1M2OB

Crystal structure of the sec23-sar1 complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
167
structure length
164
Chain Sequence
GKLLFLGLDNAGKTTLLHMLKNDRLATLQPTWHPTSEELAIGNIKFTTFDLGGHIQARRLWKDYFPEVNGIVFLVDAADPERFDEARVELDALFNIAELKDVPFVILGNKIDAPNAVSEAELRSALGLLNTTGIEGQRPVEVFMCSVVMRNGYLEAFQWLSQYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport/signaling protein
molecule keywords protein transport protein SEC23
publication title Structure of the Sec23/24-Sar1 pre-budding complex of the COPII vesicle coat
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 47
structure length 164
sequence length 167
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1m2oB00
1GKYA 4BLQA 3ICEA 4WA7A 4PZYA 1IY2A 4DEYA 4QGFA 1PUJA 2OM2A 2IXFA 3GLFB 4B2PA 1J7KA 1BH2A 2DY1A 3W90A 4D6PA 1II8A 4A8JB 4BECA 421PA 3ZQ6A 3OE7D 2G1KA 3LVQE 4HUQA 1IM2A 2N46A 2QT0A 4D25A 3FMFA 3SU8A 4KLZA 1Q44A 4RD0A 4TTRA 1GITA 4FW9A 3WYFA 4C0JA 1TQ2A 2R6AA 5H68A 1JQJC 5B57C 4HB2A 3P20A 3VHLB 5HKKD 1NSFA 3FTQA 2MMGA 4PXAA 1KI7A 5BWMA 4PSAA 4EUNA 4YLGA 5DLQC 2OBNA 4ILEA 1RYFA 5GJWC 2WPDA 4JLJA 4TN1A 2FGJA 4XSHA 3EX7C 2QBYB 1UKYA 2R65A 4PC7A 4A0HA 5JHGB 1G19A 4G5OA 2HCJB 2R6GA 2GTPA 1Z6YA 2QROA 2GZHA 4LJ8A 5AJVB 5JHHB 4QHTA 2GWHA 1D2NA 4G5RA 5FFMA 2IC5A 4URUR 1NVWQ 2OZEA 521PA 3DEFA 1SULA 4BFVA 4BEBA 1E2KA 1N25A 1IXRC 2O52A 2JIZA 2HYIC 4D82A 1VDZA 2JLXA 1ETUA 1OH7A 4C0QC 1E9DA 1NMXA 2AWOA 3AUYA 4PPNA 4DIDA 3D3QA 1DAMA 4A0GA 3A1TA 1NNEA 3FE2A 2IEYA 4DDTA 1XFAA 4OI0A 2FNAA 3P1JA 5GJCA 4GP6A 1FNNA 1TQ4A 1OJLA 2SHKA 4S35A 2O8BB 2VHTA 3B1YA 3QSYA 3SYLA 4TQ9A 3GLHB 5AUQA 1NLZA 5DHAA 1VG1A 1U8AA 1LS1A 2ZRJA 4EPXA 1GIAA 2F1RA 4IOJA 2J5XA 1TF5A 1HQCA 3QXSA 1Z22A 4QBGB 2WJIA 4MUAA 5BN4A 2BM1A 1FP7A 3CH4B 2D2EA 1F2TA 1H8ED 1E0KA 2QEQA 4ACAA 2FSGA 3Q85A 1IJEA 2CBZA 2WWHA 3U6KA 2HV8A 4HZUA 4C7OA 4B34A 1G5TA 2KSQA 4UXHA 4CEHA 1U8ZA 2HXYA 1ZM9A 4KYIB 1CJMA 3EZ7A 1G41A 5JS8A 4M9QA 3AM1A 3TVTA 1UJ2A 2BVNA 4KLNA 4EJSB 1IY0A 2AKYA 1R10A 1IOZA 1GL9B 4AYWA 4JVSB 3W5IA 2WIAA 4D0GA 3ZLJA 1FNMA 2CNWD 4NYJR 2P5TB 4AC9A 3GEHA 1VMAA 1TUIA 3AP2A 3RS7A 1XPRA 5JECA 4TYQA 2IYSA 3WBJA 3EG5A 2Z43A 4DIEA 1MO5A 1XDBA 3RRZA 4QJ3A 1OT3A 1IXSB 4TLAA 1FFHA 4MKFA 4KO8A 5AUPB 1CR1A 1T8UA 2IT1A 2F43B 4K8OA 2BJVA 3NDPA 3OIYA 1OFHA 4IDHA 4ZI2A 3RS5A 1R7RA 1NJGA 3S1AB 4U7DA 1AKYA 3L2OB 1ZC3A 4FXPA 1MO3A 3CNNA 3MGCA 4JT4A 1II0A 4WXPA 1TTTA 4QG7A 3EIQA 2FMXA 1UBCA 3BIFA 2QT1A 1MH1A 3HU3A 3R20A 2EQBA 5FUWA 2OBLA 2NO6A 3I32A 4E07A 4W9MC 3CPEA 1XRJA 4PX9A 2K5UA 1K6MA 2H7VA 2ZYTX 3U4QB 1KSJA 5CIQA 1YJ5A 5TARA 5FTJA 1KI8A 1L8QA 3AVVA 1K5DA 1EWRA 4TWZA 4QM6A 1GUAA 5G41A 4NYMR 1E0AA 5C4MA 4LGMA 2GXSA 1T3SA 2OV2A 1SQ5A 2QRNA 2JCSA 3RNLA 4C0HA 2ZRHA 2QQ0A 1OXXK 2D74A 4A0RA 5FBVB 3CRRA 4LV6A 5KDLA 1IAQA 2IYZA 2BCJQ 2CXXA 3NEYA 3CF2A 1W2GA 3KFVA 3C7KA 3PUXA 2C98A 3WY9A 2Z6VA 4YMVA 3LVRE 2WTUA 4IEIA 1HUQA 3IQWA 3TE6A 3LW7A 4CZ2A 1A2KC 2FE4A 3IUYA 1KO1A 4Y0AA 2C95A 2DHRA 4FMDB 4YXWD 1N0WA 4K81B 4BZXA 4HB0A 4MQBA 4ZDIA 3GLFA 5JJLA 3L0OA 2B7BA 2ZE5A 3CIOA 4LJ5A 5A5GA 3PV0A 3AH8A 3GQBA 1U98A 3U3JA 3UATA 4A8JA 1PLJA 3T5GA 3CR7A 2E9SA 4I99A 1G3MA 1R8QA 5TVKA 2MSEB 2QQEA 2GHIA 3QXJA 3FOZA 2IYLD 3M6AA 3DPUA 3QUSA 4JBXA 3SHFA 2W6IA 3K0SA 1UKVY 1XTKA 3Q9LA 2XZOA 2XOKD 4KBFA 3EIHA 3NBFA 2NQ2C 1W48A 5SZJA 3RC3A 5JS7A 2ZYWX 3QXCA 1M6NA 2XAUA 1GTVA 2AXPA 2ZSAA 4NDZA 1RFLA 2RHDA 2QBYA 4GZMA 3LLMA 1X8LA 2Z4RA 3SJCA 5KSPA 1NVUQ 2PL3A 1AS0A 3HJNA 4BASA 1CEEA 1CTQA 2IS4A 3B6EA 3BBPA 2BBWA 2PEZA 3GLFE 1SXJB 1S0UA 2BMJA 1ZVQA 2RGAA 1OFUX 1U94A 3TH5A 3FKSA 2WJJA 4GBMA 4FCWA 1ZIPA 1MRSA 1KI2A 1BS1A 4KJZA 4BUJA 2J3EA 5K8TA 1XCGB 1DPFA 4Q19A 1KSHA 5E95A 2O8EB 2FFHA 4JLOA 1AJEA 3HYRA 5TMPA 4OK3A 4G5SA 5JMTA 3VAAA 1KY3A 3W9YA 5J4YA 1ZUIA 1K5GA 3K0AB 1WQ1R 2AR7A 1GL6A 4RSGA 3T15A 2QMEA 3BERA 3NXSA 3FFBA 2O8BA 4MUBA 4HUTA 3GLHA 4URWR 3O8BA 1AN0A 2GETA 2ZI4A 2V7QD 5H1YA 2VTKA 3TW4A 1RE0A 2RGGA 4BE7B 4PHTA 3GJ4A 1E69A 2ZRBA 1OYYA 2A9KA 2DBYA 3PUYA 4NTZA 2QTFA 4PPFA 3KKQA 4AKGA 3F3YA 3ZS9A 4PFSA 2FSHA 4GOXA 1WB9A 2WOOA 1E2FA 2WWFA 1RW4A 4C9BA 4DLSA 4LJ6A 1QDEA 5KDOA 3A4MA 4QBIA 4RD2A 3BWDD 4LSGA 3M1IA 3WXMA 3Q5EA 1SVLA 1GRNA 1ZU4A 3NDBB 4TYWA 1MT0A 2C5LA 1NLYA 1W4BA 5CLQA 5IDVA 4CVNA 3GJ3A 5IHPA 3M0EA 2IF2A 5AJXA 4EJSA 1KTVA 2W6JD 3SE0A 4B2IA 4KBGA 4B3FX 2FA9A 4ARZB 3GLHE 2BKEA 5HZKA 3NH6A 3LA6A 3W6PA 2CL7X 5EZ5A 2XEXA 1C4OA 2VSOA 3SHWA 1PJRA 4K46A 1VCOA 1COWD 3LX5A 1FX0B 2VH5R 1W0KA 3FYHA 3GMTA 4L15A 2BHRA 3U7FB 1NSTA 1WE2A 3QPWA 2GK7A 3P4XA 4TT3A 1U2RA 1ZJ6A 3ADBA 2F43A 4LBZA 4ZPXA 1DELA 4TSFA 1BMFA 2BBTA 2DWQA 2WZQA 2ZE6A 2VO1A 4TQAA 4RZUA 1SZPA 4QJ5A 121PA 4LOAA 5LB4A 2BCGY 1NI3A 3LLUA 3PVSA 4M1YA 4TLCA 4A82A 4PAOA 3QVUA 1JI0A 1EK0A 2PJZA 3UWKA 1RPZA 1HY3A 4NH0A 1Z63A 4Q1AA 4M1KA 3GLIB 4WZAE 1E4YA 2RB4A 2W2TA 3ASZA 3MSXA 4O3MA 4Q00A 5F9HA 1XEFA 3LNCA 3QKTA 4CGZA 4LRWA 3A4LA 4P4TA 3X2SA 4ZI3A 3VNUA 1P73A 3QVVA 5LPNA 4WXRA 2GILA 3KQUA 2RCNA 3TR5A 4BLTA 3SQWA 721PA 2VEDA 4HB3A 2EW1A 2F9MA 1XNJA 3IHLA 2WV9A 4P32A 4XSGA 4C30A 4HZIA 5LD2B 1Z06A 1NRJB 2AWNA 1K8RA 3QPVA 3EA5A 2ANCA 1KI6B 4DXAA 4EPVA 4LBYA 2ZI5A 5F3WB 1DAFA 3MUFA 2B8TA 3DM5A 3DMNA 4LHXA 1XPUA 2ONKA 2QGNA 2JLZA 1DADA 4G3XA 4CF7A 2ZYUX 1XXHB 2RGXA 4DCUA 1HH4A 1XU4A 2REOA 2WMOB 4LWZA 3VFDA 1VCMA 3F8TA 4Q1BA 1J8YF 4D4JA 4BGDA 5BQ5A 5TY0A 4FCTA 1Z0FA 4HLUA 4TMTA 4BFYA 5AK0A 2XTMA 3HU2A 4XH9B 3H84A 4NCKA 1Z0JA 5EXXA 4Q21A 4Q9LA 1X1RA 2GEUA 1ZM4A 2XNDD 3JZMA 3A8TA 1BYUA 4A8JC 2A5FA 1NLFA 5SZHB 2Z0MA 2ZPTX 3NIBA 1UBFA 4XWKA 4HEJA 4PHFA 4MGIR 2GJ9A 1UBGA 4LYAA 1NG9A 4LHVA 4RCZA 3IGFA 3OEED 3TUZC 1HA3A 4IXNA 3C41J 3DDCA 3BH6A 1UEIA 2WIBA 1PVOA 2GJKA 1ZNZA 4HATA 3OFND 1W4CA 4LHZA 3MD0A 4EQ6B 3K09A 1SXJA 2HEIA 1G8HA 4MGYR 1SKQA 2PJRA 1OF1A 2ZI7A 2V55B 1CXZA 3WMFA 1CU1A 3LBHA 5LBIA 4A2PA 3P27A 1DARA 1NN1A 4HDCA 3AVOA 2ZRAA 5E7IA 2AFIE 3KJGA 2ECKA 4GFDA 4ITRC 3AUXA 5FR2A 2WJVA 1WBBA 3HWSA 3PUVA 2O8EA 1N5LA 1X86B 4Q1CA 5LB2A 2ZITA 4IXMA 1MV5A 4PHGA 4OQXA 4OYHA 1XP8A 4IFEA 3K0AA 4HAYA 5HZHA 3BK7A 3EW9A 4MDFA 5G3YA 8OHMA 2ERXA 2VL7A 2BWJA 2QI9C 1YU9A 1JR3D 3WP0A 4JVLA 4TYNA 2ZRFA 2ZAMA 4JKIA 4BFTA 3C16C 3T61A 4A6PA 3QKUA 4A15A 3V4RA 4C2UA 3SZRA 2WWXA 5H70A 5LDDC 2WWGA 4JJZA 2JJ2A 2WAYA 2YJTD 1SXJE 4EFMA 1UF9A 2ZTSA 4XTRA 1MO4A 2VHCA 3KZ1E 4G0NA 3WBKA 3EWAA 3PEVA 1MRNA 1NY6A 4OHXA 3T1QA 4JVNA 4CT5A 4BFXA 5FPSA 1DAEA 5CB8A 3AQ4A 2YYZA 4LUCA 3NH9A 3KKMA 4DCSA 2P0EA 2C04A 3A6PC 2Q9AA 3MFYA 4V0KA 3WHLA 3NHBA 3TGPA 1TEVA 4ARZA 1KGDA 1A4RA 1FW6A 1OLOA 1IN5A 3D7MA 4P0TA 4WAUA 2F7SA 5L3RA 1Z0AA 3B78A 4LCBA 4IEEA 4HAXA 1FX0A 2L0XA 2JIZD 3VR6A 2JATA 4EJSC 3LBIA 4LBVA 2R62A 2NO9A 4N1AA 2PX0A 2GVZC 3W3ZB 1JXMA 2ZI3A 2W0MA 5DO9A 1YZQA 3SN6A 4EPRA 1E2JA 3A37A 3CO5A 1RZ3A 3FKQA 5HE8A 5BN5A 1D9XA 4B76A 1Z83A 1ZCAA 4B32A 4ERNA 5H8WA 2EFCB 4A0FA 1E9CA 3ZD6A 1L4YA 3HR7A 1EWQA 4PZLA 1ZRHA 5CK5A 2FEOA 5FPYA 2GZAA 3GLIA 2H18A 4RVCA 1RRPA 4QL3A 1E1RA 2JJ1A 1RYHA 4IDNA 3EWSA 2C78A 3LO5A 5JWHA 3SBEA 4B75A 3PR1A 5FTMA 2GXQA 3SEAA 1KI4A 2CE7A 4FMBB 2QNRA 2YVUA 3ZIAD 1P60A 1CJVC 1RIFA 2KBFA 4O0MA 2GCPA 2AK2A 1QHYA 4V0NA 4FMCB 3VR5A 1T3LA 4I1UA 4IDPA 3CWQA 2WMNB 5EXSA 1YZNA 4XD7A 1KI6A 5CDFA 3AVTA 4PPQA 1VIAA 3EPJA 1GL7A 1ODFA 1OXSC 1ZMXA 1NKTA 1ZNYA 4WZ6A 1VKJA 1XBTA 2FGKA 1US8A 2PT5A 3KXIA 2RAPA 1P9NA 3IO3A 1J2JA 1E2GA 2IYUA 3T5DA 2C9OA 3L8ZA 2FPKA 2XB4A 1XXHA 1RRCA 3IEVA 2P65A 1JAIA 2WHXA 4DDWA 3CKLA 3GLIE 1Y63A 2BMDA 3TUIC 1UAAA 1N5IA 2OUKA 5C1BA 3P4YA 1IN7A 3TAHA 1CS4C 2QPTA 1P4SA 3W3AA 4NHOA 4PC2A 3RRYA 3ZDQA 5KDDA 2KE5A 3QKSB 4MYUA 4X8LA 1Q0UA 3N70A 1UADA 4LYJA 3SI7A 4F93B 2J59A 4DKXA 1E9SA 3GLGB 2D2FA 1XX6A 3ND9A 4A92A 2Q6TA 2AX4A 1S1MA 3X1WA 5EZ6B 2HUPA 1QRAA 5CDFE 3TBKA 4NP6A 3CNOA 3OAAA 2DFTA 2FEMA 2WKPA 3Q8XB 5HE9A 5FPKA 4B3BA 4MKGA 1HYQA 1A5TA 1E94E 2NG1A 4B2LA 4EQ6A 1KIMA 1KJYA 1H8HA 3NC1C 1XXHE 3KJHA 4BFWA 5E3HA 3EARA 5HCNA 1VG0B 1V5WA 2RGEA 3GJ6A 1FTSA 3CLVA 4JJKA 4RKEA 4URZR 3B13B 3I1FA 1FOEB 3LFUA 1W0JD 5EP2A 4I4LA 2A3RA 5EJEA 2PLFA 4N0EA 2GK6A 3B1WA 1G3IA 2W83A 3LW8A 2I4IA 2IXEA 2IBMA 1XTJA 3QF4A 2ODNA 3LV8A 3AF4A 4TL7A 3K09C 3THXA 1SXJC 3GCGA 4UQOA 4YDSA 5L3SB 2R6DA 3CF6R 5B64A 4TL9A 2Q21A 4IVQA 1LVGA 4DHEA 2ZETA 2JDID 1II9A 5FBLB 3RYTC 1S3SA 2C8VA 2REXB 5GVSA 1S3GA 2OFWA 1GVNB 4II7A 2RGBA 3ZVRA 2GESA 3U44B 2PBRA 2VA8A 3MWYW 1FP6A 3C5HA 4LK2A 3NBYC 2YWFA 4JLKA 4F7WA 3A1SA 4Q4AB 3DHWC 4HAZA 1YRBA 2BOVA 2ZRIA 2FF7A 4U02A 3AVXA 4DWJA 2F1JA 1VPLA 5JEDA 2JLRA 3P26A 5B2ZA 3NC0C 3QY0A 4KITB 4M1OA 1Q21A 3FVQA 1LF5A 1SVMA 2ZUDA 3A1UA 5FUXA 4Q66C 4KSCA 5DYIA 1YZTA 3CX6A 1P9RA 2HF9A 3LQRA 4LJYA 1T5LA 1JEDA 5JWRA 4GMXA 2QMHA 2NGRA 1SGWA 4R71A 1NIJA 2PCLA 2W00A 1G291 2GA8A 3I8XA 1W4RA 4Q1EA 3RSLA 5BXQC 3NBZC 4KI0A 3SJBA 1GWNA 1YZUA 4IKEA 1F5NA 1I2MA 4PQRA 2CHGA 2XX3A 1XZQA 1E2EA 3NVAA 5J40A 1CULC 1IQPA 4BLPA 3WYAA 3R7WA 2FU5C 1U0HC 1WMSA 4URVR 4GT1A 3QE0A 3TR0A 4D2IA 2B6HA 2DWOA 4DZZA 1TQDA 2ATVA 3TQFA 2KWIA 2FFQA 2VIIA 3TNFA 4A9AA 1RRGA 3D8BA 1KSFX 4QNRA 2XSZA 4WBSA 2H16A 5BW8A 2G0TA 1G3QA 2DB3A 4Z8YA 3T35A 3J81k 3LQQA 4FWTA 2O8FB 1JR3E 2IUSA 3R9IA 3WRXC 2YWGA 1P72A 2ODBA 2UKDA 4JLBA 1E9FA 1DS6A 3RSOA 3V9PA 1XTRA 5L3QB 5IK2D 3IO5A 3UMFA 5DI3B 1ANKA 2IEZA 2EU8A 4HLCA 1JNYA 4M0LA 5F2EA 5GADl 5P21A 4HDQB 3OF5A 2QMOA 1UDWA 1YQTA 4AURA 1N5JA 1KJZA 1DO2A 1VYTA 1IN4A 3OEHD 2XGJA 1S4QA 1KI1A 1EX6A 1KNXA 1W2HA 3AKYA 3B1ZA 4Z54A 2GNOA 2FH5B 4TLDA 3ADKA 5DYGA 821PA 2JLVA 4OK6A 2ZE7A 2VP9A 1W36D 2X1VA 1E1QA 2ODEA 1AZTA 2WJHA 4RD1A 3EPKA 5KNCA 1XD9A 2CJWB 4TLBA 5JI3E 3SC3A 2DR3A 4FN5A 1KJWA 3QIAA 1UKEA 1KK2A 1NP6A 2ZRLA 2WJYA 2VPPA 5C18A 1HV8A 1EXMA 2JGNA 5AJZA 4D80A 5LD2C 2ZU0C 3B82A 2N42A 1BOFA 1GNRA 2FPMA 3GD7A 3QOFA 3WMEA 3QKRB 2LKDA 2FDCA 5AUOB 1U0JA 3L43A 5JLJA 1VYVA 3CONA 2AD5A 1EFRD 4LV5B 4IRUB 1JQLB 4NU0A 3Q72A 1D2EA 3RRNA 5CM8B 3QKSA 2HJGA 1NN5A 1W36B 3I8SA 3VMFA 4KAXA 3ND8A 4Z1MA 1YRAA 4IJMA 2IX3A 1HT2E 2HDNB 3UG6A 3GLGA 3QBVA 2QE7A 3AF2A 3H86A 1FL9A 2J45A 2GF9A 1TPZA 4PSVA 1AZSC 4R2HA 4E09A 5FOWA 3ZD7A 2ZSDA 2CHQA 4LC0A 3TQCA 3O8DA 4TLEA 5M04A 1QF9A 2BEJA 3I72A 1FQJA 3AF1A 2C99A 3DVLA 3KKNA 5IT5A 1WBDA 3RS0A 4KV9A 4Q18A 1G8YA 3E5HA 5HPYB 1CJUC 3NEJA 4OI2A 3SS8A 4TZ0A 3QG1A 1OPXA 5CYOA 4UNNA 2E87A 3Q7QA 3PEWA 2F9LA 3BGWA 4UNSA 1XMVA 2OAQ1 4UJ3A 3WHKA 1E4VA 3PEYA 4AKIA 2G88A 1DAHA 5DN6D 4NCHA 2QPAA 1KYIA 1LS6A 4R7ZA 5IF9A 1LY1A 2YZ2A 4AG6A 3F5FA 4QM7A 1QHHB 2IUTA 1G64A 2FPLA 4OJQA 1Q57A 1G8PA 3B9QA 2ZU6A 2QAGB 2GVDC 4JLVA 2IA5A 3THWB 3KKOA 1N2CE 3KL4A 3GLGE 4QNMA 1NMYA 2PX3A 1WP9A 2ZUBA 3TW8B 3R9XA 4M1MA 4U5XA 1Q1ZA 3BE4A 5EUQB 3U44A 4AK9A 3QXHA 4ON9A 2NPFA 3GJ7A 4DCTA 3L8YA 4RKFA 2B8WA 2BBOA 1RC8A 3K0FB 3M4YA 5JFGA 1E79A 3DO6A 2EYUA 4E5UA 1S8FA 4D4LA 5BYKA 1X3SA 3A1VA 3DOFA 4URXR 1PZNA 3T1OA 3PCRB 4HAWA 4RD6A 1R0YA 2OFXA 2A7QA 1T0JB 3FDIA 3I73A 3W8NA 3VTKA 1S9HA 2G77B 3ECCA 1J70A 1GSIA 1QHGA 2QSZA 3K70D 3BH7A 4JMPA 1N5KA 3K9GA 4PO9A 1SHZA 4Q7JB 4KFUA 2KBEA 1XCPA 1P61B 2ZVPX 2F55A 3PJRA 4FMDF 3THYB 1QHSA 4TYYA 3N2IA 5J4LA 4QOSA 3FHOA 3OE7A 2HLDD 2W58A 2X77A 3DKPA 4TTQA 1GM5A 2GEDA 1JALA 4M53A 1W49A 1XF9A 2ZAOA 2WKQA 1R0ZA 4RD4A 1SVWA 4LYFA 3WNDA 4D0NA 5HKKA 1P62B 2QAJA 3EC1A 3QBTA 3GJ8A 4Q9HA 3PUWA 3TRFA 621PA 3TSZA 1KHTA 2DWPA 1GOTA 1JJ7A 2REBA 1JPNA 1WDTA 1AS2A 2VF8A 4Q02A 1KKMA 2EFDB 2QL6A 2QENA 1ZINA 2V4ZA 4NCJA 4C0SA 4XWOA 4BLSA 2QP4A 2CLSA 2FZLA 4B48A 2X19A 2O8FA 3IDQA 2P67A 1ZNXA 2AN9A 3GJXC 4Y0VA 1Z5ZA 2D7CA 4TQUS 5L3QA 4TMKA 2JLUA 4Q9KA 2UZ3A 1SHKA 1TADA 5FUVA 4JZKA 5DI3A 1CRPA 2PZFA 1RRFA 3IKJA 3T12A 3U7GA 4PAQA 1ZP6A 4IOKA 2J46A 1QVAA 3DL0A 4BFZA 4P3YA 2CCKA 2QTVB 3ZZ0A 4ESVA 1R4AA 4B6FA 4RJLA 2NPIA 2B7CA 1KY2A 3VHXA 2VHQA 4LX0A 4RZ2A 1A7JA 3ZVNA 3CM0A 3KQHA 2V1UA 1HE8B 2G6BA 4L16A 4ZDWA 2O5VA 1KZ7B 1J99A 3GJ0A 3QF7A 2PMDA 1T3HA 2CJWA 1Z6TA 4B33A 2D3WA 4ZKDA 3RRMA 2O0KA 3HYTA 3CB4A 1CJTC 1G6HA 1GKIA 1D6JA 4E22A 2I1VB 3ZVLA 3B60A 4RFSB 5CYPA 2J7PD 3KUDA 3CZQA 2ZSBA 5C2JB 2H92A 4B3GA 4M22A 1OYWA 3TIFA 4PAMA 1ZM7A 4ASUD 3SJZA 3CBQA 2P2LA 1EFTA 4CYMA 3C4JA 1YR9A 3S1AA 3SQXA 4WW0A 4PZZA 1F2UB 5J5CA 4A36A 4UNQA 3ZYCA 1FZQA 1CR4A 2OFOA 3W5JA 4LHYA 1JPJA 2CNWA 4QHYA 1QZXA 3ZS8A 1NMZA 2G1JA 4JKYA 4LPSA 4DUGD 1EX7A 1WCV1 3RABA 2X2EA 2IYVA 4Q7KA 3C15C 4GDFA 5FL7A 3U4QA 1F3OA 1ZCBA 2CDNA 3KTAB 4PQYA 1E1RD 5JRJA 4YMSA 5FOTA 2F1HA 2H5EA 2R2AA 4GRAA 3NKVA 2KI5A 1NJFA 3BB4A 3QENA 3EC2A 1U81A 1TL7C 2CL6X 1GZSA 4KHZA 5JCPA 1N6PA 1QHHA 1LNZA 5CM9C 4RZ3A 4EPYA 4RY2A 1OIVA 1MABB 3THWA 1G7RA 3Q7PA 3TSWA 2OO7A 1XPOA 1B0UA 4B43A 3BAFA 4IDQA 1E2NA 3ZVMA 2IWRA 2QORA 2FWRA 2ZJ5A 1NBMD 1XWIA 2VP4A 2PLRA 1YR6A 1P9WA 1DVRA 3KQLA 5KUTA 3K0FA 1D9ZA 5EE1A 4B47A 2NZ8A 4G5QA 3CRVA 4DSUA 1X8KA 1E2QA 2ORVA 4M21A 3CF0A 2QZ4A 2ZANA 1XJ0A 1Q12A 3SYKA 2R44A 2G9NA 3PEUA 1S96A 4TYPA 2JLYA 1L4UA 2NZJA 4B6EA 2IWHA 1LB1B 1VECA 1R8SA 2QMUA 3IPYA 1E2HA 3K1JA 3MLEA 2JJ8A 2MSDB 1E2LA 4DC9A 3B5JA 1OFTA 2KB0A 2XJ9A 3U3MA 2YKGA 1GNPA 4YXWA 5G40A 5KSOA 4JYCA 1JB1A 4IDOA 4KFTA 1R5BA 3D31A 1XD2B 2ZJZA 3GFTA 4WIAA 3THYA 4Q4JB 3VQTA 4AG5A 2Q3FA 4OHZA 1W44A 5JI2E 3DZDA 2EFEB 4KFSA 4MH0R 3EZ9A 3E70C 3K9NA 4WZBE 4BQSA 4RFVA 2D62A 3WNCA 4KCGA 4NONA 2GZDA 1OB5A 2F3TA 5FL3A 2ZI6A 2ZVQX 2RKOA 3ICQB 2XOKA 3N2EA 2ATXA 3SR0A 4ZIRB 1G5PA 3QI2A 4ESHA 4ZCMA 3K53A 2NO7A 4XTCS 4YC7A 4U00A 3BC1A 2VP5A 4R9UC 4E03A 4QBHA 1CJKC 4MKIA 5KO2A 1XEXB 1UBEA 4GOJA 5G53C 3K9LA 2OSBA 4I81A 4X8MA 4IVRA 2XTNA 1O3YA 2TMKA 1T91A 2AKAB 3AKEA 3SJAA 3PUZA 5AJWA 3MG9A 5FBQB 4EAQA 1PLKA 1T5IA 4P31A 4EPWA 3CUEF 4P4SB 3U2QA 3QEJA 221PA 2WWIA 4C0KA 1IJFA 3B85A 3DZ8A 3L0SA 1ELOA 1HE1C 1TQ6A 1T4GA 2HYDA 1XMSA 1IN8A 3PG5A 3KQNA 2BMEA 2PH1A 4RCYA 1ZUHA 4OHYA 2IS2A 2EVWX 1R6BX 3UIEA 4UXJA 5GJBA 2FFAA 4OI1A 1AQUA 2H17A 4OHWA 2BEKA 1OE0A 1DG3A 1P7CA 5B30A 2KJQA 1G18A 4NYIQ 2VQSA 1ZD8A 2ZRNA 2Z5FA 1GDDA 4LPKA 4MGZR 2QRZA 3A1WA 2WPDD 4ZO4A 3TLXA 4NKRA 2V7QA 1E96A 2WAXA 3FHTA 1YR8A 3AKDA 3UXMA 2G3YA 1II8B 1I4DD 4NL4H 2ANBA 3N5CA 4UXIA 3A36A 2HT1A 5L3VA 1QG2A 2GF0A 3CRW1 3OIWA 4RFSA 2Z83A 4HDOB 5D3QA 1XZPA 1ZNWA 3GP8A 3HR8A 5EE9A 4HAUA 2GCOB 4CDGA 2E1RA 3AEZA 1E99A 4PC6A 1I4LD 4WVFA 5J4VA 4I1VA 4IVPA 2IYWA 3MCAA 2C9YA 3AF0A 3PENA 3BD9A 4PTLA 4US0R 5K8IA 4MRRA 1M34E 4ZCIA 5FUYA 2CEAA 1KOFA 3I5YA 1WRBA 4NBSA 1KAOA 2QM7A 2OLKA 3KXLA 2ZSEA 2RH5A 4DLVA 1CR2A 2IUUA 1W36C 3MWKA 5KU1A 1KK0A 1M74A 3KTAA 3VR2A 3TVDA 4P33A 2WSSA 4M9ZA 1IHUA 4NPHA 3LY5A 5JSZB 4JSYA 1UDXA 2W2VA 1P6XA 3KJEA 4QXAA 2JEOA 5EP1A 4F4CA 2VP0A 1IONA 2FOLA 4LZZA 2A5GA 2ZSFA 1TEXA 3K0CA 4PR0A 2A78A 3RWMB 3TKLA 1D2MA 3HU1A 4UNRA 4GNKA 2OXRA 1GKUB 3SOPA 1TNDA 1LV7A 4Q5IA 2ZR9A 1W46A 3KFXA 1G8FA 2ZEJA 5EXTA 3UKDA 4BZPA 2CLCX 4Q01A 2ZJ8A 4V0MA 1U90A 4H9GA 5EXPA 1E9BA 2O8DB 4JVMA 2WSMA 2GEVA 2QAGC 2QPOA 4DJTA 2QGZA 5FTNA 3FMIA 2RHMA 1G17A 3ASYA 4V03A 4NMMA 1VG9B 3I3SR 4JL8A 4CEJB 2GXUA 4BWYA 2PMKA 3ZZTA 2FV8A 4I1OA 4FMCF 2WJGA 2H1LA 2N1BA 1G7TA 3FFAA 1KI9A 4KSBA 2WOJA 1GFIA 4R2IA 1JBKA 1Z8FA 2QP9X 3MWLA 3O47A 2GXAA 4NCNA 1XD2A 4OHVA 2JAQA 5FOXA 1CF4A 4Q4JA 1X6VA 2OESA 2XITA 1G3UA 3U3RA 4A4DA 1V43A 1OH6A 2RMKA 4TL8A 1XEWY 2ZROA 3LX8A 4V0ME 1NVXQ 1G5RA 5KHOC 4IOMA 1IBRA 2FSIA 1IN6A 2WICA 2VHUA 3TSOA 1A2BA 1ESMA 1TX4B 1ZW6A 2NO1A 2VF7A 4ZIRA 5DNYB 2XNDA 3DOEA 3NHAA 1OHHA 3AVUA 2C2HA 4TZ6A 2ZS8A 4DRZA 3C8UA 4IOLA 2ZS7A 4HI0E 1YZKA 3CPJB 3L0PA 4JIMA 2DCUA 4POAA 3UMRA 2GDJA 3LD9A 1S9DA 2GCNA 4LHWA 4B35A 4N0DA 3OEEA 1KK3A 4NCIA 5GJVC 4BLOA 5SZIA 3WNBA 4HYYA 4JT2A 3CRMA 2IXGA 2CHVA 1ZUNB 1I2DA 5JJKA 3JVVA 1G9XA 3OHMA 2UZIR 3OFNA 3AVWA 2YWHA 1GILA 3DKVA 2OBMA 2O0HA 2OHFA 4LDJA 2O8CB 2IHYA 3H4MA 3B1XA 2ZRDA 3U61B 2XZPA 2ASEA 3REFA 2C96A 3MRSA 4KVAA 1YZLA 2XTZA 3V4FA 5JZVA 1NIPA 5JRZA 3L82B 1Z29A 1YR7A 2O0JA 2RGNC 4F38A 1GRQA 4JL6A 2P6RA 1YKSA 3B9PA 5KSYA 1QG4A 5K8LA 1UM8A 1UFQA 4QGAA 3WMGA 2W6ID 3AP1A 3DMDA 3V00A 1SKYB 1W5SA 2GJSA 4D4KA 2BIFA 4DT1B 2QP3A 1KO8A 1JR3A 5FTKA 1Z0KA 3FWYA 4EPTA 5BYJA 2NIPA 2OE2A 2ZE8A 2YV5A 4O25A 2VYFA 1UPTA 4QGHA 1KO4A 2VP2A 1SVSA 1QHXA 1F48A 1OKKA 4L9WA 4TMWA 3Q5DA 3CPHA 3U3OA 4YMUA 4OQLA 1A82A 2IS1A 2Z4SA 2ZM5A 2IYRA 2P6NA 1Q1BA 4XWAA 3PITA 1ZC4A 4OL0A 3QJYA 1U99A 1M2OB 1G7CA 3FKSD 3IHWA 2GCOA 1RJ9B 2XB2A 3KDSE 4Q9IA 3UG7A 3MJHA 2AHOA 3R9WA 2X2FA 1YHNA 4IHQA 1R2QA 1HURA 5CK4A 1Z3IX 2D4HA 1DOAA 1XJCA 4FWIB 4Q03A 4HB4A 2RGDA 3BXZA 3LRPA 3AF3A 1E2IA 4XJXA 5DIFA 4B74A 3LWNA 5CITA 5JWOA 3SBDA 4PANA 3TMKA 2IYYA 4DCNA 4HLDA 2F1IA 3VNVA 2GAOA 3PIRA 1GG2A 1AGPA 1G1MA 1MKYA 2W2XA 4LI0A 2AFHE 3C14C 1Z08A 5CJ2A 4ZDJA 2PCJA 4W5HA 1OXUA 1U8YA 3LDAA 4LY6A 3U6BA 1M7GA 5JSZA 1AKEA 4GSYA 4M4SA 2YOFA 1NVVR 4C0LA 2A5YB 1OW3B 2OCYC 2GRJA 2VP6A 1DTSA 3AVYA 1OXTA 4MYCA 3U60B 4MYTA 3NBXX 2BJWA 1N6HA 1W7AA 2R6CA 2H57A 1E98A 2CK3A 3CNLA 1S1CA 4DLTA 4TL6A 1ZM2A 2ZI9A 2OCBA 4OBEA 3SFZA 3IIMA 3JVUA 4M8NE 1KKLA 2ZXUA 3RS4A 5KNBA 2DFLA 4AKHA 3FMPB 4PO1A 3K0CC 5FI1B 2O8DA 5BN3A 4OQMA 1N0UA 3ZIAA 4JL5A 4CEIB 1R0XA 3B2EA 5CB6A 3O8CA 2CLDX 1OV4A 1G7SA 1NY5A 1OSNA 4MRVA 1ESNA 1CIPA 4W5WA 2BV3A 4F91B 1W0KD 4M1WA 4CEJA 4AY2A 5TDHA 2NO0A 3K8YA 4TT3D 1Z0DA 4DLRA 2C77A 1T0HB 4TSFD 1BMFD 4BRWA 4AYXA 1BKDR 2VBCA 1Z07A 1KNQA 5EUMA 4Q48A 1JEEA 3I5XA 5TV2A 2VSFA 1G4AE 2OCPA 1KDOA 3X1YA 1VG8A 2FX3A 4M2LA 3D6TB 5DGXA 3WYGA 1KMQA 1F6BA 2CCGA 5E4FA 4Z8XA 5FL7D 1QHNA 2YWEA 4F4IA 4XVRA 3P32A 3EIEA 1R0WA 3RVBA 1KSGA 2ZS9A 1Z2AA 5ANRB 3RLFA 2D06A 4DEXA 1L2TA 1SVOA 2BMFA 1P2SA 3I92A 3U7EB 4CW7A 4QJ4A 2UVQA 2ZIAA 2EFHB 2JLWA 1NN3A 1OIXA 3QQ5A 2J0QA 3EZ2A 5G3ZA 5AJYA 4ACBA 1VCIA 1E9AA 1XTSA 5L3SA 5DISB 3CW2A 4C3ZA 4KODA 1NN0A 3FHCB 1P2TA 1MOZA 1JECA 2O8CA 1T8TA 5C4GB 1Q1QA 3ETLA 4FINA 2C9CA 2QG6A 2OT3B 1XEWX 4AWXA 2PT7A 5FH9A 4FCVA 1W0JA 3WP1B 4Q4AA 4GL2A 1ZIOA 4NYIR 3U7HB 4DDUA 2FSFA 3PFIA 1AM4D 1GNQA 1AQYA 2V1XA 4KU4A 3DM9B 3EZ6A 1E32A 4GOKA 1ZAKA 1IXZA 5J4KA 2D7DA 3ZGXA 2J0SA 2QTHA 2YNMA 3T1VA 5HCIA 3BFXA 1W4AA 1X8JA 1DAIA 1XTQA 4WOPA 4LJ7A 3W6OA 2JDIA 2IL1A 2PZGA 3QPUA 4DT1A 1DBSA 1L7VC 3IIJA 1E2DA 4MYHA 3Q3JB 1ZYUA 4B3DA 1Z2CA 2EYQA 4PC1A 1T6NA 1W5TA 2XJ4A 3T34A 3RDPA 1MR3F 2X8AA 1XB2A 2ONJA 4JS0A 3U5ZB 2J7KA 1FUKA 1M7HA 3IILA 4A2WA 2YOGA 3QNUA 3ZH9B 2VLIA 3OZXA 1SXJD 2A30A 2GBLA 2V6IA 3BJIC 4LJ9A 1PUIA 3ZZUA 3AVPA 1KK1A 4IFBA 2IW3A 4DSNA 4OQFA 5KTYA 3TJZA 4DVGA 1M8PA 2LCFA 3LBNA 3OIVA 1KDTA 1RJ9A 3FMOB 3PQCA 2J1LA 2DFNA 5AWFC 4BRUA 3K70B 1GAJA 2GAAA 2QN6A 3H2YA 1AIPA 1E2PA 3TAUA 3MAAC 1F60A 4B71A 1SKYE 2Y8EA 3RS3A 5FPHA 4BFSA 3UANA 2EWVA 4OJKA 2V6JA 4ZV4A 1Z47A 2WWYA 4M1SA 2IYXA 3AKCA 4TTPA 1HTWA 2H8KA 5B58C 2Q9CA 2ZJBA 1YVDA 3ADDA 3OIUA 2P6UA 4C0BA 3ADCA 1EFUA 2ERYA 2WKRA 3IBGA 3W8RA 2QSYA 4YONB 2IYQA 4AYTA 4W7SA 3G82C 2BDTA 5DHFA 4AD8A 2JJ2D 4US2R 4ZKEA 1TUEA 4V0OA 1P2UA 2B21A 4BPBA 1J8MF 1AA9A 2F3RA 1PLLA 2ZR0A 3LH5A 2ZJ2A 4F92B 2ZJYA 5EP3A 4FI3C 5DH9A 3RHFA 2AD1A 4CIDA 1N6RA 1DAGA 1MO6A 3BFKA 1Z6AA 4UJ5A 4D0LB 5DE3A 1DE0A 4QBFA 5IK2A 3VU9B 2QA5A 1EFCA 4UNPA 3E2IA 4PQFA 3TUJC 4C0AC 3CWZA 4V02A 5C46F 4L8GA 1YZGA 4JBWA 3VR1A 2AL7A 4MRNA 1EGAA 4JLNA 2Q9BA 4RD3A 5KOYA 1AS3A 3BB1A 3AB3A 4M1TA 3RC8A 4LBWA 3AGQA 5KYKA 1HQYE 4CEIA 4QC2A 1H8EA 3QKRA 1VYUA 5D3MB 3AGPA 4PO8A 2A5DA 3OEHA 1Q3TA 2XNSA 3NTUA 2ZRGA 4BZQA 1OH5A 2OCAA 4LJAA 4LV8B 1TF7A 3BFVA 4Q9JA 4H1VA 3GFOA 1NL3A 2DPXA 5FTLA 3KB1A 4YMTA 4FIDA 2Q0HA 3T06B 3B1VA 2GKSA 2OG2A 5FPTA 1FQKA 1ZM3A 1XTIA 4JLMA 3VR3A 1Z0IA 2HCBA 3LXRA 2A5JA 2LKCA 4Q7MB 4QKQA 4X8OA 3UPUA 2NOAA 4PSKA 4B73A 2ZJAA 3U3KA 2IS6A 3C5CA 4DLXA 2CCJA 4LYHA 1KDPA 3IIKA 3MJRA 3X1ZA 3MMPA 5J47A 1EFRA 1FMLA 2WSSD 1G16A 1TMKA 2JJ1D 3FGNA 3REGA 5EQTA 1ZBDA 2V8OA 2HT6A 1X1SA 5HR5A 1G21E 4Z51A 3BH0A 1N6KA 5HTKA 5KSZA 3SNHA 4XVQA 3VKHA 2ZUCA 2HF8A 4EKDA 3X1DA 1VIYA 4P4UA 2QAGA 1EFHA 1N6OA 3CRQA 1W47A 3CZPA 4XD7D 4G01B 5L8VA 5TXGA 4DLWA 1NVVQ 1G8GA 1U9IA 1KI3A 4EFNA 3X1XA 1DO0A 2BBSA 4I1SA 4JYBA 2V54A 2J41A 4G1UC 1KO5A 1JJVA 3NG1A 3HP1A 3RAPR 3KKPA 2R9VA 2OILA 5DN6A 3RS2A 4S2EA 1OXVA 3O8RA 3PXGA 2Q3MA 2Q3HA 2YINC 1WXQA 4DCVA 4NE2A 5DI9A 4QGGA 1J90A 1CR0A 4BEJA 3I62A 3KB2A 2YHSA 3FPAA 2XXAB 3LAWA 1Y3AA 1US8B 2MMCA 3BOSA 1Z6XA 2NTYC 4GP7A 4L9SA 4LJ4A 1BO6A 4QFMA 1C1YA 4M9XA 3UMSA 1RKBA 2PEYA 5KNDA 4FD2A 5GVRA 3OAAD 1TU3A 4A6XA 1CKEA 2V3CC 1Q22A 1GRRA 3BORA 4KFRA 4BLRA 1N6NA 3IPXA 3W6NA 1Q20A 5FI0B 4DLUA 1P75A 1H8HD 2DYKA 2OEPA 2FJUA 4YQFA 2J9RA 1XCMA 2DFKB 1CRQA 1EG7A 2VSXA 3GEIA 4A2QA 1VHTA 4Q4HB 1H65A 1OHHD 2VHJA 3BB3A 3BS4A 1VTKA 4NYJQ 1G6OA 1KMHB 1XJQA 1JR6A 1W1WA 4GMDA 1R5OA 3CR8A 3G5UA 2F6RA 2GJ8A 3KJIA 3E1SA 2AK3A 4Q4LA 1KZGB 1GP2A 1VHLA 2P5SA 2ORIA 4OKSA 1E6CA 3R8FA 1N6LA 2ZJOA 3GFPA 4NZYA 4C4PA 5EE3A 5JCZA 5F98A 2GBLC 4GZLA 3RWOA 4MRSA 4DLZA 2NMVA 6Q21A 1N6IA 5CJPA 5J4HA 2HLDA 1XMIA 1G3RA 1C9KA 1OB2A 2RGNA 4DSTA 1CBUA 4DBLC 4MRPA 4R98A 3SFVA 1HT1E 2FZ4A 3QEOA 4JSTA 4B3XA 2WVJA 3HPQA 2J0UB 5TB5A 2WM9B 4XIGS 4JLDA 2FFBA 4X8HA 3A4NA 4H1UA 4ZDKA 3QF4B 2I3BA 1OFIA 1G20E 3AV0B 4MGKR 4W5JA 5AR1A 3IQXA 3AP3A 3B8HA 3THXB 1P2VA 3OESA 1E9EA 5FOVA 1Z28A 3VKWA 5FR1A 1FUUA 2WBLC 2YC4C 2ZYVX 1NKSA 2MSCB 4NYMQ 4AI6A 4OQNA 3KUCA 4RZXA 3VU9A 1N3BA 2EFGA 2ZRKA 3G0HA 3CX8A 1VCNA 2PZEA 4XOIA 1OKKD 4B3CA 1QBKC 2R8RA 5E7MA 4PHHA 3UWOA 4D4MA 4DB2A 1E2MA 1ONBA 1P5ZB 4CRWB 4HUQB 2JA1A 3MWJA 1U0LA 2WWWA 4PPGA 5D3MA 1KO7A 3T1TA 2BC9A 3CX7A 3W34A 4YMWA 3EXAA 4O2RA 4DB4A 2JLSA 5FOSA 3VX4A 4UKDA 3ZQJA 3UK6A 5KPDA 4ZCLA 2ZQ5A 2XZLA 3AVQA 1Q3HA 4DSOA 4OI4A 2V9PA 1N0VC 2ZREA 5UKDA 1FTNA 5EE0A 1F2UA 2I1QA 4M9SA 1E0JA 2AXNA 2XSZD 2FN4A 3CH5A 3THOA 2QU8A 2W6JA 4TMXA 4TMVA 1M7BA 4KYUA 3B7GA 3R8CA 2G0NA 3A58B 2J7PA 1E9RA 1B23P 3VKGA 2ORWA 1FPMA 1BYIA 4Q7LA 1HEIA 5AUNB 1TU4A 2QY9A 3R7WB 1NG1A 3IEUA 1DAKA 4GI7A 1COWA 3H0KA 1LFDB 1UEJA 5FBWB 2QM8A 1XMJA 4ASUA 5IRCD 1EESA 4OK5A 4XVUA 2YOHA 1DG1G 2ZR7A 2JASA 5A4JA 5A0FA 2IHBA 5E7JA 4TMZA 2HXSA 3KXKA 1RVDA 2RGCA 1PV4A 5CLLA 1P3JA 2CK3D 4DUGA 4EDHA 1MABA 5JBQA 4IW3B 3JZAA 4N3NA 4KXFB 4EIWA 1E1QD 3QXXA 5KPJA 2CL0X 2P3SA 4Q1FA 5F9FA 4JLAA 4QRHA 2B92A 2HJVA 5FBRB 1DEKA 4D26A 5K8UA 3WRYC 3GJ5A 2GJAA 4L5BA 4JLPA 1WF3A 4HLQB 1D8TA 3ONWA 1F2TB 1UKZA 4G5GA 5JEEA 1M1YE 5JJIA 2OXCA 4MKHA 4MITA 4HZUB 1U9IC 1CP2A 1LTQA 5CIWA 1TF2A 4C7OB 3BRWD 4CEHB 1LW7A 1OIWA 2G83A 1ZD1A 4L4UA 5FOUA 3SDZA 2OLJA 3SYNA 1S2MA 2LWIA 4J0QA 4Z1MD 3HPRA 3VX3A 3GPLA 2IYTA 2XXAA 4MDEA 1JAHA 3KQKA 4CT4B 1NBMA 2QE7D 3TK1A 4C2TA 1CLUA 1AGRA 1QVRA 2JLQA 3F0TA 3EZFA 3IBYA 1XD8A 4KVGA 3HDTA 1Z6GA 2EWWA 4D81A 4O2LA 3I4LA 4GPTA 5SZKB 3EASA 4QHSA 4URYR 3I61A 5ELXA 3NWJA 3QG5A 2R6FA 2A2ZA 2BM0A 2CVHA 4MA4A 1SVIA 4Q4HA 4BFUA 3VR4A 4V0LA 4AKEA 1NF3A 1IY1A 1KMHA 1KDRA 1T9HA 3RANA 2VRWA 4AIIA 4Q1DA 3EPLA 2ZRMA 1QHIA 1ZD9A 2IK8A 4Q47A 4DDVA 3K0EA 1E3MA 4HLUC 1OH8A 1SVKA 3LXXA 1XEXA 1BIFA 2CE2X 2CVFA 4YDHB 1TAGA 3FB4A 4ABYA 1Q1EA 4HSEA 4DLYA 4A1FA 5EE5B 1NBME 3L0IB 5EP4A 2BKUA 2W0SA 3ZJYA 2ODWA 1D5CA 2C03A 4HAVA 3EPHA 2OAP1 3K70C 1E0SA 2J87A 2J0VA 4F4JA 3KX2A 3EAQA 2FG5A 1ZU5A 2J0UA 4P4SA 4PC3A 4JBYA 1FMJA 1E79D 2ZRCA 2IF0A 1G4UR 1AK2A 1A1VA 2QUZA 2YC2C 4LC1A 4US1R 3GEEA 3K9HA 2ZRPA 1YE8A 1JXOA 3EA0A 1WA5A 1KAGA 3H1TA 2CMKA 1O87A 5DSZA 4EFLA 1R5NA 1LF0A 1I4TD 4B44A
chains in the Genus database with same CATH superfamily
1GKYA 1DKRA 3RYHA 3I34X 4BV2A 1GQFA 4WA7A 1FJXA 4R7TA 5JATA 3UWSA 2JI6A 1ORRA 2P9BA 5LOVB 2WG1A 1D1TA 4TRJA 1NUHA 4IILA 1PUJA 3N3AC 3PT5A 2R5FA 2HA3A 4MJ7A 2C4MA 3OQHA 5SY4A 1HDEA 4H6XA 1F51E 1II8A 2GTIA 2H6EA 3HCOA 4J2TA 4P81A 5JD3A 4BECA 4DADA 4WH0A 4RQAA 3CQ9A 4IKOA 4HUQA 2A9OA 1XN4A 5A71A 2QT0A 4FZRA 4WCFA 4D25A 1O54A 1NUPA 2NPOA 4S1PA 3WYFA 1GITA 4WBNA 2R6AA 2I22A 1MMFB 4HB2A 1ZA2A 3VHLB 1IQRA 1BXZA 3Q98A 1SUPA 1NSFA 2B30A 1PHPA 3F5DA 3L5KA 4M88A 3RI3A 5CCEA 4W5QA 1QGYA 5DW3A 2QSUA 4PXAA 1KI7A 3REOA 2JGJA 2AYZA 3R40A 1GTMA 5HIAA 2QRUA 2OBNA 2WAOA 3K35A 3L8HA 4R1QA 5GJWC 1JDZA 2O4UX 3NHUA 3PPWA 2CNLA 2P41A 5DRYA 3ZU3A 1A8UA 5L95A 4E2ZA 1UKYA 2IZ7A 3G2MA 4PC7A 5LM3A 1G19A 4DUZB 2HFKA 2CB0A 4Y30A 3FTDA 4CM5A 1RI5A 3EGDA 4LJ8A 3VVLA 3U62A 2XE4A 1XL1A 3MJVA 1J5PA 1D2NA 3DD1A 4G5RA 4JOQA 4GKBA 4MYDA 5LZ9A 3WAGA 3N7AA 1V37A 2OZEA 4KQ2A 2JGKA 4NFSA 4URUR 1SULA 4BFVA 1N33B 1HF3A 1Q1GA 1BVUA 2ZM6B 4BEBA 2DETA 2OZPA 1SK9A 3UHJA 5SYMA 4MVWA 4R40A 2JLXA 1ETUA 3GOHA 1BJTA 4LGYA 1GKLA 2AWOA 3VOBA 3FPBA 3GOQA 4PPNA 3X1MA 3ZGYA 4F5ZA 3E9MA 1UMDB 3MTIA 1FY2A 4R1LA 1C7QA 2C7QA 4HMPA 3TRIA 4DDTA 1AHHA 5GJCA 1P0PA 2WPNA 3WLTA 4B6JA 1J39A 1YS7A 4N82A 2FF5A 4B7CA 1YBHA 2X3FA 3LHFA 4M0MA 3SYLA 5LMNB 5AUQA 3DONA 1QFYA 1NLZA 2Q2VA 1U0OC 1VG1A 1LS1A 2ZRJA 4L22A 4EPXA 1GIAA 3NHLA 5THXA 2DX7A 3I5AA 1EDEA 3KVNA 4R2MA 2D0OB 4LKOA 3QJGA 4PM4A 4UVDA 3S7ZA 3URMA 1YOVA 2HRDA 4D4GA 3G9ZA 3HCDA 4WGFA 2A5LA 1R3UA 2QMQA 3T7EA 3V8NA 1Z5UA 1X7ZB 3RG2A 4BNXA 4C6SA 1NW8A 1U0SY 5KIAA 1E5VA 2FSGA 3Q85A 5JBIA 2CBZA 1E58A 2QMYA 4KGXA 4ITVA 1PK7A 4R8LA 4RHYA 3IAM6 2KSQA 3HJTA 2ZUWA 4I4TB 1QE3A 1VI2A 2ECFA 1Z7YA 3UK0A 4JI7B 1CDEA 2OLEA 3E8SA 4MW7A 4RPIA 1KZ9A 3ETDA 5D85A 5IBPA 1SQFA 5KVVA 3HH8A 3TVTA 3AM1A 3ROFA 4WVLA 4RDCA 1DUIA 4EJSB 1IY0A 4DCOA 1UMKA 1FMTA 4QULA 3NBAA 4JVSB 3W5IA 1CYDA 1F17A 1TMYA 3IHKA 3PXXA 3P97A 2C4WA 4PIMA 1MORA 3W2TA 2HLPA 4FPXA 3GL9A 3PXCX 3GEHA 3GX1A 4ADSG 4AS2A 3VGJA 4TYQA 2G9VA 3WBJA 2Z43A 5DNUA 3RRZA 1TIPA 4CL2A 3KPUA 1OT3A 4M8IA 4Q24A 2X4DA 4BX3A 1RE1A 2FXVA 2ZWVA 4J7CA 1U4SA 5JJLA 2JFGA 2VA9A 3OOHA 3PI7A 1T8UA 5TQVA 3HDQA 3HJHA 1XLVA 3DW3X 3OIYA 1OFHA 3U9TA 1NJGA 1KZ1A 1L5FA 3DNPA 1HKHA 1T6YA 3EQZA 3A4IA 1SHJA 3QBEA 5DBEX 3IMCA 4IH9A 4JT4A 1II0A 2BW0A 4REQB 3CZ4A 2LCQA 3PNOA 4JGIA 4RMIA 3ENNA 4HP8A 2Q2NA 1T6ZA 4TV9B 4JWTA 4H6PA 2EQBA 5FUWA 2BFEA 2OBLA 3KAQA 3V6LA 3WYNA 2NO6A 3DTNA 3OQVA 2PXXA 4HRYA 2K5UA 4XYBA 4DAEA 2H7VA 3LCUA 4TM8A 3U4QB 1TE2A 1VLJA 1IC6A 2ZQYA 3GROA 2OXFA 1SU4A 1CQIB 1KI8A 2OHGA 4DWWA 4NK4A 3QNMA 3WLNA 3F47A 2ZPAA 3DC7A 5ETJA 4CLXA 1MAWA 2EX1A 2JKZA 4M9RA 1Y7TA 1WETA 5G41A 1E0AA 1RAEA 5KYGA 2DFDA 3KE8A 2YVQA 3MXOA 4OSEA 3E03A 4QAQA 1ORIA 2JCSA 3ZDFA 3KR1A 2ZRHA 2F00A 1OXXK 4A0RA 5FBVB 2NNWB 2YJ4A 3FOAA 5HFNA 4NH4A 3VHRA 3M1YA 3WJ1A 3BDVA 4FYPA 3ENKA 1IATA 1KJQA 1YWGO 4D6XA 5KDLA 5CFLA 2CXXA 4XFDA 4CLEA 4CIBA 2QHXA 3CF2A 3PXBA 5F7XA 5DM70 3E82A 1EDBA 4M98A 3WY9A 4CIVA 1PT5A 1W6RA 4YMVA 4LF5B 4IEIA 5LOVA 1HUQA 4GWGA 3COWA 2FE4A 2AG5A 4KB5A 2NVOA 1JHXA 2C95A 2VWGA 4ZYWA 1ADCA 5G4LA 4IUYA 4BZXA 4HFMA 3DP7A 3CIOA 4EKEA 2BF7A 1U98A 4L51A 4WECA 3U3JA 3R4CA 1PLJA 1LDBA 2C9BA 2Z5VA 3UATA 3ZKWB 1U8EA 3AHFA 3T5GA 3VAZA 4WLEA 4A1OA 5A4FS 3CR7A 2E9SA 3OQJA 3KJNA 3DOJA 4C08A 2MSEB 4N4AA 2ID8A 1KQGA 3QUSA 5IYZB 1E6UA 2DH5A 3BQ9A 1MN6A 4YJ2F 1IBSA 5EJ8A 2CMFA 3FBWA 4BNUA 2GGSA 1L3BA 1SXGA 1H4TA 2OYSA 3EIHA 4BVHA 3NBFA 2XT9A 2YZNA 4C43A 1W48A 2GEBA 2XVMA 5SZJA 5AM3A 2ZYWX 1EE1A 2VBIA 4TZTA 2VP3A 2XAUA 1X1EA 4BVAA 5EVJA 1GTVA 1SZJG 1VRCA 4UE3S 4EYOA 4WCFC 5H82A 3DDHA 1RFLA 3T4UA 1PNRA 1WD5A 2RHDA 1RNLA 4KN6A 4ZJZA 3ELWA 4GHWA 4FFRA 2Z4RA 4TVBA 1U0EA 4HQOA 3B6EA 2CN1A 2XXJA 1OREA 1QONA 3D6HA 3BSSA 2F8TA 2BMJA 4E1VA 1ZVQA 4GZ5A 1KRXA 1I2CA 3OJWA 1JZTA 5FEMA 4FCWA 4QYMA 1XZFA 2AOTB 1MRSA 3IEIA 1BS1A 3LT5A 4G8DA 4KJZA 3BHNA 3V46A 2J3EA 1I2ZA 2EHDA 1T0IA 2D1RA 1YOBA 3G9QA 5JU6A 1TA9A 2AZTA 1N32B 5E95A 4D3XA 1KEKA 3WSWA 2F17A 5KWIA 2C8LA 2GD1O 3HYRA 5TMPA 4XEUA 1UMDA 4KK3A 4QLAA 3A05A 3OX4A 1N9ZA 4WKCA 3CEPB 1LNSA 1UEXC 1WQ1R 3PNKA 1GL6A 5DKFA 1YUBA 3NXSA 3FFBA 4MUBA 5CHEA 3PB3A 3C3BA 2GZ1A 4FU0A 1H94A 2AN1A 3DE5X 5AIAA 3T9FA 5I7VA 1AN0A 3A4VA 2PRZA 2WTXA 1Z4OA 3CY6A 4JBHA 3OICA 1RE0A 4N39A 3T99A 2P9QA 5BSUA 5A9TA 4BE7B 2CMDA 1CNMA 2PYIA 4XIIA 4TS9A 1Y6GA 4M1EA 4OFXA 4ARIA 2A9KA 2DBYA 5ECDA 4ATNA 3ZS9A 4PFSA 5E1OA 4XQCA 1WB9A 3KWJA 1X7ZA 3QVTA 4UHCA 1E2FA 1NXTA 1RW4A 1D2HA 2HADA 2WWFA 4JX8A 4N3GA 4RVGA 3H9BA 3JPWA 5I4BA 5FHQA 5JFTA 2PM8A 4RL6A 4AT1A 1NW5A 4YMGA 4DNFA 4NCXA 5TMDA 1XZLA 3W8DA 3PLAE 4IDCA 1NLYA 1I9CA 5CLQA 2R84A 4CVNA 1PJZA 4QYWA 5IHPA 3AR4A 2NTJA 1LBQA 3E7PA 3M0EA 2CWWA 2ZB3A 4UPDA 3N8IA 4EJSA 2Z8ZA 2FVXA 4RGVA 3L1UA 2W6JD 3SE0A 4B2IA 2WAMA 3O26A 4EUEA 4HEQA 3H9JA 5JCJD 1QRTA 1QR2A 4XASA 2AJTA 2Z2KA 4ARZB 2CT8A 1WNFA 2ID7A 2CL7X 4E2XA 4Y6QA 1C4OA 3H5RA 1PJRA 5EKXA 4TKUB 4A82A 4WHMA 1B14A 4PWYA 4FOSA 1E2UA 2AV6A 3JQAB 3U7FB 1W0KA 1M6VB 1N5OX 2GK7A 5GV7A 3L0ZA 4UMDA 3IUMA 5KQGA 1BMFA 3I3OA 2ZE6A 5EMHA 4L8LA 3VU0A 2Q6IA 7YASA 1NVBA 2XGGA 1F0YA 3LPLA 4UCQA 4BKPA 1JMKC 4QJ5A 1PQWA 4EY4A 3A1EA 3ZH9B 3OKFA 4REQA 4OXQA 3OIFA 1YR2A 1P5FA 3R3YA 1AKVA 3N6XA 1QV6A 3LLUA 4NR0A 1J2UA 3JS5A 4TV9A 3E53A 3KL2A 2EZUA 1U11A 3WIBA 1IBMB 3T3DA 1H5QA 2W6PA 3FLAA 3WVNA 3M2TA 1HY3A 3WGJA 2OQ2A 3KTDA 4NH0A 5B1SA 3GLIB 3AILA 3ZEIA 4CUZA 1FYDA 1CQIA 1QTIA 4Q00A 5F9HA 4JBLA 1OA0A 1CJSA 5EERA 4CGZA 3A4LA 4P4TA 3X2SA 4HR7A 2JCYA 3HUUA 1P73A 2P9GA 3KQUA 3RUCA 1OBFO 1C0LA 2CLLB 3OQ6A 1RJFA 4HB3A 5CVCA 1WV0A 2F9MA 4RY9A 1XNJA 3IHLA 3MCTA 4XSGA 4OO3A 4UPVA 3S8EA 1ICIA 1USIA 5ED0A 3ZD8A 4EA7A 1HG1A 4M38A 4YECA 1PNOA 4L3VA 4EOGA 1ONSA 1PBTA 1YR1A 2YDYA 1IVYA 4LBYA 5LDHA 1DAFA 3MUFA 2W2MA 3H19A 2Q7OE 1SUSA 3DMNA 4R1SA 3UQZA 2JLZA 2KHZA 1DADA 1U0TA 2KW5A 5FA8A 5AW0A 2ZYUX 4HN2A 4RSMA 1IBKB 1N92A 3PDIB 2AHRA 2D3TA 1P45A 3ZKWA 4DM4A 1XU4A 2REOA 4Y8VA 2B98A 4H3KB 1LPMA 2UVDA 1K8YB 4LWZA 4IPTA 3F8TA 1J8YF 2LP4Y 4J0EA 5BQ5A 3OFSA 1KDYA 3S68A 2QTWB 4BGDA 4U0JA 1V1RB 3UV6A 5IYZA 5AK0A 3H84A 4TMYA 1QORA 3C3XA 3AU8A 5HG0A 3WAKA 4Q9LA 5A5EA 1X1RA 2GEUA 2YQ5A 3AB8A 1KU6A 4MQEA 3UMCA 1SCNE 1ZLYA 4H2DA 3JASA 3SQOA 1BYUA 4EA6A 3B51X 4F6LA 1ULZA 3C8HA 3H4VA 3BGOS 5CD9A 5CDSA 4X65B 1UBFA 4PHFA 1RYYA 2GJ9A 2HQSA 1P4GA 5C51B 2ZUSA 1KAEA 3KT6A 4YCSA 1UZLA 2B20A 3IT3A 3E61A 2VNSA 3Q87B 3LZ6A 2C31A 3QTLA 5JAIA 2FLWA 1WX1A 2BGLA 2WIBA 3WLOA 5BNFA 1H1LB 3MMNA 1N3LA 2O3SA 3QNWA 1W4CA 5DPMA 1GNVA 3PGMA 1P4HA 4C4ZA 5LU8A 4Z0NA 3K09A 1HT3A 1Z73A 2HEIA 4MGYR 2OVFA 4R4JA 5CFQA 3DDZX 2QG9A 8GPBA 1EXVA 2VF5X 1DKPA 1M8GA 2V55B 4HVCA 1CXZA 1Y89A 2AOTA 3GCDA 4GXQA 4BNFA 4DIBA 4DMHA 2HR1A 2I6FA 2VJLA 3QVJA 5KOHA 4GVLA 1XA0A 1YZYA 2WJ6A 2VAWA 3LBHA 1M1NB 1DARA 4R69A 1THTA 3CE6A 2UUOA 4RMGA 4U7JA 4GFDA 5KB3A 5HMMA 2GZ2A 4LW8A 3HWSA 3GGSA 2ZUTA 1N5LA 2M2IA 1PJCA 4E88A 1AKTA 4LF8B 1MV5A 3N0XA 3HM2A 4MV7A 2EKZA 2BTOA 1QO7A 4FYKA 2D4AA 3HMKA 4IFEA 5HZHA 3BK7A 5FO1A 1SIWA 4HS9A 3BZWA 1J49A 3CUKA 3OZVA 1TZBA 5H5JA 3T7KA 2WTNA 4TXHA 1YU9A 2A1IA 3WP0A 4JVLA 3LZDA 1CFJA 2ZAMA 4JKIA 4BFTA 2EX0A 5JAUA 3D6VA 4KAJA 3QKUA 3W7BA 4ZVLA 1ILWA 4CLRB 1FXWF 4A15A 3SZRA 3DD5A 4N6OA 5LDDC 1KQFA 5CLHA 4ER0A 2PTGA 2JJ2A 1JVBA 3HM9A 2V3WA 1ZEJA 1Y6ZA 2PO5A 4E5KA 1NT2A 3ZDDA 1QNFA 3S2YA 2BAGA 4YHBA 4N0MA 3SOZA 3ZV6A 1N8TA 2Q4EA 5CNIA 3EF3A 2VBFA 4EL0A 4UTPA 1M8JA 2UU9B 2P4SA 2G1UA 3W6ZA 3IELA 3HB4X 4LDAA 2WA1A 5AQEA 2O5CA 1VQ1A 1NQAO 4BFXA 4CNQA 5TLSA 2H2IA 3LO8A 2J3JA 3AQ4A 3DZJA 3F7NA 3KKMA 4MPDA 5J1TB 3ZWQA 4DCSA 1OCEA 2OGSA 4DG9A 3RIYA 3A6PC 3M6FA 4V0KA 4JXXA 4QELA 5ED4A 1VSQA 3TGPA 4BMXA 3DZKA 4DJJA 4ND1A 1N7IA 3LQ1A 4TVOA 4ARZA 4D9MA 2BD0A 2F2TA 1IN5A 2IY9A 3D7MA 4P0TA 1XPJA 1FYWA 2F7SA 3ACCA 4YXFA 3TG8A 1U8UA 1B73A 4IEEA 4AJKA 5C8XA 1ABFA 2OCDA 1QIIA 2JIZD 3NOXA 4EJSC 1M6VA 1WUKS 3LBIA 1GPWB 2R62A 4LBVA 3SS9X 4BGIA 1JXMA 5AVSA 2NNLD 1Q14A 2W0MA 4G4GA 4BB5A 6REQB 2DZDA 1PFQA 2GBFA 2VNIA 3HSKA 5KREA 1ZMOA 3IVXA 2JI7A 3A37A 2VCHA 3CO5A 1D9XA 4B76A 3PXDA 3EISA 5JAMA 2COKA 3LXUX 4YROA 1UAGA 5DGTA 1RABA 1OROA 2JFPA 4ERNA 2P9ZA 3EGXB 5H8WA 1FTWA 3DP9A 4Q6BA 4DOMA 1PX2A 2JGLA 2VHVA 4QPNA 5IUKC 1IUOA 2EHJA 2C2OA 2VHXA 2H1FA 2O2CA 1TYDE 2GSWA 4PZLA 3V1KA 3KYJB 4CMEA 4H1WA 4DNOA 4Z7NB 3GR6A 2GYWA 4CQJA 5FPYA 2GZAA 4NFYA 2AR9A 2ZG6A 3GLIA 1PFVA 2AUTA 2H18A 2O1WA 4QL3A 1F6WA 3FM9A 3NBQA 2AN5A 1L5YA 2JZNA 5JWHA 3CH7A 4EX7A 5BQFA 1YVEI 5I7RA 1VHDA 4QG3A 4KN8A 4OEHA 3AY6A 3SF8B 4ZYYA 1N77A 2WHEA 3ZIAD 1DJNA 3PC7A 5E4TA 4O0MA 4RL4A 1AGYA 4J1NA 4CDRA 5ALSA 4DRXB 2HK9A 4GRIA 3DDUA 1ZOSA 3ULKA 4YJGB 3KV3O 4I1UA 4X00A 1QXSA 5EXSA 2NYVA 5IAKA 2R47A 1ABEA 2B1GA 1GL7A 4BEWA 1KMNA 2C3YA 3I04M 3MB8A 5DASA 5F33A 1ZNYA 4WZ6A 3KQSA 4PNEA 1VKJA 1XBTA 3KHKA 3OJFA 1T13A 4EAAA 5LIPA 3GUHA 4YJDA 2IYUA 3UZUA 2I55A 4MUIA 2C9OA 3L8ZA 4L95C 3TW6A 4BVLA 4R2LA 1L1EA 3PDIA 2HU5A 3QWFA 2FW6A 4Q9DA 1MA0A 3GLIE 1L7OA 1ZOLA 4L0CA 4HBGA 5FPPA 3HUEA 5DWDA 1QYIA 1E61A 3RRJA 4MA0A 3G13A 2W8ZA 1C3VA 3JVEA 5F5XA 1YKFA 5DHTA 2Z56A 4ENPA 3IVMA 2W90A 3W3AA 1H2WA 2PUVA 4M49A 1P81A 4HWKA 4OMFG 1T3GA 3CZ9A 1K08A 2WJWA 4LEIA 1QAOA 4MYUA 1WDMA 5AHOA 4YLYA 3N58A 1IL0A 1E9SA 1VJDA 3GHHA 3LF1A 2D2FA 3QA9A 4BMCA 4AMGA 5IJZA 4X44A 1XX6A 3VYVA 3OFJA 3ETJA 4OH7A 3VPSA 3VMMA 2AX4A 2PXCA 1S1MA 5EZ6B 3W5AA 3SXJA 2X0JA 1GPKA 1LC3A 3IDFA 1AD2A 4I1RA 4Q93A 5A5FA 3CNOA 3LYAA 4GOND 2FEMA 4H16A 1U9YA 1WPRA 4OM7A 2O48X 3BCUA 2NSDA 3ND7A 3PX2A 4B2LA 1E94E 3DHNA 5A2QA 3K5WA 4C3VA 3BYZA 3AR2A 3WV4A 1JHQA 4OAQA 3ILHA 1QQTA 2EKBA 3EARA 3MELA 2HSJA 1I6KA 4RKEA 4WNAB 3T7DA 3V8BA 1AURA 1L4BA 3B13B 3I1FA 7ABPA 1FEZA 5ERXA 4I4LA 3FCYA 3SZOA 3HSSA 4R5MA 1JVNA 2PLFA 5EJEA 2GK6A 5L6MB 3B1WA 3WGMA 1M1NA 4OM8A 3ORFA 2ZIXA 2D5LA 3O4GA 2IXEA 2Z2XA 4PTZA 3OCZA 5KNCH 2VH2A 3RVLA 1JLKA 2O2EA 4QDXA 4BMOB 3A1DA 3NBMA 3K09C 4ZO7A 5KJCA 2R6DA 3IDOA 4EA8A 5B64A 4KQFA 1NNI1 2Q21A 4CEJB 5JCOA 3AU9A 1LVGA 1TYCA 1KJJA 1FXUA 1II9A 2DPGA 1FVHA 3LUFA 4OFWA 5ESXA 3CIFA 1S3SA 5H02A 1J06A 5CB4B 2W2OA 4EARA 2P3QA 1S3GA 2O1XA 5HM6A 4GI2A 1GVNB 1Y4SA 1PT7A 2QJTA 3VV3A 1FP6A 1OLUB 1CY6A 2VZ0A 3C5HA 4JLKA 4G5XA 4RETA 4F7WA 5EHGA 4GOMD 3AUKA 4G36A 4RFLA 3ZWOA 4CLRA 3N8KA 4JB8A 2QN3A 4PAGA 3TYXA 1EUZA 3KLMX 1WPQA 4MULA 3ZY2A 4YCBA 1MQ9A 4DWJA 2O3QA 3LLVA 2F1JA 4O1MA 1WCWA 3INGA 2DQ4A 4PSUA 4J03A 4YALA 2PJUA 3NC0C 4J9UE 1PFWA 1Q21A 1T2NA 3FCEA 4GXNA 1RM4A 4NQRA 4D97A 4G26A 5FUXA 3TTTA 5LKRA 4Q3DA 5DYIA 4LMPA 2XMRA 2XCUA 5D7NA 4CU5A 2C2KA 1Z38A 5LOVF 4D79A 3ZTWA 4DBZA 3WWYA 1JG4A 2CVQA 2OBYA 4F4UA 1NIJA 1NUAA 1UANA 4N9QA 1EH5A 3I6QA 4X1YB 1YNSA 2C2YA 4BNLA 1D2CA 3I8XA 4E09A 1B15A 2ZBUA 3RSLA 3KSBC 1TQ8A 3NBZC 3SJBA 2OGTA 1KAHA 1F5NA 2VDJA 1N2IA 5EJ7A 2XX3A 3HVHA 5J40A 1E2EA 2WT9A 3DNMA 1IQPA 2NXEA 2P4UA 4BLPA 2YWJA 3GNTA 5ALKA 4PYLA 4FONA 3GVCA 3QE0A 5H7XA 5KYYB 1MRZA 2Y1DA 1O95D 2PGXA 1GU0A 3T7CA 3ZIDA 1BCRB 2VIIA 1GCOA 1QH1B 4WQMA 1C1XB 6REQA 5ELLA 2XKBA 3UV3A 3D8BA 5JY6A 4IIBA 5HJ7A 3R3ZA 5IM5A 4WBSA 2XSZA 4MVYA 5MN4A 2HJHA 2H16A 1SCKA 3EY4A 3HE3A 3PGVA 4OP1A 4U7GA 4YGXB 2F3PA 3MINB 3EGXA 2CFIA 2SKCA 3AW8A 4W5TA 4U7WA 5ALJA 1IXKA 3D3NA 3R9IA 5FHRA 3PQ2A 1O94A 1Q74A 3ED1A 3N6VA 2H54A 4JLBA 4BWFB 1E9FA 5H81A 3PDCA 3V9PA 5L3QB 2GM9A 3C6XA 1ZRMA 3H75A 2B3DA 2CZCA 1JHUA 1AKNA 1NLMA 3UMFA 5DI3B 4S1OA 1Z6PA 3GK3A 4HX5A 1MC5A 2E21A 5FF9A 4M0LA 4CHTA 5GADl 1L5NA 3WFZA 5P21A 2QYHA 4DR7B 1UDWA 1S3FA 2JFXA 4G5FA 2ECQA 1N5JA 2Y27A 4QQFA 4WK6A 1U0BB 2MIIA 1KJZA 4FYXA 1VYTA 1CV2A 4DRXA 1APBA 2XGJA 1S4QA 4ZK2A 3I9V1 3P7MA 3AKYA 3VDNB 1IMOA 4YJGA 3BQMB 2POQX 3HV2A 3R41A 4P35A 5DYGA 4ZJYA 3GO4A 5AJHA 1UBRS 1LLDA 2JLVA 2ZBVA 2ZE7A 2VP9A 4OK6A 3O9VA 4R3NA 5D5PA 1SXQA 2VLBA 2P6PA 3LGSA 1JE1A 1IEXA 4TLBA 2ZUUA 1SUAA 3SC3A 3K2BA 1QPZA 3GPBA 2DKNA 3VR3D 1J25A 2WJYA 2QW0X 2P75A 1P9OA 4RVNA 5C18A 1QVZA 1Y9ZA 3PC8C 5CXSA 5DHUA 2PUWA 2WTEA 3RJMA 4P6VF 2XI4A 1RWXA 1OILA 4NBRA 3H9QA 3OLQA 3KHUA 1NNLA 4UM9D 3OQIA 1ZJYA 3KXPA 1G5IA 1E1CB 1NYLA 1XKLA 2HEGA 2RFLA 4S1WA 5A02A 3BGDA 3RFXA 4IRUB 4Y67A 4ZICA 2PRSA 4Y98A 3LL4A 3N7UA 2X3YA 1W36B 3I8SA 3CLUC 2C7VA 3KSAC 4DTCA 4I4TF 5EJAA 3UG6A 2V74B 3ST7A 3G2JA 4RKQA 4TYMA 2ZT5A 5EXDA 2QE7A 2ZTUA 3EQ7A 3AF2A 3RYIB 3ZIUA 4EY8A 4AFNA 1RLJA 1XRPA 4OV6B 4KWTA 1GD1O 4MW0A 5AK5A 4B09A 1DSSG 2ZSDA 1SC6A 3KLOA 4LWPA 3WKAA 1Y8QB 5AK4A 4BC1A 4P3XA 3A9CA 4TLEA 2AG6A 1WPGA 1T0UA 3I72A 1JMYA 3G0GA 3E58A 3JQFA 4QU9A 4YRLA 4ALKA 4CCAA 1D7OA 4DBVO 1GPYA 4DMKA 1NVFA 3KTFA 4KV9A 5HUQA 4Q18A 2QVBA 4U9HS 5HPYB 5IPFA 3NEJA 1OPXA 1YBAA 3TLZA 3ABRB 1Z15A 3Q7QA 4HUTA 2I1LA 4PSDA 1UL1X 1ZUWA 1JQ5A 1FFDA 2F9LA 1BEEA 3E0XA 4I9FA 4WNAA 3PRJA 3NT2A 5ESRA 1TJPB 1JHOA 1MU0A 3AX6A 5IMBA 3PEYA 3QFHA 3M81A 4P2GA 1DAHA 4NCHA 2B7LA 2QPAA 1GCGA 2ZT7A 2YX1A 1KYIA 1LS6A 1RWNA 3D4LA 1LY1A 3OM8A 4AG6A 4QM7A 1PP4A 1VL0A 1QHHB 2UVPA 2FPLA 2J5RA 1DL5A 4C2BA 1CVIA 1P9LA 1DGQA 2VTDA 5GWXA 2OXIA 2IA5A 3I9V6 3QH4A 1ZJWA 4TUYB 4B83A 3GFSA 4XM0A 3C87A 4KMSA 4CKBB 1CEQA 1PR4A 1USUA 2KQUA 5CB4A 2ZUBA 1M6WA 1MX3A 3K05A 3REQB 1KARA 5C7OO 3EVFA 3JWGA 1Y33E 2GPNA 2JGRA 3QXHA 4YUXA 1OLUA 2ID9A 4D9EA 4DCTA 2Y3IA 3LVFO 2BBOA 3S6JA 5E9QA 1REQB 4CR8A 4EQZA 5JFGA 3FAZA 2I66A 3EMDA 3DO6A 4G0OA 1IXYA 1R8XA 1YJXA 2EYUA 2WB4A 1LPNA 3R5JA 4Q12A 5KTRA 4QUIA 5JCOC 1X3SA 2ZCUA 3A1VA 3DOFA 3L6RA 3T1OA 4XIYA 1DEAA 3BMOB 3V4ZA 1YIDA 3NTOA 4L8WB 4MV8A 4E5SA 2J67A 3TM4A 3KPWA 3ESAA 1NBEA 2WF7A 3FDIA 1N78A 1Y3IA 2WR8A 1KE2A 3U48A 2O2DA 2X9LA 2AW5A 3BXXA 5FJIA 3KOXA 4MCAA 1GSIA 2INGX 3NASA 4RIIA 4H1TA 3HEMA 4N9WA 3VU3A 3LC1O 4RXMA 1GNTA 4PO9A 1NBHA 4BN4A 2KBEA 3V2HA 3GMDA 2ZZMA 1VC2A 4DUPA 5IM4A 3VGPA 3N2IA 4X1YA 3BXGA 3FHOA 3OE7A 1BVHA 4X94A 1XTPA 2HLDD 2W58A 3A26A 3DKPA 3QWHA 4KIGA 4TTQA 2AEEA 2GLXA 3DKRA 1RRKA 1DC3A 3MWGA 2P5YA 4M53A 5DGDA 1RACA 2ZAOA 3KALA 2IZZA 1RQGA 1R0ZA 3BFPA 4RD4A 1SVWA 2ATCA 4LYFA 3HLTA 3RUFA 5C8ZA 1K1EA 2EJCA 3A2NA 3RUEA 4Q9HA 5IYZF 3PJGA 1UC5B 2VYNA 2WYHA 1UR5A 4I7EA 1JKFA 4BO7A 3L02A 4R7GA 4D57A 2C9MA 2GAFA 1BCRA 1QH1A 2PS9A 4P5PA 3HUTA 2WVGA 4PYOA 4ZPJA 3ETNA 4XAQA 3VYWA 4CKZA 3M6IA 2QL6A 4YRSA 1Z18A 3HVIA 1L7DA 4NCJA 3ZCQA 3E9QA 1VE9A 2Q8NA 1YJBA 2PWYA 3ON5A 4BLSA 1IJBA 5HOEA 3MINA 3OQNA 2AZXA 1MNQA 2ZR8A 5I7SA 5LZ5A 2C2BA 2P67A 2BFWA 1ZNXA 4B6QA 3K8ZA 3HFRA 3OOYA 4JCCA 5HYVA 3R23A 5L3QA 1XDDA 1EXNA 2JLUA 4PU0A 3ZY4A 1BHJA 3QSGA 1SHKA 2WWRA 1U9CA 4UBOA 4OLBA 5DI3A 4NC9A 2LDXA 3ZHRA 3IB6A 3F4LA 5BPHA 3IKJA 4Q3BA 2ZUFA 3IKMB 2I4LA 4UHBA 1YFJA 4BFZA 4Q9AA 4P3YA 2QTVB 4EY3A 4ESVA 4JH0A 3LUBA 4RJLA 3ZNPA 2B7CA 2CBXA 4BNHA 3LA8A 5AVRA 2EW8A 2XHZA 3WE7A 1CUBA 1BFDA 3LUJA 4C4SA 3WGZA 4C6HA 3CM0A 3OEWA 1A8HA 4ZDWA 5CIYA 4Y2YA 2XYVA 2C2GA 3E15A 4NBWA 3T3HA 4JP1A 1Z5WA 2O5VA 1KZ7B 2V96A 2RHWA 4EHIA 3GJ0A 3JRNA 3QF7A 5AQ1A 2WD8A 4O2AF 2QTTA 3QU5A 4YCJA 2AKEA 2PDAA 3DDOA 2W4IA 3RRMA 3HYTA 4B3HA 2H4FA 1PRYA 4MWOA 3SXPA 5JSFA 1J8DA 5F35A 4WZAA 1SA0B 4LXQA 1HL7A 3I5MA 3HXQA 1T15A 4ED9A 4IZOA 1QKKA 2WD7B 5JAPA 4Y2SA 3DAHA 1RMYA 1M6HA 2EC5A 4JROA 1ACLA 2AH5A 3LBFA 3WYDA 3E5MA 1QMGA 1YS6A 3A0RB 1V4BA 2YRWA 1E1CA 1GV1A 4Y2QA 4PGMA 4M22A 1OYWA 2EERA 9GPBA 1TIBA 4JCOA 4BNIA 2IGBA 4WKOA 4O29A 5F52A 3RFCA 2O50A 3CBQA 4CYMA 1YIAA 2IZ1A 3C4JA 5EJ6A 1PVDA 3V8MA 4IQ8A 3H1PA 4PZZA 5KINB 3RYIA 4GPEA 5HWSA 4NV3A 1FZQA 3F1LA 3HYCA 1Q7GA 1WULS 2EFYA 3D81A 2CNWA 4GH5A 4KGDA 2GM4A 3KLPX 1NMZA 1PV2A 4JKYA 4LPSA 4U1RA 4W1SA 4BO5A 3L6DA 3ZV5A 3RABA 1FU7A 2AF4C 2YY5A 3BWYA 4CMIB 1J2EA 1JHRA 2HD4A 3ESCA 4GDFA 1HRDA 3D7SA 4KO1S 5HIJA 4EGJA 2CDNA 4XIFA 5K6AA 3AXTA 2FMUA 4C4AA 4CIXA 3K73O 2FSVA 4D9KA 3LHIA 1LC0A 2FPIB 3L92A 4IDBA 3T38A 1NHWA 4IHAA 5T4FA 2EXXA 1QDLB 4OHPA 4RA9B 3KEGA 4WK4B 3BWCA 2KI5A 3JQFC 3N5KA 3ELUA 1NJFA 5LSAA 3DTVA 4HGZA 4KGVA 3QENA 2HZBA 1SCUB 1WMEA 2CL6X 4KHZA 3NHFA 2AG8A 2C84A 5ENDA 2J6BA 1B7GO 1QHHA 3OLWA 3TS1A 4BV8A 1MABB 3EDYA 4Y2PA 2OXTA 3W1WA 4TUYA 2ESRA 5ALZA 3TRJA 4B1FA 4B43A 1XPOA 4RLSA 4CR7A 3O75A 4CKBA 2JBHA 3DV2A 2AEFA 2BKLA 2QOEA 4OSOA 3REQA 3ZVMA 2HW8A 2VP4A 1YB7A 2PLRA 1EUQA 3Q0TA 1P9WA 3QLTA 1FJ2A 1REQA 4JI3B 4TTIA 1EMDA 2O5EA 2OUIA 2WP8J 2IPOA 2NZ8A 3FCXA 1RBQA 4M9UA 4MQMA 4FT2A 2ORVA 3QWIA 5AVJA 3SZMA 3H5AA 3PD0A 4JB3A 3BMOA 4JLWA 1N9KA 2QNIA 1HDOA 1L5RA 1X19A 3T7TA 3VZDA 1GDTA 3RF7A 1NP7A 3PEUA 4YVFA 5HIKA 3K9FC 1S96A 1EXDA 4TYPA 1XNGA 1UP6A 2FLVA 4C4TA 4MUHA 5GGYA 2IWHA 5LP6B 3HO1A 4OQPA 5KTTA 1RQLA 4QVGA 1E2HA 3IQEA 3SYTA 2MSDB 2CXNA 4WV3A 4YRAA 1TPYA 2JIBA 3U3MA 1C2TA 1U7OA 1GNPA 1K7EB 1LFAA 2UZ0A 3PDWA 2NU7B 1PGPA 3AK4A 2CKMA 1Q84A 4TSRA 2ZJZA 3GFTA 3KJXA 1Y80A 3W7AA 4Q4JB 3W6UA 2IEGA 4JMLA 1W44A 4MWEA 1I0LA 1CHDA 3SXUB 2EFEB 4MH0R 5KCZA 3E70C 4DV6B 4INAA 4BQSA 1EDZA 3DMRA 3SQDA 1LXCA 3RHZA 4NONA 2GZDA 4BNNA 4JEHA 5E2AA 1EG2A 2X8JB 2XOKA 3SR0A 3VV2A 4ZIRB 5C37A 2IEBA 1SWWA 6ABPA 1NF2A 3BSWA 2B8NA 5LDGA 1LK5A 1P6QA 5M3BA 1VYHA 4AVYA 4TKZA 2WYUA 4JOCA 4YK7A 2IV2X 5EJ9A 1NJ8A 4R9UC 2NYAA 4ZA2A 4CT0A 3P19A 4WSOA 4AJ2A 4E46A 5KO2A 3ELBA 1UAYA 5BOSB 3HRHA 1XEXB 3E4CA 5KC9A 2QVCA 4GOJA 4F72A 1HLGA 4PYJA 3X0DA 4X8MA 4X97A 3ADOA 3ZXUB 2TYSB 4IR7A 1O3YA 1X87A 3D0QA 3WLLA 4UD2A 1ONNA 2YQ4A 3PQEA 2B34A 5G0VA 3MS2A 1K75A 2I3GA 4IG9A 1OI2A 4FMPA 4DIMA 3PGJA 2QX9A 2X8LA 1DCTA 2G70A 2R1TB 4BY9E 1R6TA 2JG3A 3FYSA 3OX2A 3G8BA 2N47A 3CUEF 4D4IA 4EPWA 1ILEA 1ULHA 1WVGA 3QEJA 5TEVA 1T3ZA 2E4AA 3W3AH 3V3KA 2ZULA 1PV1A 4U39A 4K5QA 3F3KA 2BHLA 3PG5A 1F8FA 1T4GA 2V65A 1IN8A 3JSXA 4C88A 3KQNA 1JE0A 2NV2B 2QTVA 1ZUHA 1QYVA 3DCJA 4ENQA 4HV4A 5A3QA 4OHYA 2EVWX 3UIEA 4FLEA 4EVRA 2IS2A 4QUEA 4C3OB 2H0RA 3PC4A 5GJBA 3IJPA 2GO7A 4NQZA 4OI1A 2A1UB 4WGGA 4ODIA 1DG3A 3F7OA 3DXFA 3LFHA 2F62A 1MENA 2PSHA 4NYIQ 2VQSA 5CHYA 1CUAA 1OGIA 5LQCA 3U3XA 1DKLA 2Z5FA 4LXGA 4LPKA 1C29B 5K45A 2UYGA 4HC4A 2NT4A 2CJXA 4HWTA 4A8HA 1E96A 1YR8A 2HDHA 3D7LA 3Q11A 2G3YA 4Z5XA 1U5BB 4YRFA 2ORED 3OTIA 4RVOA 1FTQA