3SFZA 2CL5A 2HLPA 1TVMA 5TR9A 1IN6A 4B8ZA 2VRCD 3IPLA 1X94A 5HFNA 3AJEA 3KT8A 3OZSA 5H0IA 4XWKA 4JQOA 1CY8A 4M1SA 4PBTA 2JLSA 4ZV7A 2AFIB 1AUVA 2AJBA 3KTFA 1WMBA 3C7AA 4JP8A 4IXTA 3CRW1 3OU2A 3U2QA 3WLOA 1T0PA 3ETHA