1NUUA

Crystal structure of human cytosolic nmn/namn adenylyltransferase complexed with nad
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
233
structure length
213
Chain Sequence
SRIPVVLLACGSFNPITNMHLRMFEVARDHLHQTGMYQVIQGIISPVNDTYGKKDLAASHHRVAMARLALQTSDWIRVDPWESEQAQWMETVKVLRHHHSKLLAVPELKLLCGADVLKTFQTPNLWKDAHIQEIVEKFGLVCVGRVSHDPKGYIAESPILRMHQHNIHLAKEPVQNEISATYIRRALGQGQSVKYLIPDAVITYIKDHGLYTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title STRUCTURAL CHARACTERIZATION OF A HUMAN CYTOSOLIC NMN/NaMN ADENYLYLTRANSFERASE AND IMPLICATION IN HUMAN NAD BIOSYNTHESIS
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords FKSG76
total genus 75
structure length 213
sequence length 233
chains with identical sequence B
ec nomenclature ec 2.7.7.1: Nicotinamide-nucleotide adenylyltransferase.
pdb deposition date 2003-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1nuuA00
3RFFA 4AS1A 4XFDA 4S1OA 4R2MA 3COVA 1MRZA 4ARCA 1NUUA 1T6ZA 2PXHA 3ELBA 2A84A 1IQRA 1QQTA 2X0KA 3TQIA 3L92A 4YP6A 4G6ZA 1WQ3A 1PFWA 1WXGA 2YWBA 3FDXA 4MVWA 2I1LA 4KR6A 3DLAA 1M83A 4WNYA 2AKEA 2J09A 4ZCRA 4MUNA 4E1AA 4MUIA 3HZRA 1N2BA 1NUSA 1MAUA 2PIDA 3H97A 1O5TA 1N2JA 1MJHA 3P0IA 1T6XA 1KAQA 2WQ7A 1WOYA 1U3CA 3HFJA 3NBKA 4MUKA 4F3RA 2WQ6A 4ND6A 3DV2A 2EL7A 2IELA 2H29A 4NX2A 1O6BA 5FO0A 5KHAA 3N8HA 2E0IA 2J4DA 2A88A 1M8GA 1KKUA 3VRHA 4J75A 4HK4A 2R5WA 4GRIA 2D13A 1YIDA 1O96B 4EG8A 5HUHA 3X1KA 3UOWA 3PNYA 4ZT4A 2CSXA 1V47A 3C8ZA 4ZCSA 1GLNA 3HGMA 4KKVA 3Q4GA 5FNZA 3SP1A 3IDFA 1MAWA 2QUKA 3GLVA 1HYBA 2CV1A 3OTWA 1WXHA 2CT8A 1VBNA 2GKSA 2A1UB 1QNFA 3LCJA 1O0CA 1I6KA 1M8FA 3K9WA 4F4HA 3VGJA 1U7XA 3CR8A 4PBTA 1TEZA 3IMEA 4EG3A 3IVCA 3INNA 1K92A 4EG1A 2YXNA 2DETA 3CLUD 1NUQA 1T9GR 3QTBA 1CT9A 3RHSA 3VU8A 2PFSA 2V0GA 2H2AA 1JHDA 4H3SA 3CLUC 1OWPA 3JXEA 1N77A 4MWDA 2QUHA 3G6KA 1PG0A 1G59A 4I6JA 5LFAA 3TZEA 2QTRA 3ZGZA 5J58A 1N2HA 1EFPB 3FETA 3KFLA 1O95D 3RBAA 4MW6A 1KQNA 1FYDA 3NBAA 4ZCTA 3PXUA 3X1MA 1ILEA 2ZUEA 1VBKA 1GAXA 1TYBE 3RJZA 1LI7A 3G59A 4Q16A 1I2DA 2QTNA 1KR2A 4L2IB 4OUDA 2ZUFA 1ZH6A 3CA8A 2VXOA 3CLRD 1D2RA 2A1TR 2QUIA 3H05A 4CDNA 1J21A 3MMXA 5TEVA 3UC5A 1JIKA 2QUJA 3ND7A 1O94D 1YUNA 5AHWA 2EJCA 2CYAA 4MAFA 3IODA 3D6UA 3ZXIA 2CFOA 1EE1A 1N78A 5IJXA 1QRSA 3N9IA 1GTRA 1IQUA 1UFVA 1O95C 1MB2A 3COYA 4KPUA 1I6MA 1K4MA 3DPIA 2BYTA 2BTEA 1J70A 1XJQA 1ZH0A 1ULHA 3IOEA 4YP5A 1PFVA 1EJ2A 4J76A 3CVYA 1JECA 3PNVA 4JYZA 1QU3A 3QTTA 4ARIA 2CV2A 1A8HA 1TYDE 3FOCA 5DASA 2J08A 5H7XA 1EUQA 3RK0A 1OWLA 1N1DA 2Z08A 1XNGA 4OJMX 4ZCQA 2JAXA 1NUPA 2QJOA 1GZUA 4ZT3A 5J59A 4WSOA 1YI8A 1X6VA 3KT0A 1H1TA 4MVXA 1Q19A 2YY5A 1YIAA 3ND5A 5J5AA 1M1ZA 3CLSD 4MWCA 1Q77A 4QRDA 2HZ7A 1KQOA 1TQ8A 4GU5A 3E27A 3I05A 1ZUNA 3MXTA 4NZPA 3SEZA 4YBRA 3P0HA 5TGTA 3IOCA 4K0RA 1F7VA 3IOBA 1OBHA 1PG2A 4EG5A 4JXZA 2NZ2A 4EG4A 1K4KA 2O8VA 2O5RA 1Y42X 1NURA 1R6UA 3F3MA 4QBTA 3ZJVA 1KAMA 4UZFA 5KWVA 3AKZA 3NV7A 4DDKA 4MWEA 3DO8A 3D6VA 1EFVA 1KP2A 1JZQA 1WXEA 2GOYA 2A7XA 3X1JA 1IRXA 1TFUA 2AZXA 1X8XA 2PZBA 1MBZA 1KH2A 1JIIA 3ZJUA 5HG0A 4YP7A 3CVUA 2RD2A 3SZGA 3KT8A 4YMIA 4MVYA 1WKBA 3MLAA 1F9AA 3CLTC 3Q10A 4MW1A 1KH1A 3PRHA 4TS1A 1OWNA 4ZCPA 1M8JA 2CUZA 3FNRA 3IMCA 3HL4A 1PFUA 3AIIA 3LE8A 1OD6A 2QJFA 4CQNA 4PBRA 1RQGA 3TS1A 4EGAA 1B6TA 2IP1A 4MULA 1NZJA 3M5WA 4MW2A 3QE4A 1IQ0A 4KPUB 4CDMA 1O97C 1N2EA 5HUJA 2XRZA 1JEEA 1WY5A 2CV0A 1NUTA 4U7JA 1XNJA 3L93A 1WXFA 4MW9A 1MC1A 4RUKA 4HJRA 2XRYA 5K0SA 5LLTA 3GMIA 1G8FA 2E21A 1KORA 1VL2A 4UZEA 2A4MA 4EG7A 1KP3A 3H9CA 4FZJA 4MUEA 5TS2A 1N3LA 3AG6A 4ZT6A 4R0NA 1TYCA 4EF6A 2DXIA 1H3NA 2DLCX 3N05A 1JIJA 1NYLA 3FY4A 4KR9A 4DLPA 3AFHA 1DNPA 3FIUA 1IVSA 3ZUGA 1LI5A 2ZP1A 4DDHA 1EFVB 1EXDA 3N2YA 2QJTA 3FG9A 3H9BA 3CLRC 1N2IA 5DK4A 2OQ2A 1T9GS 3IMGA 2HMAA 2AG6A 4XFJA 2PZAA 3HV0A 4MVCA 2X1LA 2B7LA 1F4LA 1COZA 4CT0A 3FHJA 1J09A 4BWVA 1VBMA 3MUEA 3P0JA 4JFAA 4DE5A 4NAUA 4NAHA 5F23A 3MLBA 2CYBA 2HGZA 3SZ3A 3CVVA 2PZ8A 2TS1A 5LM3A 4MUFA 1IFXA 1IH8A 3UY4A 3ILVA 3TZLA 4DDMA 1YUMA 1G8HA 4MW4A 1N75A 2X3FA 1U0BB 5H16A 3CVXA 4MUHA 2A1UA 2V0CA 2OV4A 2GM3A 3H99A 2VTBA 1PFYA 3FH0A 3UK2A 1H3FA 1WZ2A 2YWCA 1N2OA 1ZJWA 3S3TA 3A2KA 4ND7A 2WSIA 1FFYA 1S4MA 1U3DA 1IHOA 2Z09A 3TQOA 1OBCA 4Q93A 2DR2A 3ZJTA 5K0TA 2Z3VA 4NDAA 3SDBA 5EKDA 4U63A 2PG3A 1V8FA 2JA2A 3ND6A 1H3EA 2VTBB 1G8GA 4I6EA 1WJGA 3G5AA 2D54A 1JEDA 1QRTA 1YULA 1O94C 2JANA 2D5BA 4JZYA 2X1MA 1F7UA 4XSVA 1J1ZA 4U8HA 3AL0C 1VLHA 4ZT7A 4MW7A 3ZIUA 4G5YA 2C5SA 1TYAE 3AG5A 3COZA 4NATA 2CYCA 2DUMA 1JMVA 4MQ6A 1WQ4A 3OP1A 1SURA 4P2BA 2E89A 3IUEA 2WB2A 4DNXA 3CVWA 1MOPA 2J07A 3TNJA 3U1VA 1R6XA 1J1UA 1Q15A 4DJAA 1I6LA 1GPMA 1M8KA 2DERA 1KQPA 4MLPA 2DEUA 3SYTA 2IJGX 2A1TS 1BS2A 4JXXA 1M8PA 3IH5A 3K32A 2DPLA 2A86A 3IUBA 4MUJA 5KCMA 1J20A 1QU2A 1OWOA 1JZSA 3COWA 2NSYA 4KR7A 3A4IA 5JBNA 3Q12A 4X0EA 1N2GA 1QRUA 1KH3A 2QTMA 3PNBA 3SEQA 1XNHA 2RE8A 1NI5A 1OWMA 5TEWA 4AQ7A 4PY2A 3LOQA 1O97D 4R2LA 1EFPA 4ZT5A 3UMVA 5FO1A 3KT3A 3A05A 5BNZA 1GTSA 1Q11A 3FWKA 1GN8A 1R6TA 1K97A 1U7DA 2J5BA 3HMQA 3P52A 4PBSA 1NSYA 2E18A 1NP7A 1WXIA 4I6GA 4K03A 3CLTD 4L2IA 4OUDB 3RK1A 3ISJA 3IVGA 3CLSC 4G5FA 4RPIA 1T6YA 3ZXSA 1EUYA 4MW0A 1O96A 4MUGA 3A04A 1QTQA 1LW7A 5DEOA 3GUZA 1QJCA 4MW5A 2G36A 1O0BA 1JGTA 4MWBA 4HPWA 4A91A 4QREA 5IHXA 5DB4A 3KT6A 3IVXA 1JILA 3BL5A 4HJXA 4ZT2A 4EG6A 4EFKA 1P7PA 1MB9A 3FI0A
chains in the Genus database with same CATH superfamily
4POOA 4AS1A 4HC4A 2PKRA 2YDYA 4CYMA 4GRAA 1T9CA 3OEHA 1N6HA 1TW3A 1UODA 4J0FA 1EXMA 5AW1A 1JALA 4YJFB 2I29A 1P7WA 4QT4A 3UJPA 2IYPA 5JEEA 1PZEA 3AJRA 4JJ6A 4L76A 2HWWA 3ZBUA 5TARA 3WHKA 1J2YA 4TRRA 1FQOA 1BMTA 5EIFA 2IPMA 1E9RA 4ENWA 2R2GA 1QG6A 4CKEB 1M73E 1KBOA 3D8BA 4W9RA 3WOVA 2FU5C 5B6PA 3AB8A 4A8HA 2ECOA 4Y9UA 5K2MA 1SD2A 1H93A 4YLYA 3IT0A 3Q9SA 2CNDA 4OHRA 1W1UA 1JHRA 1Z74A 2FMIA 2V7UA 5A4DA 5EE3A 4BX9A 2XGOA 2IHNA 1MAUA 3CNBA 1O5TA 2J9XB 3QKSB 3WRVA 2H7CA 5SY6A 1SD5A 1Q7RA 5EHGA 1JU3A 4UUPA 3T95A 3EPJA 1G41A 4DNQA 2FQYA 2WE7A 1G66A 2LVBA 3WV4A 4RWZA 1SH7A 4HQNA 4DC1A 1EK0A 4MUKA 2BHTA 5J2UB 3AEZA 4OA5A 2EL7A 2IELA 3OIVA 2H29A 3CC8A 4V0LA 4JOSA 3NHLA 3VV2A 1RM5A 3SQXA 1NFQA 2P4UA 1YQEA 3RAGA 3U7FB 2QOEA 4KXXA 3THOA 4Q4AA 4GM1A 3PQ3A 4DV4B 3ZK9A 1JHMA 4CIDA 1F8XA 1HO3A 1Z7BA 4G5GA 5EUQB 2PQ2A 2R87A 3GVCA 4JOCA 1KMHB 4CNBA 2B0JA 3PCTA 4RE5A 3WA6A 4L3OA 4BB9A 1FBNA 2WJIA 1V1MA 4TXMA 3W2IA 5K8IA 3CBQA 2QLTA 3TE6A 1DBSA 2GPJA 3TG8A 3NHMA 5SV2A 4BMXA 4F2GA 1K6IA 1F0YA 3AF1A 1RAHA 3TZ6A 4EMBA 1XZHA 2B92A 3Q9LA 1PYOA 3IP3A 4KDRA 5A6VA 1A04A 3GNQA 1FSPA 1VBNA 1B16A 1ZN8A 3OCZA 4PQEA 1NLUA 1R27A 3L8YA 1KE1A 2ZB2A 2AUTA 1YB4A 4P0TA 4DIOA 4EJMA 1YASA 4ROSA 1FUYB 1PSDA 2GTPA 4XRRA 4B82A 1P2FA 4O5OA 1LFAA 2RC5A 1GHTA 5L3VA 2BCJQ 3HZOA 1JKXA 5TVGA 4C6RA 4N0DA 4IQ4A 1K92A 1S3SA 4YREA 3QM1A 4B6PA 4ZYTA 4MWZA 4N54A 3HKCB 2DYKA 5SZKB 2Z57A 2VF5X 3TLKA 2BVNA 2CLCX 4CEHA 4L8VA 2XBMA 5BW6B 2RHOA 3M89A 4MWDA 4WOBA 4X97A 3DTVB 2Y71A 1EX1A 1U6KA 1UMDB 1TCAA 4RXUA 4U8GA 4AJHA 3W6OA 1P9OA 3I5AA 3C3PA 5EJAA 4CV3A 2E1PA 5HRUA 3DEJA 1QNLA 4J0KA 1CS0B 2H85A 3H5VA 4CUZA 2O3JA 1M5TA 1KE2A 2G5GX 4NVRA 4HPJB 4K87A 5E9QA 1TMYA 2F3RA 2L82A 3PIIA 5CB4F 1O4WA 3EF1A 2RMKA 1TVCA 4L4UA 4IGKA 3ZTWA 1O95D 3PFBA 4UUQA 3N39C 2ENWA 5LOVB 5I7EA 3OSZA 2QT0A 4BMOB 3ZHTA 2R86A 2VCYA 4YACA 3PXUA 3O6VA 4RAOA 3LFHA 3LL7A 1T36A 4NI5A 4V38A 5HX7A 1AS3A 3MT8A 3PR3A 3FNHA 1UPCA 4FMCF 4MKXA 1PGPA 3O1IC 4XCVA 4EHNA 2ZUEA 1GLVA 5CB0A 2HXGA 4JC4A 4Q3EA 3BIWA 4AWXA 5BNFA 5A2GA 1TA4A 3V48A 1SBIA 1HT3A 3EZ2A 3PWTA 3N58A 2H1OA 1MHPA 4BWYA 3MIIA 2B69A 2EJVA 3R6DA 1EA7A 4HCJA 1RP7A 5A04A 1Y6JA 4FGLA 1CF2O 1KRHA 2C4TA 2PKQO 1X94A 2W6MA 5SY4A 4CQMA 2CYAA 2CKDA 1CJKC 3M34A 2JGRA 2JIBA 1KXZA 2O7VA 4INPA 2C8LA 1CZOA 3G7SA 1Y1KE 3AF3A 3H2SA 2VUUA 4FR0A 1UFVA 2LDBA 2O1SA 4JBHA 4MKHA 4MIYA 3G9ZA 1O3YA 5HF8A 1XDGA 4C30A 3LC1O 1L5LA 4UTNA 3KUCA 1O58A 3K0KA 3M5PA 1LGYA 3KLBA 4YP5A 2CGEA 4AMZA 2V3CC 2ET6A 4BMDA 4AKTA 3HCNA 2GAIA 4I1IA 4J0IA 2QVBA 4QQNA 3ZY2A 4X5OA 1O2DA 5G3ZA 3LY5A 3BSSA 4MOWA 1TC2A 1KOJA 2WYVA 4MV8A 3VSBA 2NSJA 1EUQA 2LIPA 3U6BA 3NDRA 3RK0A 4MRAA 2XE4A 3UPUA 1VE6A 3AVQA 3BMQA 1KPIA 2B4TO 3E5RA 1W36C 1HETA 1N0WA 5CVCA 4JI5B 2ZDQA 4X3OA 5ESDA 3WG9A 3N7AA 3T1OA 4BZQA 1MGOA 5BW8A 1SOMA 3WGYA 3COPA 4JT9A 5KOHB 1HQCA 3D1VA 2QVYX 2WJAA 1E1QA 3KR2A 1QYXA 3QPUA 2OAEA 3MIZA 3KT0A 1H1TA 2O5EA 1H6CA 2FLVA 4FLMA 3CF2A 3FGPA 4K7JA 2RSLA 2C2YA 1ECGA 1ISIA 3R3ZA 1UF9A 3R0VA 4GOND 4OHMA 2CD9A 2EERA 4Y98A 1DHRA 3E27A 3FCOA 1R9NA 3T0FA 3KSAC 3HCDA 4HB0A 4BGEA 5LQNA 2NU9B 1PYDA 3LQ1A 1I7PA 4TROA 2X13A 2ARKA 3OT1B 3VSEA 3CKKA 3V8QA 3QJGA 2FZEA 2UXCB 4DB2A 1QS0B 4EUFA 3DJYA 3FHLA 4L8GA 4OLAA 5TR9A 3QXCA 4HB4A 4JI4B 3D8RA 5TY0A 2VIIA 4HEHA 4BEJA 4QBIA 4C4OA 4D9BA 3JRXA 4M8KA 4YFVA 1JWAB 1LK5A 1SULA 3KDPA 4G4JA 4B3GA 4DLTA 5L8VA 3DZBA 2G80A 4JT8A 2RH5A 4BQFA 2B0CA 1II0A 4COOA 1LRKA 3LP6A 4QEZA 2GR9A 3VNRA 3VPFA 1OKKA 1WXEA 2ZTLA 4KWIA 13PKA 2AE2A 5HYVA 1OU4A 3E18A 5EQFA 2PL1A 4IIYA 5FA8A 3K4QA 2VDNB 4YRGA 5JCZA 3TDNA 3IAAA 1HXHA 1RIFA 3O4HA 1XQ9A 3CLTC 5HQTA 5IAJA 2W5UA 3PEWA 1XGKA 1MO4A 4PIMA 2OCBA 4ZOLF 1NDHA 1KEZA 4OU5A 5BYJA 4B34A 2IUYA 3EXG2 4ZEMA 1T8WA 1CZKA 4AKGA 1QG0A 3WAKA 3ZCVA 2AVDA 4UOQA 2PAAA 2OBBA 2B5OA 1ZA2A 3Q15C 5LCXA 4PC7A 5CK5A 5BUQA 3CZ5A 1B6TA 2CL6X 3ABIA 3LH5A 4V2UA 2VYQA 3HA7A 4B6FA 5BOSA 2VTKA 3PHHA 3M5WA 2ZUDA 3OPYA 4N0MA 4MXDA 3ZHCA 3ORSA 2VPZA 4G0MA 3KDSE 1AF7A 5DRYA 3FXAA 4HF7A 3SS9X 2XE8A 3TB6A 2X2FA 4B71A 5K3EA 2BGWA 1CDEA 1PJCA 3R1IA 2VAPA 4JBGA 4MYRA 2WV9A 1U5BB 3Q8WA 2CF5A 3FGNA 2XNJA 3O3NB 4U7JA 3ELDA 1MMFB 5BV7A 4G2NA 1X9IA 1U1EA 2QNIA 3KL2A 3PGMA 3CLKA 1ZGZA 4MW9A 3WTBA 4NBWA 3RSZA 1RZRA 2WFLB 2D5CA 2PSHA 3HU3A 4E5SA 5IUNC 4AZ0A 3DVSX 3FR7A 2X9QA 4FFBB 3ZWMA 1E1RD 1NBWB 2M6SA 2XGGA 3U7GA 2MT9A 1MQAA 5F2OA 5GVSA 4L4XA 2Z04A 2B2CA 3GZTB 4Q1VA 4E1VA 1LF5A 5JAOA 3KFVA 5CPBA 3FVQA 4AJLA 2Y2VA 4X1IB 4QWWA 1XRNA 2BM9A 1CJCA 2FPKA 3AFIA 3F9CA 4ZT6A 2P7HA 1J06A 2YMPA 4JWKA 1OHHA 1ZJYA 4EZBA 3QEOA 5A0FA 3KYDB 3D2CA 1P2DA 3NB0A 3M1IA 2C7GA 1K5PA 1RZUA 2LTAA 4M98A 4GPIB 4H1HA 2EHJA 2G82A 4NICA 3I09A 1GXSB 5FTNA 5KNCA 3EG9B 4PZCA 4URXR 1H2AS 1P19A 4C7MA 6NULA 4NMHA 3NGXA 1VA4A 3CX8A 5E9AA 3KB6A 2C4NA 1A8UA 1R37A 5AESA 3HXPA 2QAGA 1ZOOA 1DBIA 1EFRD 3DE2X 1FDSA 4ZYVA 1YNOA 4FYJA 2XMDA 5E7QA 1GKYA 1PNVA 2EP8A 3LLUA 3OA2A 4IHAA 3D4IA 1Z08A 2XYHA 3BXXA 3DHWC 5EKXA 3RROA 4Z7OB 3WICA 1EG2A 3ZKAA 4ERXA 4IM7A 2DFPA 4YJ2F 1NU8A 2W6IA 2AJTA 3JX9A 3AJ9A 3HVKA 5TPWA 4WOCA 2WWIA 3NATA 2XOEA 2KLBA 4YRCA 2EEPA 3OZDA 3OLVA 1CY0A 1FU8A 1CYDA 1VB5A 2VT2A 3P71T 4K9NA 4NECA 4PS1A 4KHPB 1JDNA 3PXGA 1NQ5A 2PEYA 1FCJA 2JF0A 3LBNA 3QF7A 3RSFA 4Z53A 1THZA 5A6SB 4G1BA 2AG8A 2Z6VA 4DLUA 4KE7A 3UXHA 4KL8S 3W4JA 1MEOA 4FFVA 1N75A 2F1OA 4GOMD 4N0QA 4CEJA 3RREA 3AVUA 1WUHS 3U7RA 1KNXA 1E6UA 2ID9A 2I66A 2Q8PA 1IYZA 1LFDB 2XUJA 4XKJA 1P5HA 1PEAA 2KHZA 3I6ZA 1ODIA 3PC2A 4LN1A 4FYWA 5A3VA 3V4ZA 3E70C 1C3EA 3A7EA 1NPTO 1NULA 5AR1A 4EUHA 4OMCA 2ZYGA 5DLDA 3IAFA 2AFIA 5AVKA 2ATIA 1ULAA 3CEJA 2A0UA 2MYTA 5L7TA 1OIVA 4M0EA 3E9DA 2PHZA 1YE3A 1ZN2A 3KL4A 3WDKA 1U9CA 1T43A 5LLSA 2RGUA 5FNVB 4MR9B 1WVIA 3ROZA 4RQBA 1TI7A 3CHYA 2A78A 1J49A 1VPLA 2IE0A 2NNWB 2R1TA 4NSNA 1NSFA 2CEKA 2FDXA 5K0NA 3U26A 4F84A 1RI3A 3WMFA 1SBYA 4Q9DA 3S4YA 3ZZNA 4BBPA 5JS8A 1I4TD 2JW5A 4TYMA 4LC1A 5JROA 1M1YB 5KEIA 4AZ0B 3KJFA 3S81A 3F6SA 4K6OA 4RH0A 4GYKA 4K6CA 2E4WA 2P0YA 4KXQA 4Q39A 1AMNA 4OX9Y 3JYHA 4G1VA 3BWXA 1B8PA 3FCXA 3O2NA 3TGPA 1L4MA 1NM5C 2P9EA 3L7OA 2RH8A 4RKEA 2DY1A 2NO1A 1ZS9A 3BGOS 2RG1A 4ZYWA 3T7SA 1O6ZA 4MGEA 3BT7A 4NL4H 1FUEA 2DUMA 1SBNE 1PJ4A 1D4OA 1HURA 1YC5A 3NC1C 2ABWA 4HX9A 4WNIA 3KZCA 1U0OC 3SZLA 4P2BA 1JQ5A 3ENKA 2BR4A 2WB2A 3O75A 3G2OA 4R8RA 5DHSA 3M4XA 4DNXA 2O5CA 4N3BA 4XWAA 3LJKA 1NWCA 2EJBA 1EUZA 1WMSA 4TX1A 5K3AA 1JFTA 2CJWA 1J1UA 5BN4A 3PG5A 1RCFA 3PPIA 4OJYA 4Q7MB 2POCA 3SYTA 2P9FA 3WX0A 1X14A 2R8XA 4HX2A 3U5ZB 1V2HE 1YCHA 4WXRA 3UZUA 3WBBA 2WSMA 4EJSB 2FEMA 4H0NA 1A1SA 3B2QA 3KE9A 2Z2ZA 1JR4A 3ZE8A 1L9XA 1G7TA 3MRSA 4RHXA 3HO8A 3PNBA 1YOVB 3DHEA 2XADA 3R6TA 1CU1A 2JLRA 2JFGA 3EVEA 1CDOA 1YA4A 1FPMA 1E89A 1C9KA 2ORIA 4AQ7A 1FP7A 1T5OA 4OX9B 1SUEA 2EZUA 3QTLA 5M04A 3V2UA 4AJ9A 4ZT5A 4FVTA 4AU1A 5BNWA 3LOUA 4TTPA 2AHRA 2OUKA 2PZKA 3PE4A 3UATA 4C9BA 3OJFA 1ZL2A 1JDZA 1OFUA 3CF0A 4I1UA 1LY1A 1M2JA 3BN3A 4XM0A 3K94A 1XZQA 3GLTA 1O0SA 4WV3A 4AJ1A 1Z7GA 1KI3A 2IWHA 5TNXA 3IO3A 2GBPA 1EYZA 1T3GA 1YZHA 1XXHB 3B1ZA 4I08A 1YAHA 1RYNA 3HMQA 4M38A 4NPHA 5E4TA 2FN7A 5I9BA 5CDUA 4GBGA 2OD2A 3RTCA 1GTZA 4F38A 4FZRA 4QUBA 5IBQA 4BNFA 1BCSB 4M99A 2QLFA 1RHRA 3V4VB 1HNXB 2G40A 3BE8A 3PICA 1KFKB 1PEKE 4GOKA 5B5SA 1JA1A 2C5FA 2QXTA 1EUYA 3BTUA 3HSSA 4GX5A 1N4AA 1Z2AA 5CU7A 4CIXA 3WGIA 2LKDA 4YVFA 5AJUA 2ZCUA 1KQGA 2EW2A 2OMKA 4XASA 4BVKA 4CM4B 3IDZA 4FT2A 5HQ3B 1I5RA 2JAPA 1GNPA 3A9UA 1K0FA 1R50A 3CPSA 1VLVA 2BMDA 4E21A 1JILA 1O5OA 1V7PC 3N5CA 1R4NB 5SYMA 4ZGGA 5JMTA 1U7UA 1PIWA 1T2AA 4QQ8A 4YLEA 1GL6A 2OILA 4N03A 3RJTA 1FS4A 1HRDA 1FDTA 1ZD8A 2HSDA 2JZOA 4G4SP 4S1OA 1Z0IA 4X8LA 1G8PA 1CC1S 1DO0A 3M6VA 3WL7A 1QQBA 1A9XB 5EHXA 5JJLA 1V1RB 1WB6A 3OM1A 3VR5A 1JU9A 4ACAA 4WX2B 4DIFA 4P53A 3PPWA 2V97A 3EVZA 3IAEA 1VJGA 1IMOA 4BCDA 1RWOA 1TIKA 3WLIA 1J07A 4FFDA 3QU4A 1EFHA 3HPRA 4J4TA 3IAXA 2H8GA 1C4WA 5KDOA 3S8EA 1I7DA 1HR0B 1R3UA 3G17A 3MWGA 2VYFA 3W05A 2CWDA 2I8CA 1VXRA 1LK7A 1E2PA 1V0JA 1CZLA 1Q0ZA 3DVRX 4NFYA 3GQVA 3HJBA 2GD6A 2RGDA 1II9A 2Y93A 4DMFA 2O7SA 4URUR 5HIAA 2Q5EA 3GCGA 3NI2A 4DDVA 2JFOA 1NW4A 3GRZA 3F4KA 1MU0A 3WWOA 3KZNA 2N75A 4CV1A 1TC1A 1G5HA 2AE1A 1RU3A 1QHYA 1YU9A 1QK3A 1MLDA 2MSLA 3EWNA 3G8CA 3O82A 2H4WA 4JBWA 4MEAA 3G5TA 4KV7A 4Z9AA 2IW3A 3ZCSA 4D4GA 3VI4B 5BT9A 2AEMA 1H1DA 3GRAA 5KHAA 2RGGA 2XGMA 3TIFA 1EBBA 4NBVA 4XWTA 1ZUIA 2YMLA 4QHYA 2C00A 2OKGA 2WIBA 4BV3A 4EARA 1AQLA 1RKQA 1XTJA 3ZTYA 4UHDA 1Y9JA 3I30X 1GZDA 1M1NA 2EFYA 1FQWA 2YZ2A 5DCUA 1YVEI 2Q50A 3DR3A 2CJXA 4KH1A 3C5EA 3UOWA 1W2WB 4ZT4A 3B51X 4MV6A 4U39A 5JCPA 2HL6A 5KTSA 1QP0A 4DJ5X 3I8OA 1D04A 4KV9A 3T7DA 4CTKA 2OFOA 4F92B 1VB3A 2GVNA 1FLNA 2BGJA 4MYTA 4RJ2A 3SP1A 1B76A 1VA5A 2W93A 1WNTA 5AM5A 1Q95A 3E9ZA 3MINA 3BGSA 1TZCA 2GWHA 4ZVPA 4F6CA 6REQB 3HLYA 3TQTA 3V7NA 3GAMA 2ZFUA 1XRQA 1T9AA 1NNI1 5IF9A 3ZXUB 2VJPA 2QA5A 5IDYA 4C06A 4L9WA 1F17A 1Y5LA 1EFLA 1GEEA 2PLAA 3IE2A 3ESYA 1WBDA 1A9OA 1Y6RA 5EXTA 2ZRMA 1ADJA 4AUMA 3DBLA 2PWZA 3F5QA 4ETIA 4C01A 3V8MA 5JJ5A 4H7DA 4B84A 1KZ4A 3FF4A 2Z4TA 2XNSA 5HRCA 1WDLA 1MQ9A 5L3RA 4PZPA 3T5BA 2GXUA 2W6ID 3HNOA 3HU5A 3MWYW 1JJVA 1CLUA 5F2EA 4CF4A 4MVJH 1MJGM 1FYXA 1ATZA 2AZDA 1RWMA 3TB4A 3GJSA 4DABA 5K03A 3GJTA 4J0DA 3O8RA 4E09A 3MWEB 1KK3A 1TKBA 1ZD9A 5G0VA 1C50A 4JEIA 5HFAA 3SFTA 4YAFA 1WP4A 1ZRHA 3C41J 5ICGA 5JMWA 2OO5C 4ILKA 3ZTTA 5E4FA 2O2IA 3Q7EA 1ZC3A 1YVDA 2HZBA 2E6UX 2PCJA 2JFXA 1G9TA 1CY1A 2FPPB 3ZC3A 2QY9A 1R0YA 3Q0EA 1H05A 1HG0A 1BTOA 3RBAA 2QM0A 2QE6A 3QJYA 3LT2A 1B0UA 1XFAA 5A02A 1X7DA 2F3TA 2SCUA 3THYA 2VEDA 2FWPA 2DF8A 2NACA 4BMNA 2VDJA 1DIGA 4JR2A 2LCIA 3QLTA 4CLOA 3HC7A 2Q6KA 3LCCA 2Q7XA 4H7FA 1X7WB 1DTSA 1PJSA 4DCJA 1VDZA 2PVCA 3K0AA 4O8ZA 1OSNA 3VA7A 5KX5F 4ND2A 1TYBE 2VYVA 4JQSA 3C3WA 4W1RA 4BNKA 5HW0A 1GTVA 4MGKR 2ZSJA 3EVBA 4N3CA 3WRYC 2Q0XA 4OUDA 8LDHA 5JSYA 1H5UA 1UKYA 3PQ5A 1KVSA 1WL8A 3JATA 2QUIA 1MT0A 4QLAA 5J40A 3QUCA 1J21A 1UOPA 1FIUA 3L40A 3FTFA 1S1MA 4TGLA 2H31A 4MAFA 4CG2A 2F43A 4RK7A 2Z98A 3ZXIA 1AQNA 3G6WA 3KTAB 2RH9B 5M34A 3MG9A 3KSDO 4Q05A 4TWIA 2AV6A 6Q21A 4QJ4A 1O6FA 3MWLA 4C2TA 4RZUA 2J48A 3WDSA 5B1YA 1J70A 2BTEA 2RGEA 1IEQA 4I55F 3SMQA 3FGZA 3ME5A 1LPAB 2Y0PA 3WFZA 5KVVA 2VNJA 1LB1B 4M2LA 2XCTB 2YWHA 4MRMB 2ZTMA 1P73A 4J0HA 1TEVA 3ULKA 3CWZA 1DC4A 4GSLA 4OTZA 4MV7A 1AK2A 1ST2A 4MUAA 1NOJA 1AQ6A 1QGUB 1TUIA 4GNRA 4JMLA 4UPDA 5UKDA 3K15A 2OCLA 2WSSD 1JG2A 4QXPA 1XOIA 4XOIA 3DEZA 3VVLA 2FTKE 3CNQS 4DJJA 3OO0A 1INLA 5K0FA 4H2DA 4AG6A 4PYMA 2W9XA 4D4KA 1TQ2A 3PIDA 1KDZA 4CG1A 1U8TA 3C3BA 1DAOA 1VGVA 3PENA 4PG6A 1KARA 1OJLA 2OGSA 1JJBA 2QYHA 1WUKS 2G9QA 2JJ8A 2RBKA 3QKSA 1QSGA 4UUAA 4W5QA 4LF9B 3RYFB 1YIAA 2PZJA 4IUBS 1Q77A 2BGGA 2C9CA 4KNWA 3CM0A 4ZYUA 1J42A 1P3Y1 3PX2A 1W5TA 2J3LA 4YR9A 3SFZA 5HM8A 4BJ6A 5L4LA 2R8ZA 4QKQA 3EX7C 4RL4A 1A7AA 4N39A 1RHKA 2AMLA 3PUKA 3ZH2A 3KQOA 5AVUA 2HRBA 1CDZA 3FCSB 5JNRA 3AO0B 1M6VA 3JRNA 3PQFA 4HGZA 4IMRA 4Q4DA 4DIUA 4DR3B 2CVOA 3GLHA 1IY8A 4GGOA 5KSYA 4BNVA 3E7XA 2X4GA 3OHSX 2O5RA 3CH4B 1PEYA 3ER8A 1D9XA 3VI3B 4BAGA 5KX5A 4KMOA 1Q0TA 3AEKB 4UZFA 1XD2A 2OTCA 4LDZA 2MIIA 3ZW9A 2QZ9A 2VWPA 3F3YA 3ZWBA 4I99A 3UMRA 4AKSA 4IBOA 1RAEA 1TVMA 2R6DA 2VNKA 2YHIB 1UT5A 2W6JA 3N6RA 5BQ5A 2YJGA 4E4YA 4PSUA 1G5TA 1WHTA 1GU0A 1ZCBA 3KOMA 4L4YA 2OYRA 5DXJA 3B13B 3EGOA 5KOJA 2RD2A 3OIWA 2XTAA 1CVIA 4FYKA 4ARVA 1ULBA 1Z5OA 4J16C 1KI8A 3P9KA 3A7DA 3PGKA 5TMBA 2UUPA 3C2QA 5K09A 1E9AA 1SXHA 4LHYA 4LMRA 2CUZA 3T7RA 3TRFA 1UJ6A 2B1IA 2C96A 5B36A 3ETNA 5D85A 3QNUA 4TTVA 1K5DA 3WL4A 5L4SA 4D3ZA 4QOJA 2IYYA 5EGSA 3IBCA 3SSAA 3DNPA 4ER3A 2I80A 1TUBB 3L8GA 4FMCB 3TS1A 4GIBA 5LQCA 4YRBA 3RWOA 1N5DA 3EGWA 4MULA 3BMQB 1NZJA 2Z9DA 4PYIA 4UKDA 2GDJA 3MLEA 3IPXA 4EX7A 3C5HA 4V39A 1K3UB 2H2HA 4KXWA 1A9SA 2P9HA 2XWSA 4O5AA 3SXPA 3T15A 5CGZA 2JHFA 4HQ6A 3CH7A 2XRZA 3QW2A 2QTGA 4G23A 1DFHA 2XCUA 3LXUX 1OFGA 4NENB 4BFZA 3AR7A 3ESRA 3HUEA 5ALLA 4F2HA 1WXFA 5I8PA 2GPAA 3T4EA 3WGZA 5K2OA 3CJRA 2VKQA 3DTTA 5A9RA 3OFSA 1PQUA 4WZBA 3C14C 3ZGXA 1EFUA 1Y8RB 2OSBA 1CR6A 4KIWA 5CBPA 3DLPX 1QYVA 4Q1AA 4TMWA 5AVZA 2GH1A 4JOQA 4BNJA 1F2DA 1G9XA 3PDHA 5E6SB 2YUTA 1QTIA 4KSBA 3N2GA 4V0QA 1AK9A 3VYWA 1KP3A 1P1CA 2OVFA 4IOMA 5CW1A 1GFIA 4DKXA 4G89A 1QIHA 3H75A 2LUOA 1P18A 4N6GA 4DSTA 5JYCA 4WZ6A 1E0SA 3WJAA 5EG5A 2H6EA 5HKLA 3ZS9A 4R1OA 1C8VB 4E7OA 2DLCX 4TZ6A 1SVLA 3I2YX 2IYAA 5JJIA 3UQYS 3ZY4A 4DOMA 5IH7A 3T1NA 1PDWA 4LRQA 4OK3A 2EGGA 2FMHA 4FFRA 1M2HA 1QQ7A 3ZUGA 3U09A 1J24A 4HBGA 3VOSA 1HQYE 1JDSA 3DZKA 4JD5A 4U7WA 3W7BA 5LP1A 3AL3A 1DRJA 3GVIA 4RACA 4O59O 1FVFA 2R6R1 3WQHA 4ID3A 3TZHA 3T5GA 3F90A 2GFHA 1X1BA 1TECE 3K0CC 3WLFA 4CPDA 2HN9A 4E33A 3G5MA 3QOFA 3RUEA 3TTTA 4BNWA 1U4OA 3U9SA 3MWJA 2XQIA 1ZNQO 4CMIA 1PF7E 2K6GA 5EE9A 2ZIWB 3PDIA 5JISA 5AI6A 1PZXA 1DZ3A 3L0YA 4YT8A 4JVMA 3N3AC 2NZVG 1T3HA 4A0GA 2PJDA 2ZAOA 5DYNA 1KQFA 2VK4A 1A82A 2TS1A 4IKEA 5LM3A 2OFFA 2JLZA 2VRNA 5HOEA 2VSFA 1NBMA 2NVBA 3WSTA 3T1QA 3IXMA 1W8IA 4Q3DA 4E3ZA 3RTBA 1SOAA 2AEEA 3QZUA 4S24A 4KX3A 3DVLA 3QVVA 4FGUA 4IEIA 4C05A 5BSKA 821PA 5HKOA 1AKYA 1XG5A 1SPBS 3NOVA 4V0RA 5DVZA 3MTQA 3W3AH 1XQXA 3OQIB 1PVOA 3K0BA 4RFSA 1PNTA 5CVVA 1KI1A 4YB8A 1G4UR 5AOAA 5FX2A 4QATA 1L5SA 4AY3A 2VDOB 4O2AA 3O74A 3L43A 5DM70 1R5JA 4EB8A 1IHOA 5IK2A 4U7TB 2X0DA 2IXAA 2QRVA 1F6BA 1ZI9A 3PUYA 2QBYA 3WK8A 1ZO8A 4PONA 3DDWA 5CXQA 5GZ6A 4QQKA 4EYSA 2PL3A 3N0RA 5EZQA 4TRMA 3EARA 2H7VA 5B58T 4R7GA 2YHAA 5AXAA 5SZHB 3R7BA 1Z2OX 1FP6A 2C9YA 2V6FA 2VSNA 3NWBA 1H5NA 4FDMA 4YRTA 1P72A 1ZONA 3ZDEA 4RZIA 4ZQBA 1F20A 3O84A 1YULA 2V4MA 721PA 1BX1A 4KTVE 1EXWA 2AEFA 3IKVA 3DF9A 2X1MA 4KQKA 1UQTA 5TB5A 2P91A 2OGTA 4QE3A 5HIIA 2E49A 3MJTA 4Z2AA 2QLBA 1MO3A 3UWSA 2P9ZA 3R2JA 5JSFA 2QORA 1JHZA 1E3EA 1BN6A 1T0PA 3FSJX 1QP8A 2F8TA 1YJCA 4MVJA 4I4TA 2QTCA 3BHIA 1KMIY 1SHTX 1A2BA 3PVZA 4P92A 2MSCB 3CZAA 3DO5A 5JU6A 1GYQA 1YFKA 4NWIA 4HZUA 1E3LA 1E1RA 2IZ1A 2R4UA 4HFJA 4M9ZA 2GEKA 4FC6A 3ZZ1A 1PJTA 4YYZA 4F91B 5JW6A 3CEHA 2JFYA 5FB3A 3KS9A 4ZARA 3ETDA 1O57A 4WPGA 1FJGB 4WFJA 4E5DA 1QUEA 1X7YB 2CXRA 4LHSA 3SQDA 2Y1FA 3DVQX 4OV6B 2TECE 2UZIR 4GP7A 1ARZA 4A0SA 3DFKA 1H42A 4UDYX 2N0SA 5E2BA 4KYVA 2X4IA 3P2MA 4CQJA 5MFPA 4DF3A 2VJQA 4JL5A 2XDYA 1XDZA 4OQNA 3UMJA 4IDCA 4RPLA 8ATCA 2ORED 2X1HA 1X7XB 1EESA 3V4LA 5JTTA 5HK9A 3LY7A 4BZWA 5BQOA 3FNFA 4H59A 2ST1A 2GN0A 4DWWA 5C9ZA 2QR2A 1PX0A 1MZPA 5FULA 4YRIA 1LPNA 3WMEA 1AA9A 1HFKA 3HCWA 3GGSA 3ZHXA 3OQMA 2XYRA 3RRBA 2JCGA 2HWXA 2VF4X 4FOOA 3PFNA 4FFPA 4JP5A 3VHXA 4YMHA 1ILWA 1DIOB 3E9RA 3GP5A 1NI5A 1Z83A 5AKGA 4LE0A 1BHO1 2C2GA 2O2ZA 1J5PA 2XMRA 3GUCA 3LIPA 1BE8A 2SKCA 3Q72A 2EBFX 2JFQA 4L5JA 1EFPA 3SXJA 4B7AA 5L3QB 5D8DA 3A1NA 1Z15A 3Q3JB 3QY0A 4M7PA 3KT3A 4O2RA 4Y2RA 1YVRA 1ABFA 2QQ5A 1N2CA 4PQYA 1J99A 4MUYA 1XD8A 4NYIQ 3F5DA 4EA8A 4UFPA 1HZZA 1QVVA 3I4CA 4M37A 5M3BA 4O6VA 3INYA 2FSHA 3BB4A 4LTDA 2GAOA 4HDRA 3DOEA 4BQEA 4US2R 1JVBA 1M34E 5TLSA 4B3RB 3H8WA 5F7JA 1E5DA 3GEIA 4UQPA 5CXUA 3G2KA 1QWOA 5KTNA 5BV2P 3TRHA 3QSGA 5AVTA 3T3NA 1YBFA 3AZOA 1JDTA 4W5JA 3K2EA 4QTTB 1NNLA 3D6MA 1AUOA 2V9PA 3FVTA 1ULSA 5EIBD 1V45E 4C4ZA 2D3TA 3JTMA 2C3OA 4GM0A 2IS6A 2IU3A 1NXVA 2ONYA 1ZHHA 4CIVA 3SYMA 1HORA 4UQOA 2JDIA 3FFBA 2IV3A 4JI6B 3SJZA 3OLQA 4EM6A 1ZCJA 2W6JD 3T9FA 1Z8FA 4E32A 4YCAA 4N6NA 1P2TA 3GPDG 1CF4A 1A3CA 3R5TA 3TLBA 1OH6A 1GUDA 4LRSB 5AK5A 3IR6A 3QVMA 4AULA 2XMGA 2RFLA 2ZSDA 2UYCA 3FUCA 2H57A 4R1UA 4RY0A 5E7MA 4K6FA 4KDCA 3O7MA 3FLBA 1K68A 3QITA 1NVEA 1QONA 1G6Q1 2PS9A 1XZDA 2XF2A 3DC7A 5JZ9A 3MXOA 3KAKA 3TRIA 4YJ2B 3IUNA 2AFIB 2EVWX 4YP6A 4B33A 1G5FA 2JIRA 5GIPE 1UPAA 3O4IA 1NUAA 3BICA 4UOZA 2Z2YA 2VAMA 1I2ZA 3L0SA 4QPDA 1CX9B 5ESWA 5T41A 3ZVKA 2WT4A 5I8WA 1BQ3A 3Q7RA 1A9TA 3QWHA 1AKRA 1M2GA 4J94A 4OMDA 2XDQB 1DFGA 1FDVA 4LJ7A 2PIDA 4LHVA 2PUHA 1EEHA 4KQJA 1NI4A 2CUKA 1UWVA 1UWKA 2C9ZA 3C6MA 1QXSA 3BPSA 3HY3A 4EEXA 1Z12A 1U80A 2DR0A 4PIPA 4DMRA 1AK1A 4IDFA 3PEEA 5IM4A 4W8OA 1GKLA 1SVIA 2W8BB 3DMGA 4X8HA 3U16A 1C9YA 4MYHA 4NOMA 3WKAA 4PO3X 8OHMA 4CUKA 2FZVA 4D8WA 2F7SA 2PWPA 5BN5B 1ODCA 3BWVA 3P9CA 4M83A 3MMZA 4BP8A 5KI6A 3I01A 1RYFA 5JSUA 3AKYA 2ILVA 3UHOA 2OB2A 2X0RA 3TSYA 4Z3KA 3K53A 3N8HA 4JLBA 1BCSA 3C74A 1QOQB 2GZ1A 1SK8A 3OKAA 2BFCA 1KOLA 4QYIB 2ZI3A 1OF1A 4DNPA 3C98A 5EJGA 3GLGA 3L5KA 4MAAA 2IS1A 2FJPA 2C54A 3C7TA 1KYVA 3UN1A 3I04M 1YR6A 2FR8A 2LD4A 2YX1A 3PNYA 5BOVA 1V47A 5A7FA 3LT0A 3OIFA 3HJUA 2AMYA 3Q4GA 3RNOA 1VTKA 2PQMA 3ZY3A 3M1YA 1R10A 1DEKA 5IABA 4I9FA 3U44B 3IKLA 3ND9A 3G2MA 1SR8A 4MPTA 3SIWA 3GLVA 1MX1A 1HYBA 2HAEA 2C2ZA 5A9SA 5EFZA 4XD7D 5F3WB 4BJHB 5FTJA 4ZI3A 4GICA 3R0QA 4FHEA 1ST3A 3FZGA 1BIFA 1X1SA 4IIHA 3E9NA 1RS0A 1WR8A 2X6QA 1C3LA 3H11B 4KGZA 4EQ6A 4JCCA 1PD1A 1UCFA 5EGNA 2CJFA 4PIVA 2BV3A 4F4HA 5DNCA 4L75A 5F9MA 3AR3A 3KU4A 4QDUA 4LGYA 3RSLA 3TXXA 4EG1A 2AKYA 4L8YA 1EVJA 4UZSA 2H7XA 4CM5A 5F35A 2LGJA 4WEQA 3OWOA 4TVBA 4Z4EA 5AKJA 3GCZA 3QXXA 2R44A 2YXEA 3LHIA 5AK4A 4WK0B 2O8DB 4Y6RA 3BMXA 3V8VA 1G18A 2JK1A 4NU0A 1VRVA 1GCIA 1ZRMA 2HRRA 4TRNA 1P0CA 3L7JA 2ZE5A 3DXYA 3EEBA 4IIDA 1G21B 3T9AA 4JJFA 1S0UA 3D0QA 3LTEA 3KSRA 3W5IA 4D6PA 1TVEA 3VTKA 2Q7DA 1ZU4A 2VHWA 3AFGA 2MINB 2Q0SA 4MA5A 2QTRA 5CLJA 4B3CA 1ZJZA 1T8PA 4HTFB 2A1IA 4FFSA 1TAGA 3SS7X 1N2HA 3GZ4A 1LRJA 3G3EA 4J16A 4ZV9A 3ILSA 3DMPA 1VOTA 1CQIB 1G2QA 2ANBA 4YWHA 4AO7A 4B4UA 3UPTA 3PITA 1RYBA 1HYHA 2CL5A 1UR5A 4A2WA 3BF7A 1I3OA 3SSOA 3X44A 5B3JA 4M88A 5I9MA 1NF2A 3RQIA 4IDPA 1CULC 5FUQA 1XEXB 3STUA 4FCCA 3ILYA 1IM8A 1KJNA 3QH4A 4X61A 1TMOA 2C92A 1WU8A 4GEGA 4WY5A 5TF4A 3ZS8A 1U3FA 1PJ2A 1JAXA 4MDHA 3TKAA 1KR2A 1YBMA 3KRTA 3PWSA 1ESNA 1R9MA 1N6RA 3R41A 5BPFA 1KZHA 1CUHA 1D2RA 4EKIA 2O3RA 3K1AA 1I0IA 4O3FA 1IZZA 4JX8A 3QXHA 5GOTA 1Z3IX 3PV0A 3R4CA 3NUGA 2VP4A 3P27A 4XUGB 5K01A 1VRCA 4LUCA 5JYBA 4D3DA 2CFOA 5DU2A 1EE1A 5KQSA 1HT2E 4N7BA 4GQBA 4XSGA 2YXPX 3LRTA 4HEQA 2ZSBA 3A6PC 1Y7PA 2BFFB 3QOYA 1WV0A 3DF7A 1TLTA 1XAJA 1F0KA 1Z7EA 2P0AA 3WYAA 3SLKA 2G71A 4G9EA 4QU9A 4R8KA 2IDKA 2PPVA 1OJ7A 1Y33E 5L40A 3SBOA 2Q6LA 4LY0A 1JG4A 4JQCA 3HLKA 4C2AA 2D74A 3K09A 3OWHA 2PEZA 4HN9A 4XDYA 4DMGA 2CHUA 4P7BA 4ARIA 1FMCA 5B4UA 2H59A 3D3NA 3GPCA 4F93B 5CNJA 3LY8A 1TRKA 2PBFA 4PWYA 3KQPA 3NTRA 4B6JA 4DT1A 4CM3A 5LC1A 3WYEA 3T54A 3RKUA 1DC6A 2HV9A 4NG4A 1J7KA 4NK4A 4C4XA 1YD7A 2XY4A 3LC2O 2IX3A 4HNAA 1GA4A 1QCCA 4POAA 1G8MA 2QSYA 5JO9A 3E15A 4CEIA 3SYKA 4UQLA 4ZQHA 2H06A 5CTJA 2HRCA 3T61A 4AMGA 1WUYA 3GFSA 2V65A 2NNLD 3QVJA 4OD0A 4YRDA 1NWHA 1VIAA 3FCCA 4L6IA 3KUKA 3PZBA 5EWLA 4QYMA 1NRIA 4X6UA 5EZ5A 4EG0A 2H2DA 1NVWQ 1PJQA 4MVJG 3R77A 3HUUA 3OTQA 4YBRA 1HKUA 4WZZA 1OA0A 4W6QA 2D5IA 4J0GA 1L8OA 2FUG1 3K0AB 4BMSA 4NXMB 4HGQA 3EVGA 5T4FA 3V8PA 4HVTA 4B76A 4IHQA 4CMAA 4EUKA 1CRWG 4KXYA 1E5TA 1VPEA 4W5WA 4CKWB 1Y6ZA 1D8TA 1DBVO 1UP4A 2Y0BA 1DQNA 2JCSA 5KVQA 2J4CA 3OEED 3K1YA 3PJRA 1TM1E 2DG2A 2DBYA 1N6OA 5HDQA 5CT9A 5C4GB 1A77A 4FMPA 1I24A 2X42A 3R9IA 3OE4A 1N9KA 3DV9A 3GC6A 4N18A 1CP2A 1V3TA 3WZLA 2O52A 4FEYA 2IU4A 1W4LA 1V8DA 3KB1A 4D98A 3V4FA 3OJXA 1YRQA 3O4JA 1E0AA 3B6KA 2PYZA 4C6TA 1WKBA 2VC2B 4F7WA 5DISB 1Z4MA 2B20A 4MW1A 2JC3A 1XK7A 1FX1A 5IM4F 3GAAA 1YSCA 5DTMA 1JN0A 1ZIOA 1G4AE 4XYLA 1PFKA 5DN6A 3T52A 4QAJA 1XLWA 5B1SA 3O93A 4RE6A 3JAKA 1P6UA 4KE6A 2WKSA 1ZU5A 5LD2C 4R1SA 5FPHA 3WGNA 1ULZA 3SF0A 5CCBA 3JQ8A 5AI8A 4C1NA 4MGZR 5IWCA 1QDLB 2YZMA 1MB0A 1GIAA 4PFQA 4FYYA 2DB3A 4K8RB 1B42A 4L85A 1U2PA 1BX0A 1JUDA 1ZVQA 2QPLA 4UU7A 4DEVA 3ZHVA 3CMCO 5DGDA 4HMOA 2H2WA 2IZ0A 3L93A 5H70A 1GTMA 2YYSA 3OMWA 2FGKA 5AKLA 1BE6A 2PX2A 5CVEA 2PUTA 4LTMA 1LW6E 2FW9A 4HXGA 3WHIA 4FW9A 1MV5A 4PC2A 2XRYA 2A6PA 3K4PA 4B6QA 4Q9NA 2FN9A 3DM5A 3SNKA 1WXWA 1X7WA 2BBSA 3OUUA 4YPOA 1ELOA 3IEVA 4GL2A 1Z33A 2IYEA 3NRJA 1VIYA 4I7EA 2FZWA 4AFNA 4EYGA 3R3YA 2R6ZA 5B58C 2CWWA 4DIBA 3MNFA 1T3LA 4EMSA 4DUZB 3T34A 1P6XA 4MJ7A 1M6VB 3MUOA 3U49A 1NVGA 1W4CA 2XAAA 4R8MA 4ZDKA 4YQEA 2PUJA 1R6AA 1Q1NA 4FC7A 1LLDA 1WPXA 4ETNA 3QA9A 4EGSA 3ITDA 1IDN1 2YJ6A 4FUQA 3TDMA 4LMAA 1JIJA 4BV8A 3TTUA 1J8QA 1QTNA 2C5EA 3UK1A 3ZU5A 1UBEA 5A3JA 2FFQA 1L5RA 2X7XA 1PLJA 1T9ZA 4MZXA 4BNNA 4NBLA 4R1TA 1LI5A 4RFLA 2VHYA 4RXMA 4BNXA 4CG0A 1Y4ZA 4K40A 4P93A 5JPDA 3IP5A 4PICA 5F73A 3LMKA 1ZNXA 5DK4A 3DBRA 1U8EA 1MPXA 3IMGA 4TXHA 1NY5A 4MQMA 3EZFA 4MRMA 3QG5A 1E77A 2B7LA 2CD7A 4DLLA 4YMVA 3OTOB 4M1ZA 2BH2A 5J23A 3O94A 4CKWA 2AXNA 1JIXA 4DQDA 4P0PB 1FLAA 1U3VA 2CYBA 2RJNA 4FYVA 3UTDA 2F3UA 5KTRA 3I64A 1XQ6A 1RACA 5AQEA 1QH0A 5E2AA 5ILOA 4Q01A 3I9FA 3A1WA 4NKRA 4Y2HA 1ODLA 4YAOA 3S2GA 4CTJA 1UBGA 4ENRA 4WKBA 3HXMA 4LJ4A 1A4IA 1JLMA 1N32B 3Q2OA 3VM6A 2OBFA 1L3CA 1LC0A 5KCZA 1EZ4A 2O5VA 1IUNA 1NP6A 4OYHA 1ZW1A 4AX8A 1DKOA 5A03A 4JYPA 4MUHA 3WNVA 2IXTA 2R1TB 4TV8F 5JAHA 3U7QA 3OZXA 3RC3A 1QO9A 2CZQA 3FH0A 3NWEA 3OEYA 4QGHA 5LB4A 1PEDA 4AO8A 4D9JA 3K6JA 5IHPA 5EYPB 4V1CA 4UTZA 3DHVA 3LKDA 4FDLA 3D6FA 2LR0A 1CUIA 3IDSA 5EJ9A 5J5CA 4BU1A 1M7BA 3GVXA 2VH1A 3GX1A 1AZLA 1MNAA 2I55A 1FBTA 2EG5A 5BVGA 2FXVA 2PNFA 1P4SA 1YL5A 3E9EA 4LWZA 4KI0A 5EKDA 2XZDA 3L8CA 1N1EA 1E1CB 2PG3A 4AJOA 4XW2A 3FLMA 1RJDA 2XWPA 3OUTA 4WE3A 1YTUA 4HUQB 2FPUA 1CYEA 2IK8A 3K0FB 2IHZA 3ETEA 1M74A 2JRCA 2K4MA 1IE3A 3U3OA 2E87A 2R97A 4PWZA 2A0XA 4FTWA 4AC9A 3VX4A 3OLXA 2XSZA 1ZD4A 1YFZA 3ZGNA 4RVHA 3V8NA 4U8HA 3U37A 2GJ8A 2Y8EA 1R0WA 1DBWA 2B3DA 3G8DA 1JDBC 4CTOA 5A3SA 3TF5A 4P81A 4ZA2A 1EVLA 2ODQA 1C7QA 2IEDA 1VMDA 2XCQA 2ECPA 3E7FA 5E6RB 5GMOA 5COAA 1V7CA 3CNOA 4F4DA 3HV2A 1Z4JA 2WWHA 2BJHA 5AP9A 3A2MA 3IAM6 3L46A 4FT4A 4Y6SA 5KAMA 3ETHA 3QYJA 4OB6A 5ALGA 1Q1EA 2Q5LA 3LD9A 1TUBA 5C53B 4JMPA 4JUFA 2ZWPA 1T6BY 2OO7A 2M6KA 2WIDA 4IO1A 4DIDA 4RESA 3RRNA 3PE3A 5DGTA 3HJRA 3NYWA 3L02A 1RFGE 3EUWA 4K9KA 4O4JF 4RZHA 4ECAA 4F71A 3GLFB 4PZ0A 5EWMB 1Q15A 2P6NA 2C0QA 2ERYA 2Z4RA 2HLDD 4YONB 3Q8KA 3PR1A 3WLNA 1OC2A 4MLPA 2HJ9A 4ESHA 1X38A 2WUDA 3LDUA 3DUWA 1F5SA 1V5IA 1GFZA 1NONA 2XTJA 1PS8A 3BK1A 5BN3B 2HPZA 2ZZKA 1EHCA 4OQQA 3A58B 3MJVA 2ZRQA 4QXOA 3GZNB 1ENYA 5EMHA 1SEPA 3OIUA 4R2WA 4R5HA 2B6HA 2GX6A 3IJEB 4X6YA 3WS7A 1CBUA 3TLGB 3RO7A 1WZUA 3JD4A 3KUUA 1V4BA 4IIXA 2QBYB 2Z1DA 1P4JA 4XCXA 5ALUA 5BPHA 5CDGA 4A15A 3WR5A 2RE8A 2AFHB 4LYGA 3GJ7A 3U7HB 1REQA 2X6RA 2XUFA 3RBVA 3F5FA 4IJUA 1QGED 3HP1A 3MZ0A 4DMHA 4IRUB 1D0SA 1F6WA 2JFUA 2IT1A 1VYHA 3E05A 3FD8A 1A27A 1SBCA 2BKVA 3P19A 2YV1A 4GX2A 5DBGA 4TXLA 1IN8A 1IZ7A 1ORHA 3JVEA 4OI0A 1EGHA 1KS9A 4JOBA 2IEGA 4ER6A 2AK3A 3THSA 4PBSA 4ARAA 5HQ3A 1PWEA 2DPXA 3EW7A 3OU7A 3LIIA 2WU1A 2XZLA 2UYGA 2XDWA 3G0BA 2VT3A 1J2EA 3RBXA 3ITKA 3RG8A 3T3HA 1HY3A 1MVOA 2WG1A 2ZB3A 3PT9A 4TWJA 5FTWA 5IKOA 3PDIB 1DELA 3VHRA 3T5CA 3ECCA 2IP2A 4N49A 1ID1A 2HQSA 4LCEA 4QJBA 4YCDA 2J41A 5ALDA 1M1UA 1S8OA 4BCCA 2II6A 3PLNA 1XMXA 2R9VA 5IC6A 4ZCIA 2I3ZA 2G8LA 4IFIA 1JLKA 1HYGA 3PYLA 3QK7A 2ZRJA 5DGXA 5E1MA 2WVJA 4YMWA 1U11A 4JEHA 3D4LA 1P0QA 1T5DX 3C15C 1PLLA 4TSKA 3AU9A 3BFJA 4NCNA 5IT9A 3BA6A 1K66A 2NUAA 1U5AA 3Q2IA 2Q1WA 4EI2A 5AVJA 3K6KA 1AHHA 1ZOLA 2FPXA 3COVA 1V8ZA 3TXAA 4QO8A 1BU8A 4H1TA 4C0LA 1KMCA 1F8YA 1X7XA 2A84A 3CUVA 3HY6A 2HI0A 5T3UA 2GERA 3V97A 1Y1LA 5EUCA 3OT5A 5JCJA 1OZFA 3TQIA 1P1JA 1WIWA 5JC1A 4AI6A 1C9NA 4G6ZA 2B4KA 4V3BA 4NZOA 1P9WA 1Y48E 2VG8A 3FFXA 2P2DA 2EQBA 1Z39A 2PKYX 2Y1GA 2AH5A 3I3SR 1XZ8A 3UA3A 3I2GA 3MT9A 1G7SA 3SHQA 3HKCA 3TO5A 5KSPA 4AB1A 2AKEA 1S2MA 3HJCA 4LYEA 1DEXA 5LP6F 4Q4JA 3H4VA 1W46A 3H19A 1KOFA 5EIOA 4BNUA 1C9JA 1M76A 2IYWA 3Q7QA 4JXJA 1R3DA 4P98A 1F8GA 2REQB 3NJ8A 1NMSA 1XZKA 3HCBA 4K9OA 4F96A 5HXAA 5AM1A 4EPRA 4I1PA 3CH6A 1MC8A 1USIA 4A5OA 4BBAA 4DRXA 1GITA 3FTNA 4GKVA 1N3BA 3I4LA 1DKNA 4W4TA 3TWOA 3VR3A 1TIBA 5C31A 4IXMA 4D8YA 3BSWA 3TZQA 5CYGA 4RTSA 3AJ8A 4Q3AA 3CONA 4L0MA 1DS6A 3C7KA 4CL0A 3VDMA 1N5OX 2QGZA 9LDTA 2WTBA 1BJKA 4AROA 2Q2NA 2I91A 4IVQA 3GJRA 5I9LA 5IFLA 4EHDA 4MRSA 4WI1A 2VI5A 1H4VB 3AW8A 5LQAA 3OX1A 1ZVKA 4WLOA 5H0IA 3ZHYA 3JQAD 1UBNA 1J0EA 4CZ2A 4FPXA 4B79A 4X41A 5KTYA 3ZWWA 1KIFA 3W0LB 3ER6A 5LD2B 1AHNA 2GSDA 2CLSA 3PUWA 1XJCA 2P77A 4OU4A 3SY8A 2P2SA 3FN4A 4BWFB 3WLJA 3OLZA 2JGMA 5JECA 3T0GA 1FF9A 4DCUA 1GZ7A 4LW8A 1NPDA 1QNFA 3I9KA 2JZCA 3A4VA 2NXWA 4X85A 1O0CA 2WAOA 5KYTA 1QB8A 1SG9A 2BUBA 3DDCA 1IL0A 1M34B 3NV9A 3ABZA 2QENA 2K2WA 1L6RA 2C2MA 2JCVA 2VRWA 3HZHA 3R5KA 1P7ZA 3G0CA 4O8CA 5EJ2A 4DEYA 3S2FA 5BOSB 5JC8A 1NHGA 1GAEO 1LUAA 2AQKA 2I2FA 2YH2A 5DWDA 4ZCMA 2EWMA 2DETA 5DM4A 4OOFA 1YQQA 2PFSA 1GTJ1 1MPTA 3DD1A 3V7WA 1FEZA 4P3NA 1K8YB 4WKNA 1W48A 3LUJA 4XXHA 3E61A 3JVDA 3JXEA 4YRRA 3W1EA 3KLPX 2SCUB 3IR7A 4IRXA 3THYB 2UUBB 3ICCA 1XE3A 1Z6ZA 2YFYA 3PGA1 4I2NA 3K9NA 4WFQA 3ZN2A 2YOHA 3VTFA 4R01A 1DJQA 1ZCZA 3NALA 1P1FA 3P2IA 4FX5A 4OVKA 3CB2A 4C89A 2CCJA 1HQDA 1R0LA 1EBUA 3IR5A 4QGAA 5DXAA 1EHYA 5JD3A 2BCGY 4N3AA 4C21A 1GDTA 1RCUA 1EFPB 1NLZA 3JASA 1NMQA 5THXA 3I1IA 3RC9A 4D4JA 4DS3A 4EY7A 3N0WA 5IMBA 2PSSA 4MW6A 3QA3E 3WRXA 5AK3A 1DTWB 2RB5A 1EX7A 1HDIA 1USKA 3K5WA 3KYDA 1OIWA 4K1XA 3VH2A 5TSDA 1DTEA 4ZOEA 1H6DA 3H5NA 2DFDA 3HCFA 2GILA 5CB8A 1X1TA 1E62A 4KVFA 2CB9A 4NJMB 1D3AA 4WJZA 1VBKA 3KP1A 1E5QA 5I7SA 1EH5A 1XPRA 4B4WA 2W2TA 3U1BA 2PWBA 1AZTA 1XC7A 3KU1A 4P3OA 2FQ1A 5GY7A 1VHQA 4L28A 1Y6FA 1K2WA 2I1QA 1TU4A 1CQPA 3GFOA 1JG6A 4GP9A 1FFXB 3EQ2A 1QK5A 2AT1A 1U1DA 1B14A 3IODA 4HAZA 1NT2A 4LA4A 4LBWA 2IZ7A 1F6DA 2DPHA 3N9IA 1L5HA 1E2DA 2JLXA 3R40A 2JFNA 3QLUA 2JGJA 3DLIA 4GUDA 2ZPTX 1J7JA 2UZ1B 1SOWA 2VP0A 1J9GA 1TQ6A 4KBFA 2YWJA 4HZIA 4LDNA 3ROEA 1D2HA 1RRGA 4J7AA 1X2EA 4JR1A 3GT4A 2BYTA 4G5HA 2I6XA 3E4CA 4XIFA 2VLIA 2R7MA 3TSOA 5ILQA 5DF1A 4XPIB 2Q21A 5KWEA 4DCPA 4P31A 2FW8A 3Q7PA 2XDAA 5ADWA 4JYZA 1DC3A 3QTTA 4I5GA 4P3PA 1OTHA 2FPSA 5IC4A 1FQJA 3JQFC 2AA3A 1OMOA 4I19A 2HNAA 2I4OA 5IP5A 3W6PA 2J08A 4ZODA 5FADA 4KVZA 1JJAA 2YASA 4L02A 5DO9A 5JVDF 4IQGA 4NDNE 4OG2A 2DJIA 4B81A 2G9UA 2V6IA 3BL6A 1YZGA 4TV9A 3FBGA 1HDGO 3T35A 4C7OB 3HUTA 1M34A 2WG2A 3PNMA 2OR3A 1OIXA 4RV5A 2Z3WA 4FZVA 4H4CA 2QJOA 4NBKA 1E2LA 1GZUA 3ED5A 3W4KA 4RHCA 3ZWVA 1U5BA 4MCHA 3WK9A 1Z4IA 4HN2A 4E5VA 4HG2A 4PGGA 2V7QD 3TGLA 1X6VA 2VJMA 1JPJA 1YUBA 2NX2A 2PL9A 4ZVMA 1Y81A 5IC5A 3EH1A 3ST7A 3T9CA 2Z9CA 3MRXA 4YAIA 4DUYB 1YK0A 3I9LA 1K0UA 1FTGA 4RY9A 2BTOA 1QK4A 4QRDA 1XD2B 3LBFA 2C7OA 3KXPA 3DE4X 4OQPA 1JFFB 4ZMBA 1XLUA 2ZYVX 2HCTA 3FX2A 4RQUA 5IKEA 5CDYA 4DGQA 2DUUA 4DLYA 4ZP1A 4RTPA 1QP4A 4F3TA 3ROTA 1NJGA 4GPBA 1ZUHA 5EJIA 4AK9A 4LJ6A 2B5VA 5I3CA 5JOQA 2Y0DA 3CW2A 3OOWA 1ZNZA 3CVJA 5L3ZA 2NZ2A 1Q0QA 3H4TA 4Q9IA 1RM0A 2B8EA 1IB0A 5F21A 3F3MA 3DTVD 3KPWA 1F12A 3BA1A 1G5RA 3QHAA 3JYQA 4PTYA 2HA4A 4Z4GA 3NV7A 4ZVSA 1ZFNA 4FU0A 1P4HA 5BQXA 1X7HA 3PVSA 3WLOA 4G41A 3Q1LA 5EQTA 4M46A 3K70C 1KYWA 1PYGA 1H2ZA 1G20E 3WL8A 5G0TA 1VYTA 1VIMA 4GBMA 4QNMA 3UAVA 4I50A 4RHYA 4Y0VA 3BXOA 2Q45A 1YJQA 3HHEA 3PUXA 4NYJR 4YP7A 4ENTA 5I4CA 3SZGA 1I0ZA 3E48A 1VDMA 3IP9A 2CLFB 4NZMA 1WRBA 4KAJA 1C7IA 4JSYA 4QYSA 1SKBA 4XSHA 2QV0A 2ZAIA 3IQIX 5TXGA 2RIPA 3AUAA 1Y1SA 4Q4HA 2AUNA 4KFUA 1XCLA 1D6JA 1BCRB 2A92A 3AIIA 3KJXA 2WUWE 3Q3VA 4H77A 4Q9KA 3M6XA 3SF8B 3INRA 2BISA 4CQNA 4MJ3A 2BT4A 3KLMX 3PC4A 3LZ6A 4AVYA 1IEVA 4B6OA 5KBYA 1Z29A 2UU9B 4LXXA 1Y8RA 1DJOA 1J25A 1NVKA 3DAHA 1IZ9A 1DCTA 1XB2A 3LO8A 4M8IA 4N4AA 2XH8A 3UBMA 4HTFA 2V4UA 2X8AA 4IKOA 5E6SA 3TSCA 5AJTA 2YUIA 1PI3A 5DV9A 4C0QC 4CDMA 1E6LA 4C88A 1RYYA 1UKBA 1UXHA 1TK2A 2NT3A 5JXGA 3U19A 2BE7A 3AV0B 4OQ4A 2GAAA 4J4HA 1QOPB 5AVVA 1XRPA 2PVPA 1Z5WA 3A1EA 4BNZA 3NTOA 4GT1A 2VEOA 4KDFA 1IBSA 3QV2A 1OX4B 1X0XA 2CHVA 3E1SA 3LPCA 1I6WA 1DWOA 3OEHD 1R0XA 4AXBA 1DV2A 2AUMA 4KSCA 2E7ZA 4V3CA 1CIPA 4ZEOA 5I9TA 2H00A 4NMLA 1T2DA 5JBQA 1FSGA 3KQNA 1UJBA 4UZEA 1L1EA 1FDUA 4KQWA 3REOA 5HTOA 3NQ41 4PAOA 2HUNA 4LVNA 1HSZA 2CUTA 1JE0A 1K7XB 5KZMB 4A1OA 2PS0A 2PD6A 4RLHA 1EHIA 4ZVNA 1QKJA 2OCKA 5H82A 3RT1A 3EZXA 1J90A 5KJEA 3DD5A 4I4NA 3VC7A 2DXIA 5CUQA 1UMCA 2P4SA 3B6JA 3I0ZA 4KR9A 1IMJA 2W90A 3G2HA 5DX0A 5IWAB 2W8ZA 1GUAA 2EL9A 5A5FA 3R7LA 4IJMA 2CLIB 4WN9A 3I23A 4H7IA 4HH1A 3D4NA 1ZQ9A 5IG2A 1EGMB 4UVEA 3U31A 3S2SA 3ICQB 4QGSA 1SCUB 2Q6IA 3AKCA 1BGVA 1Z7WA 3AKDA 4C03A 5JARA 1T9GS 1YZLA 2V7TA 3TCXB 1XDDA 1FMFA 2SECE 3FPHA 2O2YA 3GXOA 4HEJA 4N41A 4BLOA 2IZOA 4MVCA 3OETA 2R5FA 4RYLA 4TQGA 1VSVA 2V5UA 3RG2A 3A9TA 4ZHQB 5JZOA 5TQJA 3RRXA 4CKBB 2X6TA 3GMDA 1KYXA 3HKBA 3DQZA 1XHEA 4CCWA 2CNWD 4AMUA 5KQLA 3JWGA 5C0OE 1WW3A 3FUTA 1PGOA 4OF4A 3REFA 1U1CA 2VP6A 4ZEVA 4NAUA 1S6YA 1XA0A 2XUAA 4JYCA 5DYWA 2JLBA 1L0BA 2WMOB 4IDHA 1LQ2A 1BQEA 3GG2A 3TRJA 4TWAA 4D45A 5I9IA 1IFXA 1H2YA 1VE7A 3N2NA 3EEQA 2A5YB 1IK4A 3ZCXA 1I1NA 1EM6A 4DPLA 1YV9A 3RS8A 1BRTA 4DLZA 3RV3A 3DZHA 3N5KA 4DKJA 1YCFA 2VN8A 4MQUA 1MW8X 2DX7A 2IGBA 2A1UA 3R9XB 3BERA 1QFYA 5CFZA 4NZNA 2QDKA 4XDGA 2EFCB 1LDEA 1P17A 2Y68A 4L74A 5ITWA 3BGDA 3HWX1 1AVTA 4ZV7A 3REQB 3CGGA 3PC3A 2C20A 3HBMA 4EATA 3KV3O 1QE5A 4B87A 3VPAA 1RNLA 1D1SA 3LW7A 1JU4A 4ENVA 5F12A 5IASA 2XYGA 2FKAA 4BASA 2DM6A 3GJXC 2Z95A 5JAIA 3QIVA 1I14A 5AVSA 5IZCC 4QECA 2JA2A 2PLWA 2YTZA 4PHHA 1EPUA 3D5EA 1K27A 1AQIA 4GGPA 2VJCA 4AZ3A 1N6KA 4DMMA 1O94C 2JANA 3H3XA 3WHLA 4D2IA 4OXRA 4OHCA 1FMLA 4NESA 2L19A 3HU1A 4BE9A 3D9QX 2XB9A 4MEBA 5D1NA 4RVUA 5BWNA 1ZAYA 2EATA 2VDWB 2VZ8A 1UP6A 2AYYA 2YVLA 1PUIA 3OF3A 2V98A 3RASA 4NZYA 4W1SA 5D3ZA 5LWQA 1TUGA 2FB9A 2PMFA 3ODGA 2GPTA 4FWBA 5KAPA 1FP4A 2JVJA 4C0SA 2OY0A 5BQFA 1T8YA 4WUTA 2NPIA 2VH2A 4LF5B 2QR5A 3VKHA 2PTHA 4JI0B 1VI2A 1MH9A 1NR7A 2K2QB 1GGHA 1W0JA 2PSJA 3E7WA 5FAXA 4RS3A 2OAQ1 3DMNA 5EVJA 3ZNQA 3ZX4A 3T3MB 4K2AA 3MWFA 5E0OA 1MOQA 2QN6A 1S01A 4Y2GA 4YECA 3HXLA 4X7BA 4BBZA 5KS2A 2BP7B 1GT91 2BDEA 3H9JA 4QUGA 1XZAA 2LXNA 5F3DA 2VHCA 1SC9A 1NKVA 4KIGA 4YXWD 1T5BA 1KO7A 1N2CE 1P75A 4C5BA 1T9DA 1BMDA 2QRMA 3ELYA 4C1BA 2ORWA 4DJAA 2JJ1A 3BJEA 3ZNOA 5LA6A 5LU9A 4U7DA 2NAPA 1KO5A 1PFGA 2Q5OA 5I5EA 1V43A 4RKWA 5JXWA 5DM2A 3OP4A 4HKTA 1SVKA 3LF2A 4LYYA 1OT5A 2FSUA 4ONEA 1JJIA 1V1JA 3I12A 2A86A 3CNHA 2R2AA 4HRXA 1GOTA 5LQKA 1P0FA 1NQOA 2BGLA 2XXBA 3GWZA 5DN6D 5B3KA 2PNJA 3IPRA 5CVJA 2OLKA 1S8FA 5GV7A 5CH3A 2HCJB 3GA7A 4GVLA 4W9NA 4O4HF 2PGXA 3EN0A 4C4YA 5FQNA 5EJ5A 5EXSA 4BL5A 3KHUA 3O4FA 3TQSA 1KSGA 4BJ3A 1UADA 1FYEA 2DBRA 4P7JA 3KYBA 3WGKA 3H7AA 4IJ6A 4GQIA 4HAUA 4LC0A 1RP1A 1TDJA 5GJCA 4CV0A 3JD0A 4YAUA 4NRDA 2P78A 2B82A 1Y1RA 1GGNA 2QV7A 2YKGA 2FMTA 1W0KD 2HQOA 3SIXA 3W5JA 2PO5A 5BNZA 4G26A 1Z36A 2FZLA 3M4NA 2Z30A 2VBFA 1T9KA 3CFYA 1W93A 2IXDA 1GN8A 4QBFA 3F5SA 5JAMA 4OQEA 1DCMA 2ZRCA 3HEAA 4RKYA 1E3WA 1YACA 1FLVA 1X87A 2Q8QA 1TXGA 3OZEA 1ZIPA 2UVPA 3EWSA 3NT4A 3M7IA 2PGDA 4K9DA 3ZV7A 1MJNA 3JQ7B 3ZWDA 4OUDB 3RK1A 1ABBA 3ISJA 2R6CA 3MJSA 1SXJA 2O2GA 3GW8A 2Y66A 3PC8C 5H68A 4RTQA 4G37A 4GR4A 1RWPA 4OP1A 4A1FA 4FIDA 1NA5A 3OIYA 1FTYA 4M89A 2C88A 2H17A 4QHSA 4ZO6A 3EAFA 2WKWA 4NY1A 5AT1A 3UIEA 3FTEA 2HSEA 1HQKA 3AIKA 4ZVQA 4L5IA 3GJ4A 3MD0A 4B2IA 1P5FA 3PDJA 1QGOA 2RGYA 2VF2A 3IULA 1K75A 5CK4A 3CGWA 5AW0A 4GOXA 4PYQA 4CF6A 1XTTA 3GLSA 5IJ0B 3VH1A 4M8LA 5BRAA 4S05A 2PFGA 1PVVA 3AHJA 4IIJF 3R7AA 5I7UA 3M3DA 3OJCA 4B7UA 4J03A 1TAHA 3SEAA 4A36A 2DVMA 4KO8A 3D0RA 2X0KA 3C1UA 3U3KA 1KI6A 2OOSA 4E5YA 2F48A 1U2ZA 1JYEA 1WQ3A 1ZZGA 2H1SA 2V7BA 3P9QA 3R7SA 3NVKI 1QANA 1O7JA 5F51A 2RHDA 1CUSA 5DX8A 1U3GA 3KZOA 4JB0A 4RV9A 4CR8A 5C4IA 3UB2A 4KK4A 4AN1A 3KETA 3TLGA 4I3HA 1UINA 2P9CA 1J4AA 1YE5A 3NOOA 4PYLA 4A3SA 3I1FA 1T4CA 4OM7A 3K30A 3SE7A 3IP6A 4M55A 2PS3A 4O0LA 4YRFA 4LZNA 4NP6A 3KIPA 4I8IA 4ZI2A 4S04A 4QJIA 2FDRA 4F5EA 5IKMA 4KFRA 1Z2NX 3LPLA 3OQPA 1L4YA 2FE1A 4F7DA 5MFZA 2QSZA 5B3AA 1E3MA 2C4VA 2VUTA 4OMFG 5AKIA 2YXBA 4YAKA 2HA0A 4QOHA 3ZVRA 4BHTA 2I4TA 2ODAA 3NFYA 4JP2A 4O4JB 4OFWA 4Z51A 3C7DB 5TMEA 2ZB4A 3IDQA 5CDFE 1Y3FE 3K8OE 3N75A 4LXTA 5AK0A 1U3CA 2IDJA 2PX0A 3U4QB 2ADFA 3QLVC 1L7XA 4KWTA 2IEIA 3DV2A 4YRNA 3AEYA 4MVJE 5F52A 1Q17A 3NFRA 5ETJA 6YASA 1A9RA 4UCXA 2J4FA 5KQMA 3ZLTA 3ZHQA 1A7JA 1CV2A 5BO5A 1SA0B 2XI4A 3W04A 3WLRA 1A72A 1W7AA 2IHYA 1VECA 1R0BA 5E7JA 1IBMB 3F7TA 1PWHA 1VLMA 1M75A 1MFPA 3O8BA 2FCRA 4JIGA 1Y3AA 2BMEA 3BRWD 4KQMA 4BATA 5HM6A 1DAKA 1PK8A 3KPJA 3NNDA 4DYHA 5E6RA 5GONB 2NVWA 2RIRA 1ECFA 4M76B 2PE5A 5CHEA 4TMZA 2PRZA 1U6JA 2WJHA 4UTPA 2OQIA 1U9IC 3SR3A 5C8YB 2A57A 2J6IA 3W5SA 3QSYA 4B3SB 5BR1A 3UQZA 3HGTA 1G5QA 3RYHB 1WZCA 4YAJA 4TTJA 4H3VA 4IJQA 1UBLS 1QTRA 2RHGB 3L6OO 1G0NA 3D0KA 7ADHA 1NQUA 2JD2A 1W6RA 2WJZB 3HDJA 2V7QA 2WF8A 3G89A 3Q0IA 2H4FA 1SB9A 3F3KA 3L06A 4G4IA 3URMA 2E2WA 4HP8A 3G68A 2EJTA 2PBLA 4Q3BA 2ZUTA 4Q7KA 2XA9A 3P7MA 2EFEB 3KKQA 4H7EA 1ENOA 2C9MA 2PQ0A 3IRVA 4FDUA 3U3ZA 2OZKA 5EFOA 2VTVA 2CF6A 2DOKA 1BS1A 2J46A 3DTYA 2EDCA 5EEGA 3IAM1 4M1EA 3GV0A 3C87A 2WU4A 3DCJA 4TL9A 4UEQA 3DKIA 4EY3A 4ABTA 1JT2A 1EWTA 1G7CA 2H4HA 1JEAA 3BQNB 4P4NA 2V59A 2Y9MB 3AF5A 1VKZA 3CZPA 2IEZA 1Q0PA 2X23A 3OT1A 3QPAA 2QL7A 2ODBA 3B36A 4JQYA 3O73A 1ZI8A 3VZDA 3T7AA 4YAGA 3QVOA 3ORFA 4HNGA 5DK6A 4AAYA 1RZVA 3B3JA 1DJPA 4JC5A 1PR9A 3T0IA 4WD3A 3MC1A 2VOJA 3BM5A 2FH5B 1AF4A 3FWNA 3S29A 1ISFA 1DPGA 2W0MA 3A4LA 3O83A 3BXHA 2H48A 4TN5A 2PL5A 3AGQA 1P4GA 4J43A 2ZW9A 4WZBE 4A0HA 2IPNA 3CH5A 3Q1KA 1Z4PX 1FFCA 2OHJA 4FHFA 5J3JA 4MKRA 1JLSA 1H2EA 5IAKA 3TQQA 1EAYA 4MVJD 1D5CA 1JHAA 1ILEA 1YA8A 2PTGA 1AZSC 1SUSA 3IDAA 3NHFA 1KK1A 4DWVA 2IBTA 4BNLA 1PZMA 1U8FO 3H2ZA 3BCSA 3BFPA 2B98A 1UQUA 4L2IB 3U62A 3SE0A 1RLMA 2ZIAA 1JYFA 3AEKA 3MT0A 4PLHA 4BKPA 1KIAA 1Z6YA 2MTBA 3H05A 3MWDB 3HB7A 1E2IA 2EC5A 2IQIA 2IH4A 2QQ0A 5AHWA 2EJCA 1QG4A 3F8SA 2FPGB 1WW8A 3FTPA 2GMWA 4MQEA 2WU8A 3A9WA 5HOQA 3LV8A 1KRWA 4I5DA 1WHTB 1HDRA 3BG5A 5DYGA 4UREA 3V4SA 2FY8A 1E99A 4MWOA 4ESVA 1F2UB 1XLVA 3HZZA 3U3MA 2GN6A 2OZPA 3P26A 1U2QA 1VPVA 3H3JA 5DFAA 4CFSA 1KRXA 1E4EA 1RQLA 3PRJA 4NG5A 5HRAA 2MU1A 1QYIA 4IS3A 3DFUA 1O5IA 1SN7A 1X8JA 2Q3JA 3OKCA 4HNAB 4O25A 3ZQJA 4OL0A 4QFDA 4OKNA 3ZH9B 4J76A 5FL3A 1SG0A 3QJ5A 3I61A 1GUYA 5JHGB 4XH9B 4UUBA 4HYTA 4C7KA 2JIDA 4OBEA 4W7HA 3OKPA 1XKTA 4BNMA 4R0MA 2F00A 4DADA 4RTRA 1ZXLA 3WMXA 4DNFA 3IP8A 4FDTA 3K9GA 2JI7A 1NVBA 3JQ9A 4CLDA 2O7RA 3E8SA 1BWQA 4PE5B 1ZJ6A 3T7EA 4ZVLA 3T9EA 3NGLA 1P1IA 1UM9B 1NUPA 3E22A 1SHJA 4JLUA 4OQMA 4WBSA 3AR2A 3NT2A 2C04A 1ZM3A 2C84A 4NENA 3KK0A 4MB6A 3A0RB 3N2LA 4JGGA 4QG3A 3SDZA 3I9V6 4P54A 5C7LO 1GL7A 1L7NA 1AO0A 3CXUA 2VPTA 2DWPA 2X77A 1TJ5A 2ZIZA 4U2DA 1LPOA 3JASB 4RLSA 3QVTA 4UULA 2YY5A 3NIFB 2EKQA 2C2WA 2OWDA 1HZZC 1I3NA 1QAMA 3C4QA 3CRVA 3MMNA 5T57A 4H60A 1N34B 2XGSA 5F2KA 4RABA 3T1TA 1DKRA 1DTWA 2P6RA 2HQRA 1GQ2A 2R8OA 2FSSA 1YJAA 3I6IA 3PRKE 1L4LA 1NOKA 1W5SA 1I32A 1XYGA 1H6AA 1Z8DA 4BQRA 5KKAA 2JCXA 1UQRA 2YVQA 3SHVA 1SELA 3JYOA 1XCBA 2XNDA 4CKEA 2F6RA 4E94A 4EG5A 4BGDA 4FCWA 4OJTA 5FNVF 4KWEA 4OHWA 3E1GA 4IPTA 1CVRA 2NZWA 3MCAA 4PLFA 4D42A 4R8LA 5KSWB 2VS1A 2QD4A 2IQ5A 4RORA 1ZINA 3ZHBA 5FTLA 4PC3A 5E3IA 3UCEA 2YDXA 3WWYA 5LXTB 5IN4A 4MCAA 5REQB 3NG1A 4ARUA 2ATVA 1CF9A 1EDOA 2NUBA 1ZZEA 2Q62A 1EDBA 1SUBA 1DT3A 3PPVA 3OU6A 1C8BA 3I2IA 4BO1A 1I2MA 1WULS 1Z2CA 3PUVA 5DTJA 3A6ZA 1UJ5A 3K5IA 3Q7SA 4JB8A 1CNFA 2AX4A 1DC7A 5AHRA 5FIUA 2F9MA 2HFJA 2ZETA 4CMIB 1XWIA 1EVEA 2XYQA 5C35A 2Y1LA 2XRMA 5J2UA 1W1IA 1RAIA 4P4GA 3SC2A 3SIRA 1P77A 1EIWA 1PFUA 1DADA 1YQWA 5GOZA 2NO7A 5HZKA 1T3ZA 2ZDHA 2YNMA 3IIMA 5C1BA 3RU9A 1T13A 4F6RB 2CSXA 3ZDXB 3ZQ6A 3AUSA 1ORWA 2CCGA 3O1LA 1K6MA 3E8MA 3DTNA 3WADA 3KYCB 3IEXA 3OZIA 4ND1A 2YS6A 2ZI6A 1O97C 1L7AA 4DAOA 4DQVA 1R16A 3SZOA 3OX2A 1GZ5A 2VPQA 4JP3A 4GL4A 4OB8A 5EJ4A 3WA7A 5FR2A 4ZOCA 3X1WA 2Q3EA 3LDAA 1WB4A 1E60A 4KC0A 4B74A 3MGGA 5DLYA 4FOPA 3ACDA 1DAHA 3H3FA 2JGAA 1IPHA 1EFAA 2X4LA 5JADA 3WWEA 5ES4B 2YN2A 3EA4A 3EE6A 2AC7A 1E1KA 5JSQA 5C1OA 1KFEB 5TQ0A 1X2BA 3I5XA 3RRMA 2AI3A 5ALRA 4B3JA 2RI1A 3MB5A 3A6FA 4X6XA 3RF7A 4QYTA 1JPVA 3UXEA 2ENUA 4EOGA 1FX0A 1UKVY 1LH0A 2GN8A 2A0WA 2SBTA 2WUVA 3EZ7A 3KOXA 3LNTA 2VXCA 3GRVA 4O4LF 4QEDA 1U0EA 3C3DA 1Q74A 3SQOA 3N05A 3TQCA 3FY4A 5AVYA 4H08A 4M0PA 2ZYIA 3RTGA 3BWYA 1RWKA 1URPA 4KMRA 3SR0A 4PN7A 3E3MA 2ZYTX 3DKVA 3ZIAA 5CCEA 4EH1A 2FF7A 4O2BB 2VDRB 3GUHA 4I9UA 4IDAA 3TLZA 1HE8B 3O8OB 3VQTA 1VGRA 3B6ZA 3C1OA 3CX7A 1CS0A