3WMGA

Crystal structure of an inward-facing eukaryotic abc multidrug transporter g277v/a278v/a279v mutant in complex with an cyclic peptide inhibitor, acap
Total Genus 222
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
222
sequence length
589
structure length
589
Chain Sequence
b'TGVTARRIFALAWSSSATMIVIGFIASILEGATLPAFAIVFGRMFQVFTKSKSQIEGETWKYSVGFVGIGVFEFIVAGSRTALFGIASERLARDLRVAAFSNLVEQDVTYFDRRKAGELGGKLNNDVQVIQYSFSKLGAVLFNLAQCVVGIIVAFIFAPALTGVLIALSPLVVLAVVVQMIEMSGNTKRSSEAYASAGSVAAEVFSNIRTTKAFEAERYETQRYGSKLDPLYRLGRRRYISDGLFFGLSMLVIFCVYALALWWGGQLIARGSLNLGNLLTAFFSAILGFMGVGQAAQVWPDVTRGLGAGGELFAMIDRVPQYRRPDPGAEVVTQPLVLKQGIVFENVHFRYPTRMNVEVLRGISLTIPNGKTVAIVGGSGAGKSTIIQLLMRFYDIEPQGGGLLLFDGTPAWNYDFHALRSQIGLVSQEPVLFSGTIRDNILYGKRDATDEEVIQALREANAYSFVMALPDGLDTEVGERGLALSGGQKQRIAIARAILKHPTLLCLDESTSALDAESEALVQEALDRMMASDGVTSVVIAHRLSTVARADLILVMQDGVVVEQGNHSELMALGPSGFYYQLVEKQLAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-binding cassette, sub-family B, member 1
publication title Structural basis for gating mechanisms of a eukaryotic P-glycoprotein homolog.
pubmed doi rcsb
source organism Cyanidioschyzon merolae
molecule tags Transport protein/inhibitor
total genus 222
structure length 589
sequence length 589
ec nomenclature
pdb deposition date 2013-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF00664 ABC_membrane ABC transporter transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1560.10 Mainly Alpha Up-down Bundle ABC transporter transmembrane region fold ABC transporter type 1, transmembrane domain 3wmgA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3wmgA02
1MO3A 1NKSA 3X1XA 1OHHA 3SOPA 3N5CA 3ZVRA 5KNCA 4AWXA 3B85A 1AM4D 5JMTA 4IEIA 2EFCB 4UNNA 5E7JA 1ODFA 1HQYE 4RFSA 2IS1A 2QMEA 1GAJA 1G21E 5LBIA 4IOKA 5C46F 2BC9A 3IO3A 2WKPA 4GDFA 4NU0A 2ZVPX 3LH5A 2O8FA 1A4RA 1N5JA 4TMZA 1II0A 3FDIA 1X8JA 3GJ6A 1KDOA 4HZUA 4RZ2A 2ZEJA 3V9PA 1FTSA 2ERYA 5DYIA 1OW3B 4Q9LA 2XJ9A 5KYKA 3KX2A 1NN3A 4M8NE 1XD2A 1KK0A 2BOVA 2V4ZA 3PVSA 4LGMA 1G6OA 3FYHA 4JZKA 1TEXA 3EWAA 5KSYA 1VCMA 4BLRA 3TUIC 4O0MA 4BFYA 3BK7A 4BFTA 5J5CA 1PLJA 1XMSA 2GJ8A 1VCIA 1NMXA 4Q02A 2YZ2A 2ZSEA 5EXXA 3W5IA 3WYFA 1IN6A 3CX7A 1US8A 4OHWA 3UWOA 2X1VA 2UVQA 4A15A 1GNQA 4ILEA 1NIJA 3KJGA 5HE8A 5GADl 3EIHA 1ZC3A 2UZ3A 4V02A 1E79A 1VYUA 4A0FA 2AHOA 3LWNA 1I2DA 4A6XA 2C03A 3LW7A 2FEMA 1FX0A 3NDPA 3DOFA 3OIVA 1KSGA 4A36A 1MO5A 1G16A 3CRMA 4CF7A 4L5BA 4CT5A 2WKQA 3UMRA 1P9WA 3AUXA 4Z8XA 1WDTA 2NGRA 3THXB 3KL4A 4GBMA 5BN4A 1OF1A 2ZRFA 1IN4A 3FKQA 1KKLA 2G3YA 3PCRB 4KFTA 4LV5B 4QBHA 5CLLA 2C77A 4EPTA 1NI3A 2Z83A 5GJVC 2IF0A 2P0EA 2W6JA 4CEIB 1ZUNB 5DI3B 3TRFA 2FFHA 2QGNA 3C15C 2QBYA 1NVUQ 3RS2A 2XNDA 2HJVA 2IX3A 1OH6A 1KDRA 3EX7C 1E9FA 2WWYA 4KAXA 4PC2A 3TGPA 1E0KA 2OFOA 3QXCA 3T1TA 1ZUIA 1ELOA 2CXXA 3IPXA 4LY6A 1UEIA 5GVRA 4LJAA 4H9GA 4DSNA 4FCVA 821PA 2JLUA 1FUUA 1AS0A 3HR8A 3ZVMA 4MRVA 4A6PA 4Z54A 2QI9C 2ZYUX 3AVPA 1O87A 1CJVC 2JATA 4DLTA 4OI1A 1XZPA 4N1AA 4AC9A 4ARZA 2ZSFA 3KXIA 3RSOA 4A0HA 1W44A 3PEYA 2VYFA 3AVOA 3C41J 1NG9A 2MSDB 1J70A 1VDZA 4NYIQ 3BE4A 4GRAA 5E95A 2D3WA 4IDPA 1NLYA 1G8GA 2A2ZA 2YC2C 5GJCA 2A78A 3TAUA 3AF4A 4URVR 1U8YA 1Z83A 4ACBA 2QZ4A 2OG2A 1XFAA 1TQ4A 1BMFD 4LJ5A 5G3YA 4D80A 4PPGA 4C7OB 1KIMA 3NKVA 3W8NA 1VIAA 1RIFA 4W7SA 4BLTA 5L3QA 1U8ZA 2QN6A 4YMVA 4HLUC 3FFBA 3TW4A 1EXMA 4O2LA 4LJYA 2NZ8A 5FOUA 2ZE7A 4XWOA 1Q20A 3SJBA 1T3SA 2VP5A 4DXAA 2ZJZA 2DCUA 4JLKA 5CIWA 3KUDA 4MKHA 4TLEA 2C9CA 1XMIA 4I81A 1E96A 5M04A 3LY5A 2CLSA 3UMSA 3WRXC 4EPRA 2CCGA 4TMVA 4NPHA 4ZCLA 1ZM2A 4JYCA 1Z6YA 1U9IA 3FTQA 3P27A 1WMSA 4Q1FA 3AKYA 4TL6A 3IBGA 4C0HA 4BUJA 3QKRA 4RFSB 4IOLA 1W47A 2QSYA 3OFND 4LDJA 3JVUA 3HP1A 3RS4A 3BFKA 3RS3A 1Z0IA 4GSYA 1VMAA 1U0HC 1FQKA 4QGAA 2I3BA 2NPIA 4B6FA 5BW8A 2ONJA 3BH0A 4YC7A 4Q9IA 4DSUA 5B58C 2DB3A 1UM8A 2REBA 1OYWA 3LA6A 1P9NA 1KMHB 4EQ6B 4P33A 1E9CA 4P31A 1KO8A 4GL2A 3HWSA 4DZZA 2BEJA 5G3ZA 2A5JA 1VYTA 2ZRAA 3KTAB 2XTNA 3ZZ0A 1EWRA 4CRWB 3LFUA 2TMKA 2H92A 3WHKA 1Q3HA 2ZUDA 3VHXA 3SNHA 2CCJA 4F7WA 3MWLA 3CPEA 1L4YA 1R0ZA 1S2MA 1TQDA 4HB3A 1ESMA 3QNUA 4ZDIA 3IQXA 4KBFA 5JJLA 3KXKA 1VHTA 2QG6A 2QNRA 2FE4A 1SGWA 1U81A 2RGXA 1F6BA 3RABA 4XJXA 1EFCA 3M1IA 5FTJA 5FPKA 1YR8A 3AVYA 3HU1A 4HDQB 2FG5A 4KHZA 1Q3TA 1AS2A 2DWPA 3OHMA 1N6IA 4C3ZA 3BD9A 3TBKA 3PG5A 2C98A 2A7QA 5AUQA 2ZYWX 4DWJA 3BBPA 5J4LA 2EFDB 3FWYA 3H2YA 1IOZA 2ZJAA 5LB4A 2OXRA 1Z2CA 5AUNB 5L3SB 5TY0A 2J41A 1DOAA 4Q9JA 3OIUA 3U61B 4LBZA 3PQCA 3W6NA 4W5WA 1JB1A 4PAOA 1XXHB 1E3MA 2QBYB 5CYPA 4LBVA 1CU1A 5CJPA 1CKEA 1JECA 1G3RA 2J45A 4BRWA 2ZM5A 4G5SA 1S1MA 2B92A 1W4BA 3AKEA 3O8DA 4CW7A 1ZIOA 3AEZA 4Q1DA 3PEUA 4PPNA 2NPFA 1QVAA 4B76A 4WAUA 2XOKD 2KWIA 3DMNA 1QHXA 4IDHA 2AXNA 1P72A 1NMZA 4JLBA 5KUTA 3GLIB 1T8UA 4G0NA 1W0JD 5FBWB 3BWDD 1E2MA 2RHDA 2HT6A 5EXSA 1G8YA 2F1IA 3K9HA 1GUAA 1KI2A 2VP9A 3B1XA 2PZGA 2C96A 4JLMA 5P21A 3T1VA 3LQQA 4B43A 2JEOA 1H8ED 2AK2A 1BMFA 3NXSA 4PHHA 2ATXA 3CRRA 4UNPA 1XTQA 1YE8A 1U2RA 4RZXA 1KO7A 2O8BA 3WP0A 4TYWA 3L2OB 2JA1A 5IDVA 1YR9A 4RZUA 2W00A 4NCJA 2QQEA 1G8FA 1GDDA 1NBMD 2J3EA 2VP0A 2Z4RA 3WYAA 4K46A 3SYLA 4B73A 4LX0A 1WCV1 2AKYA 4EPWA 1UADA 2ANCA 1P4SA 1A5TA 1Z0AA 2ZRPA 3THYB 1HY3A 3DOEA 4KO8A 4PPQA 1W4CA 5CB6A 2RGDA 5DI9A 3OIWA 4F4IA 1Z8FA 5C4GB 4IXNA 5BWMA 1E2EA 3ZS8A 1RZ3A 2P67A 2QP9X 1GTVA 3OFNA 3EXAA 4OJKA 4NYMR 4URYR 2GJAA 1AS3A 2H18A 5EJEA 2V6IA 1FP6A 3HPRA 3Q3JB 4LC1A 4JVSB 1CF4A 2B8WA 3PITA 3G82C 5H1YA 1YZGA 4POAA 2H17A 3CF2A 4N0EA 2ZS7A 4LJ4A 2P5TB 3BB3A 1KI1A 3P32A 1BKDR 4TLDA 5CLQA 1DBSA 2RGGA 2XXAB 4B3XA 2B7BA 4FMBB 3SI7A 4KSCA 1IXSB 1MABB 1CLUA 1OXTA 3M6AA 1HQCA 3RRZA 1AQYA 2I4IA 2A5FA 4HB0A 2X2FA 3PR1A 3PENA 2EU8A 5JHGB 1L8QA 5G41A 3Q7QA 2HCJB 2ZRGA 5E4FA 4YXWD 1J7KA 1F5NA 4FD2A 2FOLA 1SXJC 2Q6TA 3T1OA 4AG5A 3CO5A 4JBXA 2C5LA 2JAQA 2BDTA 2D74A 4TQ9A 2EWVA 1U94A 5SZIA 2BJWA 3KQKA 1DELA 3B1YA 4OL0A 4PQFA 2AD5A 4Q7JB 3GJXC 3U60B 2BMFA 2PT7A 1TU3A 1AZTA 1G3MA 2GDJA 4V03A 1CR2A 2NIPA 2GZDA 1Z2AA 4OHVA 1W46A 1E9SA 3MMPA 4OKSA 1XEWX 4R2HA 2GAAA 3K9GA 1TADA 2HYIC 2FPKA 1CJKC 5ELXA 3L8YA 3O8CA 2RH5A 1SZPA 4X8HA 1HT1E 4DRZA 1E9RA 1IJEA 2FFAA 4NMMA 2CHVA 3VU9A 2YOFA 1ZM4A 3AB3A 1TF7A 3RWOA 1P62B 2QP4A 4AG6A 3R20A 4MDEA 4JMPA 3A1VA 5JEDA 1U0JA 4JIMA 2XOKA 3U44B 5H68A 2HXSA 3KFXA 2F9MA 1KO1A 2QSZA 1ZCBA 4EPYA 1P9RA 3WXMA 1W0JA 2W2XA 4BFWA 2D2FA 2R6CA 3QI2A 3X2SA 3Q85A 4M1KA 3W90A 1S96A 3VR2A 4C9BA 2BCGY 3KQUA 1J8YF 3DVLA 1E2HA 3IEVA 2GHIA 1ZP6A 2N1BA 2Q0HA 1SXJB 3H86A 1G20E 2YJTD 5AJYA 3Q9LA 3QXSA 1DO0A 1LFDB 3WNCA 1LB1B 2IXGA 1E69A 4DCSA 2PL3A 4V0KA 2JGNA 3WRYC 4Q1BA 1Z07A 1E0SA 1DVRA 2MMGA 3AV0B 4EJSA 3I8XA 3CPJB 2RMKA 4MUAA 4O25A 4QFMA 3LX8A 1NBMA 2AKAB 4B71A 1KNQA 1BH2A 4NYJQ 4P4TA 3TSOA 2QRZA 1JR3E 2NO1A 2ZSAA 2JLVA 4TLBA 1GILA 1GOTA 2X77A 4JLNA 2VTKA 2NO0A 4IFEA 3GJ0A 4DIEA 5B57C 4PAMA 3VKHA 4IOMA 4E03A 1II8A 4NDZA 3AM1A 2I1VB 3X1DA 3WMFA 1SKYB 1BYIA 5C18A 1YU9A 2ZREA 4OQLA 5L3VA 1P2UA 1WF3A 3UG6A 5AUPB 4TQUS 3U6KA 4PHGA 3GPLA 4V0LA 3UKDA 2OAP1 1SVLA 3RS0A 1JEDA 4MH0R 4A0RA 4DEYA 5DN6D 4PR0A 3CRW1 2F1RA 1RE0A 2AK3A 3GLIE 4BPBA 3B2EA 1NSTA 4C0SA 1KSHA 3H4MA 4D4KA 4D4MA 3IKJA 2PCLA 4M22A 2B7CA 4EPVA 3TJZA 1W36D 1XCGB 2QEQA 1A1VA 4CGZA 2CNWA 1F60A 4NCIA 4GPTA 4OQXA 4DCUA 1KZGB 4HUTA 5FOVA 1KJWA 4JLVA 3ZS9A 5K8LA 4HSEA 2IYZA 2ZXUA 1NJGA 4Q4HA 4G5GA 2GILA 3BIFA 2RGNA 1OFIA 2P65A 1VPLA 2BMEA 1H8HD 4LPSA 1O3YA 5DO9A 1AN0A 4GNKA 3FMIA 5EQTA 1G18A 3CONA 5EE1A 1ZINA 3GLGB 4B3DA 2J0UB 2DFKB 3K0EA 1IXZA 5E7MA 3EPJA 4Q03A 1DAFA 2ZU6A 4M1OA 4UNSA 2ORIA 4TLAA 1CXZA 1N3BA 2PLRA 1HTWA 3QXJA 1IM2A 2J0QA 3CM0A 4NL4H 4KFRA 3AGPA 2G9NA 1U0LA 5B30A 1NVXQ 1LV7A 2CJWB 2WSSD 3T61A 3W6OA 1NVVR 5FI1B 4TYYA 3IBYA 2ZE6A 2JCSA 2IS4A 4LYJA 4FMCF 1BOFA 1KI4A 4DLYA 1XWIA 2IS2A 1E2QA 2E87A 5HCNA 1ZU5A 2V8OA 4AYXA 2IUUA 3QY0A 1G3UA 1FL9A 1KDPA 1AJEA 4Q66C 4P4SB 4OQMA 2WTUA 2O5VA 1DAMA 1N6LA 5CB8A 3K9NA 5HCIA 5FI0B 4MYCA 3RAPR 2GKSA 4JVNA 1DAEA 1GZSA 2GCNA 3TQCA 3MWYW 2MMCA 4PO1A 2PEYA 1D2EA 1SHZA 2GJSA 5FUXA 1HE8B 1GRNA 5D3MB 4PPFA 2YWEA 5JJIA 5SZHB 2BCJQ 2OBNA 4Q4LA 2P5SA 1ZNZA 3CKLA 4X8OA 1E2PA 3LLMA 4EPXA 2D62A 5HKKD 1OJLA 1P73A 2ZRBA 4QRHA 3Q8XB 4EDHA 1KI6B 1OSNA 3R9XA 2OAQ1 4PO9A 1N6OA 1UKEA 3UMFA 5A5GA 2JJ2D 5G53C 4JL5A 4DCTA 3NHBA 5FTKA 4ZDJA 1UBGA 2A5DA 4PAQA 4F38A 2O0JA 3SE0A 3I5XA 1G3IA 4E5UA 721PA 1MRSA 1A2KC 2QTFA 3DHWC 3IDQA 2P3SA 3A1SA 3A36A 2YOGA 3RRNA 4B75A 4DB2A 1M8PA 1SQ5A 2R9VA 1IN8A 2V1UA 1T5IA 2FMXA 5B2ZA 1KO5A 3RRYA 4LOAA 3VR3A 2ZR7A 4YDSA 3NWJA 4L9SA 3TR5A 3S1AB 3WP1B 1SVSA 4FWIB 4WIAA 2PX0A 1SVIA 4I1VA 3U7EB 5A0FA 2WJGA 4V0ME 1HUQA 4A92A 2OCPA 2V9PA 1R5BA 2C04A 2WWXA 4QJ5A 5GJWC 3TIFA 2CE7A 3GJ5A 1II8B 3QBVA 3SDZA 5HR5A 1RPZA 4TMWA 2FSFA 2KB0A 2FSHA 4I99A 4RCYA 5AR1A 4HI0E 1RFLA 1KY3A 1S9DA 4Z8YA 4Q1CA 2Q9CA 2PH1A 4DT1B 2FJUA 3B9PA 3PIRA 3VKGA 3AGQA 1E1QD 4Q1EA 5DN6A 4AKIA 3QKSA 1Z29A 1ZYUA 1X86B 4WXPA 4R98A 2G88A 1DAGA 2ODWA 4AK9A 4C2UA 4QHYA 3X1WA 2VHJA 4URWR 3CLVA 3I73A 3I62A 5EUQB 3B78A 5FPHA 2CEAA 1GNPA 3QBTA 1SXJE 3K0CA 5KDDA 3R8CA 1QHYA 1NN0A 4Q7KA 5FUVA 4BLOA 2QROA 5HZHA 1G7CA 1J8MF 2ZAMA 1E2IA 4GFDA 1YZUA 2ZI3A 1H8HA 1N5KA 3AP2A 1E94E 3EA5A 2PT5A 3B1ZA 4OI2A 1RYHA 3GFOA 2HEIA 4AI6A 3QG5A 1K5DA 1M7GA 1AK2A 3PXGA 2QE7D 3EIEA 2DPXA 5AJWA 2AFIE 1UDWA 1XTRA 3VMFA 2WHXA 4BFUA 4IEEA 3GLHB 5DE3A 1N2CE 1IONA 2RKOA 3B6EA 1X1RA 4L8GA 1I4TD 1YQTA 2WSSA 2IXEA 3NH9A 4Q19A 3LBIA 2ZPTX 2WPDD 4XTRA 2ZRIA 4ZIRB 4JLPA 2A9KA 1HE1C 4JLAA 2OCYC 4WZAE 2BBTA 2HDNB 1WB9A 5KSOA 4ZCIA 1G6HA 1GSIA 3CF6R 1MRNA 5LD2C 3HU3A 2CCKA 2EFHB 3REFA 1KK3A 4DCNA 1YZNA 3LW8A 1N6HA 1ZRHA 2OZEA 2R65A 4MITA 2QM8A 3TVDA 1ZD9A 3SJZA 2E9SA 1E9DA 1E1RD 3IHWA 3QG1A 4KLZA 4MKGA 4NONA 4CVNA 2GZHA 1OFUX 3GLFA 4M1YA 5G40A 2GEVA 4D4JA 5JSZB 4WXRA 4HLQB 5DYGA 3RNLA 4DC9A 5JS8A 3DO6A 3TAHA 6Q21A 5HKKA 1QHIA 3OEHD 3OEED 4FI3C 1AGRA 2CK3D 1JAHA 3LDAA 1E2NA 3UXMA 2IYWA 3KQLA 4N0DA 4KV9A 4PSKA 2JJ2A 1Z0FA 2IEZA 1JR3A 3TQFA 1RYFA 2VHTA 4JBWA 5D3QA 3K09A 2WM9B 5KDOA 3QPWA 1LW7A 4RFVA 1W36C 3QJYA 4Q1AA 1T9HA 1XEWY 2AX4A 3K0AB 1TTTA 3K0CC 2HF9A 1GP2A 3QXXA 2VHUA 4W9MC 2FU5C 1IN5A 2BEKA 1II9A 4NBSA 4BRUA 1Q1BA 1DE0A 4ZCMA 1ZNYA 1PV4A 4FN5A 2ZRCA 1X1SA 4KU4A 4WBSA 2FPLA 1E2FA 4A1FA 3ECCA 1RRCA 2D2EA 1BYUA 3NC1C 1R0XA 5CM9C 5LD2B 1ETUA 1U90A 1G41A 4A8JA 4CZ2A 1AKYA 4DDWA 1TF2A 3LNCA 2O0KA 4P32A 4JKYA 1WBBA 1NY5A 1C4OA 2O8EA 1XD8A 3R8FA 2ZJ5A 2W58A 2ZITA 3DL0A 1KI8A 3VQTA 3I61A 3TW8B 4MKFA 3NTUA 2BM1A 4Q4AB 3TLXA 1XU4A 4NYIR 1YZTA 3SYKA 2BBSA 1DAKA 4HATA 3UATA 4PHTA 2CVHA 4TLCA 5FPYA 2WAXA 4IVRA 4BZXA 3NBZC 1WA5A 4NCNA 1TAGA 3K53A 1C1YA 3PUXA 4K8OA 4DKXA 5JEEA 3E1SA 2FNAA 4XD7A 4RZ3A 1ZD8A 5H70A 3EZ7A 1E1QA 4B44A 2C99A 1W48A 5TB5A 4L16A 2GESA 3QKSB 4HAYA 1SHKA 3U7HB 4D0LB 5LDDC 4E09A 2QRNA 2VIIA 4Q7MB 4LV8B 1YHNA 1E9EA 2C95A 1W36B 3SBEA 2CL0X 3KB1A 3U6BA 3H0KA 4D25A 3KZ1E 4B48A 4CEHA 4C2TA 4M9QA 2LKDA 3F5FA 5J4HA 2DWQA 4IOJA 1TU4A 3QKTA 3AVWA 1P6XA 4HZUB 1PLKA 2A5GA 4AY2A 2GJ9A 4JSYA 4B47A 3O8BA 4PSVA 4LSGA 2O8CA 1S1CA 4EFMA 1MKYA 1XRJA 2IHBA 1XD2B 3P26A 2OO7A 2C9OA 2DHRA 2J0VA 4EFLA 2XZLA 4QM7A 1ZNWA 3DZDA 2QE7A 3B13B 2EYUA 2WV9A 2QQ0A 4P3YA 4C0LA 1R8QA 2CLDX 2ZJYA 3ND9A 4W5HA 2C2HA 2ONKA 3B82A 3LXXA 3LX5A 8OHMA 3EWSA 1QG2A 3C4JA 4PO8A 4TWZA 3THWA 3AVXA 1XDBA 1M74A 3CWZA 1US8B 5JLJA 1QVRA 2WPDA 2DYKA 2NO6A 1Q1ZA 1TQ2A 3D3QA 3IIKA 2IUTA 3CR7A 3P4XA 5FL3A 2HXYA 2V7QD 3IO5A 2X8AA 3IILA 4N3NA 4Q18A 1Z6XA 3LD9A 3QF4A 4DDVA 3W3AA 3FFAA 5FBLB 1Z0KA 1FX0B 3NBYC 3ZZUA 3QVVA 3K70D 1T6NA 2IYYA 2NO7A 1EFUA 2D06A 2O8DA 4TMTA 3NG1A 1V5WA 1G8HA 2R6FA 4OK3A 3VAAA 1F2TA 1H65A 1GL7A 1E1RA 2V1XA 3WY9A 1SVKA 4WZ6A 2V6JA 2GRJA 4AD8A 2FDCA 3GLFB 1IBRA 3WNBA 5JJKA 4FCWA 3CIOA 4ZDKA 1Q44A 3OEHA 3OEEA 1ZJ6A 2CK3A 3JZMA 4G01B 2G1KA 2OBMA 2SHKA 1BS1A 2OFXA 2QAJA 4Y0VA 3V4FA 2WWFA 1U9IC 1FUKA 4ESVA 1KY2A 4TYQA 2ODNA 4M1TA 4YONB 2H57A 2OILA 1S3GA 5FUWA 3EZ6A 1R4AA 1GL9B 1GKYA 3T34A 5BQ5A 4XTCS 3AVVA 1HYQA 4M2LA 2YOHA 4L9WA 1XJQA 5KNDA 3BGWA 1XX6A 1R10A 1QHHA 3BFVA 5IRCD 5JWOA 4R9UC 4BGDA 3ASZA 1F2UA 1UDXA 4ARZB 5CYOA 1VG8A 2L0XA 1N6PA 2QAGA 4J0QA 4D0GA 1OLOA 5EZ6B 1GM5A 1OFHA 2GJKA 2G6BA 2OM2A 2B21A 3RVBA 4F93B 3MAAC 4TTRA 4PQYA 2X19A 2HLDD 1Z0JA 1G17A 4JJKA 4IDQA 1XEXA 2QY9A 4LYAA 1FP7A 4QXAA 4EFNA 1LTQA 4FW9A 4NCKA 2Y8EA 3SZRA 3SFZA 4B2PA 4JT4A 2ZRDA 4TL9A 4A9AA 5L3QB 4M21A 1G8PA 5TDHA 1XCMA 4Z1MD 4RKFA 2J87A 3CNNA 2Z6VA 3PUWA 1OKKD 3MWKA 2PEZA 4IW3B 3B1WA 1GFIA 4MGIR 4YMSA 1CR1A 1MO4A 2PBRA 1N6NA 3QEOA 3FE2A 3R7WA 4KITB 1R8SA 4V0OA 4F91B 2G0NA 4M9XA 3SHWA 4YMTA 1JQLB 1NP6A 4OK5A 4QL3A 1KNXA 2MSEB 1TX4B 2W2VA 4TZ6A 2IYSA 4HUQA 5LPNA 3BXZA 3DKVA 4US0R 4DLUA 5KOYA 1D8TA 2GXQA 5CK5A 4C0JA 3U3JA 1X3SA 4GMDA 4L15A 1V43A 3AQ4A 3QKRB 4GZLA 1E4YA 4QJ4A 1J99A 4DBLC 2FSGA 4GP6A 4EAQA 1W49A 2ZVQX 1NG1A 2Z4SA 1CULC 1SVWA 2OLJA 2ASEA 2C9YA 2R6GA 2N46A 2ZRLA 3GCGA 3J81k 3UG7A 2ZI7A 5K8UA 1TNDA 4HB4A 5IF9A 1R5OA 3VKWA 4A2QA 4CYMA 2YC4C 4Q9HA 2FGJA 2IYXA 3ICEA 2GCPA 3I1FA 1XB2A 2GVZC 3QIAA 3A1UA 3KKPA 2BIFA 1XTKA 3DM9B 2AXPA 1TUEA 3ZIAA 5CIQA 2VH5R 5EP1A 5TVKA 4AYWA 1G4AE 2CNWD 3A4MA 2QT0A 2BBOA 2PLFA 1RRGA 2ERXA 2ORVA 2GVDC 3W3ZB 2ZE5A 4XSHA 4I1UA 2ZRNA 2BV3A 1ZD1A 4HLCA 3SJCA 4PC6A 4HLDA 1Z6AA 4C0BA 2AD1A 3U3RA 4RD2A 1L2TA 5FUYA 2V7QA 2ZU0C 3I92A 4R2IA 1Y3AA 3MJHA 1D2NA 3BOSA 1N6RA 2F1JA 3IQWA 4QNMA 5AJXA 4LYHA 1FFHA 1UKVY 3OESA 1XPOA 2FA9A 1G7TA 1Q22A 3EPKA 2GZAA 2Q3MA 3WYGA 4MRSA 5TARA 3ZGXA 3V00A 4FMDB 4IJMA 3C5CA 4BFVA 5JHHB 2WMNB 2FPMA 1AIPA 1S0UA 4OBEA 3LAWA 1S3SA 1GRQA 2WKRA 2VQSA 4Y0AA 3WMGA 1M6NA 2WVJA 3EPHA 3LVRE 5JWRA 3KDSE 5ANRB 4OHYA 1ZVQA 5EXPA 1T8TA 1D6JA 2W2TA 5JI3E 1TL7C 4WW0A 2IW3A 2OEPA 2BMDA 4GOJA 1N0UA 1FMLA 3SQXA 1ZW6A 1XMJA 2WWIA 4PZZA 4K81B 1QBKC 2IUSA 2ZI5A 1JR6A 2FF7A 3SU8A 1RJ9A 2ZYTX 4QM6A 2GBLA 3N2EA 1ZAKA 3TUZC 4XSGA 4LYFA 3C8UA 1QZXA 1NL3A 3WHLA 1UFQA 4BECA 1WE2A 1RRFA 3ZQJA 3ASYA 1LY1A 2PJZA 2ZRMA 2JLQA 3H84A 2HLDA 5DIFA 3B60A 3U3MA 4FCTA 1ZM3A 2DY1A 4MYUA 2JLSA 3K1JA 1AQUA 2WIBA 5J47A 4ITRC 1COWD 4KFSA 2ZS9A 2IBMA 1D5CA 1OXVA 4Z1MA 2O8BB 1ZNXA 4OHZA 5H8WA 2JIZD 3GJ3A 1OKKA 4JJZA 5F98A 2J7PD 5HPYB 1EGAA 2QPAA 4U5XA 3WMEA 4BASA 1FPMA 1KAOA 3EZFA 4LHXA 1W5SA 2OCAA 3IEUA 1L7VC 4PTLA 1AKEA 1M7HA 4JT2A 3ZVNA 2EVWX 4DLRA 1XXHE 4IKEA 1QHGA 4C30A 4A2WA 4GT1A 4DSTA 4GOKA 3CPHA 5EP2A 3K9LA 2CHQA 3FVQA 1A7JA 1W7AA 5FFMA 2P6NA 2MSCB 1E2DA 2QMUA 5JS7A 1AA9A 4NYJR 3ADBA 5FOTA 1P7CA 2IK8A 4G5OA 4AYTA 1KAGA 4EIWA 3TMKA 4CEJA 2WICA 1ZMXA 4U7DA 4S2EA 3HDTA 3RS7A 2WZQA 5EP3A 4QGGA 4U02A 2DR3A 1OE0A 1F3OA 3A4LA 2KJQA 3UIEA 2BBWA 3OAAD 3P4YA 3FHTA 2Z5FA 2HJGA 4B3BA 1BO6A 2P2LA 3EC2A 3I32A 1EWQA 1FZQA 3OZXA 2ZANA 4FIDA 4DEXA 2J1LA 5DGXA 2QGZA 3REGA 1R0YA 1Z0DA 3SHFA 2F3RA 3WNDA 4ASUD 2XTMA 3KKQA 3K0FA 4KFUA 2BMJA 2AR7A 2GWHA 1U8AA 3C5HA 3AUYA 2HT1A 2WJIA 4LI0A 2JDID 3IUYA 3D8BA 1I4LD 3PJRA 1XPRA 4AKGA 2ODEA 4LPKA 4LHVA 5FL7D 1NN5A 2DFNA 4FINA 3R9IA 3VR1A 2R8RA 4URZR 4F4JA 2QENA 3PUVA 1E9AA 2J7KA 1L4UA 1IAQA 1E0JA 1Y63A 1MOZA 4XWAA 1W1WA 2XJ4A 4BEJA 4QG7A 3MCAA 4IXMA 1KJZA 1Z28A 2ZRJA 5FPTA 4EJSC 4Z51A 1KK1A 5IK2D 4KI0A 4US2R 4B3CA 4LJ9A 2ZJBA 4MRNA 4P0TA 3ZVLA 3A8TA 5KPJA 1ZU4A 2PMDA 2V55B 2JASA 3HYRA 4YMWA 5TV2A 3I8SA 4O2RA 1OV4A 1DPFA 4PZLA 2VF8A 3FGNA 2OHFA 5EE5B 4BLPA 5KNBA 3C14C 3RC8A 3BB4A 4QNRA 2NQ2C 4B2IA 2FFBA 2GCOA 4AKEA 5FR2A 1FW6A 5FOWA 1VTKA 1TEVA 1ESNA 4QGHA 3CNLA 5CM8B 2FX3A 3SYNA 4DIDA 4G1UC 3VU9B 4ZI2A 2C8VA 1EX6A 3W6PA 1UKZA 4MKIA 1M2OB 1E0AA 3E5HA 4DCVA 2JJ1D 1TF5A 4PSAA 4Q5IA 5K8IA 4R71A 1G5PA 2R62A 4O3MA 3CBQA 1OIVA 2FH5B 2HCBA 3EG5A 4D0NA 1KZ7B 4LK2A 4M9SA 1GG2A 5FOSA 4QBIA 3NEJA 2E1RA 2IYVA 2QMHA 3M4YA 4QBGB 1Q1QA 1JR3D 1G5TA 3THXA 1VKJA 5F3WB 5FOXA 2JLYA 1DO2A 4HDOB 4CT4B 5J40A 5DSZA 1M1YE 2XITA 4RD6A 1R0WA 1G9XA 3VNUA 1Q1EA 1LVGA 1GRRA 4LBWA 3ETLA 4CEIA 5LB2A 2IC5A 1AGPA 1JALA 2OT3B 4WA7A 4XVRA 2F55A 4D26A 1COWA 2J0SA 3ZYCA 1E98A 4EJSB 2RGNC 3ADCA 1NLZA 2IT1A 4TL8A 1DTSA 2CVFA 2JIZA 2XTZA 2J7PA 4ZKEA 3TH5A 4A2PA 4YMUA 2XAUA 2RHMA 3TR0A 2RGCA 4M9ZA 1OT3A 3H1TA 3O8RA 1NY6A 5KO2A 4A82A 3NBFA 2WJYA 1MT0A 2OUKA 3IPYA 3EW9A 1PZNA 3Q5EA 1WQ1R 1GNRA 4LBYA 5IHPA 4NKRA 4PC1A 1QDEA 1F48A 2WJJA 2ZAOA 5BYJA 5BYKA 1PUJA 3TUJC 2YINC 2AFHE 3BAFA 3GEIA 3A6PC 1HURA 2PCJA 1KGDA 1JNYA 1SVMA 1OIWA 521PA 3PV0A 3AVUA 4YLGA 3SR0A 421PA 3AF1A 621PA 1VG0B 3UPUA 4XD7D 3GJ7A 4MYHA 1D2MA 1JEEA 4HAZA 4MYTA 2XEXA 4UNRA 4KODA 1KTVA 4MGKR 1VHLA 2ZROA 1R7RA 3SJAA 5JCPA 3FMFA 1CS4C 3OAAA 1HT2E 2O0HA 2CDNA 4QOSA 3DKPA 1XTJA 4WVFA 1QF9A 1OFTA 1IY1A 4OQNA 3I5YA 2REOA 1KI7A 4OI0A 1KK2A 3EPLA 4WZBE 4FMCB 1HH4A 4ASUA 4AURA 4RD4A 1KKMA 2RAPA 5EE3A 4MQBA 4XVQA 4Q4HB 1ZIPA 2JDIA 3X1YA 4PANA 4BEBA 2HV8A 2OE2A 1N5LA 3LVQE 3IHLA 1NIPA 3RS5A 2J46A 3AF2A 5FL7A 2CE2X 4TMKA 4UXIA 1ZUHA 1CIPA 4HAUA 1EG7A 5JRZA 5BN3A 1PUIA 3RYTC 5JZVA 1KJYA 2ZRKA 2IYTA 3BH7A 3BORA 3ONWA 3CF0A 3B8HA 2GTPA 4E07A 1YZQA 2QMOA 5IK2A 2F43A 2FN4A 1KMHA 4EQ6A 2VSXA 4NP6A 4G5QA 4PZYA 2VP4A 1SKYE 2BVNA 3KTAA 1OB5A 2D7CA 2Z0MA 3KJIA 3WBKA 5HZKA 4X8LA 3AH8A 1B0UA 2HUPA 3GMTA 3VHLB 1ZCAA 4M53A 2ZUBA 3A1TA 3O47A 1XPUA 2GCOB 4LUCA 4RSGA 1WXQA 4TSFD 4B32A 3IGFA 3K0SA 1IY0A 3ZD6A 1Z5ZA 4HLUA 3ZD7A 2BKUA 1VCNA 3B7GA 4RJLA 1YZLA 5CITA 1XEFA 3MWJA 4MUBA 2PZFA 4DJTA 2JJ1A 2YV5A 3I4LA 4XVUA 2QL6A 5KSZA 1SULA 1TQ6A 2VLIA 1NRJB 4KSBA 1E9BA 3GJ4A 1WP9A 4LRWA 1OH7A 2VSFA 1AZSC 4EUNA 1T0HB 1G7RA 2DBYA 4C0AC 2KE5A 1KDTA 3LRPA 3KKMA 4LHWA 3T06B 5JI2E 5L3SA 5DHFA 3QPUA 5B64A 1UAAA 1VECA 3GLGE 2AWNA 2Q3HA 3L0PA 4LHZA 1ONBA 2CHGA 1XXHA 3SEAA 1SVOA 3L0IB 2ODBA 1T3HA 3BRWD 4DVGA 3N2IA 5CDFE 1A82A 3MGCA 1WBDA 3CH5A 4JYBA 1OB2A 3G5UA 1VCOA 2YNMA 1YR7A 3QENA 3LV8A 2O52A 4YQFA 1JBKA 1N5IA 1VG9B 4OI4A 3HPQA 4TL7A 2ZE8A 3L82B 2F3TA 1KI3A 4HB2A 1OH5A 4WOPA 1W4RA 1IXRC 3X1ZA 3GLIA 4AKHA 2VRWA 3U7GA 1FOEB 4BQSA 2KBFA 1G7SA 2D7DA 5EE9A 1JI0A 2BKEA 4NTZA 2VHCA 4TMXA 4D6PA 1RC8A 1ZBDA 2ZQ5A 3JZAA 1UBEA 3CB4A 2ATVA 4IDOA 2HF8A 2ZSDA 3A4NA 4JVLA 4B6EA 1SXJD 5DHAA 2QM7A 2J5XA 221PA 1KSJA 3CX6A 3U5ZB 4FWTA 2G83A 1GKIA 2R6DA 3QOFA 4KLNA 4D4LA 1FNNA 1RKBA 3D6TB 4LJ6A 3MFYA 2F1HA 2Z43A 1RRPA 2QPOA 3FOZA 1DARA 1IJFA 1MR3F 1KSFX 3CZQA 4IRUB 4TTQA 1RVDA 1EK0A 5JFGA 2VL7A 2OFWA 4F4CA 1E2GA 3QXHA 4HDCA 2W6ID 4M1SA 2VBCA 5EUMA 5KHOC 4XIGS 2B8TA 1IHUA 1FNMA 2ZTSA 3W8RA 2Q9AA 1J2JA 4DLSA 3THYA 4KVGA 2AWOA 3MJRA 3NHAA 1NF3A 4RD3A 1XF9A 1G5RA 1GL6A 4KVAA 4HAVA 1Z6TA 1DEKA 2XX3A 3NEYA 3FHCB 1N0VC 1K6MA 4P4UA 3K09C 3ND8A 1NBME 3ZIAD 3F3YA 2ZRHA 3AVTA 3TKLA 4ZPXA 3UANA 3NDBB 1Z63A 3BH6A 4KJZA 2H7VA 3OIYA 5HE9A 1KMQA 4NCHA 1CR0A 4IVPA 1KOFA 2FSIA 4S35A 2W0SA 5DH9A 3GP8A 1EESA 4IDNA 3HU2A 2CBZA 2WJHA 2F43B 3NVAA 3UWKA 1TUIA 3QSYA 3TE6A 1E2KA 2R6AA 3A1WA 3KFVA 2XXAA 3TNFA 2YKGA 2OV2A 3KXLA 2A3RA 1OXXK 2FWRA 1MABA 3PUYA 4X8MA 3PUZA 4E22A 2ZJOA 4UJ3A 5TXGA 3HR7A 4UNQA 4A8JC 3HJNA 2ZI4A 2IS6A 3BS4A 4TSFA 3Q7PA 1K8RA 5IT5A 1G291 3C7KA 4RVCA 4BZPA 4TYNA 1U99A 1GIAA 2GK7A 3CRQA 4QJ3A 4UXHA 3PEVA 4DB4A 1IN7A 4D2IA 1P61B 5F9FA 1JXMA 1E32A 1G64A 4BFZA 2XZPA 2ZSBA 3TVTA 3CR8A 2Q3FA 3W5JA 2EWWA 1OIXA 1YZKA 1A2BA 1IQPA 1NJFA 4ACAA 4JVMA 2N42A 4G3XA 1FQJA 2LCFA 4Q7LA 3VTKA 4U00A 3BJIC 3DM5A 4CDGA 3ZQ6A 1EFRD 3QKUA 4ZO4A 2OLKA 4Q4JA 2PZEA 2QT1A 4LC0A 4DDUA 4V0MA 1NMYA 1S9HA 4JSTA 4MGZR 2F9LA 3U3OA 3I3SR 3MG9A 3EZ9A 1J90A 3GLHE 2DFTA 3HYTA 5EE0A 4JKIA 121PA 2ZI6A 3U3KA 2QU8A 2PX3A 1DADA 1XCPA 2VP6A 4LHYA 1QHNA 4JBYA 3NC0C 3VR5A 2NMVA 1ZC4A 5FTMA 1KHTA 1E2JA 2IEYA 2NZJA 3ICQB 4I1OA 2QORA 3U44A 1YRAA 3KUCA 4A8JB 4CIDA 3GFTA 1ZM7A 3P20A 1YKSA 2JLRA 5A4JA 2AL7A 4ON9A 1D9XA 2O8EB 1B23P 5KSPA 1CRQA 1PVOA 1GWNA 2YHSA 4Q48A 3B1VA 2JJ8A 1DG3A 4HYYA 4OYHA 4UQOA 3SFVA 1UBFA 2G77B 1SKQA 1UBCA 2OSBA 2WIAA 2WOJA 3EARA 2QTHA 1SXJA 4FMDF 3G0HA 4ERNA 3LO5A 3W34A 4D82A 2RGEA 1CJMA 2XB4A 1U98A 4JL8A 1Z08A 3ZZTA 5EP4A 4Q00A 2JLWA 1W0KD 2YWHA 3QUSA 3WBJA 3T15A 1HA3A 2DWOA 2IWHA 5FBVB 2J59A 4DHEA 2DFLA 4TYPA 3U4QA 3GFPA 3ZH9B 3TSZA 3QQ5A 3SQWA 1EFHA 4NYMQ 5E3HA 4GI7A 2W6IA 1CBUA 1E2LA 3VX4A 1YRBA 4II7A 2PMKA 1JPJA 4CEHB 4B74A 2FGKA 5KDLA 1OPXA 3R9WA 1P60A 3CNOA 3DPUA 2GEDA 2W83A 4QGFA 1WRBA 2KSQA 3ADKA 3PFIA 5SZKB 5AWFC 3DDCA 3EZ2A 3BFXA 1W2HA 3LBHA 2VEDA 3IIMA 3OF5A 3DZ8A 2O8CB 3B5JA 2H5EA 1P3JA 4JLOA 4B34A 5UKDA 2XZOA 3RHFA 4IVQA 1W2GA 3RANA 1Z6GA 2GXAA 1G3QA 1OXUA 2JLZA 3AVQA 4B2LA 5KU1A 2O8FB 1XZQA 2VSOA 1N6KA 3DMDA 3THWB 2PJRA 2WWHA 3LBNA 4DLZA 1M7BA 3EC1A 1XNJA 3C16C 2GNOA 2OXCA 3GEHA 3QEJA 4JLJA 4NZYA 4IHQA 2QAGC 4BWYA 4RKEA 2OCBA 3B9QA 1R6BX 3EASA 1X8LA 2ZI9A 4DLXA 2GA8A 3KJHA 4DSOA 4DUGD 2ZIAA 4IFBA 2ZUCA 3QF4B 3MLEA 3AKCA 4BFSA 4ZI3A 5J4KA 1RW4A 1XD9A 3N70A 4DDTA 3OE7D 2O8DB 1XJ0A 4YDHB 4PHFA 4RY2A 1P2VA 1G4UR 2XB2A 5JECA 1QHSA 4KXFB 1F2TB 1Q12A 1NN1A 1CJUC 1P75A 1XMVA 2QUZA 3RRMA 3VR4A 1CRPA 2GK6A 1TPZA 3GLGA 1Z22A 2J0UA 3BERA 1LS6A 1VG1A 3EA0A 2F7SA 5KPDA 4QC2A 2WMOB 5AJZA 5FH9A 5KTYA 1N0WA 2NOAA 3SN6A 1CTQA 4UKDA 4M1MA 5CDFA 4MRRA 5JBQA 1OH8A 3A58B 3CW2A 4LJ8A 3RDPA 3T5DA 3MSXA 4HAXA 2QP3A 1LF5A 2CJWA 3FB4A 3Q72A 2BJVA 2IL1A 4US1R 5F2EA 3K8YA 5J4VA 5L8VA 1KI9A 2Q21A 1W4AA 1EFRA 2OESA 3KKNA 5J4YA 2OBLA 1R5NA 2EFGA 2GF0A 3CUEF 4HEJA 4PX9A 4V0NA 1MV5A 4Q4JB 4RD1A 1I4DD 2ZS8A 4TTPA 4ESHA 2EQBA 1M34E 2QPTA 3MRSA 4NH0A 1QHHB 2IYUA 4B35A 4BLQA 3U7FB 2XGJA 4BE7B 2RGAA 3BC1A 4KYIB 1F2UB 3RSLA 2RGBA 4P4SA 4D81A 1X8KA 3CX8A 2ZJ2A 2QAGB 4BLSA 3LQRA 2I1QA 3VNVA 5FPSA 1ZM9A 1CR4A 3EAQA 4TN1A 3EIQA 2X2EA 2HYDA 4Q9KA 2G0TA 2G1JA 2C78A 1JAIA 5D3MA 1XBTA 1XEXB 3KB2A 1P2TA 3L8ZA 2WWWA 5FR1A 3T35A 4TQAA 4B3GA 1E6CA 1LF0A 4PFSA 3CRVA 1VYVA 1Z06A 1E99A 3CH4B 1KI6A 2UZIR 3E2IA 4LJ7A 2VF7A 3T5GA 2WJVA 3LXRA 2XNSA 4OHXA 2WAYA 2WOOA 3T12A 1QRAA 3R7WB 4GMXA 3SBDA 2BM0A 2H8KA 1FMJA 2WWGA 1LS1A 1NVWQ 2QA5A 1H8EA 4LV6A 3GLFE 1W0KA 5C1BA 3K70C 1Q0UA 1UF9A 2CL6X 3DEFA 4HUQB 2B6HA 3V4RA 2IYLD 2H16A 4PC7A 4KCGA 3U4QB 1IY2A 4TZ0A 4DLVA 2XSZD 2KI5A 4C0QC 4GZMA 2IF2A 1XP8A 3M0EA 3FKSD 4A0GA 2RB4A 1NKTA 2VP2A 2CMKA 4MA4A 3Q5DA 3THOA 1CJTC 1P5ZB 1MH1A 3S1AA 2GF9A 4RCZA 1UEJA 3SC3A 2EYQA 5EZ5A 3QPVA 1K5GA 1KYIA 1VIYA 4A4DA 1LNZA 5C2JB 3PEWA 4HAWA 1JJVA 2GETA 4TT3D 4Q21A 3SS8A 2P6RA 4Q47A 2W0MA 2ZYVX 3UK6A 3TSWA 1QG4A 2FFQA 1OYYA 1Z47A 4JLDA 4NE2A 2AN9A 4JS0A 1NNEA 1UPTA 1C9KA 2LKCA 2ANBA 4DLWA 4I1SA 5BXQC 1Q21A 5FTNA 3JVVA 4DT1A 2FZ4A 1JJ7A 1E4VA 2GBLC 4FXPA 4OQFA 2EFEB 1XJCA 2IHYA 2ZJ8A 1NLFA 1OHHD 2IYRA 2ZR0A 3D31A 4RD0A 5BN5A 1DAHA 3NIBA 4C0KA 4MDFA 3IIJA 2IWRA 4MGYR 4DUGA 5C4MA 2YWFA 4PC3A 2LWIA 3CWQA 4HZIA 1D9ZA 1GVNB 2V3CC 4KBGA 3K70B 2NO9A 1NSFA 3FHOA 3RLFA 5CK4A 2QTVB 2YWGA 3OE7A 3QE0A 4NHOA 1ANKA 1PJRA 3AF3A 3NBXX 4EKDA 3AF0A 1XTIA 1HEIA 3FPAA 1T4GA 1T3LA 1NVVQ 4KYUA 2JLXA 2WBLC 2ORWA 3ADDA 1CP2A 4XWKA 5K8TA 4YXWA 5FBQB 2UKDA 5DISB 5GVSA 4JL6A 1YVDA 2REXB 4GOXA 4F92B 5JCZA 1FTNA 2RCNA 5L3RA 1JPNA 2Q9BA 2VPPA 4OJQA 5GJBA 3GLHA 2VA8A 1EFTA 5AK0A 4QHTA 3T1QA 5F9HA 1X6VA 2R2AA 1HV8A 3TK1A 2GEUA 4QBFA 1UJ2A 3L43A 1S4QA 1T91A 1YJ5A 3AP1A 3GEEA 1BIFA 4ZIRA 2YVUA 4UJ5A 4ZDWA 3FMOB 1G19A 3QF7A 1Q57A 2CL7X 2F6RA 4M1WA 1E79D 2H1LA 4BZQA 4I4LA 1Z3IX 1RJ9B 2VHQA 3KKOA 3ZDQA 1GITA 2IYQA 4MRPA 1DS6A 3VFDA 3ZLJA 4BFXA 3VR6A 3I72A 2ECKA 4H1VA 2IA5A 1I2MA 2YYZA 1R2QA 4XOIA 3GD7A 4ABYA 3KJEA 3MUFA 1JXOA 2CLCX 4ZV4A 4PXAA 4QHSA 2NTYC 5JSZA 5AJVB 4C4PA 3FMPB 1W5TA 5HTKA 5DI3A 4XH9B 2W6JD 4LZZA 4M0LA 4OK6A 2XNDD 1T0JB 4LWZA 1OXSC 1DAIA 3D7MA 3E70C 3CZPA 4Q01A 2FZLA 1MO6A 4L4UA 4URXR 1XTSA 2R44A 4R7ZA 5CJ2A 3RC3A 1KO4A 3P1JA 1YR6A 4AIIA 3K0AA 2BHRA 4URUR 5JRJA 4B3FX 3L0OA 2A5YB 3MD0A 1CEEA 1N25A 1T5LA 2ZETA 3LLUA 4GP7A 5JWHA 5FBRB 4H1UA 2XSZA 2V54A 1EX7A 3F8TA 5TMPA 2P6UA 3U2QA 5E7IA 1TMKA 2IXFA 2BWJA 2J9RA 3GQBA 4LCBA 3FKSA 2EW1A 3VX3A 2ZR9A 1UKYA 3A37A 5DLQC 3ZJYA 4W5JA 3RWMB 5AUOB 1JQJC 4CEJB 2GXSA 2K5UA 3NH6A 4G5RA 4C7OA 5FTLA 1PLLA 2NG1A 5SZJA 2D4HA 2A30A 3L0SA 1GKUB 1S8FA 4TT3A 4QKQA 2GAOA 3W9YA 2GXUA 4Q4AA 3BB1A 4PQRA 3KQHA 2FEOA 3KQNA 4B33A 3AP3A 1P2SA 4M4SA 1DG1G 3GJ8A 3QVUA 2WSMA 4UXJA 3AKDA 4ZKDA 3K0FB 5DNYB 2FV8A 5EXTA 2VO1A 1G1MA 2KBEA 3F0TA
chains in the Genus database with same CATH superfamily
1CUEA 1MO3A 2NU8A 4WLNA 1OHHA 2HC9A 2GF2A 3VO8A 3E9QA 3B85A 2DBQA 1SO8A 3HJBA 3AJDA 4CM8A 1BEZA 3KFLA 4IILA 4G1MB 4RK5A 1YOBA 3TMAA 2PKRA 2P4QA 4PN3A 3SK0A 1KJQA 3HV0A 4TRRA 2JGLA 4MUFA 2EV9A 5A05A 1RMYA 2JLBA 3UMGA 1Y3IA 1YCHA 1YI1A 5DYTA 2WKPA 3RKRA 1N2OA 2O8FA 2WD9A 3HBJA 3DMPA 1Y1LA 4TMZA 3HHEA 1II0A 4NZOA 4IHJB 5GZ3A 1TJYA 3R23A 1N3YA 3R7NA 5IKEA 2D1FA 1V26A 2UU9B 1N78A 3GMDA 5DXAA 2MSLA 2GPNA 1WXWA 3NBUA 5H4HA 3MQFA 3RQIA 4F8YA 5AVQA 1CUDA 2P9ZA 3BL6A 3KX2A 3F6BX 4C5BA 1XD2A 2V4ZA 1DUSA 4A8HA 4BWFB 3FYHA 3K8QA 2HQOA 1TEXA 5LZ8A 1VCMA 5I9MA 1QFXA 5KYUA 1TT5B 3L8CA 1JB9A 3QWHA 2BP7B 3OWXA 4TVOA 1AKVA 1U63A 4MKXA 1AV7A 3EWNA 3PQDA 5EXXA 3G0BA 1FRNA 3FZEA 1OILA 4AZ0B 3EXEB 4B1FA 3WYFA 1FXWA 4EMUA 1US8A 1OGYA 1LJ8A 2X1VA 2O2CA 2UVQA 1DCTA 1ESEA 1GNQA 4K9KA 3FOBA 1MNAA 4ILEA 3KJGA 5HE8A 4D9FA 5GADl 4QOFA 2UZ3A 1V8PA 2DMRA 4A6XA 3WRXA 4NG4A 2FEMA 1FX0A 5TT0A 5FWXB 1BCRA 5JIBA 3TX2A 3GF4A 1KSGA 3N0VA 1MO5A 3G7UA 4ICIA 2JB9A 2NO5A 1G16A 1Z6ZA 1BQ4A 1JN0A 2WKQA 1QXSA 4O08A 5BV0A 3A26A 1R74A 5L6MB 4M86A 1WDTA 2ATEA 2NGRA 3IP9A 1E0DA 1M2WA 3KL4A 4GBMA 3S81A 5BN4A 1FEZA 4UOQA 5CLLA 3FKQA 2OXIA 3PGMA 2C77A 1NI3A 1S89A 4CLOB 2IF0A 1V11A 2NW6A 1SKUA 3QEBZ 2CT8A 1O1YA 2OHIA 4CEIB 1QIIA 2QBYA 2UYOA 1ONSA 1NVUQ 4J7UA 2WT8A 3ZDDA 1B0AA 2HJVA 2XNDA 3VDRA 5LZ9A 2IX3A 1OWPA 2MINB 3KL2A 3FFXA 1PCXA 4PLHA 2Y92A 1D4AA 1EUDB 4IZ6A 1ELOA 2NYAA 1L5SA 4LY6A 4Q39A 2IVZA 4S3MA 3OPVA 4H9GA 4LJAA 5EZYF 1SQ0A 1FUUA 2EKBA 4IUBS 1QORA 3HR8A 5JATA 1GTSA 2Q4EA 4M37A 3QX3A 3S1SA 2GYYA 1PK8A 4B6JA 1RJWA 4IO0A 1L5ZA 4DLTA 5BV7A 3EBPA 4UHDA 5FHRA 4OI1A 1M2KA 3VAZA 1Z4PX 3GGOA 2CJFA 1O6ZA 4JI4B 3KXIA 1W44A 3PEYA 2VYFA 3C41J 4A3SA 3OBIA 2WAMA 1MB9A 4Z7NB 1J70A 1VDZA 1M73E 3NS7A 3BE4A 4KDCA 4M9RA 4XPIB 2QG4A 2D3WA 3VKVA 4D96A 4F04A 4RANA 4XGKA 3I6ZA 4N0QA 2YC2C 1MGOA 2PSFA 1JMYA 2OGZA 3ZU5A 2A78A 4NICA 1XKXA 3SXJA 4URVR 4I4CA 1ZGCA 2J85A 3KQOA 3C7AA 4K6HA 1NUSA 2P2ZA 2HA5A 3D7RA 5GGXA 1BMFD 5G3YA 3N0RA 3QBJA 4PPGA 4UEKA 3E9RA 1KIMA 3C98A 3DZBA 3F71A 4L78A 3W8NA 4DR6B 4BLTA 1AC5A 2HK6A 5L3QA 3TLBA 2BTEA 2QN6A 2VXOA 5FA5A 4HLUC 2AEFA 1KFCB 2X9VA 1EXMA 3ESYA 3BF7A 4MWOA 3TW4A 3UTCA 4F5ZA 1NW3A 2PUCA 2R7LA 1T3SA 3ZWBA 4AXXA 1HRKA 1E62A 2UVPB 5A5DA 4Q4CA 4GXTA 2G70A 3DEIA 3NFRA 4E3WA 4BY9E 4TLEA 3ONNA 1A97A 4I81A 2IYAA 4KKXB 4U9HS 4AKTA 3BN3A 2QRVB 3WRXC 5C8VA 2L2QA 1UK9A 4DV4B 5IANA 2FUEA 1YR3A 3IOCA 2WF7A 3OFVA 5EJ4A 2JIBA 2BI8A 4JYCA 1VJ1A 2AS0A 2Q6IA 3P27A 1WMSA 3GJQA 4R16A 5BT8A 2Q9UA 3IBGA 4EEKA 2X6RA 4C0HA 3QKRA 3LLCA 4DMMA 1W47A 4M76B 3NWEA 3PLNA 3RS3A 1VE7A 4XGQA 1WDLA 3UUGA 1EQAA 3DS8A 2JHFA 4MUMA 1XZDA 2CHEA 1VMAA 2OV6A 3LU1A 4R8KA 1JJFA 2G7ZA 2ZSUA 5FA8A 3UH0A 2I3BA 4FGKA 1OLXA 4LDRA 3BH0A 4YC7A 2HSGA 2WU0A 1L4EA 1D4OA 3IE0A 2V5AA 4WWHA 4QTTB 1NUHA 1B3RA 1RAIA 2FMFA 3GY0A 2JANA 3RVSA 4EQ6B 2WB4A 4LYYA 1LDGA 4CHTA 1IRXA 3Q9SA 4YT5A 1QPGA 1ZA1A 2WT4A 5DHUA 2QRGA 4R7GA 5CFPA 3LRTA 1SM4A 1T6BY 1ZONA 1DWOA 2ZRAA 3KTAB 2CEKA 4FUQA 4P3OA 3R7BA 4CDMA 4LF6B 1P0QA 3OQIB 1EWRA 4HDSB 4Q16A 4K0KB 1JXQA 2K4MA 2H92A 3ESAA 1L7BA 3VHXA 1EBBA 2QAIA 2HSZA 2Z1MA 3JQAA 4EUKA 1E1DA 4QECA 4F7WA 5ADWA 2P11A 5IVIA 3QV2A 3COVA 3C1TA 1RTKA 4YCBA 3UAVA 2RARA 2PBZA 5KAPA 3ESCA 3QNUA 2IPMA 4ZDIA 5IJ0B 4KQEA 1T1EA 3WYBA 1TUBA 1NDHA 2QNRA 2FE4A 4C4OA 2RGXA 2VDWA 4ZVSA 1BW9A 4GLBA 3QLEA 1XQWA 3H5LA 5C51B 2BHLA 4JOQA 1Q50A 1CQIA 4RVHA 1IULA 4K9PA 1GA1A 2BFDB 2DWPA 1P91A 2I7TA 3JZFA 3VTFA 1K63A 1AKWA 3QVMA 4LTDA 2PSSA 3BD9A 2R86A 2Q0QA 5EIOA 1SR8A 4DWJA 3BBPA 4EY5A 1R15A 3FWYA 5SICE 3C2QA 1IOZA 1FDRA 4HGOA 5AUNB 3PT5A 2P75A 4M0CA 5TY0A 3H9EO 2XBMA 1WETA 3OIUA 4FE7A 4LBZA 5ALIA 2FR1A 1S2DA 3IUSA 4F6CA 3HCRA 1NXVA 3AXSA 4PY2A 3E9MA 4TXNA 4KOEC 1LK0A 2O3TA 4INAA 1Q3KA 1J22A 4XIYA 4C07A 1QFMA 2QW8A 4PR3A 1U6KA 1O95C 3FJOA 1JECA 3LQ1A 4KZKA 1RQLA 3TZBA 1BCSA 1VE6A 3NNSA 5JXWA 4G0ZA 3M2TA 1JQDA 3KQPA 5JCOA 4QRIA 4DCGA 1UP6A 1ZIOA 4TS1A 5DEOA 1WY7A 1NATA 3KHKA 4HN2A 4F3TA 3DB2A 3PEUA 4PPNA 5IM5A 4NATA 4HO1X 2X40A 4J7XA 2IEIA 3FVTA 4WAUA 1OY1A 2VCYA 3ZH2A 1QHXA 1LI5A 1VBNA 4BGIA 3HVJA 5CDGA 5KUTA 2C20A 2XF2A 3E23A 4AS2A 3IP5A 3DZGA 4ETMA 5JR3A 5JY1A 5BUSA 1FIUA 1RMTA 3ONEA 3F96A 4FKMA 4KLCA 4E5PA 4Y2UA 3AUJB 3M1AA 1JMVA 5TF4A 2WNIA 2ASVA 4OKIA 1M3SA 2RHDA 3VR2D 2AJCA 3OLZA 2YXEA 1RKXA 3O94A 1C3EA 2F1IA 4NR0A 2XEDA 5TS2A 3WYCA 1Q1NA 4BZZA 3B1XA 3U7QB 4O8CA 1XZNA 3WLAA 1ZGBA 4C6HA 1C1XB 3I2HA 3CLTC 3QH4A 5GM2A 3T1VA 4B43A 1TM3E 4EX7A 2FB9A 2ZWOA 2AK2A 5JMOA 4BQEA 2B1QA 5FKJA 3H4IA 3GA7A 3C6QA 3WDMA 3MPOA 2YXBA 4C1NA 3JU3A 3NDIA 3L2OB 2JA1A 3OIDA 1UOEA 1RCUA 5C34B 2C7RA 1NBEA 1PT8A 3TDNA 3WYAA 4Q05A 5ALTA 4LX0A 2LBPA 2WINI 4MQ5A 3W7AA 2ONZA 1MTOA 4GWKA 1K06A 2HWKA 1T1IA 3TNDA 5HUQA 3THYB 5FQOA 3WYDA 1HY3A 4WKPA 5LQCA 4YR9A 1CY1A 4PPQA 5CT9A 2OORA 4Y2HA 3HRKA 1X0XA 4LK3A 9ABPA 3MCUA 4ETNA 4PLCA 3PQFA 3KAJA 3IFSA 3F73A 1GTVA 1BWSA 3ZK7A 3KQSA 3NOOA 4RKWA 1J00A 3W3AH 4G0UA 4MTLA 1M76A 4NYMR 1JEQA 2PHZA 3MLAA 4GS5A 4M8LA 2AR0A 3RK1A 2ZM6B 4WBNA 2Y05A 2VAPA 3CG0A 3ZR4B 3K94A 3G6KA 2B8WA 3E5NA 3JAWA 4IIHA 2ISSD 3AEQB 4MQLA 4CG3A 4CQMB 4E31A 1SPBS 1W94A 3MZ0A 1C7ZA 2E0IA 4L8YA 4TRNA 3CF2A 2K7ZA 1XQYA 1R6TA 2AC2A 3M7IA 4ZV9A 1TZKA 3KHUA 3K1AB 5I48A 4UD2A 2DKNA 4BJ3A 2PY6A 1EUCA 1KI1A 3P32A 4N8DA 1UQUA 1EVQA 3OZGA 2WM2A 3LQKA 3VHQA 1E20A 2P68A 4GNRA 3NGMA 1HQDA 2AOTB 3FR7A 4XRRA 1QTNA 3T1NA 4KSCA 2GPYA 1THMA 3DG9A 1C3OA 3U7RA 1MABB 3RYCB 3QEAZ 3F3SA 1PJ4A 1R50A 4EMBA 2PYDA 4JU8A 1AQYA 2EFYA 5DT2A 1PI3A 4ENRA 4EI8A 4O8ZA 4X1KA 3OJXA 2FE1A 1YK1A 3WGKA 3THRA 3H8WA 1IU9A 1TOAA 2PXAA 3PENA 3EVBA 3DZKA 1PR0A 4M9CA 4ZVUA 4KWEA 5E4FA 3STUA 4DR5B 2Q7DA 1J7KA 3KVYA 4FD2A 5DTJA 4CMKA 2VHZA 2Q6TA 1NAHA 2Q1SA 1JEYB 4XYMA 2C5LA 2JL1A 2H51A 4UZEA 3MVEA 2Z5LA 4LZLA 4TQ9A 2OPBA 3O4JA 3KQKA 1DELA 3AR9A 1EG2A 3DEZA 2UZ4A 2AD5A 1DO8A 1Z5WA 4HXFB 1UK7A 4JA0A 4LRTB 5EG5A 2PL1A 1AZTA 2ACVA 2M6KA 3ZIUA 3KSUA 1OC2A 4PG7A 3K8ZA 1Z2EA 2BUCA 1WKVA 5LA6F 5B5SA 2H2GA 1I9CA 3HXKA 4AP6A 1UIMA 4MAMA 3GFFA 4UCFA 3TBFA 1P1CA 2ENWA 2BGLA 2HYIC 2WZDA 3KT0A 5ELXA 1W87A 4I5GA 2AMVA 3GO4A 1J42A 1W4LA 5CW2A 5JQGA 1M72A 1EWTA 1M5RA 1TQ8A 1SC4A 4KWTA 2HGZA 2CHVA 3VU9A 2YOFA 2ZUVA 2VDNB 4BJ5A 2ID9A 3HE3A 1NZJA 4RVGA 4O4IA 1QQ7A 2XOKA 3PF9A 1N0IA 2G80A 5K03A 2HXSA 3KFXA 2QSZA 1P9RA 1A96A 4BRSA 4B7XA 4ZO9A 1GGJA 4PVDA 4YRMA 2V7BA 4RY8A 2MYPA 2D2FA 2R6CA 4GXQA 4Q3LA 3T5MA 4C7XA 2R0QC 3MB8A 4BO0A 4BYMA 4C9BA 4CV1A 4HWTA 3M3PA 1WEHA 4CLDA 5GZ6A 1E2HA 2QLTA 4C0WA 2FLVA 1K8ZB 5KCZA 5LOVF 4L2IA 2GYUA 1UT8A 1SXJB 3LSYA 1JH8A 2JFHA 3OZVA 3DL2A 2YVLA 5AJYA 3IVAA 1IHYA 4B9EA 4WLUA 3W7VA 1CUFA 3J7AC 3F46A 3WGLA 3D6JA 3DBLA 1E69A 3DMRA 2MIIA 3WLPA 4DCSA 4YRIA 2B3DA 4KIWA 2A0XA 3PGKA 4FEAA 4Q1BA 1E0SA 1G4HA 2PKXA 3AV0B 4RZQA 4H59A 2VHXA 3ESXA 2EX4A 1WMDA 4MUAA 1ZN7A 5BY2A 3UHPA 5M29A 4YUYA 2ECPA 4K2AA 3D3JA 1PKEA 4NYJQ 1G6KA 1WL8A 3WZLA 2NO1A 4EA7A 4PGFA 3FUXA 3PQ8A 5H02A 3LY7A 3WNZA 1DAPA 1B8OA 2CGEA 1GQSA 2PLWA 5EHNA 3F2IA 5DLYA 1J33A 2VTKA 2NO0A 3E4DA 3IKLA 3V8PA 4DG9A 5KWSA 2XQFA 3LF1A 1GN8A 2MR6A 3N5KA 4PAMA 3VKHA 2NP7A 1ABFA 4LXUA 1GXSA 4Y9RA 2FOXA 1II8A 1WXGA 1Y5RA 1ZMRA 2E1PA 2WU8A 3IXMA 5FJJA 1BJRE 2VWGA 4C6RA 5C18A 2PGOA 1OGIA 3DMTA 3UG6A 2X9NA 4ETIA 3EZLA 3O83A 3U6KA 3GPLA 1SY7A 4MHTA 2VVTA 4JJAA 1P9LA 3UKDA 3ZY3A 3UF0A 2OAP1 1YE5A 1DTEA 2FVYA 2SKCA 3DNPA 3RS0A 2C5FA 1H5QA 5BVHA 3TWOA 3HKEA 4KR9A 1KYWA 1U31A 3CRW1 1Y9ZA 3OIGA 3P2KA 4UCXA 1U1FA 4GMKA 5A4DA 4YCAA 2APJA 3T7AA 3GLIE 4BPBA 1O7JA 2RAFA 1BZYA 1PQUA 3EXIA 1WOMA 3JWJA 4M22A 3A3NA 3TJZA 4EPVA 5BWLA 3WWOA 1XCGB 4IRXA 1A1VA 2PUAA 3F5QA 2CNWA 2O2ZA 3DEYX 1F60A 3IBCA 1DJPA 2VK4A 3OTWA 4GPTA 4EGFA 4ZMBA 4HQFA 2KX7A 2ZJ0A 5FOVA 1KJWA 1FTGA 1UXKA 4EI9A 4YRZA 4I55A 1AHPA 4OBWA 1PQ4A 4Q4HA 1RZRA 2GILA 1PT6A 1OFIA 4UDOA 2DPHA 2PZ8A 2L69A 4UTRA 1WZCA 3V3TA 3RQSA 1O3YA 1E1NA 2GHRA 5DO9A 3MTBA 5EQTA 1G18A 1PD1A 5I9IA 5JNWA 2O7RA 3AU9A 4CM1A 1RT9A 4C20A 4OHUA 2H4WA 2C5HA 3T3HA 2W2LD 3EPJA 3AYZB 5DOZA 4Q03A 2D6FA 5C37A 3QVJA 3PCXA 1CXZA 1N3BA 2QTTA 4ZVRA 4R6XA 3HJCA 3UHOA 3FIJA 4FYKA 1QIDA 2OZPA 3O0TA 4RY0A 1WUHS 3KQWA 3WGJA 3LYAA 4BNLA 3WQHA 4NU5A 1E92A 1LPMA 2EIHA 2GR9A 2JGEA 1ZITA 2PIAA 4PYMA 1VP9A 1LV7A 5LYJF 2CJWB 1CSEE 1DXQA 3H1PA 5FBZA 1UXOA 5FI1B 1DINA 2GH1A 3C1OA 2C58A 3QOWA 3T3NA 1PGOA 3GGJA 4DR3B 1BOFA 1ICIA 4DLYA 2LW7A 4YPFA 2E87A 2IS2A 4S1NA 4MWCA 2V8OA 4KAAA 2IUUA 3QY0A 1NPDA 4IXDA 5CLFA 1FL9A 4LZOA 1HTTA 3OLQA 3T38A 2O5VA 2GPAA 1RLMA 2Z04A 4MW0A 4R9RA 5CB8A 3QX8A 3HDVA 2VT2A 2GZ2A 1O5TA 3L7CA 1MAUA 5ESWA 4JVNA 5L4NA 1DAEA 1ZRMA 2PBLA 1GZSA 1QH0A 3JQCA 3TQCA 3HO6A 2JFBA 2PPVA 3CKKA 1CDZA 4UUQA 1SHZA 5THXA 3BXFA 2N9UA 2VWPA 4NFHA 3RFFA 2DR0A 2QN9A 5EEGA 3U19A 5FLYA 5EMJA 2PMEA 4E4YA 3A9WA 4I1RA 2BCJQ 1E4EA 1S01A 4ALNA 1N5MA 1ZNZA 4GKVA 4MVJI 2C3YA 3LLMA 5E8JA 3AR3A 5ADHA 4YQYA 4IHJF 1Y3HA 2TYSB 3FWKA 1QH8A 4U8HA 4EDHA 3MB5A 4J4BA 1JZTA 2ATIA 1UKEA 1H5NA 2ORYA 4ZT2A 1HT0A 1RHQA 5F2NA 5FX2A 3HDJA 5EIAA 1HK7A 4XUDA 2EJVA 1EZ1A 2ENUA 3TG2A 3OJEA 1UBGA 1KMCA 2A5DA 4PAQA 2YFYA 1E5LA 1JNXX 2J30A 3SE0A 4CIAA 2PR2A 5KOHB 4E5UA 1V3UA 3RKSA 3I4FA 2PAFA 3HI4A 2B1JA 1MRSA 3VU1A 3IPAA 4M9UA 2C97A 2G4VA 3EOBI 3DT8A 1VLZA 2X2OA 2YHIA 4MV3A 3TVYA 4DB2A 1UBSB 3TAXA 1G2IA 1QGED 3L7OA 1IN8A 1XDWA 2G8LA 2FMXA 3JRWA 5B2ZA 2R79A 4LOAA 2F3QA 1EINA 2N75A 5DJ5A 5FULA 1T9GS 1N2EA 3LUJA 4L9SA 3O8QB 3S1AB 4KMSA 2VAWA 1YDEA 2DPMA 4FOLA 4WIAA 3CMMA 4J91A 1HUQA 4AZSA 2B0JA 5KTMA 5F2OA 2I2WA 1Y6GA 3R0QA 5LDGA 1F2VA 4XFKA 3SDZA 3BZWA 3WTBA 4XVCA 4MWSA 4ND5A 1OAKA 4IJVA 5A4FS 4HC4A 2F1KA 1CZLA 1BX0A 1KY3A 3ZKWB 4EJ6A 3CGWA 2FSUA 3C3JA 1FDWA 3TD9A 3DKKA 1AXRA 4HSGA 2RH4A 2J48A 3IEKA 3WO0A 3WLNA 5B7GA 5IJZA 2GB4A 4RQAA 2EKPA 3TINA 1QCCA 3DOOA 4GGPA 5DN6A 1JDBB 1UANA 1X7XB 2CFOA 2WJ4A 3FTPA 3MAJA 1X86B 3RTDA 4ZV7A 1U1GA 1HNWB 3ADOA 3R6LA 4BP3A 4C43A 2QW0X 3IR6A 3ZE8A 4AU1A 1Z7BA 5IXSA 3GIDA 4F1WA 3KIPA 3I73A 3WVNA 2WLTA 1VL0A 5KNBH 3DUFB 3B78A 1HFWA 3FOEC 2J31A 4ZI5A 1GNPA 2XMGA 3EK2A 1J0EA 2NADA 3GUUA 1KZHA 4AJIA 1EFPA 2ZT7A 4HXYA 3M4NA 1FYEA 1HLFA 1NN0A 4BLOA 4EK9A 4AW9A 4WY8A 1PR1A 1MA0A 5DN9A 1J8MF 5HX7A 1PGQA 3OE5A 1ORHA 2ZI3A 1H8HA 2HPHA 3PYLA 4W5NA 1NJ6A 2JD2A 2PT5A 4R7TA 1UEXC 2I87A 3AG6A 4OI2A 1JEAA 2HEIA 4ZYLA 3L0ZA 5G0VA 2QV7A 3C87A 1V1MB 4IIYA 4WE3A 3DBOB 4X6LA 3RAGA 2WQ7A 2QE7D 3CLRD 1TZ2A 2FZCA 3AC0A 3IAXA 3QYPA 1BGWA 3GK3A 1PE0A 3I6BA 4K6KA 1P2BA 3TXYA 1UDWA 1GPJA 4FR5A 3VMFA 2WHXA 1KQ3A 3EXFA 4GC9A 1ZGGA 4IEEA 2W4IA 3L7BA 2ZTUA 4QJBA 5T57A 1N2CE 1IONA 1GT91 3ZJVA 5T3UA 4O59O 2RKOA 3NRCA 4H4DA 3LE8A 2P2DA 3COYA 3P2OA 1WSDA 1V8DA 5EZYA 1Q2XA 3ER6A 4UE3S 3ZGOA 3NH9A 5A3QA 4QO8A 1HYEA 1NVTA 3EEBA 1P3DA 2ZPTX 4Q19A 3V7NA 3WK9A 3BRCA 1FY2A 4JLPA 3T4UA 4AECA 4F4UA 4AUMA 3W4JA 2LZ0A 2WG0A 1YS1X 4JLAA 2B4RO 1FVXA 2BBTA 4M99A 2J3HA 3FCCA 5KQGA 5KSOA 4H7KA 4ZCIA 1SBQA 1ZL2A 1JVBA 4OD0A 1WCIA 1MRNA 2QJOA 3RVLA 3UJCA 3E03A 3JATA 5JPCA 4REQA 5L9AA 1K92A 1P80A 2PIDA 4TOIA 1Y5MA 2OBBA 3ZW7A 5HQ3A 3RTAA 4F3RA 4B87A 5IABA 1RSZA 1K9VF 3NYIA 2D8AA 4IF4A 4RS4A 4DCNA 1YZNA 3DFFA 3LW8A 1QAMA 4DILA 4ER0A 1ZRHA 4BAUA 1I10A 3QW4B 4CKEA 3O6VA 1ZD9A 4MV9A 4MLPA 1G20A 3C6XA 3SJZA 3WZMA 5LJLA 3TMYA 2YZMA 1E4OA 2O06A 1UC5B 1AQIA 4NONA 4G8BA 3GLFA 4M1YA 5G40A 1EMDA 4ZVMA 4DC1A 3ESZA 4HLQB 3NO4A 5JS8A 3B1FA 3D0QA 4IYJA 1Y42X 3UENA 3DO6A 3GDFA 1DEXA 4A8TA 6Q21A 3AUKA 1QHIA 1XCLA 4RV4A 2W6CX 4MJ3A 4BXOB 5CFQA 4N0DA 1UXIA 1WOYA 2ZWIA 4PSKA 4QQNA 5PNTA 1RYMA 3RSHA 4DV0B 4BBPA 4E1VA 1JR3A 2D54A 3TQFA 5D3QA 2P6MA 1C9JA 2WM9B 1QHEA 3K09A 2BJHA 4TTAA 1W36C 1R3DA 3QJYA 4E08A 1GUDA 1XV5A 2YY5A 3H6KA 1KMIY 3FVVA 1T9HA 2YIJA 4Q1AA 3RSQA 3SS7X 4JR2A 4O33A 4Z7OB 1TTTA 2QVZX 1FS4A 3KWJA 3CPSA 2PXXA 2OG1A 5DT9A 5KTRA 3CNEA 4ZTZB 3DHNA 3C8MA 1PP4A 1Q1BA 3M5DA 1Y37A 5GY7A 2YVQA 3CVVA 4P35A 3LA8A 2I4LA 1PV4A 2XUQA 4YMGA 2JFVA 2XA2A 3OLCX 4WBSA 4LXYA 3ZGNA 4DQVA 5C5DA 3TL6A 1YB5A 5IUKC 2D2EA 3JQGB 4NEQA 3UAXA 1BEEA 1CVIA 3ZU2A 1R0LA 4HH3C 1XYGA 3WWEA 3EZXA 2QVYX 3BKWA 1ETUA 1IYZA 2XYPA 1G41A 3Q98A 3TOVA 3DE1X 3WLIA 4CZ2A 5KNCH 1DEAA 4NMHA 5FNVA 4UU0A 2HU2A 4ROTA 1ZH6A 1R9JA 5HK9A 3LECA 2JFYA 4RU1A 1KARA 1ZZEA 5EHQA 4O1MA 1Q6ZA 3WL4A 2RBGA 3NP9A 3I61A 3HXMA 5EERA 3P2MA 1P1JA 1XU4A 4YP6A 4AL4A 3GNQA 1MIOA 4TLCA 3F3KA 2JFNA 1I13A 5FPYA 2BFFB 1N5OX 1TAGA 4DKXA 1C1YA 3P9CA 3PXEA 5B3JA 3ABIA 4RZ3A 3EUFA 1KMNA 3IHTA 1O4VA 2I65A 2XY4A 4X6YA 5TB5A 3GDGA 3OWOA 3UCXA 3QKSB 5TVGA 3IXLA 1I1HA 3OUUA 1E6MA 5LDDC 4YCDA 3M9WA 1KYQA 4JQSA 1V3TA 2HRBA 2WM8A 3BXXA 4Q6WA 5F51A 4ZEMA 2NUPB 1R5JA 3KJXA 2CXPA 3JAMA 2GN6A 3SBEA 3H3JA 1QRSA 5EIHA 3H0KA 3EGXB 4OXNA 4B48A 4TZKA 5AW6A 1L6IA 2VHYA 1PG5A 5J4HA 1DAOA 3P2EA 5ALKA 3C45A 2P4EA 2FWNA 3NX4A 4WGFA 2GS9A 2XI4A 3AVWA 1HMYA 3IERA 1JLSA 4HZUB 1BKSB 2C4KA 3K6SB 1JFFA 1U9CA 4JSYA 4B47A 3O8BA 4L72A 2ZTMA 4DNPA 4ZVNA 2PUVA 3HNPA 2O8CA 3AB8A 1ZGZA 1XRJA 4U7WA 4EHNA 2C9OA 2J0VA 3KU4A 4QM7A 4HYQA 4C0LA 2EKQA 3GT0A 1SQ6A 4IDDA 1EFAA 2ZJYA 3JYQA 1WCYA 3B82A 2AJ8A 2WZBA 4RV5A 4WESA 3BWVA 3VO1A 4X5OA 2WKWA 2JGFA 3OPYA 4OXXA 4RE5A 1HZJA 3DAFA 3V46A 1YL6A 3IUQA 1LSJA 2FUCA 2DYKA 2VUTA 1B00A 2XMBA 2NXEA 1TQ2A 3D3QA 1NNI1 1SCAA 5FO1A 2PA3A 3V33A 3JV7A 1BXRB 2FW6A 3CR7A 3P4XA 1Q7GA 2YHAA 1S3FA 5FL3A 2BRUA 5ICMA 4EYOA 4UCWA 4ND8B 5I8PA 1R6VA 3GDOA 1M5TA 3KHSA 1Z0KA 2FPOA 2IKSA 3L02A 3NBYC 4QUKA 4XGIA 4X44A 1T6NA 2IIBA 2IYYA 1EFUA 4FZ5A 3EGWA 1R8XA 2D06A 4UULA 1Z0SA 2CDBA 4JC0A 4TMTA 3K32A 3R5FA 4YHHB 1DKQA 1V5WA 2I0FA 4H7EA 1MNQA 4PU0A 2FXVA 5HF5A 5C53B 2IU6A 1H65A 1GL7A 1T0PA 2BDUA 3W7BA 1HT3A 2V9CA 5AVWA 4WZ6A 2FDCA 2ZDQA 4AD8A 3ZWDA 3PHJA 3RFTA 3WNBA 5KSWB 4CKWA 3ITEA 1TYDE 1H93A 3PJGA 1RCTE 2COUA 2ZJFA 3D4PA 4FCWA 5B3JC 3RKUA 1KEEB 1PW5A 1GNSA 3ZV6A 4KE7A 2OBMA 1WZIA 3ISTA 1BS1A 2OFXA 1JHOA 3UK7A 3PGA1 3ZWAA 4H31A 4CMJA 1JG4A 3PFBA 4UFOA 2QM3A 4UHFA 5FUWA 3BHNA 2POQX 1R4AA 4BB5A 1GL9B 1GKYA 1VSTA 3DLCA 3H2IA 3IVGA 4WOJA 5BQ5A 1GAXA 1Y82A 1HYQA 3L40A 1NXSA 4L9WA 3UMMA 3OC6A 2WMYA 1XX6A 2H1RA 1WEKA 3QTBA 3TX6A 5NULA 4WBXC 4JFRA 1DJMA 1WMEA 1XPJA 1SUEA 1AUQA 4F12A 5LQAA 1GNLA 2QL9A 1Z7EA 1VG8A 1PJLA 3HBFA 4D45A 3DV0A 2QAGA 4ILKA 1SZDA 3NJ8A 3J80A 4C4AA 1GM5A 1YL7A 4F86A 3PUJA 2FZKA 4K9LA 3RVBA 3MAAC 1ES9A 4TTRA 3W9UA 5KVVA 3UYLA 4PQYA 2X19A 1T3ZA 4Y6LA 1Y7LA 2C2OA 5JXJA 2HLDD 4REOA 5CXSA 1L7EA 1B4DA 1G17A 5JD3A 1XEXA 2PVPA 2ZYGA 5F73A 1EPUA 1U1EA 4FFWA 1FFEA 2Y8EA 1N7IA 3HC7A 1GQYA 3RUAA 4JT4A 3SFZA 2QLFA 1JXAA 1WW3A 5GM1A 1CUAA 1Z8DA 4M1QA 2BE7A 4JLUA 5A04A 1G8PA 3L49A 1XCMA 5TDHA 4Z1MD 1BRTA 4HRVA 4BO2A 1NUUA 2Z6VA 2WTNA 3MWKA 2PEZA 1M9NA 1SQFA 1CQJB 1MJNA 1U1DA 2Q6KA 2R7NA 2WZCA 3B1WA 3KLOA 3QEKA 4PZDA 2PBRA 1LRJA 1N6NA 3EFBA 3R7WA 4KITB 1LTHR 4UBIA 1Y7TA 1Y3FE 2V6BA 3L4BA 1V5IA 3MS2A 3PNVA 4WJKB 5FQNA 1JQLB 4HNAB 3IPLA 3E81A 3G85A 1CZUA 2VPYA 3OQOA 4F6RB 2P2GA 3BXZA 1YJ8A 4RA6B 2A1UA 2AN1A 4XCXA 3VYVA 1XK7A 1RWPA 4XYBA 4DLUA 3ZWVA 1NASA 4D9HA 4HS4A 3RAEC 2ZBFA 1E8MA 2WYWA 1WCWA 3MW8A 2JAXA 1B2RA 3HH8A 1LPPA 2Q5FA 2Q2WA 3ABZA 3WK8A 1GA4A 1U0OC 3TTUA 2JC3A 4FCCA 4HWGA 3PC8A 3D6AA 5AJTA 2O2GA 1TM2A 3D4BA 4GP6A 4AB1A 4EAQA 2HSWA 1IZYA 4K3VA 2XUAA 5LFAA 2JIDA 2C9YA 3A6FA 2ZRLA 2ZIFA 3UG7A 1GUFA 3MSCA 2OYCA 4INJA 4R5MA 4HB4A 5IF9A 5KQPA 2DTDA 2DT5A 1X3LA 5KB3A 4Q9HA 2FGJA 3CJRA 2GCPA 4KUEA 1USUA 3I1FA 5IT4A 1RXUA 3NTOA 4TTIA 1XB2A 2WA2A 5LA6A 1Q0TA 2QZPA 5DGTA 3EIFA 2WNSA 3DM9B 2HD4A 3ROGA 4L6IA 5SY4A 1G4AE 2CNWD 4EB8A 4PONA 2PLFA 2E48A 3TGLA 4X60A 2XUDA 2PU5A 4MB0A 2NSHA 4FBLA 1YSCA 3O03A 1B8UA 4JGIA 1DQPA 3TZQA 3N07A 1LZKA 1SZCA 2YICA 4E14A 2C3OA 4EHKA 5HFJA 1RE1A 4R2KA 2I4TA 1ZD1A 5BPHA 5FLEX 1AGNA 4LTMA 4MQEB 4PC6A 1Z6AA 3MWDA 4XJVA 1ZISA 4IMJB 2YWBA 3U3RA 5JDIA 4CLRA 3EBLA 5AKJA 1K4YA 2HU5A 5B1YA 3ZCSA 4YQEA 3ZXYA 2H85A 3I92A 4Y1RB 3MOIA 4IMRA 4R2IA 5E9AA 3G0CA 5DNEA 3SYRA 2PS3A 2P2YA 1D2NA 3ZCPA 2BFAA 5SV2A 3A2NA 2IEDA 1N2ZA 2ZYRA 3IQWA 5AJXA 1GAWA 3DBRB 4NCBA 3PUIA 3DHYA 3COZA 2A4MA 2FA9A 4YREA 1YDFA 2XDQA 4RUKA 3RSZA 3VR5H 4G8JA 4IDBA 3H7AA 2AOUB 5LOVA 4MRSA 1C81A 1Q5PA 3ANXA 4MROA 5KU7A 2FPPA 2ZIUB 3CJTA 3FOCA 4BFVA 3GPIA 5JHHB 5FA6A 4FFSA 3LTNC 2WMNB 3MTGA 2R96A 5F35A 7REQB 2FPMA 2PZKA 1AIPA 3CUVA 3OCJA 4KAJA 4GPIB 3AM5A 3WICA 5AESA 2R8BA 3UW3A 5KNBD 1PFWA 3OBBA 4UM9D 1MX3A 5AK6A 3UV6A 3EPHA 5LC1A 3KDSE 4OHFA 4V39A 4OHYA 1ZVQA 2VPIA 2L18A 4XWTA 4ALLA 1GAQA 2JHAA 1QRDA 5BWOA 3BXHA 3M33A 2CSXA 5CDHA 2QN7A 2IW3A 2Q5CA 1BDBA 1NF8A 1RHUA 2C5AA 2EJBA 2IIPA 3WFJA 4ZZIA 5AVZA 3ZWNA 5JQWA 1GTRA 1T29A 1BNCA 1DRJA 4U3JA 4WINA 4EHBA 4K81B 3IQGX 4GVLA 2PJDA 3D59A 1P33A 4RF2A 3AIOA 4IV5A 2HX1A 3GT4A 1ZAKA 3TUZC 5LP6B 3DWGA 1WHSB 5IYZB 4WCFB 4CE6A 3OPQA 4HGQA 5BSGA 2NPOA 3LCVB 1IXYA 4GPAA 4D9JA 3E7PA 1X1EA 2J9XB 2FRXA 4JUAA 2E5FA 2H7XA 1HETA 1TQHA 2VPWA 4IDGA 2NTVA 4FR2A 2BF7A 1LY1A 1DX9A 1W19A 2PJZA 4ND2A 1SURA 3MJSA 4KO4S 4PFJA 4BKPA 2PKYX 5GOTA 4FCTA 3HZOA 2EGUA 4MYUA 5AXCA 1C7IA 1L5LA 2HXGA 3K1JA 3S3TA 3W2TA 2ZUTA 2QUAA 2ZS9A 4L8VA 2ZYSA 2GPWA 2B8EA 1SG9A 1D5CA 4MMXB 1Z5UA 2C5GA 2D0PB 2FWBA 5E9QA 3T7EA 1ZJWA 3EH1A 1UK8A 4ZT5A 4WNIA 4OHZA 4W5OA 1JHDA 1OKKA 4Y6SA 1TEZA 5AH0A 3HJFA 2QPLA 5IJ9A 3WJ7A 1QYXA 3WMEA 3LUKA 2G9QA 4JK3A 1KAOA 3P52A 4DHWA 2EZ8A 3F67A 4S0XA 1H9CA 4QRDA 4YCNA 4RKQA 4ZRMA 3LNTA 4I0WB 3ZWPA 3VO2A 2EVWX 3PTLA 3RHSA 4AKSA 4IHAA 3AETA 1K2VN 1QOPB 4C30A 4LG1A 5F12A 3KOYA 4DSTA 2VYND 4IUDS 4MI1A 3FVQA 4GOLD 3WISA 2VTBA 1WCXA 1R4ZA 2XB9A 5FFMA 1L4MA 1V5FA 3BGSA 3AJAA 1AA9A 1GGMA 1ICEA 4BBZA 1NE7A 4MV8A 1Y6JA 4CEJA 1J97A 1WDMA 3GVXA 1CUIA 3HDTA 1O2DA 2WZQA 4QGGA 3FROA 3OECA 3Q7SA 2KW5A 1HKHA 3A4LA 4RIEA 2KJQA 4KVFA 1NURA 2QW1A 1WZNA 3P0JA 3OAAD 2AZMA 5LYJA 3HBMA 2HJGA 4G23A 4OB8A 5CFOA 1BO6A 3ZKAA 1FZQA 5C1OA 4PAGA 1R0SA 3OZXA 1C0KA 1O58A 3BXGA 3R6DA 4EB3A 1FZTA 4FLEA 1C8VB 5DGXA 2QGZA 1VLHA 2ZWMA 3VGJA 2XDAA 2Y1GA 4G26A