3WMGA

Crystal structure of an inward-facing eukaryotic abc multidrug transporter g277v/a278v/a279v mutant in complex with an cyclic peptide inhibitor, acap
Total Genus 222
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
222
sequence length
589
structure length
589
Chain Sequence
TGVTARRIFALAWSSSATMIVIGFIASILEGATLPAFAIVFGRMFQVFTKSKSQIEGETWKYSVGFVGIGVFEFIVAGSRTALFGIASERLARDLRVAAFSNLVEQDVTYFDRRKAGELGGKLNNDVQVIQYSFSKLGAVLFNLAQCVVGIIVAFIFAPALTGVLIALSPLVVLAVVVQMIEMSGNTKRSSEAYASAGSVAAEVFSNIRTTKAFEAERYETQRYGSKLDPLYRLGRRRYISDGLFFGLSMLVIFCVYALALWWGGQLIARGSLNLGNLLTAFFSAILGFMGVGQAAQVWPDVTRGLGAGGELFAMIDRVPQYRRPDPGAEVVTQPLVLKQGIVFENVHFRYPTRMNVEVLRGISLTIPNGKTVAIVGGSGAGKSTIIQLLMRFYDIEPQGGGLLLFDGTPAWNYDFHALRSQIGLVSQEPVLFSGTIRDNILYGKRDATDEEVIQALREANAYSFVMALPDGLDTEVGERGLALSGGQKQRIAIARAILKHPTLLCLDESTSALDAESEALVQEALDRMMASDGVTSVVIAHRLSTVARADLILVMQDGVVVEQGNHSELMALGPSGFYYQLVEKQLAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein/inhibitor
molecule keywords ATP-binding cassette, sub-family B, member 1
publication title Structural basis for gating mechanisms of a eukaryotic P-glycoprotein homolog.
pubmed doi rcsb
source organism Cyanidioschyzon merolae
total genus 222
structure length 589
sequence length 589
ec nomenclature
pdb deposition date 2013-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF00664 ABC_membrane ABC transporter transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1560.10 Mainly Alpha Up-down Bundle ABC transporter transmembrane region fold ABC transporter type 1, transmembrane domain 3wmgA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3wmgA02
2OBLA 4ASUA 1OYYA 2IYLD 2NIPA 4H1UA 2YC4C 3K70C 4XVRA 4JLVA 3WP1B 1JJVA 2IYTA 5KNCA 2CEAA 4TL9A 2ATXA 5JHHB 3Q7QA 2X1VA 3SZRA 1Z2CA 2HJGA 1IN7A 1UPTA 5SZJA 2QNRA 4X8MA 1CP2A 1PUJA 5FR2A 3WNCA 4M8NE 4XD7D 4XVQA 2VP5A 4IJMA 1CBUA 1YKSA 3GLFE 2KBEA 1CJMA 1FUUA 1COWD 2JLRA 1XZPA 3TE6A 5DHAA 1G3RA 1RFLA 1KK1A 4LJ4A 4TLAA 2KBFA 1Z63A 3DPUA 3C5HA 2X2EA 4NYJR 3CPJB 3E2IA 4M0LA 2BHRA 4UNSA 4JVMA 5DIFA 1JQJC 5JLJA 3LQRA 3OFNA 3ONWA 4CEJA 4EQ6B 4F91B 1GWNA 1GL7A 4C7OA 4JZKA 4QM6A 1W4AA 3GJ7A 5ELXA 4D80A 5A0FA 2BDTA 4Q48A 4WZAE 5EE5B 1HUQA 2FX3A 2IEYA 2W0MA 4HZUB 4DZZA 5G53C 2I3BA 2IYZA 1OF1A 1W0KD 1XDBA 4URYR 2YZ2A 1E9EA 1I4TD 5JMTA 4DLWA 2OZEA 2ZTSA 5JS8A 1W5TA 4BWYA 1NLYA 1G17A 2H8KA 3JVUA 2WWWA 4J0QA 4XVUA 4K46A 1DAMA 1XXHA 2V1UA 4BLQA 2FN4A 2ZJ2A 3GLGE 2UZIR 4TYNA 3QG1A 4TQAA 3THYA 3GD7A 3ZGXA 2CE7A 1YZQA 1JR3E 4JLBA 5JS7A 2WBLC 5BW8A 1T6NA 2IS1A 1LF5A 2FA9A 1FP6A 4HDOB 2A5DA 4C0QC 1E79D 2BWJA 2ZJAA 5JJIA 1KNQA 2WWHA 1OB2A 2ORWA 4BEJA 3KKQA 1EX6A 2NPFA 1EX7A 1YR7A 2NGRA 1DO0A 1JR3D 1ZP6A 4HAVA 2DWOA 1P60A 2YVUA 2A7QA 2OCAA 3LW8A 2QY9A 1U8AA 3Q3JB 5EQTA 5LDDC 4TZ6A 5B58C 3NEJA 4RJLA 1KIMA 1OV4A 5A5GA 2C99A 2ERYA 4NE2A 5B57C 4KI0A 1CS4C 3L0IB 3DZ8A 3GJ6A 2GETA 2GCNA 2O8BB 2WOOA 1US8A 4X8LA 4A0RA 3J81k 1KJYA 4DSNA 4TL7A 4L16A 2PCLA 5CJPA 2OG2A 3AVYA 4PQRA 4U7DA 3GJXC 1MRNA 1NLFA 2BBOA 1TF5A 3V9PA 4KJZA 2X8AA 2CL0X 4GOKA 2MSEB 3L43A 2BMDA 3EC2A 4NCNA 2C96A 2GF9A 4V0OA 3KXKA 1XMVA 2PEYA 4AK9A 1SXJA 4KCGA 3EA5A 3TAUA 4JYCA 3ADCA 4G1UC 2ZSEA 3AKEA 4ABYA 2YWFA 3QF4B 1VG1A 4EUNA 2ZRKA 3N5CA 3CKLA 4GOXA 3B1ZA 2VL7A 4A8JB 2GF0A 3L8ZA 1CRQA 2GVZC 4DLVA 5HPYB 2GNOA 3LLUA 2B8WA 4Q00A 4IFEA 1ZM4A 1YRBA 4LGMA 1JXMA 4B73A 1HE1C 4B3XA 2OHFA 3HWSA 4G5OA 5IK2A 1GNPA 5K8IA 5JFGA 4OK5A 2JAQA 3R9IA 4HUQA 2LWIA 5EP3A 2C95A 4TL6A 1VYVA 2QENA 4MYCA 1SGWA 4KFUA 1SVKA 3W8RA 1SKYE 4TL8A 1QHNA 2IL1A 2B21A 2J5XA 4HB0A 3E1SA 3Q7PA 1XEXA 1Z47A 1AGPA 1KO1A 3QPVA 4D26A 2GCOB 4IFBA 1AA9A 1SXJC 3CRMA 2A5GA 1NN5A 2J46A 4C0HA 1OH5A 1EFRD 3KKPA 2NZJA 1YR8A 4MKFA 1TNDA 2IX3A 2BC9A 3UWKA 1D2MA 2ZUCA 2FG5A 3ECCA 5CLQA 5FI1B 2VEDA 3I73A 3FHOA 4FI3C 3RDPA 2PZGA 3E5HA 1Q12A 2IYXA 2CCGA 3AUXA 1E1QD 2G9NA 4C3ZA 4B3GA 4IEEA 1WE2A 4AKGA 1BO6A 1O87A 3ZS9A 4U00A 2QP3A 3GLIA 1AQYA 1OT3A 2ODBA 1GRQA 2QORA 1RRCA 3B9PA 4LV5B 2XTNA 1II8B 1WA5A 4A6XA 4AYWA 4IOLA 4JLDA 4O0MA 3BFKA 1P4SA 4AYXA 1E99A 1IONA 4I81A 5CIWA 1C4OA 2R65A 3IO3A 1Z28A 2Q21A 5EE0A 1MABA 2Q0HA 3ZS8A 3K0SA 2ZYTX 1VYTA 2RGNA 2O8CA 1I4LD 1WXQA 2VF8A 4JSTA 3K70D 2QAGB 2BBSA 5UKDA 4P4SA 3GP8A 2PJZA 4PAQA 3GQBA 1YZTA 2IUSA 2IUTA 2KB0A 2H17A 4KFSA 2PZFA 2QMHA 3AF4A 4LV8B 1NVWQ 1TQ2A 5SZKB 2RGAA 5KDLA 4LRWA 1N6IA 4HLUA 4IVPA 4QBHA 3K9GA 1E98A 3U4QA 2CJWB 2LKCA 4CEHA 3SU8A 4ZI3A 4ZDKA 4E5UA 1XJCA 4LBVA 4YLGA 2OBMA 3L8YA 3VQTA 2JJ1A 4FCTA 1VHLA 2QTHA 1G3UA 1CLUA 1G5PA 5IF9A 2VP0A 4PQYA 1Z6XA 4Q5IA 2Q3FA 1R5BA 3U7FB 1U8ZA 1XD8A 3TW8B 4ARZB 4OL0A 4ASUD 3U44B 3BS4A 1JPJA 2NTYC 4HI0E 4WOPA 3IQWA 4B6EA 1T5IA 1WDTA 2P3SA 1MR3F 1W4CA 5KDDA 5FOSA 2H5EA 1IY0A 4PHHA 2WTUA 2QGZA 2YYZA 3I8SA 1C9KA 2RGBA 2IT1A 2V54A 4PSAA 4BUJA 2K5UA 1YZKA 3GJ3A 8OHMA 1PLLA 3NDBB 2ZEJA 4YONB 2JLSA 1GFIA 1HT2E 4HLUC 2ZE8A 4A9AA 1KI1A 4YMSA 4N3NA 4NYIR 4QBGB 5FOVA 4ZIRB 3AV0B 3AF2A 4NP6A 5J4LA 3RSLA 2VRWA 4RD1A 1RKBA 4MGYR 4YMTA 4KLZA 5FPHA 4TYYA 4A82A 3K09C 1LVGA 4GNKA 3A4NA 4V0MA 3VX3A 5IDVA 2ZE5A 3BH6A 3QBVA 4QM7A 2O0KA 4BGDA 3WYFA 1KSFX 3RS2A 2C98A 4ZCLA 4M1WA 1R5OA 3MAAC 3NG1A 3OFND 3K0CA 2PMDA 3U3MA 1FTNA 4DSTA 1NBME 1ONBA 1PJRA 2JASA 1P2VA 2QTVB 5CM9C 1KMHA 3D8BA 4EDHA 3QXSA 4PO8A 1P2TA 5GJBA 4MKIA 1AIPA 4NZYA 1G1MA 4UNRA 1E69A 3B2EA 1R2QA 4LPKA 2V8OA 1SVIA 2O8EB 3GEHA 1D2NA 1E0SA 4KFTA 4C0SA 4RFSB 2BKUA 3VR6A 2JDIA 3DOFA 3ZD7A 2ONJA 3RAPR 1JALA 4LJ6A 1TEXA 1G6HA 2GJKA 1F2TA 4NDZA 3PUWA 1R5NA 2C9YA 4YMUA 3BOSA 1GVNB 3RABA 4U5XA 4LHWA 4BZXA 3THXA 1Z08A 1G41A 1Z3IX 4RZXA 3IBYA 1S96A 1G7RA 3CZQA 1AK2A 1KKLA 2RGEA 3IHLA 3LD9A 4XTCS 4ZV4A 1KSJA 3F5FA 5GADl 3AH8A 3V4RA 4XIGS 1EESA 4TTQA 1KI6A 2VO1A 1TADA 1ODFA 1X8JA 4B6FA 2A5JA 3U6BA 3K0CC 1F60A 1KK3A 1M8PA 2E9SA 3LLMA 1U98A 4N0DA 1IY2A 2GJ8A 1HYQA 3EPHA 4FCVA 1SHKA 3X1DA 2ONKA 4C0BA 1KKMA 2QM8A 5AJWA 4DXAA 3EX7C 2VYFA 1NMXA 2XZPA 5E95A 4QBIA 5AJZA 2PT5A 1HQCA 4DB4A 4PC6A 2VP6A 2ZI7A 3LFUA 3KB2A 5JJKA 1U8YA 2RHMA 3KKNA 1NMZA 1S2MA 2WIAA 4US1R 1NNEA 4BFVA 1IN4A 3B6EA 4EAQA 4ZKEA 1LS1A 1SXJE 4M9XA 2BCJQ 4I99A 3A36A 2XOKA 5D3MA 4CW7A 5CB6A 1II9A 1FTSA 4OBEA 1JI0A 3TIFA 1YRAA 2IWRA 2CL7X 4M2LA 3BK7A 3FYHA 4MDFA 2HDNB 1QG2A 1E9BA 1OXUA 4B47A 5C18A 2QU8A 1P62B 1XWIA 3K0AB 4Q7KA 1ZNWA 2W6JA 3QNUA 4ZDWA 3I1FA 4TMVA 1SXJD 1YR9A 1NJFA 3KQUA 2CXXA 4AIIA 4PC2A 2P5TB 4NYMQ 2UKDA 3CR8A 4YDHB 3RS4A 1GNRA 2JGNA 4OI4A 3HYRA 4W5JA 2Z4SA 3A58B 5EE9A 3CM0A 4EPWA 5IRCD 4EKDA 1NG9A 1A1VA 1Z8FA 1RJ9A 2OBNA 1U0JA 3AM1A 5CB8A 3BFXA 2ASEA 1Q22A 3KJEA 5IK2D 1DO2A 1AM4D 4PZZA 4OQNA 5L8VA 4TYPA 3DKPA 1BOFA 2WZQA 3NC0C 4UXHA 4W5WA 3SI7A 1JAHA 1SVLA 2ZRIA 1G7CA 2Z83A 4I1OA 3V00A 3UMSA 3VMFA 4Q1FA 4URXR 4EJSB 4Z8XA 5JJLA 3GMTA 2QM7A 2CBZA 2D4HA 4Q01A 4A1FA 2ZIAA 2D62A 5LB4A 1XTRA 3T06B 3HPQA 2OV2A 1N25A 1M34E 1FFHA 4QRHA 3AVOA 1GL9B 3U3JA 4D4MA 2EFDB 5G3ZA 1S3SA 2IK8A 3KUCA 2BMEA 2J9RA 3NHBA 4KYUA 3GLFA 2R8RA 2HT1A 2EWVA 4BEBA 1PLJA 1N5IA 2D7DA 1ZM3A 5FUYA 1FZQA 1D9ZA 5JWOA 4HLQB 5EZ5A 2XEXA 4QFMA 1OIXA 1VG8A 4WZBE 3P1JA 1A7JA 3F3YA 4JKYA 4F7WA 4GBMA 1XBTA 2OAQ1 3HR7A 4DIEA 5DI3B 2QE7A 1ZM7A 2PH1A 2WHXA 4QJ4A 1MO4A 2OXRA 2ZE6A 3IKJA 1N6PA 2GJAA 3RSOA 2H16A 2Q9CA 3RRYA 4Z1MD 3NH6A 2G0TA 5TARA 4DDWA 1YHNA 2D7CA 4TLCA 3REFA 2V6IA 5EZ6B 3RHFA 1VDZA 3P20A 2GZAA 4UNQA 4BQSA 5DLQC 2DFTA 1KJWA 2XTZA 2H7VA 3T1VA 5HTKA 3A1UA 4JBWA 4LBYA 3GLGA 2JA1A 3SBDA 2GCPA 2HF9A 2QI9C 4IDNA 4HAZA 3V4FA 4A2WA 2A30A 3RS5A 2LKDA 2ZU6A 3ZZ0A 4JLJA 1GUAA 1ANKA 3EW9A 3CIOA 2ZJ8A 4BFWA 3T1TA 4JT4A 2JJ1D 1J7KA 1N6OA 2HCJB 2RAPA 3MUFA 3U7EB 3EPLA 4YXWA 3P27A 3EIQA 1SQ5A 4LHXA 4XSHA 2FJUA 3QEOA 2WPDA 2WV9A 2P0EA 4ESHA 4B32A 2FPLA 2X2FA 4BZQA 3WHLA 3C14C 3KDSE 2OFWA 3AVPA 5FBVB 2QRZA 2MSDB 3A1WA 2R44A 4JSYA 3BJIC 1KSGA 2GZHA 1V5WA 2BOVA 1N6HA 2QEQA 1YE8A 2OFXA 2V6JA 2WWGA 2IUUA 4V03A 4Q4JB 2MMGA 4R98A 3FKSA 1UADA 1VCMA 1J8YF 4GSYA 5BWMA 2NQ2C 1TPZA 4B34A 1QHYA 4JLNA 4NHOA 2RCNA 4O25A 3LAWA 4TLDA 2XJ4A 5EP1A 3SQXA 3SN6A 2ZI5A 3ZVRA 2ZRHA 5LBIA 2OXCA 2J7PA 3TQCA 2AX4A 2RKOA 2NOAA 1Q1BA 2GXUA 2CVFA 5GJCA 2REBA 5B2ZA 5AUPB 1A2BA 1G291 1N6RA 4LUCA 4Q4HA 5LB2A 5KSYA 4C0KA 1E6CA 1S3GA 5L3SA 4Q4AA 1RRPA 5L3RA 4QBFA 3HPRA 3SEAA 1UDXA 5J4HA 4PO1A 1CJVC 4JLKA 4V0KA 3HP1A 1XMJA 1PVOA 5KO2A 4QL3A 4D2IA 4Q47A 3SJAA 1WCV1 4LI0A 5TMPA 1NL3A 5HCNA 1KO5A 5J47A 4NTZA 5KPDA 2JDID 1F2UB 4TYQA 2VHQA 3MMPA 2VSFA 1E9CA 1F3OA 1VIYA 1G64A 4TYWA 4DLRA 1S1CA 4QGAA 3ZYCA 5BN4A 3IEUA 1SZPA 1XMIA 3CUEF 1RVDA 3R9XA 1E9DA 3TKLA 1KO4A 1X1SA 4LYAA 2NO0A 1IN5A 3ADBA 3F0TA 3TRFA 3B1WA 4RKEA 3K70B 1RRFA 4D6PA 5J5CA 3AGPA 3IHWA 2YWEA 4PPGA 2Q3HA 3Q9LA 5FH9A 1OKKA 5EP2A 2P67A 1VCIA 4JBYA 3AKDA 4NCHA 2EWWA 3A4LA 3MJHA 3FMPB 4M1KA 3EZ6A 3CX6A 4OHWA 3W8NA 4DT1B 3IPYA 5GVSA 3D7MA 3QKSA 3SBEA 3I72A 1DAFA 2AD5A 5FTNA 3RLFA 1UEJA 3ADDA 3EWSA 1IM2A 5HZHA 5M04A 5JRZA 1QHIA 1DG1G 5KSZA 2XOKD 1U0LA 3QPUA 5FUWA 2IW3A 4OJQA 4N0EA 3AKYA 5AJYA 2YHSA 2WJYA 2NMVA 1UEIA 3SFVA 4DLZA 4UKDA 1WQ1R 4F93B 2W6JD 4EPVA 1VPLA 1W2HA 1VIAA 2AKAB 3A37A 5KDOA 4ZCMA 3BB4A 1MOZA 3CWZA 3OZXA 4GRAA 2OESA 3U5ZB 2F3TA 3TSWA 1T0JB 2ZI4A 3QVUA 3AP1A 3RNLA 1IN8A 5D3QA 3QENA 3NEYA 4BZPA 1X8LA 3QXHA 2NO6A 1W0JA 3CBQA 3QKUA 1JR6A 2GA8A 1N0VC 2V7QA 3NBZC 2QSZA 1M6NA 4G5RA 4JL8A 4BECA 4BE7B 1FNNA 4OQXA 4A0FA 1JECA 1XB2A 3A1TA 2GJ9A 4XH9B 2XXAA 1LB1B 1E2NA 4QGGA 1KI9A 1XCMA 4LYFA 2B8TA 3C5CA 4NKRA 1P61B 2BVNA 3TNFA 4FN5A 4RZUA 1ZYUA 2EYQA 1DAEA 2ZROA 1ZM2A 1QVAA 4CEJB 4OI0A 3MD0A 1EG7A 4IDHA 3RANA 1QF9A 4RVCA 2XZLA 4RD2A 4C7OB 5DH9A 5JRJA 3S1AA 1YZUA 4MRSA 5BN3A 3QKRB 1OH8A 4EFMA 4MDEA 2XZOA 4HB3A 3HU1A 5CLLA 1GP2A 1WB9A 3BE4A 1XZQA 5GVRA 1H65A 3P4YA 4LJ7A 4A6PA 1XXHB 2MSCB 4M1TA 5HE8A 3PEWA 3QKRA 4FWIB 3EASA 1E2GA 1KGDA 2E87A 4LBWA 3AP3A 3THYB 2QPAA 2MMCA 2QG6A 5F2EA 1KTVA 1TF7A 3KTAA 2QE7D 1UBGA 4CRWB 1E3MA 1NBMA 1OSNA 621PA 1G7SA 3ZVMA 2VTKA 2P6UA 3KUDA 4DC9A 3PENA 3K1JA 5FPYA 4FMCB 2O8FA 2VA8A 5TB5A 1G18A 4JL6A 2OO7A 2ZSFA 1EXMA 2WWFA 1RW4A 1FNMA 2Z0MA 1GNQA 3M1IA 3VHLB 5KYKA 3NC1C 3N2EA 4OI2A 4RCYA 2F1IA 4M21A 4JMPA 2OE2A 3VU9A 4X8OA 3CONA 3N70A 2CVHA 1W36C 3W5IA 4FW9A 3TVTA 2QA5A 3UIEA 1US8B 4URWR 4JL5A 3K0FA 3T1OA 2WICA 4B2PA 2Q3MA 1ZMXA 4HAYA 1AN0A 1E2HA 4LC1A 3VAAA 2D06A 3VTKA 1RIFA 2W0SA 4YXWD 5HR5A 2NG1A 2WPDD 1E94E 1MT0A 4YC7A 4I1SA 4R2IA 4MKHA 3PUXA 2Z6VA 3T15A 1XP8A 3FMIA 2DCUA 4AC9A 4A36A 1I2DA 1SXJB 3DKVA 4I1UA 2KSQA 4DLUA 4TLEA 1SVWA 1OYWA 2OEPA 3H1TA 1Z6TA 3CWQA 1KY3A 1U9IC 2ZETA 1E9RA 1GITA 1N3BA 2OT3B 4B3DA 1E2JA 3FKSD 1SVMA 4L4UA 3SS8A 4DWJA 2ZSDA 1EK0A 4NBSA 4AG6A 4CVNA 4AG5A 1XPUA 5F98A 2JLZA 1OH7A 3P32A 4OHXA 5L3VA 4MH0R 3KJIA 2QROA 4HUQB 4ILEA 2JCSA 2IS6A 3UG7A 2BBWA 4FIDA 1HEIA 2J7PD 2XSZA 1XMSA 4CT4B 1CJKC 4GP6A 4HAXA 4Z1MA 4C2TA 1R0ZA 1A5TA 2PX3A 1XEXB 1P9WA 4QHTA 1A2KC 1E4VA 2ZR0A 4DDTA 2RGGA 2FV8A 2WWIA 3JZMA 1KK2A 1HT1E 5KUTA 3RVBA 4BLOA 4RKFA 4TT3A 3WHKA 1MO5A 3P26A 1P2UA 2DR3A 4US0R 5JHGB 2QBYA 1E2EA 1G8PA 3IILA 3ADKA 1G8FA 2ZRDA 5FUXA 3HDTA 1WP9A 2D2EA 3R9WA 4BLRA 3AGQA 2FF7A 3QI2A 2F1HA 2ZXUA 2P5SA 2F3RA 4AD8A 3B85A 3I61A 4WZ6A 1XTQA 2FGJA 4TMWA 4BFXA 3BH0A 2B7BA 3W6PA 1ZRHA 4OKSA 3GLIB 1AJEA 1Q57A 2H57A 1DAGA 4FINA 1XJQA 5JCZA 3EA0A 1EFCA 2F6RA 2NO9A 2WWYA 3CRRA 4R2HA 1OH6A 1JJ7A 3MRSA 2CHQA 5GJWC 3NWJA 4FMBB 1MABB 1TQDA 3CNLA 3QEJA 4IW3B 4LJ8A 3VR5A 2O8CB 5DN6A 1Y63A 4ACAA 1R8QA 1EWQA 4PZYA 5C2JB 4P4SB 4RD6A 1TF2A 1XJ0A 3AVQA 1TQ4A 1LV7A 4L5BA 5TY0A 2O52A 3TVDA 1OKKD 3H84A 1NMYA 1G4AE 1IQPA 1ZJ6A 5JWRA 2FSIA 4GOJA 4NYMR 1KDTA 2EQBA 5FOTA 2YWGA 4W5HA 3U4QB 2CLCX 1D5CA 1LF0A 4CEHB 2BBTA 4A8JC 3EAQA 3UG6A 1N0UA 5LD2B 2JLQA 4P33A 2IEZA 4ZDJA 3A1SA 2VSXA 1JNYA 4K81B 2GBLA 3MCAA 4V0NA 4G3XA 1NIPA 3BB1A 3OESA 2B6HA 5H8WA 1QZXA 2VHJA 4LJYA 2WKRA 1YR6A 1R0YA 4HAUA 2TMKA 4PXAA 4Q9LA 4HEJA 5KNDA 4AY2A 4JYBA 3K09A 4ZCIA 3I92A 4PO9A 1O3YA 5EP4A 1GRRA 1OFTA 2J41A 1VECA 4PC3A 3VNVA 1E2MA 5H70A 3KQLA 4BFYA 4HB4A 2Q9BA 4PQFA 4YDSA 2WAXA 1W48A 1JAIA 1W0JD 4O3MA 3MWKA 4ERNA 4CDGA 3KQNA 2AWNA 3FMOB 2BM0A 3KFVA 1T3LA 2V7QD 3C16C 2HCBA 3CH5A 1TUEA 1G20E 2JATA 2H1LA 3LH5A 4OHZA 2GEVA 3UMFA 1HURA 3DL0A 2AXPA 4IVRA 2GWHA 2NZ8A 4B43A 4P31A 2GBLC 3O8DA 4QGHA 4DEYA 2FPKA 1IAQA 3AVTA 3PJRA 1LS6A 4KYIB 2FE4A 1CJTC 5FBLB 2QMUA 821PA 2SHKA 1UBCA 2QMEA 4LOAA 1XF9A 2FGKA 3TW4A 1AQUA 1G9XA 1W44A 2J0UA 2XITA 3B60A 3BB3A 1DAIA 1JPNA 1OW3B 1HA3A 4BLSA 3QPWA 3WP0A 3L82B 2B7CA 3NDPA 4CIDA 3BORA 3REGA 421PA 3Q72A 3NVAA 1KMHB 1KHTA 2XB4A 1R0WA 4M9QA 3IUYA 1OFHA 1QHHA 1TEVA 1VCNA 4IOJA 3RRZA 4BLTA 3LO5A 1L4YA 1G21E 1H8EA 1UKYA 2ZVQX 4IKEA 3DMNA 4OQFA 5E4FA 3X2SA 1PV4A 1YU9A 3QQ5A 4PFSA 1W36D 2OLJA 1F2TB 1P7CA 3TGPA 3CZPA 2CK3A 5L3QA 1G16A 4TTPA 3AQ4A 2J1LA 1MH1A 4G5SA 4DDUA 3THXB 2FFBA 4KXFB 2FEMA 2EW1A 1LTQA 4Q7MB 1YQTA 2WOJA 1NBMD 3LQQA 3B8HA 1K6MA 3H0KA 1N5KA 3QY0A 1VYUA 3CF2A 1OFUX 1KI6B 2VHTA 5HCIA 5GJVC 3OIVA 1BIFA 1MKYA 3CPEA 1KDRA 3PCRB 2Q6TA 3T34A 3QSYA 2FWRA 3SJZA 3KQKA 2J0QA 3FPAA 1W7AA 2CL6X 2GJSA 1Q3HA 1MV5A 4OHYA 3DMDA 1ESNA 1R10A 1TX4B 1NVVR 4Q03A 4TWZA 4XTRA 2AK3A 1B23P 3GJ4A 3BH7A 1JXOA 1ZNZA 2IC5A 1RYFA 3NTUA 3U2QA 2V1XA 4M1YA 5AJVB 5D3MB 4XWAA 5KU1A 1WBDA 3OE7A 1ZNYA 1Q20A 5DYIA 3JZAA 2ZITA 3RRNA 1J90A 1E96A 3EARA 1EWRA 3TUZC 1NVUQ 1PLKA 2ANCA 1TTTA 4GL2A 3FVQA 3PUYA 2JLVA 1I4DD 1Z6GA 4IRUB 3KXLA 2RB4A 2FMXA 4NCKA 4Q1DA 1FP7A 2GXQA 3A8TA 5DNYB 5FTKA 3TUIC 2GVDC 4CT5A 4KITB 2VP2A 1BS1A 1DS6A 3KX2A 4IVQA 4EPYA 1UKZA 2ZRAA 1RJ9B 4NCIA 1KJZA 1UM8A 2GESA 4C2UA 2ZJBA 1Q44A 3NBYC 5H1YA 1OXXK 2ZRJA 4PAOA 3SC3A 3AP2A 2O0HA 2GAAA 1Z0IA 2QL6A 3GFTA 3ND9A 4LC0A 5ANRB 1TU4A 3AKCA 2WJJA 1XPRA 1WF3A 5EE1A 1HY3A 3NKVA 2EVWX 2QPOA 2ZRCA 4DDVA 5JECA 4B48A 2O8DA 2XSZD 2R9VA 1J2JA 1DBSA 1E2KA 2Z5FA 2ERXA 2C78A 2YOHA 1R6BX 2ZYUX 1GKUB 1X1RA 2RGDA 3AVVA 5BQ5A 4B3BA 1YZLA 4A92A 1E2PA 4ESVA 2OILA 4Q9JA 4ZO4A 1OXSC 4B44A 3THWA 2CLSA 4B3CA 3K9NA 4UXIA 4TT3D 1QHGA 1PZNA 4KU4A 3GLHA 1UF9A 5EXXA 3ZQ6A 4D4JA 2NPIA 3I5YA 221PA 3EZ7A 3GLFB 3CLVA 4LJ9A 1XRJA 1SKQA 2YWHA 2IF0A 3UK6A 1UFQA 1GKYA 5CDFA 1NY6A 1E0JA 3FHCB 1E2FA 2OUKA 2V3CC 1UKVY 3OEHA 4QJ3A 3T61A 3U3RA 3SJCA 3D3QA 2J0VA 4LYJA 4DIDA 4KSBA 1UBFA 3DHWC 4DLSA 2QQ0A 4KSCA 1WRBA 1LW7A 5HKKA 4WW0A 4CGZA 1FPMA 3U3KA 4QOSA 1KO7A 5E7MA 1KK0A 1NVXQ 2UZ3A 2ZSAA 2X77A 3O8CA 3FFAA 4DHEA 5DI9A 5DSZA 2YKGA 2DWPA 5DN6D 2VIIA 3TSZA 1Z06A 2ZRMA 1G3QA 3F8TA 1A82A 2VBCA 3RS7A 2ZRFA 3RYTC 1Z07A 4LYHA 3TR0A 3GLGB 1ZCAA 3OF5A 4FMDF 2HV8A 2W2XA 2NO7A 5KHOC 1NJGA 1NF3A 2YOGA 3VR4A 2VP4A 1E9FA 2ZSBA 3WNBA 4D4KA 2GEDA 2VSOA 1XCPA 4Q9KA 1ZIPA 3BBPA 2JIZA 4NYIQ 5FTMA 2RGXA 1VCOA 2F43A 1II0A 1QVRA 3L0PA 4PSKA 4AYTA 2QZ4A 1N6KA 2REOA 3LVQE 4AWXA 3I5XA 3G5UA 1ZVQA 2XJ9A 1OIWA 4IOKA 2GILA 1X8KA 2C03A 1C1YA 2J7KA 1AZTA 3O47A 1ESMA 4Z54A 1KSHA 4HB2A 4MUAA 4Q1CA 3A1VA 2KWIA 2G88A 4LHVA 4EJSC 5CM8B 3ZZTA 4E09A 2C04A 3CX8A 1X86B 3BFVA 3D31A 1NSFA 4E03A 2PJRA 5EUQB 1SVOA 2GZDA 2BIFA 4QG7A 4F4JA 1FL9A 3FKQA 1IXSB 5JWHA 3SDZA 3K8YA 1JEEA 1BYIA 4Q9HA 3RS3A 2A3RA 2ECKA 2G77B 2W2VA 2IXGA 4KAXA 1P3JA 1ZD8A 4MRPA 3QBTA 4TMXA 2DBYA 3H2YA 3L0SA 3BRWD 1KAGA 2BKEA 2QP9X 3R20A 2IYRA 2HXYA 1P6XA 2C77A 4HDQB 1QBKC 1T4GA 1RPZA 3GJ0A 3LA6A 4GMDA 4KFRA 1T0HB 2HLDA 1XD2A 3GJ8A 1ZUHA 4NL4H 1CXZA 3U7HB 3PQCA 4JS0A 4MQBA 4U02A 3ZJYA 2C9OA 3WRXC 1KY2A 3O8RA 3Q5EA 2WJHA 4FMCF 4Q4HB 3B9QA 1H8HA 4ZI2A 5L3SB 3O8BA 4Q4AB 1Q3TA 4LWZA 4PHGA 1DEKA 2AFHE 2DYKA 2FH5B 2VHCA 5TDHA 5K8LA 3RC8A 4CEIA 3QXCA 1E2IA 3QOFA 4JIMA 4JJKA 4D0GA 2FZLA 4R7ZA 5J4VA 2PX0A 1KZ7B 1CKEA 3KFXA 3OAAA 2I1VB 4PPQA 1H8ED 4FWTA 4EPTA 1T9HA 1AKYA 4PR0A 4B71A 3W5JA 4WIAA 1SKYB 3C15C 3GEIA 1ZC4A 2G83A 4JLMA 4LZZA 1OHHA 2CK3D 2FEOA 1QHSA 1Z0AA 3MGCA 1BMFA 1HTWA 3AVUA 1AS3A 4M9ZA 4EPXA 4K8OA 1IBRA 4UNPA 4D0LB 4HYYA 1FX0A 3IO5A 3M0EA 1GG2A 4POAA 1KI2A 2F55A 4MITA 1S8FA 2AFIE 4G01B 5J4YA 1XU4A 2OAP1 1YVDA 1GM5A 3QG5A 3CR7A 1S9HA 4TMKA 5J40A 3RC3A 3TMKA 4BLPA 3W34A 1Z83A 3W9YA 5G40A 2F1RA 4XJXA 1J8MF 4PTLA 3SYLA 1Q21A 2W58A 4GZLA 1AKEA 3UANA 1U94A 2ZYWX 2FOLA 5JI3E 2D74A 1CF4A 3PEVA 4GDFA 5KOYA 3QKSB 3K53A 2P2LA 1LFDB 5BXQC 4WXRA 5JSZA 2XNDA 5IT5A 1FW6A 4IDQA 3CB4A 1OFIA 3AUYA 1G8GA 4HZIA 1QRAA 1XX6A 1Y3AA 1DOAA 3OE7D 3CF6R 1I2MA 2KJQA 5DE3A 4TSFA 5EXPA 3BERA 3OIYA 3X1YA 4I1VA 3VR2A 1JB1A 3FHTA 1E0KA 1HV8A 2ZUDA 4M22A 3JVVA 4P0TA 1T3HA 3CW2A 5FFMA 4RY2A 3QXJA 3AF0A 4LJAA 1CIPA 2WIBA 2IYUA 4DLYA 4F4IA 2IXEA 4MYTA 3DVLA 1N2CE 2FSHA 2JJ2A 3I32A 4HAWA 1OIVA 2R6GA 3LXXA 1OXVA 4ON9A 3A4MA 3ZIAA 5AUOB 2W83A 4DUGA 1ZU5A 1ZC3A 1QG4A 3A6PC 5F9HA 1SULA 3MFYA 2HUPA 4PAMA 4B75A 2CCJA 4CF7A 1NI3A 3AB3A 4HSEA 2C8VA 1TAGA 1YZNA 2YJTD 4N1AA 4H1VA 3SR0A 4A2QA 1G4UR 4TQ9A 3EPKA 2XXAB 2FNAA 2F7SA 4JBXA 4FMDB 1E4YA 2BEKA 3KJGA 3GLHE 3RS0A 4BFSA 4PHTA 3FDIA 4WVFA 3G0HA 1U99A 2XX3A 5FL3A 1F6BA 4D0NA 3AVXA 1KO8A 4NMMA 3VX4A 4WAUA 1Z0FA 5CDFE 3AF1A 2IYVA 4FD2A 3FB4A 1N0WA 3LY5A 3S1AB 2VH5R 3UXMA 2BJWA 1G19A 5FOUA 3GEEA 3HR8A 2BV3A 4JVNA 3PUVA 4DB2A 4GFDA 4TN1A 2YNMA 3W3AA 1W36B 1VHTA 5FBQB 3IGFA 3QXXA 3R7WA 1NN1A 4EFNA 4IDPA 1V43A 4E07A 3PEYA 3OEHD 3ZZUA 5AUQA 4CZ2A 2FFQA 4KVAA 3MLEA 4M53A 4OI1A 3FTQA 3KTAB 3KL4A 4Q21A 3BWDD 5HKKD 1HH4A 1R8SA 2GXAA 1ZIOA 4UJ5A 3EIHA 1Q1EA 4M9SA 4DCVA 3FFBA 1G5RA 3T5GA 4QNMA 2BEJA 3SJBA 2O8FB 3KQHA 1BH2A 4B33A 1OE0A 2OSBA 4MRVA 1M7HA 2I1QA 3K0EA 2EYUA 4MYHA 2HYIC 3NBXX 3PV0A 1DG3A 2ZYVX 1P9RA 1UAAA 1DELA 1U0HC 4A15A 4JVSB 2ZRLA 1G3MA 2HEIA 2ZRNA 4Q19A 3VU9B 3CNNA 1KOFA 2J45A 4XOIA 1Z22A 4RD0A 2FU5C 1OXTA 3C41J 3B13B 2GTPA 2PZEA 2WVJA 3FE2A 4JJZA 1KI8A 3K0FB 2DFNA 1U9IA 4B2LA 2X19A 1W2GA 2ZU0C 3W90A 3WXMA 4QXAA 2BJVA 4O2LA 2JIZD 3B1YA 3VNUA 4EQ6A 4Y0VA 1CR1A 2EFHB 3TLXA 2V9PA 3THOA 4QC2A 1CR2A 2A9KA 3IIMA 3WNDA 2FDCA 4HZUA 1E9AA 2G0NA 2G6BA 3BD9A 4KV9A 5EUMA 4GT1A 3PXGA 5AK0A 2E1RA 5E3HA 3BXZA 5FOWA 5FBWB 3CF0A 3SOPA 2P65A 3CPHA 3T35A 4DBLC 1XEFA 4GPTA 5AUNB 3ZD6A 1UBEA 2CE2X 4PPFA 1GSIA 4LSGA 2ZJ5A 4C30A 2ZUBA 4DSUA 1GKIA 1LNZA 2N42A 3B78A 3DOEA 4OYHA 4DCTA 2FSFA 2CHGA 4HLDA 4S2EA 1N5JA 5C4MA 4XWKA 2EFEB 4E22A 1AZSC 2G1KA 4BRUA 3X1ZA 4M1OA 2HLDD 3NHAA 4W7SA 4NU0A 4BPBA 1U2RA 2PLFA 2CHVA 1VTKA 4BASA 1X6VA 1KDOA 4ITRC 1X3SA 4W9MC 5J4KA 1E2QA 4LK2A 5EJEA 1WBBA 3ASZA 1H8HD 3GFOA 4Y0AA 5KSOA 3TQFA 4JKIA 1PUIA 1G7TA 2AXNA 1Z0KA 1GAJA 2QT0A 2W2TA 2O8BA 2QBYB 1ZUIA 4LCBA 121PA 3OAAD 1SVSA 3IIKA 3SHFA 5KTYA 3KKOA 3PG5A 4LDJA 4URVR 3CX7A 5FPTA 5DHFA 4US2R 2V4ZA 1ZUNB 3U61B 3VFDA 1NIJA 2V55B 2OLKA 3D6TB 1OHHD 2YC2C 2ZRGA 3K9HA 3L0OA 3G82C 3LV8A 1BMFD 1NSTA 1AGRA 3ZVLA 3IIJA 4DEXA 1W5SA 3LRPA 5SZIA 4BFUA 5AR1A 5LPNA 3QF4A 5EE3A 1DAKA 2IYYA 5C4GB 2GDJA 2WJIA 4A8JA 3UPUA 2ZPTX 1NN3A 2F1JA 3FGNA 3H4MA 3EC1A 3LW7A 4P4UA 4BFTA 1XTKA 1JBKA 1N6NA 3QVVA 3TAHA 1KI7A 1KI4A 2R6DA 1FMJA 1Z6YA 2FZ4A 1YJ5A 1ZU4A 2OFOA 5KNBA 3DDCA 3ND8A 4P3YA 2O8DB 4UQOA 1D6JA 2Z4RA 3DZDA 4LHYA 4B76A 3ICQB 1S9DA 2REXB 2FSGA 2XNDD 2ZRPA 3ZDQA 2R62A 5DGXA 4NONA 3TK1A 3VR3A 2GCOA 1Z0JA 4Z51A 2HYDA 2CLDX 4DLXA 3I4LA 1CU1A 4TSFD 1MO6A 4IOMA 2C9CA 3U7GA 2XTMA 4IDOA 4IHQA 3NH9A 3WMEA 1GTVA 2QPTA 5F9FA 1CR4A 1D2EA 5CK4A 3WMFA 4M1SA 1T91A 3Q8XB 2JJ2D 2GKSA 3OIUA 2AN9A 4AKEA 3KZ1E 5BYKA 2ATVA 3PVSA 2BMJA 3TH5A 2XGJA 3ZIAD 2A5YB 4DUGD 2WSMA 3GFPA 2IS2A 4NYJQ 1RZ3A 2GEUA 4YMVA 2VQSA 1II8A 5FTJA 4C9BA 4MGIR 5FUVA 1CJUC 2DPXA 3LXRA 1DPFA 2ZJZA 1NKTA 521PA 5FBRB 5KSPA 2D3WA 5DO9A 4A2PA 2WSSA 4LY6A 4OK6A 4TZ0A 1ZBDA 4R9UC 4S35A 3R8FA 1MRSA 1CTQA 2QAGA 2R2AA 3B1VA 1VG0B 4HATA 4QKQA 3UATA 6Q21A 1KMQA 3C8UA 1P9NA 2J0UB 4PZLA 4EIWA 3AVWA 4GI7A 2XNSA 4ZDIA 3WY9A 4HLCA 2GHIA 4Q1BA 2ORIA 1XD9A 3BIFA 3ZQJA 4AKIA 1IXRC 5B64A 2CJWA 3T1QA 2FFHA 5JBQA 1QHHB 3IPXA 4AI6A 3FMFA 2RGNC 3TSOA 2CCKA 2JLWA 4X8HA 1K8RA 1AS0A 1F48A 1M7GA 1NN0A 2ODEA 1L2TA 2IS4A 3C4JA 5FR1A 2HT6A 1LY1A 2DFLA 5FL7A 3MWYW 1M74A 3ZH9B 3ICEA 4V02A 2DHRA 5L3QB 2ZS9A 4PANA 1ZD1A 2BMFA 3SYNA 1B0UA 1CEEA 4ARZA 1XFAA 4PC1A 4Q9IA 4DVGA 4F38A 3U44A 5CYPA 2PMKA 1RRGA 1CRPA 3LX5A 3CRQA 1XTIA 1S1MA 2QAGC 5JCPA 1GDDA 1M1YE 2VHUA 3W6OA 1T3SA 2O0JA 4D82A 3GJ5A 1GRNA 4LBZA 3QUSA 1EGAA 2QUZA 1W46A 5LD2C 2EU8A 4MRRA 1EFUA 2ZS8A 5AJXA 2H92A 4UXJA 4HUTA 1KAOA 3MWJA 4JLPA 3IEVA 4WXPA 4DRZA 4GP7A 2IBMA 4ZPXA 4ZIRA 1L4UA 2FPMA 4Q18A 4C0LA 2QP4A 2WJVA 4OHVA 3UWOA 1E1RA 2G1JA 2Q9AA 3CRVA 4QHSA 4EFLA 1MO3A 1GZSA 1XXHE 4D4LA 5JZVA 2WKQA 5FPSA 4MRNA 3PIRA 3KXIA 2JLUA 4EPRA 1XEWX 2ZJOA 3HU3A 1TU3A 2QSYA 4PX9A 1JEDA 2ZAMA 1M2OB 1U81A 1KI3A 2YINC 5BYJA 2J59A 2A5FA 1NP6A 1Z6AA 4QHYA 5KPJA 3SHWA 1G8HA 3K9LA 4II7A 1EFTA 4ZKDA 3EZ9A 1K5DA 4DKXA 3KKMA 4Q66C 4FXPA 3SYKA 3TJZA 3ETLA 1OB5A 2W6IA 1VMAA 2O8EA 1N6LA 2ZR9A 2F9MA 4MYUA 4RFSA 2LCFA 1DADA 2HF8A 2QRNA 3MWLA 2IXFA 3DM5A 1KDPA 3Q5DA 2PLRA 4DLTA 4IXNA 1BKDR 3X1WA 2VF7A 2CMKA 5CIQA 4WBSA 2I4IA 1Q1QA 4L15A 1RC8A 3EWAA 1NG1A 4B2IA 2VLIA 3HYTA 4TLBA 1DVRA 4H9GA 4B35A 4Q02A 1XPOA 2N46A 1P75A 3U60B 3B5JA 1QDEA 2DY1A 4QJ5A 2R6AA 1KYIA 4Q1EA 3NIBA 1NY5A 4CYMA 4LV6A 1FOEB 1R4AA 1RE0A 4JVLA 2YOFA 4KO8A 3HU2A 3OEEA 5FOXA 3SFZA 3WBJA 1J99A 3IDQA 4XSGA 5H68A 1IXZA 4MA4A 5CJ2A 4D25A 4M1MA 2PT7A 1OJLA 2ZM5A 4TMZA 3QKTA 1T8UA 5IHPA 2PL3A 3FWYA 3M4YA 2GRJA 1P2SA 1KZGB 4V0LA 4BFZA 2CNWA 2QMOA 3BAFA 3QJYA 5AWFC 3DEFA 3THWB 2IWHA 2N1BA 3C7KA 4LPSA 3GLHB 4DCNA 1HE8B 3PUZA 1XTJA 1DARA 4YMWA 2GXSA 3VHXA 3ZVNA 2WMOB 3LNCA 3MSXA 2ZI6A 3BGWA 4QGFA 4RD4A 4DSOA 3M6AA 4LJ5A 3LWNA 2KI5A 3LVRE 4BRWA 4YQFA 4P32A 5JEEA 721PA 4KODA 5CK5A 4RCZA 3VR1A 3K0AA 1IJEA 4DCUA 1TQ6A 4B74A 1DE0A 1A4RA 3VKWA 2HXSA 5EXTA 1R7RA 3SNHA 3FOZA 1GOTA 4OQMA 1ZAKA 1IHUA 2ZVPX 1R0XA 2OM2A 3MJRA 3EZFA 4Q7JB 2ZANA 1GILA 3PR1A 4KBGA 1EFHA 1Z5ZA 2VPPA 4GZMA 4IXMA 1FUKA 1QHXA 2QT1A 3W3ZB 2O5VA 2AKYA 4LHZA 4AURA 2OCPA 3L2OB 2IF2A 1UKEA 3VKGA 3N2IA 4NH0A 4XD7A 3BC1A 2D2FA 2DWQA 4MGZR 1SHZA 2WWXA 1COWA 1Z29A 4A4DA 2AK2A 1P73A 1UDWA 3LBHA 3R8CA 4PHFA 1WMSA 2FFAA 1K5GA 4JLAA 2HJVA 3WMGA 4IEIA 2RH5A 2BCGY 2PBRA 4EJSA 2QN6A 2ZJYA 4D81A 2RMKA 3IBGA 5HZKA 3GLIE 3EPJA 1G5TA 1OLOA 4G5QA 1ELOA 3KB1A 3AF3A 4LX0A 4MKGA 2F43B 2DB3A 2B92A 1BYUA 2P6RA 1XTSA 3WYAA 4Q1AA 5TXGA 1J70A 4RSGA 2PCJA 2ZRBA 4KVGA 3DM9B 1W0KA 3E70C 1E2DA 3UKDA 3B7GA 2IYQA 2J3EA 4DCSA 1YZGA 2R6FA 4O2RA 2OCBA 2ANBA 1T5LA 3WBKA 1P72A 4KLNA 3OIWA 3I8XA 4KHZA 1CR0A 3LBIA 4B3FX 3GPLA 4F4CA 5DI3A 1IN6A 3QE0A 1DTSA 2ORVA 3DO6A 1W49A 1E32A 4UNNA 3ASYA 1E79A 1RYHA 3EIEA 1XNJA 5HE9A 1T8TA 2WSSD 1GL6A 1AS2A 1HQYE 2AWOA 2RGCA 2L0XA 1XD2B 2ZR7A 3KJHA 2WAYA 5A4JA 1L7VC 2QGNA 1JR3A 4OQLA 4ACBA 1FQJA 2WM9B 2C5LA 3I3SR 4Q4LA 3U6KA 2VP9A 1E2LA 4L9SA 2JEOA 3CH4B 1D9XA 2ODWA 5E7IA 1Z2AA 5F3WB 1NRJB 2KE5A 4P4TA 4CEIB 2XAUA 1FQKA 3PEUA 3NBFA 2GK7A 5C1BA 1TMKA 2AL7A 4G0NA 3OHMA 5CYOA 1ZM9A 1NVVQ 1Z0DA 2GK6A 3T12A 1XCGB 4C0AC 3WYGA 2QAJA 5FPKA 1E0AA 2BM1A 5SZHB 4TTRA 2ZI9A 4A0HA 5FL7D 1XEWY 4KBFA 3Q85A 2ZREA 1OPXA 1W4BA 3SQWA 3B82A 2DFKB 3U3OA 2YV5A 3RWOA 3P4XA 4V0ME 5C46F 5JEDA 2PEZA 1N5LA 4AKHA 4WA7A 1FX0B 2WMNB 2AD1A 5G41A 3W6NA 3ZLJA 2JLXA 5TV2A 2EFGA 3QF7A 2CDNA 3TUJC 3WRYC 1IY1A 4Q4JA 3NXSA 4XWOA 1TL7C 2EFCB 3PITA 1NKSA 4PSVA 3LX8A 5E7JA 1ZNXA 1UJ2A 4NPHA 4G5GA 4TMTA 4FCWA 2JJ8A 1ZW6A 4OK3A 3MG9A 3UMRA 5JI2E 4JLOA 3HJNA 4URUR 2H18A 5DYGA 1G6OA 1E1RD 5DISB 2C2HA 2J0SA 2WJGA 5JSZB 3VKHA 2A2ZA 4C0JA 4F92B 1G3IA 2QQEA 1ZD9A 1FMLA 2Z43A 3PFIA 4RD3A 2GAOA 5CITA 4UJ3A 2NO1A 3TBKA 4TQUS 1EFRA 1IOZA 3SE0A 2XB2A 3CO5A 1G8YA 4Q7LA 3I62A 1ZINA 4L8GA 4MUBA 1ETUA 1JQLB 3T5DA 1VKJA 1Q1ZA 4Z8YA 1ZCBA 2ZS7A 2A78A 1TUIA 4MGKR 4URZR 2W6ID 3B1XA 1L8QA 4QNRA 1DAHA 4R71A 5TVKA 1F2UA 1E1QA 1S0UA 1W4RA 4PC7A 4GMXA 2JLYA 2AR7A 5B30A 1IJFA 2G3YA 3CRW1 4PPNA 4A0GA 1F5NA 2QTFA 2P6NA 4OJKA 4RFVA 3RRMA 5FI0B 5FTLA 2OCYC 4HDCA 1U90A 3X1XA 2ZE7A 3EXAA 4NCJA 1CULC 2RHDA 3EZ2A 5G3YA 3QIAA 5EXSA 5K8UA 2IYWA 4M4SA 3OEED 1D8TA 4L9WA 3GCGA 1M7BA 2W00A 1P5ZB 3CNOA 2J87A 4DJTA 3EG5A 4DT1A 2ZI3A 2F9LA 2ZAOA 2CNWD 1W47A 1VG9B 4RZ2A 3H86A 3AEZA 3RWMB 2IA5A 2WKPA 4C4PA 2IHBA 1GIAA 1Q0UA 2ODNA 3LDAA 3TR5A 4JT2A 5K8TA 2IHYA 2Y8EA 1KNXA 2ZQ5A 2UVQA 2AHOA 2R6CA 1W1WA 1S4QA 3LBNA 4I4LA 1E9SA 3R7WB 4RZ3A 5P21A 5BN5A 2IYSA 1NLZA 3IQXA
chains in the Genus database with same CATH superfamily
3PGVA 2OBLA 2VZ9A 4ASUA 2J31A 1DIRA 2IYLD 2NIPA 4B6GA 2YC4C 3CZ9A 1QE5A 3K70C 2OUIA 2OGZA 2VSQA 2C7PA 4REQA 2IYTA 2GMWA 2D0PB 3IDAA 3Q1KA 3Q7QA 4Y30A 3UWPA 1QP7A 1ULTA 3IMGA 5BQPA 3N05A 4IRXA 4JC0A 3WBFA 2LV8A 4ZYTA 1JZTA 3JSXA 5SZJA 4DA7A 2QNRA 1PUJA 5FR2A 3UN1A 2FPGA 4HH0A 4KGDA 1DBIA 4XD7D 1F8UA 2ASVA 3BXGA 4XVQA 3RSHA 3VM6A 4Z9AA 1ACJA 1P7VA 2EBFX 5LZ8A 2ZB3A 1XZPA 2Q2VA 3H7AA 2G72A 3IR6A 4UMDA 5DHAA 3UMGA 1SR8A 4TLAA 1K75A 3HZZA 4JC5A 2KBFA 5IJWA 4RDXA 3ODGA 4ALKA 3B2QA 3UJDA 1N7GA 1Z63A 5J63A 2X2EA 3O31A 3FB1A 3UOAB 4C43A 4LFCB 3IJ5A 3PA6A 3OFNA 4K86A 5EG5A 1EIWA 3CA8A 3BBLA 4AZ0A 4CL0A 5DX8A 4PYRA 1G60A 1M54A 1PFYA 3MJ4A 3ENKA 3OOHA 4BU0A 2PUCA 5A0FA 1UBHS 3ZHTA 4OGWA 1N2BA 2FX3A 4KG7A 3EVBA 1SXIA 2WYUA 3KT8A 2CXHA 1ENZA 3VRHA 1W0KD 2ILVA 2R751 1I4TD 4YP5A 2CLKB 2OZEA 4Y0NA 1I3MA 2Y05A 5EOVA 4B3MB 1NLYA 3EQ9A 3HVUA 1QVZA 4NK5A 2H8KA 4Y1FA 4E51A 4Y6LA 1PW5A 1LX6A 1JKMA 2BHNA 1DAMA 3ORHA 4G85A 5G4KB 5CAEB 5AESA 3FYUB 4UUAA 3GLGE 4GLLA 4GWKA 1DKRA 1L1RA 1Z12A 3GD7A 4L8VA 1BA2A 3IESA 3LFHA 3WGQA 4JI7B 2CVQA 1ZK0A 2IEAA 3ANLA 3S28A 3FCAA 3PLAE 5FEMA 5B2FA 1QX3A 1TO2E 1GZVA 2FA9A 2VDPB 3D2AA 4MP6A 4B0OA 4C0QC 5JJIA 1ATZA 4ADSG 1AHHA 2YS6A 1BE1A 1BD4A 2HZ7A 4KE7A 1OB2A 3R6GA 1ZISA 3Q3CA 4GLFA 4FYKA 4AMZA 5F7XA 4NMWA 3RH0A 2VUTA 3MRVA 4E2YA 1U4NA 3LW8A 4IJKA 1JDNA 3ELWA 4QPPA 3RUPA 4CR7A 5LDDC 4TZKA 1LK0A 2RHWA 1K9VF 3DLCA 1XRRA 3A3PA 3NEJA 4FK8A 4RJLA 1GZ6A 1JZSA 3FETA 4ZAYA 5A5GA 3UICA 3ERCA 4KI0A 4NEQA 2W48A 1SCBA 3L0IB 3SSNA 3GJ6A 4DLBA 4QQNA 2B4QA 2BH9A 2GCNA 2WOOA 1US8A 1BJKA 1E61A 1KJYA 1TM5E 1NF8A 1IC6A 1GQYA 2PCLA 4PGFA 4XPIB 5CJPA 2JIDA 5DX0A 2PNJA 2OG2A 3MD9A 3V1UA 3V4LA 4WN9A 3DOHA 2H3HA 4C04A 1U4OA 5HIKA 2BBOA 1VMKA 2E21A 4I08A 1CP3A 4IX9A 2DF8A 2QG4A 1YFLA 3FTPA 2CUNA 4XDHA 3CH6A 3O82A 3FCOA 3PE6A 4GC5A 1T6YA 2C96A 2GF9A 1Z4LA 4MMXB 1J9ZA 4V0OA 4MIKA 4WKGA 1W8IA 1XMVA 3L4EA 5ETJA 2PEYA 4AK9A 4KCGA 4CJXA 4ZVKA 4JYCA 3WGGA 3UWDA 4BO2A 4JXXA 3HDQA 4OSOA 4DMCA 5MN6A 1TO1E 3AKEA 4ZTUB 2YWFA 1U2ZA 4N0MA 1YOBA 3DR3A 1IEQA 3FROA 5DLDA 4OFWA 1QTQA 1FBTA 2BGTA 4GOLD 4A8JB 4R9NA 1NUAA 5IU6A 5BORA 2MYNA 2PSFA 2J5KA 1R27A 2AN5A 3L8ZA 1ISPA 2QR2A 4E1VA 5HPYB 5C8YB 1Z5VA 1XG5A 5G4LA 5JARA 3VYRB 2J67A 2B8WA 3VPBA 3DVRX 4DV5B 1R3UA 2R8YA 5HZGA 3EXHA 4DHWA 4B73A 5KKNB 2LE0A 5IK2A 3VR4H 1GNPA 2HLHA 1GPH1 3AY7A 5JFGA 3ZCXA 4E7PA 4ZQGA 2JD2A 3OTIA 5JMPA 3H5OA 1JEOA 4JX8A 2QF7A 3UMBA 2GUWA 4PN3A 1PL6A 3C8DA 1MOPA 3IA2A 4C29A 2BEVA 5KYUB 3E1SA 2YFHA 2IHTA 1Z4PX 3AB8A 2V7UA 2I4NA 1PX0A 1XEXA 5CT8A 2BMAA 3RGWS 2SBTA 2B83A 3QPVA 4JC8A 2GCOB 1C7QA 1CUFA 1GPNA 2A5GA 1BDJA 1SRRA 1GZ4A 2J46A 3RJ5A 2BGLA 4G9EA 4J91A 1XALA 3KS9A 3UJPA 4C0HA 2DJ5A 2V6MA 2VHZA 4CF4A 4BV3A 3KKPA 4YTEA 1HFWA 1XQWA 1YR8A 4MKFA 4DSZA 1TNDA 5BRJA 1JHUA 2VQDA 2V6FA 4X91A 2HWUA 2ZUCA 2FG5A 5F3DA 5C80A 4A6EA 3AOEA 2FPPB 3ECCA 3FCCA 5FI1B 5T4BA 2ZIVB 4LCJA 4O8ZA 3OX2A 4CTNA 3GP3A 3RDPA 5E2BA 5HHTA 3RUAA 1JDTA 5I6DA 5KCMA 4G0OA 2G9NA 3G6WA 5DLPA 3EY9A 4NZ9A 1WE2A 5M3BA 3ESXA 1BO6A 1WDWB 4DYVA 5A7FA 4U9IS 2LP4Y 2JGKA 1GRQA 2QORA 2W8BB 2XD4A 1H1DA 4F5DA 4UZFA 3R7SA 5JXJA 1WA5A 1WB4A 1PAUA 2DUJA 2VQ3A 3Q4GA 3U1TA 1BXGB 4KJXA 1AT1A 4JLDA 2AMVA 2ZB4A 4G1MB 6YASA 5JT1A 1OI4A 2Q6VA 3FNEA 5CIWA 4Z1MA 5EE0A 3HHPA 3ZS8A 1A50B 1SWVA 2G8LA 1C5KA 4PBSA 4E3WA 3RD5A 3ZVKA 3BZUA 3IQDB 3T4EA 4DJEC 2O8CA 1RLUA 4JSTA 1PZMA 4FR5A 2I9PA 5CVJA 3PPYA 4ISBA 3NJ8A 4NFYA 1OFUA 2D54A 3GQBA 2QZZA 1YZTA 4V0RA 1G6KA 3N8KA 4ENUA 2I4LA 4QAJA 1OASA 2H17A 3OD5A 3R7BA 3HFSA 3I2FA 1RM0A 2QMHA 1DIOB 3FCYA 1RQRA 4LV8B 1IWOA 2ZGVA 2PQ0A 4MI9A 5SZKB 4DGSA 3FYDA 3GNSA 4AM8A 1SNYA 3BZWA 4IVPA 4QBHA 3FBWA 2IDKA 1K0FA 1PKXA 1RWQA 2R1VA 3INNA 1BU8A 2D1SA 4G8DA 4ZZ2A 1XVAA 4ZDKA 5BMOA 5JXIA 2IU6A 1CIJA 3L8YA 1DTWB 1JHZA 3RU7A 4RMGA 4IV0A 3HEAA 5JATA 3DUFB 2X6QA 2PIDA 4WDRA 1G5PA 1SIBE 4G8CA 3GLUA 2Q3FA 2IE0A 3QEBZ 1TD9A 3U7FB 1M6VB 3QJGA 1XD8A 2YR0A 3EVAA 4OL0A 5DU2A 3ZQKA 1N7HA 3FVVA 2AUNA 4K8RB 1T13A 5LXTF 1A9SA 2NO5A 1WDTA 1A96A 4E5DA 1W4CA 4HEQA 3LRTA 1IY0A 2B98A 3DA8A 1IJBA 1L5FA 4DSAA 5I9LA 1ULBA 2RGBA 2IT1A 3UT6A 2Y71A 3CZAA 2A3NA 3P0JA 5HF5A 4BUJA 5LQMA 5SY9A 4RK0A 1XA3A 1W6UA 2ZEJA 4IMIB 1ZLYA 4GM4A 3UHPA 1GFIA 1IIBA 2E18A 2GLTA 2ZTVA 3GBVA 1AKMA 4KACA 4AJPA 4N3NA 4QBGB 1FNCA 5CVUA 3AF2A 4JUDX 2QX7A 4IQ8A 4ZIRB 3M6LA 4Q9AA 5A05A 1DJQA 3ZX4A 4GX1A 4MGYR 4F04A 1XU7A 4LNHA 1N3IA 1E3JA 1YB2A 5FPHA 1JWAB 1CUDA 1LVGA 4OMDA 3WKCA 3A4NA 5BUQA 5IDVA 3HE3A 3OT1B 3FDZA 3GV0A 3BH6A 3QBVA 4Z2YA 1BXKA 5AKXA 2GCEA 5KYWB 4RMIA 2R1TA 5FFNA 1KSFX 1JLLB 1UDRA 3PD1A 4S05A 2IZ7A 2AFIB 4IMJB 2VJYA 3H2JA 3K0CA 2PMDA 4H27A 2YIMA 2ZVDA 1P2VA 2H51A 3GCXA 3D8BA 4EDHA 3QXSA 1W1UA 3MHPA 4N41A 4NZYA 4RHUA 1X9GA 2ACEA 5ITSA 5LFAA 1SVIA 1FX1A 3GEHA 2NAPA 5JD3A 1I1HA 4KFTA 2ZWVA 2BKUA 2JDIA 3EQ8A 1JALA 4LJ6A 1TEXA 4RJIA 2Z2IA 3PUWA 1IHYA 1UXIA 2VS1A 4YMUA 2P1RA 2QTMA 1U2QA 2YXDA 3WLOA 1WCIB 3K94A 4BZXA 4OAPA 2UVPA 1XWWA 5JO9A 2I3DA 2OQRA 2XNKA 4ZO8A 1IY8A 5C3UA 3CWCA 1G7RA 1CZNA 1AK2A 3IHLA 5GADl 2J48A 3NGMA 1KSJA 3F5FA 4GP9A 2HJ9A 1V3TA 4DS3A 1R0CA 3TIGA 1DX6A 2VO1A 1ODCA 4KXWA 1K7XB 1C30A 5C5CA 3U6BA 2A5JA 4J0CA 5FJIA 4LS3A 5HYVA 1F60A 2VTVA 1M8PA 3QOWA 4N5LA 1ADGA 2FPXA 3EGXA 2VZ0A 2OBBA 3C45A 4MV7A 1LH0A 1ZL0A 1N2CB 2VYNA 3RUDA 1CUUA 3WGNA 1QOZA 2QUJA 4FCVA 3IEKA 1SHKA 1CHNA 2ONKA 1FDRA 1KKMA 5AJWA 4C0BA 4D3XA 4DXAA 2ZWMA 3G2QA 1NMXA 1PE0A 3HCEA 2OBXA 1MVLA 2ZI7A 3LFUA 3QP9A 5JJKA 4MLPA 1E92A 2DTDA 3H4VA 2IU3A 4XB6B 2RAFA 3GZ4A 3WISA 5BYAA 3IEPA 1V4VA 4X45A 4Q1VA 5IEBA 4ZKEA 5ADVA 2HBYA 1V2HE 1XV5A 3QYPA 2XOKA 4I99A 4AO6A 1II9A 1AF4A 1WNFA 4OBEA 2I22A 5GAJA 4OKIA 1JI0A 4M7OA 1MLDA 4O4JA 2GO7A 3E7XA 1OXUA 4EHHA 2AIRA 1P62B 2C2ZA 3K0AB 4FGZA 1NVKA 3U80A 3TG8A 1ZNWA 1V6CA 2W6JA 4FYHA 4L0MA 3TB4A 2E4UA 3PRHA 4JI6B 3I1FA 1JBQA 4TMVA 5EIHA 4X3OA 1YR9A 3KQUA 4WEOA 1YFKA 3UT5B 3ZWWA 2P1DA 2Y4NA 2XUPA 4IF4A 4M55A 3JD2A 2FVYA 1PNTA 1PIWA 2P5TB 1AC5A 3I12A 1QS0B 4UBNA 1R9NA 1GNRA 4U9HS 4W5JA 4I7EA 5EE9A 5EHQA 1SD2A 1NP7A 2X13A 2IIVA 4MOWA 1Z8FA 2O7RA 1Y5NA 1U0JA 2CYAA 3CSUA 3MOSA 5IYZA 5LBUA 3UMMA 1Y9JA 1MB3A 2ASEA 3OD1A 2Q3BA 1Q22A 4H6XA 3KJEA 4RF5A 3KB6A 2ZUTA 2VPIA 3RNOA 4QLOA 1ORRA 1U7OA 3N28A 4OQNA 2PU5A 3DKPA 5L8VA 1AE1A 4W5WA 3SI7A 2PRKA 5EKSA 4FKBA 2HJRA 2R47A 1T8SA 2B1RA 4GVLA 3LKVA 3V00A 5A4KA 1XCJA 1O4VA 3ZV3A 3BIOA 3GMTA 5JJLA 2W2QA 1KYYA 2EKQA 1JS1X 3ABQB 1C1DB 4N65A 1DJPA 1TKCA 3RADC 5CB0A 4K9RA 4UM7A 4S2UA 1N5OX 4WXMA 1BTOA 1K7EB 4RJKA 1PYOA 3HKEB 4GOOD 1BMQA 2ZTUA 3T06B 2E4XA 3M82A 3WDKA 2ZVJA 4ZI7F 1O89A 3ER6A 1M34E 4EP1A 3AVOA 1GL9B 3U3JA 5DGTA 4EW1A 2JI7A 4ZZIA 5G3ZA 2J3JA 1S3SA 3KUCA 3Q88A 2BMEA 4AXXA 1GAQA 3D0OA 2C5SA 2HT1A 1PLJA 2YV4A 3NIDB 4JVOA 5CA1F 4ZT5A 5K3BA 2BGGA 3L6UA 1ADFA 2LZ0A 1K3TA 1Z37A 4HX5A 1HT0A 2R85A 4D9EA 4QFMA 3R9KA 1OIXA 4R40A 4PS0A 1AKVA 1QANA 3DDNA 3HM2A 2OO3A 1PJCA 1ZVKA 2FEPA 1VJRA 4FGJA 3SQLA 4F7WA 3T3OA 3HR7A 4J0KA 3ESYA 4H0FA 1ZM7A 2PH1A 2OXRA 4U7WA 3LQ4A 3ZDBA 1N6PA 1ZH4A 1FRVA 1P44A 3R76A 2H16A 4WDQA 3KAJA 4TS9A 3NH6A 1KIFA 2G0TA 4WKOA 3R8XA 2FWNA 3SQNA 4DDWA 3FLMA 5A1JA 1QTIA 5JAMA 2ZSUA 1GPMA 4WERA 4F11A 1ABBA 5IJ9B 3LQ1A 4WBXC 1OY1A 1TYEB 1KZ6A 2YN2A 5E6UA 1XZNA 3O7MA 3G1TA 5LBTA 3P20A 3VV3A 2GZAA 3ZHRA 4D8YA 3QE9Y 1L6IA 1T3ZA 2HO4A 3OJ0A 2DFTA 2XA1A 1CNEA 2C88A 2YZKA 4CCSA 1STOA 4FPXA 1FDIA 3PCXA 2XE6A 3FOCA 4L4YA 3REQB 3SQDA 3FNBA 3T1VA 3LM8A 4D3ZA 4MVJH 4YRIA 1FFYA 1K7CA 1UK8A 1I7DA 4ZZ3A 3U17A 3SBDA 2XIJA 4LYEA 5H81A 2GCPA 2HF9A 1OV6A 2QI9C 2Z8XA 4IDNA 5BOSA 3IEMA 3M1LA 1E1LA 1JDSA 3KAKA 2LKDA 2ZU6A 3JQCA 4BVBA 3ZZ0A 1V37A 1H42A 1CPYA 3AIKA 5ECYA 1GUAA 4A0QA 2ZJ8A 1FDWA 3VTFA 1WPQA 4UHFA 1F4VA 1SKBA 3H0CA 3LT5A 3EPLA 4J7AA 4QA9A 3BSWA 3JQ9C 4A91A 4DA0A 5EPOA 5FADA 4OHPA 1RBMA 1CRLA 2XDAA 2WV9A 1KZ1A 2YUTA 3N2KA 5JAIA 2X2FA 5ARBA 3R3WA 1E4EA 4QLAA 3G0BA 3IUMA 3URKA 2CVOA 2WTXA 4Y2VA 2G4VA 1U0EA 4ODIA 1M33A 1OZ0A 2C9ZA 3JYPA 5JAZA 5F5NA 4P4LA 3KPJA 3VZDA 2A57A 2GZHA 4CM4A 3WSVA 3CZ5A 2NVBA 1DFIA 4JHLA 3WLMA 3ZI4A 4F2HA 2BOVA 4UTZA 3T95A 5I7VA 5K0CA 4CKCB 2RGRA 2OCLA 2M6RA 4Q4JB 4XYEA 4R98A 3AEKB 1UADA 3TL6A 4ZVUA 3UWMA 4OLFA 4NSNA 4I9GA 2MCFA 3BM5A 2YQZA 4GMHA 5AK6A 3WFZA 1Z0SA 4LFAB 2WD7B 5SICE 3BF7A 2Z2XA 3EXIB 1E7MA 3S2FA 1C29B 1BDMA 2EQ5A 2INGX 3ZVRA 2J7PA 1PS0A 1N9GB 2VR1A 2AX4A 4KIWA 1JLMA 4IXTA 4O4LA 1WZUA 3ETGA 3GJSA 4OP1A 1H5NA 3EFHA 4P83A 4X1IA 2REBA 1ZJ4A 3ANTA 3LC2O 3LP5A 4ZJUA 3FUWA 5JAUA 1N6RA 3IBCA 3DFKA 1LRJA 3K1ZA 2HHHB 4XDYA 1W25A 4U6SA 1HE2A 2IYOA 2QN1A 3JATA 4WI1A 3WLTA 4KQIA 3NHKA 3NCHA 4Y2YA 4JI8B 1F6DA 3WGIA 2WLSA 5CP8A 5L3RA 3O2JA 3L0DA 3PS9A 5EXEA 3F9IA 4QXPA 4ENVA 1PTJA 5KO2A 2I33A 4QL3A 2YVAA 2CVPA 5IASA 1LV8A 1ZH8A 3PLNA 4G2TA 3MTIA 3VMMA 1KO5A 4PN7A 5J47A 4NTZA 2G82A 1F2UB 1MNAA 4G5YA 3G2MA 1KEEB 2Q45A 3LOPA 1QPZA 1FA9A 3IT2A 4MVJF 1VMIA 2NVUB 2C83A 2HMYB 4PSCA 1QYXA 2P3QA 4MW5A 3GNTA 4D8TA 4DWVA 2OO5C 2O5RA 4KQ6A 3GGGA 3SKVA 4BAUA 3R7DA 3IEUA 1OT5A 3MCZA 3GEPA 3E1KA 4RPGA 4EGFA 1IUPA 5JIBA 5IJZA 1TQHA 4UHBA 4JEIA 3LY8A 3L41A 4UVGA 1PQ4A 5EKDA 3ZNNA 2QX4A 1E5DA 3TRFA 3STHA 1RRFA 4O2BF 5BMVB 2QLTA 2Y4OA 3BCRA 4IG4A 2FSVA 4YJFA 1A1SA 2X14A 3IVRA 5J5CA 4BO8A 4AJ9A 1CWUA 1P0FA 3HFGA 4BKRA 4EI7A 1XXLA 2E4WA 4C3UA 3NV9A 1OKKA 3ZHZA 2P67A 4BWFB 3DZIA 5I9BA 3NHRA 3A4LA 3W8NA 4DT1B 3ZKAA 5HRAA 3VC1A 1OPRA 1Z36A 3FW1A 3I8OA 5IAGA 1R3DA 3I72A 2X0FA 3SQOA 3Q2OA 4P7KA 2JHPA 1UR5A 2JGIA 3HEMA 3PA8A 4MQFB 5IDQA 2PM8A 3QU4A 2OXFA 4OFZA 1NVGA 5M04A 1R15A 1M2EA 5KSZA 1QB8A 1V8OA 4YN3A 2AS0A 1VIMA 4EK9A 3LWZA 2IW3A 2BGJA 3O8OA 4OJQA 4F3KA 3AKYA 5AJYA 2YHSA 4NZOA 4INPA 2EF0A 4QVKA 4YDQA 4DLZA 2J85A 3UBTA 1C3OB 1IOLA 1HMYA 1S7GA 2O1EA 3CLSC 1HYHA 2C8JA 3I4CA 4V2UA 4ZCMA 2BFNA 3ED5A 2FRDA 4UE6A 3U5ZB 2OESA 2IP2A 3BIJA 4YJ2A 1ICEA 3OCCA 2MINB 1E62A 2YVLA 1RHMA 3AP1A 4NJOA 5ERXA 3WICA 5D3QA 4NFHA 1FXUA 3DE1X 4A8PA 2HU7A 1QGZA 3NEYA 1X8LA 1EXWA 3GJQA 1Z17A 3GXOA 1Q84A 4PYIA 3L1IA 3JWIA 1JR6A 4M83A 3NBZC 4PYLA 3DMTC 4U0JA 1ID1A 2EG5A 1M6NA 3F8SA 4TRRA 3T7AA 5TLSA 4G5RA 3OFSA 4IGEA 3ZPXA 4N01A 4JA2A 4BE7B 1XB2A 1Y89A 2I2WA 2GJ9A 4KIGA 2LW7A 3EVDA 4LAFA 1LB1B 2BUCA 1QGDA 2W42A 1NXTA 3K3PA 5E6RB 1TXGA 2D59A 3LU1A 4N3CA 5FJJA 3GAAA 4DADA 1P61B 3FWNA 1AK1A 3KHSA 4C21A 2B1GA 4Z1OA 3AFIA 3PQ2A 1DAEA 2P4SA 4W8HA 2ZROA 1ORVA 4CEJB 2CXNA 4OI0A 2PZAA 3K1YA 5KSWB 1L7EA 3RANA 3PC4A 4C7OB 1TVKB 3IQZA 3LPAA 4H7FA 4RD2A 2AJBA 1RWWA 5EMKA 5HKAA 3OECA 4KXUA 5BN3A 3LIIA 1CZHA 3GN2A 4PHCA 4MDEA 1EK6A 1JN0A 2XUDA 3I04M 3HU1A 5CLLA 2IFTA 2UYOA 2QTLA 1KH2A 5CDYA 5GPBA 3AB7A 1X15A 1YMQA 2JW5A 3EG9A 3EF1A 5GVRA 3BXHA 1QG6A 4DNXA 5HKLA 3TDKA 1EVJA 1DAOA 3AETB 4MS3A 3QLTA 3O8NA 4A6PA 1Z0ZA 2JLBA 4TXMA 3BTSA 1S2NA 2ENUA 3E5RA 3FJYA 4BVHA 5H59A 4X66B 4GVXA 2Y6VA 3EASA 2PIAA 1QV9A 1WDMA 2CJPA 2RHHA 1N4DA 5J3JA 3SC2A 2MMCA 3CJQA 1ZIYA 4N6GA 2DE0X 1J0DA 3F1KA 5LYJA 2O23A 1KTVA 3K5PA 1VP9A 3QBJA 5A5FA 3K9WA 5IVHA 4EO9A 2P11A 3ULKA 1NBMA 1U8CB 621PA 5J23A 2APJA 4D3FA 1M5UA 2P6UA 3JVDA 4QASA 2C97A 1PR3A 1P9OA 2RJNA 4MI1A 2IV2X 2V7TA 1K89A 1L1FA 3R09A 4DC9A 5MN4A 3N0WA 1JDPA 4ZOLB 3AXTA 3D0RA 5DM60 5KX5A 2QK4A 3KJNA 1F9AA 1R4NB 3H9GA 4QYIB 1G18A 4XYMA 1U7HA 2OO7A 4BCBA 1EXMA 2Q6LA 4E7OA 4F3YA 4XDZA 1H1TA 1B2LA 1NQOA 3FM9A 3TZCA 3KB8A 4MUHA 2B36A 3N2EA 4RCYA 4IUYA 4RS3A 4X8OA 4XSVA 2PL1A 4QELA 5EWJB 2HSDA 1T15A 5HIIA 1WZIA 4FW9A 4PBRA 1O58A 3TVTA 4Z49A 2OZLA 1ECFA 2FWJA 3KXDA 3UIEA 2CV2A 5B4TA 1U63A 1CEQA 1P2FA 3CRZA 1JAZA 2BLLA 4B2PA 2WICA 2XODA 4HDNB 2ISCA 4D9NA 3RU9A 1ZMXA 5ARCA 1GUFA 4HAYA 1XNRB 3OQJA 3VAAA 1RIFA 4FJ1A 4JB3A 2W0SA 3GGDA 3CVWA 3V2IA 2NU7A 2NG1A 2I34A 2ODPA 2OHGA 4YC7A 3VU1A 2GSDA 3M34A 2Z6VA 1IULA 3OPQA 5IEJA 3KWMA 4NICA 3ZQ4A 2KS6A 1OI7A 1IPHA 3DKVA 3HB5X 4DR1B 2G1UA 2PKCA 4BTVA 2QRLA 3SYMA 4BS9A 4CKZA 3JPYA 3C3YA 5T5QA 2IOFK 2KSQA 4DLUA 5JXWA 4R8SA 4YUAA 3QUBA 2HNAA 5KQLA 3H1TA 1Z6TA 2CDAA 1C8KA 1FFBA 1KY3A 4L74A 5JPIA 3UENA 4EHJA 3GEMA 2Z08A 4RU1A 3VBEA 4O4HB 3A10A 2MSLA 1GITA 4PFQA 3U56A 3FKSD 3L4BA 3PGLA 5LP6B 4CNBA 4ZP1A 5ED0A 4AG6A 4KUHA 3DXFA 3SG0A 5H3LA 4C01A 1P17A 3RVLA 3E22B 1QIMA 3EB9A 4CVNA 2ARKA 1FRQA 2YHIB 1W4LA 5BWNA 4YCCA 3D5EA 1D0SA 3D6NB 4IHKA 4ILEA 4GGPA 4Q82A 3DP9A 3MUOA 2IY8A 1KYQA 4PE5B 4X54A 3U4IA 3F1LA 3GC6A 3CMCO 4JJ7A 5FB3A 3DJYA 1CZLA 1X80A 1JHVA 3OUZA 2RCYA 1TT7A 3OUUA 3JQRA 3PL1A 3DFZA 4QHTA 1A2KC 1FSSA 1L7AA 5LDGA 5BSFA 3QX9A 2ZR0A 2R00A 1LQUA 3INTA 3A3OA 2I8LA 3EOZA 1YDMA 4II3A 3WLSA 3KFLA 1M8KA 1KK2A 2PXXA 4TT3A 2Z1NA 4QBTA 1V0JA 2H65A 5DGCA 5EC8A 4EKIA 4G8JA 1U6IA 2AHRA 2YIVX 1KL7A 4QX6A 3CW9A 2BGRA 1JG3A 2O05A 3IHTA 2PH7A 2QUBA 4Y2XA 3E9ZA 3KYCA 4BV9A 4F9GA 1EXNA 1EXDA 2ZLBA 2FF7A 3QI2A 4FB4A 3PGJA 3VH1A 2P5SA 1YUNA 3WSWA 3SPXA 5I7OA 5EJ5A 4KMMA 4WZ6A 1C0LA 4KVFA 4CR8A 4UW9A 3BH0A 1YQXA 2QE6A 5DRYA 4H7EA 4JASB 3OICA 3GEDA 2XWQA 4GE0A 1YL7A 1UPCA 2R5WA 4I4TF 3V8NA 2FOXA 2H57A 1KBZA 4BGUA 4F56A 2I91A 4FINA 1XJQA 2O3TA 4MMYB 4PU0A 3ZBTA 5JCZA 1YDHA 2NO9A 3D4IA 1AV6A 1NZJA 3MRSA 3BCSA 3AERA 5ALYA 4MIOA 2XLCA 5GJWC 1MABB 3EZXA 3HL4A 3PPIA 1ILEA 2RGWA 5DN6A 2Q5CA 3EWIA 2DJIA 4L4ZA 1F14A 1R8QA 4EWLA 5JYCA 2B3TA 3GUVA 4PZYA 4QDZA 5C2JB 5KYXB 2ZQYA 2ZB2A 5F7ZA 3BJZA 3GPCA 3KWJA 2WY2D 2FQYA 3IP3A 1MCZA 1TQ4A 1EVKA 1LV7A 3GFRA 1MMFB 3DAPA 3FNHA 1QQ7A 2QIPA 3H84A 1N2JA 1SQGA 1G4AE 1IQPA 1OBHA 2NV6A 1JHQA 4WZBA 4XCVA 5AMXA 4BGEA 4NYMR 5K01A 1QIKA 5LZ4A 2O2HA 5H9VA 3DV9A 4AJLA 1I80A 5T3UA 5AVTA 3OEWA 4W5HA 5IZ4A 2R2GA 3U4QB 3MTQA 1YBAA 1EJ0A 2BBTA 2P9JA 1DCFA 4A8JC 3L7LA 4W8GA 2L82A 4KR3A 1N0UA 1O95D 4UDYX 4YFVA 2IEZA 1HT3A 2GBLA 4OQQA 1QF6A 5GQSA 4G3XA 4BC1A 4DV0B 2R8PA 1P1RA 1NIPA 2P8SA 2C1XA 5C5DA 5JCXA 3JWJA 2BL4A 4CPDA 3PC6A 4J7CA 4DJFC 1SM4A 4MIEA 5FA6A 5FORA 4NECA 2H48A 3RYIB 2JCVA 1R0YA 3OTQA 3UJCA 2I4OA 2YJ5A 3DKRA 4PXAA 4B87A 4Q9LA 4YRMA 4GNRA 4K6CA 5IXYA 3K09A 2BEWA 1BKYA 2ECQA 3GJZA 4HDKB 1GRRA 1BVRA 5G0VA 2RBGA 2XMBA 4WUTA 1VECA 1JJIA 3VNVA 2Q8PA 2WYWA 4FDUA 2W11A 1M2FA 4BFYA 4GX0A 1OQAA 3N75A 4ZTZB 4BL5A 1NMSA 4XWWA 5AQEA 3STVA 4ERNA 3B1FA 4IZOA 4IXDA 2OHIA 4MUKA 4RTOA 4YV2A 3WGKA 4BNYA 3HDJA 2A14A 3HRIA 3GJRA 1I3NA 1SBZA 2PH5A 1WMDA 4D97A 1G2PA 10MHA 4IVRA 2GWHA 1JLRA 2NZ8A 2ZUSA 4G81A 4XOUA 4PTYA 4WOKA 5TVGA 4DMHA 3W05A 2J4DA 2JRLA 3KSAC 4QGHA 4DEYA 2IIPA 3M9LA 2IITA 4QPDA 3RJMA 2Q1WA 1CJTC 3ZWNA 1RXVA 2V0CA 2EAUA 4D1YA 5BSHA 1XF9A 1ZHHA 1G9XA 3B60A 2XITA 3BB3A 5JG7A 5ICSA 5JSYA 1YBMA 3AUSA 4NAUA 4WTOA 1YR3A 4XUEA 3ZXSA 2XKJE 3BYZA 2B7CA 3NDPA 4TV8B 4UM8B 4CIDA 4D6XA 3BORA 1SCAA 4R0MA 3Q72A 3NVAA 3SP1A 3O90A 4F4UA 2ZZNA 3B70A 3IT3A 2VPWA 2W5UA 1QHHA 4JNKA 1MB9A 4E5KA 1VJ1A 2R8XA 4BLTA 4XAQA 1ENOA 3C3KA 1H8EA 4IKEA 3W0LB 2V7WA 3MGAA 4ILKA 4WK0B 1YU9A 2X2OA 5AM3A 1F0PA 1W36D 3H4IA 3OLZA 3DJFA 3NNSA 5DNCA 3F5QA 3NHMA 3TGPA 1L5LA 2CK3A 2ZXEA 9GPBA 5I7EA 1TCUA 2AA3A 2HWXA 2J1LA 3AQ4A 4I0WB 3ROZA 4IIFA 3T3EA 2Q5LA 4DDUA 2JANA 1R6TA 3THXB 2OECA 2FFBA 4IAOA 1LTQA 1H6DA 1WO8A 3IMCA 4Q7MB 5H4GA 1JGTA 3QY0A 3FMGA 2QR5A 1N5KA 2JGEA 1VYUA 3CF2A 1OFUX 1XMXA 2P9ZA 2ZDGA 3KEFA 3OIVA 3WJAA 2IOQA 5FWNA 3L7IA 3COWA 2W6QA 2FZGA 3IALA 2O5EA 1L6RA 2XE4A 4ENQA 1PJ3A 4EKEA 3T34A 3E15A 1W34A 1B15A 3MOGA 3G13A 3CZRA 3TRHA 5C53B 4WXEA 2IHKA 3I9V6 5B1IA 4MNTA 3NHZA 4OHYA 1DOZA 2X8JB 1TX4B 3BKXA 3BMNA 1FYXA 3NM4A 3P9XA 3S5JA 2QRMA 4E14A 2C7OA 4KRFA 3HWRA 2PMWB 4LX8A 4Y2HA 3GJ4A 3BH7A 4ZCPA 5K0GA 1JXOA 4LJKA 3ZE1B 1QRTA 2QRJA 4C07A 1UK7A 5LDHA 4HTAA 2FZCA 4JKOA 3T1NA 4H7HA 3F6CA 1HPLA 4FZVA 6REQA 4KQCA 2JH9A 1YI1A 1A9TA 1YRLA 4OXXA 5D3MB 4H15A 4XWAA 1PYGA 1THTA 5IS2A 2GAIA 5AP9A 1ZNYA 3GARA 2QVBA 3T7IA 4JI3B 1Y4DE 1E96A 1XZFA 3CQ9A 1HDIA 3EARA 3QIVA 3RSCA 4AJOA 3TUZC 1D04A 4NU6A 2ZBGA 3ILSA 3FVQA 4PSDA 1J25A 2R4QA 5LA6B 2IV3A 4D7AA 1I4DD 1KH3A 5AICA 5EAIA 2DAPA 3KXLA 4N6NA 3FRJA 1FF9A 1FP7A 4B82A 1MB2A 2PT9A 2X42A 3DBVO 3HBAA 4QJBA 3A8TA 1ZH0A 1EGVB 1YB5A 3N86A 4UOQA 3HJTA 3N8NA 1QGOA 3RHZA 1PWXA 3O3NB 3JRXA 1GR0A 1YL5A 2VP2A 3LZDA 3QTLA 1WPXA 4N8DA 4R54A 1HLDA 1UKZA 3L93A 1BKSB 3VVBA 2VQFB 2NZ2A 4O29A 1ZSVA 3F46A 1ICIA 2FPOA 4L3OA 4B17A 1SXGA 1V1RB 5ALRA 4C2UA 3FBTA 2X0JA 4QOEA 3NBYC 2OYSA 5JROA 2ZRJA 4FFBB 3SC3A 2O0HA 2QL6A 4YMVA 3H9UA 3DKIA 5J2UA 1TU4A 3AKCA 1XDDA 5EE1A 4UAJA 3UPDA 3P0HA 3NKVA 2EVWX 3INGA 2X0IA 3Q7IA 1ZONA 4B48A 4H3KB 3KQWA 1J2JA 3ASVA 2Z2ZA 3FVWA 4Q24A 3FIJA 4HADA 4OYYA 2Z5FA 3HB1A 1FQWA 1NUHA 1L4MA 1UAYA 5BQ5A 1YZLA 1NM5A 1IZ0A 2VHXA 1X7YB 3HV0A 1ZXXA 4A92A 4TSKA 2VHYA 4ZYWA 3E4DA 3JVEA 2I6SA 2OILA 3D6VA 4Q9JA 4B3IA 3AEXA 3THWA 3EA4A 3MJFA 2OXTA 3E23A 1XTZA 2PQ2A 2PSDA 1IVYA 3GUHA 4B3CA 4KU4A 1W0CA 2I03A 5CT4A 3D4BA 5TQ0A 1ZJWA 5EXXA 2HPVA 5I9IA 2Z09A 4D4JA 1E3IA 3I5UA 1VJTA 4UBIA 3RIYA 3CLVA 4LJ9A 2OPBA 2X8WA 1JQ3A 1LPOA 1W5AA 2B4AA 3AHGA 3BXOA 3ETJA 3KQOA 1GKYA 5CDFA 3EEOA 1OLUB 3F3MA 1E2FA 2IODA 2VSYA 1JKIA 4MW9A 1UKVY 2CFOA 4PYJA 3HN7A 3T61A 3TI9A 1H4SA 4HQKA 4N03A 3COZA 4K9MA 3ZNOA 4DIDA 3DHWC 4AQ7A 3UXEA 4KSCA 1WRBA 2HO5A 4I55F 5HKKA 1SUIA 2I1WA 4HNSA 1FPMA 2X0EA 3PXBA 5E7MA 4L1KA 4R1QA 5FF9A 2GH1A 2QNIA 2X77A 2NNLD 2PZ8A 1PWYE 3C5VA 3K0BA 4FGLA 5DSZA 5FI3A 2ONCA 1DJNA 4M86A 4UPEA 1XKXA 4DYHA 2CUZA 3TSZA 3DBHB 4HFJA 2R1ZA 1Z06A 2FK8A 4OXYA 3F8TA 3RS7A 2ZRFA 4FGWA 2C4KA 2HSJA 1Z07A 3L46A 4P86A 4DJ5X 3FUTA 3GLGB 3N87A 3OF5A 1QLHA 5FNZA 2HV8A 4ZD6A 4EFKA 2NO7A 1JLKA 1DX9A 1NF3A 4X90A 2BI7A 2I29A 2YOGA 4G86A 2QL5A 1G42A 4OXRA 2ZSBA 1PUXA 1UBMS 5IARA 3VSBA 3VR4A 1NOJA 3WNBA 4EJ6A 1SIOA 5AJTA 1XCPA 2I62A 2ONZA 1A5BB 2IKSA 3BBPA 2BM8A 3N2ZB 1VSVA 3QUAA 1II0A 3K4QA 3L0PA 5ALFA 3JZDA 3ZNPA 4E30A 1MRZA 5REQB 2JHFA 1OTXA 1UP4A 1LZLA 5CX4A 4L0CA 3WRXA 1XDSA 1PDVA 4RH3A 5F77A 1OIWA 5K8JB 4ZAFA 3WZMA 3PDUA 3W6ZA 5LNK6 1QIGA 3CG0A 2C5FA 5FYQA 1AZTA 3HNRA 3S2YA 4RGYA 3SVTA 3AF6A 4GYKA 2QNBA 3DE3X 4YT8A 2G88A 4LHVA 5CM8B 1PBTA 1X86B 7AT1A 4CM8B 4KPGA