1M2OB

Crystal structure of the sec23-sar1 complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
167
structure length
164
Chain Sequence
GKLLFLGLDNAGKTTLLHMLKNDRLATLQPTWHPTSEELAIGNIKFTTFDLGGHIQARRLWKDYFPEVNGIVFLVDAADPERFDEARVELDALFNIAELKDVPFVILGNKIDAPNAVSEAELRSALGLLNTTGIEGQRPVEVFMCSVVMRNGYLEAFQWLSQYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Sec23/24-Sar1 pre-budding complex of the COPII vesicle coat
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport/signaling protein
molecule keywords protein transport protein SEC23
total genus 47
structure length 164
sequence length 167
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1m2oB00
1E2LA 3F0TA 2FEMA 4B75A 4EAQA 3IKJA 2X77A 3L0SA 3FHTA 2PH1A 2REOA 2YZ2A 4NYMR 4C0HA 1OXXK 1U99A 5FL7D 1XCPA 4FD2A 3IPXA 1AQYA 1X1SA 2J7PA 1XJQA 4YDHB 1W0KD 5KO2A 4M1YA 2C78A 4Z1MD 2FX3A 4KFSA 1E1RD 4JBWA 2O0HA 1G8HA 1Q3HA 4QGGA 3M0EA 4ESVA 1M1YE 4DHEA 1US8B 3FKQA 3BRWD 5FTJA 4NDZA 2CVHA 2F6RA 4D6PA 3U3KA 2XSZD 5BYJA 1ZW6A 2FG5A 4HB0A 4F93B 3GPLA 3B13B 5LBIA 4GBMA 4A8JC 1ZNXA 2DFNA 1PLLA 2OCBA 1N6RA 1ZC3A 3E5HA 2XXAB 4FI3C 2BHRA 3T34A 5E3HA 3EWSA 4TSFD 5BN4A 3U3RA 2V54A 1ONBA 4OBEA 1G8PA 2E1RA 4OYHA 4IOJA 4ACBA 3IEVA 4L9WA 1VIYA 1OFIA 4BFYA 3AF0A 1N0WA 3SBDA 3K0SA 1RPZA 1D2EA 3HPQA 4HAVA 1OSNA 4OKSA 1TMKA 3C5HA 1G5RA 5BXQC 3DMDA 4QKQA 3P20A 5FBWB 4KV9A 1XPUA 1I2MA 1SHKA 2OO7A 2OZEA 2IWHA 4C0QC 4ASUD 4GMDA 2H57A 3HYRA 4M1MA 3EX7C 5EXSA 1ZD1A 3UWKA 1G8YA 2NPIA 4GOXA 1HYQA 3GLHB 5KSYA 2CXXA 2NGRA 4GI7A 4TQAA 1RRFA 2XX3A 2OEPA 1GRQA 3Q72A 2RGNA 1U8ZA 4O0MA 4B6EA 1AS0A 3VKWA 2ZUBA 5JEDA 3QNUA 4S35A 1YVDA 4HLUA 1G6OA 4DUGD 4LYFA 4KSBA 4M8NE 1E9BA 3T1OA 4PO1A 1HT1E 1Z06A 2V7QD 3EWAA 4EPVA 3EIQA 4L15A 5IK2A 4ZV4A 3GLFA 4XD7A 2ZE5A 4B48A 2PLFA 2QP4A 4QJ5A 4B34A 3ECCA 1IN7A 2QMEA 3MWYW 2ZR9A 3C15C 2C03A 4UXHA 3SJAA 3UMSA 1FUUA 1NVWQ 2ZM5A 3AVVA 1RZ3A 1N0VC 1XEXB 5EP1A 3SEAA 5KNCA 4DCTA 1EFUA 4YMTA 3TW4A 2VQSA 4B35A 1OH6A 1EX6A 4HZUB 4A2WA 2JLXA 4UKDA 2Z4SA 1JR3E 3OIYA 4LYAA 5AJZA 3GMTA 1IBRA 3CZQA 2ZRPA 3K70B 4JLOA 4PQYA 5JCPA 3WXMA 1H8HA 1IM2A 4S2EA 4DRZA 5JJKA 3QSYA 4LPSA 3N2IA 5B57C 4QGAA 1VG0B 4B2LA 4JYBA 1VHLA 1S9DA 6Q21A 1EGAA 1JALA 3K9LA 3NDPA 3WMEA 3DVLA 4G5SA 3VAAA 1B23P 1ZM3A 2ZYVX 4PPFA 4PQFA 2W6IA 3BERA 4N0DA 5GJVC 3TUIC 5JRJA 2FPKA 3BOSA 2HT6A 5FUVA 3GFPA 3T5DA 2RGAA 4HLDA 5M04A 3K9NA 5DO9A 2ZANA 3UIEA 2ZJOA 3O8DA 1FW6A 1Q20A 2DWOA 1VECA 2LWIA 5C18A 2HDNB 4O3MA 2W2XA 3AB3A 3GEEA 3OIWA 2ZRCA 5IK2D 1U9IC 2OAQ1 3OEHD 3C16C 2JAQA 3LA6A 2IYXA 3WHLA 1EFHA 1XEWY 3GLIE 1U0LA 5FFMA 1II8A 4RZXA 2ZJ2A 1JNYA 2IYSA 3IDQA 1R5NA 3D6TB 4CEJB 1FQKA 2J0UB 5B30A 2GK6A 1E79A 1R10A 4RY2A 2CJWA 2WKRA 4IDQA 4NYMQ 1JR3A 3R9IA 1FFHA 2EVWX 2WPDD 5KOYA 4I99A 2R6FA 2KE5A 1NJFA 3BJIC 3GLFB 4Q4AB 1II0A 3U7FB 1ELOA 5K8IA 4ZCLA 5L3RA 1TUIA 4G0NA 5TARA 4BFSA 3U2QA 3GFTA 5KPJA 5L3SA 3L0OA 1DARA 4MKGA 4D0LB 1UM8A 4W7SA 3IO3A 1P2TA 4TLEA 3GLGE 2OFWA 4TSFA 4GOJA 1OB2A 2DBYA 1KO5A 2ZROA 3EPHA 1RRGA 4JSTA 3SDZA 4XSGA 4BGDA 3AH8A 2P3SA 1D6JA 2WSMA 2H92A 4NE2A 2YHSA 1Q44A 4US1R 3BD9A 3OE7D 4TZ0A 4OHYA 3AF4A 1GP2A 4A8JB 4ZCIA 2YV5A 3MRSA 4RKFA 2BJVA 3VNUA 2CBZA 1NVXQ 1E2KA 1XCGB 1UDWA 2P2LA 1GVNB 2QY9A 1E79D 2ZS9A 1ZD8A 3TMKA 1F2UB 3P27A 1XD9A 3KDSE 4B3CA 1NKSA 3GD7A 3HU1A 2OFXA 5FOTA 5KSOA 3TVDA 2J9RA 3CF6R 4ZDJA 4ZI3A 4BEJA 2ZRFA 3V00A 3VKHA 1N5JA 4N1AA 1G20E 4KBFA 4DXAA 4E07A 2QBYB 3MJRA 3AM1A 4TZ6A 3A8TA 4H9GA 1CBUA 1SGWA 3BFXA 2V8OA 4Q00A 1ZU4A 4RFSA 1G64A 3W6OA 1F2TB 1I4LD 1UADA 3E70C 1GITA 1AIPA 2JIZA 1M7GA 1OKKA 2PZFA 1BOFA 1M7HA 1Z6AA 2YWEA 4B32A 2PT7A 4HUQA 1IXSB 1OH8A 1KY2A 1YZLA 2FSGA 2XNSA 5EE1A 2RGXA 2B7BA 2GA8A 1OW3B 4A4DA 2AK3A 4A2PA 4P0TA 4QM7A 2ATVA 121PA 4HDQB 3RWMB 5K8LA 1YJ5A 1WA5A 2PEYA 4A15A 2Q9BA 3WNBA 4B3GA 3QJYA 5F9HA 2XEXA 4BRWA 4GNKA 2CLCX 3SBEA 4N3NA 2XZLA 1Z47A 1W4CA 3OEED 4GP7A 2IT1A 3T1TA 2W00A 3MUFA 2PMDA 2R65A 1YR8A 1Q1EA 3KUCA 4Q1FA 2EYQA 2AXNA 3VR3A 5CLLA 4C4PA 2FSIA 3IPYA 2VPPA 4A9AA 5J47A 2VP4A 1LV7A 4LC1A 4PZLA 2YVUA 3QKRB 2CK3D 1C1YA 3GJ5A 1ZM2A 3A58B 4B47A 2XB4A 2F1IA 1R0YA 4PHTA 1W2GA 2H16A 1YHNA 1G19A 5CITA 1IONA 3K0CC 2P6RA 3KQKA 2D3WA 2IEZA 3FKSA 3N70A 4DCNA 2QM7A 4TL8A 3TAUA 2HYDA 4BZPA 2V1XA 4TLCA 3AKEA 2V4ZA 4DSUA 3P4YA 2IF2A 1JEDA 3WP0A 4NYJQ 1VG8A 2F1HA 1KJYA 4F38A 2VBCA 4LZZA 3WHKA 3CIOA 1JR6A 3VR5A 4AYXA 1OH7A 1Z08A 4LBZA 1JECA 3REGA 3LBNA 3H0KA 2IYTA 3FE2A 3A1SA 1G3QA 3PQCA 2WVJA 3UMRA 5F98A 3SZRA 2XB2A 1GKYA 4OJKA 2C96A 2BBOA 3DHWC 1M34E 4TLDA 1XXHE 1SVWA 2P67A 4DCUA 2QT1A 5SZIA 1UBEA 4PC3A 1WBDA 1Q0UA 4DIDA 1DOAA 1TL7C 2GZHA 1Z0JA 1IN6A 2OCPA 3TAHA 5B64A 2QPOA 2P65A 3AKCA 3WRYC 1ODFA 3QY0A 3ZZ0A 2FF7A 1RFLA 2WWYA 1FNMA 2LKDA 4EKDA 2WKQA 4GZMA 4JBXA 1N2CE 2EFDB 1U2RA 2YWHA 4RD4A 1QDEA 2VHQA 1MABA 4HATA 5FBQB 5FL3A 2EW1A 1E2JA 1QHNA 2I1QA 2ORVA 4QJ4A 2PBRA 3W8NA 1VIAA 3GLHA 4X8OA 4ZCMA 1E94E 2ZRLA 2FA9A 4YMSA 4EDHA 1SVLA 1XXHA 3IBGA 4AYWA 2R6GA 2FWRA 4MQBA 1GDDA 4DC9A 3A4NA 5EUMA 1ZIOA 3CRW1 1XFAA 4OQFA 4HI0E 2X2FA 3SN6A 1EFRD 4EFLA 3QXSA 2VP2A 4K81B 2BBSA 3VTKA 4LC0A 1HQYE 3GJ0A 2V9PA 1M8PA 1BH2A 4EIWA 2A30A 3B9QA 4TLBA 5L8VA 1FTSA 2QMUA 4CVNA 1CJMA 2C95A 1S96A 3VR4A 1NIJA 4DSTA 2WJGA 3TUJC 2QP3A 4TMKA 2PCJA 3RNLA 3BORA 2B21A 5IHPA 4Q48A 3SS8A 1GNQA 3GLHE 1QRAA 4XVQA 3B85A 1OT3A 4MH0R 4CYMA 1CP2A 2C2HA 4GDFA 5FR1A 3HJNA 2UVQA 5KU1A 1P2VA 1HTWA 2MSDB 2D7DA 2TMKA 4Q1BA 3NC1C 1R4AA 3AVUA 3IHWA 4OI2A 1SXJC 3SOPA 1P9WA 2GXUA 5FBVB 4M9QA 3OZXA 1QHIA 4W5JA 2WSSA 2IUTA 2WM9B 1YKSA 2AFIE 1CJKC 1NN3A 2ZQ5A 4XTCS 5EXXA 3ZZUA 4NCHA 2CVFA 4M9ZA 5DGXA 2FNAA 2J3EA 3BIFA 3DZDA 4E5UA 1DO0A 2B8WA 3ZVMA 3NHBA 2ZE8A 3CKLA 2ZI9A 4ZKEA 1JAHA 3WYGA 1XU4A 3WBJA 3U7EB 4M9SA 1GRNA 2ZVPX 5JWRA 3P26A 2YOHA 1OF1A 3CUEF 1SULA 4EPYA 3ADDA 4ACAA 4BFVA 3A1WA 3SYKA 1Q22A 4A8JA 3A4LA 3LBHA 1GNPA 2ANCA 3EASA 4EJSA 5E7JA 3KZ1E 4LBVA 4LHVA 1NBME 1ZIPA 3U7HB 4Q66C 4QNMA 2ZJ5A 4XH9B 3OFNA 1KI1A 2WJIA 3P32A 1HT2E 1TPZA 1SHZA 1EFCA 1P61B 3MAAC 1N6PA 1XX6A 1NI3A 3W5IA 1DAIA 2HF9A 3ICEA 2AX4A 1Q3TA 4IW3B 5GJWC 2DB3A 2O8FA 2Q6TA 1E6CA 3HWSA 1QF9A 2WIBA 4TL6A 2OCYC 2W2TA 2GAAA 2H17A 1J8YF 1OIXA 3EPKA 2IYQA 2PLRA 4A0FA 3ND8A 4DDWA 1E9RA 5FUXA 4MUAA 3U3MA 3NG1A 3A4MA 2QRZA 4MRSA 1G41A 2XTNA 4CEIA 1G8GA 4QHTA 3HDTA 5J4VA 3B60A 3GJ3A 2J59A 1R8QA 5H68A 1IY0A 1F6BA 5JJIA 5CIQA 4Q1DA 1CIPA 3PENA 3ZJYA 1PZNA 1NSFA 2ZVQX 4MGYR 3X1XA 1JB1A 1CS4C 1ZCAA 1ZNYA 1E32A 1KSGA 2GCOB 2BMFA 2KB0A 1WDTA 3AF2A 4URXR 1P2UA 4QBFA 4TT3D 5DSZA 4DT1A 2B8TA 4HB3A 2O8BA 1W0KA 1A1VA 4CT5A 4G3XA 4BQSA 1YR6A 1TTTA 2KWIA 2C9YA 3MD0A 3PVSA 1YZUA 1G3IA 1N6HA 3A37A 4LJ5A 3VR1A 4DCVA 1IJFA 5JI3E 1XRJA 1YR7A 2EFCB 3CH5A 3SI7A 2WAXA 5FBRB 3O8RA 2QROA 2IYRA 2ZAMA 4IOMA 4FWTA 2A2ZA 2AHOA 2Z6VA 3F3YA 2R6AA 2CNWA 1SVOA 2QTHA 3MJHA 3H86A 4NMMA 5DH9A 3KB1A 5IF9A 2DR3A 3SU8A 3KJHA 4UQOA 1DG3A 1UKEA 4PSKA 4QBIA 4W5HA 1SXJB 1AQUA 1KO1A 1VG1A 2F9MA 2PMKA 4JYCA 4KI0A 4EPTA 1QVRA 1W4AA 3N5CA 1G291 1TAGA 3I3SR 1VCMA 1UJ2A 3LV8A 3OHMA 4MRPA 3QKSA 1D9XA 4B3FX 1UEJA 3R8CA 5P21A 3J81k 1TADA 3I8XA 2D74A 3BH0A 1IN4A 1X1RA 2WJVA 2HUPA 1BMFD 2JJ2D 1SKYB 2YWFA 3G82C 3ICQB 1Z3IX 4MRNA 3ZIAA 4FMBB 4TWZA 4IFBA 1OLOA 3QVUA 3TNFA 3AGPA 3Q8XB 4MRRA 3BXZA 4HUQB 2VHJA 4BLQA 3M6AA 4M1SA 4Z8XA 5EE9A 4UJ3A 2WIAA 1QHYA 3DOEA 5L3VA 1P3JA 4OQLA 5FI0B 4M4SA 1TQDA 4PTLA 2YC2C 1G18A 1E0JA 421PA 3K0AB 3KQLA 3LXRA 3FPAA 3GCGA 1ZM4A 1ZAKA 5E7MA 1KO8A 1R0XA 2AWOA 2J87A 3SHWA 4FMCB 4AKIA 2ZRHA 3SR0A 2JJ8A 1LS1A 3K0FB 3CLVA 2WJJA 2QMOA 1N5KA 4KU4A 1MO5A 2ZJ8A 3LFUA 4URZR 3B6EA 3THXB 4NYIQ 2BDTA 3SYNA 4RSGA 1KY3A 2QTVB 3V4FA 4G5QA 1IY1A 1KI3A 4YC7A 5JWHA 3SYLA 4NPHA 4EJSB 4YMUA 1Q57A 3A6PC 3GFOA 4DSOA 4KLNA 1QBKC 4Y0AA 4E09A 1AK2A 1Z0FA 1ZM7A 2C8VA 4Q5IA 3AVXA 1G6HA 3K0EA 3W9YA 2IYVA 2ZI6A 2IXGA 3QF4A 1TNDA 2NO6A 3CPHA 3ADKA 3UWOA 5DI3B 1COWD 3FYHA 4P4TA 4AG6A 2J0QA 3QG5A 1UPTA 2PT5A 1G3MA 1E0AA 4BLPA 4ZI2A 2OLKA 1KZGB 1W4BA 2QENA 2XGJA 1T8TA 2VHCA 4P33A 3R7WA 4PO9A 3EIEA 3K1JA 4ERNA 2ANBA 3PIRA 4Q47A 2FZ4A 4WZBE 5DE3A 3GQBA 2GHIA 2EYUA 2QORA 1NBMA 4IOLA 5TDHA 2ZSFA 1U0HC 1EWRA 2RCNA 3X2SA 4RD3A 4OK3A 1RW4A 3FKSD 4C0BA 2ZRMA 1GAJA 2WJHA 3AVOA 5CYPA 1ETUA 4Q21A 4TMWA 3ZZTA 2XZOA 1XP8A 1NG9A 1FQJA 1VKJA 2ASEA 2JLVA 1JQJC 3L0IB 3CO5A 3Q5EA 5EP2A 2VH5R 1KMHA 3CF2A 3KUDA 4MYUA 4PC2A 2GETA 3B1WA 3KKOA 4MKFA 2ZIAA 1GRRA 2J0VA 3H1TA 4C0JA 3KL4A 3QBTA 1SVMA 1I4TD 5D3QA 2GCNA 4G1UC 2WZQA 1FX0A 1XTJA 4QJ3A 4Q4JA 5JECA 1DAMA 1G3RA 3U60B 4Z54A 3TQFA 3N2EA 5KTYA 2VSFA 4A6PA 2ZYUX 3C5CA 3OIUA 1E2IA 3SQXA 1F48A 2F1JA 2HLDD 4FW9A 1KJZA 4GOKA 3V4RA 1XTRA 1NN0A 3DEFA 4BFUA 1DVRA 3QKUA 1PUJA 2WJYA 3PUWA 4BFWA 4XWOA 2VEDA 721PA 3Q7PA 4D2IA 4CGZA 2QSYA 4TLAA 1FPMA 4HYYA 3PR1A 3AQ4A 1OFTA 4M2LA 5JSZA 3IIKA 3KQHA 5CDFE 4I1UA 2QAJA 3PCRB 1WMSA 3B7GA 3VX4A 2QZ4A 5DI3A 1YZGA 4OHXA 3OIVA 1E1QD 2N46A 1T0JB 4XOIA 4PC1A 3ZVRA 1CR4A 1Y63A 1DAKA 4JLJA 3TK1A 4D81A 1G4UR 4C30A 2IS2A 3ONWA 4LI0A 3HYTA 2ZYWX 1DADA 4RKEA 4CF7A 3CPJB 2GTPA 4B73A 1QG4A 4MKHA 2O8CA 4Q9JA 2PEZA 2FU5C 3MWKA 4MGIR 4B3BA 1VPLA 2FN4A 3ZLJA 3H84A 2O0JA 4DLUA 4IEEA 2QN6A 4JLAA 2JATA 3W34A 4UJ5A 4KJZA 1D8TA 4EPXA 2UKDA 1W2HA 3IIMA 1E4YA 4LHZA 2REXB 2A5JA 2HXYA 2P6NA 2D62A 3ZD7A 2XXAA 1UDXA 1ZJ6A 4ON9A 5C2JB 1N0UA 1KK0A 2ECKA 3DZ8A 4M9XA 1C9KA 1N5LA 4Z51A 3GLIB 2AFHE 3FOZA 2XAUA 4ZDWA 1AZTA 4JT4A 1D9ZA 5CJ2A 1W48A 2CLDX 4DLVA 2AR7A 4BLRA 3NH6A 2R8RA 1G5PA 1KK2A 5EXTA 3DDCA 4AD8A 2QUZA 3BFKA 1YZKA 4U5XA 4DDTA 2NG1A 4U02A 4WXRA 2BEKA 2GRJA 3CH4B 4R2IA 1WE2A 1ZYUA 2XZPA 2Z83A 1SQ5A 2GZDA 4JVNA 3KXIA 3RYTC 4KAXA 4HAYA 5SZJA 1E9FA 3KJIA 5FOSA 3THOA 2KSQA 3V9PA 2O8EB 2A5GA 4DCSA 3KXKA 1E2DA 2VSXA 3HR7A 5F3WB 1GOTA 3PEUA 3BAFA 2J1LA 4IVPA 4AKGA 3NBXX 1GTVA 1T3HA 1YE8A 2GVZC 1UEIA 2J0UA 1YZNA 1J99A 1S0UA 3QENA 5IT5A 2O0KA 4HDOB 2R6DA 3A1UA 4LUCA 1KSJA 3QE0A 4R7ZA 3AUXA 3X1ZA 4Z8YA 1GIAA 1NL3A 2RGBA 2XSZA 3AVQA 5E7IA 1G16A 2A5DA 3IUYA 4JS0A 4TT3A 4CRWB 3MMPA 3O8CA 5IDVA 5AWFC 2D7CA 5L3QB 1KI4A 5FOXA 4IDPA 1P9NA 4DB2A 3UPUA 5HCNA 1DE0A 2MSEB 3CM0A 4DB4A 4A0RA 1AS3A 2ZJZA 3QKSB 3WRXC 3U6KA 1PVOA 1G9XA 1SVKA 1XB2A 5BN5A 1GFIA 1DPFA 1HE8B 3LWNA 3QXCA 3PFIA 1LTQA 1ZINA 2IL1A 1E3MA 1E9AA 1NF3A 5EZ5A 1BYUA 1PJRA 2VP9A 1E2HA 1AM4D 2DYKA 2ZETA 3FHCB 4A0GA 5BYKA 4O25A 2O52A 4KFTA 3TJZA 4QG7A 3EW9A 4WW0A 5ANRB 4MYHA 2W83A 2F55A 1XD2A 4L8GA 1OJLA 4M1WA 1TX4B 3ZDQA 1JQLB 1LW7A 1MT0A 1KAGA 3KQNA 3NEJA 4M22A 5ELXA 1NJGA 1SXJA 4Q7JB 1P72A 2V6IA 3FMIA 3MCAA 1XPRA 1QHXA 4DLRA 4Q4LA 2ZRDA 1T3SA 2JJ1D 2OCAA 2ONKA 2YINC 4D80A 4PHHA 3WYFA 4TTPA 3K70C 1AGRA 1CR2A 1Q1ZA 2AD1A 2B7CA 2DFLA 2VP5A 1HE1C 1AZSC 4IXNA 1UF9A 4KLZA 4P3YA 1E2NA 4XWAA 5C4GB 2RB4A 2CHVA 1G7CA 1X8KA 4MDFA 2OILA 4QFMA 4XD7D 4LHWA 5FUYA 5A0FA 4CW7A 1IXZA 5JWOA 1DAGA 3SFZA 5SZHB 2RGNC 4RFSB 1Z6GA 1D5CA 1T5IA 2CCJA 2JLUA 4WZ6A 5HZHA 1OV4A 3EIHA 2ERXA 5JJLA 5HKKA 3EA5A 3OEEA 3ZS8A 4HAUA 3AF1A 2G3YA 2WWHA 4X8LA 2FOLA 4NU0A 4AI6A 2GWHA 5J4KA 3U4QA 3VNVA 2NO7A 3QQ5A 3W6NA 1LF0A 2MMGA 2E87A 4L16A 1E99A 2BOVA 1KDOA 1PUIA 3CRRA 4JLBA 4JSYA 2IA5A 3Q9LA 1M6NA 3TQCA 4IJMA 5JRZA 5GJBA 3RWOA 2CHGA 2BMJA 3EXAA 3KTAA 2FPMA 3CWQA 4Q02A 4BFXA 1OIWA 5AUPB 1EK0A 4FN5A 1KI9A 1MRNA 2GXSA 3K8YA 2FZLA 4LY6A 4WAUA 3I5YA 1E1QA 1GM5A 2DFKB 4GZLA 4PZYA 5FOVA 3W6PA 3GJ6A 1L4YA 4A36A 2G6BA 3DKVA 3M4YA 2WMNB 4YQFA 1KOFA 1XD2B 3TH5A 5DN6D 4DUGA 1LB1B 4NCJA 4DSNA 2QPTA 3HPRA 2WOJA 3ADCA 2HYIC 2QI9C 3NTUA 2I4IA 2IHYA 3QPVA 3CBQA 5D3MB 3K53A 3CRVA 3THYA 5KNBA 1X8JA 1OB5A 4DT1B 3KKPA 1HH4A 2ONJA 3SJZA 2GKSA 1DAHA 4RFVA 1WP9A 3EZ7A 5JBQA 1YZTA 3I73A 4FCVA 4Q9IA 3UG7A 1L4UA 2ZRNA 1XXHB 2WSSD 2BMEA 1E1RA 3OF5A 1E9EA 5KDLA 1P60A 1A7JA 1IY2A 2A3RA 1CTQA 3T06B 4PO8A 3E1SA 3MFYA 3QXJA 2G9NA 1N6LA 3VX3A 2ODBA 2WAYA 3GP8A 2BCGY 1OXTA 5GADl 3SQWA 2Q9CA 4TYNA 4C2UA 2CCGA 2HXSA 4C7OB 1RIFA 4D4JA 1VCOA 3QEOA 4EUNA 3U5ZB 3CR8A 4KO8A 3B9PA 4WBSA 5EP4A 4C0LA 4DVGA 3EPJA 1KIMA 4UNQA 1Z83A 1WXQA 1FNNA 3LVQE 1ZM9A 2WWWA 4DLTA 5HE8A 2C99A 1N6NA 1HEIA 2RGEA 1RJ9A 3THWA 2ZE6A 3X1YA 4KBGA 1JAIA 1TF7A 2QBYA 5KHOC 4IXMA 5DNYB 4Q4HB 3KTAB 2EFHB 2WWXA 3FMFA 1TF2A 2NIPA 3CNNA 2X1VA 3KJGA 3WNDA 1JJ7A 3C4JA 1C4OA 4ESHA 1R2QA 2HLDA 3NKVA 2Q3FA 4NZYA 4B2IA 1JI0A 1Z2AA 3RRMA 4WVFA 3GJ7A 4PSVA 4LBWA 4MYCA 4LV8B 3KKQA 2VF8A 4DEYA 1CR1A 1Y3AA 3EA0A 1Z5ZA 3LXXA 2ZR7A 2YC4C 3TKLA 2IC5A 2ZS7A 5G40A 1X86B 1KDPA 4WXPA 5DHAA 4FIDA 1IHUA 1XEXA 3ZH9B 4RZ3A 3HP1A 1Z6TA 1G8FA 3OAAA 4JLPA 3RS7A 3K9GA 1S8FA 1TF5A 2IS4A 4OQMA 1XEFA 2WHXA 4O2LA 4YONB 3B78A 4W5WA 3CNLA 4JLNA 2OAP1 4JVLA 4P4SB 4KSCA 4F4IA 1N3BA 2P5TB 1KDRA 2O8CB 1QHSA 3IILA 4LPKA 5H8WA 4JL5A 2Q3MA 1FUKA 4TMVA 2KBFA 3ZGXA 4R71A 5H70A 1E98A 1OPXA 1PV4A 2PZGA 1W49A 4G01B 1KHTA 1P73A 4IKEA 4QL3A 4QBGB 4RD0A 2X2EA 3WP1B 1U81A 2DWQA 2BKEA 2PZEA 2ZRGA 4IOKA 5GVSA 2BCJQ 4JVMA 4LBYA 5CIWA 2C98A 2G77B 3UATA 4IDOA 5E4FA 4DLXA 1GKIA 1Z0DA 4PPNA 2Q21A 1LNZA 3WMFA 1II8B 2O8EA 3TRFA 3RVBA 2R6CA 3NDBB 2HEIA 3X1DA 1JEEA 2IYUA 4NYJR 4Q4HA 5CB6A 3RSOA 2BMDA 5DLQC 2F3TA 3WMGA 4CEJA 1BKDR 4EQ6B 4LJAA 1WBBA 3RS0A 5DIFA 2WMOB 2CE2X 2JASA 2ZJYA 4QOSA 4D4KA 3U61B 5JCZA 3DL0A 3ND9A 4UXJA 4A92A 4Q1EA 1K6MA 2OG2A 3E2IA 4V03A 1OH5A 1W46A 2F3RA 1GKUB 3NHAA 3AF3A 1DBSA 3PUYA 1OKKD 2F9LA 2JIZD 1KI7A 4TYWA 2QSZA 2SHKA 1P2SA 3AKDA 4HAWA 2EU8A 2F7SA 3PG5A 5B2ZA 5LD2B 4A1FA 1R5BA 5F2EA 1E2FA 4WA7A 3FGNA 4UNSA 4RZUA 4ZO4A 1KNXA 4KCGA 4C0KA 4M1OA 3R9XA 3LRPA 3U3OA 1KJWA 3K0CA 5DYIA 1NP6A 2W0SA 4US2R 5AK0A 3IGFA 1RRPA 2J7KA 1KKLA 1LFDB 2JLQA 4Q4JB 4QNRA 2ZTSA 3QIAA 4ZIRA 2JLWA 1XEWX 1VYUA 1XJ0A 2QE7D 3AP1A 4B3XA 1U8AA 1W5SA 3HU2A 5HCIA 3PUXA 2P5SA 4URWR 1H8ED 2ORWA 2ZI7A 3NC0C 1E0KA 1O87A 3FWYA 4YXWA 4D0NA 4TYYA 4Q03A 3QXXA 3GLFE 4HLCA 3A36A 1IOZA 4XIGS 2XOKA 1JJVA 1S1MA 2FH5B 3RC8A 5JS7A 2XJ4A 5FOUA 1Z6YA 1V43A 3THYB 1Z8FA 4YLGA 1JXMA 3QF7A 4RD6A 4TYQA 1XJCA 2OM2A 1DEKA 1XWIA 3D7MA 1EFTA 1KO7A 3BB1A 2JJ2A 3AEZA 4F92B 2FE4A 4JKIA 5LPNA 4JVSB 1DG1G 1E9DA 2ZRKA 3KJEA 3ZIAD 2NTYC 3ZVNA 3Q3JB 3CONA 2NQ2C 2RGDA 2E9SA 2HT1A 4XVRA 2IX3A 4M1TA 1G1MA 4GMXA 2QMHA 1VCIA 2RGGA 2RH5A 1NIPA 3MSXA 4LJ7A 4YDSA 1T91A 3VHLB 4RVCA 4BFTA 2JLYA 3LW7A 1G3UA 1IXRC 4IVQA 4LJ9A 2OSBA 1NMXA 1NLYA 4H1VA 4RJLA 5KDOA 2Z0MA 4GSYA 2ODNA 4II7A 1OYYA 5FOWA 3BE4A 2R9VA 4Q7KA 1ZU5A 4LJ6A 3FTQA 4DLSA 1YRAA 2ZSEA 2CHQA 3S1AA 2GCPA 4D26A 2ZSDA 1TQ6A 1ZBDA 4HZIA 1X8LA 3D31A 3ZS9A 4F7WA 1HQCA 3U44A 4BLSA 4JMPA 4PAOA 3WYAA 1WF3A 3LX5A 2QQ0A 3L8ZA 3F8TA 5FPTA 4LCBA 2C9CA 1W44A 1E2MA 2WKPA 1K5DA 4Y0VA 4L9SA 5EE3A 1PLJA 1KK1A 3IIJA 4OI4A 3H4MA 1XTQA 4MGKR 5KSPA 2FSFA 3I32A 2PJRA 1QVAA 2IF0A 2X8AA 3LH5A 2XTMA 4V0MA 3K70D 1TU4A 2R2AA 3BWDD 1W36D 4RCYA 4BZQA 4TL7A 1Z22A 1TQ4A 4ZKDA 2WOOA 4PQRA 1YQTA 4NCKA 4UNRA 5CM8B 5JMTA 2NOAA 3BBPA 3LX8A 4EQ6A 5F9FA 1DS6A 2JLZA 1E2GA 3R7WB 2ZJBA 1KMQA 1AGPA 1JXOA 1CRPA 1XPOA 4AWXA 4D25A 1NBMD 4PPQA 5AUQA 4C7OA 1CR0A 1D2NA 1PLKA 4E03A 5HTKA 2BM1A 1VMAA 5DI9A 3UK6A 1Z07A 1R6BX 1DAFA 1NN1A 3M1IA 1Z6XA 1ESNA 2BEJA 4IDNA 4HSEA 2HCJB 5EE5B 3P1JA 2B6HA 1RKBA 3RDPA 4PC6A 4HAZA 2QGZA 4PR0A 1S3SA 3G5UA 3RC3A 1KMHB 3PUVA 1OXSC 2OT3B 1N6KA 1ZVQA 2DFTA 5HKKD 4X8HA 4D0GA 3REFA 3K0FA 4HLUC 1CJTC 4RD1A 2W6ID 3CRQA 1Z2CA 5FUWA 3RS5A 3CW2A 4CEIB 4R9UC 1ZNZA 4DLZA 3CX7A 2WBLC 5UKDA 3K09C 1A2BA 4OQNA 2J0SA 2FDCA 4LHYA 1W5TA 2BIFA 4IHQA 4EJSC 2GAOA 1FTNA 3K9HA 5C46F 1R0WA 2G0TA 3B1VA 4LRWA 2G83A 1J70A 2IUUA 4P4UA 2GCOA 2AK2A 1VYVA 3BH6A 4LJ8A 5FPSA 4Q9HA 1UBCA 1QHHA 2XNDD 1CEEA 3T5GA 1A5TA 3ASYA 3FMPB 3FVQA 1JPJA 2JLSA 2ZITA 1CJVC 4HB4A 5TXGA 4TTRA 2JJ1A 3W8RA 1P9RA 2H1LA 1NLFA 3LAWA 3IEUA 2PJZA 5TV2A 2O8DA 2VYFA 4DWJA 3JVUA 4QXAA 4B3DA 3QVVA 2CJWB 2V55B 1F2TA 2F43A 1G7SA 1ANKA 4TYPA 3RAPR 4I4LA 4BFZA 2OUKA 1SZPA 5LD2C 5A4JA 3LBIA 1NNEA 5J4HA 3TUZC 2IS1A 5G53C 4O2RA 4Q9LA 5FR2A 2YKGA 1E4VA 1X3SA 4V0NA 4B44A 4OI0A 1N5IA 1R0ZA 3QEJA 2W6JA 1XDBA 5JHGB 5KDDA 4HUTA 1MH1A 2H7VA 4QHYA 4E22A 4PFSA 1RRCA 4ASUA 2OBLA 1Z63A 3JVVA 3QKTA 1GL7A 1NRJB 3AP3A 4I81A 3AP2A 2GF9A 3MGCA 5LB4A 1XZPA 1J7KA 3DM5A 3EC2A 5JLJA 1NG1A 4BZXA 3THXA 2W0MA 4RD2A 3W90A 3FDIA 3KKMA 1XTIA 4NCNA 4M21A 2AWNA 4UNPA 1ESMA 5EP3A 4B6FA 3P4XA 5C4MA 2OV2A 5HR5A 1MV5A 4Q4AA 5JFGA 1SXJE 1XZQA 2QG6A 4JT2A 1KGDA 1E9SA 1NLZA 1ZP6A 5CLQA 5D3MA 4B76A 2J46A 1VDZA 4JL6A 1T9HA 2VLIA 3BGWA 4AKEA 2A78A 3LW8A 1NVVR 1T3LA 2DHRA 4BUJA 5GVRA 1XMVA 3VR6A 4P31A 5EJEA 5E95A 4L4UA 2EFGA 2GJAA 4RCZA 4LX0A 3SC3A 1DO2A 2QA5A 2VRWA 1YR9A 1KNQA 4Q18A 521PA 821PA 3LLUA 4M53A 2G1JA 4TMXA 4XJXA 4PX9A 1WRBA 2FFBA 2VA8A 4NHOA 4QBHA 2W58A 4DKXA 2FV8A 5CK5A 2ZSBA 5C1BA 4KFRA 5FPHA 3RS4A 1Z0AA 1FL9A 3ASZA 2IWRA 3TVTA 5H1YA 1EESA 4FCTA 4V0OA 1F2UA 2GBLC 2IHBA 3B8HA 5A5GA 3QF4B 4AIIA 5JSZB 1YZQA 2YYZA 3T15A 2IYWA 2A5FA 3TSZA 4FMCF 1J2JA 2L0XA 5DN6A 1OE0A 3O47A 5FPKA 5KUTA 2OLJA 1G5TA 1L7VC 2HV8A 2PL3A 4FWIB 2GJKA 5EXPA 2BJWA 2WWGA 2W2VA 2ZR0A 1XNJA 5B58C 5JS8A 3CX8A 1W7AA 4JBYA 1H8EA 4YXWD 3ZVLA 1ZMXA 4URUR 4CZ2A 2QEQA 1T6NA 4U00A 5AJYA 5FL7A 2BWJA 4TMZA 1GILA 3I1FA 4ZIRB 1VYTA 1MO3A 2C5LA 3SNHA 2KI5A 4AURA 3EZ2A 1NSTA 3DPUA 4OHVA 1JR3D 2ORIA 2Z5FA 1COWA 1P4SA 3TR0A 1MABB 1G21E 3NIBA 4WZAE 2HJVA 2V1UA 2WV9A 5J4YA 1E0SA 2FSHA 3A1VA 1Q1BA 4W9MC 1G17A 4IEIA 1W1WA 1KI6B 4CT4B 5KYKA 4G5GA 1R8SA 4BEBA 2OESA 5KNDA 3AVTA 2QAGA 4Q7LA 1W4RA 4QM6A 1CULC 2GJ8A 3B1ZA 1QZXA 3CF0A 2ZUCA 5CM9C 1M7BA 2DY1A 4POAA 3T1QA 3CWZA 1WB9A 2N1BA 3U44B 4LV6A 4MYTA 3CRMA 4QGFA 1FP6A 1EG7A 4CEHA 1KKMA 4X8MA 3SFVA 2GNOA 5G41A 1A4RA 4OHWA 4WIAA 2ZI4A 4JLVA 2HF8A 2VO1A 4TQ9A 4UXIA 4XVUA 2DWPA 4LV5B 3SHFA 1G7RA 4DEXA 4ITRC 3B1YA 3DMNA 2BV3A 3H2YA 3HR8A 2QTFA 5TVKA 2ZI3A 1RC8A 4JLKA 1K5GA 2Q9AA 1DTSA 3IO5A 221PA 3TLXA 4NH0A 2CLSA 3JZMA 3NVAA 2NO0A 3QOFA 1GWNA 4LHXA 5FTKA 4XTRA 1FX0B 1XTSA 1M2OB 4NKRA 1NY5A 4BWYA 4DDUA 2EWVA 1J8MF 1LVGA 5AUNB 4IRUB 3C8UA 5CYOA 3OESA 4KVAA 1BS1A 3W5JA 5JHHB 1GZSA 1MO4A 1XMSA 2AXPA 2FFHA 3VMFA 3LQRA 2LKCA 2J45A 2VSOA 3Q85A 1HY3A 2REBA 4I1OA 2MMCA 2JDID 1FZQA 2ODWA 5G3ZA 2D2FA 2GEVA 4XSHA 4FXPA 1L2TA 3I4LA 4HEJA 3S1AB 4LOAA 2RKOA 3B1XA 1KAOA 4NBSA 3I92A 5TB5A 3FHOA 4MRVA 4P32A 4KODA 4HAXA 3GJ4A 2Q0HA 1RVDA 4Q01A 2OFOA 1CXZA 1Q1QA 1XMJA 2RMKA 3KQUA 4V0LA 4ARZB 1SKQA 2QM8A 2NPFA 1J90A 4AK9A 4ZDKA 1I4DD 1YU9A 5GJCA 2NZ8A 2QE7A 4NYIR 2NO9A 2VHUA 1FMLA 2QQEA 3U4QB 4AYTA 4LGMA 3TE6A 5BW8A 1EWQA 2ERYA 1KDTA 2XJ9A 2CK3A 4QGHA 3LY5A 1AKYA 4AKHA 2I3BA 3GJ8A 3NXSA 3VKGA 3WY9A 1OYWA 1UFQA 4OQXA 2ZSAA 3LLMA 4GP6A 5J5CA 3VU9A 1S3GA 3TW8B 4F4CA 3CB4A 1VTKA 1AKEA 3VR2A 4KITB 4PPGA 3AVWA 4GT1A 1P62B 4KHZA 3F5FA 2VHTA 3QPWA 1E69A 1OXUA 2GJSA 1SVIA 5HZKA 3D8BA 1P75A 4KFUA 4JIMA 3WBKA 1XMIA 4TQUS 2BKUA 4URVR 3RABA 3QKRA 2OBMA 2QRNA 4PXAA 4OJQA 3MLEA 1AJEA 1KSHA 5JEEA 2NZJA 1XF9A 3SJCA 1S2MA 2XOKD 3NWJA 4C0AC 1ZUHA 5FI1B 5KSZA 5TMPA 2AN9A 1NVUQ 2IYLD 3Q5DA 4FMDF 4PAQA 2AKAB 4PC7A 2ATXA 1UBFA 1R5OA 5FTMA 3T35A 3LO5A 3OFND 2IBMA 4KYIB 4LWZA 3L0PA 4B74A 3UG6A 4ARZA 5AUOB 4A6XA 1GL9B 3C41J 4JL8A 2AL7A 2QNRA 3B82A 4ILEA 4CEHB 2HJGA 3WNCA 2RAPA 2GXAA 2B92A 4AC9A 2OXRA 1II9A 2C9OA 4DLYA 2WPDA 1I2DA 3L8YA 2JGNA 3I8SA 4F4JA 4GRAA 4I1SA 1RJ9B 1G7TA 2ZXUA 2JCSA 2ZRAA 2O8FB 2D2EA 3DOFA 3HU3A 1BO6A 1O3YA 1P6XA 3OAAD 8OHMA 4US0R 4U7DA 1Z0IA 2OE2A 2JA1A 3BK7A 1CRQA 2NO1A 3TIFA 2P6UA 2ZAOA 2F43B 4OL0A 5HE9A 5BQ5A 1Q21A 3QXHA 1SXJD 2CEAA 1MKYA 2ZREA 3B2EA 3KFVA 4Q1CA 2VTKA 1U90A 2X19A 3L43A 4KYUA 5EQTA 3VFDA 5BWMA 3AKYA 4TMTA 5K8TA 2BBWA 1HUQA 5KPDA 3Q7QA 3BB4A 5JZVA 1N6IA 1CKEA 3THWB 4M0LA 4B2PA 2A9KA 4K8OA 4ABYA 3K0AA 2OXCA 3LVRE 5K8UA 3PUZA 1MOZA 3QI2A 2ZI5A 3TSWA 2V3CC 1YRBA 4WOPA 2ZU0C 4LJ4A 5SZKB 2Z43A 3EZ6A 4CDGA 1T4GA 2YOGA 4Q19A 2IYZA 5J4LA 4EPRA 1VCNA 3I62A 1S4QA 1W0JD 2PCLA 2RGCA 2IXFA 4RZ2A 1U9IA 2RHDA 4PSAA 4B71A 4UNNA 5TY0A 4MDEA 4MUBA 1UKZA 2I1VB 4A82A 4FINA 3UMFA 3CZPA 1HV8A 1MR3F 1OHHD 1U98A 1BYIA 2V7QA 4MKIA 2FGJA 3K09A 2ZRIA 3MWJA 1SKYE 5G3YA 3RRZA 3IQWA 4B43A 4GPTA 4DLWA 1F5NA 3T12A 2G0NA 3OE7A 2ZJAA 3BH7A 5EZ6B 1KI6A 3LNCA 3L82B 4ZPXA 2J5XA 1P7CA 2GESA 2CCKA 3LDAA 2XNDA 3TBKA 4YMVA 2C04A 4LSGA 2D06A 2AKYA 2IS6A 1KK3A 1E2PA 2XITA 3EARA 3BC1A 1KI8A 4MA4A 1DELA 5HPYB 3G0HA 3MWLA 4D4LA 1IN5A 1UAAA 4MGZR 1MRSA 2FFQA 3GJXC 5L3QA 3EAQA 3UANA 2D4HA 4TL9A 2LCFA 1P5ZB 3EPLA 1H65A 1FMJA 4C2TA 4BASA 4C3ZA 2O8BB 3I5XA 1U0JA 4EFNA 3FFAA 1E2QA 1HA3A 1TQ2A 1XCMA 2EFEB 2OHFA 2KJQA 1QG2A 1OHHA 2W6JD 2XTZA 4Q7MB 5LDDC 2ZRBA 4LYJA 2K5UA 3C7KA 3QBVA 2DPXA 4AY2A 3EZFA 3OEHA 1F60A 4GFDA 2ZS8A 2WICA 1DAEA 2FEOA 2YWGA 1CU1A 2JLRA 2V6JA 4GL2A 5CB8A 2ZPTX 1OFHA 4JZKA 2AD5A 4Q9KA 4EPWA 1RE0A 1KTVA 2YOFA 2A5YB 1FP7A 1U94A 3AV0B 4OK6A 1G4AE 4NCIA 1GNRA 3GEIA 1BIFA 4G5RA 5AJXA 5DHFA 1X6VA 3PEYA 4OHZA 3PJRA 1HURA 1JBKA 3NEYA 4PHFA 1MO6A 2J7PD 3C14C 2IW3A 3QUSA 4R98A 3CPEA 3TR5A 1XTKA 1TUEA 3NBZC 4P4SA 2H5EA 3AVYA 4BECA 1OXVA 2GILA 4PANA 1T0HB 4LDJA 4DZZA 1NN5A 4PZZA 1N25A 1AN0A 1ZD9A 5EE0A 2GXQA 4HLQB 3IBYA 2J41A 3KXLA 1W36B 4V02A 2OBNA 3FB4A 4BLTA 4K46A 3I61A 4MITA 3DM9B 3FFBA 1W36C 1E96A 5J40A 4D4MA 3ZD6A 1EFRA 3TGPA 1AA9A 3U7GA 1IAQA 2CE7A 4J0QA 2QPAA 4NL4H 3KX2A 1RYHA 4YMWA 1F3OA 1CJUC 2VIIA 4NTZA 1S1CA 2QL6A 4QRHA 3SJBA 3AGQA 2G1KA 2VP6A 2GBLA 5FBLB 1NMZA 2ODEA 3NBFA 1W0JA 1EXMA 1K8RA 2ZE7A 3VU9B 2BBTA 1EX7A 3IHLA 4CIDA 1IJEA 2MSCB 5DYGA 4LYHA 2BM0A 3R9WA 2GK7A 2UZIR 3RRYA 1LS6A 4HB2A 1FOEB 2CMKA 1XD8A 2FJUA 3EZ9A 3R20A 3CNOA 4IFEA 3VHXA 2GJ9A 4OK5A 2PX3A 3PEVA 3GLIA 1R7RA 3RHFA 3DKPA 4NP6A 5AJVB 1E9CA 3O8BA 3W3AA 3W3ZB 3DO6A 1VHTA 3A1TA 3JZAA 4JKYA 2YNMA 2PX0A 3MG9A 621PA 1UKVY 2ZYTX 1Q12A 2IXEA 2JEOA 2QP9X 2H8KA 1LY1A 5DISB 1B0UA 1WQ1R 4FCWA 1IN8A 4BLOA 4BRUA 4F91B 3LD9A 3R8FA 1T8UA 2N42A 3RSLA 4DDVA 4HZUA 4G5OA 1KYIA 1NVVQ 1UBGA 3LQQA 2ZEJA 1BMFA 4URYR 4D82A 4QC2A 1SVSA 2F1RA 3NBYC 2QAGB 2WWFA 5CJPA 1A82A 5BN3A 2QGNA 2GEDA 3U3JA 1ZRHA 2H18A 1KZ7B 2FGKA 2QT0A 3PITA 4HDCA 4I1VA 4KVGA 4EFMA 1UKYA 3GLGA 2BVNA 1Z0KA 3VQTA 1Z29A 4NONA 2Q3HA 2QAGC 1E2EA 3CX6A 2Z4RA 2CL7X 2EQBA 1GUAA 2YJTD 2G88A 5FTNA 2EWWA 1RYFA 3KKNA 2VL7A 4C9BA 2FPLA 3PV0A 2CDNA 4FMDB 2UZ3A 2ZRJA 4XWKA 3RS3A 5FPYA 1N6OA 2C77A 1GSIA 1T5LA 1TU3A 1VG9B 4AG5A 2R62A 4L5BA 2Y8EA 3BFVA 4M1KA 3RLFA 1KI2A 2R44A 2HCBA 2IUSA 2FFAA 3QG1A 3SE0A 2ZU6A 4LK2A 3PXGA 5JI2E 1JPNA 2RHMA 3EC1A 3TSOA 3T1VA 3BS4A 4H1UA 1ZCBA 4DJTA 1OIVA 3CR7A 3RS2A 3ADBA 2QU8A 5IRCD 3PEWA 4ZDIA 5AR1A 1GL6A 3RANA 5FTLA 1AS2A 3B5JA 3FMOB 3IQXA 2VP0A 4PHGA 1KO4A 2NMVA 5EUQB 1M74A 1U8YA 2A7QA 4JLMA 5LB2A 4DBLC 1ZUNB 2VF7A 1LF5A 2IEYA 2P0EA 2IYYA 3KB2A 2CL6X 1A2KC 2FMXA 2GVDC 1US8A 4TN1A 4IVRA 3L2OB 3AVPA 4LJYA 1S9HA 3NH9A 5L3SB 2GZAA 3QPUA 4JJZA 4OI1A 3T61A 2IK8A 4A2QA 1CF4A 4DIEA 4JJKA 4KXFB 2GF0A 4Z1MA 3D3QA 5AJWA 4BPBA 4Q1AA 3U6BA 1KSFX 3I72A 3ZYCA 1TEXA 2JDIA 4V0ME 1IQPA 1NMYA 2O8DB 1QHGA 4IDHA 1ZUIA 2WWIA 1WCV1 4R2HA 1XBTA 3UKDA 1GG2A 3UXMA 2WTUA 3X1WA 3GLGB 1H8HD 1ZNWA 4TTQA 4B33A 1ZC4A 1L8QA 3AUYA 1NKTA 2DCUA 3BB3A 3EG5A 5CDFA 3ZQ6A 3ZQJA 1D2MA 2GDJA 1OFUX 1V5WA 1TEVA 3GEHA 5FH9A 2BC9A 4V0KA 5CK4A 4C0SA 1NY6A 2CNWD 2GEUA 4BE7B 2KBEA 1CLUA 3KFXA 2ZUDA 4PAMA 1W47A 3ETLA 4QHSA 4JLDA 1QHHB 2O5VA 4A0HA 1Z28A 3RRNA 2CL0X 4N0EA
chains in the Genus database with same CATH superfamily
2QVZX 1JPVA 1WCYA 4UAGA 3B6KA 2WK1A 3FCSB 3GA7A 1J00A 1PR6A 1NVFA 1NNSA 2HC9A 3PC3A 1OXXK 2XVZA 3DP9A 4UU1A 3N7TA 2YJ5A 3RFTA 9ATCA 1EUYA 1XCPA 4FD2A 4ZU6X 1WTAA 3A28A 1IUKA 3IE2A 2FSSA 2OVFA 2Z5GA 4NG5A 5CB4B 1Y1QA 1X1SA 2J7PA 3UK2A 3NHWA 1JHYA 1KYXA 4YDHB 4N5MA 5E38A 4M1YA 5KO2A 2A33A 2Q1YA 2EP8A 3SEZA 3CVWA 3G1TA 3U31A 3ROKA 4XOUA 3TD9A 3UWSA 1Z2OX 3PQ3A 1S3FA 2WILA 1Q3HA 4QGGA 3LI2A 5BV8A 5CFRA 1N3LA 4ESVA 4UM9B 2Q9UA 1YL6A 2DWCA 1P2FA 3LIIA 3OCUA 3NAQA 3PNVA 5CB4F 3EQ6A 3BKXA 1VBMA 4HNAA 4TMFA 5FYQA 1RVV1 5DOZA 4PVDA 4QSHA 2F6RA 2Q5OA 5C8YF 4OGFA 3U3KA 1EJ2A 1Z25A 1YB7A 4IYJA 5IJ0B 1P3DA 1CF2O 2I4RA 1HFJA 3A9UA 3B13B 3DE4X 3V4ZA 5KNCH 3ZI4A 1JWLA 3IERA 4FI3C 3T34A 3VDQA 1HE5A 5E3HA 2Y0CA 3CFYA 3D81A 4QOHA 1XLTC 2V54A 2JRLA 4O4IF 3ZKAA 4OMDA 4XQCA 2E1RA 1PR4A 3I9FA 1FYDA 4OYHA 4ZYTA 4OYRA 1VIYA 1OFIA 4MROA 4B6OA 4Q3KA 2FZEA 3S8MA 1JIJA 3SBDA 2MR5A 3K0SA 3MELA 1XFDA 3TXYA 2OHGA 3KOXA 3WLLA 1UBOS 3BDVA 1TMKA 1CB0A 1G5RA 4E11A 3DMDA 1SNYA 3P20A 4OFZA 4AZTA 3DPIA 5EKSA 5BSWA 5JADA 5AIBA 2X9QA 2YVQA 4JR2A 2EEZA 2QMZA 4NENA 4R31A 5KKAA 1I2MA 4M89A 5CCEA 5K03A 3PXUA 4C0QC 1UC4B 3E58A 1OYVA 4ASUD 2PTHA 4GMDA 2H57A 3HYRA 2KMLA 1J2EA 5JPIA 3IMFA 1ZD1A 1EWVA 2H5JA 2NPIA 1KYZA 4G9GA 3H2KA 5DGTA 2FUG1 5LDGA 1BROA 2NGRA 3ICCA 1QC5B 5DCUA 4YCMA 1NKVA 1CZUA 2Q1XA 1GRQA 1DIGA 4ER7A 2ECOA 1QAMA 2HJ9A 1AS0A 1FXSA 3QP9A 2ICAA 3VKWA 2QIOA 1CX9B 5D87A 4HLUA 3RW9A 1JAZA 3V1MA 3LL4A 2IHKA 2YCBA 1T5HX 4LQ4A 1UMKA 5IZ4A 5KQRA 3E27A 5KVVA 1KE2A 2NUTA 5FUMA 1EI9A 4Q3CA 4Y2RA 2FWJA 4L15A 1N5OX 4DJAA 4QXOA 4G67A 5ICEA 1YCHA 3SWWA 5JQWA 4KI7A 2EBWA 1O7JA 4ZTBA 2F4NA 5GONA 2PD4A 3ECCA 2QMEA 3E82A 5H3HA 3MZ0A 5EQFA 2ZM6B 3Q7IA 2R00A 5KTPA 1I7NA 2UUPA 1FUUA 1UH5A 1MCZA 2HNKA 2OBBA 2VJKA 1IM5A 1BHQ1 1N0VC 1XEXB 2CLOB 2I78A 2RH9B 3KLNA 1EWTA 4YJGA 4BNDB 1DNPA 2C3PA 4GLFA 3RR2A 1U2DA 2B5WA 3QUBA 4ZU3A 1P18A 3VPHA 4X66B 3NYRA 3MTDA 3CZQA 1ICIA 2OWEA 1EE1A 4DPKA 1PS8A 3FNGA 4PLPA 2BFMA 3R3VA 2I7VA 5B57C 3R44A 1E6WA 4QGAA 3VA7A 2P7HA 3MPOA 5LQUA 1VHLA 3ZDBA 1T6YA 3NNDA 3C4QA 5SY6A 3K9LA 1VJDA 3DVLA 3VAAA 1C2YA 1ZM3A 3CNHA 3OLQA 4PPFA 4WJZA 4MYRA 3BERA 4KW7A 2YJ3A 4N0DA 4CR6A 4RJLA 2GVNA 3GFPA 3T5DA 2RGAA 5KJ6A 1FRZA 2V3WA 4HLDA 5M04A 1BCRA 4JXXA 4C4RA 3UIEA 2NSYA 3O3CA 3W05A 1U1IA 4L72A 1FW6A 2J4FA 3PNMA 1VECA 2FVYA 4O3MA 2HDNB 3DUFB 5EJ5A 3GU3A 3MYYA 3OIWA 4Y98A 5KU7A 2Y27A 2ZRCA 4D0RA 1D0VA 2OAQ1 2X0RA 3C16C 1NP3A 2VJOA 2PJDA 4FMPA 2IKQA 4PS1A 3BGOS 1H1TA 1M6VB 1RDFA 1EFHA 3MBKA 3WHLA 3WZLA 5I7OA 3N6XA 4XASA 3KAKA 3U9SA 3IXMA 1NMSA 3V8RA 2D0DA 1DC4A 1V5EA 3PQ6A 4TV9B 3H3JA 4DG5A 1I4OA 4PIVA 2MSNA 4DXDA 4EYQA 4ZT2A 4U8GA 1FRQA 4TTTS 1ILWA 1E79A 2V9ZA 4Q82A 2G5CA 1PK7A 4N40A 2FZWA 5IF3A 1QTRA 4ARIA 4NZMA 4WK0B 3ZE7A 4UUNA 5JNLA 2KE5A 3PUHA 3EDQA 1F2VA 1SM4A 3FJ1A 3JAKA 4K6OA 1IBKB 3DDNA 2HPZA 2QLTA 2EJCA 2FWBA 4Y9DA 3FG9A 1AKUA 2H2IA 4U2KA 5EIHA 5KWEA 3GFTA 1O5IA 2OENG 2VAXA 1DARA 3CE6A 4N12A 1USGA 3NRJA 4WDRA 1RQ2A 3LKZA 2BTEA 4TLEA 3GLGE 1YNOA 4TSFA 3ZDAA 2BPOA 4N76A 1TLFA 3ODGA 5AT1A 2P3SA 1ZZGA 5ENZA 2WJ3A 4C7KA 4YIHA 3BXGA 1HLDA 1YQEA 1OBOA 4MR9A 4US1R 3DOIA 1FFBA 3UHOA 4EYGA 3FTFA 4QX6A 1XKXA 2ECQA 2JGEA 3TL3A 3EMVA 2ZG6A 4GXQA 4HDRB 4IIJA 5AICA 2YV5A 3ZDZB 4ZI7B 4FJ0A 4KYVA 4EKEA 1QTQA 3E48A 3HB0A 1QV9A 1RM5A 2CBZA 1NVXQ 1YWGO 3IV9A 2Q8NA 3Q6NA 1UDWA 5F3DA 4GOLD 5B7QA 2GRAA 1KPHA 1HRDA 2JIOA 1J7JA 4RZSA 1H5UA 3EVCA 3GD7A 1L4EA 2OFXA 4H1HA 4E13A 4JQSA 1W5FA 3EFEA 1J2YA 3JYNA 1ZN7A 1H6DA 5LQJA 2BTQB 3FZQA 5A6VA 4Y6RA 4BEJA 5HX7A 3VKHA 3RJMA 1E8DA 1U5BB 4N1AA 3ZBUA 2P2YA 2A4KA 5CW1A 4LXYA 4W5TA 3R2JA 4PG8A 3MVEA 2JA2A 3A8TA 4C6TB 1SGWA 3BFXA 4NOLA 1XTUA 2RKWA 1FMTA 1ZU4A 1JHQA 3D6HA 3GCWA 3P2EA 1TD9A 5CB4A 1IWPB 2QTLA 4CKCB 1JFTA 4GKJB 1QH9A 1I4LD 2QLLA 2WZDA 2OC4A 4MQFA 4M86A 1TJ3A 1M7HA 2XB8A 1XZNA 1LC0A 4HXFB 4C20A 5CGZA 1OH8A 1K6JA 1YZLA 2IVFA 2XNSA 1X7ZB 4ZEWA 3SZ3A 3K2IA 1CUEA 5B3KA 1O4WA 2GA8A 2J48A 4O4IA 4A4DA 3LUGA 2FXIA 4MEJA 5ALLA 4D92A 4DN6A 5TPWA 1UPBA 1P39A 4P0TA 4RGQA 3PTAA 3H5WA 3U17A 4PF1A 4WEQA 3RWMB 1DTWB 2VZ9A 5DT9A 3EVDA 3IRUA 4NBLA 3VSDA 2XUKA 3STYA 5HS6A 2OFPA 4W9NC 1YUNA 4E30A 5KKNB 5F9HA 1FCJA 4GNKA 4AXBA 3SBEA 4PR3A 4CKEB 2XZLA 4I2NA 3AL0C 2W2KB 1D2RA 2IT1A 4GR4A 2M6KA 3UA3A 3OJEA 3H9BA 5AW3A 1IIBA 1Q1EA 3KUCA 1V5FA 3I2FA 4Q1FA 2PM8A 4KC0A 2BEWA 4MPJA 4OXYA 4I08A 1GZDA 2G4VA 2WDZA 3IPYA 4FDTA 4UD6A 2VPPA 3QZUA 3ESYA 1Z7WA 3C6YA 4G97A 4ZO6A 4A9AA 5KYTA 4IZIA 2RONA 2QUJA 1WEKA 1LV7A 2IE8A 2J9XB 1FW8A 2WHYA 2W2LD 3JZFA 1JNXX 4LC1A 4OREX 5EXPA 2O7RA 2Q2QA 3IIIA 3LHKA 1AC5A 2XW6A 4MMZB 1D6MA 2CK3D 3F6PA 3DTYA 2R68A 3DF7A 2JIQA 2DULA 3UJ7A 2QSJA 1B43A 1R0YA 1VP9A 4PHTA 2AE2A 4TKUB 2GM5A 4ITVA 4C3UA 4C4AA 4D5GA 3AWDA 2JHPA 3HA7A 4PLCA 1G19A 4QATA 4B6QA 5IJ0A 4DLKA 4AUMA 3LYUA 3P9YA 1U2GC 5ESWA 4BP3A 4KPFC 1QIGA 3UGTA 5JO0A 2P6RA 2EW2A 3NUGA 2D3WA 4A8PA 4NSNA 4DCNA 2QM7A 4TOIA 1MTZA 4BO8A 2V1XA 1ULZA 3VO2A 1WXWA 5MN4A 5IFLA 2V4ZA 2CC2A 1UDRA 4DSUA 3P4YA 2JHGA 2WFLB 3BKWA 3NBKA 4JJEA 2PBLA 5K4HA 2I9KA 2F59A 1QCDA 5DEIA 2F1HA 3CYFA 1TK3A 3DAPA 4BYMA 3PT5A 4RAQA 3WHKA 3CIOA 2FPUA 2EGGA 4PQEA 3SGLA 5KQPA 1N7GA 1QAOA 3EVZA 3BGSA 2HJSA 2XCQA 4FYMA 4LBZA 3LBNA 3SCZA 2W2OA 4OLJA 1MEOA 4QU0A 1TZCA 3FE2A 3ND5A 5EJGA 5F7XA 1T2NA 2OMKA 3DKKA 2EKPA 3PQCA 1MX1A 3O84A 3UMRA 2Y99A 3SZRA 3V8VA 1THMA 3L1VA 3R7FA 2BFPA 4NJOA 4BMZA 4DLBA 3HEAA 3HKDA 5CMLA 1DRJA 2C96A 4H1WA 3LUBA 3IDSA 2BBOA 2KQUA 2LZ0A 1XXHE 1SVWA 4QQRA 2GS9A 1OJ7A 4X62B 2HF2A 4YMGA 1NLMA 2XRYA 2OCPA 4H7EA 1B8OA 1KYTA 3QWFA 3S0JA 3TAHA 2X6TA 1WLSA 2O2JA 2P65A 2P9JA 4BO7A 2CT8A 2ZBQA 2EBHX 2ZUFA 3ILSA 3QY0A 3GLSA 2X9VA 2Q5FA 3EXEA 3Q98A 4YXFA 2HM7A 2J6CA 3EUAA 1FNMA 4BBAA 3KHUA 1TK2A 4GZMA 2AVDA 3IT1A 4HXYA 1RKXA 2EFDB 5T8KC 1U2RA 2YWHA 3NBUA 1PZEA 4HATA 5FBQB 1D4ZA 3FYUB 1E2JA 2G17A 1E6LA 2QX6A 1QVWA 2V4MA 4H7FA 4RHUA 3L6BA 4DR4B 2IHZA 1QHNA 4JX8A 1WPGA 2ORVA 3UXHA 4R9NA 3AUAA 1U7DA 3W8NA 2CNNA 4G2TA 3ABIA 4R3UC 3ZCPA 3GLHA 4ZCMA 3HY6A 3IT2A 3WGZA 4B6PA 2H7YA 2C8JA 4YMSA 4XLZA 1PKEA 2Q7DA 1XXHA 3GWZA 2UV8A 1QO0D 1VGQA 2Q2OA 5DN6A 4AYWA 4E5KA 3D0QA 3QE2A 3QX9A 5CDSA 4F11A 4EG3A 2HCFA 2NACA 1RBYA 4TUYB 3O5AA 4IJQA 1I14A 3A4NA 4Q7QA 2QHXA 3HNRA 3R6TA 5BSTA 1XFAA 5FWNA 2XT9A 3SN6A 4EFLA 3QPCA 1X80A 1MU0A 1FU4A 1RLUA 1USUA 1UWVA 2EJWA 3IELA 4Q6WA 4U7TB 1N2GA 5EZYF 3CLUC 1TAUA 4MHOA 1ZLXA 5A4AA 4S1VA 3FGOA 3QRWA 1BHJA 4M87A 5LM3A 4D79A 1L1FA 1KJ9A 2J85A 1FB5A 1R27A 2ID4A 4KWHA 2A30A 2ABWA 2GH1A 3V1NA 5K2OA 1I10A 4CVNA 2TS1A 1VJGA 2OGTA 3E3OA 2G70A 4MVJE 5AMXA 3T7AA 3VR4A 3ZTTA 1UFKA 2QP3A 3DPSA 4LX8A 1VMIA 2B21A 2I1LA 4HYQA 4Q48A 4CT0A 1BE0A 1PR2A 3GY0A 3GLHE 5DHTA 4IRMA 2HQRA 4B4UA 4JSYA 4Z7QB 1PDOA 2NT3A 3IKVA 1S4MA 1CP2A 1LWNA 2C2HA 2O6LA 4G1CA 4GDFA 4KR6A 2Q0SA 4YUZA 3KKKA 4QBTA 3BXHA 4ZXFA 3EWIA 4OD0A 5JCOC 1T2UA 3T3MB 3KAJA 2O9JA 3EXIA 5GOZA 3U09A 1SB8A 3AVUA 4BDSA 3SOPA 3VZPA 1P9WA 2VDWA 3F6BX 3GPCA 3HCWA 3KWJA 4M54A 4M9QA 3VHXB 5FBVB 1IK6A 3OOWA 4W5JA 5KWSA 1BN6A 1ODIA 1KE1A 2NX2A 1M3SA 3S28A 4CUZA 3DLTA 1V3VA 3FLBA 4RW0A 3ZOKA 3Q2KA 3M8KA 4XTCS 1TVMA 4MR7B 5EXXA 1HDZA 5FI5A 3WTCA 1JDUA 3KSBC 1VJRA 2RH8A 4PZPA 4IMIB 1K66A 2H7XA 3PGA1 1DO0A 3T95A 5K3EA 2JAXA 3T8YA 2B8WA 1OBHA 4HNSA 4PFJA 4RE6A 4ZAFA 3NHBA 3WLMA 4B09A 5EIBC 4ZKEA 5I01A 1ZJYA 3WBJA 3U7EB 5I6DA 2EL7A 1UJBA 1PWEA 1B14A 2ZVPX 3AY6A 1CUFA 4RQUA 2FEKA 4AUEA 5HW0A 5JWRA 3L4JA 5C0OE 2Y2VA 1OF1A 5DCWA 3RV3A 3CUEF 1SULA 4EPYA 1Q1GA 3HUEA 3KWMA 2NXEA 4ACAA 4BFVA 2A9OA 3IP8A 3D9QX 3JWJA 1Q22A 5E1DA 2YR0A 3DTNA 3AUTA 3A4LA 3LBHA 3WL5A 1DOHA 3GRZA 4QG3A 1AVTA 2VEOA 1EXDA 2V7XA 5DTJA 3RIXA 2WJIA 3P32A 3RVNA 5K0BA 1HT2E 4QQKA 3MNFA 5EJ6A 2JGFA 1N6PA 2V7WA 3VC7A 2QN1A 3T5PA 1DAIA 1KMIY 2L17A 2P1DA 4R9VA 5HF6A 3VPGA 1Q3TA 3UHJA 2HCTA 4MVJD 5BOSB 8ATCA 1M8JA 3SE7A 4LXUA 4XJSA 5CVDA 1ICEA 4TL6A 3U37A 1N2ZA 2H17A 3OU2A 5CNIA 3CUKA 1NBOA 3DL4A 1U1EA 1NP7A 4EH1A 1EJ6A 2QLBA 3HUFA 3NG1A 2XB9A 2QRZA 3A4MA 1CDZA 2JFVA 2VYNA 3NIDB 1CE8B 1G41A 2XTNA 4MRSA 4D4HA 4CEIA 3GDFA 4IFIA 1SIBE 4JI0B 4HDRA 3QBDA 1BQEA 4KQCA 5H68A 2VJBA 4FHGA 3T9EA 4CM4B 1RXVA 3TNYA 5DFAA 1IIRA 3PENA 5JU6A 3HZZA 2HLPA 3HSSA 4NULA 4MGYR 4G0XA 1NNUA 1ZNYA 2CHUA 1E32A 1XJWA 2GCOB 1Z4MA 2QV0A 1I6KA 1WDTA 3HA3A 4L3WA 4QBFA 5DSZA 4DT1A 1HDEA 5I7WA 2PUTA 4HB3A 1X13A 1PNOA 1O9HA 3VOBA 3VM6A 4BP1A 4CFYA 1W0KA 3IUJA 1I7QB 4L5YA 4ZVNA 1KRWA 2FEAA 1MORA 3JQDA 3NHJA 1G0OA 1ADGA 4G3XA 4JA2A 5CVJA 3DYVA 3OCYA 3JQ8A 5IKPA 2G82A 1FDSA 2ZBRA 4GVXA 1DQRA 1G3IA 3OZUA 3A37A 5K0EA 4ID3A 4EHBA 1JWBB 1IJFA 2NZ2A 2Q2VA 3MUOA 1TLLA 2B0JA 3R6LA 4NOKA 1YUBA 5JI3E 1RWOA 2EFCB 2OZLB 3AR8A 2WF8A 4ZU1X 4JQZA 4MJLA 1U2DC 1UXJA 4IOMA 4FWTA 2Z6VA 1XZLA 3ZXUB 3PZBA 3EY4A 3K4QA 3ZHRA 4NMMA 4UEJA 3KB1A 3M6VA 5IF9A 5GZ3A 3RYCB 5C51B 1F0YA 1ID1A 2JFBA 4XQ0A 1C80A 2DR3A 2ZAIA 1JGTA 1GPAA 1VG1A 1C29B 2F9MA 5JYDA 1YVPA 3WGKA 2OK8A 3DEYX 5A4DA 1XN1A 1QVRA 4RKWA 4UTRA 5DCLA 4JQYA 3TSAA 3I3SR 3MTAA 3LV8A 1ZVJA 3WJAA 3G79A 3VU8A 4TVSA 4XDGA 5P21A 3I8XA 3RGWS 3OQPA 4EVRA 1JIUA 4J4TA 5DRYA 4FX5A 3WL7A 4NS1A 1NF2A 1WMBA 1X1RA 2WJVA 3OCJA 3HHEA 4MO9A 2WM2A 3LWDA 4QUEA 4N3BA 1Y33E 3D6NB 3FPJA 4WN3A 2XCTB 3ICQB 3BSWA 3VR6D 4RVHA 1QJCA 4AP9A 4IFBA 1OFGA 3AGPA 3ZYZA 3BXZA 1P0FA 2YXDA 1PGPA 4BLQA 4JI5B 2Q0QA 2FPPB 2WUDA 1DQZA 3PXEA 4UHHA 5IN5A 2WIAA 1QHYA 1YBFA 2RI6A 3EXFB 3TLMA 2I7CA 4M4SA 5FI0B 1M75A 4IHAA 3FIJA 3QVGB 5IT9A 2ZAGA 4MX8A 2Y1EA 2O2GA 2YC2C 3CISA 2OB1A 3M83A 4IZHA 5HKLA 4EY7A 3K0AB 1JEJA 3WYDA 3FPAA 1ZM4A 2AWOA 1MOQA 1SD5A 4ZVPA 1K6IA 3SHWA 2AUTA 2IIQA 2B4RO 5IS2A 4CU2A 3AL3A 3SR0A 4YYEA 2H48A 3VNQA 4KU4A 4XYBA 1TT5B 4URZR 1DV2A 1PNQA 4FOTA 2I2DA 2ZSHA 4GMGA 5JAZA 1OVMA 5LQDA 2C3MA 4Q05A 2BDTA 3SYNA 4RSGA 2NV0A 4G36A 3QKIA 4DV2B 1LQUA 2ZR8A 1YQWA 2H2HA 2ID7A 3OTHA 1KI3A 1PJAA 2CW5A 1E1DA 4YC7A 3DKIA 2GUWA 3ISTA 5EA2A 4AG3A 2WABA 4OIMA 3FM9A 3NR2A 4EJSB 1N2JA 1GU1A 1UC8A 3GH1A 3C3CA 1DC8A 4KLNA 3BMNB 3HY3A 4MKRA 4HDKB 1Z0FA 3DT6A 2F8TA 1W2WB 3AVXA 2NSHA 4TTIA 3MWEA 2OO3A 2I87A 4EUEA 3AESA 1TM1E 3R3XA 4R1SA 4IMJB 3BEOA 4I4IA 2Q6OA 2CFCA 3PDIA 4N0QA 3CPHA 4R0NA 3ADKA 1P5JA 4W7IA 3L7DA 4XUEA 5EPOA 5F5XA 3WMRA 1COWD 3DLBA 3BUSA 2J0QA 1XU9A 2CLLB 2Q46A 5DM2A 3AI2A 2CXSA 4TV8A 2AX3A 4G1EB 3NWEA 4L4RA 2RKBA 4RPIA 4XYMA 5DXFA 1KZGB 3I76A 2RFLA 5AVSA 2H59A 1F4LA 1W4BA 2JS7A 2QENA 3CLTD 2DY0A 4UZSA 4MGEA 5IYZF 2VHCA 2EERA 4BGEA 4W99A 1XZ8A 4TXHA 3KDPA 3NCHA 1Q0HA 2ACEA 3KG2A 2QRMA 4GX0A 2ANBA 1I9CA 2GR9A 2H54A 3D2BA 4Q47A 4JGIA 3RC9A 3UWDA 1XR3A 3AY3A 1V16B 3P7MA 3B2NA 1KP2A 3GQBA 4WZBE 3EISA 3BHNA 4JEIA 3ZHSA 1ZESA 3D0KA 5C52B 1E60A 1Y4DE 5GONB 2B4AA 2P4QA 2J6BA 3O2QB 4IOLA 1AB5A 1ABFA 5TPZD 3X2SA 4FYYA 1RW4A 4OK3A 4BQOA 1IPFA 2PD3A 1Z17A 2YNMC 4C0BA 5CYPA 4CL0A 1ETUA 1ZH0A 4TMWA 1A95A 5EVJA 4I55B 5KJFA 1FQJA 1NUPA 2AG0A 1LQ2A 3F5SA 1Z4LA 1JQJC 3H1AA 2XMRA 3N8KA 8GPBA 3QW4B 4XW2A 5EP2A 3WNQA 2AJDA 3AI3A 1QGDA 2LXNA 3GVXA 2A0XA 3KUDA 4PC2A 2GETA 5TT0A 4XYEA 3Q1KA 4FEEA 5JCXA 2WTNA 5CXQA 1DEHA 3IV7A 4C0JA 3MWDA 1SVMA 1I4TD 2J9FA 2GCNA 3G5LA 1V1JA 1FIUA 4RIEA 1FX0A 2G9RA 1MOPA 2JCXA 1LPPA 4J1NA 1JSCA 1WVIA 1OXBB 3BA6A 4NARA 2VSFA 3TQFA 5FX2A 1U3UA 1XTTA 3I9V1 3CLRC 1E2IA 1BFKA 4DMLA 1JSRA 3LIPA 2F1JA 4IYRA 1MQSA 4X1KB 1PQPA 1I4EB 1TXGA 1FVXA 3QKUA 4S1TA 1PUJA 2WJYA 2YZKA 3DBHB 3OTWA 3PUWA 5HJ2A 2JFYA 4XWOA 3EUWA 4YI3A 1BMQA 1H94A 1OFVA 4TLAA 4DRXA 3BRCA 2CFTA 2CHEA 3UTCA 5DTQA 4MQEB 4XLLA 3FVTA 3PXBA 5CDFE 3CZCA 4F46A 5JH7B 3GFBA 3A6FA 4ZWNA 2A14A 3B7GA 1NTRA 3B48A 3MOSA 2CMHA 4KX3A 4TVBA 3UMJA 4D9EA 4DQDA 2HWUA 4XOIA 1IAVA 3ZVRA 1RI5A 3GFRA 1NBWB 3EXG2 4XJVA 2ERCA 2H7CA 3SX4A 3PKZA 3ONWA 1UMDB 4YUAA 4JZYA 1FSFA 4HCJA 3L4SO 4XUCA 2R7AA 2VK4A 2AUNA 4CF7A 2X1LA 4NMWA 5NLLA 5BW5A 5F2NA 2YRWA 5DTIA 3BMCA 3BL8A 2VJDA 3FW1A 1QTNA 1R6AA 1R6VA 3AJAA 3BTSA 1VBKA 3H75A 4FNMA 4GR9A 4MGIR 4MPPA 4RTOA 1CUUA 1JTEA 1VA4A 1VPLA 4I50A 5I7SA 2FN4A 4QDXA 5L6MB 2O0JA 3DVRX 2WTEA 2JAUA 4ZYZA 2MHCA 2POCA 3Q88A 3HXPA 3T6KA 2R1UA 5DBFA 3TLZA 4H77A 2GNAA 1YI8A 4IBOA 2FMUA 2HSGA 4V2UA 3G2MA 5LXTF 2QV7A 3IQHX 5DBGA 2REXB 4GRDA 2HXYA 3T54A 2D62A 1K1EA 3HFSA 4RTPA 3CX3A 1REQB 3H4IA 3OHSX 3RKRA 7ADHA 5ILQA 2PRSA 4OQQA 3VVLA 1DPGA 3MCZA 3RROA 4AO7A 3GLIB 1O08A 5KC9A 1AZTA 1VSVA 3ETGA 3C3YA 3LGSA 4QPDA 5KTMA 2O5EA 2GLTA 3DP7A 3NH6A 5A71A 5KJCA 2VJQA 1ZK4A 4AD8A 2QUZA 2CUNA 3FA2A 2QTGA 3GARA 1RIIA 2I03A 1YZKA 4U5XA 2E4VA 4WZAA 2FP3A 3FHLA 4U02A 4WXRA 2BEKA 1Y9EA 2GRJA 3FLAA 1B8UA 4R2IA 3WLTA 5IUNC 2Z83A 1L5FA 5JVDB 4UTPA 2VBFA 5JAOA 3BDIA 4JVNA 3ELYA 5SYAA 3RRZA 4AQDA 5C5DA 2TYSB 1BXRA 2C1ZA 3RU3A 4HAYA 4CDNA 3ZUGA 3DVSX 1H9BA 3TEJA 3V55A 3V9PA 4PBRA 1QC5A 3KXKA 1PWHA 4IUDS 2HZ7A 3PEUA 2GWRA 1B0PA 2VZEA 3AHJA 1YE8A 2GVZC 3KZVA 4MLZA 3E5RA 2Y0EA 2POQX 3IAS1 1J4AA 5AI8A 1QQAA 3JD4A 1J99A 3GGCA 3QWIA 1YA4A 5E2AA 1DKNA 1TB4A 4ODIA 4CEIB 4R7ZA 3ONEA 4Z8YA 4DV3B 3JZDA 4W7HA 2OG1A 3K8QA 4ZVVA 1U8UA 2RGBA 2WU4A 1Z56C 3BIJA 5E7IA 2A5DA 4JS0A 5L9AA 5I7UA 4KR0A 3O8CA 2VF2A 3UB3A 1HOXA 3A6JA 5AWFC 4A10A 4BAGA 5L3QB 1EHYA 1P5FA 1U2SA 2VNAA 2J3HA 4HEHA 3ROQA 2FVXA 2VHYA 3O1HB 3R40A 1XOIA 2E4ZA 2X5OA 4MS3A 5D5PA 4DB4A 5JTUA 3QPAA 1ISIA 1WETA 4UCQA 2YMLA 4FEGA 5AI5A 4NPCA 1YFZA 1G9XA 2WJ4A 1XB2A 3AI1A 2C3YA 3RV4A 1R4ZA 1GFIA 1DPFA 1HE8B 3LS2A 3LWNA 4BB0A 3QXCA 3PFIA 1LTQA 3VR5D 4C4ZA 4CV2A 5I4BA 1F20A 3U7RA 4NV1A 2VP9A 2JIMA 3HHPA 2ZETA 2DYKA 4HGPA 5EEHA 4FJ2A 1T29A 2CN1A 1NGSA 1XA3A 2P79A 5H3CA 4JK3A 2E2WA 1UBLS 1L3IA 4CV1A 3ERCA 5ANRB 4C89A 1CFJA 3PUJA 4MYHA 3IAS6 2RG7A 2W83A 3PHHA 3QUQA 5DNWA 1XD2A 2VHEA 1V1MB 2PMFA 2XUHA 4L8GA 4M1WA 1SIWA 4QICA 2XH8A 2DHDA 2BFNA 1PJLA 3FHJA 4LVNA 1GT6A 4TZKA 1KU0A 3NEJA 4H59A 1QH1A 1WOYA 2VSQA 1EJ0A 4M22A 5JCOA 2G9ZA 3Q2IA 4K8RB 1HFKA 3DWGA 2QN2A 4J2OA 5THKA 3I01M 3RK1A 3MCAA 3D64A 2ONKA 1RHJA 1U8FO 4WNYA 3K9CA 4IGAA 1N3YA 1WD7A 4YBRA 4RBNA 4CT4B 1B42A 3JZIA 1GPJA 1AZSC 2WF9A 2ZSUA 1NVAA 2PSFA 4KLZA 5TPWB 1IZ0A 3HBMA 4ENUA 2JG3A 1G7CA 1IEWA 4RF3A 4V39A 4XD7D 2O8CA 1ORIA 4K3VA 1N2SA 4U7HA 5A0FA 3KJNA 4CW7A 5JWOA 3LPLA 4RFSB 3ZWCA 3WIDA 5DYWA 4EBFA 2CLEB 4AJ2A 1Q95A 4RVSA 4UEQA 1BE6A 2WHPB 2DZDA 3ITDA 5EHZA 4BXOB 3WLNA 4HAUA 2RAUA 1FRNA 2WWHA 2SKDA 3FFXA 3W7VA 1BTOA 5EC8A 3MHPA 3EZNA 3IDFA 3ZWXA 1LV8A 1RXIA 1MW9X 1JU4A 1TCAA 4LWPA 3EEBA 4GPZA 2OORA 3DB1A 4HDMA 4L16A 2BOVA 1CNEA 1SCJA 2M6RA 1I2AA 2QTBA 4IJMA 4RK1A 3TQCA 4RH0A 2C5FA 1Z82A 3GW8A 3RWOA 3EVNA 3REQB 2R8ZA 4DA8A 3NV9A 4DWWA 1XI2A 3BREA 4BFXA 3PDHA 5AUPB 5BV7A 5IU6A 2ZUUA 4WXMA 4FN5A 3GT7A 1MRNA 2GXSA 2QR3A 3C3EA 3K71B 5EIXA 1LA2A 4LY6A 3U1TA 2D2XA 2CNBA 3LY9A 1UBNA 4XSVA 5CLHA 3L4KA 1E1QA 3A9WA 4GZLA 4PZYA 4RVUA 2X3UA 5FOVA 1PQWA 1YBMA 3KZCA 4ZOCA 4DZTA 1NRWA 2FOXA 2ZYSA 4NZOA 3M4YA 4XFKA 1IQRA 4F5YA 3HP4A 3TSCA 3QTBA 4WLVA 3TH5A 5CA0F 3GQBB 1VSTA 4NCJA 1ZXLA 1UP4A 1XZHA 1L7PA 2PIAA 2VWHA 1V39A 2Z2KA 3EUFA 2IHYA 2WB2A 3CRVA 3F8WA 5KNBA 1OB5A 2AEFA 2ONJA 4E1AA 1DAHA 2Q5JA 3ZE6A 2PH5A 2UVPA 1U0OC 5JBQA 1QRSA 4BVKA 3I73A 4KQXA 1WNFA 1XQVA 2IGBA 2QD1A 3HV0A 3V7FA 4JV5B 4TV8B 2ZRNA 2QRKA 3QPBA 1LBTA 4IJ5A 3ANTA 2BZSA 2GPNA 2BMEA 2V5AA 1E1RA 5DGHA 4EKYA 3OF5A 5LUBA 1A7JA 3VH4A 4PO8A 3DTVB 3QXJA 1JILA 1Z0UA 3B36A 4AROA 1TJ4A 2WAYA 4RX1A 1QOQB 3HUTA 1NVTA 3GRCA 1H2FA 3FF4A 5GADl 5K3BA 2ZB3A 4TYNA 2PGIA 2HXSA 2WIFA 3INYA 4D4JA 1HNWB 4WBSA 4KO8A 1E1NA 3B9PA 3F4LA 5EP4A 3V1KA 5LXTB 3ESZA 3GLUA 4EUHA 1NYQA 4MP3A 4MS4A 1AN9A 5CX4A 2Q3EA 1GGEA 4EO4A 3FTDA 1ZFNA 1I5RA 1PS9A 1PSDA 3LWZA 4G1FA 3W2EA 3LDFA 1K3TA 5BORA 4UE6A 2RHGB 2C5EA 4GVLA 4BWGA 4Q4HB 1EDZA 2Y77A 3ZTWA 5K0LA 3L7BA 5B1IA 3RVOA 3WNDA 5C8VA 2CEKA 4UUBA 4CMEA 4ER3A 3HH8A 3C4JA 4R0MA 4A91A 4RJTA 2HLDA 3NKVA 2PLAA 1JI0A 1Z2AA 4IIBA 1CW2B 4KAAA 4NY1A 1VB5A 3L8MA 1L1RA 1Y8RB 1LLQA 3F96A 3DONA 1Y3AA 2VDWB 3EA0A 3TI9A 4DEYA 1K98A 4IS2A 1O4VA 2X7JA 2ZR7A 3AERA 3L04A 1HDYA 2JFFA 3UJBA 1R0BA 1X86B 1P0IA 1KDPA 1N9GB 1IQUA 1G2QA 1UZMA 3BQNB 2CBGA 4R1LA 4RACA 5JS2A 5FNVB 3F7NA 4GZ3A 1V4VA 1XRPA 3OAAA 4JLPA 4IIGA 2B6NA 1TF5A 1UWKA 3NHMA 1TKCA 1Q3KA 2JI4A 2H4HA 1U3DA 2ZB7A 3OZBA 4O2LA 1MTOA 2RIRA 4R40A 5CVUA 1WZNA 3M4NA 3VDXA 1TIBA 2OAP1 4JVLA 3TX2A 4REMA 4EG0A 3IPRA 1N3BA 1NXOA 4RH1A 1QIDA 4I5GA 1QHSA 4AWBA 1UK8A 1FLVA 3KSDO 4LPKA 1ZGGA 4UZEA 4FUQA 5LXTA 5H8WA 1WM1A 3O9MA 4JL5A 2HA0A 5FA6A 5H0IA 2C61A 1JN0A 2ILVA 3P9QA 3AY7A 4KQ9A 1OPXA 4X44A 5KOJA 3C5WP 3JWEA 3L9WA 3LKBA 4UEWA 5G4KB 3WKAA 5KX5A 4EY5A 2YZMA 3A7EA 1U81A 3UMBA 3WP1B 5GVSA 3LPNA 2BCJQ 3P2YA 1DRVA 1TJYA 3O74A 4JBLA 4JVMA 5F5LA 3RVMA 3UATA 5B7GA 2D59A 4XUGB 3ENVA 3IKMB 3D6UA 1JLMA 4KE7A 2DE0X 4DLXA 1A9RA 2F3QA 4ND6A 4JI7B 4KXWA 2Q21A 2J6HA 1DL5A 2R6CA 2A8YA 3CCCA 3DEKA 2JFNA 5DLQC 1T9GS 5KAMA 3WLKX 4CWAA 4CEJA 3O0TA 4WINA 3STUA 1WBBA 1Q0ZA 4FNAA 1L4GA 2NP6A 2WMOB 2Z2YA 3TN7A 2JFXA 3NHKA 2EKQA 3ND9A 2XADA 3CBGA 4A92A 4MWDA 1OH5A 2OG2A 3EODA 2F3RA 4BV9A 4J16A 3TCXB 1C9DB 5EINA 1GKUB 4CM4A 4DQ0A 1MXHA 2ZYRA 6LDHA 5LWQA 3VR4D 5DYTA 5AKHA 3G2QA 3FYUA 3Q4GA 4WY8A 4EY6A 3VOAA 1W73A 2AF4C 2NU7A 1D1PA 4UDOA 4W8GA 4WXEA 3I6QA 4A1FA 2Q4BA 4EB6B 5F2EA 3UFXA 1NMQA 4QXPA 2Q2WA 1ZWLA 2B9VA 4KQ6A 3P9KA 1IZ9A 2VXCA 4J2HA 4AJOA 3L7KA 3BTOA 5DNAA 3X1MA 1KNXA 3JQRA 4KCGA 3W8EA 4FUTA 4M1OA 5DU2A 4PLFA 4AP6A 4BJ6A 4C0KA 1ISFA 3I04A 3TECE 3KTOA 5LDHA 2W0SA 5BN1A 1PFYA 3DR5A 1TT7A 1V9CA 2B30A 4RM3A 4B3RB 2XWJI 1LFDB 2JLQA 1D0IA 3VDRA 3DJYA 3M6FA 2CLMB 1LLCA 4IDBA 3QELB 1OLXB 5HBRA 3RYFB 3F73A 1W85A 4KSYA 4U7GA 1U8AA 4I5DA 4C6RA 1TE2A 2XXBA 3UCXA 5A9RA 5F35A 1JG6A 1OT5A 1O87A 2OHOA 3FWYA 3DHYA 3GA5A 3QXXA 4TUYF 1F7VA 1S1MA 2FH5B 5AJHA 1ZLYA 2NUBA 5DLYA 5G4KA 4DG8A 5KX5B 1UOQA 1X1BA 2VNKA 1V43A 2ZULA 3DR3A 1XDZA 1JXMA 4HD8A 3ONDA 3U1BA 5AW9A 2BGTA 1PL6A 1SC9A 5KOHA 4DSZA 1ARZA 4KO3S 3EXHA 4CQMA 1DEKA 4BQFA 2G1PA 3OU6A 4ZMSA 2JJ2A 5JZOA 1KJIA 4OXRA 1CB7A 3TAXA 1DG1G 2ZRKA 1QZZA 3KJEA 3KYDA 4GBJA 3PC7A 1W29A