1M2OB

Crystal structure of the sec23-sar1 complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
167
structure length
164
Chain Sequence
GKLLFLGLDNAGKTTLLHMLKNDRLATLQPTWHPTSEELAIGNIKFTTFDLGGHIQARRLWKDYFPEVNGIVFLVDAADPERFDEARVELDALFNIAELKDVPFVILGNKIDAPNAVSEAELRSALGLLNTTGIEGQRPVEVFMCSVVMRNGYLEAFQWLSQYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords protein transport protein SEC23
publication title Structure of the Sec23/24-Sar1 pre-budding complex of the COPII vesicle coat
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport/signaling protein
total genus 47
structure length 164
sequence length 167
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1m2oB00
1SHZA 4L9SA 1AS0A 4QXAA 1OXSC 5G53C 4D26A 4KYIB 3GJ5A 3CONA 5FFMA 2BM0A 1Q21A 5JI3E 2GDJA 4KSCA 3TW8B 4LJ7A 4ZCIA 2IUTA 1YQTA 4TMVA 8OHMA 4IJMA 2RCNA 4LRWA 2V9PA 3EC2A 3CBQA 3NG1A 4JJKA 4TT3A 3A1TA 2DHRA 2QI9C 2C9CA 2WOJA 4EPTA 1FUKA 2A7QA 1OB2A 4PC3A 1PVOA 1E9BA 1N6RA 1KI1A 1VG8A 3ADCA 2WTUA 4KHZA 1BS1A 3I8SA 4OL0A 1RIFA 5DI9A 5JCPA 1XCPA 4U02A 1VIAA 2W00A 1IONA 2FZ4A 3EASA 4LJ9A 4XTCS 2ODWA 3QVVA 4HB0A 1Z06A 2P0EA 2GILA 3UMRA 3I32A 1G3QA 1KZ7B 5TDHA 4Z1MD 5EQTA 2GK7A 5EXPA 1GNQA 4KLZA 4JKIA 1TAGA 1G8FA 2G77B 1W0KD 3QXXA 1KO5A 2I3BA 3RS4A 5DNYB 1MOZA 4UNSA 5FBVB 1OIXA 3HR7A 4NCJA 1E94E 1X86B 2FSGA 3K0FA 5J4LA 1T5LA 2J9RA 3VKHA 1OJLA 5KDLA 4MYCA 5AUOB 5AWFC 3B1WA 1E69A 2G6BA 3B60A 3OIVA 2QT1A 1UKYA 1VHLA 3NVAA 4DLSA 2OLKA 4H1VA 5CIWA 1HE1C 3RAPR 1PUJA 4JL8A 1GNRA 2ZI3A 4D4KA 2FF7A 4BZXA 2W0SA 2G83A 2ZRKA 1SXJD 1TMKA 2CJWB 2D06A 2IYQA 1TQ2A 2QMUA 2PT5A 1E0SA 4RFVA 5TMPA 4U5XA 4DLYA 5JSZB 1E9CA 2PZFA 3C16C 4I1OA 3LO5A 4LY6A 2WAYA 4WVFA 3GLGE 4F4IA 4AY2A 1W4RA 4ACBA 2R2AA 1U99A 2C04A 2ZVPX 2FDCA 2LKDA 1JBKA 4RKFA 1L4YA 2RGXA 3CLVA 1M6NA 4B74A 1XEFA 1CS4C 3V4FA 2VP5A 3NEJA 1E98A 1UPTA 3THXB 3QXCA 3A36A 3E2IA 4BRWA 2H8KA 4UNRA 2B7BA 2HYIC 2ZSEA 4JKYA 2JIZA 3H86A 2IYWA 5HTKA 1YZKA 3PUYA 3G5UA 3F0TA 4DXAA 1Y63A 1TQ4A 1ZNWA 2J41A 3KTAB 4MRRA 3F5FA 4YXWA 5FUWA 1EG7A 3E1SA 3B9PA 1XMSA 5FPHA 1T0JB 3VNUA 1HY3A 4JBXA 1N6KA 3FFBA 3SC3A 3Q85A 2ZJYA 3P32A 1KMHA 4Q18A 4QBHA 2OBNA 5IT5A 1KI6A 1EK0A 4QNRA 2QP4A 3UMSA 1JR3D 4IFEA 1S4QA 4Q4AB 4Z8XA 5JRJA 2UVQA 3QUSA 1ZD9A 1G6OA 3KKMA 1KDTA 4D2IA 1CJMA 3NDPA 3TIFA 1LVGA 3BORA 1JQLB 5E3HA 4FWTA 3B1YA 3IGFA 3DHWC 1J8MF 1GOTA 1M2OB 2IYUA 2AWNA 5FBQB 1FUUA 2A5FA 4MDFA 1BO6A 4BASA 3LD9A 2IS2A 1T6NA 3Q9LA 4PSAA 4EDHA 4ZCMA 2NPIA 1MABB 3PITA 2BBTA 3QKSB 4Z1MA 2G1KA 1N6HA 3IO3A 4B33A 3U4QA 1T91A 1RYFA 2LKCA 3PR1A 4PHTA 3FMIA 1QHYA 1FTNA 4GZMA 2MSEB 2GVZC 1W0KA 3A4NA 2ZJZA 3AF3A 3C8UA 2P65A 4JLMA 4QHTA 2O5VA 2HYDA 1VIYA 1T9HA 2CCGA 4Q02A 2BMEA 2OFWA 1XD8A 4CEIB 4GI7A 4GOJA 2H17A 4WZAE 1G19A 4LYHA 2ZR9A 4FMCF 2EFEB 5CM8B 4KBGA 1R2QA 2YC2C 2FSIA 4B35A 3CRRA 3CO5A 3W5IA 5A5GA 3AV0B 3C41J 4NE2A 1G21E 3H4MA 4BWYA 1N0VC 2CL7X 2WJGA 2YWGA 1SXJA 4JLPA 2OCPA 1F2TB 1P6XA 1E0KA 3KFVA 3OESA 2OZEA 3PENA 4JMPA 4XH9B 5E7JA 4BECA 1ZUNB 3BS4A 4B2LA 4Q5IA 2UZIR 4IFBA 3BBPA 3DM9B 1YZQA 4TQ9A 2VSFA 1KNXA 4LJ4A 3CNLA 3BFXA 3LNCA 3QKSA 4GNKA 4DHEA 1JQJC 1JJVA 1XTRA 2PL3A 4V0KA 2FMXA 2PEZA 1JPJA 2UZ3A 4LI0A 2IXFA 1UDWA 1VG0B 2FV8A 4ESHA 3AVTA 1EGAA 4V03A 2RGEA 2ORVA 3KFXA 4I4LA 1G7TA 5B58C 1S0UA 1G4AE 2F1HA 4PXAA 4ZKEA 4Q4JB 2QQ0A 4UJ3A 3VKWA 2NIPA 1F5NA 2C9OA 2ZU0C 4KYUA 4PZZA 3TMKA 2J0VA 4B43A 2XEXA 2BDTA 3IIJA 3KXKA 2IEYA 3CH5A 2B8WA 4RD6A 2MMCA 1R0ZA 3U5ZB 1LNZA 2GKSA 2ZRJA 1Q22A 1ZVQA 4JVMA 4ARZB 3I4LA 3G82C 4KJZA 4Q7MB 2J0UA 3K0EA 3AF0A 1QZXA 3RS2A 4DLTA 3GLFB 1A5TA 3I8XA 4Y0AA 2QMHA 1QVRA 4BLTA 1KNQA 3C4JA 4PPQA 4OHVA 3NC1C 3V4RA 5KDDA 1CKEA 4V0OA 2ZITA 1TADA 1JR3A 1FL9A 2EWWA 2GCOA 3EA0A 4RZ3A 1NVWQ 2Q9BA 4FXPA 4PX9A 1D5CA 1Z6GA 1N3BA 1P9NA 1P9RA 5AJVB 2O8DB 1P72A 3RC3A 3R20A 2WAXA 4OYHA 3ICEA 5B30A 4IDOA 4CIDA 2FEMA 1TNDA 3W9YA 5DN6D 1G8GA 1UEIA 1F2UB 2V7QD 2A2ZA 5L3RA 5JZVA 4NBSA 4I81A 3BD9A 4Q4JA 2QE7D 2VP2A 1T8TA 1ELOA 3K0AB 1TQ6A 5D3MB 1AS2A 2VQSA 4TMTA 2IXEA 4MYTA 1XZQA 4MGZR 3REFA 5DHAA 4LV6A 1W5TA 4ARZA 1KI8A 2H92A 4TL6A 1E9FA 2OCAA 4BLSA 2VHCA 1EWQA 2GJSA 1XXHE 1MR3F 1DADA 2ZS7A 2RH5A 1R5OA 2Q6TA 3TE6A 4NCIA 1KO1A 1PJRA 1XCMA 2D2FA 3PVSA 4HDQB 3KL4A 2YWFA 1GDDA 1YJ5A 1NP6A 1AS3A 4JT2A 3WHKA 2WOOA 3AKDA 2YZ2A 4URZR 1E9DA 3O8DA 4HZIA 5IHPA 4FN5A 3AVWA 1WBBA 3TLXA 2DCUA 2H1LA 2O8DA 4FMDF 1G3RA 2FN4A 2X19A 4ZCLA 2YYZA 4BFZA 1D2MA 4Z8YA 2JLUA 4C0QC 3NBFA 1R4AA 2AL7A 5KNDA 2QTVB 3SS8A 4X8LA 3GLHB 3TSOA 5FH9A 1D9ZA 2ANCA 2WBLC 4QM7A 2GEUA 2QT0A 3MWYW 5TXGA 4DLZA 4P33A 4AKEA 5LB4A 4LBWA 2V1XA 3K9NA 1CLUA 1WE2A 4TLDA 4DB4A 3KKNA 1E2KA 2GHIA 2HF9A 4LJAA 1XFAA 4F4JA 3R9WA 1NVVR 3CH4B 4DUGD 1UM8A 1ZCAA 2CDNA 5KNCA 2CVHA 4OK6A 2D4HA 4NH0A 4PZYA 1ZNYA 4G1UC 2Z4SA 3NEYA 5FUYA 3CR8A 4FD2A 3RANA 3CRW1 4A2PA 4QOSA 1XMJA 5GJBA 1VCNA 4H1UA 3K9HA 5BQ5A 1N6PA 3NC0C 2R8RA 4TYPA 1MT0A 3TH5A 1AZTA 1FQKA 1NVXQ 4DBLC 2YKGA 1PZNA 2A5DA 1CEEA 3U7FB 2VP4A 3P20A 1IM2A 5F2EA 1YZTA 4NYMQ 2E87A 2FJUA 2GEVA 2WWHA 2F1IA 5AUQA 5AK0A 3EC1A 4V0ME 1NKTA 5P21A 3WY9A 4KFUA 1XMVA 3W6NA 4K46A 3WMEA 4TN1A 5J4HA 3EG5A 1E99A 1GRQA 3P26A 4LPKA 5E7IA 3FHOA 3UKDA 1D2EA 5FPKA 1L2TA 4X8MA 1P75A 1WRBA 4C7OB 5B57C 1EFRD 3CNNA 4JLAA 3EWAA 2GA8A 2IC5A 4R7ZA 5A0FA 3WYFA 4IOKA 2QBYA 1VECA 5CJ2A 6Q21A 2O8EB 5DN6A 5C4GB 2AFHE 2AX4A 2V7QA 3X1ZA 1IN6A 5FPYA 3AF4A 1OE0A 4D0GA 3I5YA 1OV4A 4LWZA 2QE7A 3CZPA 4JSYA 4URUR 4Q00A 3RNLA 3ZS9A 3SI7A 2ZI6A 2QQEA 1GUAA 1XD9A 1ZAKA 5JBQA 2BIFA 2F1JA 2CHQA 2DFTA 5FTNA 3BOSA 5AUNB 3X1YA 4C0AC 2GBLC 5JLJA 1BMFD 4KV9A 1GFIA 2QGNA 4JLDA 3K0CC 3OEED 4P0TA 4PC2A 1ZINA 4U00A 1AKEA 2GRJA 2QMEA 2UKDA 2ZANA 2P2LA 1Q1BA 4KAXA 4WOPA 4OK5A 1LS1A 2ANBA 2W6ID 3E5HA 4YQFA 1SXJC 3RSOA 2RGGA 3MMPA 1LV7A 5EE3A 2ZROA 1LW7A 2OE2A 2NTYC 1JB1A 1XP8A 1E4VA 4PO1A 2DWPA 2BHRA 4JIMA 4Q9KA 1NKSA 2OCYC 3I5XA 4LDJA 1E2EA 3KKQA 2J0SA 2DBYA 3A1VA 2C03A 5G3ZA 1KSGA 1E2LA 3SU8A 1QHNA 1OHHD 1WMSA 1FNMA 5BW8A 2IYLD 4UXIA 3RC8A 4FINA 2HT6A 1FTSA 2BMDA 3HWSA 4MYHA 3AKCA 4F38A 2IXGA 4QGAA 3TNFA 3VHLB 3GLIB 5C1BA 1V43A 1RJ9B 1E6CA 4LYJA 4DUGA 2PMKA 421PA 2FEOA 1E9EA 3KJIA 2XXAB 1W4CA 2ZPTX 3A1WA 1G7CA 4US0R 2I1QA 4OHXA 1NJGA 3EAQA 3GLGA 2PCJA 1CP2A 3GPLA 4JT4A 3TR0A 2A3RA 2WSSD 4ITRC 1U9IA 1UADA 2BV3A 4M9XA 2JEOA 3NBZC 1YRBA 1SQ5A 2N46A 1VPLA 2KBFA 4BQSA 2J7PD 1DTSA 1JNYA 4Q03A 4Q4HA 5HPYB 3D6TB 2O8FA 1SKYB 2OXRA 2QSYA 4DLRA 5L8VA 2PX3A 4EKDA 3RS0A 1J99A 2P6NA 4C0LA 2FH5B 1OXXK 1JR6A 2O8CB 3P27A 5KPDA 4LJ6A 2JASA 4LHYA 5EE9A 3ONWA 3I62A 2QUZA 3B9QA 3I73A 3IIMA 2QMOA 1OH6A 1FOEB 4WW0A 4RZ2A 3X1WA 3TUZC 1G5TA 1A2KC 2CL0X 2F3TA 2XTZA 4HAUA 2QU8A 3PQCA 4BFVA 1CR1A 1DS6A 5DO9A 2ZXUA 5CYOA 5KU1A 1EFRA 1ZRHA 1P2VA 1EFTA 2H5EA 3DMDA 3EPLA 3HU2A 3DKPA 4R2IA 4DIEA 4W9MC 2P67A 4I1UA 3LLUA 3X1XA 2DFLA 1J8YF 1KI7A 4LJYA 3UPUA 1W7AA 3EZ2A 3GFTA 5D3QA 1X8LA 2VA8A 3PJRA 3T1OA 3ASZA 1FMLA 4BFXA 3EX7C 1WXQA 4M53A 1GITA 5E7MA 2W2VA 2O0JA 4PQFA 3QXSA 2ZAMA 2FFBA 2WWGA 2D3WA 1P73A 2R65A 1BMFA 4FCWA 4LC0A 1S9DA 1VCIA 3OEEA 4DSNA 5DI3B 1MO4A 2WZQA 2Q3FA 4EPRA 2IYRA 4IDQA 1GKYA 2ZRAA 3EWSA 4BE7B 3LVQE 2W6IA 1E0JA 2GAOA 2A78A 4EIWA 5EJEA 3AVYA 2BCGY 4ZO4A 1U0JA 3UANA 1EESA 1EFUA 1MV5A 4GOKA 1E2NA 4URYR 4QGHA 2PMDA 4L8GA 1ZNZA 3QKRB 4GDFA 3CF2A 3RRZA 1IY2A 1HV8A 4YLGA 1XEWX 3C5HA 4ZKDA 1ZJ6A 1AA9A 4J0QA 4HUQB 2P3SA 1GIAA 4BEBA 2QL6A 5HR5A 2OLJA 2ONKA 4R9UC 4UQOA 5EUMA 5FOUA 1OHHA 1XDBA 4OJKA 4NYIR 1NIJA 4WIAA 3KB1A 4BZQA 1TU4A 4IRUB 3U6KA 4A82A 4F7WA 4F4CA 4IOLA 3VAAA 1XPRA 1CJKC 3RS7A 4W5HA 1K8RA 3LFUA 2JLSA 4QHSA 1K5GA 3ZQ6A 1Q20A 2NG1A 5KNBA 4KLNA 4LJ5A 5SZJA 2IHYA 2WHXA 3U7HB 3SEAA 2NO7A 1OF1A 3CB4A 2WSSA 3T1QA 4CF7A 1N25A 3TUIC 3AF1A 1X8JA 3EZ9A 1D8TA 1DEKA 2J7PA 2ZE6A 3FB4A 4M2LA 5KPJA 5KOYA 2XGJA 1J2JA 5FR1A 3L43A 4TZ0A 2FPMA 2C78A 2RGDA 3ND8A 4HZUA 4Q1DA 3SYKA 2ZM5A 3K9GA 3RRYA 1JEDA 4RD2A 3RDPA 2QNRA 1W1WA 4PQYA 4TTRA 4RKEA 4E22A 2ZRNA 1NN3A 4DEYA 1JJ7A 4AIIA 2HLDD 2XZPA 4IDPA 4GP6A 3GP8A 1OPXA 3HP1A 3EA5A 3W3ZB 2R62A 4B3XA 1EWRA 3ZD6A 4NTZA 2KB0A 3VFDA 4A8JA 4IXMA 4ASUD 1I2DA 1O87A 3RSLA 4ZI3A 3SE0A 1T3SA 1X6VA 4QBIA 4XD7D 3U44A 4GP7A 2MSDB 4WAUA 1TQDA 3TQCA 4XVQA 1XZPA 4A4DA 1MRSA 1KSHA 4M1MA 4CEJA 2J45A 1Z47A 2G0NA 3UG7A 3K0FB 4MKHA 1TEXA 2C2HA 4AKIA 4Q1EA 3JVUA 4PHFA 4BLOA 2EYQA 3B1ZA 1RRFA 1C1YA 2JLRA 1KJWA 3T61A 4EPVA 4FMCB 1KKLA 2N42A 1E2MA 2B92A 1NBME 1VYTA 1Q0UA 4LHVA 3PG5A 3TRFA 3WNCA 3UK6A 3HYTA 2D62A 1NN5A 1BH2A 4LUCA 5GJVC 2GXQA 2FSHA 3P4YA 2ZI4A 4TLCA 2Q21A 3EPJA 1W36D 1GRNA 2C96A 2QN6A 4O2RA 1XWIA 1OFHA 4QL3A 4TYNA 5JHHB 2V4ZA 4C3ZA 4I99A 3GCGA 3EIQA 2ZJ5A 4GOXA 2VH5R 5AR1A 1XXHA 1Z0IA 1F48A 1E9SA 1VKJA 4C2UA 1E9AA 4B71A 3T5GA 5CDFE 1KMQA 4M0LA 1G9XA 3LBHA 5KHOC 1W44A 2QM8A 3FDIA 3MWKA 3VQTA 1UBGA 2ZRIA 3FMFA 3QBTA 2A5YB 3ETLA 3S1AA 2AN9A 2C9YA 4RD3A 2W2TA 2D7CA 2C77A 3MWJA 2FA9A 4JYBA 2IW3A 3REGA 2PCLA 1XEXA 3L0OA 4LOAA 3SYNA 4N1AA 3IEVA 3QNUA 3CUEF 2XTMA 3IILA 5JWRA 3OF5A 3B1VA 4M1OA 2YOHA 3ADBA 2WPDD 2EYUA 1EX6A 5KDOA 1U9IC 2J46A 3QKTA 1LY1A 1XTJA 2AXPA 1VG1A 2BM1A 2IT1A 1N6IA 3BAFA 2IWHA 2IS1A 2WKQA 4US1R 1U0LA 4CGZA 1SULA 4M9QA 1KMHB 2C8VA 2V54A 1HEIA 1KI6B 3A58B 2HT1A 4ZPXA 3GJ8A 1MRNA 4ACAA 1HQCA 3PIRA 3WMGA 1W2HA 4LV5B 2NO9A 2PLFA 1CU1A 2GK6A 4DC9A 1YR7A 2R6AA 4Q1BA 2OHFA 5FUXA 4IEIA 2JJ1D 2ZAOA 5HE9A 2QSZA 1JAHA 3NDBB 2AXNA 4AWXA 2W83A 3CR7A 1FZQA 2YHSA 4KFRA 5EZ6B 2EQBA 5HCIA 4B3BA 3BK7A 2PH1A 1QHGA 2X2FA 3KQHA 2V3CC 3A1SA 3QPWA 4Q01A 1W5SA 4P32A 4TWZA 1JAIA 2CBZA 1ZU5A 2HLDA 2IBMA 2ODBA 1PLJA 4NHOA 4PC1A 2R6DA 1TTTA 1KK3A 1UBEA 3TJZA 1ZC4A 1OIWA 2BVNA 5HKKD 3SHFA 3U4QB 3DKVA 3AQ4A 2OO7A 3Q8XB 4MRNA 4ASUA 1E2GA 1CULC 4M9SA 1XPOA 1DAIA 3IQXA 4JVLA 4XD7A 1OYYA 1U8YA 4B47A 1WDTA 1MO5A 1HH4A 2A9KA 1FP6A 1E2IA 3RRMA 3WP0A 3N70A 4B48A 1H65A 1U2RA 3B13B 3BRWD 2WSMA 2ZRBA 4ZIRA 1M7BA 1W4BA 4MUAA 4XTRA 3HJNA 1GWNA 1SVKA 2ZS8A 5JJKA 2OAQ1 2JATA 3VU9A 2GZHA 1GAJA 3LAWA 1T3LA 5DYIA 2V1UA 3KKOA 4L4UA 3JZMA 1PLKA 1SXJB 2GTPA 3WYAA 1ANKA 2ZUDA 3GLIE 3FGNA 3GJ4A 4RD1A 1NL3A 1Z5ZA 2WJIA 1B23P 3IDQA 4M21A 2QEQA 1DG1G 721PA 2KI5A 4NP6A 4EFNA 4LHXA 3IBYA 4LV8B 1ZBDA 2RGCA 4C30A 1BKDR 4BPBA 3FHTA 2D2EA 2O8BA 4TSFD 3THWA 3MG9A 1IY1A 4A0HA 4KVGA 1G4UR 2QM7A 2L0XA 3LW8A 4MITA 2E9SA 3U3KA 1GG2A 5EP4A 4ZV4A 2WWXA 1SKQA 5CIQA 5DIFA 5EP2A 3K70D 2ZTSA 4UJ5A 2BWJA 1E2QA 1QHHA 1KK2A 2GBLA 3MAAC 2F9MA 3LQQA 2ZYUX 1KI9A 2JLQA 3K0CA 2WPDA 1DG3A 2HF8A 1GM5A 3PUWA 3Q3JB 1I4DD 1IJEA 2J0UB 2IYTA 1M7GA 4LCBA 4M1WA 1KI3A 3F8TA 3I92A 4KVAA 3GJXC 1Q57A 1S3SA 4RD0A 3RS5A 3BWDD 2FU5C 1G64A 3L0PA 2HJVA 3PXGA 4F91B 2ZREA 3FTQA 4B3FX 4OK3A 2HCJB 3R9XA 5HCNA 2GCOB 4D4JA 1YR8A 1SVWA 1GRRA 5JEDA 2YC4C 3W6OA 3U3JA 1Z22A 3ZGXA 3SJZA 3FFAA 2JJ1A 3FKSD 4OI0A 2ORWA 1DE0A 2A5JA 4ZI2A 1OFTA 3K8YA 2BKEA 3M0EA 2EWVA 5FBWB 2QY9A 1E32A 4A8JC 3DZ8A 2BBOA 3EXAA 2FGKA 1OXVA 1XF9A 1TX4B 3UATA 4C4PA 4MYUA 2GZAA 3MWLA 1GL9B 2DR3A 2OXCA 2V6IA 5HKKA 2ZI9A 3VR2A 3KQLA 4A92A 3UMFA 2VSOA 5FPSA 1F3OA 3W8RA 1FMJA 4D81A 4PSKA 1NMZA 1KJYA 1P60A 5HZKA 4NCNA 4OHZA 3VX4A 2CHVA 1SHKA 3D7MA 4V0NA 1XRJA 2ERXA 3BH7A 1W47A 4LJ8A 2ZJ2A 1RE0A 5H1YA 2CXXA 1EXMA 3CF6R 1JXMA 3ECCA 3A37A 1VYVA 4HI0E 3PUVA 4L9WA 2X77A 3KQUA 3K0SA 3QI2A 4GPTA 2OFXA 1IY0A 4TLBA 3BFVA 4NMMA 3T15A 4QJ3A 3QY0A 1TU3A 5FL7D 2ATVA 4A2QA 3IPXA 1Z0DA 2IHBA 4ON9A 1ZD8A 2NO0A 3PV0A 3RS3A 4IKEA 1RFLA 1UKZA 2G3YA 1ZC3A 3B7GA 3SYLA 1Z6YA 2O0KA 2R6FA 4KBFA 1NBMD 2OV2A 3PUZA 3OZXA 2IYVA 1DARA 3VR3A 5C46F 2ZJBA 3UG6A 3H84A 1HURA 3PCRB 4QNMA 4TSFA 5JEEA 2QTHA 4S2EA 4V02A 1DELA 1OLOA 2WWIA 4JLOA 3H2YA 5LPNA 1XJQA 1AJEA 2BBWA 2ODNA 4R2HA 2BJVA 1KJZA 1VMAA 3OIWA 4A0RA 4QKQA 1Q3HA 1XJCA 2XJ4A 1CR4A 3AF2A 2H57A 1TF7A 2F43A 2CLDX 1RKBA 1IXSB 4ABYA 2FWRA 4R71A 1W2GA 4HSEA 5KUTA 2XSZD 1ESMA 1TL7C 4KU4A 2Z83A 4W7SA 1US8A 3MJRA 2WJHA 2XAUA 1CRPA 3KDSE 2OFOA 4P4TA 4ERNA 4O2LA 3Q5DA 1M34E 1E9RA 2RGBA 2N1BA 2WWWA 3T1TA 2QTFA 4A6XA 1KY3A 4II7A 5EXXA 2NO6A 3CKLA 2QRZA 3CRVA 3KXIA 3O8RA 2V55B 1TEVA 2GNOA 2VHJA 1Z2CA 2Z4RA 4NCHA 2HXSA 1R8SA 5BN4A 1XX6A 2Z5FA 1L7VC 1KSFX 3GEIA 5FBRB 1Z07A 2AKYA 5L3SA 2OEPA 1VTKA 2HV8A 1GNPA 4EJSA 4AYXA 4P4UA 1P7CA 3FWYA 2JLZA 1NVUQ 3FKSA 2VPPA 3T06B 2ZR0A 2XTNA 2ZRFA 1Z0KA 3OAAD 1B0UA 5GJWC 2QBYB 3MSXA 3FKQA 3L2OB 2W0MA 5J5CA 5EUQB 5HZHA 5FOTA 5CITA 1QHXA 1KO4A 1QBKC 1OFIA 3GJ3A 3DEFA 3IQWA 4B75A 1H8ED 1U0HC 2PT7A 4QRHA 4N0EA 4NU0A 2FPKA 3CF0A 1KOFA 4IVRA 3TW4A 4XWKA 1HUQA 3AP1A 1ZUIA 3DMNA 2IK8A 2IYYA 1KO7A 4D25A 4AC9A 2FSFA 1ESNA 2ZJAA 4HB4A 5CM9C 4DRZA 4LBYA 1M8PA 3QBVA 2ZRHA 1XTSA 3OIYA 3ZVMA 3ZZTA 5DGXA 1N6OA 2V8OA 3SJBA 1ZYUA 5DISB 2D74A 4AG5A 1RRPA 1NLYA 1BOFA 4IOJA 4PAMA 5BWMA 4A6PA 3L82B 3BJIC 1KDOA 3A8TA 5F98A 1QHSA 2HEIA 2XZLA 3NBXX 1KDPA 1R6BX 3QQ5A 4M1YA 4D0NA 1XPUA 4IVPA 2LCFA 1XD2B 4G3XA 3WRYC 1W36C 1OKKD 5FI1B 4M1TA 4TMXA 5JFGA 3W8NA 1VG9B 4HAYA 4P4SA 4PFSA 4O25A 5FL7A 1GZSA 4B32A 4P3YA 4TTPA 1ZM3A 2ZE5A 4JYCA 3E70C 3QF4A 4TTQA 5CK5A 4XWAA 1U81A 3WYGA 5K8TA 3Q7QA 4BFSA 1K6MA 3AVUA 4EQ6A 3V00A 5BN5A 3BB4A 1R0YA 1NBMA 2YJTD 2K5UA 2XITA 2FFAA 3CM0A 4OKSA 1NMYA 1J90A 1LTQA 1G20E 1NG1A 4RCYA 5A4JA 4MKFA 5J40A 1YR9A 3IIKA 4GFDA 4DDWA 1Z83A 3GLGB 3NXSA 2RGNA 1GILA 4YMWA 3M1IA 4OQNA 3FE2A 4RFSA 2GXUA 5JWOA 1G3MA 1NN1A 3OFND 5L3QB 2NQ2C 3LVRE 2CL6X 3K09A 1VDZA 2NPFA 5CDFA 2XSZA 2KSQA 2PJRA 2ZE7A 1ONBA 2PZGA 1Q3TA 3JZAA 1U90A 2GXSA 4Q4HB 1T3HA 1I2MA 1DVRA 3TVTA 1II0A 2O8FB 1KY2A 1XD2A 3QPUA 3CWQA 1U8AA 4A1FA 1RYHA 1WA5A 4M1KA 3RABA 2YWHA 1AM4D 3T1VA 4YMVA 2JLWA 3VX3A 1P61B 1AK2A 2X2EA 1VHTA 2Z6VA 4TMZA 3CRMA 2FE4A 2SHKA 3IPYA 2NO1A 3GJ6A 4MGKR 3RVBA 1QVAA 2OAP1 3VR4A 5J47A 1C4OA 1G7SA 1YR6A 1MKYA 1Z63A 1A4RA 2BOVA 3ZZUA 4L5BA 5DSZA 1P2TA 4AKGA 2QP9X 1P2UA 1DO0A 1Z0FA 4I1VA 2PX0A 4DLVA 3IUYA 2J0QA 3SN6A 1YZLA 3L0IB 3OAAA 5TY0A 2IEZA 5TVKA 1G41A 4CVNA 1AIPA 4PHHA 2GJ8A 1U94A 3AVVA 3ZJYA 4RJLA 1XJ0A 3WRXC 3AM1A 1XBTA 3AGPA 3D3QA 3QG1A 5L3QA 2P5SA 2ZYVX 1H8EA 3AGQA 1ZIPA 3ND9A 1QDEA 2YVUA 4A2WA 4BGDA 1LF0A 3R7WA 1OH8A 3NH9A 1G291 3MLEA 2A30A 4D6PA 1KO8A 4G5RA 4RZXA 3ZD7A 2GETA 2OM2A 3GFPA 2DFNA 5KYKA 2ZJOA 2IYXA 4B3DA 4NYIQ 3B78A 2CEAA 5K8IA 2IYZA 1T0HB 4CRWB 1KI4A 4N3NA 2J59A 3LXRA 4JLKA 1R5BA 4OQXA 4HUTA 1NJFA 2A5GA 3EZ7A 1V5WA 2R9VA 4FCVA 2WMNB 3TVDA 3LWNA 3M4YA 2FOLA 3T35A 1P2SA 3DL0A 4JVNA 2AD1A 2DB3A 4H9GA 5JS8A 1OKKA 4RD4A 1DO2A 4HLQB 2RB4A 1G16A 2W58A 4IOMA 1RC8A 4YONB 4GT1A 3DM5A 2ECKA 2H16A 2OBMA 4DT1A 1COWD 2W6JD 2JLYA 3EARA 4X8HA 4GZLA 1NLFA 2JA1A 3KJHA 3U7EB 2G9NA 4EFLA 4WXRA 1DPFA 1R10A 1E3MA 2Z0MA 2VHQA 3WBJA 4UNPA 5SZIA 3HPQA 2AR7A 4TQUS 4XSGA 3CW2A 4V0LA 2J1LA 5J4YA 2GF9A 3K70C 2H18A 4NDZA 3CX8A 4NYJQ 3SZRA 3R8FA 4XWOA 3CPJB 1OYWA 1W0JD 3NTUA 1OSNA 1FW6A 4MDEA 3LLMA 2GJ9A 5J4VA 2WICA 3OFNA 4YC7A 1W48A 1CR2A 2KBEA 1IBRA 3GFOA 1E2JA 1XEWY 2R6CA 2BC9A 4BFUA 3L0SA 1XMIA 1OIVA 1VYUA 4HZUB 5J4KA 4A9AA 2F6RA 4TQAA 2RHDA 3C14C 2ZSFA 1UJ2A 4MKGA 1E96A 1Z2AA 3VTKA 1D9XA 3IKJA 1EFCA 5B2ZA 4EUNA 5JWHA 4EJSC 1E1QD 4MGIR 5DYGA 2ERYA 1PV4A 2DWOA 2REXB 3ZH9B 1UBCA 1R7RA 3GLFE 2JJ2D 5CK4A 3SBEA 4A8JB 2CK3D 2FPLA 4OI1A 1KAOA 3D31A 2PLRA 3SQWA 1XNJA 3A1UA 4XIGS 3U44B 2WKPA 3NH6A 5LDDC 2B21A 5DH9A 4C9BA 4PHGA 4CEJB 4EFMA 3QOFA 4HB2A 1XTIA 3ZVRA 4EPWA 5JI2E 2FZLA 5FOXA 3KQNA 2BEJA 3TKLA 1M74A 2DFKB 2I4IA 2QAGA 1EFHA 4HAVA 2ONJA 5IF9A 4HAXA 4B2IA 1II9A 2AHOA 1A1VA 2EFCB 5AJYA 2HDNB 2HXYA 5L3VA 2IF0A 3QG5A 4TZ6A 1Z0JA 3W6PA 1P9WA 3NBYC 3LBIA 3NIBA 5FOSA 3NWJA 3TAUA 2QORA 1RW4A 3C7KA 5CJPA 4CW7A 3OEHD 3TK1A 4AURA 5FUVA 5AJZA 1XXHB 2WJVA 3FPAA 3FYHA 4QHYA 1S1MA 4BEJA 1CBUA 1ZM7A 4D0LB 5GADl 3EPKA 1GSIA 3VKGA 3KZ1E 1N5LA 3FMPB 1COWA 2W6JA 4OQMA 4Y0VA 3S1AB 4HLUA 4QC2A 3B5JA 3OIUA 2EVWX 3LV8A 5FR2A 2QPTA 4JVSB 2FX3A 1XEXB 1O3YA 1OB5A 2WIAA 2Q3HA 3PUXA 2VP0A 4A15A 2RGNC 1HE8B 3DPUA 2HJGA 2GAAA 3KKPA 4BUJA 4YMTA 5H70A 5FTLA 1YVDA 4KITB 3U2QA 3GLHE 3PEWA 2BEKA 4PC7A 1E79D 5C4MA 4F93B 2JGNA 3K09C 5KSYA 1MO6A 3VR6A 3UWOA 2REBA 1AKYA 3MD0A 1W0JA 2BJWA 3L8YA 2CE2X 3SOPA 3KUCA 2XZOA 1YU9A 1CJTC 1LS6A 1S9HA 2C98A 4TL8A 1XU4A 2TMKA 3ZQJA 1UKVY 2QPAA 2B8TA 4JBYA 1QG2A 2NZJA 4DLUA 5F3WB 4DLXA 3IBGA 4BFTA 3HU3A 2VF7A 1KKMA 2JDID 2Q3MA 4KFTA 1E2PA 3FVQA 2WWYA 2R6GA 3N2IA 2ZSDA 4PQRA 5ANRB 2J7KA 2C5LA 2WIBA 2V6JA 3P4XA 1PLLA 2OILA 4QBFA 4RZUA 3X2SA 3HR8A 2ZUBA 2ZJ8A 1E1QA 3VR1A 4CT5A 2ZRLA 1QF9A 3IHWA 2RAPA 3R9IA 3SJAA 3ZZ0A 4B6FA 2AD5A 1G7RA 1J70A 3MJHA 2D7DA 2GF0A 1FX0A 2JJ2A 4JL6A 1S96A 2CK3A 3LBNA 3SFZA 1IN8A 1N2CE 5HE8A 4R98A 2F3RA 3QSYA 2W2XA 3B6EA 3VNVA 5EXSA 1IHUA 4K81B 4XVUA 5C2JB 4C0HA 1X1RA 1XTQA 4D4MA 1G5PA 3B8HA 4DSOA 4DDVA 3QIAA 2IUSA 1RRGA 2FFQA 4P31A 4QGGA 2ZIAA 2IF2A 4ZIRB 4RCZA 2Z43A 1YE8A 4FIDA 521PA 2OSBA 3BE4A 3Q7PA 4GRAA 2GCNA 1FNNA 4DWJA 1OH7A 1IJFA 3HDTA 3IO5A 1CJUC 4B44A 4DCVA 3VU9B 3L8ZA 4CZ2A 2CNWD 1IXZA 1GKUB 3EW9A 2RGAA 2ZI7A 4US2R 2OG2A 3AVPA 1P5ZB 4OI2A 1CR0A 4MH0R 4KCGA 5KSZA 3ICQB 4L16A 4QBGB 1S8FA 1ETUA 3FOZA 1JEEA 1II8B 1W36B 1Q1ZA 1Z6AA 1HTWA 4Q9LA 1I4LD 3LW7A 3QXHA 4BZPA 2I1VB 2KJQA 4L15A 5BXQC 4LC1A 5AJXA 3OEHA 2NMVA 2O8BB 3U3OA 1XCGB 4M4SA 4OQLA 5LD2C 3THWB 1UFQA 1VCOA 2IS4A 2QAJA 1SVMA 4V0MA 3ZLJA 4PO9A 4D80A 2ZRMA 4BFYA 5CYPA 1DOAA 1D2NA 4KSBA 4CYMA 1VCMA 1N6NA 3ZIAD 4GL2A 2QG6A 4LHWA 4TYWA 3AUYA 4MRVA 1SGWA 4MA4A 2QZ4A 1JI0A 4C0JA 5C18A 1QHHB 1NG9A 1QG4A 4I1SA 1CTQA 1K5DA 4UXHA 4EPYA 2YOGA 1KI2A 2F7SA 2HUPA 4MQBA 5GVSA 1Z6XA 2GESA 1E79A 3ADKA 3EZFA 4K8OA 4Z51A 4Q9IA 3QENA 4HB3A 4C0BA 4F92B 4OBEA 4FMDB 2CJWA 2AFIE 1E1RD 5FBLB 1II8A 5JSZA 4HAZA 1G8HA 1DAEA 3J81k 4QGFA 1RRCA 3LY5A 4MRPA 4YMSA 1S1CA 3ZDQA 5JMTA 4HLDA 2DPXA 4Q9JA 5KSOA 3HPRA 5KTYA 4JL5A 1N6LA 2GXAA 2JDIA 4WA7A 3AVXA 3ZVLA 2X8AA 4B3CA 3QF7A 1JECA 3THXA 2QGZA 3I3SR 4URWR 1IXRC 2OUKA 2OT3B 1SKYE 2EU8A 4Q1FA 4WZBE 1FQJA 3DO6A 3W90A 3TUJC 1QHIA 5G3YA 3WBKA 4HDOB 1EX7A 2GZDA 1IOZA 1KTVA 3DOFA 2Q9AA 3KTAA 2ZRDA 5LB2A 2VIIA 4PTLA 2OESA 3NHBA 2ZUCA 4PPNA 3F3YA 2O0HA 2KE5A 4HLCA 4HAWA 3CZQA 1IN7A 2BMJA 2G88A 2QAGC 4B73A 2C99A 3IEUA 5KSPA 3CX7A 1RZ3A 4FCTA 2IYSA 2ZETA 1SVIA 4AK9A 3VR5A 1IAQA 3UIEA 2GCPA 2ASEA 3CPEA 3RWOA 4Q4AA 1M1YE 2FFHA 2DY1A 4UKDA 2XB4A 3ADDA 2XOKD 2VP9A 2MMGA 1IN5A 2CLSA 1NNEA 2CNWA 2VRWA 5GJCA 1SVSA 1D6JA 2CCJA 3EPHA 1W4AA 5JHGB 4MKIA 4BLPA 2MSCB 3SJCA 1LFDB 3WXMA 2F55A 5ELXA 3LX5A 1LB1B 2XB2A 2GEDA 4A0GA 1AZSC 3AKYA 3WMFA 821PA 1MABA 4HLUC 4LBVA 1FFHA 3OHMA 1OT3A 2H7VA 2VHUA 1NIPA 3KQKA 4Q7KA 4JS0A 2G1JA 3LDAA 2QRNA 1CIPA 1PUIA 4IW3B 3D8BA 4Q4LA 3MGCA 5M04A 2NOAA 5FL3A 1H8HD 5BN3A 1Z8FA 4A36A 1Q1EA 2WMOB 1TF2A 5BYJA 4AD8A 4DZZA 4G0NA 3ZIAA 2F43B 1UKEA 4QJ5A 1U8ZA 4YDSA 3VMFA 1NLZA 2NZ8A 5EE0A 1NVVQ 3K70B 5JJIA 1G8YA 1TUIA 1US8B 4CEIA 4DCUA 2RKOA 2VTKA 4GSYA 1CF4A 3CWZA 3KX2A 4QM6A 1ZM2A 3AEZA 3THOA 1TF5A 3SNHA 4LPSA 1KHTA 2QROA 4E09A 3THYB 2IL1A 4JZKA 4HDCA 1GP2A 2ZEJA 5F9FA 1R0WA 4D4LA 1YZUA 1ODFA 3SHWA 4DDUA 1F2TA 3CRQA 4XJXA 1E1RA 1N0WA 4G5GA 1Z0AA 4M1SA 4IVQA 3A4MA 4O0MA 2QP3A 4AYWA 1HT1E 3KB2A 2XNDD 4E07A 2PJZA 2KWIA 5B64A 5L3SB 4B76A 4DB2A 3PFIA 4AG6A 3BXZA 3KXLA 3RRNA 4EJSB 4PPGA 4OJQA 1OFUX 1X1SA 3K1JA 2CMKA 1X3SA 2VO1A 1AGPA 4DCSA 1KYIA 1NRJB 1YZGA 2F9LA 1AQUA 1GL7A 3CNOA 4CDGA 3PEUA 4NONA 2RHMA 1BIFA 3QE0A 4JLBA 4C2TA 1OW3B 1UDXA 3Q72A 4XOIA 3KJEA 3I1FA 2VEDA 4PAOA 4PSVA 4B2PA 5G41A 3U3RA 2PEYA 5CB6A 1LF5A 1R5NA 1DAKA 2F1RA 3UXMA 1SVOA 3BC1A 3NHAA 2VF8A 3FHCB 3THYA 4DCTA 4GMXA 3C5CA 5DLQC 4G01B 1L4UA 3KUDA 4E5UA 4TL9A 1DBSA 2VLIA 3EIHA 3HU1A 1G1MA 4DLWA 3GLFA 2Y8EA 2OCBA 4C0SA 1F60A 5JRZA 2QPOA 2IS6A 5AUPB 1WP9A 3JVVA 1W49A 2Q9CA 4PR0A 4B6EA 1KK1A 3MCAA 4AYTA 1NSTA 2XOKA 3U61B 4JSTA 1I4TD 4OQFA 4P4SB 1T8UA 3QF4B 3BB1A 3SDZA 3H0KA 1AQYA 4BLQA 3OE7D 2G0TA 3G0HA 4TLEA 2YNMA 4PANA 4EQ6B 5JECA 1ZP6A 1F2UA 2CCKA 3AH8A 4QJ4A 5TB5A 3O8CA 1GVNB 5TARA 3TAHA 1FP7A 5JJLA 4YDHB 1KIMA 2WM9B 3I72A 1KDRA 2VHTA 4Q1CA 2YINC 3K0AA 4GBMA 5D3MA 3DOEA 4TYYA 3ASYA 3QEJA 1XTKA 3GJ7A 4TL7A 1UF9A 3AKEA 5EE5B 1H8HA 3AVOA 5K8LA 2XNSA 1E4YA 3TR5A 5FI0B 1ZM4A 1G3UA 4RFSB 4OHYA 3QKUA 4LGMA 2PBRA 4JJZA 1OXTA 1P3JA 3LRPA 4DCNA 2ZE8A 4XVRA 4WBSA 1SZPA 3WHLA 3FMOB 1DAFA 1T5IA 4EPXA 2VYFA 4Q66C 621PA 4POAA 1AGRA 4N0DA 1S3GA 4IEEA 3P1JA 2BKUA 3BGWA 1T4GA 2J87A 3WNDA 2JCSA 4PO8A 5TV2A 2GWHA 1ZUHA 1HYQA 1KK0A 2AWOA 3GLHA 2WWFA 3LQRA 4ZDIA 3ZS8A 3PEVA 4HYYA 1YHNA 4G5SA 4M22A 4IDNA 2WV9A 2YV5A 3A4LA 1JPNA 2XNDA 2ZI5A 3AP3A 2IUUA 1Z08A 4JLJA 4URXR 4PPFA 3CPHA 3N2EA 3W34A 2WKRA 4B3GA 3KJGA 5H8WA 1MO3A 1HA3A 4KO8A 1NSFA 1Y3AA 1NY6A 3EIEA 2IX3A 1RPZA 5IK2D 1UAAA 2P5TB 4MGYR 2DWQA 1G3IA 2BBSA 1A7JA 5EXTA 1ZIOA 3R7WB 1DAHA 5DHFA 1F6BA 2P6UA 2ZSBA 4JLVA 4B34A 2ATXA 3B1XA 2CE7A 3GD7A 1NF3A 1NMXA 1R8QA 3GEHA 5GVRA 1ZD1A 4TMWA 2ZU6A 5E95A 3ZVNA 3B82A 3RWMB 4KXFB 4QFMA 2RMKA 3O47A 2VBCA 1G18A 4AI6A 5DE3A 1OXUA 1NN0A 4JBWA 2WVJA 4LYFA 1DAMA 2AK2A 1JXOA 2GVDC 2B6HA 2VP6A 1KAGA 3AB3A 3GQBA 3B85A 3W3AA 4Q48A 4KI0A 5K8UA 1TPZA 2BCJQ 3GJ0A 3QXJA 2ZQ5A 4EAQA 1G8PA 3I61A 3W5JA 3H1TA 3HYRA 3T34A 3QPVA 3TSZA 4DT1B 4C7OA 4DJTA 4TLAA 4DDTA 3QEOA 3OE7A 1GKIA 1HQYE 1L8QA 5LD2B 2O8EA 3N5CA 2ZSAA 2FNAA 2J5XA 5E4FA 4LX0A 3K9LA 3SFVA 2QA5A 3AVQA 1KSJA 4FMBB 4PAQA 3MFYA 4NYMR 4TMKA 3BIFA 1SXJE 5EZ5A 3CIOA 1A2BA 1GTVA 5F9HA 5FTJA 3U3MA 1IQPA 1N5KA 4NL4H 4W5WA 5JS7A 4D82A 3DZDA 1HT2E 2YWEA 2DYKA 3PEYA 2X1VA 4DSTA 2JJ8A 3O8BA 1N0UA 2CLCX 4OI4A 5CLQA 3V9PA 2REOA 3T12A 2JLVA 3DDCA 3Q5EA 1Q1QA 2Q0HA 1Q44A 4DKXA 2NGRA 2AK3A 4LYAA 4WZ6A 4U7DA 1NY5A 1UBFA 2EFGA 4BFWA 4IHQA 3BH0A 4ILEA 4TYQA 4UXJA 4O3MA 2VL7A 5JCZA 5SZKB 1E2HA 2OBLA 3WP1B 4XSHA 4DSUA 4Q7LA 3EZ6A 1E2DA 5LBIA 5EP1A 1XB2A 3AUXA 5FTKA 4NPHA 2EW1A 4PZLA 2ZYWX 1OH5A 3AP2A 4BLRA 3LXXA 4RY2A 3NKVA 4ZDWA 3X1DA 3UWKA 5BYKA 4CEHA 4AKHA 3DVLA 1DAGA 1WCV1 1X8KA 2EFDB 2ODEA 1WBDA 1G5RA 4MUBA 3T5DA 3GLIA 1NI3A 4ESVA 3RHFA 1RJ9A 2YOFA 2QENA 1JR3E 4PC6A 2ORIA 2P6RA 1YRAA 1YKSA 4DEXA 5IRCD 2JAQA 2XXAA 1CJVC 2ZRCA 1A82A 4Z54A 1CRQA 3M6AA 4LHZA 5H68A 2FGJA 1SVLA 3SBDA 1Z28A 1P4SA 221PA 4TT3D 1Z29A 5CLLA 3BFKA 5IK2A 121PA 1YZNA 2JLXA 1UEJA 4QG7A 4ZDKA 5KO2A 1Q12A 2QAGB 4MRSA 1ZCBA 3LX8A 2CHGA 2ZR7A 1E2FA 4M8NE 4KFSA 4WXPA 1CXZA 3WNBA 4ZDJA 2IWRA 4HATA 4LBZA 3GMTA 4GMDA 1N5IA 1MH1A 1TUEA 5FOWA 2O8CA 2EFHB 4G5QA 1W46A 1KGDA 3B2EA 3BH6A 3SQXA 1Z3IX 4KODA 1M7HA 3QJYA 1BYUA 3TBKA 2ZYTX 1GL6A 4LSGA 4S35A 2HCBA 1ZU4A 1C9KA 2FG5A 4LK2A 3U6BA 4HEJA 3MRSA 2O52A 3LA6A 1WF3A 1WB9A 2BMFA 2VSXA 1FPMA 4NZYA 5EE1A 3TSWA 1WQ1R 2XX3A 1RVDA 1AN0A 4OHWA 5SZHB 3K53A 2LWIA 1U98A 1ZMXA 3R8CA 3TQFA 3BERA 4UNQA 4UNNA 1JALA 4DIDA 1P62B 3U60B 2ZRPA 4Q21A 2R44A 4IXNA 4CEHB 3GEEA 3SR0A 1IN4A 2XJ9A 4JLNA 5EP3A 2ZRGA 1ZW6A 1R0XA 4NKRA 3CX6A 3ZYCA 1G6HA 5FTMA 4Q7JB 2C95A 2PZEA 3QVUA 4Q47A 2J3EA 4RVCA 4X8OA 3U7GA 1E0AA 4Q1AA 4C0KA 1KZGB 3RLFA 5DI3A 5AJWA 1J7KA 4FW9A 1N5JA 3MUFA 5IDVA 5UKDA 5FOVA 4E03A 2AKAB 2IA5A 1ZNXA 2ZVQX 5CB8A 3A6PC 4DVGA 1BYIA 1ZM9A 4M9ZA 4Q19A 4YMUA 2CVFA 4LZZA 4A0FA 4G5OA 3QKRA 1Z6TA 2GJKA 4CT4B 1QRAA 2ZS9A 3RYTC 2WJYA 3VHXA 2E1RA 4NCKA 2B7CA 2GJAA 2JIZD 4HUQA 4Q9HA 4W5JA 4BRUA 3IHLA 1G17A 3LH5A 4NYJR 4IDHA 3C15C 3TGPA 3BB3A 5G40A 4FWIB 4YXWD 2WJJA 4RSGA 4URVR 4FI3C 1S2MA 1FX0B 5FPTA
chains in the Genus database with same CATH superfamily
1Z4NA 4YCLA 4L9SA 1FS6A 3EC7A 4F4HA 2FN8A 1EWYA 1SZCA 2C4HA 1CV2A 2HAEA 2K87A 3LY7A 4QXAA 5DRTA 3S0JA 4D26A 3IVXA 2R8XA 3CONA 4CXMA 5JI3E 2BMVA 1VA4A 2HPAA 2PIDA 2GDJA 4LYEA 4M60A 1JSCA 3SKXA 4A0QA 1IY8A 1TVEA 1B8PA 3WRWA 1SQGA 4A5OA 2V9PA 2EATA 5E2AA 1ZAYA 3WLJA 1BX0A 3CBQA 4MO2A 4TT3A 4X44A 3A1TA 3OX1A 4WN9A 2QRUA 1MBZA 2WOJA 3SSNA 2A9VA 1TA4A 3D2AA 2XAAA 3HL4A 3ESZA 3LUHA 4G2TA 3O2JA 4K9KA 4AJLA 2O5CA 1E9BA 1XN1A 1YC5A 1GSOA 3A70A 5H02A 1VG8A 1UWVA 2X1LA 3GROA 4UVDA 4KI7A 4C6TB 5EJ6A 2JFVA 1H0SA 1N7JA 4P3PA 3ADCA 3Q8LA 2VJOA 2HMVA 1BS1A 1V6CA 3HUUA 1FDUA 1CP3A 1BRMA 1PFQA 1XCPA 3QWFA 4BCCA 1JHXA 2AZDA 2X2PA 1AMOA 1ZH8A 2Z5VA 2W00A 1HMYA 1UFRA 1IONA 1MPXA 4CQMB 1QO9A 4AU1A 4BN4A 3NYRA 2VWPA 3LP6A 4HB0A 4BB9A 1MX5A 2P0EA 2GILA 4KQ1A 2VWGA 3V46A 3OQIB 1KZ7B 4HNQA 2GK7A 4HZGA 4C78A 3HSKA 2XH8A 5EMKA 4NESA 2B9VA 2LCIA 4YCNA 2D0IA 5IT9A 1G8FA 1W0KD 4X61A 4ENSA 2C9BA 4LNUA 2WABA 4QDZA 2WAOA 5AXAA 3PQ5A 3KZCA 4UNSA 5FBVB 3HR7A 1AK9A 5CD1A 4B84A 2ZIXA 1ZR2A 1IHXA 4I2VA 4EVIA 1E94E 3NBAA 4NAUA 4Z7QB 1RQ2A 2J9RA 4BMSA 1F8UA 2MSLA 1GSAA 1O5OA 1QXSA 2D2VA 1ECPA 5KDLA 1B1CA 2O59A 1QUEA 2I2CA 2VFAA 4LOIA 1E3DA 4LE1A 1CUWA 2WUFA 4EECA 1E69A 1Y8RA 4IMPA 3H13A 2IHVA 1L5VA 4JJIA 3P45A 4B4WA 3C3MA 3NBMA 5LM3A 1ZJ5A 2ZRKA 3KQTA 4MICA 4R2MA 1HE5A 3T8YA 2PT5A 3P0HA 1RC0A 2B2CA 1KU6A 4LYDA 2PZFA 4I1OA 1KBQA 4DNQA 3ZI0A 3JYQA 3CEJA 4RQAA 5C34B 1CVRA 4Y1RB 4EP1A 3UW1A 1GPMA 2Z30A 1JAXA 1Z26A 1FK8A 2AJDA 4LMRA 3LU1A 2P91A 3SXPA 2A1UA 2GN9A 2ZJ4A 4BBZA 2CN1A 5K45A 6LDHA 4RLQA 3CO0S 3B2NA 2HWXA 3TRJA 1AUXA 2WAMA 3V8VA 5BVHB 1TQHA 1XEFA 2E4VA 1CS4C 4MDHA 1LVUA 1TJYA 1X7WA 2VP5A 3TTYA 3VU1A 3DOHA 3A36A 3E35A 4ROSA 3WGTA 3OQPA 3WV5A 2XV1A 5BQ3A 2JIZA 1CY1A 5K6AC 3F4KA 3H86A 4JBIA 2ID8A 4JP8A 3PUYA 1AQLA 3HLKA 1E66A 2QN8A 1JU4A 4ZJPA 2NTEA 2PNFA 4MRRA 2FZEA 3DDOA 3PKZA 4HNAB 4C06A 2JG3A 2VJMA 3GD5A 3H16A 1EG7A 1HO3A 1ZMTA 3SQOA 4BB0A 1EGQA 1XRLA 3MGBA 3B9PA 4DNPA 5CBPA 3G85A 3EF0A 3MUEA 3KB6A 1N2XA 4EG7A 1JI3A 3FY4A 3VNUA 1K8QA 1PDVA 2HWUA 4OJTA 1BFDA 3E3OA 1HY3A 1PSZA 4JBXA 5K3OA 1N6KA 4NVRA 2WIFA 3FFBA 5HUJA 3AERA 5C7IO 3ZYZA 5KREA 2PA3A 5JQGA 3HEBA 1WDLA 4E2ZA 3B70A 5IT5A 1N32B 4QNRA 1PKEA 2DG2A 4ZAGA 5KTMA 1S4QA 2E6KA 2ZT6A 4RBNA 5JRJA 1DKLA 2V74B 4LTMA 2ILVA 2OV8A 3RBXA 1CJMA 1JIJA 4OM7A 4E46A 5JSUA 3BORA 4BVEA 4Z86A 4FWTA 3B1YA 1RRVA 4N65A 4YYZA 1R4NB 3OM1A 1TT5B 4JJ7A 1UZNA 3BL5A 2IYUA 3ESQA 3NEPX 5AOVA 3GFVA 3GBSA 5ALDA 5FBQB 3KEOA 3W5BA 3OZ7A 4WH0A 3LD9A 3GRRA 3DE2X 5H3LA 4DMCA 3K8OE 3QTTA 3EGIA 4DCGA 4EDHA 1SUDA 1GLVA 2PD3A 4C3UA 1XZFA 4RTLA 3ZCQA 2BBTA 2WZCA 4XM0A 4Z1MA 1Y37A 2G1KA 4AQDA 2GARA 2PFGA 3IO3A 3ITNA 4D3SA 1K9SA 1RYFA 1U5BB 2KS6A 3F5QA 2X40A 2PS0A 3RVRA 1EEXB 4G86A 4GZMA 4ZO7A 2JFNA 2MSEB 1XL1A 3WQHA 3O0DA 3WKBA 4P7GA 3UWDA 1ZD2P 1E58A 2B69A 1QKJA 1SHTX 4QHTA 1FUEA 5LQNA 2EW8A 2ETVA 3DHYA 4HXGA 2HYDA 4MQUA 2VDPB 1VB5A 5TC4A 3RI3A 4Q02A 4MEJA 3ILSA 3Q3HA 3I2IA 3WLKX 1K5HA 1QS0B 5CM8B 2EFEB 3REOA 4NBRA 5LL6P 3ASUA 2YXPX 2CUZA 4KQEA 1UP7A 3AV0B 3F1LA 3N05A 4G2NA 4L2IB 1QH1A 3H4MA 4DREA 2P9GA 2IZ0A 4BWYA 2CL7X 4LIPD 1ABEA 1XYYA 3TEFA 5FFFA 1XTVA 2OO3A 2ASVA 3RM3A 1P6XA 1S02A 2OZEA 5IH7A 5E7JA 3ZHUA 2WF6A 5KNDD 1PNTA 3H8SA 3JQAA 2LCQA 5ECDA 5A62A 1R8XA 2FRDA 4IFBA 4GR9A 4MIYA 1I1HA 2ZT7A 4FDAA 1Q7BA 2CYCA 1Z0SA 1EKXA 1NVKA 3CNLA 3EQ2A 4GNKA 1JQJC 1Q84A 4PN7A 3NNNA 2FMXA 2C20A 4G4SO 2Q50A 1JPJA 1W581 3EEQA 4TS3A 3BSFA 3REQB 5KNCD 2FK8A 4B3MB 1VG0B 2FV8A 2SKDA 3GUZA 1EGAA 3AF6A 3AVTA 3BRQA 1KVSA 4V03A 1RMTA 2ORVA 1SCQA 2PD6A 2FZVA 3QVTA 1YFLA 3LCMA 1S0UA 1G4AE 2F1HA 4FZJA 3KT6A 4XX0A 4PXAA 2RD2A 3IP9A 1O4WA 1M2VB 4NV1A 4EYGA 1QANA 2HPVA 3VU0A 2ZU0C 1K7YA 4RL6A 5KTKA 2BDTA 1R6VA 3IIJA 5F21A 2IEYA 3QMWA 2MMCA 1R0ZA 3RC9A 1YK1A 1XTBA 2PH5A 4ARZB 4EYSA 4RA6A 3I4LA 5FQNA 5B37A 1F4PA 4O8ZA 4ZEXA 1TZMA 1U7OA 2M6SA 2E82A 2VTDA 1XDZA 3E9YA 5LLDA 1ILEA 5K0NA 3GLFB 2F8TA 4RULA 4Y0AA 2QMHA 3EUAA 4QVIA 3PFFA 4JKOA 5ULLA 1U2EA 3NC1C 1EX9A 4V0OA 1HNXB 2ZITA 1TADA 4JYPA 4QIHA 4YDQA 5M29A 3PGMA 1A97A 3EA0A 5EGSA 4R40A 2B1JA 1NVWQ 1H9CA 1TZBA 2Q9BA 4FXPA 3HXPA 4PX9A 4KREA 2JANA 2XE7A 3E53A 1A7AA 3OY2A 4I8DA 4PE5B 4OMDA 4QOJA 2FXVA 3R20A 3ZK8A 1QHEA 4LNAA 4C29A 4CCWA 4OYHA 3GRZA 4E08A 1L4HA 3ID6C 4E2XA 3IBCA 2F17A 2FEMA 3EEYA 5L7YA 3VNSA 4YY3B 3KZOA 2PGXA 5DN6D 3D4LA 1V8BA 4ZEOA 4J0EA 4GLOA 1GPBA 3GL9A 2A2ZA 3N8DA 3PUIA 1Q6YA 4H0NA 4NBSA 2AC4A 3BD9A 3WAKA 1YAJA 4P98A 4Q4JA 3VUEA 1KYZA 3GPCA 1LNSA 2QE7D 4K2AA 1S8AA 1T8TA 2H2IA 2H54A 3L7YA 4PLHA 5D3MB 5TVGA 3FOEC 4MVJE 1A5BB 3C3DA 4H27A 1FSGA 2A14A 1XZQA 1Z4QA 3MJEA 1P1RA 4ZVSA 4G4IA 4OOFA 3ZUGA 4ECAA 1P0QA 5A04A 3HXOA 1SU4A 1NU8A 1AY0A 3N1UA 3OZFA 2HO5A 4G8JA 4LG1A 4QXMA 4TUYF 4P38A 3ZY2A 2ZIVB 2IZ6A 4B09A 2OCAA 3HJCA 3GNLA 5LLTA 4TRJA 1XXHE 3KXDA 3GLKA 4LK3A 1A9PA 2QQGA 3HMKA 2BHLA 1NE2A 1TVKA 2H1CA 2OV4A 4EMSA 5KQRA 2NYAA 4IGAA 4HDQB 5F5LA 2HMYB 3KL4A 4OXKA 1Z7YA 2YWFA 1GDDA 3MIZA 1QYVA 5HIMA 1ZA1A 2HU8A 4YDRA 5BPHA 2WOOA 1C5KA 1QLWA 2OVBA 2QZ9A 4QSHA 4D9BA 3ZCPA 5IHPA 4FN5A 3B6IA 4KGDA 3TLXA 4WY5A 1XPJA 2VHVA 4D8TA 2ZB7A 4K6KA 1WBBA 2NUAB 5DSXA 4KPGA 5L7WA 2MYPA 4ZCLA 1VBFA 2YYZA 1YJXA 1Q1AA 4FZ5A 4LXGA 5TQVA 2W48A 1T8RA 1YD7A 2AL7A 1CY6A 4N5NA 3TLKA 4CLDA 1VLQA 1D9ZA 1YR1A 3DOIA 4GE3A 4JB3A 4QM7A 2RHLA 4DLZA 2COUA 3MWYW 2Y99A 3OUTA 2R6ZA 1C1HA 4Q3EA 4Y7DA 3RS9A 5JZSA 5AMXA 1EJBA 2V1XA 3K9NA 4TSKA 4EDFA 3OD5A 3A3YA 3G0OA 5B2EA 1OFGA 2QJOA 2GHIA 1SOUA 2HF9A 2XHZA 2XA1A 3HNOA 3C2QA 3CH4B 5JH7F 2A35A 2CDNA 5H7XA 1KH3A 1FDIA 1KJNA 3NCTA 3NIWA 1WMEA 3G7NA 4NH0A 5D7NA 1P1JA 4DSZA 4F85A 3TNLA 4U2DA 1S89A 3KV3O 4WBXC 1K6XA 4ZOLF 3OQBA 4I6JA 3TOCA 4WUTA 1PEAA 2VAXA 3SQMA 3IAFA 4A2PA 2D1TA 1EAYA 1OBOA 2PXXA 2JARA 5BQ5A 1NZDA 1Y1SA 3A4YA 3NC0C 5F2KA 1VP9A 3R3HA 2K2WA 2R8RA 4TYPA 1MT0A 2IV7A 3TLJA 4CFSA 1UJNA 2BF4A 3HADA 3AETB 1FQKA 4NZZA 4OA8A 4PG7A 2PWAA 4RXUA 2R2GA 1PZNA 1K6IA 4P0PB 1LU9A 3SGLA 4QU0A 4NICA 3JV7A 5HQ3B 3L07A 3P20A 3HJHA 4BX9A 3V4VB 4EABA 3PL1A 1QR6A 4BCDA 2FDCA 1YZTA 2VRCD 3OG9A 1M8FA 2E87A 1LSJA 1NR1A 2OCDA 4AP6A 4DCCA 3I83A 1XKLA 4R5MA 1W6RA 5BVGB 1JT9A 1GSHA 1NKTA 3Q4GA 5E9QA 4FFVA 4KFUA 1E6KA 1TU0A 2C7GA 3VVBA 3W6NA 1XDDA 4BV3A 4TN1A 2ID9A 5BOSB 1GRQA 3P26A 4ALJA 1BXZA 2XEDA 3KYIB 1D2EA 1G8JA 1CQJA 1FBNA 1L7NA 1JSZA 1O6GA 2BUBA 2O1XA 4Q82A 4RVUA 4C2BA 1WRBA 4U1RA 2X58A 3WIDA 1MTOA 4WSOA 1V5IA 2CWDA 3CNNA 3IELA 4HDMB 4BCBA 4F9EA 2QBYA 1W8IA 4JJGA 1NVBA 2WNSA 4CMJA 1EUCA 3GVIA 1TYEB 3X1ZA 4M1QA 4L07A 4QLOA 1UWKA 1BHSA 3AYZB 3NPMA 1YRLA 3TDKA 1RE1A 2G40A 3MQ2A 2CJYA 4CM8B 4JSYA 1T2VA 4P82A 3ZS9A 3OPYB 2QQEA 1A9YA 1HLPA 2BIFA 3J7TA 4MWZA 4CM4A 2QLMA 5C5IA 3AIOA 5K6TA 3KKZA 5FO1A 1QVZA 1F9EA 4NOMA 5FTNA 3STWA 3WLMA 3LL4A 4D45A 2BRUC 3VUFA 4AJEA 4JLDA 4RY0A 4XDHA 4GMHA 1E3QA 1JHZA 1AKEA 2ZANA 2UKDA 3D2CA 3O95A 5BXYA 3AY3A 2ANBA 2HMTA 1FRZA 1MC4A 2R60A 5BQFA 1SXJC 3HJBA 2RGGA 3LC1O 1LV7A 3K31A 1LWOA 1YUNA 3JZFA 3CZRA 5EE3A 2NTYC 1VPEA 4AX8A 4C7MA 4I08A 2A57A 1LK7A 4Q9KA 3ZKAA 2P77A 4LY3A 3VNAA 3C7TA 4LDJA 1YKFA 2O7SA 1A9ZA 2DBYA 5BQPA 3V7WA 3A1VA 4DILA 3GDOA 2AR9A 3N28A 1N2ZA 4BNTA 1QHNA 1OHHD 2QIOA 2CNNA 5E3JA 1FNMA 5GZ1A 2ZWMA 1APBA 2I4LA 2RFLA 4H3SA 4KQ9A 4E30A 5CFNA 3RC8A 5G1OA 4F4UA 4FINA 3P71T 4YV2A 3HWSA 4TTIA 4N3GA 3OC0A 3AKCA 4F38A 2QLBA 3UHFA 4KRXA 1DJPA 1P17A 1R64A 4DUGA 3KQSA 3CNEA 2Q5IA 3GH3A 1E0AA 1TM3E 2D7JA 1RZVA 3WI7A 2HFKA 3MJ4A 1NJGA 3JZIA 1U2GC 4X95A 1ENPA 4JT4A 1BWQA 5CM2Z 2WSSD 1U9IA 5AVSA 1V0JA 2JEOA 1O8BA 4FGSA 5HW0A 4MVJH 4X3OA 4CIBA 3W04A 2NU7B 1NURA 3AEKB 1VPLA 2JFZA 5CGQB 4ETNA 1JNYA 2Q49A 4DMLA 4Q4HA 5ERXA 2QSYA 4KGZA 5L8VA 1MJFA 1FF9A 1ODLA 4LQDA 1A9QA 1MXFA 1ZXXA 3U1BA 4Z3OA 2P6NA 1W30A 1OXXK 3L8CA 4KIGA 4QYXA 4ALNA 1GTRA 4PM4A 3S81A 2NXJA 1QZ3A 3F49S 3VZDA 4RA9B 3JQRA 4FDVA 5EWLA 3UJ3X 2D5BA 3DP7A 4PWZA 1MT3A 5CA0F 3NJ4A 3I73A 1D6MA 1VSUA 2XYVA 1RLUA 3UH0A 3VO1A 4BVHA 2Q1TA 1D6NA 4FFWA 4PSCA 4XRRA 2UVPA 1GKKA 3DGFC 5DGTA 3WYNA 4QBTA 4CMAA 4HFRA 2E4AA 1JDSA 3Q88A 4CKXA 2CL0X 1W9HA 2F3TA 5BSHA 5ENDA 1E7YA 2OBBA 4LISA 4OP1A 1MHTA 1DS6A 1EFVB 5DO9A 5CYOA 5KU1A 2ZZKA 1EFRA 1EFTA 4KXVA 5F5NA 3WLPA 2O0LA 3HU2A 3DKPA 3A28A 3ZNQA 1XZNA 1QGUA 2GCIA 4DIEA 1J2EA 4W9MC 5I8WA 5AHXA 1J8YF 1RAHA 3H2HA 4LJYA 3SEFA 5JO0A 3UPUA 1OD6A 3EZ2A 3T5BA 1KAHA 3PJRA 3DTVB 4IDCA 2R8BA 5TPWA 2ZVDA 4KW7A 4GKAA 4BFXA 5IJZA 2QJFA 3EN0A 4IIHA 3V4OA 1TW3A 3W2TA 5M7EA 2XNKA 1SZJG 1AHIA 5FA8A 2BH2A 2W2VA 2PZMA 5F9MA 2Q1UA 3HDJA 2OORA 1X7HA 5TEWA 4AZ3A 5BMVA 5LP6F 1CRLA 2D3WA 4JHLA 3DBOB 4TVOA 4YRMA 3C3AA 1C8LA 3MS4A 3JY6A 3OEEA 5G1NA 2I55A 4MGHA 1B15A 4DNFA 1R0KA 1T6YA 1VXOA 3FDZA 1Z75A 2QQ5A 3D4IA 2ZRAA 4C14A 5DBIA 3IVMA 2HU2A 4CFZA 2BTQB 1VIMA 4EIWA 1EESA 3N8KA 1MV5A 4GOKA 1K4KA 1YONA 3ORSA 4OKIA 2PMDA 5K8VA 4BV8A 2G9QA 3LI2A 3RV4A 4F3RA 2WJWA 3RRZA 4E12A 5FFNA 4EHHA 2QTZA 3LFTA 2OHGA 4NY1A 1ZJ6A 1AA9A 4PLWA 1U0TA 4DR1B 1HG0A 4N8EA 4BEBA 3NHPA 4FFMA 2WLSA 5K8JB 1E0DA 1CQWA 2QL6A 2YY5A 5FOUA 1WZUA 3FPFA 5A03A 4FUTA 1NIJA 4MJLA 4WIAA 1E8NA 1OTHA 1NRWA 2LXNA 3KB1A 4AFNA 4BZQA 4KDFA 2C2GA 1DHRA 2G9RA 4FEAA 4EY6A 4KPEC 3KLBA 4HWRA 4WT7A 3BMOA 3VAAA 5H59A 3RIGA 4L8VA 2QRPA 4W5HA 3TQHA 2JLSA 2ZZMA 1K5GA 3GH1A 1Z4OA 4O1MA 4PLGA 5KJFA 1W85B 1XJ5A 4KLNA 5SZJA 5KNBA 3Q87B 4A27A 1WPXA 1OF1A 3HKCB 3T1QA 1XROA 4LYGA 1N25A 3LYLA 4O6VA 2HQOA 3OTIA 4Y6GB 1IDN1 2ZIZA 5GINE 3C1UA 4DANA 4O4HA 4J07A 3FB4A 3N8IA 2B7LA 1E5DA 3C3EA 3EOZA 3RTBA 2HK8A 3NYWA 4N6NA 1J2JA 4X1IB 2CZQA 5ICEA 3HXLA 1A04A 3NPAA 4YJ2F 5ELMA 3KYJB 2FPMA 3MJDA 4BFLA 3ND8A 3BWCA 4DIMA 4EKNB 3UHOA 4D44A 1FBTA 2HNAA 3H65A 5D2CA 2UUAB 1E9VA 3E23A 4OLAA 2GF2A 5JR3A 4RD2A 3D0KA 2SECE 3NJ8A 4ND2A 4NBVA 3RDPA 3NJRA 1DRKA 1EUZA 1NU6A 1VDMA 2GK4A 2ZRNA 3CLUC 1I5OA 3SYTA 3ND7A 1RPJA 5LA6A 3DE5X 1N5OX 2ZT8A 3CVWA 1FLVA 1OASA 4IDPA 1RZRD 4B3XA 4BTEA 2VG8A 2R62A 4NTZA 2KB0A 3KWLA 4XYEA 4GYYA 1GDTA 1SHJA 1I2DA 1TRKA 1MIOB 3BG5A 4FJ0A 4K9DA 1X6VA 4QBIA 3U44A 1IBLB 4WAUA 3E4CA 4V3BA 3K0HA 1W1UA 1NDHA 1JA9A 2I2XB 3DUFB 4KGVA 4RAQA 4M1MA 2J45A 4NJOA 4MKHA 5CHEA 3OUZA 2C2HA 1RP1A 3JVUA 3B52X 4ZV7A 2VJLA 1Q14A 1RRFA 1UANA 1Y9JA 3JATA 5EZSA 3SX2A 4CMEA 2HDHA 1YIOA 2N42A 1E2MA 1SNYA 4BVKA 3UCFA 2DWUA 1SOMA 1AX9A 4L51A 4YRQA 2PO5A 3HYTA 3CUWA 1BH2A 1FFCA 4FHZA 1B6GA 5GJVC 3AUTA 2JFOA 2DFPA 2F4NA 1H6CA 2HSJA 3BGVA 4IIEA 4G9BA 3EPJA 1T1GA 1P2GA 3IP7A 3PFCA 4QARA 4BNWA 2B3DA 1CF9A 1UBNA 4PINA 1XQ9A 2NLOA 3BKXA 3DBLA 5JHHB 3H99A 1GQYA 1SUAA 2QHXA 2XE6A 2B35A 3L5KA 1PZHA 4GOXA 1NJ5A 2VH5R 1G5QA 5D7BA 1Z62A 4WLVA 1F48A 5TF4A 2FSSA 1E9AA 2A86A 3WO1A 3LRTA 1WB6A 5CDFE 1FX1A 2QIPA 1G9XA 2IU6A 2W6NA 3INGA 4LZLA 5KHOC 5TF0A 3FDIA 4PYOA 5L6MB 2EHJA 1VE1A 2AN9A 2RHHA 2JF0A 4Z4FA 3ZE0B 2PCLA 3L0OA 1IZ9A 1X70A 1XAIA 3JASB 2AE2A 3IEVA 1LVHA 1RYMA 1VJ1A 1C7IA 4X24A 1Q91A 4LY0A 4M1OA 3NUZA 3G89A 2WPDD 5EC8A 2QG4A 1EX6A 5CYFA 3OOJA 4CNQA 3UAXA 1H2BA 1VQ1A 4WFJA 2IWHA 2I6QA 2IIVA 4D0SA 1E2BA 3TPFA 1FSZA 1PT8A 2WKQA 4GYKA 4US1R 4CQNA 3E9ZA 4GKKB 4JVOA 2RAVA 1GPWB 2XRZA 1Y0BA 1KMHB 1ZMOA 2V54A 3A58B 3OJWA 1VB3A 3EAGA 2WF8A 4LI3X 4PICA 3GDWA 2HT1A 1PR9A 5K0CA 4WKNA 3PIRA 4QDOA 4X97A 2G4VA 5CA1A 3WMGA 1EK5A 2NO9A 1GO2A 1XRSB 2P2NA 2PLFA 8ABPA 4DC9A 5C32A 2X14A 3J7AC 2I1LA 5I8PA 3MVEA 1VE7A 1JAHA 1G2IA 4IJ5A 4IYJA 2JVJA 3H5TA 1HG1A 4K03A 4KN8A 4BAGA 5ABPA 3FZQA 2EQBA 3OZWA 4Y67A 1IWBB 1C9MA 2X2FA 3CEMA 1H6AA 1KFCB 1NUAA 2XUKA 1GV0A 2O0MA 2FWPA 1ZU5A 3EFEA 2IBMA 3AOGA 4TWZA 4X41A 4U7JA 1I9CA 5AHOA 1L5OA 3JQ6A 3K2IA 5HKKD 5IAOA 4DA0A 1XVTA 1PJAA 3AQ4A 3GWGA 3DYBA 4QAQA 4WOBA 5BSEA 5JDCA 1CULC 3CIFA 4M9SA 3DMYA 4OXRA 4ERXA 2GYUA 1Y4DE 5ARDA 2VDWB 4XD7A 5GM1A 4B47A 2IV3A 3JYOA 4BBPA 1HH4A 2A9KA 3LC2O 3OWOA 4UHHA 3M6XA 4BLVA 3A26A 3MWDB 1C1DB 2W6OA 2ZYIA 1AXEA 1JHMA 2YJ6A 2ZRBA 5JCXA 4MUAA 4XTRA 3HJNA 1GWNA 5JD4A 2DETA 5LWHA 5JJKA 3A4TA 5JNSA 2AFHA 4C6SA 1BMTA 1IZ8A 2FEAA 3LAWA 4WGFA 2X0DA 4R1UA 3P9RA 4GKBA 4DPKA 4F3TA 1JG2A 5A4FS 4DMFA 4UAUA 5IAAA 2C7BA 4I8IA 3WYAA 3KHSA 2EF0A 5F52A 2SKCA 3SC2A 2EZ4A 1PK7A 1NL3A 1Z5ZA 2BGIA 3E7XA 2BN4A 1B23P 1HF3A 4G67A 4M21A 4DJ5X 1BN6A 1MC5A 2ST1A 3QOXA 2PUEA 1CUUA 4BU1A 5IXSA 4FT4A 4PYJA 2VK4A 5EINA 5CXQA 1JR2A 4BPBA 1LTKA 3BL6A 5MGNA 1LPBB 3RUEA 4YREA 1PQPA 2XQJA 4TSFD 5B1DA 3ANXA 1UJCA 2I4TA 3MG9A 3DFIA 2QMQA 2HCRA 1MJHA 1OYOA 4TVSA 4G8BA 1HORA 2X9NA 2E9SA 3KE8A 3KWMA 1IVYA 3ZTWA 1J0BA 1GYRA 2ZYRA 4RWEA 4FR5A 2Z2YA 2OV3A 4MEAA 4S0ZA 4W6QA 2ZTSA 1EUQA 4UJ5A 2QSJA 2BWJA 2EWMA 3BWXA 3OJLA 4UUAA 2GBLA 5B7PA 2F9MA 4MS3A 1P5HA 2VF5X 2JLQA 2FJPA 2DKOA 2GNAA 3UHAA 3OOEA 4DF3A 1GM5A 3N0VA 3K4HA 4TRNA 3RBAA 1FTQA 2ENUA 3P9IA 1F1BA 1Z68A 2W2OA 1L5HB 2P1DA 4KR0A 4M1WA 4YGXB 2FY8A 3F8TA 2G28A 4EBFA 4S3MA 3A6LA 1GTMA 1H1LA 2JH3A 2CDCA 4G1BA 3BWDD 5WRFA 1G64A 2C0QA 2RH9B 6CHYA 2ZREA 3VJLA 3FCEA 3RGGA 1AUQA 4KIWA 4YAUA 3SDSA 1M8JA 2HCJB 1Q1NA 4D5EA 4EHJA 2X3FA 3M1YA 4L22A 4FOOA 4B7CA 5GIPE 2BI4A 4CKCB 1KH2A 1ECBA 1O6FA 4EA7A 1AXRA 1HGXA 1KYVA 2DOKA 2EIHA 1DKMA 2WVHA 1Z22A 2FPPA 5EFOA 5IYZF 2ZIEA 3U3JA 2PYIA 3E9NA 5L95A 4PNZA 3D5TA 2LV8A 2ODTX 3SM9A 1KFEB 4TS1A 1ZL2A 3ER8A 4JP1A 3DMHA 1HSZA 1OFTA 3KYCB 4G1CA 1GZ4A 5HG0A 5ALYA 3DZKA 3LVFO 2NO5A 3V2IA 3EXAA 3PZBA 2HRCA 5FTMA 1OXVA 4FDLA 4C4XA 2QL7A 3H8JA 1SN7A 4R9RA 4UAGA 1OXKB 4B5LA 4ZVOA 3VR2A 4A92A 2RJOA 3R75A 3WRXA 1F3OA 3ILYA 1IK6A 3ZEAA 5LQUA 4RPKA 3BJRA 5G1PA 4OM8A 4PSKA 4I9GA 3ZD8A 1NMZA 2C92A 1COZA 3C98A 4MRMA 1NKVA 5E2BA 1EHYA 3MT9A 5AW1A 5EOVA 4FSHA 3E8MA 2POQX 1D1PA 4ZO8A 1L1FA 5K3EA 2PGDA 2V97A 1VC2A 2H06A 4TWIA 4IAOA 4NOJA 1RE0A 3NHWA 1QC5B 2CXXA 3EDQA 3P9ZA 5H1YA 4HI0E 3TI9A 1VYVA 1YI8A 4ENVA 1JHOA 1YS4A 3BWVA 2OFXA 3VR4H 3CGWA 4R7GA 3BFVA 4NMMA 5DB4A 2L19A 4QJ3A 4HT3B 1TU3A 1JZTA 2EKLA 3FG9A 1VBKA 1VRVA 2X4LA 1K8YB 1Z0DA 3IVAA 3M4JA 4PZEA 4C4ZA 4ON9A 2VPWA 4FOLA 4N49A 5K0SA 3T3OA 1RFLA 4UQPA 3DLIA 3SC6A 1CUYA 3V3KA 2R84A 3BCHA 3I1YA 4IHJB 4PFJA 4RY8A 2O0KA 2I78A 1CS0B 1ORDA 1NBMD 1WCIB 2OV2A 4UM8B 4K6OA 5FWDA 1NOJA 1X7DA 5T64A 1DARA 5EUBA 2YIVX 4EG0A 5ISMA 4QLBA 1HURA 3T3NA 4QNMA 5JEEA 3HYCA 3IMFA 3H11B 1SC1A 3H2YA 1AJEA 1FNDA 2I7DA 3PQDA 2BBWA 3KVOA 3P9PA 1YJAA 1O94D 4G41A 4UEOA 1L7XA 2I6UA 3F98A 4R2HA 5DHUA 4AAYA 4A0RA 2CFSA 1GLNA 1XJCA 2HUNA 2VATA 1CR4A 3AF2A 2H57A 1TF7A 1G2QA 2XD4A 2AJCA 2YY6A 3IQZA 4DARA 5L53A 3HB9A 1OYVA 3TCKA 3QE9Y 1SIBE 1T6BY 2I4NA 3G1TA 4W7SA 5IUNC 2NAFA 3O74A 4I6EA 1NTRA 4DRXB 1RQRA 4CDNA 1JRLA 2OFOA 4P4TA 5LP1A 3QK7A 3MJVA 3OF3A 4MTLA 2RGBA 4EB3A 3IDOA 5TJ9A 1DC5A 1PYGA 2HCTA 3T1TA 2QTFA 5FKJA 2NTJA 3UA4A 2GJ4A 4RZSA 3PXEA 1ZIXA 1KY3A 4OGLA 3WQSB 3TQSA 3F5MA 2P8JA 4FKMA 1X39A 4NI5A 4OOEA 4PFQA 4KQGA 2A92A 3KXIA 4JA2A 4ZAVA 4B80A 2I2AA 3O8RA 4ES6A 3CVUA 1TVCA 1A72A 4BN0A 2VHJA 4HBGA 2Z4RA 3SIPA 1EFPA 3WHPA 5CPBA 5E0KB 1D1SA 1QB7A 5CA0B 3COJA 1UPBA 5BN4A 2Z5FA 2Z09A 1KSFX 4GKVA 4GZ3A 1Z07A 1Y9DA 5FBRB 4RPCA 1VTKA 1SU7A 2VCYA 2JAPA 4EJSA 2D0OB 3CSSA 2PTHA 5HQJA 1NVUQ 1S01A 4XXHA 2X13A 2OGSA 3FKSA 3RIMA 1MV8A 3IQIX 1QG0A 4JI2B 3C45A 1B16A 1Z0KA 2H07A 4DVJA 4OFBA 5BWOA 1JLLB 1QWOA 3TR6A 2ECPA 5HFAA 5NULA 2XCQA 1DLJA 3I2FA 1QBKC 1UZUA 4HV4A 1UPCA 3IQWA 3HRHA 5IX8A 2PY6A 3A9SA 3ORRA 3D02A 3DNFA 2PUBA 3TM5A 4DMKA 3VJRA 2FPKA 4QD3A 2W8BA 1HUQA 3AP1A 5IVDA 2IYYA 2FSFA 4R1QA 2ZJAA 3NHLA 4CL8A 4LBYA 4OGWA 2C0PA 3DZCA 5KC9A 4F1JA 3GJZA 1EE9A 3ZXUB 2V8OA 3SJBA 5IS2A 1QCDA 1ZYUA 5IAGA 5LP6B 3I2KA 1C1XB 1ESCA 1NLYA 3UA3A 4PAMA 3PR2B 1HYHA 4BGEA 3WVNA 3CU5A 3L82B 5EJ7A 4YCCA 4H7EA 3CUYA 3A8TA 4M49A 3JQDA 4FZRA 4WINA 4D0NA 1R6BX 4XLLA 4M1YA 4NIMA 4MW2A 1XD2B 5FJJA 4EJMA 1MAHA 1BQ4A 1OFUA 4G25A 4TMXA 3W8NA 5JFGA 1DC8A 1VG9B 5FL7A 1MH9A 4X6LA 1LBSA 2QD3A 2DT5A 1ZM3A 2ZE5A 3LKDA 1WULS 1RCTE 1V16B 3PNQA 3BSWA 2GM9A 3HUDA 3ORHA 4DV6B 3BE5A 5K8TA 1G8KA 3PD7A 3Q7QA 4TV8F 2J07A 4PG5A 2ZB4A 3N8GA 1U8XX 3TDMA 1U3DA 2IH5A 2F8MA 3N6XA 2PVPA 1QMGA 2IZ7A 4DZRA 5BN5A 2PKRA 3KOMA 3RD5A 3GLVA 2FSVA 2FF5A 3OJOA 5HKLA 3R3VA 3NGLA 4OKSA 5FWYB 1A8QA 2FFAA 5EJGA 1O08A 3DLPX 1R0LA 3TYXA 4OSEA 2RK6A 1S2DA 5JD5A 1JX6A 1NG1A 1L7EA 4MKFA 3Q6IA 2PU5A 2EZ9A 3QITA 1YR9A 2QRVA 3SX0A 2QDKA 4EEXA 5BRAA 3TXYA 4GFDA 1PYOA 3GLGB 1P4GA 3NXSA 1KMIY 2RGNA 4RLFA 3AB7A 3ZV6A 5B4TA 1ILWA 4YV1A 4KN5A 1HL3A 1N2BA 1V1RB 4C22A 2VZEA 2GXUA 5JWOA 3OFND 1FS5A 2E85A 2OPBA 4GO1A 1QP7A 3EMBA 4KLCA 5TPZA 1I30A 2YXEA 4WE3A 2PJRA 1HLFA 1KJIA 1Q3TA 2WF9A 3OPYI 3ZBUA 1M66A 3GAZA 1MIHA 3T7IA 5D5PA 3DT8A 1U8AA 1L4MA 3C6QA 1JLKA 2Y0DA 4S05A 4OHBA 3T1VA 5JOQA 3PJFA 1P7PA 4QT4A 1XQWA 2X2EA 1AK2A 3CLRC 3Q9NA 4OQPA 2W37A 4W5OA 3CRMA 2ZRQA 2P3OA 4WLUA 3S2SA 5JZ9A 4PGGA 5K0JA 3GUYA 3JSXA 4QUGA 4RV4A 1WF6A 3E1KA 2QTRA 2ZSJA 1FTWA 4BAUA 1MB3A 2PRJA 1QE5A 3PZRA 3AHGA 3MXOA 4X6YA 2GKOA 4YIKA 5JNLA 2UUBB 1ZCZA 1Z63A 1A4RA 4EY4A 5K4GA 4L5BA 5DSZA 1VPVA 3H1PA 5C35A 3UVEA 1XSEA 4EL0A 1WY5A 3FDJA 1Z0FA 1FJGB 1V45E 2BF7A 2HGZA 3UKOA 3ZZ1A 1MHPA 4Z6KA 2Z58A 3CZ5A 2VK8A 3IPAA 1AIPA 1VCHA 1QGYA 4RJLA 3ZJYA 1XCJA 2HJ9A 3MTAA 3I09A 3KAQA 1XBTA 5K0ZA 3PJGA 2I76A 1X38A 4P58A 5L3QA 4O08A 3JQPA 3AGQA 2ZYVX 4GI3A 3N2GA 3OT1B 1BJRE 4LSWA 3M34A 3PTZA 4DKJA 4NSNA 4IFTA 1WUJS 4J7UA 4D6PA 3L6BA 4G5RA 3GFPA 5KYKA 2IYXA 3JQCA 4QEKA 4NYIQ 2V5UA 2CEAA 2XYGA 2IYZA 1T0HB 3WIOA 4CRWB 2BGRA 4H7HA 2AN3A 4KQJA 4N3NA 2J59A 3N2ZB 5AJHA 3MGAA 5DM4A 5AOCA 1EXVA 2V4UA 1L5SA 2A5GA 3MQFA 1Z15A 4DWWA 3O3CA 5KYWB 4WOCA 1R6XA 5LXTA 1AKRA 3DFFA 3LWNA 2QJTA 4GWLA 2C1ZA 3MGGA 1U0RA 1HE2A 3RJMA 3T3DA 4BIIA 2PKYX 5CD9A 2DB3A 1R5JA 1TAUA 3H7AA 4H9GA 3W06A 1O9HA 1G16A 4IOMA 4UUNA 2LIVA 1Z5GA 2PAAA 1GVHA 4ETIA 4TWRA 5KWIA 2ZWVA 1COWD 1P1BA 2H00A 3EARA 2CUKA 4WZZA 4GZLA 2JZNA 4Z9XA 1LBQA 2VWHA 2FQ1A 3AHFA 4GD3Q 5DT9A 4EFLA 5JC1A 3E5NA 4YS6A 1YVRA 5J2UA 1JYSA 1SCNE 2Z0MA 2QUJA 2VHQA 3DBRB 4JX9A 4EA6A 4YUXA 3TL2A 2JHPA 1XDSA 3RW9A 1T1IA 1Y5NA 2AR7A 3Q8WA 5G4KB 4XSGA 1N8NA 1XRRA 4DQLA 1GKLA 2POCA 5T57A 3IEXA 2MU1A 5ALZA 1UC5B