3WMGA

Crystal structure of an inward-facing eukaryotic abc multidrug transporter g277v/a278v/a279v mutant in complex with an cyclic peptide inhibitor, acap
Total Genus 222
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
222
sequence length
589
structure length
589
Chain Sequence
TGVTARRIFALAWSSSATMIVIGFIASILEGATLPAFAIVFGRMFQVFTKSKSQIEGETWKYSVGFVGIGVFEFIVAGSRTALFGIASERLARDLRVAAFSNLVEQDVTYFDRRKAGELGGKLNNDVQVIQYSFSKLGAVLFNLAQCVVGIIVAFIFAPALTGVLIALSPLVVLAVVVQMIEMSGNTKRSSEAYASAGSVAAEVFSNIRTTKAFEAERYETQRYGSKLDPLYRLGRRRYISDGLFFGLSMLVIFCVYALALWWGGQLIARGSLNLGNLLTAFFSAILGFMGVGQAAQVWPDVTRGLGAGGELFAMIDRVPQYRRPDPGAEVVTQPLVLKQGIVFENVHFRYPTRMNVEVLRGISLTIPNGKTVAIVGGSGAGKSTIIQLLMRFYDIEPQGGGLLLFDGTPAWNYDFHALRSQIGLVSQEPVLFSGTIRDNILYGKRDATDEEVIQALREANAYSFVMALPDGLDTEVGERGLALSGGQKQRIAIARAILKHPTLLCLDESTSALDAESEALVQEALDRMMASDGVTSVVIAHRLSTVARADLILVMQDGVVVEQGNHSELMALGPSGFYYQLVEKQLAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-binding cassette, sub-family B, member 1
publication title Structural basis for gating mechanisms of a eukaryotic P-glycoprotein homolog.
pubmed doi rcsb
source organism Cyanidioschyzon merolae
molecule tags Transport protein/inhibitor
total genus 222
structure length 589
sequence length 589
ec nomenclature
pdb deposition date 2013-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF00664 ABC_membrane ABC transporter transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1560.10 Mainly Alpha Up-down Bundle ABC transporter transmembrane region fold ABC transporter type 1, transmembrane domain 3wmgA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3wmgA02
1G6HA 4JLJA 2C96A 2ZVQX 3FKSA 1S4QA 1KI1A 3KB1A 1GRRA 4IDHA 2YV5A 2BMEA 4HAWA 5DYIA 1OXUA 3UIEA 2B21A 3PFIA 5JFGA 2GEDA 1GDDA 2A5FA 1NVVQ 1R10A 3RWOA 1N3BA 1UKEA 4KLZA 3UG7A 1GFIA 2D62A 2R62A 3KQLA 5ELXA 4TYQA 3QKRA 2GJKA 2P0EA 3EA0A 4L9SA 4RKFA 5J5CA 1NG1A 2XB4A 3QXCA 2BC9A 4ABYA 2GRJA 2P3SA 4NYIR 3FKSD 1MO5A 1E9SA 1Q1EA 3ETLA 3BJIC 3IBGA 2BWJA 1TQ2A 1X6VA 4MRSA 1CR1A 5EXSA 2ZJAA 4IFBA 5HPYB 3NBYC 1XJCA 1AKEA 3KFXA 1NN1A 1ZIPA 1U8YA 3OIWA 3EWAA 5H1YA 3TUJC 1S1MA 4PC2A 1X86B 3AF1A 1LS6A 5BN4A 3AF2A 3CLVA 3GJ0A 1LVGA 3AGQA 1UBEA 5FUYA 1SULA 1F48A 2PCJA 5HZHA 1E79A 1L8QA 2NO1A 4RD0A 3SN6A 1KK0A 4G5RA 1G9XA 2EFGA 2YWFA 3LA6A 5CB6A 3ADCA 1MOZA 4RFSA 5LD2C 2ZITA 1CR2A 2NO7A 2V6IA 2AKYA 1AM4D 1KSHA 3IEUA 4B34A 4EFMA 3NDBB 5DYGA 3TK1A 1E0SA 3EWSA 4MITA 3KL4A 3RS0A 4Q19A 3TUZC 2CLSA 2IYTA 3NBFA 4D26A 4C7OB 2QL6A 1KSFX 1E9FA 3SZRA 1IAQA 2FPMA 3CO5A 2JCSA 3U6BA 5HE9A 1L2TA 1TL7C 1XTIA 3DZDA 4F92B 3RS3A 5JZVA 2J7KA 2ZU6A 2NGRA 1HY3A 4HEJA 5CK4A 5EXXA 1E79D 1BIFA 4ZKEA 4DCVA 1TU4A 3KXLA 3ZZUA 3A4LA 2NQ2C 1Q44A 3GFPA 5F9HA 3TIFA 3U7EB 4BLPA 1RZ3A 2I1VB 1G1MA 4D0LB 1N6LA 4WBSA 3VKHA 1YRBA 1ZNXA 4C4PA 4DXAA 3AH8A 4KHZA 1DAKA 2JLVA 3FFBA 4OJQA 1E2LA 3T12A 3P32A 1U98A 2DBYA 2ZRDA 3QKRB 4US0R 5HTKA 3ZS9A 1VYVA 3T5GA 4DCNA 4A15A 1NBMD 2PCLA 3QKSB 2WWWA 4D81A 2DFKB 4IOJA 3EZ9A 1WA5A 3CONA 1E9AA 1KDRA 4PAOA 2DB3A 2YHSA 5FBVB 1II0A 2YKGA 1W5SA 3E5HA 5C4MA 3ZD7A 5E7MA 2W2VA 2IYYA 2MMCA 4B43A 1IN4A 5HZKA 1Z6YA 4BLSA 2B8TA 4CW7A 1T0JB 2R44A 5SZIA 2BJWA 2VHUA 2ZYTX 1X3SA 2ZI7A 1NN0A 2EFEB 4URZR 3VR4A 3QXXA 4GRAA 3AVWA 3X1DA 1IXSB 2QE7A 4DWJA 3EX7C 4OQMA 3OIVA 1CXZA 1I2MA 4PXAA 3TW4A 1JR3D 4R2IA 2JLSA 3RS7A 3RSLA 3QF4A 4F7WA 3R9IA 2JJ2A 2H8KA 2ZSAA 3GP8A 2IS4A 5EXPA 4C0BA 1Q1QA 1QHNA 1R7RA 1Z6TA 1XCPA 2IYLD 2QZ4A 1KMQA 3KQKA 4Q4JB 3QVVA 3DO6A 1I4TD 1KJZA 4QBGB 4DZZA 3O8RA 1GNRA 3RANA 3W5IA 2ZRBA 4ZI2A 2IT1A 4Q01A 4TTPA 3U3OA 1GUAA 3I92A 2ZREA 4HAXA 1J90A 4ZCMA 1IM2A 5P21A 1S0UA 2YWHA 1KI7A 3A37A 3SS8A 2D3WA 2FZLA 2QN6A 1CEEA 1W36D 2QENA 4DSUA 1Z0IA 4CDGA 5AUNB 1VMAA 1XX6A 3H1TA 5KDDA 1OYYA 4DJTA 2JLUA 1NI3A 4DLSA 2ZSEA 4KI0A 2HUPA 1PVOA 4QGHA 4M21A 5JCZA 4JLVA 3THWA 2ZJYA 3EZ2A 5JEDA 5AJVB 5KSPA 4UNSA 2DHRA 3OE7A 4GOKA 3I32A 2GBLA 4QBHA 4WZ6A 4GMXA 4D6PA 2TMKA 4H1VA 1YZTA 2CMKA 4NCKA 5KSYA 2DWPA 4MKHA 4OHYA 4W7SA 3WRYC 4UXIA 1XD2B 5HCIA 4DB4A 2QQ0A 4FW9A 1VYUA 5FTJA 1S9DA 3V4FA 2WIAA 1G7TA 1DBSA 3JVVA 1VYTA 3A1SA 2Q9AA 4LI0A 1XEWX 3QG5A 1G8PA 4XH9B 3MJRA 4TZ0A 1U9IC 3EZ7A 2JGNA 1H8EA 5C46F 1ZRHA 4TTRA 1XWIA 2J0VA 3KTAA 2GXAA 2GVDC 3OE7D 2IYVA 4BFYA 3KQUA 5FR1A 5DNYB 2OM2A 4RD4A 2ZROA 3MRSA 4A8JB 4BGDA 4YDSA 4OKSA 5TV2A 4ON9A 1N0WA 4Y0VA 3VHLB 4CIDA 4DHEA 1JNYA 4J0QA 4B32A 4FXPA 4GZMA 1NF3A 3UATA 2GJ9A 3T1VA 2IS1A 2EQBA 2JIZA 1Z08A 2Q0HA 4D0GA 4EPXA 1CJUC 3B60A 3G5UA 1JPNA 1N25A 2QAGB 4PHTA 4NBSA 5JRJA 1UF9A 2AD1A 3TSWA 5L3QA 3LW7A 5D3MA 5EE5B 3IEVA 4RSGA 4NP6A 4I81A 2CXXA 4EJSB 2LCFA 1CU1A 4LBVA 5FL3A 3DHWC 3PUZA 3MCAA 2RGNC 4O3MA 2GCOA 2FSFA 1VDZA 3EASA 1NP6A 3DOFA 4XTCS 3THWB 2EFDB 3QKUA 1NL3A 1T5LA 1F2TA 1G8YA 2W00A 3Q3JB 1M34E 2JIZD 2IF0A 1KO7A 3QG1A 1GWNA 5A4JA 1G64A 2IXEA 3FOZA 4AC9A 1EFRD 5CB8A 2J0QA 3LFUA 1WBDA 1SVWA 3SBDA 2GESA 3EPKA 4PR0A 2ODEA 1FNMA 4RKEA 3B5JA 2BEKA 4TMKA 1ANKA 4LCBA 1SQ5A 4NCHA 4C0SA 4FMCB 3SR0A 3IBYA 2XXAA 5FL7A 2VO1A 3AKDA 4FINA 2R2AA 3PEWA 2G9NA 1XF9A 3OEHA 3GLGE 1WP9A 1C1YA 1ZIOA 2GEUA 1UADA 3B82A 4ZPXA 3U7GA 1KO8A 3WMFA 2HV8A 1FUUA 1Q21A 4AK9A 2IS2A 1EFUA 2OUKA 3P1JA 2WSSD 1R5NA 2NO6A 3T35A 2VHTA 2QT1A 2FV8A 5TXGA 4A82A 2XOKA 4DSOA 1CRPA 3I61A 5LBIA 1G3QA 2YWEA 2ATVA 2F1RA 1OF1A 1PLLA 2GNOA 4NKRA 1SVOA 2J0UA 1OXVA 3GFTA 3AF3A 4CGZA 1N5IA 3TJZA 1AS2A 4DDVA 5D3MB 1UM8A 3V00A 3BK7A 3Q85A 2ZANA 4XIGS 4DCTA 1DO0A 2HCBA 2ZRNA 4LYHA 3BE4A 3SHFA 5TDHA 4Q4HA 2RCNA 2GAOA 3B1ZA 421PA 4QRHA 4BLTA 1KSJA 2P6UA 4Q1FA 4DIEA 1XCGB 2C2HA 3ZIAA 2F7SA 1UKYA 2G88A 2H5EA 2Y8EA 1AS0A 3N70A 1F2TB 2ZYVX 4ARZB 2XOKD 3NHAA 4M9XA 1XTQA 4YMSA 1ZW6A 1ZM4A 1N6HA 1OIXA 4FCWA 4MYHA 1J99A 4C0KA 2BDTA 2XZPA 1XTJA 4XVRA 5FUWA 1AQYA 2RGGA 3BB3A 3X2SA 1E2QA 1CTQA 1W4RA 2KI5A 1RIFA 1I2DA 1XEXA 3GLGB 4HLCA 4B3BA 1IBRA 5CM9C 2YZ2A 2J1LA 1E4VA 1PZNA 2GK6A 1VPLA 2ZJ5A 3LVRE 2P5SA 4NONA 4GT1A 1TU3A 3ND8A 2JLZA 4L16A 1AN0A 3TR0A 1OH7A 3BAFA 2X19A 4CZ2A 1R5OA 4PO1A 1WE2A 3K0SA 3C41J 3TR5A 3RVBA 1XPRA 3NVAA 1O3YA 3OIYA 1I4DD 1XBTA 2CLCX 3CIOA 4DEXA 2QSYA 2D7DA 1P2SA 1ODFA 4GBMA 2CL7X 1A7JA 1AKYA 1P72A 3U61B 1RC8A 1EXMA 3ZZ0A 4MKGA 1SXJA 1R8SA 2ZXUA 5J4YA 3AV0B 3C14C 3KJIA 1OIWA 3CW2A 2QBYB 3PG5A 1NG9A 1E2FA 3MGCA 1KY3A 4US2R 1J7KA 2ZAOA 4HLQB 1AGPA 1TTTA 3U7HB 1NLFA 4JMPA 2GWHA 2CE7A 1RYFA 4BFSA 1W46A 4B6FA 1NY5A 2RGDA 1TF7A 4MUBA 1VTKA 2ZEJA 2VHQA 1DTSA 2YOHA 3LDAA 2VRWA 5JJKA 4M0LA 4G5OA 2WJIA 1GTVA 1G16A 2VSXA 4Q7LA 1OIVA 4YMVA 1GSIA 5E7JA 3GJ7A 4C2UA 3EIEA 3L0OA 1U81A 4G1UC 4D0NA 4X8OA 4B48A 3OAAA 3GLHA 2OBMA 2V6JA 5TARA 2DCUA 2PMKA 2YINC 4HB0A 3MLEA 1SKYE 3DMDA 2C78A 3IGFA 3WMEA 1RRFA 3M1IA 1W48A 2KJQA 1GOTA 4ZCIA 4JVLA 4I1OA 3TNFA 4CEJA 2XJ9A 4CF7A 1OXXK 2REOA 4QC2A 3Q9LA 1L4UA 4HLUC 5CM8B 3RRZA 4ZIRA 1HQCA 3RLFA 2FGKA 2L0XA 3CR8A 2W6IA 4II7A 4B74A 1OFHA 3OAAD 2OXRA 4URXR 4I1VA 5H8WA 4KYUA 1DELA 5BYKA 2Z43A 3W6OA 3BD9A 4Q48A 4MRNA 1LV7A 1OXTA 2O52A 2ZRMA 2NO9A 2ZRPA 3M0EA 4TN1A 3SNHA 3GJ4A 3W8RA 2O8FA 2PX0A 5KPDA 1WMSA 2R6AA 2PBRA 3GJ3A 1P9NA 1XD8A 1Z8FA 1KK3A 1ONBA 2BMFA 2YWGA 4KBGA 3I73A 4QXAA 4GFDA 1P6XA 1U2RA 4RD3A 4JKIA 1AK2A 2CCJA 1MO4A 1TPZA 2KBFA 2WMOB 3C5CA 4IRUB 2W6ID 4JL5A 4EQ6A 3R9XA 2OAP1 3FWYA 5GJVC 3TKLA 3K9NA 2Z4SA 5KSOA 2PX3A 5TMPA 4OHWA 1OH5A 3I5XA 4TYPA 1HURA 4XD7A 1QHYA 2VP2A 1E2MA 2CVHA 2JLRA 1R0ZA 1CKEA 2ZVPX 5G41A 2BKEA 4Z51A 3UMRA 2OZEA 2AK2A 3LNCA 1WXQA 1Z0FA 5GADl 4JLOA 4KJZA 4D4JA 1NSTA 1E2KA 3CF0A 1FX0A 3ZJYA 3PEYA 5KU1A 2H1LA 3IPXA 3GLHB 3CBQA 4Q21A 3IHLA 3VR2A 2ZSBA 5EP2A 2P65A 3GFOA 4LSGA 1ZUNB 1KO5A 1XMJA 2W83A 3LQQA 3QQ5A 1PLKA 4M4SA 4YXWD 2QP4A 3LX5A 1XTRA 4AY2A 4DBLC 4MUAA 5EE1A 3X1XA 4NYMR 3TQCA 1FQKA 2ZRKA 1NVUQ 2G6BA 2N46A 2NZJA 3P4YA 3GCGA 4TLBA 4XD7D 2J9RA 3PUWA 2ZJZA 2V1UA 1KMHA 4B2LA 1DG1G 4XTRA 4AKIA 4BLOA 3WBJA 2QPAA 3DZ8A 4KCGA 1VIYA 3F5FA 3BH6A 3GLIA 2C99A 1NNEA 4UXHA 1OH8A 5EUQB 4M9QA 2BBSA 4RJLA 3EPJA 4RZXA 4M1SA 5FPKA 4R9UC 2ORVA 4BFTA 3C8UA 4RD2A 2CJWA 2A2ZA 3H86A 2AD5A 4QOSA 3SI7A 3P26A 1F5NA 3J81k 2R6FA 1L7VC 4DLXA 2J41A 2JASA 4W9MC 3K70C 4LX0A 4LJ7A 2N1BA 3QXHA 2P6RA 3GEEA 4K8OA 2ZR0A 4V0KA 1E3MA 1YR9A 2J59A 3ZDQA 4D80A 4C9BA 2R6GA 1IY1A 1Z6GA 5CJ2A 3PCRB 4YONB 2B6HA 4AI6A 5DI9A 5JEEA 1BYUA 4G5QA 4MH0R 2O8EA 1G18A 2BBWA 2G77B 2QI9C 3OF5A 4OHZA 4JSYA 2GZHA 4HB4A 1YZNA 1MO3A 3ZZTA 4P4SB 3HYRA 4ZI3A 3BIFA 5FR2A 4KVGA 4HZIA 1R8QA 2QGNA 4FCVA 4JLPA 4E07A 1HV8A 1M7BA 4Q03A 3VX4A 1E9BA 3B78A 4LHVA 4EPWA 1FMJA 3ZVLA 4NMMA 2JLYA 1OHHA 1IOZA 2FPKA 1XEFA 5G3YA 1BKDR 2C9YA 2EFHB 3EXAA 4DVGA 4IEEA 5JSZB 4JYCA 4OBEA 5AUPB 4B47A 5DLQC 5FBQB 2OHFA 1W7AA 3QIAA 4JSTA 2VEDA 1ETUA 3FPAA 4C2TA 3IUYA 4A0HA 1XDBA 1M2OB 1RW4A 2B8WA 2BMJA 1UJ2A 3BRWD 4ASUA 1A1VA 5AJWA 5IF9A 621PA 1OPXA 4DLVA 2ZU0C 4YC7A 2QGZA 4A6XA 1UAAA 3IPYA 1II8A 1Q1BA 1CR4A 4YMWA 1N6IA 1P61B 4P0TA 4ACBA 1OHHD 2J3EA 5KNDA 4HUQB 1TF2A 2CJWB 3UG6A 2MMGA 3SQWA 1LS1A 4P33A 1LFDB 1SZPA 3OEED 4JS0A 4GZLA 4A2QA 5H68A 2VH5R 2WWYA 4YLGA 1TF5A 3Q5EA 3GLFB 3T61A 4Q9KA 3G82C 5LD2B 4D2IA 3AQ4A 5E3HA 3RYTC 2O8BB 5JI3E 4OJKA 2E1RA 1SKQA 4V02A 2DY1A 3ECCA 4Q1EA 2X1VA 5JMTA 3R9WA 2ZTSA 2QUZA 4XVUA 4FI3C 3KX2A 4HAZA 5AJYA 1E98A 4KFUA 4BZQA 3KUCA 3THOA 4DDTA 4JBWA 2F1IA 4XWOA 2IUSA 3FMFA 4B3XA 5L3SA 2ZRIA 2QT0A 2ZRCA 1GM5A 4LHZA 5KYKA 2A5DA 3BB4A 4JJZA 1G6OA 5CLQA 4LWZA 2OBLA 3H4MA 5TY0A 2EYUA 3THXA 1T3LA 1J70A 4MKIA 2WOJA 3QE0A 3DM9B 1G5PA 5DHAA 4Q1CA 2Z4RA 4JLKA 3U4QA 4RZ3A 1IXZA 3B13B 4MGZR 2C9CA 2JJ1A 3VX3A 2QM8A 3EZFA 2XITA 3NTUA 1K5DA 1VCIA 1XXHA 2OLJA 1N2CE 4B3GA 1ZM7A 4PHGA 5GJBA 2J46A 5FUXA 3VNUA 1DO2A 1NKSA 2Q3HA 3A1UA 5FOXA 4LJ6A 2WAYA 2Q6TA 3RC8A 3BORA 4NYJR 4JVMA 1KNQA 3AF4A 2IHBA 2NO0A 1UBFA 1X8LA 4IDQA 4BECA 4QBFA 1P60A 4BZPA 1W44A 3I8XA 3VR3A 5JRZA 5GVSA 2H17A 1FFHA 2WAXA 5DN6A 5J4HA 3X1WA 4EKDA 1E2EA 4UXJA 5FTLA 1U9IA 3CR7A 4LJ4A 4IKEA 2WOOA 2JJ1D 2PZGA 5FUVA 2HJVA 4L9WA 3A1VA 3CRVA 2PJZA 2JAQA 2RGXA 5UKDA 2WWXA 2PT5A 5BQ5A 4QNRA 5AK0A 5LB4A 5JWRA 1AGRA 5JBQA 4DC9A 1YU9A 2WIBA 2HYIC 2O8CA 1NBMA 3A1WA 2ZUBA 2BMDA 3IIJA 4OYHA 5F2EA 3KQNA 1M74A 1Z6XA 1N0UA 4IW3B 1E1RD 2VSFA 4C0JA 2QTFA 1RJ9A 5DN6D 5L3SB 1KZGB 1IN6A 3A1TA 3RS2A 4W5JA 4OHXA 2P5TB 2YNMA 5E7IA 1Q0UA 2WWGA 3HWSA 2Q3FA 2QP3A 4C0QC 4NTZA 3THXB 2F1JA 1ZNWA 5J47A 2P67A 4MDEA 1US8A 4P4UA 1QHHA 3IILA 2VSOA 2HYDA 1JXMA 3WYAA 1H8HD 4DLUA 3MUFA 4TYYA 3KJEA 3VR5A 4A0GA 1T4GA 2G1JA 2RGNA 4JT2A 521PA 4BEJA 3L82B 2QG6A 5JJIA 1Z2AA 4D25A 1OSNA 1ZMXA 2ZRJA 2OT3B 3TVDA 4D4MA 2IS6A 1JR3A 4DLTA 2GZDA 4PQFA 1GITA 3QOFA 2VHJA 3CWQA 4B2PA 3BOSA 3CNLA 3NC1C 3NC0C 3HP1A 2QMOA 2D2EA 3OFND 4Q02A 3B9PA 5G53C 1CJTC 3IDQA 5LDDC 1NKTA 4P3YA 4BASA 2ZM5A 3PJRA 4HAUA 1KI3A 3K0AA 2IL1A 1YR7A 3I3SR 3LXXA 1D9XA 2GF0A 1T0HB 3FMOB 4RFSB 5DI3A 3HYTA 3U3RA 3LAWA 1D2EA 3I4LA 1OFIA 1QVRA 3CX6A 1YR8A 3E1SA 4PO9A 2AXPA 2ZRGA 1E0KA 1R5BA 2WKRA 5FOVA 4LUCA 5L8VA 2CHQA 4EUNA 3LO5A 2EFCB 2CLDX 2VP4A 2FNAA 1UBGA 3PVSA 1Z2CA 2OCBA 4OI4A 2QMEA 2Z5FA 3KXKA 1RPZA 2GA8A 1CRQA 1K8RA 2JLXA 4CEHA 3VNVA 3ASZA 2D06A 2XX3A 4KSCA 3QPVA 4PPQA 1E69A 1T91A 1RJ9B 4CT4B 1OE0A 2JATA 2OV2A 1E2JA 3KJGA 4MGIR 4TMVA 1JR6A 1K5GA 4Q9LA 2OCYC 3DKVA 3QBVA 1E9RA 4BRUA 1EESA 1QZXA 1AQUA 1MRNA 3TSOA 4IOMA 4L5BA 2FSHA 2HF8A 3FMPB 1YZKA 4HAVA 1P9RA 3BFXA 3Q72A 3I72A 4M22A 4NPHA 1RRPA 1JPJA 2FWRA 2Z83A 1G7SA 2IYQA 3QY0A 1ZC3A 4M8NE 3FHTA 2QRNA 1JBKA 3C15C 5FI1B 3RNLA 2ODBA 2IC5A 1DAFA 2YC4C 4WXPA 4LV8B 2GCPA 4OK3A 2CL0X 4DSTA 4EAQA 3QF7A 1B23P 4E22A 2D4HA 4B75A 1VG0B 3ICEA 1ZD9A 3L2OB 5EE9A 2B7CA 4B71A 1KJYA 2WWIA 1M7HA 1ZBDA 2J5XA 4LJAA 2BJVA 1CJVC 3TQFA 5AWFC 3FGNA 1E96A 1KJWA 3VKWA 1GL9B 2ZR7A 1WB9A 2F9LA 4WW0A 2OAQ1 1TEXA 1OKKD 3F0TA 4TMTA 1E6CA 2PMDA 4TSFA 5FOSA 3PXGA 4BLRA 1XB2A 3B1XA 1R4AA 1VECA 2C8VA 1W36B 1T6NA 3QF4B 3THYA 1HA3A 4PQRA 1PV4A 2WJYA 5AJZA 3EARA 4K46A 3TW8B 2DFNA 1N5KA 2RGCA 3U7FB 1Z3IX 3KKOA 3IIKA 4HYYA 1S96A 1S9HA 1JQLB 5FPHA 3ZS8A 2W58A 4IVQA 2VLIA 4A1FA 4CEHB 4B33A 3HDTA 1N6KA 4LPSA 4KAXA 1ESNA 4HSEA 2WJVA 1P2VA 2NMVA 4OK5A 1D6JA 2BVNA 4TSFD 3T1QA 5FTNA 3X1ZA 4R71A 2IYSA 1EFRA 2ZS8A 4WIAA 1W0KD 2GJ8A 3M4YA 2QQEA 4OK6A 2GTPA 2WJGA 1KI4A 5KO2A 2A7QA 4DLRA 5BWMA 4JL6A 4JBYA 3CRRA 1NRJB 5JS7A 2FPLA 2IWRA 4OQFA 4KODA 1GKUB 2A9KA 4DLYA 1W49A 4M9SA 2IX3A 2EWVA 2PEZA 2NTYC 1FL9A 1HUQA 5KDOA 4M2LA 5BYJA 1ZD1A 2FF7A 4JBXA 3DPUA 2GXUA 2IEZA 1M8PA 1Z28A 2KSQA 2OBNA 2WICA 2XTZA 3FHCB 2VP9A 4LHXA 3TVTA 3WHLA 4QM7A 5F9FA 2H18A 3P27A 2OG2A 2NPIA 2AHOA 3MWYW 3QENA 4ZDIA 5IRCD 2JJ8A 1D2MA 2WSSA 3BB1A 3VR6A 1W4AA 4D4LA 4MGYR 1HE8B 1T8UA 4JVSB 1AIPA 3WBKA 3IHWA 1SVIA 2YJTD 3VKGA 4N3NA 1DAMA 2HLDD 2IXGA 3LXRA 5KDLA 4K81B 1ZM9A 4HLUA 3E2IA 2PL3A 4ERNA 3KTAB 4PZYA 4CEIA 1G7RA 4V0NA 3ZYCA 2GCNA 3T34A 2OE2A 2XSZA 4TLDA 1E99A 1NJGA 1QG4A 4OI0A 3TGPA 1HEIA 3SFZA 4Q66C 2I1QA 5GJCA 4DEYA 4W5WA 1CP2A 4URVR 1N5JA 4KVAA 2J45A 3SFVA 3A4MA 3AVUA 3NH9A 2MSDB 1UDXA 5CDFA 3KUDA 4TL9A 1DPFA 2XAUA 2P6NA 4KBFA 4HDOB 3VHXA 5HCNA 4DRZA 4F38A 5L3QB 4MRRA 5EP3A 3R8CA 2XSZD 4JYBA 5CLLA 1VIAA 2ATXA 5HR5A 1NN3A 4A8JC 1E2GA 5KPJA 1DEKA 2WV9A 3SC3A 1NMYA 2WSMA 2DYKA 2GCOB 4GNKA 3Q7QA 1ZCBA 4JL8A 4BFUA 3NXSA 2GDJA 1NJFA 2KBEA 4KFTA 3UKDA 4ESVA 4C0HA 1EX6A 2FFBA 2ORIA 2QAGC 3EIQA 4LHYA 4XWKA 3S1AA 3WYGA 3C5HA 5K8UA 1XMIA 2A5YB 2W2XA 1NY6A 1YQTA 3QPUA 2OESA 2ZJOA 1JECA 4DUGD 4EJSC 2FSIA 5F98A 3CNNA 3SDZA 2HF9A 1VHLA 2LWIA 4M9ZA 2J0SA 4KITB 2YC2C 2ZI9A 2GKSA 4EPRA 2XNDD 1YZGA 1ZD8A 4CRWB 2CHVA 2XXAB 1M7GA 2CVFA 3PENA 4GP7A 3H0KA 4X8MA 3BGWA 4Q7KA 5GJWC 1DVRA 1KI9A 1N6RA 3ZVNA 1AZSC 3TAUA 3TAHA 1RVDA 1HQYE 2YYZA 1RFLA 1KO1A 2ERYA 5BXQC 4QGGA 1N0VC 3JZMA 4AYTA 3WNDA 3EPLA 2V3CC 4PO8A 1X8KA 3QUSA 1ZVQA 4AWXA 4I99A 4NE2A 2QP9X 3NH6A 1KYIA 4H9GA 5CK5A 1MT0A 2J0UB 3WRXC 2HXYA 4AG6A 2NPFA 4ACAA 1XRJA 4O25A 3U44A 3KKNA 1E2HA 2E87A 5EP4A 1SXJE 1R2QA 2D7CA 3RDPA 3EW9A 4BQSA 2VIIA 2AKAB 3CPEA 4FWTA 3CF6R 2BIFA 3GJ8A 1FP6A 4TMWA 2FG5A 4V0OA 4Q4HB 2RGAA 5JLJA 2QA5A 2F3RA 1SVSA 4R2HA 5AR1A 4LV5B 4LJYA 3K0EA 3AKEA 1HT1E 1GILA 1GNPA 1GKYA 3MWLA 3F3YA 3IIMA 4IFEA 4U5XA 3K70D 3W8NA 2QY9A 2X77A 1F6BA 1U0LA 2G3YA 1R0WA 3S1AB 2B92A 4FMDF 2UKDA 3CZQA 2BBTA 1GIAA 2V7QA 4N0DA 2R8RA 3OHMA 2UZIR 4DCUA 1XEXB 4HUTA 1UPTA 1ESMA 4PFSA 4RZ2A 4PANA 4XJXA 1V5WA 3DDCA 3GPLA 4GL2A 3VTKA 2ZETA 5EXTA 3GLHE 3IO3A 1P7CA 2I4IA 4IXMA 4Q7JB 4P32A 2ASEA 3B1VA 3A6PC 2GVZC 4A92A 1Q12A 4OQLA 3GJ5A 4PSVA 2OILA 4DLWA 2JDID 1TQ4A 4F91B 2OO7A 4N1AA 4IXNA 3CPJB 1T9HA 2IYRA 4AIIA 1NVWQ 4CYMA 1IHUA 1CR0A 1NN5A 4UKDA 1HH4A 4ZDKA 2MSCB 2V7QD 2ZJBA 3MG9A 5CYPA 1GZSA 4JLBA 3AVVA 1W1WA 1WRBA 3NEJA 1O87A 1RKBA 4PC3A 3CNOA 1SXJB 5TB5A 5EJEA 1DS6A 1UKZA 4PHHA 1H65A 1FP7A 1WDTA 4B76A 4O2RA 3QSYA 2JLWA 2OCAA 1FOEB 2EWWA 3QI2A 3G0HA 1U0HC 2JEOA 3LRPA 1E9EA 2BHRA 3DEFA 1OJLA 3SJAA 3T15A 1T3HA 3QEJA 4C3ZA 1DAEA 2FA9A 3B9QA 1MO6A 4YXWA 5KTYA 3FDIA 5HE8A 2WVJA 2Q3MA 3DVLA 1P5ZB 3VMFA 3KXIA 4ZV4A 3IO5A 2Z6VA 1KI8A 821PA 1IY0A 2REXB 3L0SA 1R0XA 3A8TA 3CWZA 1QG2A 3AF0A 2O5VA 4LYJA 1BMFA 3FB4A 2GJSA 2ZJ8A 1QHSA 3R20A 2LKCA 1G8FA 3D6TB 2F6RA 4DDWA 2DWOA 3Q7PA 4IOKA 2EVWX 1FTNA 4RD6A 4PC1A 1KAOA 3GMTA 2FEMA 2F9MA 2QNRA 1BH2A 3LBNA 2QM7A 4WXRA 4POAA 5H70A 3EIHA 1QF9A 4DDUA 1VKJA 2QPTA 3QBTA 2AR7A 3WNCA 4V0MA 2FGJA 4DCSA 1NMXA 4CEJB 2RGEA 5FTMA 2PEYA 1OFTA 2IEYA 4KYIB 1NVVR 3AUXA 2BCGY 3CF2A 5K8LA 3HR7A 4ZIRB 4HI0E 1BMFD 1W0JA 2FEOA 2KB0A 1ZINA 2IYZA 4IDPA 4AYWA 3FKQA 1FMLA 1FQJA 3OZXA 1Z5ZA 4PZLA 4QNMA 1CULC 1ZNYA 3C7KA 4Q47A 2O8FB 5CYOA 3CZPA 4ZDWA 6Q21A 4I1UA 2PH1A 2ZIAA 2C5LA 4FIDA 2FFAA 4Z8YA 1TQDA 2IYXA 1W47A 2PLRA 2QAJA 3BH7A 3ND9A 4OQNA 3SHWA 1LW7A 4TLAA 3TUIC 4AURA 5K8IA 1J8MF 3QJYA 2W0SA 4N0EA 4LOAA 2FE4A 3K09C 2FU5C 3B2EA 4Q4AA 4EPYA 1MABA 1W0JD 3CRMA 4DT1A 3N5CA 4RCZA 2F43A 4EQ6B 5DHFA 2VHCA 4QFMA 1IN5A 2W6JD 4PPNA 3MJHA 2OFXA 3PUYA 3FYHA 2D74A 3GLFE 2BKUA 4Q1AA 1CJKC 1FX0B 1E2DA 3RRYA 5JWOA 1LF0A 3SE0A 1VCMA 721PA 4KFSA 1LNZA 1T5IA 2QSZA 4Q1BA 4M1TA 1CBUA 3Q8XB 1LF5A 1TNDA 2CK3A 2QTVB 4HDCA 2OFOA 1F3OA 5AUQA 2VQSA 1PUJA 3MMPA 3OEEA 3NDPA 2RHDA 4JZKA 1KI6A 1ZP6A 4LK2A 4V0LA 4JJKA 1N5LA 5EE0A 3SEAA 3RS5A 1KMHB 3L0IB 4Z54A 1JAIA 1ZUHA 3KKPA 4PHFA 4A36A 3A58B 3GQBA 4PX9A 2FN4A 3GLIB 3PEUA 3ZGXA 2YOFA 5J4KA 2A5GA 3HU3A 2G0NA 1WQ1R 2IBMA 4G5SA 3BS4A 1AS3A 1YKSA 2CK3D 1TX4B 2FJUA 4TMXA 2X2FA 1Z0JA 2ZRLA 5CIWA 4ZDJA 1G8HA 1EFCA 1SVLA 3LVQE 1T3SA 4HZUA 4TQ9A 3IQWA 4QJ4A 4A4DA 4IDNA 2QMUA 1W5TA 3AKYA 1UFQA 3AVYA 2IUTA 1G4AE 4TYWA 2HXSA 2F3TA 3T1TA 4DT1B 1JJ7A 3U60B 2PZEA 2F43B 3SBEA 2VF8A 2WJHA 3JVUA 1IQPA 3I1FA 4GOXA 4KSBA 4MGKR 3SOPA 1GKIA 1MRSA 3W5JA 3EZ6A 2IUUA 4BUJA 1ZYUA 3KDSE 3WHKA 4TTQA 2O8EB 1KDOA 1GVNB 2V1XA 1XJ0A 1C4OA 2XZLA 4KFRA 2ZRFA 2CNWD 3LBHA 4LYAA 1QHXA 4TLEA 2QEQA 2O0HA 1WF3A 2UVQA 3C16C 5HKKD 2ZI4A 4YMTA 1MV5A 1G3MA 4QGAA 1GP2A 5KOYA 3OESA 4A9AA 4PTLA 5FTKA 1KKLA 2EU8A 3REFA 5EE3A 5LPNA 4UJ5A 3TH5A 1DG3A 1JALA 2GK7A 1QDEA 1JEDA 5IT5A 2RMKA 4C7OA 3CPHA 2GJAA 3AM1A 2IF2A 2CCGA 4HDQB 2ZUDA 2AWNA 3KFVA 3QPWA 4BFZA 4MDFA 1TQ6A 4X8LA 3ADKA 4WZAE 4BEBA 4NYMQ 2QORA 2REBA 1G41A 2WHXA 4LBZA 1G4UR 2LKDA 1V43A 1KK2A 1II8B 4NCIA 1XTSA 4NU0A 3GD7A 5DISB 2I3BA 3RWMB 4B2IA 1A4RA 2ZUCA 1D2NA 4BFVA 1DOAA 2RAPA 3PQCA 4L8GA 3N2EA 1JEEA 2KE5A 1YJ5A 1NLZA 4M1WA 3SYKA 1SVKA 3GJ6A 2RB4A 3LH5A 1XXHE 4HZUB 1E1RA 4AD8A 3QKSA 3W9YA 3UMFA 4V03A 5B64A 5B57C 4GDFA 1NSFA 3A4NA 2WTUA 2OSBA 4MYCA 3K0CC 3VAAA 3ADDA 1IN7A 1NLYA 1DE0A 5JWHA 5EUMA 1LTQA 3Q5DA 3NWJA 4AKGA 1MH1A 3O8DA 3AP3A 1OH6A 4HLDA 4E03A 1II9A 2YVUA 1A82A 4U7DA 1Q57A 1XTKA 3HR8A 1H8HA 1D5CA 2V4ZA 4MKFA 5FOUA 5IDVA 5D3QA 1S8FA 1E0AA 1M6NA 2N42A 4GSYA 4ITRC 4MRVA 1OFUX 2BM0A 3H2YA 4BWYA 4NCNA 3W90A 1G19A 2QPOA 5ANRB 2FZ4A 1DARA 4PQYA 3LV8A 2IW3A 2ZPTX 1EK0A 2NOAA 3RRNA 2H92A 3BXZA 3SJCA 4EPVA 2O0JA 3DKPA 2WKPA 4LBWA 2CDNA 2QRZA 3BFVA 4TL8A 1KY2A 5FFMA 3KKMA 3OFNA 1NBME 2CEAA 3PEVA 1KHTA 4Z8XA 1I4LD 5IK2A 4OI1A 3ZVMA 3BWDD 4JLNA 4URYR 3U4QB 1T8TA 4Q4JA 4LC1A 4QL3A 3VU9A 2R6CA 1W2GA 4A2PA 3DMNA 1SVMA 3AVPA 2KWIA 3K9GA 2X2EA 1XXHB 4LYFA 221PA 4M53A 3RABA 1GG2A 3WNBA 3P20A 1XCMA 2W2TA 4UQOA 5JHGB 4QHSA 4Q1DA 4QBIA 1ZM2A 2ZQ5A 1D8TA 5JCPA 4Z1MA 3O47A 1KSGA 1TUIA 5AUOB 1XFAA 5B2ZA 4D4KA 2AL7A 5IK2D 2ZYUX 2QTHA 4M1KA 5FH9A 1D9ZA 1PJRA 2Q9BA 3U3KA 4NHOA 3PV0A 1Q1ZA 1JXOA 4L4UA 3I5YA 1JR3E 1Z22A 1Z47A 2IYWA 4MQBA 1G8GA 1XP8A 2CE2X 5KUTA 1YE8A 1YZQA 4ILEA 3NIBA 3AKCA 5KHOC 1KK1A 3TLXA 4QJ3A 4LBYA 4XVQA 1B0UA 3AGPA 4BFXA 4OI2A 1G17A 1F2UA 4M1MA 3BC1A 3U3JA 4P4TA 5J4LA 1XD2A 2K5UA 3CH5A 4A6PA 5KNBA 1HYQA 1HTWA 1TADA 4B35A 2O8CB 4Z1MD 1CS4C 3HPRA 3NG1A 3CUEF 4MYTA 3NBZC 2OLKA 3GJXC 3AVOA 3UPUA 1QVAA 2AFHE 1NIJA 1ZJ6A 3RAPR 3K53A 5K8TA 3HU2A 4IVRA 1DADA 2JA1A 2IK8A 3CH4B 1S3SA 5TVKA 4TQAA 5LB2A 1Z0AA 1US8B 1QHHB 1YZLA 4A8JA 121PA 4CT5A 2MSEB 2G0TA 1OKKA 5EZ6B 3T1OA 3VU9B 3FFAA 1VHTA 4TZ6A 2R6DA 1EFTA 3ZD6A 4DB2A 4G01B 2GETA 3AP1A 3D31A 3QVUA 2WPDA 2QE7D 3O8CA 5EZ5A 2C98A 2ZSDA 4GMDA 1KOFA 2QAGA 4B6EA 4AKHA 2C03A 4NYIQ 3W3ZB 4B3FX 1GAJA 3ZQ6A 1DAIA 2ZE5A 5JECA 4RZUA 3CX7A 1ZC4A 2JJ2D 2A78A 1HT2E 3WP0A 5BW8A 4EJSA 4JLDA 1TAGA 4JIMA 3T06B 2GAAA 3UWOA 2DPXA 3K0AB 4NYJQ 1YRAA 4G5GA 4Q7MB 1K6MA 4XOIA 3T5DA 3VQTA 4UNQA 3RS4A 2ANBA 5DI3B 3BH0A 3MWJA 1BYIA 1PLJA 2WPDD 4EDHA 1W0KA 3L43A 1G3IA 4OQXA 1G5RA 1F2UB 4Q18A 4UNNA 1CF4A 3FHOA 4RVCA 1XJQA 1Z6AA 4PAMA 5FBWB 3PITA 3FMIA 4GOJA 1CIPA 1Z29A 3AEZA 4NH0A 4HB3A 1E9DA 1TMKA 4IEIA 5L3RA 4XSGA 1IN8A 1EX7A 1TEVA 2BCJQ 1X1RA 1VCNA 1U99A 1Z07A 3TE6A 1BS1A 3D7MA 1BOFA 2V8OA 1A2KC 1XZPA 4E5UA 2Q9CA 1COWA 3K0FA 3E70C 2ECKA 2H16A 1KAGA 2V55B 2HLDA 1AJEA 3P4XA 3CRQA 1E9CA 3KKQA 2GHIA 2FH5B 1EFHA 4PSKA 3WXMA 2WMNB 3ICQB 4EFLA 4TMZA 4TWZA 1ZM3A 1OW3B 2ZJ2A 5A5GA 5FOWA 1H8ED 3L0PA 3UWKA 3WY9A 1R6BX 3AB3A 2DFLA 2ZR9A 3C4JA 3EC2A 5KSZA 2ZE6A 4TL6A 3V4RA 1Y3AA 1Z0KA 2OXCA 3B8HA 1LB1B 2DFTA 1P75A 4IJMA 2J7PA 5A0FA 1KI2A 1COWD 2XB2A 5CITA 1W4CA 4PPFA 5FPTA 4A2WA 5B58C 1Q3TA 3HU1A 1PUIA 3D3QA 1KGDA 2HT6A 4BPBA 5G3ZA 3ONWA 2ONKA 4ARZA 4A0RA 4XWAA 4O0MA 1E2PA 3REGA 3U3MA 4TYNA 3THYB 1FZQA 3DM5A 4AG5A 1XPUA 4I1SA 4KO8A 4R98A 3GLGA 2VA8A 4LHWA 5C18A 4A0FA 1FPMA 1ZAKA 2HDNB 3K9LA 2IYUA 5SZKB 1YVDA 2J7PD 5BN5A 5J4VA 1E2IA 1E1QA 2CHGA 5DO9A 2XGJA 4G0NA 1DAHA 4Y0AA 2ZYWX 1G5TA 3L8YA 3RC3A 1OT3A 1A2BA 4Q9IA 2BOVA 2RH5A 3JZAA 3F8TA 1CJMA 4IDOA 4Q00A 1W36C 2VF7A 1SHZA 4NZYA 1R0YA 4DUGA 3KB2A 4YMUA 5J40A 4QG7A 3K0FB 2VL7A 3LBIA 4U00A 4LRWA 1JJVA 5CDFE 3IKJA 1P3JA 1GL7A 1X1SA 4GPTA 4ESHA 2XNDA 2ZI6A 3WP1B 4KXFB 1EWRA 4HATA 4WA7A 5DIFA 1WBBA 1ZUIA 4X8HA 1E1QD 4RY2A 1WCV1 1IJEA 1SGWA 3PUVA 4OHVA 4AKEA 2QBYA 1E0JA 1N6NA 3I8SA 2VBCA 3W34A 3SQXA 5FL7D 3H84A 5FPYA 2SHKA 2WWFA 2XTNA 4LJ8A 1IXRC 1E2NA 3OEHD 4HAYA 4QGFA 1Z63A 3B1YA 2G1KA 1RRGA 2EYQA 1Q3HA 3NBXX 1Q22A 3MWKA 3SJZA 1QHIA 2ZE7A 2C04A 1E94E 1G21E 4WOPA 1Z06A 2A3RA 2OEPA 4YQFA 2QU8A 3EAQA 4ZCLA 1C9KA 1E4YA 3U2QA 1EG7A 1P73A 1U0JA 4QKQA 2GBLC 4FMCF 1S3GA 4NL4H 3GEHA 1QRAA 4CEIB 1G7CA 4NDZA 4FMDB 2O0KA 4E09A 3LLUA 3CM0A 1AZTA 3MAAC 2VTKA 4B44A 2WM9B 2ZAMA 2UZ3A 1GRNA 4LY6A 2IWHA 2IHYA 4F93B 1AA9A 2ZE8A 3HPQA 2HCJB 1G3UA 4YDHB 1J8YF 4G3XA 2ODWA 4BE7B 1W2HA 3AUYA 4US1R 3ZIAD 5JI2E 2ZS7A 4IHQA 5DE3A 1Y63A 1JB1A 3QXSA 3K09A 2PZFA 5DH9A 4H1UA 3FE2A 3B7GA 2D2FA 4L15A 2E9SA 1CLUA 2GZAA 1P9WA 2ZI5A 3NHBA 5BN3A 1VG1A 4F4JA 2V9PA 2FFQA 2OFWA 1VG8A 4BRWA 4LZZA 3R8FA 1IJFA 3CX8A 3R7WA 1TUEA 5SZJA 3QXJA 3UANA 2QMHA 4FMBB 2JDIA 2AXNA 4EPTA 1ELOA 3ZH9B 3UMSA 1HE1C 3A36A 2GEVA 2IXFA 4BFWA 4C0LA 2IA5A 4GP6A 3LY5A 4PC6A 4LDJA 1U94A 1XMSA 2VYFA 3NKVA 5E95A 5JHHB 2A5JA 1Z0DA 1QHGA 4MA4A 1EWQA 3CKLA 4JLAA 1SXJD 3I62A 2XNSA 2DR3A 1XPOA 2DWQA 3BFKA 4TT3A 4D82A 4QM6A 1U8AA 1GL6A 2XZOA 4IVPA 1G291 2P2LA 3ZLJA 1OV4A 1UEJA 3BERA 3VFDA 4U02A 3U6KA 4CVNA 2QROA 1ZCAA 2A30A 3MD0A 3WMGA 1XNJA 1XU4A 1G3RA 1VCOA 5EP1A 5G40A 4HB2A 5DSZA 1J2JA 2H57A 5GVRA 3QKTA 2F1HA 1UBCA 2YOGA 4TL7A 3K70B 5B30A 1XEWY 1Z83A 4LPKA 2WBLC 1KZ7B 2GXSA 4TT3D 3X1YA 5F3WB 1P4SA 4RD1A 3EPHA 4ZKDA 2Q21A 1YHNA 5C4GB 3U44B 2RKOA 2VPPA 4BZXA 1EGAA 1Q20A 2WJJA 3HJNA 3SJBA 3MFYA 1OB5A 2O8DA 2C95A 4F4CA 4JLMA 3O8BA 1ZNZA 3LD9A 5FBLB 1YZUA 1JAHA 3WYFA 2FFHA 1FTSA 3R7WB 1XD9A 8OHMA 4LJ9A 3EC1A 5DGXA 3K1JA 3DL0A 3DOEA 1OB2A 1N6OA 1GRQA 4FD2A 2ZSFA 3W6PA 1ZU5A 4TQUS 1GNQA 5JS8A 1S1CA 2R9VA 3CRW1 2BBOA 2PT7A 3B85A 3EA5A 3RHFA 2ANCA 3QEOA 2J87A 1A5TA 2HEIA 4W5HA 3AP2A 2FDCA 1KDPA 3TSZA 3PUXA 2BEJA 1SKYB 3KJHA 2WWHA 4S35A 1M1YE 1MR3F 4UNRA 1FW6A 3LW8A 4FN5A 4FWIB 5SZHB 3AVTA 4JT4A 4P4SA 2AWOA 1FUKA 1XZQA 1OLOA 3ADBA 4MYUA 2VP6A 4P31A 5CJPA 4PC7A 1X8JA 1XMVA 3QNUA 5EQTA 3OIUA 4LV6A 1LY1A 4LJ5A 1UDWA 4V0ME 5FPSA 3UK6A 3EG5A 4Q9HA 2W0MA 2WKQA 1MKYA 2W6JA 3M6AA 4M1OA 3TMKA 1G20E 5JSZA 3PR1A 2ZRHA 1KNXA 2B7BA 3GLIE 2C77A 2NG1A 2ZI3A 3TBKA 2CCKA 1S2MA 4PPGA 2GXQA 4PAQA 2ODNA 5FBRB 3UXMA 3K0CA 5C1BA 2GF9A 1NIPA 2AN9A 4QJ5A 2XJ4A 4Q4LA 2PJRA 3AVXA 3D8BA 3LLMA 2FMXA 4HUQA 2O8DB 1FNNA 3RSOA 1P2TA 1P2UA 4B3DA 5AJXA 4OL0A 4PSAA 4MRPA 1SXJC 2CBZA 2PLFA 4F4IA 3U5ZB 2ONJA 2NZ8A 1KO4A 3V9PA 1JI0A 4I4LA 1KIMA 2VP5A 4IOLA 1OYWA 3N2IA 4Q5IA 2F55A 2OCPA 1W4BA 4O2LA 3GLFA 4DIDA 2ERXA 5JJLA 1SHKA 3FVQA 3K9HA 4TLCA 3ZQJA 4Q9JA 3ASYA 3VR1A 2O8BA 2Z0MA 1E32A 1KTVA 2FOLA 4B73A 1JQJC 3ZVRA 4KV9A 5L3VA 4R7ZA 3TRFA 4C30A 5KNCA 5M04A 1KDTA 1NMZA 3B6EA 3PIRA 2FSGA 4RCYA 4LGMA 2NIPA 3W6NA 4URWR 4RFVA 1RE0A 2HT1A 5FI0B 4NCJA 3AVQA 3L8ZA 3IQXA 3GEIA 1KKMA 1ZU4A 3LQRA 2ZS9A 2CNWA 2G83A 1U90A 1RYHA 4PZZA 3SYLA 4QHYA 1DAGA 1IY2A 4KLNA 4M1YA 3KZ1E 5HKKA 2RHMA 2JLQA 4AYXA 4B3CA 4LC0A 4Q4AB 2RGBA 1MABB 2AFIE 3NEYA 4UJ3A 4XSHA 2ORWA 2XEXA 2H7VA 3W3AA 2R65A 4JKYA 3LX8A 2ZRAA 4EIWA 4DKXA 3LWNA 2XTMA 1L4YA 4JVNA 4KU4A 3BBPA 5E4FA 4WVFA 2AK3A 1YR6A 5FOTA 2HJGA 2EW1A 1U8ZA 1N6PA 4GI7A 3K8YA 4DLZA 5IHPA 3SYNA 2C9OA 3MSXA 2VP0A 4ZO4A 1F60A 2X8AA 4URUR 2BV3A 1VG9B 2WZQA 1BO6A 3FTQA 3RRMA 1OXSC 4EFNA 4FCTA 4C0AC 4ASUD 1UKVY 1QBKC 2AX4A 2V54A 1P62B 3CB4A 4UNPA 4S2EA 4BLQA 2FX3A 2GILA 1NVXQ 4QHTA 5CIQA 3KQHA 2CL6X 3B1WA 1RRCA 5C2JB 1KI6B 1IONA 1UEIA 4WZBE 4DSNA 4WAUA 3SU8A 2BM1A
chains in the Genus database with same CATH superfamily
2HL6A 5F73A 5IAEA 2C96A 3F78A 3U7RA 1N34B 1S4QA 3WA6A 1ORWA 1U8FO 2YV5A 3B3QA 2BSXA 1OUMA 2FPUA 4XIFA 1OXUA 5L51A 1YK0A 1ZNQO 1QYXA 2DJ5A 3D4OA 3P4UA 2B21A 3AL3A 4RPHA 5D8DA 4R2MA 5ALNA 1GDDA 4EVRA 3B7PA 1VHWA 1EVZA 1R10A 4FX2A 3CV3A 2C94A 3G2PA 4HDNB 4EX6A 2G9VA 2PVSA 4PX3A 1MMFB 4O08A 1SURA 5B1HA 2XVYA 4AULA 1IWBB 2YVKA 5ALZA 4CKCB 1SUPA 1NXWA 4FFVA 1ADBA 1KAMA 5ELXA 2JHAA 3WTCA 3OJFA 3K1AB 4RKFA 4H6WA 4RTJA 1NG1A 2XB4A 4RHEA 4YRTA 4B3TB 3PP8A 1TZCA 4TV8A 5EMJA 2O7RA 3A27A 3RBXA 5HUHA 1M5UA 3VH4A 1JJAA 3FWZA 1EX9A 1L5YA 3BF7A 3ETLA 3QKWA 2J3LA 5JO9A 3GLRA 1NP3A 1UIMA 1X6VA 4MUHA 4D9CA 1QRSA 1VSVA 2Z3WA 4TSRA 4YJ3A 4DAEA 1L8LA 3GH1A 3EZYA 1TOAA 1ZIPA 3B9RA 3OIWA 4LECA 3TUJC 4LRUA 3EDCA 3SQDA 5BWLA 4G24A 4FCCA 1UBKS 4F21A 4MW7A 5C3UA 3UMJA 4YCAA 3GJ0A 2Z5VA 4BNHA 4Z3KA 4OUDB 1QGYA 3OHPA 5FUYA 5IVHA 2CV0A 4XGQA 2PCJA 2MHCA 1ABBA 2NO1A 4WZBB 4RD0A 1YS4A 3QTTA 3KVNA 4ENVA 4Y2HA 2Q1UA 3E0XA 3EPPA 1KY4A 2ZITA 1CR2A 2YWBA 5FBHA 3WFIA 3D59A 3QQPA 4GMHA 4DLKA 3BWCA 1XHLA 1M2NA 3EWSA 4E6PA 1Y37A 3B5EA 4MITA 2G25A 3C6MA 1DCFA 4QICA 1K8QA 3U0VA 1JWLA 2OMEA 1CVRA 2JANA 3H4TA 5IFLA 2J9YB 2I99A 2B4AA 1BXRA 2WC1A 1KSFX 1SQFA 3K8OE 4FE4A 4LI3X 5DXFA 3SZRA 2FPMA 1YHYA 4AF7A 2I78A 5HE9A 1L2TA 3PFFA 1L7BA 1G4HA 1HDXA 1S5PA 2A67A 2X3YA 4G25A 1PNOA 2J7KA 4WASA 1HY3A 1DWUA 2W2QA 3PC3A 4IVNA 3LCMA 1QTQA 5IXJA 3A4LA 4ZTZB 1Q44A 3EXFA 3KSAC 2OZVA 4BLPA 1NXQA 2C42A 2I1VB 1NW8A 4MS3A 4WBSA 3SE7A 1VI2A 1LA2A 3N8KA 2W43A 4DXAA 1XMPA 1H3EA 2BEVB 3VC2A 4OJQA 3T12A 3P32A 1GGFA 1P31A 1WUJS 2FQXA 2ZRDA 3HB1A 4MUXA 4US0R 3M3DA 1O5TA 3ZUGA 4BO9A 1IDOA 1NBMD 1S8AA 3H65A 3UH0A 4I4NA 2DFKB 3FOWA 2VXOA 2H7CA 1L7OA 5H80A 4QDKA 1BS2A 1YS7A 1YAJA 1T2VA 3H8SA 1VJDA 5TPWA 4JJ7A 2RK4A 2QNBA 1H3FA 1SG9A 3ZD7A 2A0KA 3HJAA 1JSLA 4KB5A 5LQCA 3MRVA 1YZHA 2B8TA 4KE6A 3RR2A 1YKGA 1JUDA 2VHUA 1NXOA 2ZYTX 3UCXA 5K0CA 2JAPA 5HF8A 2E3JA 3VR4A 4M46A 4URZR 2BI7A 2DBRA 4N12A 1GCGA 3C70A 2J08A 3H9UA 3OTHA 5E4JA 4JOCA 1THZA 1P1BA 2VQFB 4Q12A 1J25A 2R8BA 4GVXA 3IPAA 2ADFA 4HL6A 3RYIB 3O91A 1WD7A 4FBLA 4U63A 2AMFA 2MR6A 4EUSA 1ZITA 4KIGA 1P1CA 1QC5B 2WK1A 5EXPA 1Q1QA 2X8LA 1BGWA 2IYLD 2QZ4A 2IOHA 2JCVA 1CEXA 3I9KA 3D7RA 3T1YB 1NPTO 1QGUB 4B17A 1NURA 4PZDA 5AHXA 2PO5A 4PFJA 3BSWA 4QBGB 2BDEA 2PQ6A 2P27A 3W5CA 3RANA 3OZSA 4R1UA 2IT1A 1V7PC 2YY6A 2A0YA 1YB1A 3ET4A 1HYBA 1GUAA 2DPHA 3EVAA 3I4CA 2YZGA 2ZREA 3I92A 2BE7A 2FUEA 3KVYA 4F12A 3ZDCA 2YWHA 2FN8A 3SS8A 2FZLA 2QN6A 1EB9A 4N47A 4DSUA 3ER9A 3BMOB 4QUEA 1R4ZA 1VJ0A 3V1TC 5IDQA 4B8YA 1FU4A 4EZIA 2OHGA 1P1IA 4FEYA 4MNTA 3H1TA 5BT8A 5KDDA 3OMXA 1ZSYA 2IZZA 4DJTA 1A7UA 2JLUA 2L2QA 2ZSEA 3IJ5A 2HUPA 4AKGA 4NEGA 2EIHA 1NVDA 4RPIA 2WP0A 4HADA 3NWOA 1X9HA 1XZLA 2VWHA 3IP8A 3WKAA 5JEDA 4C4ZA 3I32A 1U2DA 4WZ6A 1F7UA 4K86A 4D6PA 3ZK9A 3TLZA 4J16C 1FSSA 3JX9A 3KCNA 4NCKA 4EBBA 5KSYA 4MKHA 3PDUA 1U65A 2FX5A 2BFNA 2YXEA 3LOPA 5AKKA 3WWDA 4DMFA 4OHYA 2OO5A 3HVKA 3P19A 1DPGA 4B79A 3PK0A 4FW9A 3UMCA 1XHEA 5H9VA 3T7KA 1VYUA 3PU6A 1C2YA 5FTJA 1E1LA 2H4YA 1G7TA 3IP6A 2EJCA 4LHSA 2Q9AA 1F20A 4Y7DA 3QG5A 3OJXA 3MJRA 4XH9B 4KQHA 3EZ7A 2QPLA 3MZ0A 4TOIA 3IKLA 3DVQX 4MQEA 1XWIA 4B9AA 3WAGA 1DAPA 1Z34A 2EG5A 1X87A 4BFYA 3ORFA 3KQUA 3GFGA 4OSEA 1KBOA 5IAGA 1YD7A 4RD4A 1UMDB 3W8DA 5ES4B 3VH3A 2V0CA 1Y1QA 3B3GA 4Y0VA 3VHLB 3AMVA 1GLVA 5KTSA 4B32A 3WVNA 2XDQA 4D92A 3UATA 1Y5NA 3T1VA 4YT5A 4O8ZA 3B51X 4D0GA 5J2TF 1GN9A 5C5CA 2EJWA 1UK7A 2YNMC 2HQRA 5TQ0B 2QAGB 1XV5A 2AJDA 1SPBS 3BMCA 2O7QA 4MAMA 3ICCA 4RAQA 4QYXA 4LTMA 3WDLA 2AC7A 5A3QA 5L3QA 2YW9A 2NXNA 2I3GA 2QLNA 1XWWA 2ECQA 2ZP1A 4RSGA 5C7IO 4GE0A 5T3YA 2NX2A 1TQ8A 3BWXA 3R3HA 5D6OA 3K4PA 4I81A 4X24A 2OD7A 4EJSB 5I5EA 1CU1A 5DCUA 2C59A 3PUZA 3MCAA 3LHDA 2V7BA 4O3MA 4MYDA 4MQ4A 5FI5A 1YRWA 1DBQA 4IIVA 1HRDA 1MRZA 1UT5A 1YZYA 4OP2A 3AHGA 2Q6LA 1EHCA 1QAQA 1F2TA 2KPOA 2L42A 2O3RA 2W00A 3NU1A 1M34E 2IIPA 4V39A 2IF0A 1KO7A 4RGYA 3UJPA 5K4GA 1GWNA 1P1JA 3DT9A 4DANA 1E66A 2P40A 3N6XA 5F7JA 1EFRD 1EXWA 2YHUA 3NVDA 5CB8A 2DQ4A 1Z6QA 3PZRA 3OX3A 2Z5LA 2QMYA 1SVWA 2O4UX 3GFVA 4L76A 5EINA 3P52A 4WLNA 5SICE 5CA1A 2ODEA 2GK3A 1FNMA 4A8HA 1V8PA 4RKEA 4RTRA 2G1PA 2FETA 1L7DA 4MUKA 1EBFA 1DDIA 3DTVA 4CHGA 4V1CI 4LCBA 1UT8A 1SQ5A 5ISMA 1FDOA 4KQKA 4C0SA 5GONF 2XXAA 3PFWO 4D3YA 5FL7A 4KN5A 4EBFA 1I4OA 1YDMA 1Y3FE 2QL7A 1XF9A 3AFGA 2G9NA 4PNEA 5I7FA 1C1YA 1RXEA 4ZPXA 3U7GA 4REMA 4CMHA 1ND6A 1KO8A 2XNKA 5DPMA 1GTG1 3WMFA 2HV8A 2P11A 3MT7A 3NNDA 3DKRA 4LTDA 1MZPA 4DMHA 2QL9A 2WSSD 3QVMA 1FQWA 3AR9A 4ZRNA 4Y3UA 4EY7A 1MTOA 1Z5VA 2AZ4A 2VHTA 5B3JC 5JCOA 1IHOA 4FNAA 1N2ZA 2HSDA 4MB6A 2ZCVA 3I34X 3UAWA 3NASA 1SHTX 3OG9A 4NG4A 3UENA 4HWSA 3UKOA 4LF6B 5LBIA 1UZUA 1YDHA 2YWEA 2F1RA 1GPDG 2HA3A 2QZZA 5FA5A 3ZIUA 2J0UA 2EJUA 3A7DA 3UM9A 1ACLA 2IEDA 4TGLA 5B6IA 5JD4A 2Q5FA 1VFPA 2CDBA 1M2JA 1MZVA 4FEGA 5JC8A 1U3WA 5KNLA 1ZJYA 1AS2A 5D3MB 3WLTA 3Q85A 2E4ZA 1RAGA 4XLTA 3H05A 4C7BA 4NQRA 2HCBA 4EW2A 3AC0A 3PNMA 3FX2A 2B35A 3NHLA 3SHFA 4COOA 1REQA 4TXHA 4D9FA 3F4LA 3O82A 4BDTA 4QRHA 1T8RA 2BGNA 2C2HA 2HWYA 2L69A 4L8FA 1DFHA 2BUAA 1UKYA 2N47A 2H2DA 2Y8EA 3OOYA 1TCBA 3N70A 3HSKA 3S6JA 2JFFA 2JPDA 5EHNA 5KYYA 3OIGA 2XOKD 3NHAA 2YY5A 4FE7A 4M9XA 4UBIA 4ENQA 4YMSA 3CF4A 2H5IA 1WNFA 2X0EA 2BDTA 3Q11A 1XTJA 2DM6A 1VE6A 4ZOCA 1AQYA 2CKDA 1O9HA 4NBVA 4B85A 1KJ8A 4A5SA 4BO5A 4QG3A 3TOCA 1RIFA 1XK6A 4YBZA 4NOKA 4YJFA 3GLGB 2W42A 3E18A 2Y9MB 5T8KC 4B3BA 2C20A 2V6BA 4QOFA 2AJBA 1PZNA 1KR2A 2PAFA 1PD0A 2P5SA 3GZNA 4GT1A 3ILYA 2RJNA 3MTIA 4ZEMA 1KYYA 3BGVA 3RVOA 2E55A 3BVPA 1DBPA 3BAFA 3E0QA 1J97A 2SICE 1LX6A 1MGPA 4RGVA 5ALWA 3DWEX 1WE2A 3K0SA 1PJ2A 1NPYA 1B15A 1T6BY 3EGOA 4QAJA 4ZO6A 4XWTA 3UT0A 4FDVA 1O3YA 3MXTA 2O3UA 2IH5A 1I80A 1IU9A 1NQWA 2CLCX 2NZXA 2VK8A 1X7GA 3JQCA 3B70A 3MLBA 4GBMA 4RVUA 4Z9XA 4MUGA 4DQVA 1TVCA 5JBNA 1Z9BA 5HM8A 5LZ4A 4D9NA 1A7JA 5K05A 1AKYA 2GEBA 1GKLA 3ZI4A 1B7GO 1RC8A 4I2VA 2HO5A 5DCWA 5BWCA 3ZZ0A 4GXTA 3W0LB 3E9NA 5KOHA 5JANA 2PUCA 4J94A 1HZZA 2QMZA 3OQ1A 2CLMB 3J7TA 4MGEA 2ZXUA 2I6UA 2PX4A 1HLGA 2IZ6A 3C14C 3F46A 4RZQA 2H4XA 1W87A 3SXPA 3V42A 3V3TA 1NG9A 4C6RA 4KI7A 3SG0A 2GPYA 3FCAA 3MGCA 4IGIA 7GPBA 1YJBA 1UL1X 2PUHA 4UCQA 1AGPA 4NJMA 2D13A 1HMPA 4FGSA 3IHTA 3QEBZ 1LTHR 2P35A 4B6FA 2OGZA 3JU3A 3P2OA 1QP8A 3O8NA 3AKZA 1I3MA 2A84A 3BA6A 2ADOA 5AW9A 5HJ7A 2VRWA 3KT3A 3OC6A 4EH1A 1OGIA 3GYBA 4X90A 1G16A 2B69A 4NY1A 4Q7LA 3CYFA 3VO1A 4CMKA 4YMVA 3I23A 1C0IA 4U2FA 4BU1A 5E7JA 4GYKA 4DSAA 4AWAA 4C2UA 1A5BB 2NTJA 3ENWA 3EODA 4P1ZA 5A1JA 4R31A 4HCJA 3ZHTA 3WLJA 4G1UC 3KOYA 2RIRA 1OOEA 4X8OA 3ONDA 4B48A 2HCFA 4RLFA 3M9WA 2YMQA 3KK0A 4HB0A 1J7JA 2YINC 3MMNA 3CU5A 4PG8A 2RI1A 2C78A 1IZ7A 3A1CA 1R9NA 2WSIA 3HQ4O 3MC1A 1RRFA 3M1IA 3ZWCA 4G65A 4XIJA 3GA7A 1QAOA 2BONA 4JVLA 4D8TA 4EHNA 3FRJA 3PHHA 2XJ9A 4OGGA 1G8AA 1OXXK 2HBRA 3LUKA 2R1TA 2XUZA 2DHCA 1L4UA 4HLUC 4KAAA 5EIXA 3VPXA 1PWEA 4UC0A 4INOA 2GBGA 2L0XA 1NAHA 3CUKA 2W6IA 3B2QA 1DHRA 3E22A 4II7A 1U1EA 3GRKA 4UUQA 4W8GA 4B74A 3OAAD 2XB6A 2N75A 5H8WA 5BRAA 1RWPA 4KGVA 4ZFNA 1JMYA 4G1EB 5BSUA 1HDRA 4Q48A 4UFOA 3G88A 4UUNA 4EZBA 3REQB 3W8RA 2NO9A 3SNHA 5IPFA 2UUCB 4XDYA 1IRIA 5KPDA 2AQIA 3SGLA 4KKVA 1WMSA 2R6AA 3H83A 2D2IA 1EWYA 1LBHA 1E5XA 2BMFA 4U9IS 4ER7A 3S8MA 2Z9DA 2YVAA 1K7XB 1MVNA 5BR1A 3AEUA 1IEXA 2IU4A 2A86A 1KVUA 4MCJA 3KZKA 1U2RA 3ES9A 4RD3A 3PXXA 3NRJA 5AI9A 2I76A 2WUFA 3PQEA 4KBYA 3QEMB 1TYEB 1CPYA 1MO4A 2KBFA 1F1JA 2RD2A 1FFYA 1K1EA 3AUFA 2D54A 1G9TA 4JL5A 5F1KA 4BX2A 4EQ6A 4EW3A 2AMLA 2HK9A 5BSEA 1IE3A 2OAP1 4N5MA 1PJSA 3COWA 3K9NA 1H23A 2K7ZA 5AKEA 4D9MA 1OH5A 2EX1A 4LVCA 4XD7A 4YUXA 1MGOA 4FXOA 1CKEA 1WUKS 2BKEA 4X3CA 1PL0A 2OZEA 3P5BA 3LNCA 4YHBA 1AB5A 1KEPA 5LMUB 4FFRA 1NSTA 1VZ2A 4INJA 1XAGA 4R41A 2EW2A 3CF0A 5DGDA 5EUBA 3ZJYA 1EFKA 2EF0A 4KXYA 2HMYB 3VU3A 5KU1A 4LFBB 4ZYZA 2NU9A 1F51E 4CN8A 2ZIXB 4G0PA 4BP1A 4LQDA 3KO8A 4L1KA 4OB6A 4B6SA 4KGZA 5EHXA 4LSGA 1P5HA 1KO5A 3A04A 4XUCA 5BSMA 3UK7A 4I8DA 3WTBA 5K09A 1Q0TA 4ZVOA 1FP2A 1JJBA 1X3LA 2JI6A 1H69A 2X2PA 4U7FA 4NYMR 3M5DA 4BP9A 5KMGA 1NVUQ 2G6BA 3G0OA 1T0PA 1ZUWA 2FSPA 3GCGA 4P4GA 4ALMA 4AJ9A 5GINE 4X54A 3S68A 4NZZA 3CH6A 4D96A 1HLDA 2AXEA 2VYCA 4P5DA 4U6SA 5M3BA 1UZNA 1Y6GA 2CHUA 2QPAA 1QO0D 1BQ4A 1HYEA 1FYXA 1N8SA 2CJYA 2F1KA 4Q0MA 4NBUA 3ZCSA 2X1LA 4UXHA 3FSGD 1CZUA 4EJ0A 5LOVA 4FKBA 4M9QA 4RJLA 4M1SA 3VR2D 4RD2A 4KGDA 4QOSA 3ZXUB 4I50F 2JIDA 3GLUA 2GUGA 3GRFA 3P26A 4UZFA 4N40A 2ISCA 3JASB 1EGMB 4DC9A 1P0IA 1UZMA 1YZFA 1PJAA 2REQA 2CSUA 2HEGA 4TS1A 3RUIA 4BFCA 3TSCA 4W9MC 3NEPX 3PDIB 4AAYA 4LJ7A 5D84A 1W88B 1BHQ1 1P2GA 1FS4A 3W4KA 5C53B 4LISA 5KTOA 3K6SB 4YMLA 2P6RA 3A6KA 4K8OA 2LW7A 5IT0A 4GBGA 3MGAA 1SPXA 3TD2A 4BMVA 4D80A 4CV2A 3TLYA 4MLDA 5G2OA 4OLAA 4LQCA 1EP2B 4AI6A 3H9EO 2ODAA 3OPVA 3P9QA 3TX6A 2H9AA 3ZHXA 2O0LA 5CU7A 4A2CA 1XAJA 5K4AA 2O8EA 1G18A 1DDOA 2CWDA 4MEBA 3OMWA 3QJGA 3OF5A 3SDSA 2N9UA 1KERA 1U0RA 1L0BA 2GZHA 4HB4A 4XPIB 1YRYE 1YQWA 3ZZTA 3C4QA 4KVGA 4HZIA 1Q7RA 4E07A 3EEQA 4JLPA 1M7BA 1CDEA 1X7ZA 2Y1LA 3D6VA 4Q03A 2YZNA 5F7OA 2BP7B 5HKOA 1Y33E 3ROQA 4EPWA 3AHFA 3KS9A 1L4MA 2PRKA 3KZXA 1C3OA 2XQGA 1PR9A 4QXPA 1U28A 2EFHB 2YH2A 1IUKA 1TJPB 1ZOPA 4NE9A 2AYXA 2WV7A 4OBEA 2PBFA 3LUDA 1VL1A 3FCCA 1YFKA 1H1LA 3NV9A 5CVCA 5DLQC 4CLRB 2CXQA 3VYRB 3QIAA 1ZN7A 1JDBB 2VEDA 4DIFA 1ETUA 5KX5A 3W04A 3KZNA 2BMJA 1XDBA 1B8UA 3I42A 4ASUA 1V4VA 2VT6A 4HFJA 5CNIA 3TBHA 1JBEA 2V7TA 1IMOA 1OPXA 2XWJI 4YC7A 4DLVA 3IPYA 4HX5A 1Q1BA 1CR4A 3MYRA 1KWKA 5A71A 2OP0A 1CZNA 4HUQB 1E1KA 5JH7F 4RBNA 4OHPA 1ADJA 2PU7A 3IAXA 4WBNF 1PYDA 4NNOA 1NBAA 3D4IA 4NBWA 5B55A 3AR5A 1C1DB 1QZ3A 5AVSA 3I2HA 2D5AA 1Q0QA 2O48X 3LO8A 3P9XA 1RYDA 3II6X 3QYPA 4RTNA 4I55F 4RPKA 1U6JA 2ODPA 1EINA 4MYSA 2H1RA 5LXTB 1PJTA 2VDVE 5K20A 1U4OA 5IJ9A 1P4RA 3GZJA 5B3LA 3GLFB 3H7AA 4PSDA 2DY0A 5LD2B 1Z56C 1KIAA 3AQ4A 3PHCA 1CY1A 1CY8A 3OECA 4NXMB 1QUEA 4GZ3A 4R2JA 3ZTTA 3DE2X 2VTDA 3KETA 3HNOA 4PLGA 1KEUA 3ECCA 4UHDA 4FQ8A 4V02A 4N48A 1MV8A 2X1VA 4P5EA 2ZTSA 3KR9A 1SBYA 3N0TA 3KX2A 4HAZA 2ATCA 2C5GA 2H85A 5BUCA 2DHDA 1C9YA 2PUJA 4GU5A 1XK7A 2HRCA 4LDNA 3V8QA 4DDTA 5K0ZA 1RJGA 2BT4A 4JJ4A 4NF2A 3R4VA 2E1PA 3AQIA 2J3MA 4Y30A 1ZMBA 2F1IA 3NHWA 1JAYA 1NLUA 4AY5A 4XWOA 4WK0B 3DCJA 3FMFA 3L93A 4B3XA 1J0BA 2ZRIA 3HS3A 2QT0A 5KYKA 4U8HA 2A5DA 4U2EA 1V4BA 3F8WA 2JC3A 3R75A 4DUPA 4HWPA 2HK6A 4N5IX 2LV8A 4MKIA 3BQMB 4N0QA 3SBXA 3T7RA 4NEQA 3OZVA 3WE7A 3DUFA 3QVJA 3DM9B 1SCUB 3FUXA 1G5PA 3TD9A 2ZBFA 3U31A 2JHPA 1JBQA 3BX1A 2TMGA 1IXZA 2XE7A 3HY6A 4WI1A 1HDOA 3LPDA 4JCOA 3JD2A 3G6WA 2WMDA 3OLQA 5A4DA 3NTUA 1K5DA 4RKWA 1XXHA 1TD9A 2OLJA 2PQ2A 2VJOA 5AK6A 1F9AA 4GPEA 1ZM7A 5JR3A 3H2BA 3PEFA 3BE6A 4QUKA 5AVVA 1NKSA 4UZSA 4Y1EA 3IIEA 3H17A 3BORA 4M0FA 5FBZA 3E7WA 3WZMA 2H1SA 3WRYA 1EG2A 3AF4A 2NO0A 5FO0A 4FDLA 3NAQA 4GGMX 4IDQA 5TS3A 2WFZA 2NTNA 3SC2A 2CKMA 2ZWIA 2OL4A 5KTRA 1JG3A 5CNMA 1YCHA 4W6QA 3I8XA 1FFHA 4DBVO 3S27A 1SD2A 1U9IA 2JJ1D 1NGSA 1LQTA 2PZGA 3OKPA 4IM7A 1NX9A 4DC1A 1ZD5A 3C5VA 2JAQA 2RGXA 4HAIA 4UOEA 1RWNA 2PT5A 1UDRA 1FDSA 4MROA 4QNRA 1CUYA 5JWRA 5BVHB 1I6KA 3PXCX 4KHPB 1CJBA 1YU9A 5H16A 3DBHA 2HYIC 3VR5H 1L5RA 2FN7A 5CEJA 1LPOA 1PL6A 1RQ2A 4FEEA 2JGKA 5IU6A 1T43A 2C3UA 1JHOA 3EUFA 2BFPA 4FZ3A 3ESQA 4GI2A 4EG6A 4IW3B 4AP6A 4IIDA 1UJ6A 4EJFA 4XGKA 4C0JA 2PK3A 4QYIA 2R8ZA 4UTXA 1KZGB 3PGA1 3WWYA 3JQPA 2P5TB 1NI5A 3QW4B 2WWGA 2TS1A 3HWSA 2Q3FA 4R8LA 1JA9A 1W25A 1NVEA 4HAOA 1ZLYA 3PZBA 3UV3A 2RGUA 3EXG2 7ABPA 4U8GA 3DZIA 3QHPA 4P4UA 4TWAA 2VNIA 5DGHA 2HYDA 1NVTA 3E81A 3WYAA 5HZGA 3H1FA 3H97A 3MUFA 3QJ5A 3HK2A 3B20A 1LLCA 3ZGZA 1PNQA 2YV1A 1B26A 4ARBA 3DV0A 1BWSA 4BJHB 1GEGA 1NVAA 3DC7A 2RGNA 3IULA 3WGNA 1ZGBA 2C8LA 3ETHA 3IUMA 3O2JA 2WT8A 3DE5X 1WP4A 1X39A 2C4TA 4K6KA 4UM9D 4C2AA 5ELLA 1NF8A 3K9FC 3IX7A 1CLEA 5KYUA 1JR3A 1XQXA 4PQFA 2PKWA 3HL0A 3QOFA 3ZWQA 2VHJA 1VKZA 3CWQA 3RRXA 4B2PA 3BOSA 4C4AA 1RU3A 3LDUA 3NC1C 3SYMA 3EAGA 1KJIA 1J8VA 3OFND 4Q02A 2I55A 4IGAA 5FOQA 2W2KB 3NGLA 5BNZA 2OXEA 3COPA 4DMLA 1KYQA 1DL5A 4LDRA 5LDDC 1H42A 3VO2A 1NKTA 3IXLA 3EF0A 3LSTA 1WW3A 2EZUA 2NADA 4QYSA 2J5RA 2JH3A 3VR5D 1JQ3A 1I9GA 2WJZB 3TRDA 4C6HA 3WIBA 3P2EA 2AOTA 2GF0A 3CMMA 1T0HB 2XOEA 5EJ6A 3HYTA 4IZHA 4EGQA 2EC5A 2NUBA 4OFWA 1VMIA 2C82A 5TGDA 3RVQA 2P77A 1SD1A 4XKJA 1XWFA 4A8PA 2AYZA 3WIVA 5M2QA 1KPGA 3WG9A 3E1SA 2VK2A 4PO9A 2AXPA 4ZTBA 2QRUA 1RSZA 4DABA 1VE3A 3UHAA 3MQ4A 1DC4A 1WPQA 4GPZA 5L8VA 4EUNA 4TLLB 2VHXA 4EA9A 4IUCS 3UJNA 3QOYA 1ZVMA 3S2ZA 1UBGA 5ESRA 5CB4B 2QMEA 1XC7A 5ALSA 1U7DA 1R74A 1CRQA 1DLJA 5CA0A 5D7NA 2XX3A 4PPQA 4KSCA 4C4OA 1QQTA 5IH3A 3VSDA 1E69A 3FB1A 4CT4B 4J2HA 3BJMA 2OV2A 3V8MA 2Q4DA 1XDDA 3W5UA 4AJJA 4BBZA 1GXSA 3HN2A 3MTEA 2IU0A 4Q9LA 3DKVA 4ZQEA 5BSKA 3ANMA 1NR5A 4V1CB 3PRYA 3SK0A 1QZXA 4L08A 1MRNA 5EJ5A 5HM6A 3HCRA 2HF8A 4A3SA 4NPHA 3X1KA 3BFXA 1TO1E 4M22A 3HEMA 1GZ7A 1RRPA 1MAWA 1JH9A 2WSLA 2Z83A 4IDEA 1FVHA 2BGUA 2X86A 3AK4A 4Y9UA 1FYDA 2YW2A 3ZX5A 2ODBA 4OGKA 2IC5A 1DAFA 2FJPA 4Z4QA 1L3CA 1NZDA 1UPXA 1QFYA 3NHUA 2Q3DA 4FYJA 4JJ8A 3JQBA 2W8BB 3KJFA 4HDSA 4DR6B 1FYEA 2VEOA 3V2IA 5EY5B 1UC5B 4UM7A 2PXHA 4Q3DA 4RJJA 3PGXA 1H2HA 4UFPA 1BKSB 5DTRA 4YHHB 1BCRB 2J9GA 1KJYA 3PE4A 3OSZA 4M86A 4E2WA 2J3HA 3GEPA 4O2BA 3QPDA 4KZKA 4M49A 3IKTA 3ON5A 4MHSA 3AFMA 3ZQKA 4POOA 8LDHA 3VKWA 1N7JA 4D44A 1M54A 5AXCA 5GWXA 3SEZA 1WB9A 3RIHA 4CF4A 4K9PA 3F0TA 2BJHA 3K1ZA 1E6CA 1WXEA 4FYPA 1UJBA 3T4PA 4AJOA 1ZL2A 3A0UA 4UVDA 4CFZA 1RBMA 4LWQA 3WO1A 1CE8B 3PXGA 2PYIA 1VECA 3EXEB 5CHYA 1JE0A 1RHMA 3ZD9A 1U5AA 2N1MA 1ABEA 2RG1A 3A9RA 5ALOA 2E21A 1HA3A 4W5RA 5LNK6 3NRCA 4IMIB 2WJYA 5T41A 3EJ6A 2DFNA 2RGCA 3G2KA 1Z3IX 3KKOA 2ECOA 4G5FA 5KHLB 2XUIA 3ZS8A 3NAMA 3R0QA 1IL0A 4CEHB 3OQVA 4B33A 3DVAA 4NMWA 4L8WB 4X6LA 1JHRA 6LDHA 1OROA 4RQTA 4LOKA 3ZXYA 2VFAA 2IITA 3R5HA 3BIWA 2BVNA 3TLCA 4RLQA 2ODQA 3DE1X 4RF2A 4IQFA 3W5VA 4NMLA 2F4VB 4G4IA 3AI7A 3GBSA 3O74A 4KK4A 4R71A 2V58A 3C7TA 1JVSA 1U0EA 1NRWA 4OK6A 5DOVA 2I2DA 3K35A 2GTPA 3KTOA 1O6ZA 1DEXA 2Q5IA 3CUYA 3IBCA 3L5KA 2A7QA 3C3CA 1U7TA 3OM1A 4HSGA 1Q0RA 3VNBA 3VJLA 4BAGA 4UUAA 1MB4A 1NRJB 4GF5A 4F5EA 3O3OB 5BMVF 2G6TA 3PTZA 5LU8A 2QRKA 3OZTA 3LYUA 4NCBA 1QH1B 2XAAA 1W49A 5JS1A 1KJ9A 1P1RA 1FL9A 1XNGA 1EWKA 2NAPA 1S89A 2Y1KA 4CMAA 2LTAA 3F7OA 4K3UA 4P8RA 1ZD1A 1S2NA 2F67A 2KLHA 1U1IA 5HJ2A 3O21A 2VP9A 4JDUA 3OJCA 4OXRA 4PHCA 1UXGA 4Q34A 2OPHA 1C7IA 3P27A 2OG2A 3D7NA 3L07A 1BMTA 3OVMA 3CEMA 2D5LA 2JJ8A 4NH4A 5FHQA 5IRCD 4MA5A 2XIQA 3SVZA 5AFSA 1YQDA 2E6KA 4G23A 4I2NA 4MGYR 3P7MA 1O0BA 1AIPA 4MYRA 3TO5A 3WBKA 2YXPX 1PEAA 1RMYA 1RHRA 1SXIA 2YJTD 3AM3A 4TZKA 1JQEA 4GPD1 2HLDD 1V8ZA 2WMYA 1BDHA 3ZN2A 2BF7A 1RWMA 1ZM9A 4OATA 3GCDA 4WK4B 4OOFA 1O8CA 4OQZA 5F4ZA 1A9PA 4R8RA 4ERNA 3KTAB 3OCZA 5E9AA 3ZWOA 5L40A 4CEIA 4QUDA 3NHZA 1WY7A 1HXHA 2OK7A 5DBEX 2GCNA 3T34A 2FMIA 4RQBA 4TLDA 1E99A 3TGPA 2WKSA 4Q66C 4KIUA 5CFOA 2I1QA 1FW8A 4CMIA 1NUSA 5K0LA 5FBKA 3VPFA 2QLJA 4EGFA 3ZDAA 2IVZA 2WTEA 1VSQA 5A3RA 3O3MB 1NXPA 5ALTA 3ZQUA 3NYRA 2EP8A 3EXHA 4P81A 3AVUA 4ZI7F 3M7IA 5CVTA 1F0YA 1OLSA 2AEFA 4L7VA 4B0PA 4WERA 4BUZA 5HQTA 2P9TA 1C9NA 1PJLA 4KBFA 1JEYB 1K3FA 3E9YA 1KP3A 1FDIA 5CVDA 4ZWNA 1KU0A 1RTTA 3C87A 4OSOA 4J03A 5HKBA 2BTQA 2F3PA 2NSYA 1IBSA 1X74A 2QXTA 2WD8A 3UXHA 4F38A 3R8CA 2HTEA 1CFZA 5CLLA 4LYGA 1RWQA 4OX9B 1E2GA 2PLAA 3K8ZA 3VSEA 2DT8A 4YJHB 1KAEA 2DX7A 1PV1A 2EX4A 1U8UA 2HNKA 3LVFO 4QU9A 1RIIA 1WHSB 5IG2A 1M0SA 2G82A 4C14A 4J1SA 4UMVA 2OFPA 4LZJA 3NXSA 3NV7A 4KFTA 1NJFA 2KBEA 4D6XA 4CMEA 1TKBA 3JWJA 3TI7A 2FFBA 2ORIA 2QAGC 4PNPA 3WDSA 1BVUA 3EIQA 4R51A 5HQJA 4OLBA 1XMIA 4PRYA 1DKRA 3QPUA 2OESA 5AIBA 2ZJOA 1CS0B 4GO1A 1MBZA 3CCBA 4RSHA 5GV8A 2ON6A 4MQUA 4HYTA 3WGZA 4E5VA 1RZRA 4DUGD 4EJSC 1H85A 3HRIA 2R47A 2MIIA 1DQSA 4C0XA 5DBHX 4R3NA 5IBPA 2Q4OA 2WSYB 4GQIA 2V74B 2LWIA 2F17A 4B4VA 2BFBA 1MB2A 2ZI9A 3QNMA 4IJ6A 2XMQA 3LT1A 1Q15A 4CRWB 2CHVA 2R79A 3LHSA 3RYFB 4ZYWA 1KZ9A 1R0LA 3MTAA 5AESA 2H48A 1XA3A 2ZIWB 3A6HA 3ZWKA 5LP6A 1ZIXA 3TAHA 3V9AA 1E3QA 4I5FA 1GTL1 3U17A 1V11B 2ERYA 2Y93A 2QXYA 1OYVA 3WLKX 2OZLA 5DP1A 4LRYA 3JZMA 4AYTA 1PFKA 3EPLA 1HDZA 1FTQA 3KEFA 3FZGA 2RBGA 1ZMTA 3ASUA 3EDMA 4OHFA 1X8KA 3SHQA 1U6KA 4AWXA 3I2YX 1WMFA 4KWCA 1T26A 1U9ZA 3UK2A 1XO1A 4EUFA 5CLFA 4NE2A 4AJEA 1CERA 3QIVA 4YS6A 2ZSKA 3AUUA 3NH6A 3AIMA 3LPNA 1MT0A 1U3TA 4H9GA 5CK5A 4AG6A 2HXYA 4LRSB 2NPFA 5I4IA 1X7XB 3T8YA 5C8DA 1XRJA 1JXQA 1ZA2A 3AHEA 2JAWA 2CJPA 3U44A 1E2HA 3O1LA 2OENG 1XDGA 1BHJA 4IEFB 3RDPA 4BQSA 5HOEA 4J7AA 2AKAB 3V34A 1RXSA 2BIFA 3GJ8A 1UQRA 1WKCA 2CLKB 1W4ZA 3KDAA 1SVSA 1NQAO 4QOGA 5AR1A 2JBAA 3LTNC 3K0EA 5HIMA 5L4SA 3F1LA 2LCQA 4PSCA 2VNHA 3F6RA 1A5SB 1N9GA 3V8NA 3B7WA 4WK6A 2QY9A 4O4JF 4JXKA 2YJGA 3U9LA 1F6BA 1X1DA 4EKEA 2QN3A 4JSRA 4MI6A 4P6VF 1JKXA 4GOOD 4K2AA 1UK6A 1GIAA 1Z15A 2WTAA 3L02A 4N0DA 2F8LA 2R8RA 3CEAA 2UZIR 1J00A 3IEXA 3NCHA 3NGMA 4BO2A 4DCUA 1EUQA 3T0IA 1XNRB 1U7XA 4XJXA 1TM2A 1B73A 4I1YA 3JWGA 2FPPB 3NYWA 4R83A 3VTKA 2BKLA 2ZETA 3LKBA 5EXTA 4E51A 3GLHE 2GYWA 1P7CA 2G4CA 2I4IA 3PDJA 4I9HA 1OYOA 3UAZA 1QCCA 2ASEA 2I7XA 3AJEA 4MV8A 3B1VA 1NVFA 4GEKA 3R3XA 1F8UA 1X7HA 3EFHA 3B9BA 4KFCA 2I62A 4OQLA 4U7PB 2P2ZA 3X2FA 1W581 2JDID 2R3SA 1O94D 1U3GA 4H0CA 4N1AA 4F91B 4IXNA 2YRXA 4WE3A 3ICVA 1NVWQ 5AHRA 2YUIA 3H18A 3GL9A 5ALFA 3RF7A 3ZKWA 1Q95A 3EZXA 3OZEA 3MCTA 2ZJBA 5CYPA 2C29D 5C1DA 1W1WA 3C3AA 3IBFA 4H3KB 1TK9A 1RKBA 2GT1A 4PC3A 1BGXT 4ZAGA 1ZVJA 1FSZA 1QNFA 1QFJA 1SXJB 3BWYA 3GN1A 3KKZA 4R2WA 1ODIA 1OLXA 2ZULA 1JJFA 1UKZA 3AETA 2VZEA 2JKZA 3PPIA 4OLJA 1WDTA 2NT4A 4PHHA 1NWHA 1T1RA 5HCUA 4B76A 2OCAA 3HUUA 2W6CX 3M6LA 3DDHA 4XQEA 4S0XA 1E9EA 1FNSA 1DUIA 3SJAA 4DM7A 2B0CA 1T3HA 3LUBA 3QEJA 2CV2A 4C3ZA 4CLHA 5EIWA 3B9QA 3C97A 2Q3MA 4ZV4A 1P5ZB 4J0FA 2Z6VA 1KI8A 2IPMA 1K66A 5IJ0A 2I34A 3RQSA 3AF0A 1QP0A 2WA2A 4J0HA 4LYJA 2HLHA 1ENOA 3JV7A 1QH0A 5C31A 4YPVA 5BR4A 2Z8ZA 1DMRA 4LW8A 4LYYA 5AT1A 4WKGA