1M2OB

Crystal structure of the sec23-sar1 complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
167
structure length
164
Chain Sequence
b'GKLLFLGLDNAGKTTLLHMLKNDRLATLQPTWHPTSEELAIGNIKFTTFDLGGHIQARRLWKDYFPEVNGIVFLVDAADPERFDEARVELDALFNIAELKDVPFVILGNKIDAPNAVSEAELRSALGLLNTTGIEGQRPVEVFMCSVVMRNGYLEAFQWLSQYI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords protein transport protein SEC23
publication title Structure of the Sec23/24-Sar1 pre-budding complex of the COPII vesicle coat
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport/signaling protein
total genus 47
structure length 164
sequence length 167
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1m2oB00
5HZKA 4C0LA 2OBLA 4EFMA 3V00A 4B47A 2HYDA 4Z8XA 3A58B 5GJVC 1OXVA 3HYTA 5FOVA 1IBRA 4I1UA 4OBEA 1MR3F 1PLJA 2BBTA 4IVPA 4JLDA 3PEYA 5DH9A 1W1WA 1QRAA 3K0FB 2IHYA 2GXSA 1QHHB 2WOJA 4JVLA 2RGXA 3CKLA 1NIPA 2KWIA 2P65A 2WZQA 4EAQA 3U3JA 2ATXA 1EFTA 4MRPA 2CLCX 4HUQB 4PPNA 3T5DA 3M6AA 1VPLA 2W83A 2BJVA 4MITA 3VR1A 2FFAA 2QP9X 1KI2A 3MLEA 1PVOA 5B30A 5FFMA 3LW8A 4WA7A 4AC9A 4CW7A 3RC3A 2VP4A 2ZIAA 4A0GA 3K1JA 2ZROA 5F2EA 2X1VA 2J0QA 4JKYA 3UXMA 5JMTA 1MABA 3NBYC 2K5UA 5FR1A 3SDZA 2JLSA 4ESVA 3B6EA 2QM7A 3ZQJA 1E2MA 1R5BA 3KQKA 1SKQA 2G77B 3A1TA 2A5JA 2Y8EA 4Y0VA 2JLVA 1FTNA 2AWNA 4I99A 3SYNA 4PQYA 4I1OA 5AJYA 1P9NA 4EJSC 1U0LA 2WJVA 2JDID 2EVWX 3TSZA 2E9SA 5DI3B 4JS0A 4AKEA 5BN3A 3GLIE 4PQFA 4EPTA 5TY0A 3LY5A 1M7GA 2DYKA 2GXUA 2EWWA 3LFUA 4CGZA 1Z0JA 3QXHA 5H8WA 2YHSA 4TZ6A 2ZS7A 1TAGA 1YZTA 4X8MA 2WWHA 4F4CA 2ZE6A 5CYPA 1CP2A 1ZU4A 4MGIR 4B73A 4U5XA 3M0EA 1IONA 2IXEA 4IHQA 3LXRA 1QVAA 5EP4A 3L2OB 3RRNA 4A2QA 1VYUA 4NONA 4A2PA 5TARA 2QTFA 4Q19A 3TQFA 3QOFA 4DXAA 3KFXA 2QGZA 3FMOB 3A6PC 1CULC 5E3HA 5C46F 1U8AA 5KUTA 1F60A 2QAGA 3IIMA 2AFIE 3G5UA 3TR0A 3QBTA 1FL9A 1FX0B 1W48A 4AI6A 3FE2A 1U0HC 3GLIB 4OQMA 3RHFA 2YNMA 3LO5A 4RD1A 4AG6A 4O3MA 1Z0KA 3RABA 5EUQB 2ZE5A 3N2EA 1U99A 2DPXA 2YVUA 4RSGA 4P32A 2Z5FA 1OH6A 4RD4A 1ZM2A 2R6CA 2RHDA 1AZTA 4FMDB 3TVDA 1YR9A 4DRZA 1Z83A 4JVMA 4BLRA 2O0KA 1W5TA 1W0KA 3U61B 2HXSA 3WNBA 2O0HA 1X6VA 1OE0A 1ZCBA 4UJ3A 1R0WA 4CEHA 4AURA 3OIUA 3RWOA 1YR7A 2JATA 4HZIA 1FTSA 4MUAA 1QF9A 5CB6A 1D2EA 4D0GA 1FFHA 2MMGA 2ZAMA 1SVKA 1B23P 1U90A 4HAVA 3DDCA 1TPZA 1QHGA 4UJ5A 2VF7A 2NTYC 3OE7A 4G01B 2JEOA 4DLRA 1QDEA 5DYGA 5P21A 3MFYA 1N6OA 1W36C 4MKIA 1GKUB 4MYCA 2ZI6A 3RSOA 4YDHB 2EFEB 4RZXA 1XCPA 4IOJA 3QG1A 2F55A 5H1YA 5AUOB 3X1DA 2C96A 3EA0A 5DHFA 5LDDC 5E4FA 3GJ0A 3I4LA 1GUAA 4ON9A 4IW3B 721PA 4LJAA 2ZRDA 3OIYA 3B82A 1KJWA 3GLGA 4M9XA 3SJBA 2OEPA 1A2KC 3ONWA 3QPWA 4Q1EA 1MABB 4F4JA 1GL9B 3BIFA 4M1MA 3GEEA 5FBRB 2RGNC 4KYIB 5FUVA 1S9HA 4AD8A 2I1VB 821PA 1H8HA 3EPLA 1UBCA 4TYQA 1IY1A 4JBXA 1HYQA 5BN5A 1COWA 1DAIA 3GFTA 3ZD7A 3ZIAD 3AV0B 5FOSA 3JZMA 4UNPA 4TLAA 3EIQA 4LGMA 2GRJA 1L4YA 2VSFA 2ZQ5A 4CRWB 2FPMA 3Q7QA 1G8GA 2ZSDA 4Q01A 3K0SA 2A5FA 1D2NA 1JR6A 5C2JB 3KUCA 3QVUA 2ZUCA 2IL1A 5FI0B 3ZVMA 1T91A 4XIGS 1NY6A 1HQYE 1DAKA 3K9GA 3LA6A 2W58A 1VCMA 3ND8A 1Q21A 1N3BA 2YOHA 3KKOA 4FD2A 4GOXA 2VBCA 3QXXA 4KI0A 5JZVA 4PX9A 1Z22A 3A1SA 4J0QA 2A2ZA 1KO1A 4KV9A 2WJIA 4TTQA 1BMFA 3IILA 3FKSD 4KBFA 1UAAA 4L16A 5JEDA 5JRZA 4UNQA 3FFBA 4HDQB 5EXXA 1GAJA 4LBYA 2O8BB 1D6JA 1VG9B 2WPDA 2PMKA 2P5TB 4E07A 4DUGD 3NDBB 4Z1MD 1YZGA 3HR7A 2GEVA 1ZVQA 4B3FX 5UKDA 2QAGB 4IKEA 1ZM3A 3IO5A 2OHFA 1G3UA 3CW2A 4GP7A 2ORVA 4LHWA 4TSFA 5DE3A 1OYYA 2XOKA 2CVHA 3EC2A 1W4AA 3RDPA 2EYUA 1DAHA 3AVVA 1T9HA 4E03A 1A4RA 3THWA 3KJEA 2R8RA 2QI9C 5E7MA 1F3OA 2F43A 1KOFA 5HPYB 4KAXA 2QMHA 1NY5A 3WNDA 1X86B 3TUIC 1Z2CA 4JT2A 5JHGB 4HDCA 3IHLA 3OAAD 4NYIQ 4NYMR 4AYWA 5LD2C 2WJYA 4ZDIA 2J0VA 2ECKA 3GLGE 2Q9CA 4B43A 2YINC 4CEHB 3NWJA 1G21E 2HF9A 2YWHA 3HR8A 3B1ZA 4LJYA 3B1VA 5HCNA 2IEZA 4TTRA 3F5FA 1GSIA 3UG6A 3AB3A 2CK3D 1S3GA 1OFTA 4ZCIA 3VX3A 1GRQA 2XTNA 4RD2A 5FPTA 4DLXA 1Q3HA 1XCGB 4LUCA 1Z6GA 1XB2A 1P6XA 4C0BA 2IYLD 4PZZA 5SZIA 2W6JD 1HV8A 1J7KA 1QHNA 1UEIA 4M1OA 3FMFA 2P5SA 5K8LA 2WKPA 2HLDA 3JVUA 3I5YA 3WYAA 1G18A 4JLBA 1QZXA 2FPKA 3Q9LA 2A30A 4QJ4A 1P62B 2OG2A 2FH5B 3JVVA 2B8WA 2IX3A 1DAMA 3BERA 4D26A 4HB4A 1M1YE 4MYHA 5HKKA 2IA5A 3BB1A 3CLVA 1ZRHA 3UPUA 3AVPA 3GLGB 1XPUA 3G82C 2WSSA 4MKHA 1XTKA 4WW0A 2FEMA 3B7GA 3LH5A 2DFKB 5JCZA 2OM2A 1CR4A 1TU3A 3A1WA 4WXPA 3OEHD 2WIBA 1JR3A 4D4KA 2BV3A 4Q1CA 4TLBA 4R2IA 1CBUA 2BEJA 2GXQA 2OLKA 3GJ5A 3CPHA 3AVYA 4IFEA 3RRYA 2GA8A 1G8HA 1HUQA 2AKAB 3LX5A 1DADA 2WHXA 2ZI9A 3CX7A 3GLFE 5FL7D 3VHLB 4II7A 3I8XA 3OEED 4PO8A 3MRSA 2XNDA 2BVNA 4XWOA 4AKIA 1VYTA 4B44A 4EFNA 2CBZA 2ZRGA 3EWSA 3IKJA 2OO7A 2J41A 1G6OA 4QNMA 3SBEA 1QG4A 2ZVPX 3PJRA 3OHMA 4PR0A 4YC7A 1EFCA 4Q9IA 1EK0A 4KLNA 3RRMA 1E9CA 1WBDA 1OFHA 1W36D 2XJ9A 3O8BA 3U7FB 1AA9A 1R4AA 3D31A 2RB4A 3AKCA 1N5KA 2OCBA 2XAUA 3A4MA 3MGCA 5BYJA 2UZ3A 1FPMA 4D4MA 4DZZA 4WZ6A 5EXSA 1E3MA 2OAP1 2QM8A 3OFND 1DBSA 1E2KA 1UKZA 1T0HB 1OH7A 2IT1A 2ZS9A 1FUKA 1M2OB 4G3XA 4B2IA 5C4MA 1OJLA 1E1RD 3AEZA 2HT6A 1EGAA 4H9GA 1M34E 1OKKA 2XGJA 4GSYA 5B57C 4NCNA 3NG1A 3UKDA 3VR3A 4U00A 1U98A 3TSOA 4OL0A 2VRWA 4DEYA 1GVNB 2ZRKA 4Q21A 5A0FA 4R7ZA 3PUVA 5KNCA 1OFUX 2WKRA 1KI4A 4JVSB 1Z6AA 1NVWQ 4D0NA 3THWB 2WWIA 4B32A 1HEIA 2F43B 4UXHA 1OHHA 5EE9A 2EFDB 2ONKA 2GK7A 1NVVQ 2N46A 2C8VA 1TUEA 1S0UA 4LDJA 1A7JA 5KHOC 2ERXA 1RYFA 2NQ2C 2V54A 4TMWA 3RYTC 4C2TA 4BPBA 2OCYC 3T61A 1NVUQ 4P4UA 1ZIPA 2LKCA 3K9NA 1Z3IX 4WVFA 1KKLA 1CRPA 1JR3E 3RS2A 1II9A 1Z0AA 3AGPA 4DLWA 1LF5A 1NP6A 2GEUA 2YC4C 1RE0A 3U4QA 1AQUA 1T5IA 4RFSA 4QBFA 3T1QA 1Z07A 3QVVA 5FTNA 1NLYA 2TMKA 3BB4A 1PUJA 3L0PA 1C1YA 4LHYA 4PZLA 1UFQA 4JJZA 2H92A 1JI0A 1XEWX 4ACBA 4Q4JA 3Q85A 1Q1BA 1E2PA 2J1LA 2F6RA 3AP3A 3IPYA 2PX3A 3W3ZB 1IY0A 2PEYA 1DE0A 1AS3A 3RS5A 1II8A 3AVXA 1MKYA 3AP2A 3AVTA 1IQPA 1KDRA 4FMDF 5L3VA 1ZC3A 1EWQA 1G5RA 3ASYA 2MSEB 1N6RA 4MDFA 1ZC4A 3ZYCA 1AS2A 3NC0C 2P67A 1RRCA 3R9XA 1HQCA 1RRPA 3E2IA 3QENA 1ZM7A 4BFXA 1VCIA 3PG5A 1DG3A 1GNQA 5EE0A 4NCIA 1KY3A 4MKGA 5IT5A 3ZDQA 3QKUA 2W6IA 5D3MB 1LY1A 3GP8A 3K70B 1CKEA 2ORWA 3L8YA 3B1WA 2VPPA 4K81B 4S2EA 4RKFA 4LBWA 2NPIA 3CNOA 3EZFA 4N0DA 1TTTA 1G41A 1YVDA 3W8RA 1U8YA 4C3ZA 2NPFA 4LYJA 3KUDA 4NMMA 4Q1BA 4JYBA 2AN9A 2PLFA 1AZSC 2R2AA 1ZW6A 3KZ1E 4DSTA 4BLOA 3VNUA 1YHNA 1E4YA 2G3YA 2ZI3A 3QF4A 4MGKR 3SI7A 3THOA 4EPWA 1QHIA 4Q4AA 1AQYA 2AX4A 4IDNA 3HDTA 1IN6A 4DLVA 2J46A 4TMTA 2IW3A 2QGNA 4IDHA 1G6HA 2BMFA 1VHTA 1QBKC 1JEEA 3RANA 3QBVA 5TB5A 1XZPA 2DWOA 3CB4A 4DDTA 2R6FA 1O87A 1ZIOA 3RSLA 2ZYVX 2JLUA 2QMEA 1JEDA 2EFGA 3WHKA 2CCKA 3T12A 1RKBA 4EPVA 3K9HA 4PSAA 1Q22A 2GCOB 3Q5EA 4MGZR 4BUJA 1DO0A 2WV9A 2ZRAA 3K09A 2BBOA 2FF7A 1LW7A 2RH5A 4MRNA 4MYTA 3AVQA 4M21A 4WBSA 2G1KA 1OYWA 5KSPA 2JIZD 2H16A 1Z47A 4RD3A 4CZ2A 1WF3A 2QPOA 2RGGA 4DC9A 1XU4A 4RVCA 4UQOA 2EFCB 4NBSA 3MCAA 3T35A 3LW7A 2VF8A 1HE8B 3GFOA 3P20A 1AIPA 2VA8A 2YWGA 4XVUA 2KI5A 1E2EA 1U0JA 2QAGC 5TVKA 3H4MA 2PEZA 3LRPA 4MRVA 3EPHA 4XD7A 1BYUA 1MO3A 2FNAA 4PPFA 4RFSB 3IQXA 3IPXA 1R2QA 2BIFA 4UKDA 4NP6A 2HCJB 2REXB 3AKYA 1SHKA 4LBVA 3FHOA 621PA 2XB4A 1E2HA 2BC9A 4KFRA 2CCJA 4ASUA 4Q4JB 5LBIA 3FWYA 1NN1A 2WWXA 4V03A 8OHMA 1KI6A 1E2FA 5FUXA 4P4TA 1FNMA 5F9HA 2FZ4A 3RS4A 1II8B 2IK8A 1VG0B 5J4VA 1IN4A 1JJ7A 3TUZC 2IS4A 1ZNYA 2C9OA 5JBQA 5AJVB 5IRCD 3D3QA 5B58C 2GZDA 3C14C 1RRGA 2WBLC 1Q1EA 4OQXA 3U44A 2H1LA 3X1YA 2HF8A 3NKVA 2IYUA 5CJPA 4CVNA 5FR2A 1YE8A 3HYRA 5KSZA 4HLCA 1ZP6A 3NH9A 1E0AA 4ARZB 1CJKC 2JJ1D 1OXSC 2GBLA 1F2TA 3VFDA 2E87A 3LV8A 4CT5A 2V6IA 1M74A 2FDCA 2OZEA 3WRXC 2IC5A 5K8UA 2QP3A 1IHUA 3CM0A 4GZMA 1E4VA 3V4FA 4OHXA 1GM5A 4F93B 3KQHA 4V0KA 5JFGA 4KXFB 1E98A 2ZRFA 1GTVA 1WA5A 5E7JA 4BFUA 2GJ8A 1R0ZA 3NEJA 1WB9A 4EDHA 3CPEA 3CNNA 1MRSA 1ZD1A 4E22A 3MG9A 2BCGY 4Q4AB 4G5RA 4N3NA 5KSOA 2KE5A 2X77A 2NG1A 3BFKA 4UNNA 2O52A 3TAHA 4IVQA 3TE6A 3SFVA 3AF4A 3UMRA 5FL3A 5DI9A 1G3QA 1N0UA 4LHZA 4OQFA 3W34A 4WXRA 4QKQA 2IYTA 4D2IA 4BZPA 1UKEA 4DLYA 1SQ5A 2NOAA 4QGHA 1Q44A 2RGCA 2RMKA 3C5CA 1E9AA 2GVZC 3KXLA 4G0NA 3AF2A 5J5CA 2ZS8A 3HPQA 3VR6A 3SYLA 4JL8A 4Q9JA 4Q66C 2QA5A 1I4LD 4HLUA 4FWTA 3A4NA 1YR6A 2KSQA 3RRZA 4PAMA 1IOZA 1U9IA 2ZETA 2DHRA 5CJ2A 3I8SA 3RS0A 1G7TA 2GZHA 3PXGA 1Z0DA 3W6PA 2R9VA 3ASZA 1GOTA 1N0VC 1PLKA 4URWR 2DFLA 3QXSA 4W9MC 5KDDA 4HB2A 1E0JA 4EPXA 5JWRA 1P72A 2NO9A 1YZKA 4WOPA 2D62A 1VG8A 1KY2A 5JJLA 1S4QA 4JT4A 2Z0MA 2BMJA 5CB8A 4ACAA 3IIKA 4PPQA 5C4GB 1S96A 2J7PA 1ZAKA 5JI2E 4FCVA 1G1MA 1KYIA 1DG1G 4PC1A 5JWOA 1YRAA 1KNXA 2F1RA 4KFUA 3U3OA 4CT4B 4W5JA 3W6NA 4EPYA 2FSFA 1KI6B 2HJVA 4WZBE 1CXZA 2GESA 2REBA 4IXMA 1OXXK 5D3QA 3SOPA 3U3KA 1R5NA 2VL7A 5CITA 4OYHA 2FJUA 1TUIA 5AWFC 2JLQA 1HT2E 2VLIA 4U02A 5CK5A 4BFVA 4LI0A 3KQLA 1G4UR 1BYIA 1OFIA 4CF7A 1T0JB 1OIVA 2DFTA 2ZRLA 4BE7B 3U44B 1RC8A 4D80A 1NSTA 2QPAA 4LPKA 1FW6A 4PSKA 1QVRA 3KKQA 5L3QA 3SQWA 4QFMA 1W0JA 2RGAA 1W4RA 1RJ9A 3EAQA 3ZGXA 2CJWA 1FMLA 1KI8A 1F2TB 3U2QA 1Q1ZA 3UMSA 2GNOA 1XEWY 2NO6A 4CDGA 2P6NA 3GJ4A 4BZXA 5HCIA 5FPKA 1GZSA 4PZYA 5IF9A 4D82A 4NCKA 3Q7PA 4KODA 4HB0A 2V1UA 2JDIA 3BGWA 1NG9A 1XZQA 2WOOA 2EW1A 4PFSA 4F38A 1KAGA 2XEXA 2G0TA 4M53A 3B1XA 1T3LA 3LNCA 3WHLA 3A4LA 5F3WB 1R10A 4Q7LA 5TXGA 4G5SA 1TQDA 1VKJA 2ZAOA 1W0KD 1GP2A 1NBMD 4TTPA 2QRNA 1E0SA 1NRJB 1CRQA 1IY2A 4G5QA 3K70C 3AUXA 3T06B 2I3BA 3FPAA 2BMDA 3VX4A 3ZS8A 1D5CA 2ZSEA 4C30A 4EPRA 4BLTA 2YYZA 5JLJA 3CRMA 3DMNA 2ZPTX 3WRYC 3KJIA 1E2LA 1FP7A 3OE7D 3ZJYA 1S8FA 3CH4B 4URVR 4AKGA 2OCPA 2V9PA 1XTJA 2YV5A 1J8MF 4M1YA 4LYFA 4FN5A 4TQUS 1Z6XA 2Q3MA 4DKXA 2PL3A 2YZ2A 4IXNA 1QHSA 1R0XA 3QIAA 4I4LA 4TL9A 5EP1A 1G7SA 3BBPA 4B48A 3MJRA 4TYNA 1UJ2A 5GVRA 1DS6A 1KJZA 4US0R 4ZDKA 2RGDA 4MUBA 3KB1A 3DHWC 4RD6A 1ZD8A 1ANKA 2C95A 3KX2A 1JPJA 4HUTA 3MSXA 1LTQA 2FE4A 2ZU6A 2R6GA 3B5JA 1H8HD 1ODFA 5EZ6B 5ANRB 1E96A 4KFTA 3T15A 4BFTA 1COWD 4BLQA 1NI3A 2RCNA 5FOWA 1ELOA 2PBRA 5HZHA 5FBLB 3WMEA 4F7WA 1XTRA 3D8BA 1DARA 2Q3HA 2CL6X 4C0KA 2FMXA 1WXQA 3L43A 4TWZA 3W90A 1Q12A 5GJWC 4BLPA 4PAOA 4AG5A 4DVGA 2OAQ1 1NMZA 4BQSA 2GVDC 5DO9A 2MSDB 3M1IA 3FYHA 1VIAA 3PFIA 1IN7A 4OQLA 5IK2A 2XX3A 5CDFA 1P9WA 2UVQA 1W7AA 4PO9A 1HA3A 2ZSAA 3CWZA 3L8ZA 5B64A 4QBIA 3C7KA 2ZSFA 1I2DA 1XFAA 4QL3A 1W4BA 1XBTA 1ZMXA 3H1TA 4URYR 2QTHA 3A1VA 4GBMA 3H86A 2ZYWX 5BWMA 4RFVA 5L3QB 3QG5A 4M9QA 1N6LA 1VIYA 3QNUA 3H84A 1RJ9B 2WPDD 4QOSA 4ZIRA 2AXPA 2ZI4A 4L4UA 2BBWA 1NKSA 1QHYA 5G3YA 1OXUA 4BRWA 4EUNA 3EC1A 3QI2A 3QY0A 1SXJA 4GNKA 5CIQA 2XNSA 4DLZA 4MDEA 4JLVA 4PXAA 1M6NA 4JIMA 4TMVA 3ZIAA 3U60B 4BEBA 1AGPA 4BFWA 4TSFD 4ERNA 1KO4A 4L8GA 2XOKD 4TT3A 1NMXA 3KTAA 1Z8FA 3F0TA 3EZ2A 1BOFA 2J9RA 5FTJA 1JALA 2QL6A 3GLFA 3A8TA 2D4HA 3AGQA 4QGGA 4ZCLA 2LCFA 1S9DA 2KBEA 2AFHE 5EE3A 5FOTA 3H2YA 3PV0A 2WTUA 2VHTA 4YQFA 1T8TA 2H18A 1H8EA 2P6RA 1XP8A 5AJXA 4GRAA 5GADl 1TL7C 2BCJQ 2D2EA 4KVAA 1UDWA 1KK3A 1UEJA 2WAXA 3LBIA 4RY2A 2AHOA 3PVSA 3FKSA 3QEJA 1HURA 4O2LA 4TMKA 1ONBA 4ITRC 2WM9B 2OFOA 1W4CA 5H70A 2WWFA 4DUGA 2ZYTX 2CNWA 2JASA 3TQCA 4DB2A 3TW8B 2ATVA 4KO8A 5G41A 4YXWA 3C4JA 4A9AA 1FZQA 2R6DA 2QROA 4F91B 4A0RA 2QUZA 2X8AA 2HLDD 5AUQA 3I61A 3EX7C 1ZD9A 3PIRA 1WDTA 1FQJA 3C8UA 4LCBA 5JEEA 3MJHA 3QQ5A 5CDFE 4NDZA 1TF2A 5HKKD 3B2EA 2JJ2A 4Q9LA 2A9KA 2P3SA 1XJCA 1N6KA 3UATA 4EJSA 3SJCA 2O8FA 4GMXA 4A82A 2GF0A 3N5CA 3OAAA 1UBGA 3P4XA 4B3GA 1TF7A 1JR3D 3CZPA 4EQ6A 1NLFA 1UF9A 2I1QA 4EFLA 1F2UA 3TBKA 5FI1B 2IS6A 3GCGA 3K09C 5H68A 3LQRA 2X19A 3P1JA 5JRJA 1CR1A 1N2CE 2C98A 2IBMA 4RZ3A 2F1JA 2CK3A 1P3JA 3Q5DA 1SXJE 2ZI5A 4X8HA 3K70D 2ODBA 4B6EA 1OW3B 4YMVA 3S1AA 3TR5A 1RVDA 3BB3A 4RJLA 2XNDD 2QU8A 1ZYUA 4B34A 1SVSA 2FX3A 2N1BA 2W6JA 1M8PA 2B7CA 4PQRA 1BH2A 1GITA 1KI1A 5DYIA 2ZRIA 4OK6A 3I72A 4LHVA 3H0KA 3CWQA 1XCMA 5E7IA 5AJWA 4QHSA 3VU9A 1TQ4A 4R98A 3B13B 4AYTA 4DSNA 4FW9A 1KDTA 1ZNWA 2GEDA 3K8YA 1IAQA 2IXGA 1E2GA 4LY6A 1AM4D 1BO6A 2WJHA 3B9QA 3QJYA 2ZXUA 3SS8A 1ETUA 4TMXA 1KTVA 5FPHA 2FWRA 4ZIRB 4P3YA 3UG7A 1R7RA 4R9UC 4IEEA 4LK2A 1SXJB 3RWMB 1OKKD 2Z4RA 1ZINA 1Z0IA 1N6NA 4PC6A 1M7BA 2OXRA 4BFSA 2B7BA 1OSNA 3AF3A 4P0TA 3B1YA 2R6AA 1XRJA 1QG2A 3ETLA 4GT1A 4OJQA 1EESA 2QQEA 3KTAB 1I4DD 2ANCA 1NG1A 5AUNB 5J4HA 3U5ZB 3KL4A 3GLFB 3R8CA 2HYIC 2Z83A 1VHLA 3OEEA 4XSHA 1XEFA 4BFZA 2XITA 1G8YA 1OHHD 2QSYA 2X2FA 3G0HA 2BEKA 5JI3E 2FGKA 2FSIA 4X8LA 4JLKA 1XJQA 2OESA 2VHQA 2ZYUX 1R6BX 2WAYA 1G9XA 4RCYA 3RVBA 3DM9B 3U3RA 4BECA 3ZS9A 1E9EA 4D25A 3L82B 4DJTA 1CF4A 1XD2A 2ZR7A 3RS3A 2P2LA 2GHIA 3ZZUA 4B3XA 1U94A 2ZRJA 1RYHA 3AF0A 4WZAE 2OBMA 4D81A 4M9SA 3TGPA 1DO2A 5CYOA 3IBGA 4JLJA 4HATA 1N6HA 2DFNA 3QPVA 3UMFA 2NO1A 4IDOA 4DIEA 2W0SA 3VR5A 2J45A 4KFSA 5JS7A 1N5LA 3ADCA 4NYJQ 1F5NA 1P7CA 1Y3AA 4IJMA 5AK0A 1E1QD 3CO5A 3REFA 3TUJC 1E94E 1XWIA 3D7MA 3ZVRA 3HPRA 4L9SA 1OB2A 4QGAA 2QRZA 3QSYA 1WQ1R 4Q1FA 3X2SA 1N25A 1ZJ6A 3TLXA 1X3SA 4M0LA 1E2NA 5JHHB 3I92A 3PEVA 4C7OA 5C18A 2C77A 1W44A 2NO7A 3P32A 4P33A 4L5BA 3U6KA 5CIWA 5G53C 1LVGA 2VHUA 3GMTA 4Q1AA 4B3CA 4C0HA 1JNYA 1MV5A 2YOFA 4OHZA 3LVRE 1T6NA 1KI9A 3ZVLA 2ZE8A 1GL7A 4PHFA 4C0JA 1XMJA 1T4GA 4TQAA 3BWDD 4EQ6B 5EE5B 2IXFA 2F1HA 1F2UB 1JQJC 3KJHA 3KXKA 4C0QC 4Q5IA 4D6PA 3VAAA 2GTPA 5EP3A 2GILA 2ZRMA 3THYA 5CM9C 4ZI3A 1E79A 1IJFA 2OCAA 2PJRA 4GMDA 2J59A 2LWIA 2W6ID 3DPUA 3O47A 3W3AA 3C15C 3S1AB 4ZO4A 1U9IC 2BBSA 5KNDA 1UKYA 1HH4A 4HB3A 1E99A 1JB1A 2BDTA 4XWKA 2D74A 1DVRA 2ODWA 2WSMA 5B2ZA 2EFHB 2GF9A 2QE7D 3VU9B 1G8FA 4PTLA 2ZANA 1DTSA 2IYQA 5DN6A 4QXAA 4NL4H 5AR1A 1NLZA 5L3RA 5KTYA 4N1AA 3U6BA 2CL7X 1KZGB 1X8JA 3CRW1 1KO7A 3A1UA 3CR7A 3LBHA 2DY1A 3E70C 3UWKA 2RHMA 4IRUB 2O8EA 1M7HA 2PMDA 1O3YA 3AUYA 3P4YA 1XF9A 2CEAA 1LS1A 4S35A 4V0OA 4EKDA 4LC0A 1KHTA 5J4KA 4DT1A 1YR8A 1KK1A 3M4YA 2YWEA 4XOIA 3EG5A 3NDPA 4DBLC 2C03A 3DM5A 2WMOB 1Z29A 2GJKA 1CTQA 1N6IA 3QUSA 2J3EA 3PITA 2VIIA 3ZZTA 3EZ7A 1Q3TA 2VP9A 2VHJA 1YZLA 2F9LA 3LD9A 3GD7A 1G3RA 1Z06A 4Z51A 3I5XA 2HXYA 2L0XA 5KU1A 1WRBA 4ZV4A 2DR3A 1K6MA 5G3ZA 2QBYA 2Z6VA 2CE2X 2PJZA 4H1VA 1XD2B 3SJZA 4M1TA 3ADDA 1G4AE 2FFQA 4F92B 2XSZA 4E5UA 2C99A 4XH9B 4KVGA 4KCGA 4DLSA 4LYHA 3EWAA 5JSZA 2IS2A 2V7QA 4M9ZA 2ZRBA 5EJEA 4Q4HA 4XD7D 1XMVA 3LXXA 2CL0X 4JBWA 3SQXA 3PENA 4LOAA 1DAFA 1J2JA 4A4DA 4YONB 2NMVA 1US8A 1P4SA 4Q00A 221PA 4P4SA 3SFZA 4B71A 4ASUD 1KDPA 4AKHA 3VTKA 3U4QB 1NL3A 4YDSA 5JJKA 2LKDA 3QKSA 5EQTA 4CEIA 2Z4SA 1LV7A 2ZJYA 4PAQA 4QHYA 3IDQA 2PLRA 1Z6YA 3RC8A 2HDNB 2ZJOA 2HJGA 4GZLA 1XEXA 4LC1A 4B3DA 1UBFA 3K0FA 5JCPA 3OIVA 4U7DA 2IF2A 3WNCA 5BQ5A 1YQTA 5DISB 3BE4A 1N5IA 3CNLA 3A36A 4HUQA 4A8JA 2XB2A 1EX7A 2ZSBA 3ICQB 3TNFA 2A5YB 3C16C 4HZUA 1U2RA 2DWPA 2GJSA 3EA5A 1XPRA 3FFAA 3THYB 3Q3JB 4A15A 4PC2A 2GZAA 2FG5A 1DOAA 1S1CA 2EQBA 2RKOA 3SZRA 3CX8A 4JMPA 1SKYE 4MYUA 3KDSE 3TVTA 3B78A 4ZPXA 4BZQA 2QMUA 1SVWA 1YZNA 4B75A 3R9WA 3W5JA 4ESHA 5KPJA 1XTSA 1G7RA 1DAEA 2XZLA 2QQ0A 3LBNA 1BIFA 3AVOA 1IM2A 4E09A 1D2MA 4FMCF 1AK2A 2CDNA 4QM7A 1E2JA 2GCNA 3VHXA 1X8KA 1XTQA 2QN6A 3SEAA 3R7WA 2WJGA 1RZ3A 4KYUA 2ONJA 2PX0A 2D7CA 2BKEA 5KOYA 3DMDA 2IUSA 3T34A 1EFRA 3MWYW 4B2PA 3REGA 2QZ4A 2ZTSA 3U3MA 4HDOB 3CZQA 1A82A 3O8RA 3FDIA 4MH0R 1V5WA 3QF4B 4LJ7A 2YC2C 3WMGA 2REOA 1S3SA 2ZI7A 1R8QA 1UBEA 3IHWA 4O2RA 1MO5A 4NE2A 1KGDA 5L3SA 1RPZA 5EP2A 1G16A 1G64A 2IWRA 2GAOA 1WCV1 2DCUA 4DT1B 3RS7A 1AKEA 1NN5A 3EW9A 3NC1C 4JLMA 2Q21A 2JJ1A 4I1VA 1UADA 2R44A 4BLSA 5TMPA 2BMEA 2IYWA 1D9ZA 3VNVA 4N0EA 2PT7A 4A36A 1Q0UA 3TIFA 2ZJ2A 2DB3A 2H17A 2OSBA 2QT0A 3AQ4A 5GVSA 421PA 4IOLA 3THXA 1MOZA 4HAUA 3GJ6A 2WICA 3O8DA 1XPOA 1IJEA 5FPSA 2NGRA 4LJ6A 2QBYB 3DZDA 4LJ5A 1ZM4A 4RD0A 2CMKA 4LRWA 2O0JA 1Z6TA 4KJZA 1L4UA 5KNBA 4HAXA 2A7QA 4LHXA 1OV4A 1NVXQ 5JSZB 2V1XA 3I73A 4FWIB 5HR5A 1SXJC 2JLRA 2F3TA 2QP4A 4TL6A 2H7VA 4KITB 3KFVA 4KHZA 4Q4HB 1F48A 5BXQC 1DEKA 1NIJA 1Z63A 4QJ5A 4UXIA 1XTIA 3BFVA 2GDJA 5AJZA 2PZFA 1ESMA 1J8YF 2N42A 2EYQA 2OBNA 1VYVA 4I1SA 3SR0A 3B8HA 4US2R 3ZQ6A 2J7PD 4JLNA 1CS4C 1SHZA 4QNRA 4NCJA 1IXZA 2P0EA 3ADKA 3CRQA 3MD0A 4P4SB 4PSVA 3SE0A 4MGYR 3W9YA 2QORA 4B33A 1P60A 4DLTA 3QKSB 4B76A 4CEIB 3LLUA 3VR4A 1KI3A 3N70A 1ZNXA 4JSYA 5TDHA 1PV4A 3MWLA 4OI2A 2VO1A 1IXSB 4ZCMA 3ZZ0A 1XEXB 1I2MA 5SZHB 4DCNA 4TN1A 3WP1B 3E5HA 1Z5ZA 4V0ME 1KZ7B 4FI3C 2GKSA 3BRWD 2FFHA 3VKWA 2H57A 2VH5R 1NF3A 1R0YA 3CRRA 1A5TA 4A8JB 4IDPA 1KMQA 5LB2A 1WE2A 4HZUB 1N6PA 3EIEA 3MUFA 1DELA 1JBKA 3TH5A 2Q0HA 3AH8A 1GG2A 1YZUA 1KSHA 3I1FA 4K46A 2QEQA 1XNJA 4NYIR 4B3BA 1W0JD 1XDBA 5ELXA 1SZPA 4KU4A 1G5PA 4Q18A 2W2VA 1NN0A 1E32A 3SHWA 3W6OA 4QC2A 1JPNA 1TADA 4QBHA 4O0MA 4JKIA 4KLZA 4HI0E 4RZ2A 1SGWA 3MAAC 3QXCA 1JQLB 2QSZA 4UNRA 1BKDR 1J70A 1GNPA 3OESA 5CK4A 3K9LA 4D0LB 1E9BA 4DCSA 2C2HA 3N2IA 4RKEA 1CJVC 1ESNA 4BEJA 2H8KA 2V3CC 2CXXA 2C04A 2ODNA 4WAUA 3R7WB 3I3SR 5FOUA 1IN8A 4FCTA 4PC3A 3R8FA 1IXRC 4DSOA 1FMJA 2JCSA 1S1MA 2ZVQX 3BS4A 3DZ8A 3K0CA 3WXMA 3ZLJA 4HAYA 4JVNA 3KB2A 4LV5B 5FBWB 5L3SB 3WBJA 3EZ6A 4OI1A 4AWXA 3B9PA 1AN0A 3GQBA 2D3WA 4HAWA 4D4LA 3ADBA 5IDVA 1IN5A 3GEIA 4D4JA 2O8BA 1PUIA 3BH6A 2RAPA 1Q1QA 1W46A 2GK6A 5L8VA 4Q03A 1GL6A 2ZR0A 2VSXA 2ZJ5A 5DHAA 4WIAA 4NCHA 3THXB 3TK1A 3TKLA 2ERYA 4XTRA 3F8TA 1W47A 1ZBDA 3LX8A 3ND9A 1OXTA 2YJTD 5FTMA 1CR2A 1NN3A 1YU9A 4QRHA 2P6UA 3EASA 4TLCA 2ZJZA 2JAQA 3NBZC 4Q1DA 4A6PA 1CU1A 1YJ5A 5JJIA 2WKQA 5FTKA 1TU4A 3OF5A 4OI0A 2O8CA 1LNZA 3UWOA 4JYCA 2AK2A 4TYYA 3DL0A 5FTLA 4GOJA 3W8NA 4L9WA 1NBMA 2IYZA 2CLSA 1DAGA 2XTMA 3D6TB 3BOSA 2ZRHA 2QTVB 3E1SA 3GEHA 4M8NE 5FH9A 2QY9A 4TMZA 4OJKA 3GLHA 3CUEF 5BW8A 1X1SA 4YLGA 1CLUA 2BHRA 1LF0A 2ZE7A 4G5OA 4B35A 3T1TA 4M22A 2QENA 3LVQE 2J87A 3SU8A 1E0KA 1G3MA 1ZUIA 3CF0A 5IK2D 1D8TA 4QJ3A 4NH0A 1YRBA 4Q7MB 3HU3A 4PO1A 2QG6A 3BJIC 3AP1A 3QEOA 1VDZA 3K0AA 1NVVR 4BASA 4HLDA 4YMSA 3B85A 5HTKA 3DO6A 5J40A 2F7SA 4ZDWA 4OKSA 4GP6A 1E6CA 4Q48A 1KI7A 5K8TA 4MRRA 1WP9A 4NYJR 1ZNZA 1K8RA 5EE1A 1BMFD 1OT3A 3PEUA 1SXJD 3BH0A 2O5VA 1KSFX 5IHPA 3LDAA 2GCPA 2I4IA 2OT3B 1RW4A 4A0HA 2G88A 2CJWB 1RIFA 4TT3D 4DDWA 2ASEA 3DKVA 4JLPA 3HJNA 4A92A 2HV8A 2ZITA 1SVMA 2PT5A 1L7VC 2ZJBA 4R71A 5J47A 2SHKA 2WWYA 5E95A 2IWHA 2HT1A 2V4ZA 3UK6A 3FVQA 5TV2A 3SC3A 1A1VA 4QG7A 1K5DA 1XXHA 3K53A 3QKTA 4L15A 1HY3A 3OIWA 3EARA 4B6FA 1H8ED 2VP0A 3CH5A 3KKPA 3T1VA 5AUPB 1G7CA 1FQKA 3FKQA 3SNHA 4LJ4A 4W5HA 3IEUA 4MA4A 1MH1A 1CJMA 4EIWA 4US1R 1NBME 4TZ0A 1II0A 1XJ0A 3FMPB 1G17A 2CNWD 4OHYA 5KO2A 4LJ8A 2AL7A 3ZD6A 3GLHE 4YXWD 4IDQA 4MKFA 1XD9A 2GAAA 2OUKA 1TF5A 4IEIA 3IGFA 3SHFA 3CBQA 1FUUA 2GJ9A 3TRFA 4G1UC 2J7KA 4Z1MA 4NTZA 5GJBA 3CR8A 3J81k 1GKIA 4XJXA 5KDLA 4IFBA 1OB5A 1GILA 1E9SA 1OF1A 2G6BA 4R2HA 2Z43A 2XJ4A 1CEEA 1OPXA 2JJ2D 2X2EA 4NPHA 1XD8A 4UXJA 4IVRA 3X1ZA 4Q4LA 4FMCB 2IYVA 4V0NA 2O8CB 1Y63A 4LV8B 4AYXA 5FBVB 1ZUHA 1T5LA 3KQNA 3GJ7A 1NMYA 3U7EB 4LWZA 1E9FA 1L2TA 1E2DA 4Z54A 3UIEA 2WSSD 5JWHA 1ZU5A 1KK0A 1LFDB 3AVUA 3MMPA 3GLHB 4YMWA 3U7HB 1SULA 2RGBA 2VP6A 4QHTA 3X1XA 5A5GA 4BGDA 4JL6A 2QNRA 4PHHA 3W5IA 1E9DA 2JGNA 1GRRA 1PJRA 2FOLA 2BM1A 2IYXA 3Q72A 3BD9A 4C9BA 4GFDA 4FMBB 2RGEA 3GJ3A 3DOEA 5BYKA 1G20E 2KBFA 1JJVA 3L0SA 1Z2AA 3FTQA 3VKGA 4LSGA 4UNSA 3NHAA 2ZM5A 1XXHE 1XMSA 2DWQA 1MO6A 3MWKA 3FB4A 1TX4B 3K0AB 4ILEA 2A5DA 4RZUA 4M1KA 3EPKA 3FHCB 2WJJA 1WBBA 1JXMA 1P2TA 4M2LA 1MRNA 4JLOA 3PUYA 3NHBA 3V9PA 1VECA 4KBGA 1TNDA 2IF0A 3CX6A 1R8SA 2EU8A 2PZEA 3PR1A 2O8DA 3AF1A 1E9RA 2G1JA 2JLYA 2XZOA 2V8OA 2NO0A 2OXCA 1TMKA 1HE1C 4DCTA 4M1SA 2VSOA 4DSUA 3EZ9A 4GI7A 3P27A 3QXJA 4A0FA 3BXZA 3FHTA 3OEHA 3V4RA 3ECCA 5D3MA 2OILA 1P5ZB 4W7SA 4TYPA 4A8JC 5FUWA 2ZJAA 4TLEA 3I62A 1LB1B 5JS8A 2IUTA 1LS6A 1FOEB 1KIMA 4POAA 1XXHB 1GWNA 3VR2A 4KSBA 4M1WA 3VQTA 1DPFA 5FL7A 1OIWA 1TQ2A 1SVIA 1XX6A 3NBFA 2FSGA 3EXAA 2AD1A 3FMIA 2F9MA 4URUR 2ORIA 4F4IA 2F1IA 1CJUC 3P26A 2FGJA 5K8IA 2QT1A 5KPDA 1E2QA 4LV6A 3PUZA 2FPLA 4XTCS 3TMKA 4HAZA 4LYAA 3QE0A 4NU0A 4TL7A 121PA 3CIOA 3U7GA 4GPTA 4KSCA 4NZYA 5A4JA 3CF6R 3I32A 1SVOA 1VTKA 1G5TA 2GBLC 4PPGA 3FOZA 4CYMA 1KK2A 4OK3A 5FBQB 1KAOA 2WIAA 1JAHA 2FU5C 1A2BA 1AGRA 2OLJA 3OFNA 2B21A 2UKDA 2IHBA 2G83A 4G5GA 3RLFA 2VP5A 2C9CA 4JZKA 5CLLA 2Q9AA 5LB4A 1X8LA 3HP1A 1OLOA 4B74A 1E1RA 2VQSA 3F3YA 5DGXA 3KJGA 3QKRA 2HCBA 2GCOA 5KSYA 1XMIA 4P31A 4QM6A 3WP0A 2V55B 3AM1A 3RAPR 2VYFA 2RGNA 4LJ9A 5C1BA 2JA1A 2ZEJA 2JJ8A 3NBXX 5DIFA 5GJCA 5JECA 2MSCB 2XZPA 2GJAA 4ZKEA 2AKYA 2WWGA 1AS0A 3SJAA 1NJGA 2YKGA 4DEXA 1C9KA 2JLXA 1K5GA 2CHQA 4EJSB 2O8FB 1HTWA 1NJFA 1CIPA 1TQ6A 1U81A 5KYKA 4NHOA 3RNLA 4A1FA 5CLQA 5J4LA 1E79D 3WMFA 4DHEA 2FEOA 3IQWA 4AIIA 3BC1A 1OIXA 1D9XA 5EXPA 2AXNA 2W2TA 2BOVA 4FCWA 2VHCA 3IIJA 3LWNA 1FP6A 1GNRA 1GDDA 2FA9A 4URXR 4OQNA 1E1QA 2ZU0C 4GDFA 3C41J 3QPUA 2CHVA 2R65A 4XVQA 3WYGA 2R62A 2XTZA 2B92A 2VEDA 4HLUC 1P2VA 1Q57A 1TEXA 1RFLA 2OV2A 1UPTA 3CRVA 3TJZA 1EFHA 3X1WA 2JLZA 1F6BA 1KMHA 4DLUA 5F98A 3KKNA 2D06A 2KB0A 2XXAA 5DN6D 2NZJA 1P73A 2ODEA 1MT0A 4XSGA 3GFPA 2GETA 3BFXA 4C0AC 2VP2A 1VCNA 4B2LA 2CE7A 1Z08A 4QBGB 5SZJA 3CF2A 1HT1E 4OHWA 5KDOA 3GPLA 4PC7A 1ZM9A 2O8DB 5J4YA 3PUWA 3R20A 5EUMA 4BRUA 3DKPA 3O8CA 3IUYA 4AY2A 2NIPA 4NYMQ 4I81A 2C9YA 3PEWA 3OZXA 1GRNA 1QHXA 4K8OA 2WWWA 4ARZA 4FIDA 2QMOA 4HLQB 5DLQC 3EPJA 1S2MA 2EWVA 1OH5A 1GFIA 4LBZA 4DDVA 2FV8A 2D2FA 3KKMA 2FZLA 4DIDA 2GXAA 2J0UA 4LPSA 4TYWA 1Z28A 6Q21A 2B8TA 1BS1A 1VMAA 1PLLA 2ZRNA 2C78A 4PANA 1C4OA 4X8OA 4ZI2A 4ABYA 2QE7A 4TLDA 4OHVA 2UZIR 2YOGA 1B0UA 2XSZD 4IOKA 5BN4A 1P2UA 4Y0AA 5LPNA 3A37A 2ZRPA 1NKTA 3Q8XB 2V7QD 2IS1A 3WY9A 1T3HA 3QF7A 2ZUBA 3IO3A 1I4TD 1GKYA 2W0MA 5HE8A 2ANBA 1W36B 3HWSA 4BFYA 4LZZA 5DSZA 4CIDA 1SVLA 2IYSA 4H1UA 3ZH9B 4XWAA 2FFBA 1VCOA 2BM0A 3SN6A 1YZQA 2NZ8A 2E1RA 5FOXA 2H5EA 1NNEA 4DCVA 1X1RA 4IOMA 4O25A 4C0SA 2ZREA 2D7DA 1JAIA 1UKVY 3QKRB 2QAJA 4RCZA 3K0CC 1RRFA 5EZ5A 3DEFA 4M4SA 4PHGA 4CEJA 3AVWA 3DOFA 3SYKA 3TAUA 1R5OA 3T5GA 4A2WA 2IUUA 5FPYA 4BWYA 4AK9A 1KO5A 4FXPA 1T8UA 4C7OB 3LLMA 1KSJA 2W00A 3CPJB 3HU1A 2MMCA 4ZKDA 4LX0A 1P75A 3AKDA 3IBYA 3KQUA 1KNQA 4HEJA 3ZVNA 1QHHA 3ICEA 4DWJA 1L8QA 2OE2A 5DNYB 4XVRA 2OFXA 4C4PA 4NKRA 521PA 2JIZA 2Q3FA 2ZUDA 3WBKA 4TL8A 2AR7A 5FUYA 4JBYA 3L0IB 4DDUA 1G3IA 4V0LA 4A6XA 1W5SA 3C5HA 1CJTC 2QPTA 5M04A 4QGFA 1G19A 1P2SA 3GJ8A 1W2GA 1KKMA 4DB4A 1PZNA 1N5JA 2JLWA 2PCLA 3NH6A 2W2XA 3JZAA 2WMNB 1TEVA 3NVAA 3NTUA 2KJQA 1E69A 2WVJA 3VMFA 4MQBA 1UDXA 2YWFA 4YMTA 2O8EB 2B6HA 3BORA 3PCRB 1KMHB 4Q02A 1P61B 1W49A 4JLAA 2XXAB 1AKYA 2C5LA 4JL5A 4MRSA 3EIHA 3BH7A 3TSWA 4TQ9A 4Q7KA 1U8ZA 2V6JA 4GOKA 2ZRCA 2GWHA 4JSTA 1NSFA 3UANA 1G8PA 1T3SA 1EFRD 2HEIA 4V0MA 5CM8B 3BK7A 1YKSA 1UM8A 1KDOA 1KJYA 1Q20A 5DI3A 1EXMA 2IYYA 4DCUA 4Q9KA 3PUXA 3AKEA 2VTKA 5HE9A 3TW4A 3MWJA 1CR0A 2G0NA 1JECA 3B60A 3R9IA 2G9NA 3SBDA 2BJWA 2F3RA 2AK3A 2AWOA 1J99A 1JXOA 2A78A 2BWJA 4JJKA 3K0EA 1N0WA 1ZCAA 5SZKB 1OH8A 2PZGA 2J5XA 4Z8YA 4FINA 1J90A 1SKYB 4OK5A 3CONA 4C2UA 1W2HA 4GL2A 2J0UB 3NIBA 5LD2B 1P9RA 1G291 3KXIA 1MO4A 1VG1A 3NXSA 2CHGA 3LQQA 2ZR9A 2AD5A 2BKUA 4V02A 3LAWA 3PQCA 2FN4A 1KO8A 5EXTA 1GIAA 1EG7A 4HSEA 3T1OA 2DBYA 1WMSA 2CLDX 2CVFA 3GJXC 1FX0A 4PHTA 1E2IA 2IYRA 2Q9BA 1H65A 3GLIA 2J0SA 3IEVA 5G40A 4URZR 4HYYA 2FSHA 2PH1A 3WYFA 1KSGA 1EX6A 4W5WA 2ZJ8A 1V43A 3DVLA 1ZUNB 3BAFA 4Q47A 4OI4A 4ZDJA 2IEYA 5F9FA 3VKHA 4YMUA 3NEYA 1AJEA 1Z0FA 2PCJA 2A3RA 1FNNA 3L0OA 1EFUA 2OFWA 2Q6TA 4Q9HA 3FGNA 2CCGA 2HUPA 3HU2A 2A5GA 4Q7JB 1US8B 4CEJB 1EWRA
chains in the Genus database with same CATH superfamily
3COZA 5F4ZA 2OBLA 1DEOA 4DG5A 4EFMA 2QN7A 1O57A 4DUPA 2G9NA 4YCMA 1QHFA 2I2CA 3A7DA 4Z8XA 4KPYA 2D1TA 1OXVA 3AHFA 2HSWA 1T2DA 3ENNA 4GM0A 3DR5A 4Z3KA 3H2JA 4G0PA 4I1UA 1MR3F 1PLJA 1QG0A 4AY5A 2VZEA 3K8ZA 4XI9A 4IVPA 2HX1A 1V25A 1W1WA 1YT5A 2A9FA 3EQ8A 3NC4A 4QYSA 3WK9A 1K63A 2GXSA 1QHHB 1E5TA 1SRQA 1W30A 1W4LA 2Q6IA 2WOJA 1NIPA 2W93A 2I9PA 2WZQA 4KUHA 4TMYA 3DCIA 4C87A 4EAQA 1PQPA 3KXPA 3CF4A 3ZUGA 3TLYA 4MRPA 5H9VA 4EVIA 4LXXA 1LBIA 4XARA 3T5DA 2OCGA 3KWMA 5I4KA 4S24A 1NPDA 2G82A 3KJNA 4L4ZA 2PGDA 1KQGA 2FFAA 3G8DA 3EDCA 5KJ1A 3R7BA 3E7WA 1LRKA 3LW8A 2ZUTA 3RU3A 5K0SA 1LPOA 1AOXA 3CVYA 1OC4A 2CXQA 3BK1A 4YMIA 2I03A 4BVHA 1T0IA 1QS0A 1RHQA 5HK9A 3PNVA 3UXMA 3VU0A 3KUXA 4BNDA 5IVHA 1QYIA 1NW4A 3WLKX 4G86A 4M3NA 3ESZA 2P40A 3F9RA 1JQKA 3B6EA 3TOCA 3W8EA 5FWNA 3USCS 4FZVA 1Q2UA 1E2MA 5EJGA 3O3CA 4YP1A 1SKQA 4CLDA 1HFJA 2RKWA 2J5BA 4W82A 3WYNA 2Y0PA 3A1TA 2JLVA 4MA0A 2BTEA 4BGUA 1A9PA 4PQYA 4I1OA 3SYNA 1U0LA 3SZLA 4UEWA 2JKZA 2NU8B 5B3KA 4BE9A 3ZHYA 2B4TO 1J39A 1AZWA 3E9QA 2AOXA 3FPHA 4JS0A 1HO3A 4PQFA 4JXJA 4K0KB 2FSPA 1DC3A 3D3KA 3LY5A 1YVUA 2F8MA 3OPQA 4LEIA 4CBVA 1ZY2A 5K0TA 2JFPA 2PVPA 2BYTA 3F8WA 4CGZA 5MHTA 4CM1A 2ZS7A 1K2WA 2Q0XA 4DV5B 5ELMA 2IIPA 3FNBA 3MUOA 4C89A 5ICMA 4ER5A 5LZ9A 3F9CA 1CP2A 2AG1A 4BNNA 3E27A 5JCOC 3KEMA 3M0EA 1IONA 1UZAA 4IHQA 4M89A 3S55A 4WXYB 5CFNA 4ZRMA 2E7ZA 3B51X 1QVAA 3PPWA 5EC8A 5EKUA 5EP4A 2Z9CA 4JC5A 3L2OB 4O2AF 2WYIA 2GEFA 5T67A 2MSLA 5KX5B 4DQVA 1FNSA 4D8VA 2HC9A 2QTFA 2YV4A 5TARA 5BXYA 2J9GA 2HXGA 4G1BA 1BVUA 3QWBA 2ISSD 5E3HA 2NW6A 2COEA 1F60A 3IIMA 3G5UA 3P2EA 4M76B 3QBTA 5K2MA 1L7QA 2FQWA 1FX0B 2SBTA 4Z9AA 3ZE9A 1FFDA 5CT5A 4XR9A 4FONA 1T5OA 3EVBA 3M82A 4RD1A 5D7NA 4D4HA 1VL5A 4E2XA 4O3MA 4DJJA 4XM2A 2BF4A 2NZWA 1Y5NA 2YVUA 2DPLA 2NP7A 1SZJG 2OYSA 1GUFA 2Z2XA 4AKSA 1YRQA 2CJFA 1P0FA 3SVZA 2A3NA 3ZDZB 5LN1A 1VI6A 4DMLA 4AP5A 2A1IA 2BEUB 1XRSB 5HZGA 2I4TA 4LOIA 2HXSA 3WNBA 2O0HA 2OXEA 4IDAA 4LXYA 2O2DA 1OE0A 1QO0D 1R0WA 1NXXA 3AR3A 1L3CA 4HQLA 3T38A 1CS0B 4P7FA 1YR7A 3HKEA 4K6HA 3QVGA 5JDIC 1W5FA 1BJRE 1D2EA 5B6IA 3A10A 5EJ9A 4EITA 4JROA 3LTEA 4RYLA 1B23P 5A2GA 3AHCA 4HAVA 1TPZA 1XZHA 2ZKIA 3W1VA 1T1IA 4BX9A 4G01B 3O92A 2PAFA 1PDOA 1MJGM 1KZ1A 1R0BA 1QDEA 3QJ5A 5DYGA 5P21A 3UC9A 1S2LA 4FD3A 4WBNA 2MCFA 1YJCA 3HVKA 4MYCA 3RSOA 2EFEB 2D6FA 3BTOA 5FRDA 3TBHA 4B7XA 3TOZA 3SM3A 5H1YA 3LWDA 2G4CA 5AUOB 4GC5A 5IPFA 2ATCA 5JO9A 5AW1A 5JNLA 2FDXA 5CM2Z 4R31A 1AKUA 3H2KA 3SJBA 2B8NA 2DULA 4HDMA 1G21A 3QPWA 1P7PA 1Q0RA 2PJDA 3LUKA 4I2VA 5BQ3A 1ADJA 3BIFA 1DX4A 2EHJA 2K2QB 5FUVA 4LWPA 3HCEA 1V16B 4G9BA 4LY3A 1FUYB 4OP1A 3SQMA 4Z4IA 4YHHB 1KFJB 5BN5A 1COWA 2CLKB 2QSUA 4ZEMA 4X1YB 1JJIA 1GQFA 2A4KA 5FOSA 4ZZ1A 1Q92A 4IXTA 4UNPA 1SCBA 2EDAA 2IZZA 2OQRA 2Z09A 3FYTA 4TLAA 2PLNA 2GRJA 5EWJA 2PO5A 1G8GA 4BVAA 3EMBA 1K9VF 2A5FA 1D2NA 3AEXA 5BN3B 4CV1A 1CNMA 1T6YA 2IEAA 4Z7OB 4PFJA 1HQYE 4RVHA 1DAKA 3RYHB 4BNMA 2PSFA 3ND8A 1UIMA 4MUNA 3KKOA 2YOHA 1HNNA 3WLQA 4A03A 4PX9A 3PEWA 2A59A 4OY3A 2DLDA 2ATIA 2WK1A 2A2ZA 3FF4A 5H80A 1B42A 1B6RA 3ROPA 5AHXA 1KEUA 5AJUA 1RWQA 5GONF 5JEDA 1AE1A 4RS3A 4H0FA 1XHLA 1ABBA 1JLLB 3HXMA 1GAJA 4LBYA 4ODIA 4YCJA 2WPDA 4AQDA 1IVSA 3TQSA 2O8BB 5ISMA 3DMTA 1I10A 1ZCZA 3FPJA 3OECA 5E4JA 4M0CA 3WGTA 1WMEA 2IVFA 2QAGB 4IKEA 2P9GA 3GCXA 1ZM3A 1G3UA 1IXYA 5JSHA 4CM7A 1W4AA 4RSRA 4JV5B 1Q1GA 2GBFA 4ID9A 4CHGA 4E03A 3WLAA 2FR0A 1K4MA 3CSDA 3GDFA 1U2PA 2R8RA 3V8MA 4QT4A 3THWA 4E1BA 3EGIA 3F71A 1K5HA 1GSHA 2QMHA 4CMGA 1NZFA 1X86B 1G8KA 1W35A 2R6R1 5CU7A 2IELA 5JHGB 4HDCA 3RBVA 3ZD8A 4NYMR 4NYIQ 1NRIA 3RFUA 3REQA 5A71A 3H1PA 4MUXA 1GNVA 2WJYA 4ZDIA 4IFTA 4B8YA 2XTAA 2F8LA 4L8VA 4EHFA 5IBPA 3BXGA 4E32A 1FIUA 1U8EA 1MNAA 1COZA 3AB3A 1S3GA 1TM1E 4MVWA 4QPPA 3V3KA 2EBUA 3RJ9A 1GRQA 1RI2A 3VX3A 2IOQA 1QX4A 1SIUA 1Q3HA 2RJNA 3JQ9A 2TRSB 3OKAA 4IHJB 3IAEA 1KMNA 1KP9A 2GEBA 3BHJA 1EK2A 5AP9A 5IZCC 2Z30A 3L9WA 4P7BA 1P2BA 4UE2A 2YQ4A 1AA6A 1QTNA 4PZZA 2FVYA 1N8TA 1E5DA 2UYYA 4NAVA 3KFLA 5K8LA 4K1XA 4KW7A 5HILA 4FWBA 1WY5A 4M9CA 3FUUA 3K9CA 3JVUA 3PPVA 1WPXA 5B58T 4FHEA 3TZBA 1QZXA 2D5IA 3Q9LA 2G80A 3FYDA 3MC1A 1AZLA 2XUGA 4V0SA 2FH5B 2XE8A 4DV6B 5JCJD 4U2EA 2VT3A 3T7DA 3IXLA 2NXNA 1NW9B 4MYHA 5EJMA 1F0NA 1SK8A 2IA5A 5KTPA 3UPUA 1WHSB 2WSSA 3T3GA 4OHPA 1N9ZA 3ZWYA 1L1EA 2FEMA 3TFQA 3K7EA 3MS4A 4J0GA 2F00A 1E6UA 3LH5A 5JCZA 3CZ5A 3S2UA 5AOBA 2QKYA 2WVHA 1XA4A 3MINA 3OEHD 2WIBA 1H3FA 1JR3A 3E15A 4Q1CA 3WGLA 4EARA 3ZJVA 3LKVA 1BS9A 1CBUA 4II3A 2JKVA 2GXQA 2HBYA 4K26A 5FFNA 2HFJA 4IFEA 5BN1A 4MX8A 5ALEA 1NGSA 3DEIA 1H5NA 1HUQA 4FYJA 2FZ5A 2VTDA 1Y3CE 1U28C 2G28A 2WHXA 2YMLA 1IJKA 5FI3A 4BXOB 5DHPA 5KIAA 3GLFE 3QKWA 4ZMRA 4TOIA 3IP5A 2D1FA 4II7A 4XSVA 4ZANA 2BMWA 3MRSA 2XY4A 2J31A 2BVNA 2XNDA 4LW8A 5FEMA 4XRGA 1UZLA 2QTGA 1WVMA 3OQIA 3AX6A 1PL6A 1RXWA 2CBZA 1DB3A 2ZRGA 3FRIA 2LRHA 3IKJA 1G6OA 3ND6A 3WSTA 2RI1A 3DQZA 4CQJA 3LTNC 4D6YA 5KVVA 3G2OA 3P45A 1QG4A 2GNAA 4DJFC 2ET6A 4MR7A 1HL7A 4YC7A 1EFCA 5JPIA 5T41A 2DERA 3EGXA 3BIJA 4QJBA 1AA9A 4S1TA 1J07A 4Y6PA 4BNZA 3GUVA 3AKCA 2XAUA 3A4MA 2B2NA 4IG4A 5ALKA 4I9GA 3O8QA 4D4MA 3H18A 2O3QA 1P4AA 1JHUA 3B6JA 3VU3A 3GGGA 3JALB 3VR5D 3ZK9A 3IKLA 3IQZA 2BHLA 4AJ9A 2IHJA 4BMZA 2CKMA 4IIFA 4I5IA 1JPVA 1L7AA 2WFZA 2V7XA 3T5TA 2ES4A 5B57C 2O14A 4I4TB 3NG1A 4NCNA 3UKDA 4OA5A 2XDQB 4CUZA 3QOYA 1U98A 2DJIA 4DE5A 4OL0A 1L4NA 4J07A 5AI8A 4DEYA 5COBA 1GVNB 3D8UA 2AH5A 3W0LB 5KC9A 5C52B 1YONA 1Z6AA 1V96A 2VDQB 4JVSB 3TQIA 3Q1KA 4YRCA 3RQIA 1ESZA 2CLMB 3G2JA 4H77A 2F43B 4NBVA 4TWBA 4UXHA 1U0EA 2EFDB 1L4GA 3QVSA 3K15A 3O8LA 4D9EA 1UT8A 1K66A 1S0UA 4UUQA 2AJTA 2PVCA 1XRLA 2D2XA 1RYFA 3C7AA 2HK9A 3NHYA 1MP0A 4MI9A 4E5NA 4TMWA 3DL4A 1H66A 3DCYA 4QOFA 3LRTA 1NVFA 3CQ9A 4QTZA 1OI3A 4E2YA 1WMDA 4GSLA 1ZIPA 1KFEB 5M2QA 1S5PA 3SQOA 1V7ZA 4FZ5A 4WVFA 3RRBA 3BHMA 1RYMA 1PT8A 3LSTA 1BE6A 3K9WA 3K8OE 3EDMA 4GBED 3ANNA 3LGXA 4HGZA 2OOKA 2E4AA 2YC4C 1UC9A 2Q3EA 3BKWA 4WCFB 5IAKA 4CG1A 1LRLA 5EI5A 1SCNE 1AQUA 1BMTA 2IPLA 4RFSA 4ZMBA 3RVMA 3ABQB 1NF9A 1X80B 1NLYA 1YBMA 2YZNA 3D0QA 3D0OA 3AF6A 1KYQA 1N32B 4J0DA 4BKOA 4M0MA 2L82A 3MBKA 3EGDB 1C1YA 1MEJA 3PGVA 1YR1A 1Q91A 4PZLA 5EYPB 4ZHQB 1NQOA 4ACBA 3FSGA 4PNEA 3Q85A 5DZSA 5KOJA 5L4NA 1LI4A 1PT9A 5F3RA 3V4ZA 4D25A 3IPYA 2PEYA 3AR9A 1DE0A 3ZBTA 1LXCA 1T2FA 5TGDA 1TVKA 3CLTC 4DQUA 3AQIA 2NXJA 2JAOA 3AVTA 4FMDF 2ARKA 1P81A 3KV3O 2DR2A 3KLOA 4M8IA 3KZXA 4IH9A 3SZMA 4Z2AA 2PQMA 5JXHA 4FLFA 1SB9A 4K9OA 4TKUA 4XXHA 1Z12A 2FMUA 1N8KA 4J94A 4O8ZA 4PCVA 3C3BA 3DBOB 3PQFA 4YROA 2B8EA 4MWCA 2P67A 4L75A 4ZT5A 2YS6A 3QENA 3ONFA 3ER9A 1VCIA 4IIJF 5DGDA 5D3KA 1RPTA 3JWHA 4DG9A 1GNQA 1QCCA 1RAGA 3MPOA 1FFXB 4NCIA 4S12A 4TRJA 1NNI1 4MW7A 3SXUA 2HWXA 4MKGA 4IINA 1NU6A 3ZDQA 3UV3A 5K0BA 1KAHA 4HC4A 1CKEA 4HZGA 2ORWA 4C08A 2VPPA 1X7ZB 4J49A 4LQCA 3RBAA 3RK4A 4ENVA 3NANA 3HDJA 5LSAA 4IKPA 4JB2A 4E14A 3ZK8A 2XTJA 1YH3A 4HFMA 1TTTA 2Z8YA 4N0DA 3EVEA 1T9BA 1YVDA 2OFPA 1U8YA 1LDNA 3EXHA 1MOPA 3HGTA 4NMMA 1NBEA 3TJRA 1EJ6A 2VHZA 4CLRB 1DQSA 1AZSC 5C1IA 2G9ZA 2X8BA 5ICEA 2O54A 3ZI7A 1VJ0A 1DWPA 3E53A 3FTNA 4P82A 3WLTA 2RGRA 1BXGA 4BLOA 1I2AA 1SG0A 1UFRA 2WZBA 4LYGA 3QF4A 2G3YA 2ZI3A 4WN9A 5E4TA 4R1TA 1QHIA 1UDRA 3HSKA 3PDUA 4X45A 2ZBUA 1YQEA 1AQYA 1K8QA 2IOYA 4PTYA 3AESB 4ZVOA 3OX1A 4DLVA 1UMCA 2J46A 2VYND 4TN5A 3CY6A 1BFDA 4FBLA 4EZBA 3B1FA 2PA0A 4D92A 5AVXA 5IU6A 1QBKC 5C8YA 1FSPA 3RANA 3QBVA 1YAJA 2DWOA 1IDOA 1EXVA 5SZIA 3SQDA 4XDHA 2M6SA 4JC8A 1R50A 1CVRA 3VJRA 1FDOA 3W5BA 1JEDA 1KXJA 3ADOA 3ZWOA 4ITVA 2CCKA 5T7BA 2XF2A 3EVZA 5J2UB 5T6MA 2Q27A 4BO9A 1BFKA 3B12A 1G63A 1Y0BA 3PNPA 3ZE6A 3RT9A 4E1VA 3GH3A 3CJTA 4WCVA 1J22A 3BIXA 4GR5A 3DPSA 2VKQA 3ONEA 4XQCA 3R44A 3VR0A 1S7GA 1MJNA 4PINA 5IZ4A 3H9GA 1YL7A 1QP4A 4M21A 1BN7A 1OYWA 3VOSA 3PDIB 4RDIA 3QUBA 2GD0A 2Y27A 4NMXB 2RGGA 1RI1A 1H6AA 2ETVA 4CZ2A 3RAFC 2PVSA 4DC9A 3DXFA 2X0DA 4UQOA 4UTXA 1XZNA 3KR2A 3MCAA 4CL3A 3LW7A 5E7QA 4IXWA 3ZDFA 2R79A 2YWGA 4RHYA 1C3EA 2KI5A 4FYPA 4RXUA 4ZZ2A 2DWUA 2JD1A 3PFFA 5TVKA 3LRPA 4HH0A 2P9BA 4GOLD 3EPHA 1EEHA 5KJEA 4PPFA 3UPTA 5HS6A 3IQXA 3WB2A 1BE1A 1QR2A 3P0RA 2Z98A 4X24A 1TEZA 3AKYA 1ODJA 1QRRA 2B99A 3FHOA 4LBVA 4F4UA 4KFRA 2CCJA 4ASUA 4JLUA 4RK4A 2EJUA 2I6SA 5E3JA 3IP8A 3ELDA 3U9LA 4CG2A 3WGIA 4HX9A 4KK3A 4XA8A 4V03A 4UHCA 2GCEA 4ZOLA 4OM8A 1YQGA 4W1RA 1E2FA 1USVA 4WBXC 4PLCA 1II8B 5J4VA 1VG0B 3HLTA 2HA2A 4MVJF 1R0LA 1EZ1A 1WU8A 3CLHA 4D57A 1I7QB 1YIDA 3A0RB 3TUZC 2IS4A 5AVUA 5ALDA 4ZAXA 2CDBA 3U7JA 2PX4A 5DTQA 4RPKA 5HS4A 1UKAA 5B58C 1OCEA 1XHEA 3HVUA 3R9XB 3UFXB 1EBBA 1JUDA 4U7TB 2AEFA 2GFIA 5LQCA 1AKRA 4OQXA 2IEGA 1FC0A 1ENOA 2DEUA 4N48A 1J20A 1DLJA 4J16C 4Y2HA 4CVNA 1YE8A 3HYRA 5KSZA 4NCBA 2BTQA 2B78A 2JJ1D 3I6ZA 4JQYA 4DBZA 2JJYA 4LKRA 5DNVA 5B3LA 3AG5A 3AUSA 2ISCA 2MR5A 3LA8A 4IJWA 4YAOA 3VFDA 1FU7A 2V6IA 4ZJUA 1FFCA 1TZKA 2OZEA 5K8UA 1AKMA 2QP3A 3GG9A 2ADFA 2XQKA 5C81A 1XV5A 1JA9A 3EVTA 2WZCA 3HN2A 3NBMA 4KQ2A 4OHXA 2VAWA 4YRQA 5B1SA 2DPGA 4V0KA 3S7TA 4F93B 5ITZA 3IHKA 3EVGA 3IAXA 4YN3A 3UAWA 1K89A 2XODA 4NDAA 5HBRA 3WL5A 4ZJZA 1YBAA 4JD5A 4O2BA 2F2TA 1WY7A 3CPEA 4KXLA 3HDHA 3V7FA 5KZMB 4F84A 1U1GA 3WK7A 1HSOA 3ZD9A 4E22A 2O2EA 3QVXA 1ZMOA 1W581 1MPTA 2BZSA 4MKZA 2VT7A 2EF1A 3F67A 2EBFX 1Y1LA 3T5PA 1O6ZA 4C3VA 3FI0A 3FNHA 3BFKA 1W2WB 4JJ8A 4DLPA 3VJMA 2XI4A 3KIPA 1JDNA 4OFBA 2O52A 4OUDA 4JIGA 3S2IA 3TAHA 3WB1A 3SFVA 2CJPA 1RNLA 2DTXA 2Z9BA 3G49A 3OLQA 5E6SB 4LOLA 5FL3A 1W6UA 2MSNA 5EJ5A 2CDCA 4LHZA 2DHEA 4OXIA 3LX4A 4WXRA 5KTTA 4PWZA 1ENYA 1NX9A 4MEBA 3LHSA 1SQ5A 2GDZA 4YJ2B 4EEZA 2RSLA 2V5AA 2BUAA 1JNXX 1WW2A 2II6A 3SJUA 3C5CA 1QTQA 1E9AA 3DO8A 2NPOA 3AF2A 2Q1TA 2ZS8A 3VH4A 1PF7E 5DEOA 3IYLW 3OJEA 4QSHA 3VR6A 4RU1A 4BQPA 1DC7A 1GGFA 3SYLA 5JU6A 5TIIA 4ZAVA 5K0EA 4Q66C 3N2ZB 3KR1A 1E7MA 3ZQKA 2I8CA 1IOZA 3PQ7A 1CFJA 5EWLA 2I7XA 3WLJA 2M98A 3W6PA 5C35A 3RJZA 4CV3A 1CQPA 2R9VA 5FADA 3OMLA 3W04A 5BSUA 3ANMA 3DP7A 1JV2B 3LBFA 5DP1A 2LTAA 4H7PA 4WOBA 1SUWA 3V1MA 4W9MC 4ZVTA 2WF7A 4QTYA 4HL6A 5IEJA 3ZWXA 3HVRA 3B9BA 3X1MA 2VH2A 2D62A 2V45A 3Q7TA 2JJMA 5BURA 4GYYA 1H2EA 1Z34A 3VSAA 2BMJA 1WSWA 5CB8A 3T4PA 3HKCB 3IIKA 2RGYA 4KLCA 3F6CA 4PPQA 5C4GB 3SMVA 2J7PA 1QK3A 1CEQA 3BMCB 2H3HA 1J2TA 5HBGA 1KYIA 1OVMA 1ZN7A 2OQIA 3LFTA 2AI1A 2Q3CA 1KNXA 2F1RA 1U7OA 1Q15A 2VP3A 3N53A 4KFUA 4MW6A 3DH0A 4P92A 4QSMA 4F06A 4CL2A 1GL3A 4AROA 1JDSA 2FSFA 2O2YA 3KCQA 3QELB 3ZLVA 4C1NA 3H7IA 1J2RA 3A1CA 4WZBE 4F45A 5LOVF 2HSZA 1O96A 1Z0SA 2REBA 3P0EA 4IXMA 3SOPA 3TQHA 1H0SA 3JQ7A 7YASA 2GEKA 2W37A 2G1UA 4DV0B 1XVIA 3LOPA 2UZ1A 2YRXA 1PJ8A 2GK3A 4OYHA 1TRHA 2BHSA 5CXUA 3MUEA 2PUJA 3I2FA 2VLIA 4LXQA 3KQLA 1G4UR 3E9DA 3WLMA 4QDKA 1PR1A 3CE9A 2OCXA 1N0HA 1OIVA 2ZRLA 3MT0A 1O94A 2OHJA 4MOWA 3U44B 2G40A 1NSTA 3UHFA 2QPAA 1RC8A 4LPKA 2VUHB 4UTNA 1FLVA 1LVHA 1NATA 1W0JA 2VDWA 1L9KA 2Y0DA 1U2SA 2FMHA 1ACJA 1ENPA 4J2OA 4WUVA 3RT7A 1QO7A 3ZGXA 1AUVA 3H6KA 4KLRA 5LMCA 1F2TB 3AO0B 1O2DA 2R85A 2A1TS 3A9VA 3FTCA 3TSAA 3UMSA 1D1TA 2GNOA 1XEWY 4ZO7A 4B3TB 1U8CB 3IMCA 4OAQA 1HK7A 2FDRA 5FPKA 5AW3A 5IF9A 4BJ6A 4PG5A 5IARA 1E3IA 2Z8ZA 4RV4A 3DCNA 4E70A 3LXMA 4DA7A 1MZPA 1QAOA 2B6NA 3UGJA 5JZBA 4M7OA 3AWDA 1I8TA 2FLKA 2PHZA 4NCKA 3TRKA 4HB0A 1C7IA 2JDIA 1NG9A 1XZQA 2ATEA 4YACA 4PFSA 2LE0A 1HG1A 2XEXA 2W2MA 2G0TA 5CA0A 4DNOA 4M53A 1SC6A 4PGAA 4B87A 5GINE 5F3WB 1R10A 3O4JA 1MW8X 1MIOA 1EUCB 4M60A 5TXGA 1MB0A 2VCEA 3EGWA 4NU8X 2ZAOA 5ADWA 5KOIA 4GUDA 1F51E 1QGUA 2RI0A 4I3FA 1GP2A 2H48A 3H9UA 1BQEA 4MGHA 4E7OA 3N8KA 2C82A 1LI7A 4HYTA 5LYYA 1CRQA 3SDSA 4G5QA 2QNIA 4EFDA 3LRXA 3MF4A 4DN6A 3VX4A 3ZS8A 3M81A 2OA0A 5K51A 4BDSA 1FSGA 3N28A 5E1OA 5FEUA 1OXMA 3SP1A 4NEHB 2PYZA 2ONYA 2P4EA 3CLUD 3BWEA 1KDZA 4E6PA 5IJ9B 4CGYA 1FP7A 1RM5A 1KXZA 3ZQ4A 1BCRA 1GQRA 5IUJC 4WMLA 1S8FA 2XB9A 4MO9A 5ES4B 1DLIA 1EHYA 2C1XA 2JZCA 1HM5A 2O9JA 3QPDA 2B4QA 3S2SA 2R87A 1QDLB 4KQWA 1M1NA 4DV7B 4EELA 1NE2A 4URVR 4AKGA 8LDHA 2EW8A 4FNMA 1XTJA 1YFLA 4B0OA 1YA8A 1JB9A 4G63A 2H1IA 2X9LA 4FN5A 1MC4A 4TQUS 5DCUA 4Q12A 5HIMA 2PRZA 4Y8VA 3CH6A 4HBZA 4W5OA 3ISVA 1X1TA 4K5QA 2WD8A 2QTZA 3BBPA 4W8GA 4U2FA 2W2KB 4OOEA 4ZDKA 3HMKA 3FCXA 9ATCA 1U31A 4G8DA 4I50B 4WRRA 3LVFO 4RD6A 4HUTA 1ANKA 5K4AA 3JRXA 1EP9A 1K7EB 2NV2B 3MSXA 2WNHA 3ZE2B 5KYWA 1DXYA 1H8HD 1ODFA 2PS3A 5ESXA 4Z0HO 5ANRB 1PG0A 1V5GA 3NETA 1P77A 4H7EA 1NUPA 2R25B 4IXDA 1RSZA 4BFTA 1JHYA 1RZVA 2O3JA 3PEEA 2D2IA 5FOWA 1XPJA 1ELOA 1B3BA 4S0XA 1C14A 2V7EA 2V8BA 2ZJ7A 4ND4A 5HZHA 4GSKA 4H3HB 2W71A 3KQYA 1TCUA 3GAAA 2OMEA 5JR3A 4GX5A 4D99A 3T52A 4UVDA 2VPQA 4ARBA 3MTJA 1T5TA 2GN8A 1DARA 5CX1A 2CL6X 2IU4A 2JHGA 4V3CA 5ULLA 1NXWA 5GJWC 1XQXA 2PMEA 5IM4F 3IV7A 2O2CA 1QYDA 5CURA 4AG5A 2OAQ1 4BQSA 1NAIA 2AW5A 4KGDA 3FYHA 2ZIUB 3PFIA 3VSDA 1IN7A 3IUJA 3FAKA 2XX3A 2UUBB 5M5BA 2UVQA 4MROA 3EVNA 2J4FA 4NMWA 4UFPA 4K6GA 3ENZA 2ZSAA 5B64A 1W0CA 3W06A 4N4AA 2R7NA 3ZBUA 1N2EA 3X44A 1C1XA 1A9XA 4GMHA 3DT6A 4D9BA 4LDQA 4Z3OA 4ID3A 1U3FA 3JVEA 3M1YA 5TRTA 4N6OA 1N36B 1PG5A 4M9QA 1G8MA 3FWZA 1T1EA 3EXEA 5CVCA 3EXIB 4ALMA 3H84A 1RJ9B 4BB5A 4KPFC 3PC3A 4F8JA 5IWCA 1WV1A 3RPEA 1VIMA 1N0IA 1SQFA 3LBAA 4AJLA 4KDEA 2X4IA 2YJ5A 4PVCA 3QI2A 1AK9A 4EUNA 4LXUA 3V6MA 1OXKB 3AF5A 4JLVA 2YRWA 4EHKA 1WAMA 4W1QA 3LCJA 3VZBA 1ISFA 2HNAA 3F49S 4BEBA 1UOQA 5CFQA 4Q3LA 1K3FA 2VAXA 4L8GA 4FOTA 5A4MS 3KG2A 2WU3A 2GYYA 5BV7A 1UBKS 2MHCA 2YFQA 2FPGA 4G36A 1BOFA 1KEEB 1GTRA 1JALA 2QL6A 2E4VA 2HSJA 2NSDA 4EHNA 3VPDA 4NJMB 4Y9SA 3DS8A 2KBEA 3I58A 4RA6A 3IJPA 3EFOA 4NJOA 3PV0A 1PZFA 2WTUA 2HDOA 1A3CA 4MJXA 1EUYA 1WTAA 1VJDA 2H0QA 3E3AA 3PRYA 4DLBA 1JQBA 1ML3A 2AQKA 4RIGA 2P6RA 4GRAA 2NTEA 3E23A 3A3OA 1GZHB 2D2EA 2AOUA 4H7DA 5EMJA 3BWBA 4B3IA 5AVZA 2YX1A 3TMAA 3ENVA 5KB3A 5LYJF 2CN1A 1NOKA 2YVQA 5JJBA 1UEJA 1KK3A 1D5WA 4WK2B 4KPUA 4U7FA 4PG7A 5AXAA 3K71B 1F8XA 4O2LA 1P5HA 1V95A 3I6BA 1A8PA 2WM9B 2YASA 2HN9A 5DGTA 2DETA 3LE8A 1GG5A 4WNYA 3STTA 4DUGA 2ZYTX 4GNRA 3FTPA 5J1SB 2HUNA 3LNTA 4YK7A 2JIQA 4JJFA 3ZI4A 4GKBA 3GRPA 5K2OA 2IOHA 4W5NA 1UDCA 1M34A 2B4YA 1IZ7A 2QUZA 2HLDD 3DDOA 1UPAA 1FQJA 3C8UA 4G9EA 5JEEA 4HDSB 1NPTO 3ICCA 2Z3ZA 4WBNB 3BGIA 1KC3A 1TF2A 2BF7A 2O7NA 4Q9LA 1AX9A 1ZD5A 3ZE0B 4RTKA 1JJBA 2WJ6A 4MQ4A 4OMCA 1B0AA 1TKRA 3SJCA 1PE0A 5KREA 3Q3EA 1OBCA 2AA3A 3FZQA 2W42A 3T9BA 3HA7A 1UBGA 3P4XA 4X6UA 1V45E 1TF7A 5FP0A 4EQ6A 1NLFA 2IZ0A 4G0YA 1MJGA 3FG9A 4UVIA 2ZJFA 4CCAA 1F2UA 4HNGA 2PX8A 2DGDA 1E2UA 1XAJA 2X0FA 5BV1A 2JFBA 3K09C 3PX3A 3LQRA 2I65A 1CY7A 3P1JA 5HMMA 3PC8A 1GPMA 1Y6RA 1AXGA 1P3JA 3DDWA 3IALA 3RV4A 4E46A 4QXOA 4UTOA 1OW3B 4DABA 3RIMA 3TR5A 4YMVA 1XVUA 4UHFA 5SY6A 2Q2NA 2ZATA 1R9JA 1ZYUA 1SVSA 2G8NA 2N1BA 2W2LD 3RHZA 3SYTA 1V3QE 3EGVA 2EBHX 3I37X 5LQJA 5EWJB 5FA5A 1ZHFA 1M8PA 3UXYA 1GITA 3ET4A 3WZMA 4EHLA 2AMJA 3I72A 4BN0A 2YS7A 5E0OA 2DC1A 4PYMA 4YUZA 1J6UA 1MVLA 2LVBA 4O63O 5E7IA 4CKEA 3KYDB 1N2GA 4E30A 3QVMA 3R09A 4IICA 1MT3A 5EMLA 4OGLA 3AM4A 1ZNWA 4LJSA 2FX5A 2AC7A 1G6Q1 1L7RA 3CKMA 4AN1A 2CF6A 1Y9AA 5B7QA 3H8SA 2NQTA 2PFKA 3K6KA 3KBOA 4GM1A 2V5UA 4X97A 1O6BA 4Z99A 1ZJYA 2ZXUA 2NACA 1GPLA 2OCDA 4TV9B 4ZIRB 3DG9A 1N2CB 3PDCA 4P3YA 1XWFA 3UG7A 4BVKA 4KXQA 5JE8A 1EGMB 2FVXA 2X3YA 4LK2A 1SXJB 4F11A 2PLAA 3B9RA 1SUDA 4OXKA 4L7QA 2R7LA 1Z0IA 4PC6A 5CNMA 1M7BA 2OXRA 5AHKA 2B7BA 3J7TA 1UPUA 2BW0A 3B1YA 4ATNA 3Q6MA 3DLHA 4GT1A 1L4MA 3WLSA 2H4JA 5J4HA 1J8QA 1KL7A 2HYIC 4ZO9A 1A9QA 1VHLA 1T36B 1VL8A 1UEXC 4XSHA 3UK7A 5M29A 1XEFA 4EW3A 4J75A 4OV6B 2X2FA 1MAVA 3P9IA 1RYYA 2BEKA 3KQMA 1YS4A 4R16A 2Z56A 4BP9A 2UVPA 1XT6A 4KXYA 5EHXA 2OESA 3F9IA 4RCYA 2C7PA 3RVBA 3TZHA 3RAGA 3WB0A 1MLDA 3ZS9A 5BSEA 5JMOA 2VAMA 4YCNA 3M5PA 2ZJ0A 3L82B 3MJVA 2JCYA 1ISSA 1PK8A 2ZR7A 3CLKA 4FNOA 4J7CA 5CTJA 2GHIA 1J1IA 2FMKA 1I0ZA 5AKIA 2OBMA 4JUCA 2QWXA 4EOGA 5HZMA 1RADA 4S2UA 1OX4A 4XUCA 5CYOA 2FSUA 3ELYA 4L5YA 4HATA 3U0VA 1NHWA 3EG9A 3UMFA 4IDOA 5ER9A 1A9OA 5CFZA 4F71A 1CE8B 3NOXA 5KCMA 3C8MA 1N5LA 1MQ9A 3M3PA 3PE6A 3ADCA 4IMIB 4IJMA 1T1SA 1GKKA 1J0XO 2EQAA 1SOWA 2JVJA 3CO5A 3REFA 4JMLA 3TUJC 3WLFA 3IAHA 3HPRA 4Z7JA 4G6ZA 4JU9A 3Q3CA 1TYEB 4OM7A 1SOVA 3V9AA 1B2RA 3D4LA 4MXDA 3X2SA 2YJ3A 3STYA 3TLXA 4OHCA 4JI0B 5BNWA 4IP0A 3PEVA 2CXUA 4C7OA 3O03A 4FGJA 4RULA 1DKMA 4F0JA 1JDBB 1E3DA 4REQB 1T5DX 2E2WA 3SF8A 4ER0A 3DONA 3U6KA 1QUEA 4Q1AA 2AV6A 4M83A 1ONNA 3SE7A 3WV5A 4C0HA 4IY1A 4WZAB 4D3FA 4JELA 2YOFA 4X20A 4D4IA 1HTBA 2GFQA 2RHCA 2PDAA 2XYHA 4JLSA 3V7YA 3O4GA 4ND3A 4NENB 2F1HA 4YR9A 4PZAA 3KXKA 3AFGA 2GTPA 2XVMA 1MC5A 1DTEA 1IJFA 3E0QA 3WAKA 2AJCA 1TQHA 2JHAA 2OCAA 3NPAA 1ZJZA 4P83A 3PFCA 4BYMA 4D02A 6REQA 1OX5A 3QW4B 4HVCA 1GPJA 1NLMA 1RCFA 3U39A 4QU0A 3WV4A 1NZJA 1U9IC 3TZKA 2Q2WA 3LCUA 3KAKA 4QEDA 3EISA 4KAAA 4HB3A 1VE9A 3E9RA 3NWOA 2RK3A 4YR7A 5FOQA 1E7RA 2QJWA 3QHPA 3UT6A 1E99A 1JB1A 4YLEA 2FW6A 3F8SA 2XUQA 4QDTA 1SURA 1SKUA 2D1YA 3UY4A 3D7RA 4EUHA 5ABPA 4V2IA 4L3WA 1L4EA 1WL8A 4BB6A 5EMNA 2EFHB 2GF9A 4M0KA 1G8FA 2J9ZB 4L02A 4PTLA 2CSUA 5EUBA 5K3SA 4E6EA 5A6SB 1LDYA 1L4FA 3TTSA 2ZIGA 2REQB 4O5AA 5JDCC 1QX3A 3M5CA 3NVMB 4N1AA 4BN5A 4QQFA 2V97A 5LU8A 3PNLA 3RUEA 1RLIA 3A1UA 1Z4IA 4U7WA 2IHNA 3T3OA 1JS1X 1RP1A 3E70C 3G2HA 3HVJA 4I3GA 1BROA 4FLMA 4DREA 5J2TF 1GYQA 2PMDA 3O8QB 1QP7A 3E03A 2H9IA 2GPNA 1N77A 1VBNA 4BVJA 1WXXA 1LS1A 3DZKA 1PS9A 1Q17A 2OORC 1FMTA 1KHTA 5J4KA 5EESA 4OH7A 2HDWA 3EG5A 1UMBB 2C03A 1GA1A 3F6SA 3SVLA 3IURA 1I3LA 5CLHA 2WQ7A 1SU8A 4HN4B 2Q6VA 2O05A 1XDWA 3I0NA 1J23A 2A94A 4RKWA 1Q3TA 1R6DA 1TUBA 3L6DA 2Q5OA 2F9LA 1YGYA 4JA0A 3LWZA 1AKVA 2QD5A 2VPWA 2EATA 3I5XA 1W19A 1U4SA 5DNUA 2L0XA 4WQMA 3LFHA 5KKNB 1NVTA 1NVBA 3C43A 3KWJA 5JSYA 2PJZA 4MR9A 1EHIA 2XBUA 1Q7CA 2FFQA 3GLVA 1VLQA 2P69A 4E5UA 1V9SA 2A67A 4LYHA 4B4KA 3C3YA 5JO0A 5JSZA 4TV8B 1YIOA 2H9YA 2WYOA 4EF6A 1ML4A 2V6MA 4B34A 1OI4A 5LQDA 1XMVA 2O7VA 1XVTA 2WM3A 3V1TC 5EJ6A 3D8HA 4JBWA 4R8KA 2UYHA 3N8IA 1CR6A 2H3EA 3PENA 3MTDA 3VR5H 3X1JA 4LOAA 1DAFA 5LKAA 4HQKA 4CR6A 2NMVA 2Q2OA 3ANXA