3WMGA

Crystal structure of an inward-facing eukaryotic abc multidrug transporter g277v/a278v/a279v mutant in complex with an cyclic peptide inhibitor, acap
Total Genus 222
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
222
sequence length
589
structure length
589
Chain Sequence
TGVTARRIFALAWSSSATMIVIGFIASILEGATLPAFAIVFGRMFQVFTKSKSQIEGETWKYSVGFVGIGVFEFIVAGSRTALFGIASERLARDLRVAAFSNLVEQDVTYFDRRKAGELGGKLNNDVQVIQYSFSKLGAVLFNLAQCVVGIIVAFIFAPALTGVLIALSPLVVLAVVVQMIEMSGNTKRSSEAYASAGSVAAEVFSNIRTTKAFEAERYETQRYGSKLDPLYRLGRRRYISDGLFFGLSMLVIFCVYALALWWGGQLIARGSLNLGNLLTAFFSAILGFMGVGQAAQVWPDVTRGLGAGGELFAMIDRVPQYRRPDPGAEVVTQPLVLKQGIVFENVHFRYPTRMNVEVLRGISLTIPNGKTVAIVGGSGAGKSTIIQLLMRFYDIEPQGGGLLLFDGTPAWNYDFHALRSQIGLVSQEPVLFSGTIRDNILYGKRDATDEEVIQALREANAYSFVMALPDGLDTEVGERGLALSGGQKQRIAIARAILKHPTLLCLDESTSALDAESEALVQEALDRMMASDGVTSVVIAHRLSTVARADLILVMQDGVVVEQGNHSELMALGPSGFYYQLVEKQLAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for gating mechanisms of a eukaryotic P-glycoprotein homolog.
pubmed doi rcsb
source organism Cyanidioschyzon merolae
molecule tags Transport protein/inhibitor
molecule keywords ATP-binding cassette, sub-family B, member 1
total genus 222
structure length 589
sequence length 589
ec nomenclature
pdb deposition date 2013-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF00664 ABC_membrane ABC transporter transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1560.10 Mainly Alpha Up-down Bundle ABC transporter transmembrane region fold ABC transporter type 1, transmembrane domain 3wmgA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3wmgA02
1HQCA 4LJ5A 1MO6A 2WV9A 4YLGA 1CIPA 1K6MA 2ZE7A 4Q66C 2J3EA 1IY2A 1NVVR 4FMDB 5C18A 4Q1BA 2QQEA 3B2EA 4OI2A 5FPTA 2XXAB 3RS7A 2BM1A 3ND8A 5EE5B 3QY0A 2ECKA 2ZRIA 3RHFA 4FMCF 3KJGA 4IFEA 3DOEA 3RSLA 4AWXA 3J81k 2CNWA 1E9SA 4MRSA 3QKUA 4V0NA 4QC2A 1SHZA 5D3MA 4A1FA 1FTNA 2ZRKA 5BYKA 1II9A 1TPZA 4MRPA 3X1ZA 4FINA 4EAQA 1OPXA 4B2LA 1FP7A 4DBLC 3PV0A 4DLWA 2D4HA 4XH9B 3K0SA 3CWQA 4GP6A 4DSNA 2HV8A 3D8BA 1AZTA 2XTMA 3VU9B 1IAQA 4OK3A 1KYIA 2JLSA 3A58B 3TNFA 3F0TA 4FN5A 4EKDA 1P2UA 3NG1A 3RANA 5HKKD 3OF5A 2WJJA 3K70D 3AM1A 4TLEA 3SNHA 1F5NA 3IQXA 1AK2A 3L8YA 3OHMA 1OIWA 2XTZA 3OIUA 2F3RA 8OHMA 1VECA 4TLCA 1VG0B 4BASA 2JJ1D 2ZRPA 4QBHA 4D4KA 4Q4JB 1ZBDA 4PHGA 4OYHA 3IO3A 3GLIB 1G6HA 4RD1A 4MUBA 3UG7A 2OILA 1Z29A 1A82A 2XGJA 2QP9X 4TMXA 1EFCA 5FTMA 4D0NA 5FR1A 5LBIA 3WNBA 1R4AA 3I1FA 3SEAA 4C4PA 3MUFA 2PMKA 4L9WA 3ZIAD 1RVDA 4ZCMA 5EP1A 3HYTA 1SVIA 4KFUA 5JSZB 1Q57A 1JALA 5CLQA 2ODEA 2HCBA 4KBFA 2CCGA 1ZCAA 4Q4LA 5HKKA 1P62B 2PT7A 3LO5A 3TSWA 2FG5A 3BB1A 2ZETA 2P3SA 5K8UA 3EZFA 2WOOA 2X19A 5B2ZA 1L2TA 1OT3A 2ATVA 1V43A 2B21A 1KO7A 4PPQA 2IUSA 3BD9A 1MABA 2GTPA 2KI5A 4DDVA 1GKUB 1E0JA 4L8GA 3M1IA 3SYKA 1P60A 4BFUA 2CNWD 5F2EA 3D31A 1S2MA 1SQ5A 4TYNA 4U5XA 1GRQA 1XXHE 4DLZA 1VCOA 2BMFA 3W34A 2KWIA 3N5CA 3B5JA 2KBEA 1D2EA 4G5RA 4BEBA 5KTYA 4JYCA 2QBYA 3KUCA 4F93B 1BMFA 1W48A 3ONWA 4TL6A 2D2EA 5FPKA 1S3SA 5EE3A 4TQUS 2FDCA 4MQBA 1TF7A 1KOFA 4JLNA 4LC1A 2PBRA 3C4JA 1YQTA 1R8SA 2F9MA 2ZSDA 3A1WA 5A0FA 3WHLA 3NHBA 3OEHA 1KI8A 2JLUA 1XNJA 4LJ4A 2X2FA 2G0TA 5FR2A 4ASUA 3B7GA 3X1DA 3S1AA 3L82B 1Z6TA 3CPEA 3Q8XB 4UXHA 2IS1A 3IPXA 1GIAA 3W5JA 1MOZA 1QRAA 2RMKA 3Q3JB 5JWRA 3IEVA 2GESA 3IGFA 1GKYA 3IBGA 1E2FA 4W7SA 4HAXA 5G40A 2PX0A 5B64A 2ZJ2A 5D3QA 2G3YA 4TMKA 4GDFA 3SR0A 2RHDA 2XSZA 4I1SA 4P4TA 2HXSA 1JPNA 1JXMA 3QG5A 5FBRB 2C2HA 4M22A 1IN4A 1KDRA 2EFDB 2NO7A 2PEZA 4LV6A 4KLNA 3WNDA 3SBEA 1ESNA 1VCNA 2J0UB 4TL8A 2CJWA 1KMQA 4UNSA 4TN1A 2XB4A 2ZR7A 2W6JA 4M9QA 1XMIA 3LDAA 5EXTA 2O5VA 3FE2A 5LPNA 1D2NA 4Q1DA 2VIIA 1KDOA 2DFTA 1OFHA 4R98A 1E9CA 2J46A 3B1XA 4B76A 2RKOA 2OSBA 2ZVQX 4KCGA 2C96A 4KJZA 4KYIB 1GTVA 2ZJYA 1TADA 4ZCIA 1GP2A 2HT1A 1NVVQ 1ZC4A 3D3QA 5JCPA 3U7HB 4H1VA 1JEDA 3QKRB 1LNZA 1ZM7A 3VHLB 2A5FA 2IA5A 1O87A 1UDXA 3K9GA 1YZNA 1K5GA 3EC1A 1BMFD 4G01B 4CDGA 1P2SA 3M6AA 3PFIA 4TSFD 5J5CA 2H57A 2QMEA 4A0RA 5TXGA 4UXIA 4YXWD 1W4RA 2CK3A 1KMHB 3AVVA 3I62A 1U81A 2IT1A 1E2QA 2CL0X 1RZ3A 1ZM3A 3FTQA 2ERXA 2GEDA 2Q3HA 2ZS7A 1KI3A 1M8PA 3IHWA 3FHCB 5DE3A 4K46A 1JR3D 1G18A 1MT0A 1ZNYA 5CYOA 2C77A 2LKDA 3EARA 1A4RA 2FU5C 3QEJA 4ZDIA 4FWTA 1P9NA 3HU1A 2ZRDA 2OLJA 1XEXB 2YZ2A 4XWAA 1Z0FA 2WAYA 1ZD1A 1X8KA 2CL6X 1XTJA 3TUIC 4PQRA 4HYYA 1P61B 5H68A 1NSTA 3E5HA 2P0EA 2GCOA 2BKEA 1OYYA 1H8HD 2QG6A 3O8BA 1W46A 4Q19A 2FPMA 2J0QA 2VPPA 1Z2AA 2Q9BA 2OCAA 3P1JA 4O2LA 1OXTA 2AL7A 4TZ0A 1P2TA 2VO1A 2FSHA 4OQFA 3K0CC 2GCNA 2WKPA 2ZE6A 3TGPA 5J4KA 4LCBA 4JVMA 5E4FA 3EG5A 2ZRNA 3DM5A 3TSOA 1OXSC 2XJ4A 4GP7A 4V0OA 3NC1C 2P65A 4OHWA 2ZRFA 3D6TB 1KAGA 4FMCB 1QBKC 4D0LB 3X2SA 5J47A 2A5YB 4R71A 2IYRA 4Z54A 4A15A 4CEHB 4M1YA 1GWNA 2HLDD 3CF0A 4DCSA 1YU9A 4BUJA 5L3QA 3RRMA 1KI6B 3PIRA 4B48A 1LV7A 4EPTA 2O8DB 5DHFA 3U3RA 3PEWA 2Q3MA 1LVGA 1FQKA 3REFA 3K0AA 3FB4A 3EC2A 2IEZA 2O0JA 2IC5A 5LB4A 3TRFA 1KNXA 4YC7A 4PSKA 4ERNA 1TEVA 1W36C 5EZ5A 1VMAA 4K8OA 1L7VC 3IBYA 5HPYB 1GFIA 1QHXA 4IOKA 4Z8YA 4ZDKA 5GJVC 3DO6A 1F2TB 4US0R 2ODWA 5HE8A 1E1RA 3ASZA 4G3XA 1IN6A 2IW3A 3BBPA 3MCAA 3QXSA 4LRWA 5IF9A 3BOSA 3EASA 1R5OA 2FF7A 1DADA 5FTKA 1KMHA 1XFAA 2XTNA 4DDUA 1TQ2A 4QHSA 3EIQA 2G1KA 2H17A 4MKGA 1FNMA 2IYLD 3I92A 4TYWA 1N6RA 3WBKA 4QHYA 1WBDA 2CMKA 3TUJC 3AKCA 4S2EA 4XSHA 2HXYA 4DXAA 2C9CA 2RGXA 4Q47A 3TLXA 1ZP6A 3B9PA 3B1ZA 3ZS9A 1DAMA 1WMSA 2OBNA 4AYTA 1KSGA 3KQLA 1PUJA 5EQTA 4GMXA 4IRUB 4KXFB 4QGGA 2Q21A 1ZJ6A 2KSQA 4UXJA 5FI1B 1IM2A 3SHWA 2OG2A 4DLYA 4IXMA 4DKXA 1R5NA 3CPHA 2UZ3A 1TAGA 3DHWC 1NBME 3NH6A 4RZ2A 5DN6A 1II8B 3GJ4A 1S8FA 2C5LA 5FBWB 3FPAA 5FOXA 2PCLA 4B34A 1DPFA 1CU1A 2GF9A 2ZI3A 3ZYCA 1US8B 3IKJA 3C7KA 3AF2A 2CDNA 3NWJA 2J1LA 2WHXA 2F7SA 2O8BA 1LB1B 1CR1A 1SXJD 2FWRA 2ZVPX 5AJYA 3UWOA 3KL4A 4E03A 3WYGA 1XEWY 2FJUA 2QGNA 3HJNA 4KSCA 5DI3A 1ZW6A 3QPUA 2VP5A 4WOPA 2XZOA 4EPVA 2O0HA 2R6CA 4E5UA 1CRQA 1E9AA 2MSCB 5UKDA 2IYXA 2D7CA 4A82A 1OKKD 3AF1A 5FPHA 1XF9A 2LWIA 4XSGA 4F4JA 2EWWA 3GP8A 1E79A 5DLQC 4FW9A 5JJKA 3GLHB 1I2MA 2QENA 2BJVA 1KZGB 5HE9A 2ORIA 4B43A 1XXHB 1N3BA 2Q9CA 4AYXA 4PANA 1UBCA 4X8HA 2W2TA 2GA8A 4GRAA 4JT4A 1N5JA 3SN6A 2EW1A 4DIDA 1UBGA 1G3IA 3BERA 4M8NE 2CHQA 1KI7A 4NDZA 1NVWQ 2QM7A 2R44A 1XEXA 4NCHA 3GLHE 1NMXA 4M4SA 2A7QA 4ZPXA 2X77A 1SVWA 5FUVA 2PMDA 1WXQA 4I4LA 4DSUA 1GRRA 4XOIA 4NYJQ 2IF0A 1W4BA 5KSYA 3GJXC 4Q1CA 2QBYB 1IONA 1G5PA 2DPXA 1OYWA 2G0NA 5DHAA 1N6LA 2OAP1 4C30A 3ZZ0A 2BEKA 2FA9A 2XZPA 2CHGA 1FMLA 1ZUNB 3JVUA 4PC6A 4I1OA 3NBZC 2ZJ8A 2JASA 1NN3A 5BXQC 1IQPA 3KJEA 4E22A 3HWSA 1ZU4A 2WSSA 3RVBA 1E32A 1SVKA 2R62A 3W3AA 1AN0A 3CZQA 3EZ2A 1W36B 1G4UR 3SOPA 3U61B 2FNAA 3PCRB 2FGKA 4A0GA 4LPKA 2N46A 1ZAKA 4WXRA 3UWKA 1G3UA 2DFLA 2ZJBA 3GLFA 5SZHB 2H5EA 4AG6A 2YOGA 6Q21A 4LYAA 1NN0A 1XTIA 3NBYC 1CR2A 5EE1A 3ZD6A 1NF3A 4LV8B 3K8YA 3ZH9B 4NONA 2WIAA 2RGNC 4N0DA 2DHRA 4QKQA 1RRCA 3LVRE 4QJ4A 3TJZA 1S9DA 5TY0A 1WCV1 1R0WA 1T0JB 4B75A 3BH7A 3BFXA 4BLPA 2VH5R 4CIDA 3B1WA 4C7OB 1E0KA 4LBYA 4BPBA 4V0ME 2IYUA 4HAVA 3B13B 1YZTA 4LHYA 1J70A 4FCWA 3ZVMA 2DCUA 3UMRA 4A2PA 2RH5A 3QBVA 2QTHA 1EESA 4TL7A 4EPWA 3BIFA 5KHOC 5JFGA 2ASEA 4UJ5A 4M9ZA 3RDPA 5BW8A 1XDBA 2CL7X 2VP9A 3A37A 1T3SA 1VG1A 2YWFA 3Q9LA 4TT3D 5E95A 4BGDA 2GWHA 4DC9A 3GJ8A 2P67A 4OQLA 2DBYA 4QGFA 4AC9A 1KO1A 4Q7KA 4LPSA 4AYWA 2QE7A 4QM6A 621PA 3I8XA 1GKIA 1R10A 5DI3B 3LBHA 5SZKB 3CRMA 4PZYA 1YR7A 2I1VB 2GVDC 4P3YA 2CJWB 3MGCA 4N0EA 4AD8A 1NMYA 3THXA 3H0KA 4ACBA 5EJEA 1G21E 4G0NA 4LC0A 4DEYA 1A5TA 1U8AA 5B30A 5HZHA 1XRJA 3RC3A 5KNDA 1JQLB 4MH0R 4XWKA 2PL3A 2FOLA 3LXRA 1MR3F 5JRZA 4S35A 4MYHA 4D0GA 2A2ZA 4C2TA 3W8NA 3OE7D 4OQXA 2AKAB 2VYFA 2RGAA 4TTPA 1M74A 3TW4A 2IWHA 1GDDA 4B3GA 1XCPA 2ZUCA 2ZTSA 2BHRA 1E2PA 1EX7A 1E1QA 4Q9HA 2ZAOA 2W2VA 4DLUA 4GL2A 1WE2A 4LJ6A 3PUYA 1E4VA 2QI9C 2QT1A 2ZSEA 3CNNA 4OQMA 2GZHA 3CONA 5L3SB 4Q03A 1LS6A 2RAPA 3T34A 4ZKDA 2J0UA 4DUGD 1HH4A 2D06A 5JSZA 1UFQA 2EFGA 5J4YA 5AR1A 4A2QA 2HYDA 2J59A 2MMCA 3FDIA 1JNYA 2F55A 3AH8A 2SHKA 3R20A 5HR5A 3CF2A 5CDFA 4PO1A 4YMVA 2MSEB 1G41A 4MGZR 3Q7QA 2YINC 4GBMA 4M9SA 4EJSA 4XVUA 1ELOA 4AKHA 1MABB 2WPDD 1KK0A 3EIEA 4JSYA 1R0XA 1DO2A 3VNUA 3WMFA 1P6XA 2AD1A 2BCJQ 3K53A 4JLMA 3RS0A 1HV8A 1Z07A 3HYRA 4I99A 2QP3A 3BORA 4QGHA 3RAPR 5BN4A 2VRWA 4L5BA 1KKLA 4BLRA 1BOFA 4Q4JA 3W90A 4EDHA 4AI6A 2KBFA 4CRWB 1E2IA 1Y3AA 3AV0B 1DAEA 3QXJA 1RYFA 3I4LA 4URZR 3V00A 1EFUA 4BFXA 3U44B 3F3YA 2GBLC 2ZI9A 4A2WA 1L8QA 4DSOA 2V7QA 4CF7A 2F1RA 3VTKA 5JI3E 2RB4A 2WICA 3EZ7A 1AGRA 4NYJR 3U3KA 1FX0B 1GSIA 1FPMA 3ADKA 3KB2A 4HB4A 2DY1A 2YJTD 2ZSAA 3QXXA 4WVFA 1Z2CA 1M34E 2GF0A 5DGXA 3M4YA 3W8RA 1RE0A 1X3SA 4OI0A 1LF5A 1OF1A 2GJSA 2IYVA 2PJRA 4M1SA 3GJ5A 2L0XA 1C9KA 1N2CE 4G5OA 1GG2A 2QMOA 2RGDA 2P2LA 4GSYA 3TIFA 1SVOA 4JBWA 3ADCA 4W9MC 2QAJA 1W4CA 2W00A 1QG4A 3KKOA 5JEEA 1PLLA 5JEDA 1DEKA 5JHHB 4MDEA 1MKYA 4NPHA 4F4CA 4QM7A 1AKYA 3RS4A 3C15C 2AXPA 2O8CA 2DWQA 3WMGA 2ZI7A 3QXCA 3EA0A 3FWYA 1W1WA 3H86A 1DO0A 3I8SA 4JLOA 4LUCA 4OJQA 1E2JA 3VAAA 2V4ZA 4A8JA 3KX2A 4QL3A 1G6OA 2VP6A 2P5TB 3UIEA 4L15A 2IX3A 1XPOA 3ZJYA 2YOHA 4AURA 5IK2D 3U3MA 1TF2A 1A2KC 3QG1A 3ZZTA 3TAUA 2G83A 2H16A 4HSEA 3KQUA 1BH2A 3T1OA 4Q1AA 4W5WA 4IEIA 1NLZA 4L9SA 3TQFA 1FX0A 2O0KA 1OB2A 4W5HA 3ZLJA 4Q48A 1P7CA 5GVRA 1FP6A 2K5UA 4KLZA 5IDVA 4LYHA 5FBVB 4LJ9A 4ZIRB 1Z0AA 2DFNA 2ZQ5A 3QKRA 3AEZA 1I2DA 4DWJA 5C4MA 2DB3A 2V6IA 1XTSA 2WJHA 3CF6R 3LQQA 5JWHA 3CKLA 1WDTA 2ZRAA 1E94E 3THYB 4CEIA 2NG1A 3ZVRA 2NOAA 2ANBA 4ZKEA 3AKDA 4EJSC 3U4QB 1KY2A 1OH7A 3QKSB 2JAQA 4C3ZA 3HPRA 4WXPA 4XTRA 1P72A 2R6AA 2R65A 2VHCA 2O52A 2NO0A 3KKPA 4O3MA 3BGWA 1T91A 3R9WA 2YOFA 3GLHA 4P0TA 3AP3A 1RFLA 1XP8A 1KK2A 4UNRA 1XWIA 4C0SA 1S3GA 3IUYA 2YWGA 3IILA 2GJAA 5K8IA 1E2EA 1SVMA 3OIYA 1W2GA 5FOUA 1G19A 3LV8A 3UANA 2EFHB 2VSOA 2JIZA 1VHTA 4PTLA 2YC4C 1FW6A 2WJGA 3RRZA 1MO5A 4MYUA 2BM0A 2REXB 4M9XA 5G3YA 1DAFA 3E2IA 2NTYC 2C9OA 3PUZA 2CHVA 3AVXA 1W47A 1ODFA 4LSGA 1YZGA 2CLDX 4DHEA 1CXZA 2FFAA 5HZKA 4KBGA 2CE7A 4IVQA 1KJZA 1N0UA 2XEXA 4FCVA 2GCPA 1ANKA 4Q7JB 3LNCA 2JA1A 4PPFA 2W83A 2VHJA 4CZ2A 5EUQB 1M7GA 1YJ5A 4Q7LA 5KYKA 1CR0A 2P6UA 2Z5FA 3R9IA 2WIBA 4FWIB 4KFRA 4X8MA 4EJSB 2F43A 2B6HA 2C99A 2GNOA 1E0SA 2ZYWX 1UADA 3VX3A 2GJKA 3GEHA 3ZGXA 4JJZA 3ICEA 4D80A 2D2FA 4TSFA 2FEOA 4UJ3A 1P9RA 3AF4A 721PA 1Z83A 1ZM4A 4BFWA 4XD7A 3CR8A 5FL7A 2ORWA 3LH5A 4RFSB 1R7RA 3WBJA 2AX4A 4B73A 2FFHA 3MJHA 5AJXA 4H9GA 1P4SA 1SXJE 5CK4A 4WBSA 3PEUA 3CPJB 5ELXA 5H70A 3RLFA 3EIHA 5FFMA 3RYTC 3K1JA 3WHKA 4F7WA 4PO9A 2V6JA 2BV3A 1G7SA 2CCKA 3VR5A 1NI3A 3IIMA 4DCTA 1NBMD 1B0UA 1XMSA 2AHOA 4G5QA 3AGQA 4A92A 3OFNA 3RC8A 4KO8A 1VTKA 3CH5A 4POAA 3CX6A 3FVQA 3TW8B 2QPAA 2F1IA 1H8EA 1G1MA 4YMSA 3CH4B 1G17A 3SE0A 1KIMA 5L3RA 5GVSA 5CYPA 3EWAA 3FMIA 4ABYA 1BO6A 4M2LA 4Q1FA 3K70C 1R0ZA 2FSFA 3CNLA 3C5HA 4Y0VA 4URXR 4EPXA 2VHUA 4BLQA 3KQNA 4OHXA 3THXB 3AVYA 4JVNA 4BZXA 2VP2A 4B3XA 1UEIA 2D62A 3B85A 1QVAA 5LB2A 4M21A 4P32A 3BJIC 1J8MF 3T1QA 3X1XA 2B8TA 3AKEA 2VHTA 2E87A 3C41J 4HI0E 2ATXA 1MO3A 1ETUA 2JLVA 3NBXX 4CGZA 3A6PC 1S1MA 3H1TA 2WSMA 3VU9A 1U0JA 4A0HA 1ZCBA 3IIKA 3SYLA 3IPYA 4DVGA 1E1RD 3ZVLA 3VR6A 1SGWA 2ZI6A 3C16C 3R9XA 2Z0MA 3TVTA 2QORA 4FCTA 4HB3A 3FKSA 3QI2A 1UBFA 3UATA 3UKDA 4B3BA 1KI6A 2OBLA 5F9HA 2QRNA 3VR4A 2QU8A 2VSXA 3REGA 3Q7PA 4DT1A 1E6CA 1JJVA 3P26A 4NYMQ 4ZO4A 3DMDA 4M1WA 2G6BA 4IVRA 3PUWA 2FZLA 5AUPB 1XB2A 1XMJA 3RWOA 3TR5A 2XX3A 3K9NA 2O8EA 2ODBA 3NHAA 3PG5A 3CX8A 2YC2C 1VYVA 4Q9JA 1UEJA 4QG7A 3SJCA 2ZS9A 3KKNA 4IOLA 2W58A 4KI0A 1R2QA 2YYZA 4OL0A 5AWFC 3SBDA 3GLFB 4NE2A 1TF5A 2CLSA 4QXAA 1NVXQ 3NKVA 1N6KA 1Z0IA 2JEOA 3U7EB 3I5XA 3MD0A 5DI9A 2HJGA 2R2AA 1ZMXA 4TZ6A 2PX3A 1NRJB 3CLVA 1TX4B 1HE1C 2W2XA 4FXPA 4URYR 4D26A 2QQ0A 1P2VA 3BFKA 4LBWA 2OFOA 3TR0A 3A1TA 2QPTA 2FEMA 2QAGB 4BRWA 4URVR 3SC3A 3SDZA 4EIWA 2WJVA 3B78A 1LFDB 2IS2A 3U3JA 3W3ZB 4R2HA 2H92A 4BFZA 3H84A 1XJ0A 4J0QA 5K8LA 1GL9B 1U94A 3SJZA 3PENA 2FFBA 3DEFA 1ZNZA 4KODA 4Q9IA 4A8JB 2ZU0C 2WMOB 4LJAA 4DLTA 2W0MA 3T5DA 2WWIA 2X8AA 4JKYA 1E0AA 2O8BB 1DG3A 1TNDA 1Z63A 1G9XA 1M7HA 3RS3A 2OCPA 2Z4RA 5BWMA 2OESA 3WY9A 2Q6TA 2ZE8A 5CIQA 2OZEA 4C0BA 1E1QD 4RZ3A 4KU4A 4IHQA 3NIBA 4GZLA 1KDPA 1G3QA 1N6HA 3WNCA 4PQYA 1XXHA 1U8YA 4DLSA 5GADl 1I4TD 2GXQA 3GLIE 1GZSA 1KI2A 4HAYA 3T1VA 2AWNA 1U8ZA 3G82C 2ZAMA 3OE7A 2A9KA 4LZZA 3NDBB 2CVHA 4B2IA 2J7KA 4Q1EA 3NEYA 1K5DA 3V4RA 3QPWA 3QVVA 4F91B 1QHIA 5G53C 4DLVA 2C04A 1SZPA 2GDJA 2D7DA 1S96A 5JMTA 1Z06A 3CIOA 4TMWA 4V0KA 3AVPA 3GEIA 4HLUA 4JLAA 3LW7A 3QF7A 2XB2A 1OXUA 4JT2A 4GOXA 1T4GA 3PUXA 1G7CA 2W6ID 1IN8A 5JRJA 3A1UA 2YNMA 1SKYB 2X2EA 1XTKA 3THOA 4WZBE 3UG6A 5FOTA 4Z51A 4A36A 4F38A 1KZ7B 1QHSA 1G20E 3SJAA 4R7ZA 3ADBA 1G8FA 2W0SA 1GAJA 1M7BA 1G8GA 1RJ9A 1XZQA 3I72A 4TWZA 4LV5B 3I32A 1AA9A 3GFPA 3OAAA 1KNQA 3AKYA 4C0KA 1G3MA 2IHYA 1Z0JA 1Z6GA 2R8RA 3Q5DA 1Z6AA 2Y8EA 1Q3TA 2ZRGA 2V3CC 3FHOA 3X1YA 4YDHB 4YQFA 3UPUA 4NTZA 5AJZA 1W49A 2CCJA 5FOWA 1TEXA 1OJLA 1COWA 1NLYA 5KUTA 3K0CA 1JBKA 1NSFA 5IT5A 1XD9A 3AB3A 3GFTA 1XEFA 4C0LA 1LY1A 2OXRA 5A5GA 2OO7A 3GLGB 3OEEA 4EPYA 5L3SA 1HT1E 3NBFA 5K8TA 5A4JA 2QA5A 3OAAD 4MDFA 1US8A 1LTQA 4IOMA 4WAUA 3K70B 1TUEA 3SS8A 5E7IA 1F2TA 4DDTA 1X86B 4C7OA 2NGRA 4FMBB 1A1VA 3WMEA 4PR0A 4V02A 5EP2A 2C95A 4BFVA 3DM9B 3ZS8A 3OEHD 2A5JA 2ANCA 3QNUA 4C0QC 4LGMA 2YV5A 5JI2E 4U00A 2JJ8A 3C14C 1D2MA 1J2JA 4DEXA 4BLOA 3TKLA 2RGGA 5CIWA 3L2OB 2RGEA 1TUIA 4TQ9A 3KDSE 1WF3A 4MRVA 4B3FX 4BLSA 5C46F 2O8DA 4B3DA 4ESHA 5KSOA 1U2RA 1GNPA 2XSZD 3BH6A 2QL6A 4DDWA 5KNCA 4Z1MD 3CO5A 2PLRA 4HLQB 4A8JC 4NYMR 4MGYR 3R7WA 4LBZA 1YZLA 5DYGA 4X8OA 4RJLA 3DKPA 4EPRA 4AG5A 1XPUA 2OFXA 3B8HA 2Z43A 3O47A 4LJYA 2BKUA 4RY2A 2LCFA 4RCZA 2NO1A 2QAGC 2QP4A 4DZZA 4LYJA 1DAHA 4UNPA 5FBQB 3T35A 4B47A 2WWYA 2IYSA 2VSFA 4B44A 5JJIA 2GAAA 2REBA 1PLJA 2QY9A 1KAOA 1SXJB 4BEJA 2FH5B 2V1XA 2NPFA 2ZRBA 4FD2A 3CRW1 3TE6A 2C9YA 4LHXA 4QRHA 4A9AA 4D4JA 2FX3A 4XWOA 4MRRA 3N2EA 3GJ7A 1CJTC 2OT3B 1RYHA 1AQYA 3VKWA 1CULC 4WZAE 5EXPA 4PQFA 4GZMA 2IHBA 5LDDC 2C98A 3LVQE 1G5TA 1NVUQ 1SXJA 2ZUBA 4AKEA 2GKSA 1CKEA 1ZC3A 1O3YA 2BEJA 1SULA 1W5TA 1IN7A 4UNQA 2JJ1A 2NZ8A 1M1YE 1W0KA 2ZM5A 1FUKA 1XD8A 2ORVA 4JL8A 4R9UC 3GEEA 4RD6A 4ZI2A 3TUZC 1EWQA 2BBWA 1W2HA 1QG2A 2WWXA 3GD7A 3U7FB 1V5WA 1AS3A 1F48A 1W4AA 1ZU5A 2E9SA 2V8OA 2ZREA 1XD2B 3O8CA 3THWA 5FUXA 3FOZA 1U0LA 3LBIA 5CDFE 4GT1A 3SU8A 5CJPA 1WRBA 1OFTA 4PC3A 3EZ9A 5FH9A 4OHZA 1VIYA 1IY0A 3AUYA 2WVJA 1N0WA 2BVNA 2ZSBA 1D6JA 3WYAA 3F8TA 1R8QA 1DAGA 1T5IA 2PCJA 4HAZA 1UBEA 4ZCLA 2B7BA 1ZIPA 4ZDJA 3CRQA 1CEEA 2A5GA 1CRPA 2WAXA 1KHTA 5CB6A 5KSZA 3FKSD 5JECA 3EX7C 1EGAA 1Q0UA 2A3RA 3P4XA 5EUMA 4GNKA 4C0HA 3EPKA 1UM8A 3IDQA 1SVSA 1IOZA 1KJWA 2HYIC 1DG1G 1QHGA 2GVZC 2W6IA 5EE0A 1AKEA 3FMPB 2VEDA 3G0HA 1X1RA 5JS7A 5DISB 2YWHA 2ZR9A 2WBLC 5BYJA 4ILEA 5HCIA 1OH5A 2C8VA 2FV8A 2VF7A 4ON9A 4CYMA 1QF9A 3E1SA 2QT0A 1T5LA 3LXXA 3MJRA 3T15A 4B2PA 3D7MA 4CT4B 1XCMA 1E99A 5EP3A 1R5BA 3CNOA 4EUNA 3V9PA 4U7DA 2AWOA 1P5ZB 2D74A 4TMTA 3ZQJA 1Z47A 4LHZA 2ZROA 3IO5A 3NXSA 4PHHA 4TMVA 1GL7A 5E3HA 2REOA 3DPUA 4QBIA 3DDCA 1U9IC 4B35A 2YWEA 3MSXA 1OH6A 2IS6A 3CW2A 4I81A 5HCNA 4JMPA 2MSDB 4UNNA 1OHHA 4Q18A 3VR2A 3T61A 4M1TA 4DLXA 5KPJA 5C1BA 4Q21A 1W0KD 2PEYA 1UAAA 4HDQB 2CVFA 4JLPA 4MKFA 1JI0A 3GCGA 4Q4AA 2MMGA 4US1R 2V7QD 4IOJA 2EYQA 4D2IA 5BN3A 2GEUA 2HF8A 1OXVA 1N5IA 4TT3A 2RGBA 2JLXA 2HCJB 1QVRA 1NKSA 2VP0A 1G3RA 1UKVY 1C4OA 1H8HA 3LBNA 4LJ7A 3RS2A 5B58C 1J90A 2HDNB 3B60A 5KDDA 2XOKA 1OFUX 5AUOB 1G5RA 2BMEA 4TYYA 4NCNA 2OV2A 4TTQA 3MRSA 3ADDA 2PZGA 2ODNA 4C0JA 5JZVA 1PZNA 3KKMA 4U02A 3QUSA 2BMDA 1MO4A 1Z28A 121PA 4DRZA 3EPLA 4HEJA 1PLKA 4EFLA 1GUAA 1YZQA 2WPDA 4BRUA 1U0HC 1AIPA 1TQDA 4DIEA 3NTUA 2N42A 2NIPA 1Z5ZA 1J99A 3PUVA 4M1KA 4Q4AB 4B3CA 4IVPA 2PZFA 1CF4A 5LD2C 1VIAA 1NJGA 3SQWA 4IDHA 4Q9LA 4M0LA 1N25A 1II8A 4RKEA 5TDHA 3GLFE 5KOYA 1ZM9A 3KUDA 4E09A 1KK3A 5FUWA 4Q9KA 3U60B 5SZJA 3QKSA 4B71A 4PAOA 1E2GA 1JPJA 4AKIA 3U4QA 1A7JA 1AGPA 1DVRA 5B57C 1WB9A 1KK1A 5CLLA 4Q7MB 5DNYB 3A36A 4QNMA 2ZS8A 1G7RA 1WBBA 1G7TA 2I3BA 3GMTA 4ITRC 1DBSA 1E9DA 1TQ6A 1S0UA 4MUAA 1W0JA 3CRVA 5TV2A 3AVWA 5F9FA 2B8WA 2PLFA 4A6XA 2XNDA 1PVOA 2A5DA 5CM8B 1C1YA 2EVWX 4WW0A 2UZIR 1Q21A 3AP2A 1CJVC 3KQKA 2TMKA 4QHTA 4BLTA 2IUTA 5KO2A 1Q3HA 4NYIR 1ZUIA 4P33A 4NMMA 1HA3A 1G64A 4IKEA 3C8UA 2WTUA 4YMTA 1DOAA 4OBEA 2GAOA 1S4QA 2VP4A 5DYIA 4Q4HA 1JR3E 1FUUA 2F6RA 2XJ9A 1OFIA 2QTVB 2ZUDA 2V55B 1R0YA 1KY3A 1IXZA 1ZUHA 3BB3A 4HATA 3R8CA 4D4LA 5AK0A 4L16A 5ANRB 5TMPA 1U98A 4XVQA 2Z83A 5L3VA 4OHVA 4KHZA 4Z1MA 2FPLA 5H8WA 3MWLA 4RD0A 5JS8A 2JLQA 3KZ1E 4JIMA 1SVLA 1AQUA 4A6PA 3HU2A 4HAWA 4BZQA 2RHMA 1OKKA 4JBYA 1Z0KA 421PA 4MA4A 2R6DA 3VNVA 3OFND 4PHFA 4TQAA 4MITA 1P75A 4JJKA 1X1SA 1Z0DA 2WOJA 4LY6A 2H7VA 4PO8A 3KQHA 1UKYA 2ZYUX 2IEYA 3LY5A 3U6BA 2XXAA 1RW4A 1T0HB 1S1CA 2GETA 1NBMA 521PA 3NVAA 2DWPA 4M1OA 2WKRA 2IXGA 1TU4A 2ZJ5A 4RFVA 4AK9A 1X6VA 2OUKA 5KNBA 5TVKA 2J7PA 2NPIA 4MRNA 1L4UA 3H4MA 1EFHA 3ND9A 1E4YA 1UKZA 1AS2A 2BBSA 1IY1A 2JDID 3FFBA 1EFTA 3UXMA 1FZQA 2IYWA 3THYA 4CEIB 4PAQA 1CP2A 4LBVA 1NNEA 1OHHD 2ZI5A 4US2R 5FL7D 3K09C 2IXEA 1GL6A 3VKHA 1I4LD 1RRGA 1HQYE 2ONJA 1ZRHA 4C9BA 4C2UA 1WP9A 1KO5A 1JB1A 2BBOA 2D3WA 3I3SR 4O0MA 4Q01A 4RD4A 4RD3A 3LRPA 5EXSA 4NP6A 3UMFA 2QEQA 1NN5A 1G4AE 4XIGS 2GBLA 4KAXA 3F5FA 5G3ZA 4ASUD 3AVUA 4M53A 4DCUA 2X1VA 2QMHA 1E69A 1R6BX 3KXLA 4HUQA 5FTJA 2WWGA 1E3MA 2XNSA 1M2OB 3P32A 3IQWA 4JSTA 4D6PA 2ZXUA 3Q85A 3L0OA 1DARA 3VFDA 3PQCA 4B6EA 1HYQA 5J40A 2F9LA 1G8HA 3TQCA 4KSBA 2IXFA 1GM5A 5P21A 2PH1A 2O8FA 3K0FB 1U9IA 2J41A 1D9XA 3BC1A 4QOSA 3CB4A 3QEOA 2FFQA 2FZ4A 3TVDA 2ZEJA 2ZIAA 3BRWD 4QBFA 3EZ6A 4YONB 2HEIA 3TAHA 5F3WB 3EPHA 1E9EA 1XZPA 3QF4B 1E9RA 3Q5EA 4G1UC 3W6NA 1FFHA 3GJ3A 3THWB 2AFIE 2RGCA 4UQOA 2E1RA 4JLJA 1TMKA 1XJCA 4KITB 4WA7A 1UKEA 3G5UA 4W5JA 2ZYVX 3RRNA 3PJRA 2VHQA 2QRZA 2QSYA 3W9YA 5IHPA 1LF0A 1LW7A 4LHWA 3ASYA 2JGNA 3QSYA 3FMOB 1Q20A 2AXNA 3QF4A 2EYUA 5E7MA 1AS0A 1ZM2A 4P4SB 4Q4HB 3C5CA 3ICQB 3KB1A 3HR7A 4HLUC 3OIWA 3B1VA 1KO8A 4P31A 3TMKA 4JVSB 2IYTA 4FMDF 1DAIA 2XOKD 2NO9A 5CITA 1VYUA 4QBGB 4Z8XA 3K9LA 3AVOA 3HP1A 1PV4A 2F1JA 5AJWA 2VF8A 2H8KA 1XX6A 4WIAA 2CBZA 4JBXA 4TLBA 1W7AA 3MWYW 1DTSA 3HDTA 3NH9A 4KVAA 1XPRA 3T12A 1SHKA 2HJVA 3U3OA 3GLIA 1CJMA 4LWZA 4DSTA 1VHLA 1RIFA 4EFMA 1YRBA 3L8ZA 4NYIQ 5AUQA 1KSHA 2KB0A 3LQRA 4JLKA 1VPLA 1IJFA 1HURA 2XITA 3BB4A 4NHOA 3VKGA 4IDPA 3PR1A 3BFVA 3EPJA 3I73A 1ZD9A 1E2KA 2C03A 4IDNA 1UDWA 1QHYA 3VR3A 1LS1A 2NZJA 4G5SA 2OBMA 3K0FA 2DFKB 3KKQA 4MKHA 4HB2A 4LDJA 3V4FA 1BKDR 4G5GA 4QNRA 3ZZUA 1IJEA 1P3JA 3GQBA 2QZ4A 2VBCA 4YXWA 1D5CA 5EE9A 1Q1EA 1EG7A 1GRNA 5EZ6B 5KSPA 4V0MA 2GXAA 1NG1A 5LD2B 2JATA 3BE4A 4E07A 3K0EA 2IL1A 2G77B 3A1SA 4FI3C 4L4UA 2N1BA 4LX0A 1EFRA 4FIDA 4KFSA 2GXSA 2KJQA 1K8RA 4GI7A 2FMXA 5FBLB 1X8LA 4TTRA 4QJ3A 2BDTA 5SZIA 2A30A 3SYNA 1Q44A 4YMUA 1GILA 1HT2E 1VG8A 2HUPA 3A8TA 1Y63A 1WQ1R 3CX7A 2EU8A 3OESA 1II0A 1T6NA 2AR7A 2HF9A 1MV5A 2G88A 2J5XA 1QHHA 1OSNA 2QMUA 4JLVA 1KTVA 3ZVNA 3OEED 4D81A 4JLDA 3IHLA 2G9NA 4CEJA 3SQXA 4PHTA 1JAIA 5M04A 3A1VA 4MYTA 1BYIA 4YDSA 1HEIA 3UK6A 3KXIA 4TLDA 4AIIA 1E2HA 2DWOA 4BFYA 1DS6A 5JCZA 4TLAA 3MWJA 4XD7D 1YHNA 3KTAB 3P4YA 2J87A 3QE0A 3KFXA 4N3NA 3QKTA 3VX4A 3N70A 4DCVA 1XD2A 4PSAA 2Z4SA 3JZMA 2QGZA 2PZEA 2JLYA 2P6RA 2IBMA 3DMNA 2BWJA 1MH1A 2WM9B 3HR8A 4IFBA 2RCNA 3PEVA 4I1UA 4CEJB 4JKIA 3MWKA 1HE8B 2FE4A 3IEUA 2F1HA 1YZUA 3LLUA 5L8VA 3WP1B 2ZJZA 2OFWA 4PFSA 3SFVA 4TYPA 3QPVA 1TU3A 1F6BA 5D3MB 1SKYE 3K9HA 1KSFX 5FOSA 4ARZA 5J4HA 5JWOA 3JZAA 3O8DA 3U44A 2GCOB 2IS4A 1JR3A 1ZIOA 2NMVA 3BH0A 4B6FA 3GJ0A 2QAGA 4IEEA 1N5KA 2ZRJA 2A78A 2V54A 3SHFA 1ZNWA 3MAAC 2EFCB 4JL6A 3R7WB 3PITA 1SXJC 2Q0HA 1E2DA 1G291 1OIXA 1GOTA 3I5YA 1TL7C 2WZQA 1JQJC 4OJKA 2BMJA 2FN4A 3MG9A 3W5IA 2WWFA 3QQ5A 4B74A 2CK3D 3SI7A 3T06B 3GLGE 2WSSD 3U6KA 4DLRA 4NCJA 3CWZA 1NY6A 2FGJA 1XU4A 1JAHA 3B6EA 3ZQ6A 2R6FA 1T8UA 2RGNA 1QHHB 1A2BA 1NP6A 1YE8A 2OLKA 4EQ6B 1CBUA 1KKMA 2UKDA 3DOFA 3LX5A 1BYUA 4BFSA 3GLGA 4N1AA 2FPKA 2ZRMA 3KFVA 4CW7A 2OM2A 4PC2A 3MFYA 3O8RA 2EFEB 4NKRA 3VQTA 3T5GA 2BC9A 3TSZA 1WA5A 3FGNA 4OKSA 4M1MA 2G1JA 2VQSA 4URWR 2OEPA 4QGAA 1IHUA 2ZRCA 3CZPA 3N2IA 3X1WA 4D25A 3IIJA 3SJBA 1JJ7A 4GOKA 3DZ8A 1OLOA 4OI1A 3HU3A 1RJ9B 3WP0A 3L43A 5FL3A 3S1AB 2ONKA 4DB2A 3GJ6A 1EX6A 4V0LA 4LHVA 4AKGA 3PXGA 4RSGA 4PXAA 1E79D 4KVGA 1T3HA 2B7CA 1KI4A 2BJWA 2JLWA 2FSIA 2R9VA 2I1QA 1FOEB 5J4LA 2VL7A 4BE7B 1GVNB 1NJFA 5KU1A 1KSJA 1VCMA 2JCSA 4A0FA 1HUQA 1G16A 5TB5A 1YR6A 3SFZA 2ZJAA 3L0PA 3RNLA 4F92B 3PEYA 2GJ8A 1UPTA 1MRSA 2JLZA 2CE2X 5DSZA 3RS5A 2ZSFA 3LFUA 3U2QA 2I4IA 5GJCA 1KO4A 1OXXK 4PX9A 2Q3FA 1FTSA 1OV4A 2ZANA 1RKBA 1E2LA 3CM0A 5AUNB 1AJEA 1KI9A 1GITA 1KJYA 2OE2A 1GNRA 3FYHA 3FHTA 5GJWC 3B82A 4TYQA 5IK2A 2YVUA 1EFRD 3CRRA 2VLIA 1ONBA 4IDOA 3CUEF 3RRYA 1IN5A 2KE5A 2IYZA 4NCKA 1BS1A 1YRAA 2OCYC 4LK2A 1CLUA 4KYUA 5FOVA 2IWRA 3W6OA 2V1UA 1F60A 3MMPA 3LW8A 2P5SA 4MGKR 4PC7A 5FPSA 1JEEA 4JLBA 1D9ZA 1QDEA 3P27A 4IJMA 4BZPA 4Q02A 4XTCS 1U99A 3ZDQA 4B32A 4D4MA 1VKJA 4P4SA 1F3OA 1UJ2A 4Y0AA 4HLCA 3QJYA 4JZKA 1B23P 1DAKA 4CVNA 2ZYTX 4HUQB 3A4LA 3DZDA 3CBQA 3BS4A 4ZV4A 2QUZA 2GK6A 1RRPA 1W36D 4R2IA 1BIFA 1S9HA 3JVVA 4RCYA 3AF0A 1F2UA 5JLJA 5AJVB 4II7A 3EW9A 1XCGB 5L3QB 5JHGB 4DB4A 1N6PA 2ZRHA 3AVQA 3WYFA 2EWVA 4YMWA 4HLDA 4HDCA 3KJHA 3K0AB 821PA 5KDOA 5C2JB 4QJ5A 3ZIAA 1HY3A 4PPNA 2YHSA 4LI0A 5EXXA 1OW3B 4HDOB 4OQNA 1TQ4A 2QPOA 3EA5A 4TL9A 1I4DD 2AD5A 5GJBA 2O8FB 2Q9AA 1YVDA 2AKYA 3EXAA 1EWRA 3H2YA 3Q72A 2LKCA 4PSVA 2HT6A 3B9QA 4HZUB 1MRNA 1E2NA 1F2UB 3LWNA 2VA8A 2HLDA 2BOVA 4QFMA 4RFSA 4V03A 5BQ5A 3LLMA 1XMVA 4MKIA 1TTTA 3GFOA 221PA 1ZD8A 2GJ9A 4OI4A 4GMDA 3U5ZB 1EXMA 2WJIA 2GEVA 2IF2A 2EQBA 1NIJA 1AZSC 1XTQA 1E9BA 4RZXA 3FFAA 2QSZA 1U90A 1Z6YA 3R8FA 3MLEA 4NZYA 4RD2A 3WRYC 2JLRA 4BFTA 4F4IA 2OXCA 2DR3A 4URUR 3L0IB 3EAQA 4KV9A 4A4DA 4RKFA 1RC8A 5KPDA 2P6NA 4PZZA 1OB5A 3EWSA 5CK5A 1YZKA 2IYYA 3OIVA 2WKQA 4NBSA 2QROA 2QM8A 4UKDA 5EP4A 4DUGA 4RVCA 2FSGA 3VHXA 4OK6A 3VMFA 1OE0A 2GHIA 2R6GA 3FKQA 4MGIR 5HTKA 3B1YA 1E2MA 3DVLA 3QIAA 1XBTA 4LJ8A 5JJLA 3AQ4A 4NCIA 3AP1A 4NL4H 2XAUA 1NN1A 2IUUA 1GNQA 4PC1A 3QXHA 5E7JA 3T1TA 2QE7D 2J0VA 1OIVA 5C4GB 2ZR0A 1E96A 2WWWA 3LX8A 5DIFA 4D82A 2JDIA 2OCBA 1Q1QA 4I1VA 2JIZD 2ZI4A 4BQSA 1M6NA 1YR9A 1Z6XA 2J7PD 2F3TA 3AF3A 1W44A 3W6PA 1ESMA 1ZINA 2AK2A 5H1YA 3BXZA 1T9HA 2BIFA 3DKVA 4BECA 3RSOA 3KTAA 1JECA 1KDTA 3TBKA 5IRCD 1DELA 2W6JD 4ESVA 1Z08A 5BN5A 2WMNB 3U7GA 2O8CB 3ZD7A 4HZUA 4RZUA 4IXNA 2V9PA 4PAMA 5F98A 2XZLA 5CJ2A 4MYCA 1Z3IX 1G8YA 3SZRA 2GZAA 4CT5A 3A4NA 1H8ED 5JBQA 1XTRA 1FL9A 3I61A 2CEAA 3QENA 4DT1B 4LOAA 1CR4A 4GOJA 4OK5A 5TARA 4X8LA 2JJ2D 4H1UA 4ACAA 3DL0A 3QBTA 1PJRA 1NY5A 1YKSA 2OHFA 1AM4D 4TMZA 2BBTA 2QNRA 1J8YF 4JYBA 3QVUA 1QZXA 3LD9A 5DO9A 2C78A 5FPYA 2PJZA 3M0EA 3BWDD 4K81B 1XJQA 2AN9A 1JR6A 1E9FA 1CTQA 1HTWA 3VR1A 4KFTA 1XEWX 1D8TA 2F43B 4Q5IA 1IXSB 1NKTA 2NO6A 2XNDD 2ZPTX 4JVLA 1VG9B 1W0JD 2H1LA 2J0SA 4XJXA 4JS0A 1FMJA 2AFHE 3NDPA 4B33A 1PUIA 4HUTA 1KI1A 1T3LA 4JL5A 3RWMB 4CEHA 1NLFA 2QN6A 3A4MA 5FUYA 2AK3A 4EQ6A 3WXMA 3AGPA 3BAFA 1ZVQA 1Q22A 5FTLA 2GK7A 2GXUA 4PPGA 2VTKA 2GZDA 3L0SA 1ZYUA 1CJUC 4DJTA 3BK7A 2CLCX 4ARZB 1FQJA 3K09A 1SKQA 2UVQA 5KDLA 1X8JA 4IDQA 1QHNA 2GILA 2IYQA 4XVRA 1VCIA 1N0VC 2H18A 4Q00A 1Q1ZA 3NEJA 3QOFA 3CR7A 4P4UA 2GRJA 2BCGY 3ECCA 1RRFA 3PVSA 4GPTA 5FTNA 1EK0A 4BWYA 2ERYA 2J9RA 1OH8A 5DH9A 4LYFA 3KXKA 3NC0C 1N6IA 1H65A 2WJYA 4HAUA 1VDZA 4DCNA 4ZI3A 2ZU6A 2YKGA 1Q1BA 1Z8FA 1T8TA 3HPQA 2ZJOA 2Z6VA 2PT5A 4HZIA 4NU0A 2JJ2A 1N6OA 4C0AC 3GPLA 1IBRA 1CJKC 3RABA 5J4VA 2WWHA 3AVTA 4NH0A 4EFNA 2IK8A 1NMZA 5DN6D 4IW3B 2O8EB 5G41A 3LAWA 1COWD 1J7KA 3TK1A 5CB8A 1Z22A 1N5LA 4PZLA 4O2RA 1UF9A 4GFDA 3AUXA 3OZXA 1RPZA 2DYKA 1W5SA 1NG9A 3P20A 4OHYA 3LA6A 1KGDA 1FNNA 2QTFA 3E70C 4ZDWA 3UMSA 2OAQ1 2NQ2C 5FI0B 1JXOA 1N6NA 1YR8A 2ZITA 3WRXC 2ZRLA 3FMFA 1IXRC 1P73A 1P9WA 1CS4C 1Q12A 1L4YA 1G8PA 1ZNXA 5CM9C 4AY2A 4HB0A 2ZE5A 4O25A 2CXXA 1DE0A 1NIPA 1VYTA 1E98A 4WZ6A 3TH5A 4ZIRA 3ETLA 2B92A 3KJIA 1NL3A 2J45A
chains in the Genus database with same CATH superfamily
3C3WA 3INGA 4LJ5A 1MO6A 3F98A 1UOPA 4OGLA 1M34B 2BGKA 5IVIA 3WQBA 4Q66C 5AQ1A 2P78A 4Y9UA 1IY2A 4FC7A 1NVVR 1OZHA 5LXTF 4C21A 1F20A 1SCQA 1ZGHA 2FUKA 4JOQA 3R74A 3DMTA 4HDRA 4EITA 1QP4A 2PSHA 2FQWA 1JMYA 3RS7A 4ZI7B 2BTEA 4RE6A 4YRZA 1H2AS 1UM9A 5FEMA 3LT1A 1PJ8A 3L8HA 1AGYA 3KJGA 3RSLA 4AWXA 1VXRA 4KK4A 1UC8A 1YJCA 2CNWA 2Y1FA 3LPCA 1V8DA 4OYYA 1FVFA 2WB4A 4JNKA 2ZRKA 4RIHA 3IE0A 1FTGA 1MLDA 3UOAB 1M67A 1TPZA 1OWPA 3O92A 1NSYA 4M37A 4GZ5A 3ID6C 1FP7A 2BGJA 3K0SA 1VM6A 2D4HA 4XH9B 4DLWA 2ZWAA 5DCWA 4GP6A 4NOMA 4OX9B 3UOWA 2GPWA 6NULA 2G5PA 4AT1A 1AZTA 1D0IA 5JW6A 2XTMA 3F96A 5B36A 2EHJA 4OK3A 2DM6A 2Q1YA 3TCNA 1NMSA 1K9SA 2DUJA 3G5TA 3LIPA 3NG1A 3RANA 3TNFA 5HKKD 1HNWB 3AM1A 5LP6F 1A5BB 1HM5A 1OIWA 3WYDA 5BW4A 2F3RA 1VECA 3GDGA 1E5LA 2G28A 1XN1A 2ZRPA 3ZK8A 4D4KA 4P7KA 1AMOA 1LZKA 1SH7A 1J8QA 3A3KA 4HFMA 4ZU1X 4JUCA 4HC4A 1PQWA 2ID9A 4RD1A 1BD4A 1O8BA 3UG7A 4E33A 4EG4A 4RTLA 1XCBA 3HJTA 4AUKA 4DY6A 3SNKA 3D5TA 3QLUC 2XVZA 2YHIA 3H2JA 2A8YA 2FN3A 4AKSA 2G36A 2YY6A 4ZHQB 4OV6B 1M5RA 1F5SA 1Q14A 3ANSA 4B17A 2QVXX 2XD4A 4ZYUA 1K88A 5EP1A 4Y6SA 1H1LA 3HKCA 4QDJA 2GR9A 5BQ3A 4Z3OA 1XEAA 5ERGB 4QXMA 2CCGA 4NJMB 2OORC 3P9ZA 4LVOA 4Q4LA 4JBNA 3RVNA 1NX9A 3PIIA 4Z99A 5AVQA 3PC6A 3KUUA 1T4BA 2ZETA 3EW7A 3GVXA 3JYPA 5K8UA 2Q27A 3D4NA 2WOOA 3HJUA 4LY3A 1V7PC 5A7FA 1M8GA 4NV3A 3QX8A 4EY8A 1I3LA 1V43A 1KO7A 5JS1A 1IBSA 4PYLA 2PPLA 3CVXA 2GTPA 4DDVA 3AM3A 4C6HA 1GKUB 4GXTA 1O5OA 1PZXA 1QFSA 1CDOA 1E0JA 3BQNB 4XGNA 3CR3C 3E6AA 3ZGZA 3D1VA 5F2EA 3D8SA 4U5XA 2IE0A 2PQ2A 4CG1A 1HFKA 1XXHE 1QZUA 4H3KB 1VGVA 1VKNA 4DLZA 5AOBA 3A1FA 3ROEA 2GS9A 3GUYA 3JR3A 1KAHA 3RRFA 5G4KA 5KYTA 2PSSA 2RG1A 1HDYA 2SCUB 3WR5A 1IK6A 1KIFA 4KQKA 1BMFA 3L7JA 5GV7A 5IH7A 1Z4MA 3HNOA 3LP5A 4BKUA 4CKCA 2HJSA 1WXFA 1C3JA 2FDCA 1PK8A 3I45A 2DHEA 4U8GA 3G2NA 2O2IA 4WFQA 4YUAA 4CXMA 5BV0A 3G2PA 3A1WA 2XDWA 4PFKA 1ZIXA 1LLUA 3NHBA 3QU7A 5CFPA 2R00C 2JLUA 3PB3A 1OWOA 3G7NA 3NO4A 1JILA 4QU8A 5K0FA 2C83A 3ZD9A 3FMVA 3B7GA 2C0QA 4CLXA 3S1AA 4I5GA 4PYKA 4ZFNA 1WIWA 1KMMA 4WERA 4NG5A 2ZB4A 5EPOA 3GUHA 4AZWA 3O3MB 5JWRA 2GESA 1N4AA 2OZKA 3AMVA 4M0KA 4DNXA 4E0BA 1E2FA 3P71T 4HAXA 4KR0A 1K6XA 3A9VA 3KC2A 5G40A 3U26A 1JQDA 3OFKA 1L5GB 2R00A 5HWSA 1RZUA 3VAZA 3QOYA 1ZVMA 3OJWA 4GDFA 3QMMA 4BJ3A 4FYJA 4DMGA 2HCFA 5F1YA 5AM0A 3IRVA 1IG3A 3PI6A 3TOVA 3M6MD 4YRSA 1V4BA 3D4PA 2FN8A 2INGX 1XA3A 3B2NA 3HRIA 4XARA 2PEZA 2IV2X 3W1WA 1GFWA 2FPIB 3AESB 2I2WA 5K2OA 2WI8A 2J0UB 3ZJVA 1GNLA 1A9OA 2HU2A 1KMQA 1LK0A 1A9TA 2XB4A 2XUOA 2ZR7A 4NBVA 3CN7A 4Y3UA 2RAVA 1J00A 1G66A 2WUFA 3ST7A 2P6MA 4S12A 1Z35A 1KFBB 3MS7A 1R3DA 4WXHA 3UK7A 1NMEA 3LUFA 4TSRA 1TAQA 2E5LB 1D2NA 1EFPB 3OQHA 1H4VB 4JMLA 3R3ZA 1PN3A 1OFHA 3KVNA 4WN3A 1Q17A 6GPBA 5JH7B 3JAKB 4JA2A 1RXIA 2DLNA 1ZMTA 2QTCA 1P7ZA 2YFYA 3ANNA 4OKIA 5AK5A 4KCGA 3T4UA 3UB3A 4KJZA 5A4FS 1R16A 1GTVA 2B8JA 1PZHA 1TADA 2ZJYA 4D6XA 1SWVA 2HT1A 3D3QA 4FDMA 3VPBA 3U7HB 1E3QA 4YT2A 1DP4A 1F14A 1M6VA 3PXXA 1ZM7A 5A04A 2A5FA 2IA5A 1O87A 5D5PA 1T4CA 1UDXA 2QTRA 1R9GA 1IRXA 1VI6A 4G01B 1GUBA 1X0VA 2C4NA 3SC4A 2QMEA 1NVBA 1WY7A 5LUBA 4C78A 1F12A 1W4RA 5A2QA 1Y8RA 2XUJA 4OXKA 1EUDB 1S01A 1XKQA 1PWZA 1DU4A 1FRNA 2C5GA 3HWX1 5FWYA 2VK1A 4XUGB 5AICA 2W2KB 2FN7A 2C5EA 1U8TA 1Z37A 4IV5A 2Q3HA 4MMYB 4RWZA 4CJXA 2ZS7A 3WRVA 1RP1A 2VC2B 3BXGA 1P4AA 3IHWA 2IRWA 2OPBA 3BIXA 3EZNA 1U5BB 5DE3A 5BT9A 2P8SA 1JJFA 3OCWA 2FP3A 1IBCA 2C77A 2Q99A 1A4RA 1L9XA 3WSWA 2TMDA 3T9AA 4KRYA 3HU1A 4BV9A 2OLJA 2YZ2A 2V97A 3DTVD 1IUKA 4TTVA 1XAIA 3EOBI 4QYXA 5TS3A 2BKAA 3VO9A 2BGWA 1L4KA 3DDZX 1ZD1A 3FCOA 3DGFC 4R51A 1P9LA 4BEVA 1VJ1A 2I8CA 4HYYA 2C9ZA 4ZZ1A 1NSTA 3MXTA 2CLKB 3F74A 3E5HA 2P0EA 4J0HA 4TKLA 3RYCA 5I48A 1L5LA 5TPWA 2FPWA 2GCOA 2IGTA 4LNUA 2QG6A 1Y7HA 3L9WA 4FQ7A 3O8BA 3DZKA 3CT4A 2FSPA 2VPPA 5DM1A 2Q9BA 1ZJYA 2O2GA 4ZJPA 4WINA 1RWBA 4FGKA 3CZAA 1ZK4A 5IC5A 2QRGA 2X76A 1ZLXA 4JWTA 4E2ZA 4RU1A 3KOMA 3DC7A 3T41A 4FM9A 1L4HA 4UE2A 2OGZA 3SZLA 1XP5A 5E4FA 3EG5A 2ZRNA 2QVYX 1KH2A 1Z5PA 3DM5A 1DZ3A 2XJ4A 1XZEA 2FZVA 3HEAA 2YY7A 4V0OA 1DC5A 2QTTA 4J9UE 3QV1A 4OHWA 3X2EA 4BO3A 1E1DA 4FMCB 2QUBA 1GG8A 3X2SA 4YQZA 4ETIA 3KLNA 1U28A 5J47A 2ZGVA 4KE8A 2D0PB 4Z54A 2Y76A 5CDSA 3BWBA 4MI9A 2Z6QA 2YXEA 4KIWA 1GWNA 5KU7A 2CW5A 1K75A 2NUTA 1IPHA 4LZLA 1AQ6A 3FUXA 4C87A 3I2FA 1YU9A 2WMDA 1DI0A 3FGOA 3NCTA 4X44A 3UJ8A 4EPTA 1H2EA 3A6JA 3U3RA 5JQGA 4BVEA 3PEWA 1TMYA 2B98A 4JJ6A 1FQKA 1V16A 4AUEA 2O59A 2PDAA 2BR5A 5FYQA 4F45A 1CZNA 2IC5A 2Z3WA 4DA6A 3P2OA 3B48A 5JXIA 3AL3A 1S2DA 4CHGA 2EJVA 1TEVA 1U80A 1WMBA 2NSDA 2VZ9A 5GONF 2B6NA 4GP9A 5EZ5A 4EK9A 2Y71A 4NAHA 2LV8A 5HPYB 5KREA 1GFIA 1QHXA 1U2DA 1JIKA 3OH8A 4IOKA 1P19A 4Z8YA 5F3RA 4EDFA 4FEEA 3DZJA 5H16A 4YCNA 3ZVKA 3DO6A 1GV1A 2EBHX 2B94A 1E1RA 1OR8A 4MUYA 3ASZA 4KJXA 5TMBA 4G3XA 2XMRA 3BBPA 1W93A 1HL3A 4EENA 1KZ4A 1DADA 2VUIB 1KMHA 3P7MA 4MQFA 1OA1A 4BO4A 3N2YA 3MWEA 4DDUA 4QHSA 2ZLBA 4Z3DA 4MKGA 4QFBA 1TO2E 1ZSYA 1FNMA 4K9OA 4P3PA 3SG0A 1V3QE 4OA5A 2FY8A 3CUUA 4Z0HO 2AG0A 5H02A 1NXOA 1IB0A 2XKAA 5AKGA 2C9CA 1F2DA 4DXAA 3RRXA 3OJEA 2MINB 4RIIA 3U7QB 3Q98A 5TQ2B 3A4VA 2CJPA 3KQLA 5J9FA 3L5OA 3TRIA 4IRUB 2QRKA 3LWDA 2Q21A 2KSQA 3RV3A 5FI1B 2OG2A 1CUAA 2RBKA 2NZYA 3ROFA 5C53B 4ZT6A 3VXKA 1YIOA 3JD2A 3MTBA 3Q9NA 4RX1A 4D5EA 2P9QA 1EEXB 1Q6YA 1NBME 3WLFA 5DN6A 5TE9A 1IQRA 2C5FA 1S8FA 4IIXA 2C5LA 2TYSB 5FBWB 4YPFA 4UZFA 3TOZA 4B34A 1V35A 1ODSA 4EHLA 1TQ8A 3KELA 1ZXBA 1US8B 2VNAA 2Z58A 4AFNA 3H87A 2CDNA 2FHSA 8ADHA 3BMCA 1JAYA 1LB1B 2C9DA 2A9RA 2AGVA 2FWRA 2ORYA 1ST3A 3KL4A 1N9ZA 1ZK3A 1C29B 4E03A 2P77A 4FFPA 1L1QA 2PZBA 3HZOA 2W90A 5KNDH 2H1IA 3LSYA 1R9MA 1ZW6A 1GPWB 1UT8A 4WOPA 2XZOA 2O0HA 3D8HA 3W4IA 3EGCA 1Z0ZA 3JQEA 4MUNA 2MSCB 4DM7A 4OG2A 2HBZA 3BZBA 1OKKD 4BGVA 9LDBA 4HJRA 1YB2A 5C8ZA 2CJYA 1U3GA 3V1UA 1T2FA 2MYTA 4U2EA 5IVDA 5DLQC 3FNGA 3FAZA 3C1OA 3RVMA 2H11A 1ORTA 2HMAA 2QJOA 3EEQA 3H9QA 3OZFA 4FW9A 3GLHB 2E4VA 4Q3OA 4QTZA 4CIWA 4QDKA 2BJVA 4HGOA 2XNHA 5HE9A 1J23A 1XXHB 2AH5A 2GZ3A 4QIHA 4D8UA 2XHZA 1AHPA 4YJ3B 1B6TA 3FWPA 3MJ4A 2P1DA 2W2TA 1VHQA 4W63A 2YXLA 2WFZA 4OXQA 1MVOA 4JT4A 3WLNA 4ARIA 2K2WA 5B7PA 2EW1A 1J0CA 4GLOA 1UBGA 3H5NA 4DIDA 3BERA 1W1IA 2O5RA 3QYFA 2CHQA 2CUKA 1ZN2A 1FVHA 1WP4A 3VTZA 1WQ3A 3A06A 4RHEA 4Z5XA 5CRIA 2AFHB 4KYTA 4UDYX 4TWAA 4EYSA 2H5IA 1W4BA 2IF0A 4C88A 3EQZA 4Q1CA 2QBYB 4HDKA 2XOXA 1G5PA 1YVUA 2Z8XA 4ER5A 4RHFA 2YJZA 5C34B 1OYWA 5DHAA 4C30A 6ABPA 4LF7B 2BEKA 2ODQA 4E6PA 2CHGA 2CVZA 1FMLA 1W30A 1ZUNB 4KKVA 1UBNA 5ES4B 2OV8A 2YJ6A 3B6MA 2JASA 5BXQC 1IQPA 3FSRA 4PX5A 3WV5A 4AB1A 1UKAA 1SIOA 1ZU4A 1JA0A 2F9FA 1E32A 1SVKA 2YHUA 3OOWA 5FQOA 3ZDXB 2CNNA 2BFOA 2DOKA 3OSZA 4O8ZA 5HA5A 4EOGA 2ENWA 2G9VA 1OLSA 2FNAA 3NEPX 4HQKA 4A0GA 1CPYA 4XPZA 4WQMA 2VVTA 4LGCA 4UDNA 3PQ5A 4GM4A 3KOUA 2ZJBA 1VKRA 4MW7A 2HPHA 1J97A 4ND3A 3R3WA 4WI1A 5CM2Z 5SZHB 2IU0A 4II2A 2YOGA 6Q21A 3R7DA 5EE1A 2QQGA 2QX7A 1G21A 1KC3A 1JN0A 1L5FA 2YUIA 1A96A 3DMHA 2G9UA 3QBJA 3K8YA 4LV8B 4M49A 3ZH9B 4DILA 1QP8A 3RFXA 3NHSA 3IMKA 2XI4A 3LLVA 3IQHX 1S9DA 1WCV1 3QLJA 3FCAA 5ENDA 4LF5B 2VH5R 3VPGA 2JFNA 5DULA 3JVEA 2J30A 4LBYA 1GPBA 4QQKA 3SLGA 5KIAA 2QLJA 4HAVA 1TAHA 1GZ7A 2IVFA 2I34A 2ORED 1EWVA 2PGXA 3B13B 3K92A 4G5FA 4JOBA 5DVZA 2D2VA 4FCWA 2DCUA 1QZ3A 5I6DA 5AVKA 2QTHA 4JYPA 5BSMA 4BMSA 5IM5A 4EPWA 3BIFA 2JVJA 2NO5A 4CG0A 3D1LA 2W8ZA 1XDBA 4RA6B 1DIHA 1FS5A 3P97A 4RPGA 5HJEA 3NHWA 4CHTA 3WMXA 1MD9A 4D4GA 2XOEA 4UHBA 3MVEA 3V6MA 2WRZA 4E2WA 2QLFA 4L4ZA 4DIKA 3R09A 2QE7A 4QM6A 4PLZA 4KXMA 3PR3A 4HH3C 1U3DA 1KMCA 3DA8A 5FWYB 3LBHA 4MIOA 4PZYA 2I1VB 3IX7A 2GVDC 4P3YA 5GY7A 2P68A 3GWZA 3IDAA 4LZNA 2EP5A 3U4DA 8ATCA 1I2BA 2JCVA 4K3VA 5EJEA 1FQWA 1G21E 1NUSA 3A10A 1ONSA 5B30A 5HRAA 4DV1B 2JFHA 4R1NA 5CTJA 3AR8A 2OK7A 5JT1A 1JQLB 1Q1NA 4XWKA 3QWIA 1B3BA 2Y9MB 4F91B 4WJKB 2HMVA 4D0GA 3W8NA 4EZEA 1H2HA 1WB6A 4TS1A 4Z2YA 4HGRA 1H6CA 3OE7D 5HQTA 1W5FA 4YAJA 5IEBA 3LCVB 4WECA 5AJHA 2NO4A 2RGAA 3AT1A 4AJPA 1M74A 5M29A 1FSSA 2XXJA 5I3CA 3GRVA 3IS3A 4EI7A 3NHKA 1A8UA 1LPNA 2BHRA 2GHTA 3TDMA 5JANA 2VSNA 2GQ0A 2ZIXA 3RRBA 1GZ4A 4ZTBA 1UPUA 1Y4UA 2ZYIA 2OD2A 2DR0A 3HZZA 3Q7IA 3HJGA 4DLUA 4UZSA 4MJLA 2IHVA 3FBWA 4NFHA 3VBEA 2BMAA 1X7ZB 4D3SA 2QT1A 5IG2A 3JSAA 3QBEA 2XADA 4G8CA 5EIWA 4RS3A 4OHUA 3AETA 3RPEA 1HE3A 5DXJA 2YFQA 4UOEA 3HKBA 3KS9A 1XFDA 2HDOA 2R87A 3CKKA 1SQGA 3R3VA 3WKEA 3E4CA 2A14A 4QYMA 2J0UA 1NOIA 2R8PA 4OXYA 4DUGD 1YFZA 3VZPA 4RPKA 1Y9DA 3O83A 5REQA 1PNVA 3AG5A 5AR1A 4OP3A 9ABPA 2EJTA 4OQ4A 2F55A 1FSZA 2SHKA 5T8KA 2HF7A 3I6BA 1F6DA 3GHYA 2ETVA 2AS0A 2GN9A 4OXRA 1U3WA 4AL4A 2ESRA 2XWSA 1LA2A 2GN4A 3FZGA 1IUNA 3LTEA 2OGUA 3OZRA 1HDGO 1VBNA 2FWBA 3E9EA 2R8EA 3FPKA 4H3HB 2YINC 4GBMA 4HP8A 3SXUB 3OQVA 4EJSA 1ELOA 1X3LA 1KZ6A 2PNJA 3C8ZA 4BC1A 3CJTA 5FF9A 2F3QA 1MABB 2O3JA 4FFWA 4LQ4A 4FTWA 4GPD1 3JAWB 3EXG1 3K53A 2P4EA 2ZULA 3X44A 4CCWA 1HV8A 3WADA 4RULA 3QMWA 1EDBA 1F9AA 5LA6A 4E3WA 2VRWA 3CMCO 1Y5MA 4BLRA 4C04A 2C82A 5A4DA 1HQKA 1H2ZA 2VDUE 4HWRA 5AKJA 4G4JA 4AI6A 3R5KA 2KBFA 2XDAA 1GR1A 1DAEA 1DHTA 1OY1A 4NEHB 3DEIA 1J1IA 3EXHB 3F3YA 5JAIA 2IOHA 2AZTA 3ZBUA 4HK4A 1JLMA 2GBLC 3N2GB 1WJGA 5IF3A 4KO2S 1ZEMA 1QMGA 2WMYA 3OLZA 3EZ7A 3IEXA 4S0XA 5KQMA 3C85A 5KZMB 3U3KA 2IYNA 2PUHA 1NUHA 3PC8C 4CCYB 2Z1MA 1EHCA 3HE3A 3J7TA 1MB4A 3ORYA 3KKLA 3K73O 3EOZA 4HB4A 2YJTD 1DJNA 1O94C 1Z2CA 3WK6A 1WEHA 1GSHA 1M34E 2AZMA 3L7KA 5F5XA 1MX1A 2IEBA 1X3SA 1D4OA 3ZWXA 1RZRA 1DC6A 2G76A 2IUFA 2IEDA 3OECA 5EWMB 1EFDN 2L0XA 5ICEA 4FJ2A 1KP2A 1GD1O 2QMOA 2RGDA 4GSYA 5CNIA 2Q5CA 3L92A 3DGEC 4ZQCB 3SJ7A 4W9MC 1YB1A 2QAJA 4IILA 1YTUA 3TBFA 4TV8A 5D01A 4AJNA 1PLLA 1DEKA 3HKEB 2YN2A 1WX1A 3AEXA 3RS4A 3KZVA 1Z3CA 2BRUA 4K6GA 1RLJA 1K5PA 3A4IA 4WV3A 1SK8A 4X24A 1ZA1A 5EWJA 2BGLA 4DMKA 1Z7EA 1E63A 4KFRA 1PT8A 3FWYA 3I8SA 4ZZIA 1DO0A 4JLOA 3KE9A 2MINA 3AJAA 4MUGA 2F1OA 4HXYA 4OJQA 4YECA 5GGXA 3WFJA 3HYSA 1CYDA 1V26A 4QL3A 4RMHA 2D13A 3SXPA 2VP6A 3UIEA 1NT2A 3EY9A 3SSOA 1N2IA 1X7GA 3RSZA 4E1AA 2OV3A 3SVLA 2HO4A 5DBEX 3I1IA 2XT0A 2ZIGA 2Q3EA 2VP3A 4BKPA 3OVMA 5ITWA 5IKOA 5LJIA 2NN3C 5ECWA 3ZZTA 1A2KC 4CTKA 2IEIA 2ZJFA 4X3OA 2OR3A 1HNZB 2JBAA 2H16A 3KQUA 4RWEA 3GK3A 2BFMA 1X80A 3EN0A 5FI3A 1NLZA 1ZHHA 5DBOA 3UBMA 1ZR4A 4XQEA 3AHFA 3TQFA 4KPEC 3OQNA 1OB2A 3NDIA 1V1RA 1COZA 3ZY5A 1RWWA 4JROA 5GVRA 3ZLJA 5IX8A 5IDVA 4A6EA 4LYHA 3FOWA 3OSUA 4LJ9A 4LOKA 4ZCSA 1Z0AA 3GZ4A 1PQPA 3ZE7A 1Z5WA 3AEZA 4N3AA 1WUKS 5HILA 3AW8A 3NTQA 5KINB 1N0HA 3LQQA 3CKLA 1J8FA 2ZRAA 3D8NA 3NOQA 2NG1A 4U6SA 4ZKEA 4EJSC 3U4QB 1B8VA 1NHGA 1TTHA 2VJQA 2ZJ4A 3D3EA 5M34A 5JYDA 4FHZA 1PZGA 1P72A 3FCSB 4G8DA 4N3BA 2O52A 5EG5A 3NB0A 4O3MA 3BGWA 4M7WA 1U11A 2SKCA 1T2EA 1K8QA 2AIRA 4MVYA 4P0TA 4IFIA 5AVUA 1RXYA 2Y93A 1RFLA 1LGYA 2IDKA 3DE1X 3PFFA 5IXYA 4UNRA 1ADJA 2BKLA 2K7FA 3O4GA 1NZJA 4Y67A 3IPRA 4C0SA 4DMUB 3DEKA 8GPBA 2D6FA 2ZYHA 3OY2A 4KAAA 1RQGA 2GJAA 2PL5A 4MS3A 1S8OA 5HF6A 5I8ZA 5A6SB 1MMFB 3LV8A 3UANA 5JTUA 2EFHB 5SY6A 2VSOA 4TMYA 1U0NA 3NBUA 4MWSA 4PTLA 4DPKA 3FDJA 4I8IA 3DMRA 3EEBA 1ZHFA 3GDWA 5FJIA 1GL3A 1TDJA 3U7QA 4DCMA 5L9AA 1WZIA 1NJ5A 2CNOA 2WJGA 2Q4OA 1N5OX 1MO5A 3PD1A 2BM0A 3PE3A 3SD7A 4M9XA 1NRWA 1DAFA 3C1AA 2NTYC 1DKQA 2CHVA 1W47A 2QWXA 4LSGA 2CLDX 4CMGA 3C3CA 1JFTA 1LDMA 4EGCB 5EVJA 1PAUA 2BW0A 4KBGA 5LUAA 5AKKA 4HFRA 4QUEA 5JNWA 1F1BA 1LDBA 1NZFA 4IDDA 3URKA 4G0VA 4Q7JB 4WPGA 3DE7X 3LNCA 1RU3A 2JA1A 3VPFA 5BYAA 4PPFA 3LKVA 3JQCA 5CB4B 4B8WA 2Z5FA 3R9IA 1KAMA 2HSJA 3GDFA 3W06A 1FTWA 2JAUA 3ADOA 4RKRA 2CZQA 2Q41A 4PGGA 1G2QA 4ZV9A 3VX3A 3L1HA 1BFUA 5GTDA 2JJQA 2OFFA 4D4IA 4D80A 2D2FA 3OT1A 4TSFA 3N0XA 4XOUA 4RTJA 4UJ3A 3AF4A 3WYNA 1BCSB 2ZWPA 1MT3A 1P1JA 4BFWA 1ZM4A 2R97A 3AEKA 4IQ8A 2EIHA 4OQYA 3AKZA 4D41A 5CFNA 3G0BA 5ALTA 2SECE 5KTTA 3NAQA 4MCJA 4MWCA 1KH1A 4AMUA 1J9ZA 3TAXA 4H9GA 3VR4H 1X7WA 5TEVA 5CK4A 2O0MA 2B0JA 3GAFA 3CPJB 3I53A 4I0WB 2Y0PA 3TRHA 4JQCA 5E2AA 1S89A 4M0FA 2VNJA 4BNHA 2G8LA 4MROA 1L7BA 2Z4TA 1X7ZA 1JKXA 3UW3A 3VR5A 1HGXA 3C7DB 2FSVC 4I9UA 4LMAA 2WU4A 2YMLA 3OUZA 3PPVA 5EN4A 1G20A 4Z7NB 1C8VB 3PHIA 3KWLA 4IAOA 4A92A 3CT6A 3OFNA 5B1YA 1CY0A 3RC8A 4IR7A 5DKFA 1W59A 1Y98A 2Z1DA 4POAA 1P5HA 3TW8B 1B8OA 2F1IA 4MWTA 1PK7A 1G1MA 3E9ZA 2P9EA 3IA7A 1V6SA 1J2RA 3IOEA 3IP9A 5EHQA 3TX6A 4G0WA 2RHOA 1E3EA 4LYDA 3N8HA 3K70C 2AG5A 2FSFA 4INJA 3KQVA 2X2OA 5F12A 3VC1A 4URXR 3G17A 3KQNA 4OHXA 4HH0A 3QJ5A 1QYVA 4BZXA 2VTBB 2D7JA 2PLNA 2DR2A 1JHUA 2D62A 1NXVA 1KFCB 2SICE 4HDMB 5LB2A 4YFYA 5CA1F 2YVAA 3I58A 3EDOA 5CFZA 2D1RA 3DV0A 4Q6BA 3T0GA 1I9CA 3X1XA 3ANTA 3IQIX 4RAOA 2P2NA 4XUEA 2OBBA 1TYCA 4Y0NA 4DGQA 2IVZA 4K0RA 3H83A 3D3WB 4L4XA 5J2UA 4EF4A 3NBXX 1ZJZA 3BMOA 2PKXA 4P93A 5F33A 1HLDA 1A77A 2WSMA 3VU9A 1U0JA 3VJMA 2I33A 2DX7A 4D9GA 2VHWA 4JBLA 3IIKA 3KAPA 1KEPA 2UZ4A 2VJOA 3ZVLA 1SGWA 1Z39A 1BFKA 1UPFA 1DIGA 2ZI6A 2Z0MA 3LQKA 3MBOA 4X92A 4NZZA 4D9MA 4FCTA 4DR4B 2H29A 4L5CA 1OZFA 4J9VA 4HR7A 3P2JA 2VDLB 1M83A 2FOXA 4X95A 5FYDA 3U4HA 5KTMA 2QRNA 3G1UA 3Q12A 1EDOA 2GBCA 2QRMA 4LYEA 2UYCA 3UV7A 4JC5A 1B93A 3TG8A 1UJ6A 4R1PA 2CWDA 3IBSA 3P26A 3YASA 2C8KA 2G6BA 1TCBA 3M6WA 4KMSA 5AUPB 5DNAA 5F1OA 1XB2A 2LVBA 2VJNA 2AUNA 3QWAA 3TL2A 1Q7GA 2BZ1A 2XX3A 2ZQZA 3K9NA 4G1BA 2DTDA 2QMQA 3H8WA 3N6RA 4WASA 4KQGA 1H0HA 3ITEA 1Y3BE 2ZS9A 3KKNA 3WLSA 3ZX4A 1SD5A 2ZW9A 3UT6A 1YBMA 4KI0A 1N32B 2B5VA 4J1QA 1OZAA 4NE2A 4QXAA 1N6KA 1Z0IA 3U7EB 4BNVA 3EDYA 3I5XA 3MD0A 4DMFA 3CFYA 4XLTA 1ZMXA 1SELA 2PX3A 2I65A 1LDEA 2Y1WA 1YQQA 5G0UA 5IJ0A 1TX4B 3BCHA 4FXPA 4HQ0A 4MCHA 2FXVA 4URYR 4D26A 1P2VA 3GG9A 5CA0F 3TBHA 4TS4A 3BHJA 2XT9A 2EFJA 5D86A 3P19A 2Y0CA 3KQQA 4DN6A 1HYEA 2JG3A 1M72A 3SC3A 4K05A 4EIWA 4E5SA 3FOCA 1RXWA 1W35A 3DF7A 3EDCA 4GI2A 3W3ZB 4BFZA 4CFZA 4CETA 1DEXA 4RPCA 2PUAA 4DQDA 3VV3A 2KS6A 3GRAA 3ZY6A 4PLTA 2BGUA 3PENA 4JB3A 2NU8B 5HUHA 2G71A 3F9IA 4EG7A 1PG5A 1QYIA 2JAXA 2PX8A 1C7FA 3FDZB 2ZU0C 3R5JA 4LJAA 2W0MA 1VSUA 3DXFA 2XNJA 4GOOD 3T5DA 2O05A 2D0DA 2L17A 2ZIEA 4JKYA 5FUMA 3GBPA 5K0BA 3BMCB 1P1IA 3GGSA 1PVVA 3GVCA 5ITSA 1G9XA 1MA0A 2ZAGA 3WLRA 1XQXA 2OESA 2JNWA 5L7TA 2QKYA 5HF8A 1Y89A 1FDIA 2ZE8A 4C0BA 4DWWA 1IYZA 2FR0A 3H17A 1E1QD 1E8MA 3MQ2A 2C2WA 2ZG6A 4E5VA 3THSA 2B69A 4GZLA 3SS9X 2D59A 5IBRA 3VH3A 5DJ5A 1U8YA 2YMPA 3BJEA 4C6SA 2GXQA 5GADl 1GZSA 1P4GA 2WLSA 4Z53A 3S8MA 4HAYA 4WKBA 5HOQA 1W96A 2AWNA 1MW8X 4YMGA 2VN8A 3V4LA 2I3AA 1U8EA 4XA8A 4Q1EA 1I9GA 1HFEL 3GARA 4JI6B 4M9UA 3ONFA 4MPTA 1OREA 1QHIA 3AJRA 3R3SA 3VPAA 1UBLS 3DE5X 3GLTA 4DLVA 1QIDA 2D7DA 3S2EA 3OF3A 1Q2UA 1Z06A 4TMWA 3VR4D 4LTNA 3TQHA 4OFZA 1UZLA 2IITA 2VQ3A 4BS9A 5LQUA 2XB2A 2QGFA 4O4JF 4YB8A 4XB1A 5DMHA 1OXUA 4MR9A 3SEFA 4A3SA 1KOGA 2AEFA 3ETGA 3LC7O 4F2GA 4IXTA 3UJBA 3TFOA 3E8SA 2XV1A 4MQFB 4BO9A 2I5PO 4P9NA 4ZAXA 1HO3A 3OLCX 4FZJA 5AHRA 4BFLA 3D54D 4WZBE 3UJ6A 3UG6A 2QX8A 5K3OA 4Z51A 2VG8A 4F38A 1JAZA 1L5HB 4G8BA 2XB9A 3HJBA 2H6EA 3SJAA 3WVNA 2IPXA 1QKIA 3T4XA 1JDZA 2RK4A 2FPPB 2VJLA 4HXEB 3ROZA 3FCYA 1RM5A 5KNBD 5ALEA 1MAAA 1DJPA 2OQRA 4D0RA 1GAJA 1XZQA 4I8DA 3I32A 4QU5A 3CZ4A 1AA9A 3BWCA 1IE3A 4EQZA 5JI3E 1I6MA 1EGMB 3FI0A 3PGJA 1G3MA 3PR2B 4AQDA 3P2EA 1Z6GA 3H1GA 2CZCA 2C8JA 1A04A 1N2HA 2R4UA 2Y8EA 3AILA 4KQJA 4N65A 4A5OA 3OT4A 3X1YA 3UPUA 2C9MA 5HJ2A 1V3UA 1N8SA 4NTZA 4ZOCA 4R9NA 5FOWA 3PBKA 3H2HA 1GPDG 2HPAA 3NX4A 3ZOZA 4N76A 3G9UA 1KAQA 1NSFA 4ZC8A 5IP5A 3TW0A 3GFTA 2JAOA 2BKVA 3FXAA 3P2MA 1VL6A 2OO7A 3DOHA 3GLGB 1LBHA 1L4BA 4JP3A 5K8TA 2PKWA 4ITVA 2QA5A 1KYZA 3OQIB 5M7EA 1LTQA 3INNA 5F1PA 4B0PA 2Y0EA 2AFVA 1NNSA 1TUEA 4N6NA 1F2TA 4DR3B 1L4LA 4C7OA 1UK7A 1BJRE 2WVHA 3ASVA 3R5TA 1DEHA 1RYZA 1W76A 1RAGA 1SUCA 2HK9A 3FHJA 4BCBA 4PR0A 5EP2A 1XRPA 1UAGA 2C95A 2XMSA 3UWPA 3DM9B 2FW9A 4MR8B 1C81A 4RA9B 5BYBA 3FF1A 5H5JA 1E1MA 1MHPA 3COPA 3T7SA 3ZDRA 5JI2E 1PQYA 1XAJA 4U00A 5CH3A 1RIIA 1USUA 5FA6A 3S44A 4IIJA 2RGGA 2QYHA 4DMLA 1VJCA 1WCWA 4DBVO 1WF3A 4MRVA 2QU7A 2EX0A 2O8DA 4R3NA 5BNZA 4JAVC 5KSOA 1ISHA 1GNPA 2XSZD 2YBDA 4IIDA 4HBGA 3PX7A 1N3YA 1K8YB 1LSJA 1B6GA 1NVMB 1WMEA 2PLRA 1DBQA 1TFUA 2YIDA 3A3OA 4HLQB 3R75A 2BGRA 1PR1A 2FWNA 3NWBA 2HJWA 4X8OA 4X63A 2R48A 4RJLA 3WSTA 4AG5A 4EPRA 2OFXA 3EISA 2FWAA 4FYVA 2V7EA 3IAHA 3GELA 4WNYA 4LFCB 4RY2A 1GT6A 4NK5A 4Z0TA 4RCZA 1M0SA 3WICA 2EWMA 2HCTA 2P9ZA 4G6ZA 4UCXA 1WW8A 2REQA 2C58A 3QW2A 4NBUA 4LYJA 2J3JA 3UB4A 4RYLA 5T6MA 3GMIA 2JC3A 5DFAA 4WY8A 2IYSA 2HIGA 3S99A 1G5IA 2VDVE 3QE4A 3BA1A 3FLBA 1TKRA 1DQNA 5I7OA 4FD2A 1LRKA 2OHHA 4LRYA 4W8HA 1N2JA 4I50A 5B37A 3N9IA 3VU8A 4ARVA 5KQLA 4YUZA 1NAIA 2FX3A 3PYMA 1X7DA 5L6MB 2OL4A 2Z8YM 1KEEA 3GJ7A 1CJTC 4WACA 4QPCA 1AQYA 3MTGA 3VKWA 1CULC 5K3BA 4ETMA 4Y18A 2IHBA 4UU8A 5CHYA 2CYBA 2WYVA 4JXKA 3ABQB 2Q1WA 1SXJA 1NVUQ 4FS3A 3LI2A 1TPYA 5ALYA 4KKXB 1ZC3A 3EK2A 2JFVA 1O3YA 1LNQA 1QO7A 1P33A 1W5TA 3IE1A 2NU8A 3G9QA 4QECA 4IDBA 1WKBA 5EHGA 1BX1A 5JAMA 4GMFA 3FUCA 4LDNA 4TV9A 4DCPA 3ENNA 3TEJA 1UBKS 1EE1A 2HQSA 2QRHA 3BHNA 4JL8A 4RD6A 3KKZA 4TVKA 4D56A 3TUZC 2BBWA 3DV0B 4ABTA 4JR2A 1GZUA 1KZHA 1NQWA 4IL5A 4CQLA 4L0QA 1Y9EA 2OZLA 3B6KA 1WD5A 1USVA 2ZREA 3EXFB 4KXWA 4QDOA 5FUXA 4DM3A 3LP6A 2VPIA 5HRUA 1NKVA 4JB2A 2DRIA 3MMXA 3FPJA 2O2HA 4G0PA 4L76A 1OFTA 1WR8A 3EZ9A 4B7CA 4RSHA 3OMWA 5FH9A 2BUCA 3IULA 2EATA 2AI1A 2BVNA 2IU6A 1A9SA 2W7TA 4FEYA 1E6WA 3F8TA 3WYAA 1DAGA 1E60A 1K7XB 1VRCA 3GGCA 4NULA 4AY5A 1AUPA 1GTG1 2ASVA 3L02A 3GD5A 4JQZA 5JXWA 1CEEA 2XQIA 3G02A 4GOLD 3ZKWB 1YDFA 2VRNA 5ESXA 2QRUA 4RYDA 1KHTA 1IEQA 3HL0A 5KSZA 3FKSD 3WTBA 4GLJA 3BQMB 2PG3A 5DTMA 1BKSB 1UWKA 5EUMA 1QYXA 2AT1A 3QNWA 4MYSA 3ZEAA 4AZ0B 3S7ZA 1X7XB 3QW4B 3WG9A 5K4GA 3OKPA 5JD3A 1SVSA 4QA9A 4WKPA 1XN4A 2QIPA 3E0QA 2GVZC 5BSTA 1JL3A 5EE0A 2VEDA 2F1KA 3G0HA 4AKTA 1P18A 2VSQA 5CGQB 3VPXA 4DMHA 4BB0A 4UEKA 2YWHA 2ZR9A 3Q8MA 2HKIA 1JR6A 1OPRA 3F3SA 4HQRA 1ZUNA 4S0ZA 3LPNA 2BGIA 5L40A 1L7PA 3DL7A 2R60A 3L8MA 1JIIA 3T0FA 2QT0A 1N9GA 5IAJA 4PF1A 1AHNA 2GM5A 1E7YA 1R5BA 2ISCA 4