1NUUA

Crystal structure of human cytosolic nmn/namn adenylyltransferase complexed with nad
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
233
structure length
213
Chain Sequence
SRIPVVLLACGSFNPITNMHLRMFEVARDHLHQTGMYQVIQGIISPVNDTYGKKDLAASHHRVAMARLALQTSDWIRVDPWESEQAQWMETVKVLRHHHSKLLAVPELKLLCGADVLKTFQTPNLWKDAHIQEIVEKFGLVCVGRVSHDPKGYIAESPILRMHQHNIHLAKEPVQNEISATYIRRALGQGQSVKYLIPDAVITYIKDHGLYTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FKSG76
publication title STRUCTURAL CHARACTERIZATION OF A HUMAN CYTOSOLIC NMN/NaMN ADENYLYLTRANSFERASE AND IMPLICATION IN HUMAN NAD BIOSYNTHESIS
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 75
structure length 213
sequence length 233
chains with identical sequence B
ec nomenclature ec 2.7.7.1: Nicotinamide-nucleotide adenylyltransferase.
pdb deposition date 2003-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1nuuA00
2A86A 4K0RA 1J1UA 2QUJA 1JZQA 3CLUD 3LE8A 5TEWA 1O95C 4MWDA 4NZPA 3VRHA 4PBRA 3P0HA 4KR7A 1I2DA 1YIDA 3L92A 4EG5A 2TS1A 2QJOA 4TS1A 1GLNA 1VLHA 1N2JA 1EE1A 1IFXA 4I6JA 1I6KA 1PFUA 4KPUA 1IRXA 1JECA 3ELBA 4MWEA 2QTNA 2ZP1A 3IMGA 3MLBA 1TYAE 1IH8A 2WSIA 4MWCA 1J20A 1N2EA 2E0IA 1PFYA 2DXIA 2VTBA 2YY5A 3H9BA 3K32A 5TGTA 1H3EA 4GU5A 3NBKA 5K0SA 3SZGA 1OWLA 5DASA 3SEQA 2J5BA 1MOPA 2GOYA 4ZT3A 4DNXA 2DPLA 2YWBA 1B6TA 1XNGA 3RFFA 1G8GA 1SURA 1NUTA 3P0IA 3PXUA 3SEZA 1O0BA 3FDXA 1O0CA 2H29A 2RD2A 2CYCA 1TYCA 4MULA 2CV1A 2J09A 4FZJA 1NI5A 1Q11A 1WY5A 1XNJA 2QJTA 3G6KA 2J4DA 4J75A 1JZSA 1TQ8A 3KFLA 4J76A 4CDNA 1KH3A 2H2AA 3L93A 2NSYA 4K03A 5J59A 4A91A 3RK0A 4WSOA 2PZBA 3VU8A 1U3DA 1MC1A 1N2BA 2X1MA 3FOCA 1JIIA 3IODA 1OBCA 5FNZA 4L2IB 2PZ8A 1IQRA 1KAQA 1FFYA 1EUQA 2JANA 4EF6A 3TZEA 2PG3A 4MVYA 1H3FA 4QRDA 3ZGZA 1P7PA 3FI0A 3UMVA 1N2OA 1KP2A 2CSXA 3ISJA 1MAUA 1QNFA 1VBMA 3MMXA 4EGAA 2RE8A 4MUFA 2G36A 3PNYA 1N3LA 1O97C 2CYAA 2VXOA 2WQ6A 2AKEA 2OQ2A 5JBNA 1K97A 4JXXA 4MUKA 3GLVA 4EG7A 1WOYA 4EG1A 4AS1A 2R5WA 3X1JA 4EG8A 3HZRA 3HV0A 3AFHA 4MW5A 3A04A 5J5AA 1NP7A 3IOCA 4MW7A 1QU2A 1WXIA 2HGZA 2GM3A 4KPUB 5TS2A 3RBAA 1N2HA 4MW1A 3JXEA 1GAXA 2GKSA 3KT0A 3UK2A 3CLTC 1MJHA 3IOEA 2VTBB 4XFJA 1O97D 1NYLA 4KKVA 1MAWA 3MXTA 4YBRA 1ZH0A 2QUIA 3C8ZA 3A4IA 1WXEA 3IH5A 1KAMA 5DK4A 1KR2A 1PG2A 1EFVA 5J58A 2BTEA 1I6MA 4HK4A 4MW0A 3VGJA 4MUGA 3RHSA 3G5AA 4GRIA 1J21A 4DDMA 5IJXA 3CLTD 3RK1A 2O8VA 3LOQA 2J07A 1I6LA 3UOWA 3CLSC 1UFVA 1N1DA 3FNRA 4DLPA 1K4MA 4CT0A 2V0GA 2NZ2A 3QTBA 3BL5A 5FO1A 1JMVA 1EFPA 1JHDA 1U7XA 2PZAA 3ILVA 5HUJA 1JILA 2WB2A 1YUNA 3TZLA 2DEUA 1N77A 1NUQA 4ZCSA 1U7DA 4DE5A 4MQ6A 4JXZA 4P2BA 2DUMA 2OV4A 2ZUEA 1WKBA 1WXHA 2A7XA 5LLTA 4YP5A 1J70A 1N2IA 1ZH6A 4UZFA 4MUHA 1QRUA 5TEVA 3SYTA 1HYBA 2DR2A 1O95D 3CLSD 1WZ2A 1KORA 1LI5A 2BYTA 1XJQA 1M8FA 4DDKA 4F4HA 3AL0C 1KH1A 4MVXA 5DEOA 3TQIA 3M5WA 3D6VA 1ZJWA 1R6TA 2CUZA 5KCMA 1KH2A 4MUJA 3INNA 3IMEA 3GMIA 1WXGA 3MLAA 3IVCA 4ZCRA 3UC5A 4R2MA 1A8HA 1KKUA 3F3MA 1BS2A 1XNHA 1R6XA 4EG3A 4MUNA 2CYBA 3X1MA 3FH0A 4MW4A 4U8HA 3CVVA 1WXFA 5H16A 1OBHA 1M1ZA 3SZ3A 4HJXA 4ZCTA 3AG5A 1JGTA 1NURA 1T6YA 1EJ2A 1G59A 2IELA 3ZJVA 1N78A 1COZA 3KT3A 1KQOA 1QJCA 2EJCA 4MUEA 5H7XA 4OUDA 5KHAA 1J09A 1EFVB 3Q4GA 4OJMX 4XFDA 2A88A 5KWVA 4WNYA 4U63A 1OD6A 4ZT4A 4MUIA 1N75A 4QBTA 1O96A 3IDFA 4MLPA 1Q77A 3IVGA 4MW2A 5K0TA 3S3TA 1F9AA 5HG0A 1Y42X 3K9WA 4ZCPA 1U3CA 1OWMA 1NUUA 4PBTA 2IP1A 3FG9A 3AIIA 1EFPB 3CVXA 2CT8A 1PFVA 3SDBA 1U0BB 1QRTA 3HFJA 1M8GA 1NUPA 4G6ZA 1OWOA 1OWPA 3CLRC 1VBNA 1TEZA 2X1LA 1TFUA 3ND5A 4PY2A 2QJFA 2QTMA 4EG6A 4F3RA 1KQPA 1RQGA 3PNBA 1LW7A 4JZYA 5LM3A 1VL2A 3ND6A 3DO8A 1M83A 3N2YA 3G59A 3QTTA 1S4MA 3ZJTA 4DDHA 4DJAA 2A84A 1MRZA 2QTRA 1LI7A 1O94C 4NDAA 2C5SA 4MAFA 1NSYA 2I1LA 3SP1A 4NAUA 2PIDA 3GUZA 2ZUFA 1V47A 3CLRD 4Q16A 1VBKA 4MWBA 2E21A 3TQOA 2D13A 2DLCX 3HGMA 3IUBA 1K4KA 3MUEA 4NX2A 1QU3A 1Q15A 3FHJA 2J08A 3H97A 1IVSA 3IUEA 2A1UA 2DERA 1JEEA 1PG0A 4ZT2A 1T6XA 3E27A 3AKZA 4ARCA 3FWKA 3D6UA 1WJGA 3NBAA 2A1TR 2JA2A 3UY4A 1NZJA 4ZT5A 4OUDB 1G8HA 1GN8A 1EXDA 2XRYA 4RPIA 4ND7A 1O94D 1YI8A 1R6UA 2CV2A 3COYA 1D2RA 1O96B 3H9CA 2A1TS 4ZT6A 1J1ZA 1T6ZA 4CDMA 1CT9A 1IQ0A 3IMCA 1K92A 4MW9A 2HMAA 4JFAA 3CR8A 1M8KA 5FO0A 3P52A 3ZUGA 2AG6A 5LFAA 1NUSA 3TS1A 3PNVA 3ZXIA 5BNZA 3N9IA 1ILEA 3I05A 4G5YA 4EFKA 1GZUA 4KR9A 2X0KA 3X1KA 4NATA 1MB2A 3ZIUA 1KP3A 3H99A 2WQ7A 1X6VA 1QRSA 1ZUNA 3OTWA 3KT6A 1GTSA 1IQUA 4HPWA 2E18A 3NV7A 3DLAA 1G8FA 2O5RA 4E1AA 4MVWA 2E89A 1PFWA 1OWNA 2DETA 4BWVA 3Q12A 1GTRA 1WQ4A 4JYZA 1F4LA 2D54A 4Q93A 1Q19A 1JIKA 3FETA 4S1OA 1YULA 4AQ7A 4CQNA 2YWCA 5EKDA 4MW6A 1GPMA 4PBSA 3COVA 1O6BA 3FIUA 3FY4A 2EL7A 2JAXA 4H3SA 2CFOA 4U7JA 5F23A 3Q10A 2Z08A 2CV0A 2AZXA 3DPIA 3ND7A 3HL4A 3P0JA 4G5FA 1F7UA 2QUHA 4UZEA 3A2KA 2V0CA 2PXHA 4YP6A 3LCJA 2A1UB 2Z3VA 1MBZA 1QQTA 3CVUA 4XSVA 1ULHA 3ZXSA 3IVXA 3QE4A 1YUMA 4RUKA 1KQNA 4HJRA 3COWA 1YIAA 3KT8A 1FYDA 3N05A 3DV2A 2PFSA 3OP1A 4R0NA 3RJZA 2XRZA 2B7LA 1DNPA 3CVWA 2X3FA 4YMIA 3U1VA 2YXNA 1TYDE 1O5TA 2Z09A 1M8PA 4KR6A 5DB4A 3TNJA 1H3NA 2HZ7A 1QTQA 4I6GA 3ZJUA 1IHOA 3A05A 1WQ3A 1F7VA 1JEDA 1M8JA 3CLUC 3IOBA 4ARIA 3PRHA 1H1TA 4QREA 4ND6A 4YP7A 4NAHA 4L2IA 2IJGX 3H05A 1JIJA 5IHXA 3CVYA 2QUKA 3HMQA 1EUYA 1T9GR 4I6EA 4EG4A 4ZT7A 3N8HA 4X0EA 2A4MA 4MVCA 1TYBE 4R2LA 5AHWA 2D5BA 3AG6A 1T9GS 1MB9A 4ZCQA 3CA8A 5HUHA 1N2GA 1X8XA 3COZA 1V8FA
chains in the Genus database with same CATH superfamily
1EIZA 4KI0A 1EGHA 4TGLA 3A8TA 2H2DA 1P1BA 1PNVA 3LXMA 2YASA 2ZWVA 4O63O 3DQQA 1O95C 4OSEA 3DKIA 5I7HA 1CF9A 1ZUD1 3IV6A 2QJOA 1DO8A 2BZGA 3I0ZA 4QSHA 2HHAA 5L3VA 3DDSA 2DE0X 3WAGA 1P31A 2QTNA 2CDBA 1SUPA 2EP7A 3CO5A 3IMGA 4DW8A 5AM3A 1WCWA 1AK1A 3WGIA 2B5OA 2MDTA 1TTHA 3IUJA 4KACA 3D8NA 2QS9A 3NTRA 1R5OA 1C3OA 4IRXA 3T12A 4LZAA 4Q82A 1OH6A 3HB4X 1KAHA 2ZVJA 3KOZA 3LRPA 4ZREA 3VOAA 1L5QA 1TJPB 4N40A 2B3TA 3TIIA 4EO7A 2D1QA 2PZKA 4U0KA 2YRWA 4NMLA 4X1IB 5DASA 2J67A 1A2BA 2BMWA 2JGEA 4LGMA 4DAEA 1MW9X 2C5FA 2WJ3A 3FB4A 3PUYA 3RASA 3E0XA 4ZI7A 3THYB 4ZT3A 3G5LA 1LNZA 5HRCA 4DCVA 4RY2A 3OG9A 1W88A 4K88A 4TKVB 2GRUA 3A1FA 3NI2A 4M7OA 5A4IS 2QDXA 3DF9A 2ZT7A 1PF7E 2Q50A 1AUPA 5A1JA 3AR6A 1EFAA 5C7YA 3R5XA 1H5NA 3C3XA 4JI2B 4G5QA 1I4EB 2QJTA 2WK1A 3QKWA 4L9SA 1JXOA 4QHTA 5E7JA 4EENA 5BR8B 5FF9A 3WMEA 3L4BC 1E9AA 5A4KA 3I0NA 4EAAA 3L7DA 2FRVA 2PKEA 1FJGB 2AMLA 4HFNA 2G67A 4N39A 2P91A 2Q5JA 5L53A 5LIRA 1VYHA 3GLHA 3VNQA 5C34B 4DHEA 4TMKA 4C4OA 3K8YA 4I7EA 4Z0PA 1SK8A 2AKAB 1DCFA 5J4YA 3K1AA 4DA7A 1QIJA 3JATB 4JI5B 1HDZA 1KAQA 2J3KA 2OXFA 5ECDA 4ZEXA 5KYYA 3ADBA 2IS2A 4DYDA 3TRKA 4D41A 1P81A 4YAOA 4O8ZA 3DT9A 4LYJA 4IJKA 3ZGZA 5L3SB 3BBPA 1CJBA 1M6NA 2RI0A 3QVTA 2QM7A 5G40A 4URUR 2EKZA 3KPWA 3G1UA 4GQBA 4MUXA 1MZPA 2FPMA 2FPUA 1F4PA 1FQOA 1NONA 2GBLA 3FCSB 5CA0F 1DAPA 1VBMA 2V98A 3A4VA 5DZSA 4BCCA 2YWGA 1ABBA 2HSGA 1N2SA 1A1VA 4I3GA 3O8RA 4F1KA 2XAAA 5DLPA 5K8JB 2F59A 1H0RA 3KALA 4JXJA 3KTOA 2DPYA 2IIQA 3F8WA 1BCSA 4M0EA 1ZOPA 2DY0A 2EWVA 4MUKA 1APBA 3GJTA 2PUGA 2CWDA 4ZDWA 1T36B 3OY2A 1WNTA 4AS1A 3SGLA 1VRCA 1PN3A 3E9CA 3WJ7A 3EPHA 3C85A 1EK0A 2VUSA 5HIIA 5TJHA 1JEAA 1OMOA 1UBJS 4E11A 2V0NA 2C20A 1XPOA 2B61A 2CFSA 1QHGA 2VP0A 2TMGA 1BEUB 3BSFA 3C3KA 3FPHA 4LVOA 4TVBA 3F5DA 5KSPA 4ALMA 4EQZA 1I7NA 3NEAA 1QDLB 4RD4A 1EDZA 4CM7A 3GCZA 5HJ5A 4BMDA 5ALEA 1K08A 5FPKA 2QUBA 1JWBB 1RXEA 3PDIB 1ISJA 2KPOA 1AM4D 5BSEA 4NCHA 1DJMA 3L7JA 4JBYA 3TNFA 2EG9A 4IGIA 1N2XA 4WCFC 5KQLA 3LX6A 5K8UA 1SVSA 4W82A 3ZDDA 5B2ZA 4UPDA 3DPUA 4JL5A 1MAWA 1FUUA 3TVTA 4D8YA 3FCCA 1WM1A 3ZWBA 3ZW7A 1PZNA 1QHNA 1K27A 4KQCA 3ZWAA 2WZDA 2Q3FA 3THSA 1W73A 3AEYA 3UXMA 1U4OA 3SJAA 4AIRA 5JAMA 1ONNA 1RU3A 1RTTA 1X42A 1YB1A 2QLMA 4XVHA 1RYYA 4RIIA 5F7OA 5C9ZA 1NA5A 3F73A 1JZTA 2YV2A 3B6ZA 3UZUA 1HZZA 3EZFA 3ZDEA 1N5DA 3TTWA 1T0JB 1ZM7A 1EVLA 4V39A 2HWKA 1E7RA 5JAPA 1MTOA 4DT1A 2OM6A 4GRIA 3L7KA 2HDOA 1PZGA 1XZIA 2GZ1A 5EMLA 4AN0A 1LB1B 4FFBA 4DCNA 4CTOA 3N3BC 3TD2A 3OBIA 1BMFD 1K9SA 2J07A 4G8CA 1VLMA 4UULA 2Z6VA 4C08A 3SXUA 1VGQA 3ZZ1A 2X23A 2GPBA 1YR3A 3IIKA 2GZSA 3M9WA 3M5PA 1QKJA 3ZHOA 2P62A 5CURA 3WLRA 4GM0A 1KMCA 3V4VB 1JHAA 4ZK6A 1Z7YA 1JFFA 4FLMA 4LF4B 2F1RA 1VRVA 1M0WA 3AUUA 1D1TA 5IJAA 3AUJB 4Z3OA 3LT1A 4WOPA 4Y2XA 4JYPA 4U4AA 1CIVA 1AGPA 1OFTA 3DOHA 1M6VB 5BNTA 3K6JA 4LHYA 1NQUA 2G8LA 3EXIB 1W36B 2HFKA 4IH1A 4R2IA 2Q5OA 1EFDN 1NX6A 1YASA 2JRCA 4Q4AA 2NVUB 5JHHB 1ZN7A 5D3ZA 2FJ0A 3JQQA 3TQFA 5F4ZA 1BSVA 4HH1A 1ZGHA 2W2TA 4E2XA 3N39C 3CPHA 3ZIAA 3HPRA 3OF2A 4MRMA 4DADA 3ESRA 1DC3A 1G19A 3JQFA 1WP9A 4BHTA 1P4GA 3PPIA 3PDJA 4JC5A 2BYTA 4H3KB 2Z8XA 2O6HA 5ER6A 1N0WA 4RPJA 3V7NA 5ALVA 2ETXA 5L45A 1US8A 4LZPA 5CH3A 5ALUA 3SIRA 4A4DA 4C5AA 2XJ4A 1UCFA 1E89A 4PC3A 3OOEA 2UXBB 2JDIA 1EM6A 2Q2OA 2G25A 2X8WA 3IMEA 4MTCA 2ORYA 3B9BA 2Q8NA 3IVCA 1HQYE 4PZLA 3UICA 2NVOA 1FP7A 3C87A 3M4XA 2W2KB 3W8FA 2VDOB 3RIGA 1V0JA 4TKLA 3SDSA 3WGTA 1JFTA 3WB1A 2H00A 2VK1A 1T25A 3FH0A 3UFBA 1M75A 3WK4A 4AKEA 2J7KA 3INTA 4EW6A 4WLEA 3THXA 1YFZA 2SNIE 1VFNA 1CD5A 2FQYA 4GI1A 4FQ7A 1ECJA 4DOMA 2JI7A 3WGKA 4JUFA 4UE3S 1ZVQA 4GXTA 1C29B 4Y2HA 1AQNA 3S2GA 1YJQA 3ANXA 3NDBB 5A4JA 3OY7A 4KREA 1G42A 5EP2A 3IPLA 5LJLA 2O59A 3M1YA 3LCVB 3OAAA 1YRQA 3Q4GA 4NHEA 4OJMX 3CUSA 5TF4A 4W7HA 3LDFA 4UUNA 1QM5A 2XYVA 1N2ZA 4JELA 2R00C 3G2LA 1YOBA 1R8JA 5KC8A 3GMTA 4NWIA 5B2EA 1RR6A 3D5EA 2JFPA 1EAMA 2O06A 5EOVA 5BNFA 1PJ4A 2EC5A 3FYSA 3KJNA 2YKGA 1SC4A 4AM8A 5K0TA 3SYKA 1Z37A 5JYBA 4LA4A 1DRUA 2C2GA 4IIYA 4F38A 1UMDA 4ZCPA 1KU0A 1HEUA 1LW6E 3BMQA 1OWMA 4PRKA 4E13A 3QV2A 1HKHA 1SPXA 1IN1A 4ZIRA 1WDMA 4V1CI 1IJEA 3JSXA 3REGA 3IXQA 5JU6A 1L7QA 5H8WA 2C7BA 5B1DA 2ILVA 2OQIA 1IB0A 1L0BA 2PJUA 2QQGA 1SVNA 1J39A 2CHUA 3OHSX 4G1MB 3H2KA 2R86A 3FDJA 1T5TA 3L82B 1KF0A 5IDQA 5EMNA 1DBPA 2XDQA 2HRDA 3ND5A 4J1TA 4NQRA 1QFYA 2CDRA 1HY3A 3ESQA 3ND8A 1RPZA 2WP0A 2TECE 2IWHA 5JTUA 5HKBA 2E4XA 3EIWA 3FSGD 4KB5A 3K0FB 4WKGA 4MPPA 4G86A 2F1HA 5KYWB 3AF2A 1DJNA 3GCWA 1VJGA 5J40A 1U8ZA 4ZK2A 1Y6GA 4TOIA 5EQDA 3FPBA 1GFWA 3FFAA 4I0WB 4X62B 1U5AA 4DJAA 5MDHA 3WDSA 1ZICA 1OH7A 1E62A 4HEA6 4J0CA 1IG3A 4IG4A 3VZCA 5EJGA 3NXSA 2ZXFA 2V3VA 2WWIA 2XF2A 4AJNA 1BJTA 1N3IA 2FN7A 3CLRD 4ZEWA 5AJVB 3TMYA 1QV7A 2NPFA 3WGOA 2IE8A 4Q3BA 3JQAB 4KXMA 1NU6A 3WY9A 1W76A 2GB4A 2DULA 3G5MA 1LQUA 3L7YA 2EFGA 1R6AA 3OX3A 4B6OA 4EKDA 1B0UA 2WU8A 1ZOSA 2CXRA 2JKVA 3ZWDA 1RZUA 2HA0A 2P0EA 1F8XA 1U98A 2AC4A 3NP9A 2B1QA 3HU5A 5ILQA 3O21A 1LS1A 1JEEA 1M9NA 3PFIA 1FS6A 4ESHA 4Z5XA 3NZEA 4LS3A 3BE4A 1Z2NX 1IATA 3OJFA 2BMAA 2CHFA 1ISPA 5AKXA 2A1TR 1I7QB 2P2SA 1IDN1 3IQXA 4FE4A 2X2FA 4R7ZA 4C7OB 2R47A 1PGQA 3QM1A 2VI5A 1VCIA 4JL6A 3KG2A 3RREA 4ERXA 4L02A 4WFQA 1FFEA 2HHHB 1TUIA 1IXKA 3ZHXA 1QE5A 2OA0A 1QONA 2HIAA 2AD5A 3EG9B 5DGXA 4OP3A 3KX2A 5FEMA 5CFQA 3H9CA 4P33A 4IH9A 1ZD5A 4DRXB 3AY3A 3GBPA 1R0XA 1JQDA 2GM5A 5AM5A 4CF4A 1TE2A 4EI8A 2RAPA 4JFAA 1UZLA 3O83A 1M8KA 2Z4SA 1FFDA 5T3UA 3MTJA 1TTPB 4G23A 3PGA1 4QZVA 1ORIA 1P1CA 1SBZA 3PNVA 4IMIB 1E9RA 3I5XA 2Z1NA 4UM9B 1VA5A 2YRXA 5FHRA 1GIAA 3ANNA 3QG5A 2VSQA 3TB6A 4HNTA 5KJFA 2FW0A 3O3NB 3QVVA 4YJ3F 1QGAA 2GCOA 1QRSA 2HADA 2JHCA 3MWFA 2HLHA 4D80A 2NTNA 4WBXC 3Q7QA 3TMKA 3RADC 3ERCA 1HM5A 4UFNA 4OAOA 4YRQA 4HN9A 3NV7A 2BIFA 2NU8A 3DM5A 4FWBA 2Q99A 3RVKA 2H07A 3BF7A 2IP2A 3OQ6A 1HDRA 2NTJA 4E1AA 2VK2A 4R1MA 3GAMA 2ATEA 1FLAA 1IAQA 2PK3A 1A1SA 1JE0A 3GU3A 3GZNA 3REFA 5CAEA 2PNJA 2RI1A 3OTGA 5I7AA 3V55A 3O8CA 3IEMA 2CVOA 3QEJA 4ESVA 2WJHA 1WQ4A 3U7GA 4C4ZA 1BMFA 1TOAA 3A9CA 4JB2A 4J03A 4LJAA 3PJFA 4HDKB 3KXLA 1OU4A 1WSBA 5FB3A 4XIYA 1AU9A 4ND8A 4RJKA 4UC0A 2HMYB 3VPHA 3ZZ0A 4DCUA 1UBOS 3FOFC 2ZK7A 2AQKA 1XDDA 2F1OA 3FYUB 2BEWB 3FIUA 3IEKA 2E87A 3DE1X 4U5XA 3ZZUA 2OY0A 2CFOA 2QN9A 3L0YA 3JY6A 4RHFA 2H1OA 1XDUA 3P2OA 5AVSA 4BV9A 4KE8A 3VR0A 2F3TA 3BHJA 1W59A 5JZMA 2X3UA 3ROFA 2ZXEA 2HWWA 4UDOA 3IE1A 2PXXA 4HQKA 3UB3A 2W11A 4PX2A 1YD7A 4L9AA 1XG5A 1GFIA 4NCIA 4R1NA 2CLLB 2C8JA 1A7JA 5IM4F 2C7PA 4PZAA 2B8EA 3CZ4A 5TVGA 1NV9A 3UUGA 3A6PC 3Q3EA 2YWJA 5EJEA 5HSGA 1Y8AA 1CQJB 1EA7A 4XSVA 1MABB 5FNVB 5TF0A 3T5GA 3I6ZA 4ARSA 1U0OC 3KEGA 1S01A 1RHRA 3ZNOA 2O4UX 2ZTSA 4LXQA 3ESDA 4N01A 3S27A 1FYDA 5CMLA 3RJZA 1MFPA 3DV2A 4Y6LA 1TQDA 1YCFA 2PU7A 1D6SA 2SECE 4K1LA 2HRBA 5B3LA 3S8YA 2B7LA 4JJZA 4XI9A 3PL1A 3W05A 3ICQB 2X3FA 2J8ZA 2QPLA 1YCHA 3NWBA 4MRVA 1SNYA 1U04A 5E6RA 3QMPA 1E8MA 5GV8A 1T2EA 1U11A 1ST3A 5A62A 3ZQKA 2UUPA 5IAKA 2HDNB 4FQ8A 5F52A 3DA8A 1RXCA 4BBAA 1OX5A 5K0JA 2ZVQX 1Y1KE 2FZCA 2GRJA 3OCVA 3BJRA 3O4VA 2A30A 3HUTA 4GMGA 4W1RA 1PJRA 3IT1A 1OTYA 3OPYB 4L8VA 4FBLA 1NR5A 2EP8A 3PE3A 4HL6A 4TRMA 1C4WA 1H65A 4IJ5A 1NOJA 1KKLA 2WUEA 1RHMA 2ZBRA 5KSYA 4L2IA 4CPDA 5LQMA 1K6IA 1IN7A 1MEJA 2IYFA 1D2CA 2IUSA 2JLQA 3DULA 4IJ6A 1CG6A 3M6XA 1HSZA 1N7GA 1JT9A 2CVQA 3L8YA 3LKZA 4NULA 5F3RA 5GM1A 1QS0A 2PKXA 2GEDA 3BGDA 3WADA 1DQRA 1MJNA 3VZQA 1XK6A 2P5YA 4BMPB 3NTUA 1MN6A 3K9BA 2BFPA 4KR2A 2QW1A 1VKHA 1W48A 4DJFC 4NS4A 2IQIA 5BPFA 3RRXA 1TTQB 1N34B 4LHXA 3OURA 2A5GA 4GX5A 1UAAA 3TCNA 4E32A 2C07A 3VNSA 2HM7A 2OV6A 4Y1RB 3LE8A 4D9MA 4ZO4A 4Y1GA 5DTRA 1P0PA 5JFGA 1C9DB 4PSUA 1T9DA 1YRWA 1NJ1A 5BWMA 4D42A 2DB3A 1BC5A 2BM1A 2Z2KA 4M0MA 3U56A 3IA2A 5K4AA 3RAEC 1AOXA 3GAAA 4BWFB 1F9EA 3UK0A 1IFXA 2KJQA 3P26A 2FFRA 2G80A 1EVKA 1ZW1A 5LQNA 4WY5A 2P78A 4PLTA 4CIVA 2FFHA 3R4VA 2XUJA 4BN4A 1OPXA 4HG2A 4OQLA 4D0LB 4AP5A 1QP7A 1BDIA 1S7GA 4L27A 2I4LA 3KOWA 1S2MA 4X7RA 1SVWA 3FSGA 4CMIA 4GU5A 3EJ6A 3EVGA 4AZTA 5C81A 1N33B 3LIIA 1FDRA 4WBNB 4P35A 2J0UA 6GPBA 1KTVA 4D3ZA 1JPUA 3N2IA 2LCFA 5LMZA 2E7ZA 4XGRA 3GLTA 4L6IA 1VSQA 1USKA 2E4ZA 1X2BA 2MIIA 4K8OA 3LSYA 4AY6A 2AZDA 3IP5A 3R7SA 4KAFA 2COEA 3FDXA 1NGSA 3F3SA 4GL4A 1AJEA 1S7CA 4JJEA 3O9MA 1N6OA 4LFAB 2C4KA 2C8LA 3UUFA 5JJ5A 5C1PA 4RULA 2OGSA 2QXUA 1CRLA 1VKRA 2J4DA 3O5AA 3WLTA 2O8EA 3VO1A 4TYNA 5LPNA 4YGXB 5EQJB 4FS8A 4BLPA 4OU5A 1B0AA 2GX6A 1BXRB 2PH3A 3RK0A 4B6GA 2NSLA 3HLYA 3GQBA 4EBBA 3ZLVA 1U2GC 4BGVA 5ALZA 3EAFA 4LDAA 3GUVA 4F2WA 1RXUA 3PBKA 3E4DA 4IOKA 1A2KC 2R3SA 2F9FA 2OCDA 3LD9A 1J8DA 1USVA 4OAQA 3MBOA 5GONF 3LXUX 5A7HA 3O84A 4EF5A 3G89A 1EUQA 2KYRA 2JANA 1QUEA 2FDRA 1BOFA 2IHKA 1SPBS 4NF2A 1TIPA 4OBWA 3L4KA 1NDHA 2GDJA 3AF1A 2PNFA 5F7XA 4EJSA 3NTOA 5C3UA 1NW7A 3OZEA 4DR1B 2P3OA 4MRNA 1U8UA 3ESXA 5CVJA 2JZCA 3KJHA 2CNOA 1QNFA 4EGAA 1DXQA 2VT7A 3ZG6A 1QE0A 3KSBC 1M2OB 1JJ7A 2WA1A 4UVHA 1QYXA 2D0PB 5CU7A 4DLZA 3PGJA 2W2OA 1K97A 1OX6A 4PNZA 4CV1A 5LIPA 4CKEB 2H7YA 3L8CA 2HCFA 4EG1A 3RYHB 2FLVA 2NQ8A 2QM8A 2QTVA 3EB9A 1T91A 2LWIA 3HV0A 2P6RA 2QD3A 1B6SA 1PJQA 2BFFA 3E3OA 3QFCA 5COBA 4BGDA 1WO8A 3K3PA 3A04A 4US2R 4WERA 5LZ4A 2RHWA 1HC7A 3CUKA 4PZDA 1DQZA 3K1YA 4OQYA 4BMYA 2HCTA 1YL7A 2A9VA 4FGUA 1F2UB 2ZT6A 4M1ZA 1U0EA 1REQB 4DV3B 2XX3A 1KI1A 1OU0A 2BDUA 1EFUA 5AT1A 1P7YA 5E7MA 3WGYA 1N6HA 4HF7A 3WK7A 4EYQA 1K7SN 1THGA 2JIPA 2GD6A 4ZVKA 3IOEA 2C29D 1BYUA 3OO1A 4Z3KA 1T10A 1XRNA 2IOYA 4NBWA 5FTJA 1KJNA 3O7MA 3H3JA 4JQOA 5FULA 2Q8QA 4IICA 4R9NA 2XVYA 4HGPA 3VV2A 4LOHA 2PD6A 1SIBE 3QZUA 3A1CA 5BSVA 1RJ9A 3GOHA 5AESA 3ZDBA 1Z06A 5JV5A 1ZWKA 1MA3A 1YXMA 3GPDG 4G0YA 3O3CA 1PBTA 2AW5A 1Y3AA 3IUSA 1KR2A 1PG2A 2WT4A 1JLLA 3WRXA 4DY4A 1EFVA 3NTXA 3MB8A 3T5BA 4BBZA 2YC2C 4RAQA 1FUKA 2HXGA 2I3GA 3BJIC 5AYVA 1NKVA 4YUZA 5DOZA 3AY6A 2WT8A 4ITVA 1NL3A 5AW2A 3TL6A 2HA7A 3V8RA 2BJVA 3F6SA 2V7VA 3DVRX 1HL7A 4IJVA 2ZI9A 1L8XA 4NMHA 4OOFA 2C2HA 3ADKA 3L06A 3EXHA 2FQ1A 3T94A 1C9KA 1NJSA 2JATA 4OLFA 1PUXA 1T0HB 3H0EA 4EPVA 3EVAA 3S2YA 3T3NA 2AMFA 2ZRKA 3EVZA 4TUYA 2QRUA 3QTBA 1FS4A 1U0JA 1GZ3A 2B3DA 3H11A 4KRGA 4RPGA 1WCYA 5FDFA 1DINA 1CXZA 4DMLA 3PXEA 3ZI7A 3ON5A 2P9HA 1R8QA 4RA9B 4IIEA 3WV5A 3X2EA 2WWGA 4YV1A 2MSEB 4TRRA 4KR3A 3QU7A 2WKSA 2I78A 2HQBA 2XMBA 1TLTA 3ZY4A 1KEPA 1DX4A 2OV4A 3ZJ4A 1T9CA 2R84A 3ZLUA 2E55A 4EQ6B 2RFLA 4TKZA 1P6XA 4CV3A 4YP5A 3ZGNA 4LFCB 5IP5A 2Q3DA 4M1KA 4S1TA 4UM7A 3TPCA 1UPAA 1KXZA 1ECFA 3L1KA 1EWQA 4MGYR 1OYOA 2VBFA 3GJ7A 3IP6A 2WYHA 2C42A 5F2NA 1ZAYA 3GAFA 1J42A 1F06A 3NONA 1R3DA 4HN2A 1LJ8A 2DVMA 5DEOA 3WGZA 4BEBA 2MSWA 1SCKA 3FCAA 1XK7A 1KI2A 2PRYA 4LY3A 4TVKA 4ZQCB 5LNK6 1PNRA 5K3CA 1ZJWA 3HDYA 2WJJA 2FCAA 2W93A 4G2NA 4DAOA 2WEKA 1EK6A 2PLAA 2PGIA 3MF4A 4WJKB 3OTOB 1ZN9A 3JSAA 1G66A 1A9RA 1DKPA 1BGXT 4FONA 4EUEA 5BWCA 3A9WA 3SI7A 4AECA 3T5PA 4YRRA 1UKYA 5BUCA 5DGDA 3VPGA 1I3LA 1NQOA 1Z2CA 2TYSB 2YV4A 3LMKA 1IM8A 2ADMA 1Q1GA 4IYRA 1AXRA 3G8AA 2XUPA 4BLWA 3AJ9A 1NW8A 4KN6A 3W8EA 5A9SA 4QHSA 4TLDA 4V2UA 2A9JA 5D6NA 3OPVA 2ZSJA 3IDAA 1U3TA 2GYYA 4KE9A 5TSDA 4R01A 3BIWA 4B09A 3H87A 4BN0A 2IYQA 3GPIA 3TLEA 3AZPA 3N5KA 3PFHA 3V7FA 4J1SA 4NTZA 3TD9A 4WXRA 2M32A 5D7NA 3QKTA 4G4SP 1MF7A 1X80B 1TFRA 4D9BA 4Y2QA 3QE9Y 1PGNA 2Q5QA 1DAIA 3Q2IA 4GD3Q 5DMXA 1L7EA 4QBTA 5D5PA 3B9PA 1FLNA 5DYNA 3ZWWA 1OREA 2XCIA 5K6TA 2R4QA 3RYIA 3T1QA 4RKWA 1NMYA 1RTKA 3S6JA 2OCKA 4DTIA 3CVOA 4LE1A 3WL6A 2G1PA 1UZMA 1P3Y1 3ZVKA 3MCWA 5KX5B 3M9XA 1II8B 1SEPA 2CXPA 2ZB4A 1KZ7B 4B3GA 4QBGB 3C1OA 5M04A 3S1AB 4LYAA 1Q0TA 2XW6A 4FGSA 4KQ1A 1A04A 1H8ED 3F6BX 3L1UA 3MNFA 3SK0A 1F0NA 4JP8A 3BH0A 1EFPB 3GT7A 4LISA 4R8RA 5KJCA 1MJGA 2O2XA 3W5JA 3U44A 3SX2A 3FZQA 1F48A 2HA5A 5DBIA 5ESWA 3HBJA 4GKBA 4G56A 5CYPA 5BQ5A 5EKXA 1PUIA 3D59A 4AWXA 1YZKA 3OOWA 4JC8A 4YP0A 4OCZA 4PY2A 3R0XA 5GZ6A 4AD8A 3NC4A 1CZUA 2OCAA 5TJ9A 3VMMA 3HN7A 1DTEA 4A26A 3B2EA 5KWJA 4IZOA 3SC2A 1VJ1A 1DEKA 1RQGA 1Z6PA 1GM5A 4HDSB 2CF6A 1P2UA 3AM4A 1Y7IA 4MP8A 3JTMA 4OXKA 4QOIA 4X94A 2JLXA 4EY6A 1XTJA 3R6GA 4QYTA 3NHLA 2YYAA 3GC6A 4A6DA 1DQPA 4X84A 1R9MA 2IPXA 1HTBA 1WLYA 1OSNA 2VHEA 3HACA 4IXDA 3NHRA 1H1LB 4ROSA 5AVJA 5JRZA 2PTGA 3WLOA 1P7VA 3QVWA 1IBMB 3UJNA 5KTKA 1EFCA 1F6BA 2Q4RA 3ZWCA 4F5DA 3MPOA 4KW7A 2PM8A 5LQUA 3TQTA 2B4YA 2Q07A 2GBGA 2Y1XA 1SG6A 2XD9A 4E14A 1VJTA 3FVRA 1PR4A 3QWIA 5E7IA 4CCYA 2RBEA 3V7UA 5CH8A 3EIEA 2P67A 1QGOA 2C2YA 4G5OA 4G4GA 3ZJYA 3DZCA 2VTEA 3JQAD 5BV2P 2FNAA 4UEWA 5JANA 1ND6A 3EXEA 5FA8A 1U9IA 2JAPA 1SD5A 3RG8A 1WU7A 1CUVA 1HLFA 1POWA 2MYNA 3NDIA 4RHTA 3KSZO 5HZMA 2PVSA 3DKPA 3QELB 4EEZA 1NI3A 2VPQA 1MV5A 3EEQA 1JS1X 1HDYA 4DWWA 3EQ8A 1HDGO 4KO2S 2EIXA 2ZYSA 3RUCA 3I1FA 1WZCA 3RC7A 4N7BA 3D6UA 1WJGA 4NC9A 2VHCA 4P81A 2JA2A 1QIHA 3V00A 3CW2A 3VA7A 3RUFA 2WDZA 2I7DA 1P9LA 1JV2B 3DFKA 4BRWA 5DI3B 1JDTA 3PEWA 1VB3A 2WP8J 2ZRBA 1EFHA 2AF4C 3ITEA 3SJCA 3AL2A 5K3BA 2J31A 3WMRA 3HB0A 4YRNA 3Q3VA 2GM4A 1N8TA 2E2WA 2FX3A 5CJPA 3SLRA 1RYHA 4YCCA 3IQZA 2PQMA 4LSWA 1ZCJA 4IWXA 5B1SA 5ICGA 4MW9A 4F3CA 1BD3A 3AMVA 4A0SA 4BTLA 2WVJA 5J5CA 4XARA 2PGXA 4AS2A 3W8RA 5KNBH 5JWHA 3ZWMA 4RMNA 2HA6A 1KK2A 1GOTA 5T8KC 4TTRA 2FEWB 4H1HA 1ZC4A 2ZDQA 1C4KA 4UM9D 4KR9A 4NATA 1MB3A 5KOIA 2WQ7A 1P1KA 1BDBA 1HLGA 3GN2A 1W19A 2VDNB 5EQTA 2ONKA 4ZAGA 5L7YA 1J06A 2Q5FA 4BV3A 5D8DA 1EKXA 2E18A 2QLBA 4OYRA 4D8TA 1AURA 3N5CA 4PO9A 5A7GA 4BMCA 1P77A 1PNTA 3E1KA 1IBCA 4NAVA 1OI4A 3NV9A 5AVOA 3USES 1G7TA 1PWZA 4BKPA 1AXEA 2XB2A 3RABA 4DRYA 3DAYA 2HLPA 4M1QA 3IQGX 2BFMA 4WMLA 2GAJA 4Q93A 4IMJB 4JODA 5CA0B 4S1OA 4A23A 4MYTA 3WIBA 2JLSA 2JIQA 3Q8LA 1XMQB 2R5NA 5EIHA 1MT0A 2W71A 4ZO8A 2ZW9A 1SHLA 4YALA 2JIMA 1EK1A 1RZ3A 2JJYA 4WRRA 1USIA 3LDGA 3AF5A 3UJ8A 2WWHA 3T9AA 3LQRA 4Q48A 1RS0A 3CE6A 2Q6TA 4RDIA 2GPAA 3NHAA 3H4MA 4AFNA 4HS9A 3W2TA 2J5RA 4CL3A 2X7HA 4QO7A 5DBHX 5EWLB 1R9JA 3CRW1 3HWWA 3QHQA 1RFLA 2O2JA 3NBXX 1N5LA 3PXBA 5DK6A 5BYBA 1PS9A 4D9HA 4EOGA 5ECGC 3IKVA 2EVWX 2C3OA 3F78A 4LKRA 1EB9A 4JP3A 4E5YA 3UMMA 3PFBA 1JTEA 2ZS9A 4KODA 4U1RA 3MM4A 4J29A 4ZO6A 2JRLA 2HF8A 5DNVA 3H9GA 4H0NA 3G0DA 3KQNA 1GPH1 3IMKA 4RHEA 4YACA 3L18A 4U7GA 1MJ5A 3HRKA 2GK7A 4U0JA 4JLMA 4QLOA 5TXGA 4KR6A 4PZPA 1HT3A 1PWYE 1L1RA 2BEKA 1BRTA 2HJGA 1G5PA 3ETEA 1JWLA 2YMPA 4XPIA 1ZGZA 2LE0A 4DV5B 4EGQA 2PSSA 4RLFA 1G5TA 5ALLA 3VDQA 1HNXB 1AB5A 1NPYA 3CZRA 4R98A 5BW6B 4DANA 1TK9A 4BRUA 4LF9B 4B17A 2NTVA 3H5LA 4XYGA 1SUDA 4BO8A 1ZIOA 2E9SA 1F8GA 3HDTA 4IMPA 1HBJA 2HLDD 2V4ZA 4Q4DA 3F6PA 1I10A 2P75A 4KFTA 2VNSA 1B23P 1HT1E 4J43A 4PS1A 2R5FA 1TA0A 2FA9A 2XGOA 3KSMA 2UUAB 4MCIA 4BMZA 1CPYA 3PLNA 1WDLA 2WD7B 3FF4A 4L4ZA 4BVJA 2E1PA 2C3YA 3D3WB 2BM8A 4P7BA 1L1FA 1FTWA 5C52B 4EFDA 3OOJA 1B2LA 5HQTA 1X1TA 3GRRA 5A3RA 4ZCQA 1GUFA 2H1VA 3GCXA 5BOVA 3OLQA 1MNAA 4FC6A 3UT0A 2V59A 4FHZA 1UFKA 5DEIA 3PPWA 4HQRA 1E20A 2GZ2A 1D07A 4UD6A 3TAHA 2FPLA 3DBOB 2RC5A 1ODIA 3DMGA 2AJDA 4RJJA 3EN0A 2OBFA 1PDVA 5AD1A 1UKBA 4MKHA 5C1IA 1BWRA 1HTWA 3DCJA 4E2WA 4F71A 1YIDA 1R4NA 3L92A 4N7RA 3D6JA 1TJ4A 1C0KA 4C78A 4YCNA 4YLEA 5J43A 3S29A 3PC2A 2XI4A 4UXIA 1I6KA 4WZAB 1UBSB 4MGKR 5EESA 1P3DA 4ZOAA 2ZWIA 3D2LA 3H8SA 5BV7A 4YLYA 3NDPA 2P4QA 3ASUA 1RYZA 1TM5E 3CINA 2FSFA 2OECA 1NY5A 3VSAA 4FZ5A 1CZHA 2D0IA 5ENVA 1RXWA 4W5NA 4GOOD 5BN4B 5K9ZA 3LT5A 3V42A 1JKXA 2RBGA 3RRFA 2C3MA 3GDHA 3I0MA 5TGTA 1PJ8A 4B2YA 1H3EA 4LXGA 1YB6A 5K0SA 3AXSA 4ND1A 3DWEX 3RAFC 3UOAB 4KDEA 2Y9MB 3BE5A 3KAJA 4G89A 1SVUA 3DBIA 2J5BA 1GCAA 3MGGA 4ARBA 3RM3A 1TJNA 2A2ZA 2WSMA 3DJYA 4A5OA 3E22A 2O14A 4PTLA 2QD1A 3RS4A 9ABPA 3UGJA 4MUBA 2QX7A 2XCUA 2CVPA 5FYDA 2PYIA 1ODKA 3AZOA 3UYLA 1R6BX 1XWWA 3UIEA 3B78A 4EY7A 3GRPA 2ZCVA 5AICA 4ASUD 5HWSA 1TYCA 4MULA 3UJAA 5KJ1A 1YVDA 4LRSB 3FWHA 2VR1A 3I5YA 3AP1A 2PJRA 3R20A 3ZIDA 2ZB2A 2DHEA 2HTEA 1FU4A 2J85A 3CM0A 3F5FA 2HCRA 1HI9A 4J75A 4BJ5A 1JZSA 5H68A 2QI9F 5IKPA 4IVNA 2Z3ZA 2R96A 3DCNA 1L5ZA 4ZYXA 1ZCZA 5AQ1A 2ZUVA 2O20A 3V8PA 4AO8A 2QENA 4KGZA 3AF4A 4GHWA 1V8PA 2QRVA 3F6RA 1MC1A 3EDQA 2EFYA 4HUQB 5HX7A 2R7LA 4WKCA 2O0JA 1PLLA 4U7DA 2HB6A 3D8UA 4OGFA 3UMRA 4BP8A 2JLUA 1G6OA 1WXXA 4DQLA 1XKLA 4LZLA 1HDOA 4INPA 1XRLA 3V3TA 1KA9H 1QVAA 2JGJA 1PFKA 4TL9A 1XD8A 1XF1A 1N8SA 4GMKA 4FYIA 4X92A 1DC5A 2FETA 1KVTA 4XGIA 4KYUA 5BVHB 2HW8A 4PS0A 2E4VA 2H57A 1NXOA 4Z0HO 5IASA 3M6MD 1VHWA 2CSXA 3E9QA 2A33A 2XMPA 3D5QA 3R40A 5AUPB 1P73A 5ITVA 4JI0B 2DUJA 4ZOBA 4A8JC 1UPUA 2FXIA 3K0HA 1MX1A 1SELA 4QRHA 4XVUA 1RWBA 3I61A 2CLMB 4G1EB 3GLVA 1G2QA 1OXKB 2IYZA 2PQ2A 4X97A 3I5UA 4D0RA 4C4YA 2OAP1 5K6AC 1FDSA 1TW3A 4FW9A 1PGPA 1YRHA 1ZKMA 2QR5A 3LVRE 1FRFS 4NENA 1JJAA 1RI3A 1NOKA 1KWGA 3TW8B 3IOCA 2V7BA 3MHPA 2ZJ0A 1JEOA 2HGZA 3BXGA 3QPBA 4WTOA 3TGLA 3N75A 1AUQA 1GUBA 4M6WA 2AXQA 3SNHA 1AK2A 3DTNA 5FQNA 3T7EA 4ZXPA 2QX9A 3F98A 4BP9A 1E1RD 4E5NA 3S1SA 1DBRA 3RU3A 3URMA 4L73A 4OQXA 1E5LA 4R2XA 1MW8X 3OPNA 1HNZB 3WBFA 3ZEIA 1NN1A 1CYDA 3BERA 4KJZA 2HQSA 1KL7A 3FA2A 4O6VA 1YDFA 5FI0B 5FA5A 4Q3NA 5HIKA 5KKCA 2O7SA 4Z8YA 4RE6A 821PA 2F8LA 3VKFA 2V6JA 1PP4A 2AV6A 5EGNA 3ZCVA 3BMOA 3QW2A 4GWLA 3RSHA 1N2CB 1S2GA 3HM2A 3CH4B 1E5VA 3AI7A 5B4TA 5DNUA 5J2TA 4S05A 3PF9A 1FNCA 2GXQA 5L4NA 3QU2A 2IHUA 3VOBA 2PL9A 4JP5A 4CG1A 1ZSNA 4LVUA 2NU7A 1YE5A 3H8JA 3I1YA 4DCOA 1E9BA 4HVTA 5H82A 4KN8A 2X2PA 4F1WA 2IGTA 1C8LA 5JROA 2YFYA 4K6FA 4ANFA 5FLXA 3U09A 2O8VA 2ZUDA 2ZRIA 1NC1A 4KNVA 3BXXA 3RRNA 2XBLA 4Q9KA 4WLFA 2VH2A 4NKRA 2VUUA 5E0OA 2FSIA 3D6AA 2YWEA 3LHIA 5KYKA 3HNRA 2QBYB 5FPQA 2JAHA 3A3NA 3IUYA 3CTMA 4A1OA 5ERYA 2WI8A 2J9RA 2BCJQ 4XB2A 3F47A 4Z3DA 1Z7BA 4EECA 2XTZA 5BQFA 5C5CA 4NYIR 4OF4A 5C46F 3JQDA 1UJ4A 4IUYA 1RAGA 1IY8A 1NI4A 1A76A 3NKFA 4WESB 3BS4A 1NE2A 3SC3A 4UEQA 2C4WA 5CH5A 3BOSA 3QQ5A 2RGNA 2QT1A 2X15A 1BX1A 3CYFA 4GSLA 1HT0A 1Q16A 2JFYA 2VYQA 3PUKA 1QYVA 3CPEA 4QU5A 4DV1B 4A36A 1R9GA 4KQJA 1GPLA 4XTRA 1ZK1A 3ZWYA 1QYIA 1XZCA 2I99A 1BFKA 1GL3A 2VQDA 2D5AA 3O26A 4D97A 1UL1X 1HV8A 2WWYA 1CEEA 4GBED 1IMOA 4WIAA 5F21A 3TKYA 2EATA 4NI5A 1FVXA 1ZESA 4LBWA 4OSOA 4H77A 3TGWA 3VJMA 4LQCA 5JD5A 4NCBA 3R5JA 4FYKA 2X13A 4Q21A 4F4HA 3BRQA 3L6RA 4CMAA 4EKYA 1EVYA 2IUEA 4AMZA 4HHEA 1CUGA 3LBNA 1BXGA 1KOFA 2NT3A 5LZ5A 5EN4A 3PV0A 4BAUA 4JI3B 4QUKA 2RGRA 1SIUA 2CUZA 2ZJFA 2HLDA 4ZYYA 2HF2A 2OHOA 3F1LA 1GDTA 1QH1B 1LDGA 4J90A 1JMYA 4U39A 4LF7B 1R10A 3FLEA 1R8YA 3R8CA 2ECFA 4G0QA 4OMCA 2PIAA 2NGRA 1KO8A 1KKUA 1J07A 2BGKA 3UWPA 4RD3A 3UA4A 2EZ9A 2ZSHA 5FUMA 1KAGA 2BZSA 4WJZA 2XMGA 2IYAA 5SYMA 1K1EA 1WXFA 5HNKA 1B6RA 5EJ4A 2OUKA 1PNOA 1NXXA 4F4JA 4U02A 4BNMA 4HJXA 1OC2A 2PBFA 2DBZA 4TMFA 4DV7B 1UDAA 4PR3A 1PNQA 1UJBA 1CY0A 1MQ8B 1KQOA 3KAPA 4RVOA 1YZLA 4MUEA 5H7XA 4Z1OA 1SD2A 5JEDA 1DS6A 1LLQA 2Q4EA 2QGZA 2DCMA 3KV3O 3L3BA 4XFDA 5HEKA 2ODTX 4DSAA 4H27A 1A88A 3GZJA 3BTOA 1NSTA 3T3EA 5LL6P 2EQ5A 2LTAA 5K8IA 1XEXB 2W42A 3V2HA 4KQWA 4GP6A 2HJ9A 4XLZA 2E5WA 1TF7A 2KE5A 2D1FA 2VUTA 1RKBA 2XMQA 4NH4A 1GPDG 1H2AS 3KOYA 3CLVA 4PANA 3K9WA 4RVFA 4ZVUA 1XTKA 4Y1FA 1AMUA 4DPKA 4PR0A 1KMIY 2JAOA 1FFXB 4ZQFA 4HDMA 4MIEA 1XRQA 5DYWA 2IP4A 2AVNA 3ZV3A 4BO9A 5EZYA 1BTOA 3MTBA 3ZVMA 1ZY2A 4E3ZA 1DEXA 3RTCA 4L7QA 3UW1A 1Q1BA 2C57A 2YN4A 4B32A 2QZ9A 3SC4A 1X19A 2Q21A 2YBEA 4ZEVA 1ATZA 1NUPA 4G6ZA 4A7PA 1R2QA 3RSCA 2WJ6A 1IEXA 2VH5R 4TLCA 4MKIA 1UMBB 3ENWA 4ASUA 2R8RA 2Q2VA 3SYLA 3H1AA 1Y3BE 1H42A 4M37A 4YI3A 5ALQA 4XYBA 4IRMA 2IUTA 1LDEA 1FFCA 1C7QA 1CDDA 5IC5A 1ZA2A 1VLJA 4Z9YA 4JENA 5F98A 5AK6A 4NIMA 1PJZA 4TT3D 1Q7TA 3GDGA 3P7MA 4ZTUB 2CNWD 1IONA 1IRIA 1CSEE 2G6TA 4DDTA 3HCFA 2ZVPX 3K2BA 3ZJTA 4AJ4A 3PD1A 4UVGA 5E0KB 1I7LA 3VJLA 3WGLA 3II6X 3R3VA 1XEFA 1LI7A 3VKGA 3K4QA 2D5LA 1Z8FA 2H1FA 1W0JD 4WOCA 2FPGA 3DL0A 4DXAA 3V97A 1XIVA 2BBOA 3L5KA 5JLJA 3T5TA 2XCQA 3BWEA 4F4FA 3NVDA 2W2NA 2Q0XA 1P5JA 4FYYA 3IESA 2DLCX 5A0VA 1ZUWA 3Q3HA 4NX2A 3U0VA 2PO5A 3M3PA 1S2IA 4D3XA 5JTTA 2HRQA 5AW3A 1DQSA 1FYWA 4NEGA 3RBVA 5JS1A 3HEBA 4HYYA 1U1CA 2DR3A 3F4BA 2GASA 1G17A 1P33A 2C7VA 4BB6A 4C07A 4RZUA 3RG2A 3AKZA 1BH2A 3IV9A 2CJPA 3HVJA 4OFZA 1K8ZB 1DAGA 1EJBA 2XB9A 1B3BA 3I2IA 4H18A 1G8HA 4AG5A 4EIWA 3RVDA 1G4AE 1AHHA 3NAMA 1SXHA 3IPCA 2P3SA 4DILA 3EVTA 4WKNA 3B1XA 1HUQA 3Q1KA 1XALA 1O96B 3TXXA 5FBVB 1YVEI 3AOEA 5C53B 1JB9A 4C0BA 1T6ZA 4MSUA 1CY8A 3NAQA 4W6QA 4N5DA 4WNAB 3DEHA 3HP1A 5LOVF 2B7BA 3AX6A 4QKQA 4JQYA 3I01A 3V33A 1ZI6A 2XEXA 2JFBA 2J5XA 1J8MF 3FGZA 3AEKB 3FOEC 4GNRA 1IEVA 2PWBA 3VUEA 4LBVA 3LU1A 7MHTA 3TS1A 4YR9A 2DHQA 2I62A 2FMHA 2QP3A 4I4CA 1CULC 2H4WA 4P7JA 3TRHA 4FBGA 4OHBA 2EZ4A 2HGSA 5LP6F 3OCUA 3SU8A 3WFIA 4A73A 5ITWA 1CTQA 4RTJA 5AKEA 1ETUA 3B48A 1J7JA 4GDMA 5JY6A 1GTSA 3QITA 1XJWA 2ABWA 2BKLA 4YJFB 1AQLA 1S8OA 3QX8A 1DXYA 4D4JA 2GJSA 1RRPA 4PLWA 3GUYA 4FSDA 1FUIA 3BFPA 3WLHA 1DAEA 1U8YA 3UK1A 4DSOA 3U9LA 3B1YA 2XLBA 3BRSA 3B6IA 3QF4A 5A9RA 5E3JA 3QPWA 5FOVA 1OWNA 2J0VA 3T95A 5L3ZA 4JX9A 2WJ4A 3FLMA 3W5SA 3ZQ4A 3EQZA 4QJ5A 4R1PA 1OF1A 3PKZA 2OBMA 3AQIA 1RRMA 1F4LA 5FJIA 1HFEL 2ANBA 4ZGBA 2CVFA 1IY1A 2B8TA 2I87A 2NU9B 2BMFA 1GKYA 3D4LA 3PC8C 1PV4A 1GGFA 4P4TA 4ZZ0A 2IVZA 1IOZA 4AQ7A 1IEQA 1Q74A 2YWCA 1VQ1A 1SU7A 2XQFA 4P4GA 1F3OA 3AW9A 3SQNA 3LO5A 3OQPA 4D92A 1MQ9A 3I9KA 3FY4A 4JT2A 4O1MA 3U1BA 1CJKC 2J48A 3GA7A 4JJAA 1U7WA 5BURA 1G8YA 1H5QA 2D1SA 1DHTA 1P0IA 2HMTA 5AVXA 3EGXA 1JU9A 1Z88A 2XNJA 1SB8A 3FTDA 1CR0A 3JQ7B 3LGXA 1C2YA 4MO9A 4TWZA 3OLCX 2W43A 4LC0A 2I6FA 3GR6A 4HNGA 1OBOA 4LMBA 2PT5A 4GG1A 4B80A 3AXTA 3K2IA 4BNHA 3EBLA 3ZDFA 3C70A 4RK6A 2RIRA 1JU3A 4N6NA 1ZIDA 4CEHA 4K6KA 3A3YA 1CUWA 3FI9A 3P0EA 2R8EA 3ZU3A 1O9HA 2UUBB 1ULHA 1H69A 1GUYA 1RE0A 1WKVA 3ISVA 4RUKA 4R69A 5FT9A 1OLUA 3OQVA 1ZL2A 5T4BA 3W2IA 4CF6A 2WIDA 5FFFA 3BWVA 4CMCA 4XLTA 4FXOA 1W25A 3T52A 4CQLB 2YWHA 5AHXA 1MO2A 5FKJA 3RS7A 5TX7A 1E7QA 1DNPA 3IRUA 3TTUA 3ICPA 1ZN2A 3H2JA 1FFAA 3H2SA 3Q8WA 3OP4A 3COJA 2Z09A 3PDUA 4HMQA 4NBTA 3L0DA 4R5HA 3FUWA 2WTXA 1S9HA 3O6VA 2ZQ5A 1X7ZA 2E4UA 4R68A 1LD3A 1ESMA 4TTVA 1MZVA 2V7QA 3RTGA 4HBZA 1CRZA 1G9TA 1WB6A 2XVMA 4S1WA 4IKPA 3J7TA 4I81A 1QHEA 5EE1A 2HSJA 3U4AA 5CCEA 1VE9A 3AUSA 1F7VA 1KGSA 3BXFA 3C41J 4B6QA 1RJEA 3R0JA 4A8JB 1GPYA 4JQCA 1YACA 4MROA 5E4JA 2VJBA 2UZAA 3DMRA 4IDFA 5AW6A 3EH1A 3TUIC 2AR9A 4FLFA 1WP4A 4IQGA 4NMWA 4HEQA 1AY0A 5BRAA 5IXYA 1K8XB 3VU9A 2RDMA 3EEOA 1Y5IA 3HG7A 2C2MA 1RWWA 1Z29A 4ZT7A 4E31A 5FPSA 3O2SB 4YN3A 3NYWA 4W7IA 2RB4A 1PTJA 3AEXA 4P3YA 2AJCA 3V8QA 3ZLBA 4JHXA 3C8HA 5BQOA 2E85A 2AYXA 3LX5A 3SIXA 1I36A 4ZV4A 1M2KA 2C7OA 1WB9A 3IRVA 3SS7X 4F04A 3LT0A 3WVNA 1ZU4A 2H48A 2D2EA 1J24A 3HYCA 4KDRA 4R0VA 1IWPB 4UJ3A 5BT9A 3L9XA 1J1UA 3PJRA 2EWMA 5EXTA 1SHZA 2QI9C 3BGOS 2AHOA 2FR0A 1S8NA 2QX8A 4PRZA 5BNWA 4KXXA 2XCLA 2PJDA 3IJPA 3DMDA 3IBYA 1K86A 3PE6A 1USWA 1I30A 1KMMA 2J5KA 1I2DA 4UE2A 4TS1A 3V1LA 1A3CA 4N0EA 2YHUA 1A4RA 3U4QB 5KOHB 2Z57A 3ELBA 1FTSA 1KSJA 4S2UA 3TVYA 4XYLA 2X14A 3AB7A 3KKZA 1V37A 2YY7A 2OWEA 2OZVA 3D4PA 4MWCA 1TX4B 4Y8VA 5HGXA 2Z9DA 3UAWA 1LJUA 2V7GA 3KSUA 4II2A 3ORFA 3ABQB 2DXIA 3RYCB 2A1IA 1YZNA 1P62B 2G6BA 3LGAA 1PL0A 3BXEA 2IXBA 3CS3A 3NBKA 3CJTA 2H11A 2PT9A 3NM5A 4R8LA 2P3LA 4ZQHA 1GQOA 2A9FA 4EJFA 4DV2B 2I5PO 3PGVA 3KUCA 4YDRA 1FDUA 2F7SA 2COKA 2GOYA 1V2HE 5AXDA 1YMQA 1DJOA 4FN5A 4QTYA 2CNWA 4Q37A 4BFWA 2G9VA 3L8EA 4RV5A 3LVFO 2IXGA 5CM9C 3WXBA 2B4RO 1RLOA 1MVOA 2D2XA 3VHXB 4MA0A 5FWXA 4YXFA 2V3CC 4QUAA 5DCWA 3NT4A 1X94A 3B85A 1IDOA 1S2LA 3MWEB 5AJXA 4JI1B 4M9XA 3B9QA 1W0JA 2VHTA 3KVNA 1RRKA 3QFHA 4UHBA 5F64A 4B3FX 3FDIA 5IPFA 5SY6A 1RWNA 5CEEA 2H06A 5E8JA 3QP9A 5G0VA 1HMPA 1QE3A 2BI8A 1DWPA 4EL5A 3AKYA 3V4RA 5IXSA 4HMPA 2NSYA 4ISBA 4KVAA 4EB8A 4G1FA 2JIBA 2NZJA 3KETA 5EHXA 4X63A 1CC1S 5P21A 3JWJA 4JVNA 5BRNA 1Q1NA 1ZEJA 4AK9A 3UMCA 1OBCA 3I6MA 5LQCA 3GCDA 3JTEA 4HDNA 2DFPA 3OU2A 5KJEA 3NP7A 2ZSFA 2V6MA 4Q6WA 2FSSA 4F0JA 4DLTA 5C35A 1Z83A 2AMVA 2XYGA 3P9NA 2DCUA 1GVHA 4MVJM 2XMDA 4YI5A 1FSPA 3CNQS 2XBUA 2EFEB 2YJNA 3DP9A 3HY6A 3L1IA 2ZJOA 3NANA 2BKVA 2HWXA 3PA8A 4FDAA 1N6IA 1XKTA 1PFGA 1I3CA 4LSGA 2DHDA 1AX9A 1CUHA 1C7RA 3GJXC 2C3PA 3SFVA 2GN4A 4CMBA 2G36A 1O97C 1LVGA 2CYAA 2P7HA 3PWZA 3RD5A 2OQ2A 1NW4A 1OVMA 3O1JC 4NLLA 4URZR 3Q1LA 3NNDA 3WNDA 1X77A 3K0AB 3K9LA 3ZGVA 5IS2A 4ZWNA 4YTEA 2DERA 1SUWA 1C8KA 3QFFA 5M7EA 1NSFA 3AR9A 5IJZA 2ZETA 1E3WB 1B74A 1IM2A 2Y1LA 2Y6VA 4XR9A 3VO8A 3CRZA 1R3UA 3WZMA 4JVLA 2YXPX 3L8FA 1WXIA 4A8TA 3AVPA 1CUIA 1T9KA 3LLCA 3R0QA 4L5AA 2N3ZA 5FUBA 1L5NA 5HYVA 3CLKA 4BVLA 5F77A 1OYYA 4RAOA 3JAKA 2ZJ7A 1NIJA 2GUWA 4QU0A 3U2QA 1Y9JA 3I45A 3TIGA 1FPMA 2Q5LA 4LKOA 4DG9A 4F6RA 5AFSA 1I7PA 2BR4A 2VTBB 4I3FA 4XFJA 4QASA 5T4EA 2QTWB 4CKCA 4D9FA 1RRFA 2HCJB 2VO1A 1AGRA 1PJBA 1E0SA 4Z6KA 4L72A 5IVHA 1FRVA 2Z2JA 2ZITA 3OZIA 4HNAA 4Y0NA 1U8EA 1V3TA 2GHTA 2HPVA 1ZIPA 4CMEA 2BBWA 1YS6A 3GRZA 3NB0A 2QTGA 1RWPA 4AZ0B 3FMOB 3GLUA 2AFVA 4NMMA 5AJHA 2FU5C 4JOQA 4TTQA 4EHIA 5JALA 2DG2A 4WFIA 3ZDZB 3DDHA 1TLFA 5HFNA 2NO0A 2JA1A 1C8BA 1PK7A 1ZJ6A 2ZKLA 4ISCA 4HK4A 4I4TA 4N03A 4RDCA 1E1DA 4JKYA 2LIVA 3RHSA 1TYEB 1T6BY 4O5AA 3OFVA 1FB5A 2QRZA 4HH0A 1E66A 1JEQB 1Z74A 5A9TA 1KNQA 3QQPA 1V1RA 1J49A 4MDFA 1XAJA 5AUNB 1F6DA 2IKSA 2IUUA 2OZLA 1X92A 2PMCA 1NFFA 2OXEA 5KVVA 3J7AC 3GJQA 1E7WA 4QA9A 3L02A 3A31A 5BQPA 3E03A 2IPNA 3V46A 2R8ZA 1JHQA 4QYMA 2EQBA 2EU8A 5CLIA 1QG0A 3GLKA 3KJEA 1CQPA 2REQB 3DKKA 4LQLA 3WB0A 5DYGA 4EVSA 1QVVA 2B82A 3WP1B 5JCJD 1U7ZA 1OFGA 4EGFA 2PZAA 4Q7QA 1PJAA 3LCCA 4CV2A 1S5PA 3HCRA 2BBTA 2EFDB 3U49A 3ZKWB 4PTZA 4DLRA 3PXXA 2CJWB 2QLFA 4ZVQA 3TX2A 4ZCSA 4G0WA 1U7DA 4GUDA 5HBGA 2PUTA 1JHZA 5AVRA 4DA4A 4IJQA 1RWXA 5C8VA 5K0FA 4HXGA 1ZN8A 4MV1A 4WN3A 5ALKA 1FP6A 2CL6X 2CY0A 1AKWA 5J5VA 3RAPR 4AN1A 1XDZA 3E1GA 2RGGA 5KYVA 1SZDA 2LUOA 3CWCA 4NL4H 3TDMA 3H1FA 2O2YA 4IIFA 5K3SA 4MUHA 2FSGA 5KSWB 5JH7A 1IVNA 1CW2B 2B30A 2XXAA 1JR2A 3DKVA 3CLSD 4FMBB 2IU0A 1T2NA 3VQTA 5IMSA 2FTKE 2E82A 2G28A 1ZGCA 4RD6A 4UBNA 1A9XB 1FDVA 4XFKA 3L0CA 4CT4B 2BAGA 1BO6A 2YOGA 1BE6A 2OXRA 2JCYA 3KELA 5FXMA 4R3NA 4BRSA 2ZRLA 1OVGA 1HDEA 2GAOA 1NJ2A 1WE2A 1ZRHA 3NAZA 4JEHA 3AC0A 2JB9A 5K8CA 3WKBA 3RUHA 1Z0ZA 3ANSA 4WZBE 3B38A 3HCPA 2Z5LA 5CNJA 3CU5A 5EZ6B 3MWLA 3DEYX 4C6HA 1GCOA 2I2XB 3IHLA 3B82A 3RWOA 1H8HA 1I7SB 3UB2A 4KLNA 3TJZA 2HXSA 1KXJA 1WCV1 2VWQA 4O1HA 3U4GA 5H16A 4CG2A 2JHAA 1T9AA 1RYMA 1E0KA 2FPWA 3FDZB 1T6YA 1BZYA 1JA1A 4KFRA 4P4LA 4IKOA 4TXHA 1DE0A 2CXQA 3NDRA 4O4IF 4Q3DA 4DA0A 3GH1A 5BN3A 5HXAA 1YIOA 4CI0B 5JVDF 1OZAA 1XCPA 3DE3X 2O05A 1X39A 1JT2A 5ALIA 5FWYB 2PT6A 4US1R 2NPIA 4RTPA 3AJAA 2IZOA 1Q21A 2ZJ4A 3GRYA 4U63A 3S70A 1KEVA 2NMVA 4JDUA 1T1IA 4X3OA 4NZMA 4YK7A 3R7WB 2R2AA 4RKRA 3WL4A 1P9OA 1ZVMA 1TPZA 1PT7A 3B9RA 3IVGA 3M6AA 1X7HA 1YJCA 4FMDF 3NU1A 1JTFA 3TW0A 2C9OA 4C3OB 2DBRA 2PWPA 1R0SA 2NAFA 2NZVG 4FYHA 1BS9A 2ZAMA 4YDHB 3E6AA 4DNFA 5NLLA 2ZAIA 3UCXA 4DSZA 1NNUA 2HHLA 2Q4OA 1L4GA 3C0KA 3LK6A 4ABTA 3BDIA 3ZDCA 3PDWA 2JC3A 1IXRC 2W7TA 3GOQA 4U3JB 2O07A 4QHYA 3ESYA 5BP7A 4KK3A 1PD0A 1VJ5A 2QAGC 1EVIA 1XQWA 3H86A 4C2AA 2QVCA 3JQCA 4R1QA 2R60A 1OWPA 3ZW9A 1H9AA 4L8WB 2D4AA 2H2IA 1WSDA 2C2ZA 5DM2A 4PNEA 2JVKA 2ERXA 1XMOB 3RJMA 3KEOA 2YUTA 3H84A 4H60A 5A3VA 1W5FA 4MRPA 2BRUA 1QZUA 1EDEA 4MKFA 4CMGA 4M9RA 4F2HA 5A5DA 3WISA 1FRNA 3N2KA 3VHQA 1SVKA 2HF9A 2ODQA 5CRIA 3BDVA 3DM9B 3F5SA 4BZXA 3LF1A 3F6EX 5ALGA 4PG5A 3ST7A 3V4PB 1YTUA 1IY2A 4XE5A 2LD4A 4DUGD 4PGAA 2HT6A 2NZXA 3OM9A 1XKQA 3GVHA 3HZHA 4HH3C 2W9XA 5K3AA 4LVCA 1UKCA 3B3JA 2G63A 1J8VA 1FMJA 4QDTA 5KIAA 4MK4A 2XDAA 1DAFA 3CE9A 1NJ5A 2GPYA 3MA0A 4LMPA 4QXAA 1XKXA 3U0BA 2C5SA 1V71A 4MR9A 1D0IA 5M3BA 4C0JA 2YS7A 2ZUCA 3ETDA 4QPJC 1EP3B 5FFMA 3NM6B 2FPKA 3G82C 3L8GA 3VDNB 1J2EA 3DOUA 3UKDA 1PYDA 3F7OA 2PX3A 4IIVA 2I7TA 2A8YA 1ZD4A 4ZI7F 1WHTA 2ZIFA 1VGVA 1XT6A 1XV5A 1YHYA 4TTIA 5IKEA 2J08A 5JDIA 3S8EA 3VTKA 1BROA 3IUEA 4RELA 1QVRA 2IXAA 3CJQA 1F5NA 3EXFA 5HZKA 4ZT2A 1XA4A 2CUTA 2G09A 3BAFA 4QYWA 4R05A 5LWHA 5C4GB 5JI3E 4KMSA 2O8BB 2QG4A 3F4KA 3JQEA 3HNOA 4UMDA 3E3AA 3ENZA 3AINA 3EULA 2GPTA 3AU9A 4JEUA 3HUUA 2OB2A 4W5JA 1O2DA 5JSUA 1VCOA 2RJNA 3A4TA 4KIFA 5BSHA 3AFOA 4M9ZA 5EFOA 3VISA 1ULSA 1SQ5A 4ETIA 4QEKA 1W0CA 1TAUA 1W4ZA 3MT8A 4ZV7A 1P9WA 3NYRA 3QMMA 4TMXA 3ANYB 1ZXBA 3FKSD 2BFNA 2ROQA 4V1CB 2IS4A 4EHJA 4B40A 4PGMA 4L0QA 3LLVA 1E4VA 4BMNA 1O58A 3GDFA 1WHSA 2W58A 3MS2A 1VKOA 4YJFA 4NP6A 5TIIA 2DPXA 2J46A 3UM9A 1JI0A 4TZTA 3ZIUA 3H99A 2P5TB 1X6VA 3IR6A 3TE7A 4AMBA 1KEEA 2EG5A 3GARA 1B14A 2QMUA 3KUDA 4W9RA 5A3JA 2JI8A 1LS6A 2GILA 4K86A 2ID4A 4TROA 3WHLA 1G8FA 1T2DA 2L82A 4JBIA 1AKQA 1Y1RA 2JH9A 4YVFA 2YDYA 3VR5H 3UHAA 1AGYA 2R8PA 1Z75A 2GKOA 3G2NA 2PR7A 2GD2A 2FFAA 3MYYA 3P4YA 3STVA 4B74A 1YV9A 3EW7A 4M0DA 5EIFA 3HKBB 3RUAA 4EHDA 4N1AA 4OTZA 1P9NA 2CLDX 1M7HA 1X1EA 2AE1A 2E49A 2VP9A 5EUQB 4RKYA 1UQTA 4II3A 1IL0A 4HEHA 3UANA 2IKQA 2OEPA 1C1DB 2I33A 4IIDA 1JIKA 3FETA 5CCBA 1AKTA 4TS4A 4C0HA 4XEUA 1KPHA 1MAAA 2GPJA 2K87A 1WUHS 2D7CA 3LUBA 5DNEA 4LPSA 4Y30A 4WADA 1SCNE 2PL3A 3C6MA 5F5NA 3TDKA 2XPCA 1D09A 3R4CA 4LAFA 4WACA 4BFXA 1E77A 4PAQA 5JT1A 2ZI3A 2CHVA 3ACDA 4HWPA 5JCJA 3D1LA 3EEYA 4Q4HA 4FB4A 3L01A 4K1XA 1QCDA 3D7SA 5IABA 3FYHA 3ZWNA 3DPIA 4IWNA 1QF9A 4TYYA 1PW5A 4TLLB 3T1HB 1V25A 3VTAA 3ZXUB 3P0JA 4FGKA 2WKWA 3E5MA 3C7TA 2QUHA 1O3YA 3THRA 4O0MA 4JMLA 3HCWA 2HNKA 3G2HA 3OQIB 3LCJA 3U7HB 2VHXA 1DPGA 2D8AA 3EQ6A 4P08A 1PR1A 4DKJA 1YI0A 4GE3A 5CJJA 1LBTA 1HFJA 1WVIA 3GRUA 1VYVA 1KYZA 4UZSA 2J33A 5FQOA 3DD1A 4GP7A 4IR7A 3COWA 4FHEA 3JASA 4A5SA 2FVXA 3ZU4A 1QQBA 2OCIA 4KH1A 3LAWA 2EW8A 4GXQA 5CVVA 2H1RA 2ASEA 3KB8A 3U4IA 5DSXA 1N7JA 1HGXA 2C4MA 4DY6A 1XTUA 1VL5A 3FOWA 3KQWA 2WM3A 1GO2A 5E6UB 2DWOA 2E48A 2FV8A 3L46A 1H3NA 3LWZA 3QBEA 1E6KA 4PC7A 2FOLA 4G8BA 1OC4A 3SY8A 1S8AA 1WDTA 2A9RA 4MQBA 4PPQA 4X8MA 1K7CA 3DF7A 3WFZA 5LYJA 2UU9B 2WD8A 2HMVA 3DE6X 1LVUA 4F86A 4WVFA 2ZUWA 3IFSA 5L6LB 4OX9Y 5T64A 1QFJA 1WQ3A 2A9KA 4L7VA 5CPBA 3TTXA 2AOWA 2PMBA 1PR0A 3AUAA 3G0CA 4KDFA 3ZZNA 1EWYA 2A57A 4CWAA 1K8YB 2XGMA 4EA6A 5G4KA 3P9IA 4D98A 4QREA 4Q9LA 3QUAA 3HEAA 4RZ3A 4YP7A 3EPPA 4LOIA 3TD6A 4M4SA 3E3MA 1N8NA 1CHDA 4QAQA 5FLKA 1AHPA 3HXMA 1NF9A 1XWIA 5IBCA 4GOKA 4LTMA 3DW3X 2PKWA 1UBCA 5HJEA 1U28C 3FNFA 5EHNA 1EDOA 2P35A 4K9KA 3IT0A 5CYFA 3TDNA 3U9TA 3WBBA 3KRTA 5H9WA 1TUBA 3AY7A 1T1GA 4QLAA 1SVMA 3QPCA 4R4JA 1QUFA 1UK6A 2ZYUX 5EJMA 4ZHSA 2ZWMA 1MB4A 3HVKA 4FQ5A 4LY0A 4NDZA 2WUVA 5DHAA 1RXYA 5EXXA 3B7WA 4XWAA 5KB3A 3S2EA 1W5SA 1NRWA 3LPNA 3ZI4A 5BR4A 2ZTHA 3U19A 1JB1A 1COWD 2B1JA 2DWPA 2C9MA 2ENUA 2QTTA 3ICCA 3AEUB 1IN4A 3RVNA 3TW4A 4HEJA 3FGNA 1M1UA 3VH3A 3QXSA 2BFEA 3ABOB 3RWMB 1NLYA 3ZHYA 1LWOA 4F4UA 1A9QA 1YO6A 2EKDA 4TS3A 4B0PA 1CQWA 3DR5A 2HEIA 2IU6A 2IH4A 2G0TA 1QO0A 1XNQB 2QD4A 2ZULA 4MR8B 5LKRA 1EE1A 4OI0A 1G6KA 3OHPA 3UAGA 4DABA 4INOA 3AOGA 4UNQA 3UCEA 3HO1A 2ZP1A 4YRKA 3DBRB 3UWOA 3EFHA 1F8UA 1IH8A 4B3HA 4FDVA 1OLXA 3ASZA 3NWOA 4FU0A 2IV3A 3RVLA 1LRLA 3KFVA 521PA 1JQLB 4M1YA 3PGXA 3ZH2A 1ZHHA 3OEHA 2CDAA 4D1YA 1QPZA 5CHEA 1VIVA 3G85A 3WKDA 2FUG1 5EVCA 1T9BA 2ZRJA 1GQRA 3FNQA 2KBFA 3FN4A 3BSSA 5AIBA 4BNYA 4B6FA 1Q1EA 2DJIA 3OBBA 5EGSA 1NUAA 5FPPA 2FPIA 1NBEA 3ASVA 4DUGA 4HUJA 3P2IA 2DPLA 2PSFA 2YWBA 3H4IA 3MRTA 3KQSA 4RA6B 1ZW6A 2R6DA 3PEYA 4TMVA 3P0IA 3PXUA 1DLJA 2UZIR 5LYYA 1SZPA 2A6PA 3OLVA 4BU1A 4ENUA 3C43A 4GR9A 2RD2A 2CUKA 1NPDA 2XR1A 1A9ZA 3LVQE 2AZ4A 3LX4A 4JJGA 3LDAA 4QDJA 1L4EA 8LDHA 4JGGA 4OXQA 4UEKA 1A97A 2DBQA 2C98A 3MTAA 2V5VA 4J76A 1ADBA 3KBBA 1X2EA 3QY9A 5BVGA 2ID8A 1GUZA 7REQA 4I2VA 1U3DA 1AKVA 1Z35A 2R6JA 2QV7A 4BZQA 1E1CA 4LVNA 3H1TA 4EB6B 2PUWA 3NEJA 2RHBA 4KG7A 3JRXA 1ZOIA 4RY0A 4BZWA 1BMDA 2AMYA 2R6ZA 1QFMA 2N75A 5IYZA 1Y4AE 3HV2A 3DVAB 4PHTA 4IV0A 2PBZA 4HDQB 3WLNA 3A1WA 1Q22A 1QHIA 1Y3IA 4NYJR 2PUCA 3OCYA 1HA3A 4Q1EA 4XLLA 4A3SA 4W6ZA 2MMCA 3LBFA 4MJ7A 2ATCA 1TO2E 4Y7CA 4UATA 4K6HA 3M81A 3D4NA 3N2GB 1Y4DE 3DGEC 1WEHA 1JDVA 3ZY5A 5IZCC 3W8DA 4EAQA 2BFCA 4PAMA 2H0RA 7ADHA 2GXSA 3D8SA 4D9NA 4RABA 1ZM4A 2OZPA 2Z83A 3OD1A 5F76A 2PVCA 5FORA 2UYHA 3FKSA 1KY4A 1F2TA 3ABSB 1Q44A 1OFIA 4P84A 3FPSA 4WV3A 3HU2A 4XJXA 2R5WA 3PL5A 3T35A 4B2LA 2WHPB 5B57C 2FDXA 2VA9A 2W6MA 2ZUUA 2VHYA 1SK9A 2GD0A 4ND2A 3EXAA 2AI1A 4EJ6A 1DKNA 2W2PA 3UJ3X 2O2ZA 3QYJA 5FBKA 4BRZA 4Q9AA 3M34A 1R64A 4EVIA 2QJWA 2OB1A 1XXHE 1Z4JA 1SXJE 3CLTC 5KAMA 4KLRA 1RAHA 3HBFA 3HN6A 4P32A 2PR2A 1ISMA 2FYTA 3HYNA 2AX4A 4PCUA 1O8CA 1E58A 1BG6A 1J2TA 1EA5A 1GNQA 1OZGA 2O9JA 1QAMA 1JNXX 1NVMB 3RLIA 1TD9A 5EJ5A 1F2DA 1XLTC 4WGFA 3LQKA 3PGLA 5JIBA 4IDNA 4BMVA 3R8FA 1P2GA 1TM7E 1LBEA 3GLRA 1CFZA 4PFKA 5DTQA 1U2DC 2OT3B 3MEQA 4HDRA 4YMLA 2O7VA 1H23A 2QN2A 1E1YA 1UKVY 2X8JA 1TZJA 3DE4X 4RDXA 1YQXA 4P1ZA 2VHJA 5CP8A 1WTAA 3TYXA 2JVJA 3WL7A 3G2IA 3C16C 2Z95A 4QDKA 1MAVA 2D4HA 3F4LA 2QAGB 4KR0A 4E6EA 3OO0A 3OIUA 5KO2A 3EVNA 4IFTA 2B7CA 1Z33A 4FHCA 5EE5B 4UOZA 4OMDA 2VT3A 1F38A 3RE1A 2A92A 2AUNA 3GDWA 4KGDA 2XKJE 4H9GA 5ICFA 1L5YA 2JBAB 3NYIA 1ELOA 4JB8A 4WN9A 1TKBA 5DMHA 3X3HA 4I8XA 4HRXA 5K3EA 1E2QA 3TQCA 3JWEA 2CN1A 3PVCA 3VNRA 1I13A 1SKQA 4DLPA 5JD3A 5LA6A 4E3WA 4NG4A 4IEIA 2X3YA 4N5MA 1B15A 1DU4A 4NJEA 4DMUB 2FW8A 2H4ZA 4AJLA 3E8SA 4CLEA 2PDAA 4EKEA 1DIRA 1JQAA 4IGEA 3KE8A 3NT2A 4IILA 4TZ6A 4M49A 3A9TA 3AM3A 3GLFE 4Q39A 1Q12A 3E58A 4EFMA 2LGJA 2NZYA 3BXHA 4P2BA 4X1YA 1NVKA 4TQUS 4U5QA 2B98A 5LP6B 1NQ5A 1JE1A 3A6ZA 1LSJA 1KBZA 1MR3F 3T1OA 3UN1A 4KRXA 2IUYA 4D6PA 1SH7A 2RKOA 3CNOA 5JCOC 5CG1A 3USCS 3SYTA 2O7QA 4IOMA 2OGZA 1RYEA 1O95D 3L0OA 4RQBA 3R3WA 5JY1A 1H6DA 1EX7A 1L1QA 1ZINA 2WFLA 3G1WA 3RT9A 1SCAA 4MVXA 1Y6RA 3ZJ5A 4UHKA 4Q03A 5CCXA 3OICA 1G55A 2QHXA 4FKMA 3TRFA 3WLLA 3ZU6A 1U8FO 2XB4A 4TQAA 3I62A 1JWAB 4QICA 4GC9A 4C06A 5B1EA 2G17A 2W48A 5B7QA 2OGWA 4LRUA 3GEGA 3WYFA 2C9DA 1CIPA 3BMCA 4MS4B 1DRJA 3EMVA 3U3DA 3R9WA 2ZSDA 1VJ0A 5DKFA 2P6MA 1RLMA 3MSXA 1AQUA 2R87A 3MPUA 1EAYA 1M34B 2WU3A 3DEIA 4WBSA 3DWFA 3U3MA 4RETA 4LV6A 1CDZA 3RKUA 5KVCA 1JVBA 5EJFA 3STUA 1PS0A 1UBLS 2YJ4A 3KQVA 3PXCX 3AK4A 2VHWA 3P8ZA 1COWA 421PA 2X4IA 1PSDA 1OFUX 2IXTA 2VSYA 1U81A 1U6JA 1XHFA 1Y63A 4MDHA 1J09A 3K9FC 3MOIA 3IB6A 3DL2A 4DV4B 1PCXA 1SC6A 3ELYA 4RVCA 4OHUA 3PUXA 1UXIA 1M5TA 1OV6A 4E6PA 2MINA 4KAXA 5H0IA 3U61B 1X7WA 2H8KA 2KWIA 2JGDA 5LMCA 2VIIA 2X9VA 2LBPA 1Z4QA 2WF6A 2WZQA 4UBOA 1D6NA 2QNRA 1Q77A 2WR8A 3WAJA 1ZWLA 4QFBA 1Z45A 2W6QA 3IL2A 3UGTA 1OCEA 1J25A 4HAUA 3CRVA 5FP0A 5A06A 4ZKEA 1UOQA 3HE3A 4IOJA 4GX2A 4MWSA 3GNSA 4HAXA 3G6WA 2IV2X 3SOZA 1G4HA 4OQEA 4DQVA 2CBGA 3BN3A 4ENRA 1JKJB 4BNZA 4CN9A 4LGVA 3EGDA 2RHJA 2X8AA 4TLMB 5EJ8A 3FG9A 5E38A 4JIGA 1XVLA 2PTHA 2C0PA 4KHPB 1UM9A 2O19A 3H2GA 3OKCA 4WX2B 5TQ0A 1E4EA 3C24A 4TL6A 4B6PA 1T34A 3TKAA 4EO4A 1M2VA 5F5XA 2PKCA 5B3JA 1KOGA 2IBMA 1NZDA 4XD7D 1JIUA 1DKRA 2AZMA 3EA5A 4MEAA 3JVEA 4Q0MA 3LUJA 1U9CA 4LMRA 1I2CA 2O57A 3A0UA 2FLWA 3B1WA 2JIDA 2G1AA 3FFXA 4DSTA 5JNUA 3A27A 5AK3A 3HO8A 5H59A 2O8DB 3NVKI 3RQIA 1IXSB 3LYLA 2VPYA 3A3KA 2C9BA 3REQB 4KAJA 5EA2A 3BD7A 4H4DA 2WNHA 1UK8A 1ECGA 2YQ5A 4KWHA 2GNAA 4RSGA 3P9YA 4B5LA 5ECWA 5H02A 3WWZA 3ETGA 3I1IA 4J7XA 5ALTA 3U17A 2N46A 1KY2A 3MCAA 4FE3A 3RVQA 1MRZA 4P54A 2Q1UA 2J4FA 5GMOA 4G5HA 4OQPA 4OI2A 3SP1A 1YHZA 4G0ZA 3H5WA 1E0DA 1KDRA 4OM8A 1MGPA 1QVZA 2AUMA 4BASA 4JBGA 1PJLA 4JKOA 1KMHA 1TUGA 4BVGA 1C0IA 4G09A 1JKIA 3D9QX 4JJIA 4TSFD 3WWEA 3K31A 1ZX1A 4I14A 4UU1A 5FD8A 3EGIA 3TOXA 2CCGA 3AFMA 4CM4A 2GR9A 5KNCH 3HKEB 1RWMA 4RKFA 4NFLA 3R7DA 3W06A 4EUNA 4HC4A 1E7YA 4WZBA 2BEVB 1XJCA 5THKA 1E2JA 2PWYA 1JHRA 2ZYRA 3CRNA 4J6EA 4PU0A 5EP3A 1T6XA 1YTLA 3NHYA 3OZXA 4UBIA 3OQJA 3MT9A 1XR3A 1KYYA 3KC2A 4Q9JA 1E8NA 2D1YA 5TQ2B 3IAS6 1H4SA 1ORTA 3ADCA 3L43A 4HQ0A 4UU7A 5AVYA 5DN9A 2R1VB 4YHHB 1TZCA 4PIPA 1R6UA 4H1VA 2POQX 1ZD9A 3TI9A 5I4BA 5FTMA 4JP2A 1LH0A 1N25A 4LRYA 4PC2A 3H5AA 3CUWA 2Y1DA 3LC0A 3UG7A 2B2NA 1CQXA 2V7UA 1CUSA 3DFUA 4FR5A 1S4QA 3EUEA 4QDXA 5J63A 3Q8KA 1MG0A 1L7MA 3C5CA 2BELA 4YRGA 3PIRA 5FO0A 1R1DA 1CNFA 5AW4A 4A0HA 2A9QA 3RRBA 4O02B 2OC9A 4S1VA 2P79A 5KTTA 1NTRA 3UC9A 3WWCA 3W34A 4XYEA 5F1PA 4YONB 2K2QB 4BN5A 3B1KA 1BHJA 4GW3A 4Q12A 4WXHA 2ZG6A 3CRRA 2NUTB 2R6CA 1VIYA 3AO0B 3X1KA 2C04A 4C6SA 4MWZA 1KP3A