1NUUA

Crystal structure of human cytosolic nmn/namn adenylyltransferase complexed with nad
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
233
structure length
213
Chain Sequence
b'SRIPVVLLACGSFNPITNMHLRMFEVARDHLHQTGMYQVIQGIISPVNDTYGKKDLAASHHRVAMARLALQTSDWIRVDPWESEQAQWMETVKVLRHHHSKLLAVPELKLLCGADVLKTFQTPNLWKDAHIQEIVEKFGLVCVGRVSHDPKGYIAESPILRMHQHNIHLAKEPVQNEISATYIRRALGQGQSVKYLIPDAVITYIKDHGLYTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FKSG76
molecule tags Transferase
source organism Homo sapiens
publication title STRUCTURAL CHARACTERIZATION OF A HUMAN CYTOSOLIC NMN/NaMN ADENYLYLTRANSFERASE AND IMPLICATION IN HUMAN NAD BIOSYNTHESIS
pubmed doi rcsb
total genus 75
structure length 213
sequence length 233
chains with identical sequence B
ec nomenclature ec 2.7.7.1: Nicotinamide-nucleotide adenylyltransferase.
pdb deposition date 2003-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1nuuA00
3SZGA 5HUHA 3I05A 3GMIA 5FO1A 3IVXA 4MUIA 1KH3A 2CYCA 3TNJA 1TYAE 2D13A 3A05A 4MUJA 1KP3A 4ZT4A 3ZXIA 5IHXA 4MW7A 4EG3A 3CLUD 3L92A 5J59A 4NDAA 4JXZA 1O96B 1VBMA 3D6UA 1EUQA 3N05A 4ZCPA 1XJQA 4WNYA 3CA8A 5DEOA 3Q4GA 3IMCA 1JILA 3FG9A 3KT6A 4OJMX 3S3TA 1EFPB 2RD2A 1TYDE 2YWBA 4XFDA 3ISJA 1T9GR 4ZT7A 3CVWA 3P0IA 1N2BA 2XRZA 4CQNA 2H29A 4JZYA 2NSYA 1GAXA 1A8HA 3Q12A 1LW7A 3SYTA 1T9GS 1M8JA 1VLHA 2A4MA 3QTBA 2CV1A 1Q77A 3QTTA 4F3RA 1O97D 1GLNA 1X8XA 1P7PA 2CSXA 3IOEA 5TS2A 3IMEA 1TQ8A 2V0GA 2PIDA 1IHOA 2OV4A 4KPUB 1JZQA 4ZCQA 1K4KA 4MWEA 2J08A 2CYBA 4ZT3A 2A1TR 3COWA 4L2IA 1O94D 3ZJVA 1NUQA 2NZ2A 4GRIA 1K92A 5KHAA 1O6BA 2D54A 4MW0A 4TS1A 1NUUA 3IUBA 1KKUA 3QE4A 4K0RA 3FH0A 3VGJA 1U3DA 1S4MA 3P52A 4MW4A 1WXEA 2QUIA 1I6KA 1J09A 4NATA 2RE8A 3TZLA 1KAMA 5TEWA 4MVCA 3TQOA 2CFOA 5AHWA 3PXUA 5HG0A 1LI5A 1O0CA 3DO8A 3DLAA 1MJHA 1F7VA 2HMAA 3L93A 3PRHA 3VU8A 4PBSA 4XFJA 4ZCRA 1O94C 4RPIA 3NBAA 1JEEA 3X1MA 2O5RA 3MLAA 1JEDA 3MXTA 1OWLA 3IOBA 1EE1A 3TQIA 1WKBA 4ARCA 1TYBE 2QTRA 2CV0A 4R2LA 1OD6A 3COZA 1J20A 4I6GA 1O0BA 4DDKA 1KH2A 2YWCA 4UZFA 1NYLA 3IOCA 1JIJA 2QTNA 2J07A 4WSOA 2H2AA 4ND6A 2HZ7A 3PNBA 4HJRA 3H99A 4HJXA 1DNPA 4MW6A 1TFUA 3SZ3A 4MUNA 1JMVA 2IELA 1JECA 1IVSA 3CLSD 1ZJWA 2JANA 5J58A 1EUYA 2Z09A 3FETA 4MW2A 2CT8A 2Z08A 2J5BA 1M8KA 2C5SA 3RK0A 3OTWA 1LI7A 1I6MA 3A4IA 2DLCX 1K4MA 4G6ZA 3FI0A 1U7DA 1J21A 5K0SA 1V8FA 4KR6A 1MAWA 4DDMA 1U0BB 2IP1A 1NUTA 3K32A 5DK4A 4J75A 3FOCA 4KPUA 4GU5A 4ZT2A 3IVCA 1KORA 3AG5A 3UMVA 1I2DA 4QBTA 3RJZA 2CV2A 3C8ZA 2V0CA 3ND5A 3H97A 3TS1A 2DUMA 3CVUA 1G8HA 2EJCA 3SEZA 3IH5A 2CYAA 3HFJA 3FY4A 2QUJA 4EG7A 3H05A 1WZ2A 2VXOA 4MVXA 1N2EA 4ND7A 2DERA 1N78A 1UFVA 4NAUA 3MUEA 1QU2A 1N1DA 1T6ZA 3UOWA 2PFSA 5F23A 3AL0C 3SP1A 3JXEA 4PBRA 1N77A 5DB4A 3P0JA 3ZJUA 5IJXA 2OQ2A 1ZUNA 4ZCTA 3LCJA 2I1LA 3IDFA 3LOQA 2E89A 4X0EA 4BWVA 4PY2A 2PZAA 1OWNA 2GM3A 1XNJA 4MUEA 5HUJA 1GZUA 1OWMA 3K9WA 4EGAA 1WQ4A 3COYA 1G8GA 1MC1A 1H3FA 1NUPA 2A1TS 1J1UA 1WOYA 3E27A 1QNFA 3CLSC 3RK1A 4EG6A 2X0KA 1B6TA 1Q15A 1EJ2A 4MWCA 1YIDA 1MB2A 1EFPA 4U8HA 4MQ6A 3H9CA 1RQGA 2JA2A 4MLPA 4QRDA 2X1LA 4U63A 2DEUA 1KR2A 1F4LA 3UK2A 5LM3A 4MW5A 1O5TA 1IRXA 5H7XA 4JXXA 2DPLA 4MULA 1N2JA 1U3CA 1X6VA 3RHSA 3G6KA 3VRHA 3ZGZA 3CLTD 1FFYA 1WJGA 3HV0A 4OUDB 2DETA 3F3MA 4EG5A 2ZUFA 1QRUA 1IFXA 1N2HA 4H3SA 1O96A 5FNZA 2VTBA 1N2OA 1MRZA 5TGTA 2HGZA 1KP2A 1PFWA 4MVWA 1J1ZA 2A1UA 5H16A 4YMIA 5LLTA 3N2YA 3FDXA 3A2KA 4EF6A 2XRYA 3KT0A 1PFVA 1XNHA 4ZCSA 1IH8A 1G8FA 1O95D 4NX2A 1YI8A 1HYBA 2X3FA 1BS2A 3PNYA 3FNRA 4E1AA 1IQUA 1NI5A 4YP5A 1Q19A 4ZT5A 2IJGX 1M8FA 1EXDA 4KKVA 4U7JA 1R6TA 3TZEA 2PZ8A 3NV7A 2YY5A 4QREA 2ZUEA 2R5WA 4S1OA 5K0TA 1EFVA 1J70A 3M5WA 3Q10A 3CVYA 1NURA 2DXIA 1OBHA 1MB9A 3FWKA 3N9IA 1Y42X 1KQOA 3SEQA 2GOYA 2PZBA 1FYDA 3P0HA 1WXIA 3RBAA 2X1MA 2E18A 1H3EA 1KAQA 1WXGA 4Q16A 2TS1A 2GKSA 1M8GA 1OWOA 4FZJA 3U1VA 2QJFA 4MAFA 3H9BA 3HL4A 3CLRD 1QTQA 2QTMA 1ILEA 3KT3A 4MUHA 1EFVB 1QQTA 4DLPA 1NSYA 2O8VA 4DNXA 1OBCA 4CDNA 1MAUA 3ILVA 2A84A 3CLRC 1KH1A 3KT8A 3ZUGA 2DR2A 3CVVA 3KFLA 3D6VA 4Q93A 3CLTC 4CDMA 1WQ3A 2E21A 2JAXA 3DPIA 2YXNA 2BYTA 1KQPA 2CUZA 5EKDA 4CT0A 1T6XA 1F7UA 3A04A 1QRTA 5LFAA 3RFFA 1COZA 1GN8A 1NUSA 3ND7A 3G59A 2BTEA 1M8PA 1NP7A 4DE5A 4J76A 2QUHA 4R0NA 2G36A 1V47A 3ZIUA 1OWPA 3CVXA 3X1JA 4EFKA 1N3LA 4I6JA 4KR9A 4KR7A 5J5AA 4MUFA 1U7XA 2WQ6A 3GUZA 2B7LA 4UZEA 1YUMA 1T6YA 4EG4A 2A7XA 4G5YA 1Q11A 2QJTA 4A91A 4MVYA 3HGMA 2WB2A 1ZH0A 1KQNA 4AS1A 3NBKA 3ND6A 4PBTA 3PNVA 2AZXA 3UC5A 4MW9A 1PFYA 1ULHA 1YIAA 2PG3A 1VBKA 5DASA 5KCMA 3IUEA 4DJAA 1M83A 3FHJA 3SDBA 2QJOA 1D2RA 3ELBA 1XNGA 3ZJTA 4ARIA 1IQRA 1JHDA 1MOPA 1M1ZA 1JIKA 3INNA 3IVGA 3UY4A 1R6XA 1MBZA 1GTRA 3CLUC 2PXHA 3COVA 3MMXA 4G5FA 4MWBA 1CT9A 5FO0A 1PFUA 3G5AA 4YP7A 4MUKA 2J4DA 5KWVA 1QU3A 4K03A 4OUDA 4DDHA 1N2GA 2Z3VA 4XSVA 2A86A 3DV2A 1F9AA 2E0IA 3OP1A 4YBRA 3BL5A 1H1TA 3LE8A 4NZPA 2J09A 1VBNA 3IODA 2D5BA 3CR8A 1WXFA 5BNZA 1TEZA 1WXHA 4ZT6A 1YULA 4JYZA 1G59A 1O95C 1YUNA 4AQ7A 1GTSA 1PG0A 4MUGA 1QRSA 1N75A 1O97C 3AIIA 5JBNA 4RUKA 1H3NA 3IMGA 3AG6A 1PG2A 1GPMA 4JFAA 4L2IB 1ZH6A 2EL7A 3HZRA 1SURA 4P2BA 4MWDA 3MLBA 5TEVA 4EG1A 2VTBB 1JIIA 4F4HA 1QJCA 1N2IA 3N8HA 1R6UA 3AFHA 2A1UB 4R2MA 2AG6A 2ZP1A 1IQ0A 1K97A 4HPWA 3GLVA 1JZSA 3ZXSA 2AKEA 4HK4A 1I6LA 1JGTA 4MW1A 4I6EA 4YP6A 2WQ7A 1WY5A 1TYCA 3FIUA 4NAHA 4EG8A 3AKZA 3X1KA 3HMQA 2WSIA 1VL2A 2QUKA 1NZJA 2A88A
chains in the Genus database with same CATH superfamily
5DNUA 3MT7A 4Q37A 3V32A 1DT5A 1C3OB 4GVLA 2PDAA 3A37A 1I3OA 1HA3A 2CYCA 2IYAA 3A6EA 1RMQA 1RZ3A 3A05A 1UJBA 2IEIA 2W2XA 4N8SA 3KKZA 3VUEA 4G1CA 5IVDA 2BHSA 1PGJA 1XOIA 2RGWA 4GI5A 3V80A 3NVAA 3EVTA 4O08A 2Y9MB 1PNVA 1TJ3A 1FUIA 4WZ6A 1KEZA 4DV6B 4E32A 5LBIA 4Z9YA 3ZWWA 4XGKA 4MQ4A 4XPZA 2NO4A 3H2ZA 4JLNA 1CYEA 2VSOA 1K2WA 3QYPA 1BWPA 1OFGA 4I66A 5CX1A 4AUMA 5HE9A 1A1SA 1A96A 1KF0A 2GCGA 2HKIA 2HNBA 3I8OA 3U4DA 3WMFA 4X64B 3EGWA 5BSGA 1DTSA 2AZDA 5LOVB 3S3TA 4CN8A 5C8XA 1XTVA 4XGQA 4DNFA 3FN4A 3TLAA 2WFLA 4NNPA 1LZLA 3WV4A 1B0AA 1C1XB 1OUMA 4OAOA 3GRCA 2PKQO 5KC8A 4PGAA 3FIJA 5GGXA 3JQ7B 5B53A 3R74A 3LYAA 4AROA 3CEAA 4Y2PA 1GT6A 1EK6A 5DGHA 4BRZA 3ZHUA 4D3ZA 3VU1A 2PLNA 1WPRA 2AFIA 4TKMA 4BY9E 4LRUA 4GZLA 4J0DA 5JSKA 3GLIE 1YZ3A 2OCKA 3BWEA 1T4CA 2GWRA 1N25A 2SNIE 3UC9A 1GAEO 3GGJA 3CBQA 3WLQA 3STWA 2EFYA 2OHHA 1VL5A 5KQGA 4WINA 2D0OB 4G5GA 4WEQA 4Q9LA 1JZQA 4YRDA 2NU9A 4BCCA 4PZCA 3P1JA 1Y5MA 3AF1A 3LA6A 4E15A 4GDFA 3S28A 4X91A 2H4XA 2BMVA 1TM4E 3CN7A 1DJPA 1GKLA 1EWKA 1O6BA 3E18A 3Q0EA 4XB2A 1YAHA 4NAVA 3LG2A 1JFFA 2FYTA 3QX9A 4NECA 5HHTA 5FOQA 5D1HA 2FFRA 2BKEA 1W2WB 3AF3A 1L6RA 5AIAA 2ODTX 2PHZA 2I6SA 2IIQA 3OLWA 3H1EA 3ZLJA 4I7EA 5T4BA 3ZE1B 2RHTA 1QDLB 2TECE 3FMPB 3LC7O 3FMIA 3IAS6 1T1RA 1JHVA 1NN3A 2VHWA 1CQPA 3DO8A 5ALLA 4W5WA 2PZEA 3TQSA 1PJTA 3MBIA 2AK3A 5JWHA 1CQIB 3AI3A 1N8KA 3F4LA 1F8FA 4C06A 4X85A 3D9QX 4JDUA 5LLSA 1FP4A 3DTVD 2CL7X 1YRWA 5CVUA 3RIEA 1RQRA 4ALKA 2WLTA 1P60A 3NBAA 2PMWB 3PHBE 3PUYA 4MVJE 4TWAA 2JLZA 1Q7GA 2WHXA 4KBYA 3UVEA 1OWLA 2GYUA 1T8WA 2VHVA 2VKTA 2ZRPA 3IOBA 4P31A 2QPTA 3B13B 4J07A 4UNNA 1AUXA 1WKBA 4F4UA 1AGRA 3B52X 1TYBE 3WL3A 4AKGA 5KEIA 1FX0B 2ZEJA 5AW4A 4KAJA 2NW6A 3AF6A 2FPLA 3ZKWB 2O0LA 4O63O 1SC6A 2Z2XA 1WPGA 1X8LA 3QE3A 5AJVB 4AJHA 4UTPA 4L27A 1U80A 3QFHA 1DXOA 1GA1A 1NIJA 4PANA 2H2AA 1JSZA 3EZYA 3URMA 5KMGA 1QIGA 3ROEA 5LYJF 3JVEA 3W2TA 1DMRA 1TZBA 2ZCVA 1VKZA 3RC7A 3ZV4A 1OX6A 2WD7B 3QX8A 1EKXA 1T3TA 2EX0A 3ZGVA 4CT4B 1H9BA 2XQKA 3R7AA 4LCJA 2B8TA 2R6R1 3H7IA 2REBA 2FSVA 3FFBA 2XNDD 3NALA 1X7HA 3PLRA 3UENA 1R6DA 4HZIA 1T25A 4LZPA 2CVPA 1LBIA 3W34A 4Z53A 3AQ4A 1W4AA 2CXQA 3NT4A 2A0FA 5DXFA 3OTOB 5I3CA 5D3ZA 4F1WA 3ZVNA 2L19A 4RCZA 2IHZA 4RO0A 5CTAA 3BXGA 3EAFA 2G4LA 2K6GA 9ATCA 3RK0A 2VJMA 1NVUQ 2D2FA 5U1PA 4X3OA 2QVYX 1SGWA 3HVJA 1XL0A 1HSZA 1K5HA 2J9YB 1QCYA 2R4TA 3DE7X 1WVGA 2V7QA 3PENA 4PZPA 1U7DA 3GP8A 4AAYA 2FZWA 3LDGA 4Z0PA 4F8JA 5I9NA 3CGGA 1NTOA 1XFAA 4H17A 2DAPA 4AZSA 3ZDZB 3W2HA 2G8LA 3AY6A 4KUHA 2BE9A 5F2NA 2O7SA 3BB4A 3OA2A 2P0AA 4S0XA 2AF4C 1R9MA 3SM3A 4B87A 1ZD5A 3FOCA 2GZHA 3WNCA 4IXTA 1P2BA 3L6DA 2PXXA 4JITA 2V55B 1N2CE 1X15A 2H31A 1P80A 1CUJA 3N76A 5E1OA 3RO7A 4EJFA 4F12A 1BVHA 1TRHA 4EA9A 4MRSA 2B99A 3DDNA 1GEGA 2QIOA 4B09A 2SBTA 3FW1A 4QODA 2WUDA 2ZSUA 5JY1A 1NT2A 4NCIA 4WDQA 2P6MA 2GN9A 4U6QA 1GQRA 1P5RA 4MP3A 4PINA 2FAXA 2XXJA 1QQ6A 3QQ5A 3IV9A 2YXPX 3F98A 4YUWA 4PG5A 4G0ZA 1TMYA 2DVMA 4TQ9A 1N7IA 1QR6A 1SUPA 3L77A 3WGZA 5B2EA 3TFOA 2C7QA 1WCXA 4DNQA 1NF3A 4CL2A 6CHYA 5JTUA 5ULLA 1WPQA 3M2TA 1WZ2A 3TPFA 1M2GA 1M1XB 1ZSNA 2QL9A 1JLMA 3AFOA 4HB3A 4TV8A 4TXHA 1U0EA 1HE3A 4Z2AA 3SVTA 3LYLA 3ITEA 5KUTA 1VKOA 1U6IA 2VLBA 3SYKA 1J8YF 3OZIA 5AJZA 3SF0A 3RGGA 2BF4A 3IMFA 4TL7A 2ZBVA 4WFJA 5EP1A 4DLYA 3ZDRA 3RUPA 1TD1A 4OHOA 3F5MA 3IIEA 4BEBA 1S7CA 3AW9A 2C5HA 4I9HA 2IXBA 2C9YA 2XMGA 3MQ2A 4P4SA 3RS8A 5HFNA 4GVXA 2FW9A 3S8EA 4H1HA 1ACLA 3DR5A 3C43A 1A95A 5DHPA 4L72A 1NJSA 2HK8A 4KQIA 1ZEJA 5AK6A 1N2CA 5DKFA 4A36A 5WRFA 5ECDA 1O08A 2BP7A 1KU0A 4TL6A 1KDZA 3C4JA 3DMPA 4UCWA 4PYMA 5IBQA 3G23A 1G2QA 4NHOA 1CWUA 4HFJA 4XWKA 4BXOB 5LB2A 2WW8A 2XIQA 2YXDA 3BFPA 1E1MA 2RGEA 2XUHA 3FAKA 1DQNA 3GA7A 2QRJA 4PNZA 1SXJC 1N5MA 4WOCA 3RABA 3VM6A 5LZ9A 3GXOA 4JB2A 2QY6A 4OBEA 4HYTA 4D9HA 1RRGA 3GGDA 1GP2A 1O3YA 4DWJA 1JIXA 4UKDA 3G88A 2VPZA 4BLTA 4WN3A 2O07A 1P0FA 1TZ2A 1YQWA 4JSRA 4B84A 2OBXA 1IHDA 1YQEA 3JATB 4TPKA 4EL5A 3TG2A 4K81B 2V4MA 3RYTC 1FNMA 1A9PA 1T5SA 2P0YA 3MC1A 4KN6A 3NHYA 3STUA 1RAHA 3IAEA 3G6KA 1IY2A 3CLTD 1RYNA 1T9CA 3T3IA 3AJDA 4IVPA 3PDCA 3FLAA 4MQUA 4BMCA 4HX2A 2R1UA 5BYJA 2I6GA 4EG5A 4QNRA 7MHTA 3U7QB 5IUJC 2I34A 1XVIA 2R1TB 2Y05A 4PSAA 4OKIA 2VTBA 3JYLA 2IIPA 2H4JA 1FCJA 1YJCA 1VGRA 1DEHA 4GP9A 4KRGA 1Z56C 4X60A 1RLJA 5FUYA 2IBTA 4DA8A 1RTKA 1W85A 4Q24A 1VRCA 3LD9A 4KQJA 3F5FA 4H08A 3KT0A 3RSCA 3IKTA 2ZI3A 1Z0FA 1Z47A 5JJLA 1YS4A 2Z9BA 1G8FA 4NMXB 4LZWA 3TRKA 4UOEA 1EUDB 4X6XA 5KVQA 1MHPA 2JI8A 2JGFA 1LNSA 3ZJ5A 5HCIA 1OLOA 5EUBA 4GS5A 3MXOA 4GUDA 4YP5A 1Y0BA 4YCDA 4V1CI 1T9DA 3ESXA 1UUFA 1R18A 3CB2A 2NUBA 3N07A 4RV4A 3U39A 4YRZA 4KNYA 2FKNA 3GFTA 3W8DA 1G9TA 1K98A 2ZYRA 3F6EX 3ZI4A 1WMFA 1RIIA 1JWLA 4S1OA 2ZSAA 3SZLA 1Y8AA 3UQZA 4AJ2A 1Z88A 4C43A 4AG6A 4J0IA 2GRAA 2CL5A 2R6FA 2D3WA 3AIOA 1AZWA 4NZNA 1SQSA 2ACEA 3UANA 1WLSA 3OUZA 3OWXA 1DBPA 1N7JA 1X7YA 2UAGA 4P6VF 1BQ3A 3S7TA 4AM8A 4E07A 1EX7A 3U19A 2ENWA 3B3QA 3WNQA 3TUIC 3VR6D 1PZXA 1KAQA 3W5SA 1IEXA 4FE7A 4PGFA 4MTLA 2GKSA 3KWJA 2IEYA 5AOAA 4O4JF 2I03A 3L7JA 5I9MA 4CTMA 2YUIA 4I4TF 2HQ1A 3K1TA 1EWVA 3RUAA 2LPMA 4LHYA 4DLAA 5L8VA 3GRUA 1XTKA 3Q7TA 1GQYA 2UVQA 2X0IA 2P2LA 5EJ8A 4YCCA 1XQYA 3IEIA 3CTPA 4RZIA 1KSFX 3G0GA 1RWVA 5DSTA 4BNDB 3L1HA 4ARUA 3TB4A 4OUKX 3VPBA 1DDOA 3U4IA 4EHNA 4LJRA 1Y3DE 4REMA 4K88A 2VDKB 4JBXA 4N40A 3TLBA 4YALA 5MFPA 1GLGA 4LVUA 2X5JO 3PD7A 1ZISA 3NBQA 4RDHA 4HDNA 4W8HA 3KSBC 3DFFA 2Z9DA 5JXJA 1Y9DA 4JMPA 1KETA 2N9UA 4B6PA 1P8AA 3G2IA 3ITNA 4PYLA 3VPDA 3KPVA 3IJEB 1CQZA 3AKCA 2ZUDA 3IEUA 5EKDA 2BM1A 1SKQA 3GPCA 2P2YA 1DTEA 3EEYA 3FWHA 3ZZNA 2I62A 3QPCA 1WVMA 4GD3Q 4I36A 3PE4A 1T3HA 4GMDA 1GN8A 2AZ4A 4K86A 4FB4A 4EVSA 1RAFA 4ZEXA 4D74A 3LY5A 1TQ2A 2UXDB 4YFVA 4NBSA 4MQEB 3REFA 2Q1XA 4EPWA 2DFDA 1QGED 4FR0A 2BTQA 3WJAA 2VL7A 1XF9A 3EVZA 1N1MA 2FUG6 4ZU1X 4RTQA 2SKEA 2VFAA 2G9VA 3OZRA 5AK0A 4C0WA 4NOLA 4ZVKA 1C3JA 2D62A 3GIDA 2OWDA 3UHJA 4ANFA 1JU4A 1BS1A 2Q0QA 5REQB 2ZG6A 4FFNA 4QUJA 1I7DA 2Q8PA 5C1IA 1JSRA 3PZBA 3T5TA 2R87A 2VDLB 1ISMA 4G5YA 4A91A 3OO1A 1WZNA 3R23A 3O8OB 4Q01A 4PBTA 1GNLA 1YRAA 5K3EA 1SQGA 2E2WA 2WJGA 1XD2B 4BQRA 3JR7A 3LNTA 1Z75A 3SQMA 1VRVA 3AF2A 3CE9A 3PFWO 4QUEA 3D8TA 3SSNA 3WFJA 3D8RA 2XRMA 3OTQA 3A6PC 2FW1A 1N32B 1QGZA 1XVTA 2OVFA 3KPWA 1ZAKA 2OV2A 1B8VA 1XNGA 1ZM2A 1EVEA 4JXJA 2XJ9A 3W77A 1M6VA 2Z6AA 2AA3A 1JHZA 3INNA 2VZEA 4EMBA 1GTRA 1L4HA 3V48A 4QT4A 1A69A 2CDNA 3E5NA 3QUCA 1CT9A 1UFOA 2XQIA 4I5FA 4MP8A 2G70A 1GUYA 2V4ZA 5EQTA 4WUVA 5FBVB 4AJ9A 3II6X 4LC1A 3M4ZA 5K51A 3FF1A 1P9LA 2PO7A 1MFZA 1TKBA 1CE8A 2IXTA 4H15A 4Y2YA 1QAMA 5B58T 3WICA 3IALA 3JQAB 2Z3VA 3O31A 1GQ2A 4NPHA 4BUCA 4WXRA 3CUKA 4CCYB 4CEIA 2QVGA 5IUKC 3R5KA 4FT4A 1ZKMA 4OHUA 3SKVA 3L4JA 4FM9A 4CG1A 3IQDB 1D2CA 4U2FA 4M83A 5EYPA 4IM7A 4DKXA 3AEKA 2JEOA 5AVRA 5H8WA 3AV3A 5BQFA 4GMGA 5TDHA 5B64A 4MUXA 2IITA 4XX0A 5K3FA 5AT1A 5AVOA 1ZO8A 3PQ4A 3VBEA 4BGDA 1AH2A 1KZ6A 1U90A 2VJYA 4QGAA 4IIBA 4PTYA 2KSQA 3RIGA 5HQTA 3ICPA 5EZ6B 5C1PA 4JLSA 1YUNA 1L5HA 1RHRA 2R6HA 4I50A 2TMKA 4IIJB 3W4KA 1DAMA 4CMCA 4JXKA 1M6HA 1OZGA 4IS3A 4MAAA 4KMMA 4L95C 3RKSA 5JH7F 3VJRA 4RUKA 4XUEA 2PFKA 3FYUB 2YOGA 4LZOA 1KXJA 4G0YA 3WTCA 1H8HD 3PD1A 2WAOA 3FOEC 4PONA 3OFJA 3P2YA 4DJJA 1BOFA 5JSQA 4JJ4A 5CIYA 1MIOB 1CDOA 1JIIA 1Q2XA 2C2XA 1NVKA 4ARAA 1KRWA 1YR8A 2GMWA 4E31A 2XVMA 4U9IS 2PU5A 1RXVA 3LRPA 4QYXA 1DBVO 1QDEA 1UBJS 4Y1EA 2Z83A 1ENZA 3KK0A 4ZGWA 5D00A 1V4VA 2VYCA 2ZP1A 1KP9A 1CNMA 5EG5A 1KI7A 1G1AA 1E2DA 1IOVA 1N0UA 3MWJA 1OE0A 4OK3A 4JYCA 1S2LA 3VTKA 5FA6A 4WVLA 1HDZA 4I2NA 4PZEA 4G4GA 2I3GA 1E20A 2OZLA 1S1MA 4WPGA 1NTRA 4KQ2A 3WKDA 4YRNA 4MR9B 4E2WA 5JZ9A 3PDHA 4R9NA 5B4VA 1PBTA 4M1KA 4OV6B 4YJGB 2YW2A 3HA2A 4MYCA 4F6LA 3ZOKA 2HW8A 1Z0IA 1DTWA 1ZVVA 4BQQA 3CH4B 4X8MA 3P0RA 5G53C 4FU0A 1T9KA 5AJHA 3H4IA 3KQTA 2ID4A 3EZ7A 4JYPA 3T1VA 3VSAA 5BWCA 4G26A 1P2SA 1A2KC 2O2CA 2HJGA 4M0FA 3O3NB 4ETNA 5HZHA 3OE7A 1N33B 1UMCA 3PHHA 1XJQA 3E0QA 2VCEA 1O8CA 1U9JA 2EQBA 1R9JA 2FPPB 1UXIA 2JJ1D 3L3BA 4NS1A 3ROQA 1SNYA 4AJKA 3ZHOA 4CKCA 3H7AA 2GERA 3ZEIA 1ZA2A 4IJ6A 2OV3A 3HO6A 1UAYA 2UYQA 3QW2A 3RYCB 1AKTA 3EDOA 3N2LA 4ISBA 5BV1A 4IVQA 3ZY3A 5KTRA 1UJ4A 1CDEA 2C04A 3VYSB 4BE4A 2JKZA 4IVRA 1X0VA 2QVZX 4FNGA 4C30A 1CQIA 4Q3AA 4L4XA 3VH3A 4F2PA 5B7QA 4Y2TA 1P4GA 1KKMA 2BFCB 2G0AA 4LIPD 3PSHA 5F9HA 3IPLA 3SYTA 3OLZA 4J4BA 1H6DA 1SEVA 1R4NB 1UJNA 3GDOA 3TSWA 4RTKA 4E5DA 1DCTA 1M8JA 2H65A 3BD9A 1T36B 1X80A 3QTTA 2I4IA 3AINA 1VHQA 1YNSA 2H2WA 3C3YA 3OESA 1Y5LA 1TYZA 4QOHA 1EA7A 4KQKA 4OMCA 2CNLA 4AJ1A 4IZ6A 3F47A 2EP7A 2V6FA 3EVGA 2ZE8A 1XAIA 2EZUA 3EXHA 1V0JA 3IILA 5LDDC 2IF2A 1ZN7A 1KJIA 1V39A 2DBZA 2VG8A 1NOIA 4JJAA 4D8WA 4CCWA 1KC3A 3ZCXA 2H00A 4KGZA 3T1TA 5AW3A 1YTUA 1DIOB 3F0TA 4Z2YA 3P52A 4WA7A 1ULZA 2D7CA 1H2AS 1UQTA 2WTMA 1J09A 1H85A 2C0QA 3DTVA 3I01M 4NATA 4ZO9A 5IBPA 3MGBA 3A6ZA 5BO5A 5CXXA 2BL4A 4C2AA 4DCCA 1NNEA 4PAWA 1B8PA 2JAUA 3HSYA 2GEBA 4MVCA 5G1NA 3ZNPA 4R8LA 3PJFA 4YV0A 1TMKA 4HN9A 1MCZA 1KI9A 2IDZA 5KSPA 5KSZA 4O2RA 3MM4A 4JI4B 1LWOA 4UE2A 1H0RA 4FLFA 2VTEA 2I78A 4CIDA 4XQCA 2UYOA 1JFFB 1I14A 1IG3A 1TVCA 3P9ZA 4IDGA 2QW1A 3NEAA 4R3WA 4OSEA 4N48A 1E59A 3R7NA 5AOBA 2VT6A 2IDJA 1EEHA 1ZGGA 5A4FS 4JYAB 4NOJA 4HDQB 1XLWA 4D96A 1AURA 5KQSA 1GUFA 1IYZA 2MSEB 4GGMX 4L75A 4DDKA 1ABEA 3V3TA 5I45A 1XTTA 2P78A 3CNQS 1XT6A 4FGLA 2RGAA 1KHTA 3PVCA 1W48A 4KXMA 3N8IA 3GK3A 4JI7B 1CLUA 1JIJA 3DZKA 4WDRA 3IA7A 3MD9A 1YJ5A 4BGIA 3O3CA 3DZJA 3GZ4A 2HDHA 2LNDA 3OJOA 2WWHA 2YV4A 4C6HA 2HZ7A 4CM8A 1I3CA 3R3HA 5DNYB 2ZT7A 3MB5A 2GN8A 1X7WA 2YV5A 3HE3A 3QKRB 4U7WA 3DEHA 4BNLA 4N54A 1P0MA 1Y81A 4MUNA 3P5BA 4DLWA 1U5BA 4EPVA 4CR8A 1WV1A 2VNHA 1C4OA 1PJRA 1PZFA 1YQGA 2JLRA 5LZ8A 4HQKA 2JANA 3QWAA 2BFEA 3C97A 3TQRA 4CIXA 4CUKA 5ARDA 2CT8A 2XHZA 3GT4A 5JE8A 4LYFA 5DNCA 4KXXA 2V96A 3V7NA 2HYDA 3CW8X 4TV8F 3A4IA 4M8SA 3PXEA 3CVOA 3U80A 4EKGA 1HG0A 2XTMA 2WM2A 1Q0PA 2VF4X 1Z8HA 2FWBA 4BBJA 4IYJA 1UF9A 4UTVA 3EZFA 3TN7A 4QVIA 2J3DA 3VH4A 3GELA 4QO7A 2EGGA 3VTAA 4M1QA 4I4NA 2RGBA 5B3AA 3SHTA 1PYDA 2Q21A 2QM0A 4FHFA 5JI2E 1MAWA 3ORSA 4J16C 3Q40A 3TLKA 1OBOA 4H0CA 2I2WA 3HYNA 3QOWA 2ATIA 3GCZA 1QHIA 2YYZA 3O4FA 3PIRA 4IIYA 5D6OA 4DR5B 4YR9A 2CMDA 2DH6A 4W6QA 3IVCA 4P32A 5BN5B 1UC4B 4D1YA 3K72B 1TLTA 4P7JA 3P2IA 4K3UA 3OJLA 3WLRA 1S6YA 2PZLA 1A9OA 4OOFA 1SC4A 4K3VA 3L4BC 2WWXA 4C7VA 4I1PA 2E3JA 3LC0A 1W34A 3V7WA 3PXXA 3IT3A 4RCVA 3GDHA 2CV2A 5DP1A 1P1KA 1YGYA 2COKA 1NVTA 3NWJA 4G4SP 2OV8A 3OETA 5AFSA 2W6ZA 5IDWA 1I1HA 1M5TA 1T8SA 2DT5A 2J6IA 2ZWIA 1XKXA 3MGGA 4KV9A 1B6RA 2VZ0A 1YVEI 4B4WA 5L7WA 2ZRLA 1QB7A 4FD3A 2Y92A 4H7JA 3NAQA 3SJCA 3UFXB 3I83A 3N7AA 2YV2A 4WY8A 3NCHA 1PCXA 1L7NA 1SWWA 1I9GA 1T2EA 2VXOA 4ZP1A 1QKJA 4M2LA 5TJHA 2HA3A 3HHPA 2XZOA 1BEZA 1CVIA 1ZUWA 5K4HA 4Q7MB 4F1JA 2QLMA 4A8TA 4A0RA 1LCIA 1N1DA 1T6ZA 2HSGA 2VNIA 4BO9A 4AMUA 1KI6B 1SXHA 4YAWA 5HIJA 3ACDA 4KUEA 4EQZA 3DCYA 4NCAA 1JDNA 2HU2A 5LQJA 3A2NA 1EFUA 2ODQA 5JAQA 1XZAA 2Q0XA 3VV3A 1BFKA 3F6RA 5JD5A 1VGQA 3DMTC 5A62A 1UJ5A 1XVAA 2C7VA 2XB8A 1TU3A 3LT4A 1U28C 4GLOA 1VCIA 1QFMA 2INGX 4KVFA 4UHEA 3TL6A 1W4RA 5EQDA 4C0JA 2OUIA 2VK2A 3MCTA 1DRJA 3K09C 5TQ0A 4D82A 2VDJA 2EFDB 2A1TS 4TTTS 2HMTA 2KBFA 2FEOA 3M8KA 1FVFA 4AZWA 4II2A 3FR7A 1QP7A 1U9IA 3PDIB 3MCVA 2DLDA 1E94E 1ST3A 2CFSA 4JDPA 4JIGA 2ZIUB 1FDIA 2HN9A 1NM5C 2W6NA 4E5KA 5ALDA 3GH3A 1ZJJA 1VJDA 4Q1CA 1E6LA 4BPRA 2Y0PA 5ALYA 1JHAA 2J9GA 3U5ZB 1PK9A 1GPUA 2B25A 1RQGA 1V4NA 4B2IA 3EEQA 3RF6A 3H42B 1LBTA 3GFGA 4KSBA 4MRAA 1YB7A 2BFBA 4NCXA 3RS9A 3W8FA 2GYVA 4YT8A 2GETA 3H9UA 4ZO7A 4MULA 1ZRSA 1Y1PA 4KR3A 5KIAA 1Y7PA 4K9OA 1WXXA 5LJIA 1Z7GA 4MV3A 3ECAA 3ID6C 3RJ5A 2F8TA 4RU1A 2X9QA 1ULBA 4EPRA 2IPXA 3NHAA 5BVGA 4DARA 1PWEA 2I3ZA 4NBNA 5D8DA 4TSRA 2R7LA 2V4UA 1ODLA 2V7TA 4JP2A 1FOEB 5KYGA 2J3QA 4ICIA 4C5CA 3NQ41 1BYIA 2YUTA 4EHDA 1B15A 2ZR8A 1ML4A 3AVYA 1GQOA 1UINA 4RX1A 2WMDA 3EGXA 2ZDGA 1NVMB 3G0DA 3AF5A 2ZE7A 1MC4A 1ODFA 2C4MA 4MVWA 4P9NA 4YY3B 1IZ7A 4QYIB 3SQLA 3ESBA 2C2OA 1XEAA 4HEJA 3G17A 4Q02A 3T7SA 3FPHA 4GSKA 3S1LA 4KAFA 3WHPA 4EDHA 4LW8A 4R84A 4YRGA 1HDXA 2PZJA 3U0BA 5JXHA 4M54A 3IBGA 1P29A 3I9JA 2YMLA 2ZRBA 4QX6A 1XNHA 2ZI5A 4Z7OB 4Q6BA 5K6AA 1D04A 3RVDA 4M0PA 4ZDIA 1DUVG 2ZETA 4Q05A 3ORQA 1YDEA 3OICA 4JUIA 1BS2A 1AG9A 3SNKA 4KQMA 3VHXA 1XCPA 1U8CB 3GD7A 2V58A 2YZMA 4IEEA 3FNEA 1GUDA 4Y6OA 1M8FA 1OAOA 1QMGA 1W85B 3KD2A 4EKDA 4EMSA 2A2ZA 4A0HA 3WAJA 4ZAYA 5JCXA 2EF0A 3B51X 1JVSA 4OQMA 2ZUEA 4IUBS 3SR0A 4EM6A 3T0FA 4M9SA 4LYHA 1Q22A 5JWRA 4KCGA 3R2JA 5B30A 4C4PA 3HABA 1BEEA 4HUJA 3FWKA 4URZR 3N9IA 1TZMA 1M54A 1EWRA 1RE0A 4EGJA 1OAOC 1BKDR 4E5PA 1WCIA 4RVNA 3RBAA 2WJVA 3TDNA 1T34A 1Y1KE 3WL5A 2EIXA 1NNLA 4C6SA 3I2JA 1D1SA 2FP3A 2H5EA 5H9WA 5L51A 2VHCA 4DG9A 4EWLA 4MQEA 1DG9A 3VXKA 2H92A 4IEFB 1EFVB 4IMRA 3D4BA 4PX5A 3SU8A 2WD7A 2DF8A 4YAOA 2VOEA 1K7FB 4MKXA 3E05A 3H04A 1P5ZB 4Q7QA 5J9FA 2ZSJA 3R9XA 4LDQA 1W9HA 1XK6A 1OJ7A 1TOAA 1BU5A 4M0MA 1JJAA 3WYNA 5CT6A 1OI7A 2A84A 2RJ3A 4IH4A 1R64A 1KOFA 2FP4A 2JFQA 4MIYA 4WN9B 2PBZA 5C5DA 2ERCA 5J4KA 1AB6A 1JLKA 5CFNA 1GPBA 4GH5A 3CVVA 3NETA 1KDRA 2X4IA 4RLQA 4BP1A 1VCMA 2W83A 5FQNA 1R6VA 4B3HA 5TRTA 5LQMA 4EJMA 1COWA 3KEMA 4B2PA 2IOFK 3UZUA 5C7LO 4LX8A 3U09A 4BVJA 3AEYA 2IDKA 4GBED 5AWFC 4DWVA 1XQXA 1E1NA 3IEKA 4H9GA 1SVWA 1XPRA 1U4NA 1O57A 2PYDA 3UMRA 4K1XA 5DM60 2HWKA 2OVBA 2HSDA 1Q0TA 2C9OA 3QX3A 5E7IA 1LDEA 2H16A 2JAOA 4M6WA 4EAQA 2PKQP 3IUYA 4RXMA 5IXSA 3E8XA 3ND7A 5ES4B 3JSXA 4MO9A 4CQMB 2HSJA 1G3MA 1PQYA 3PHLA 3HYCA 4R9RA 1FNNA 1KMMA 3QVMA 4BLWA 1FUEA 2H52A 4R7ZA 3B60A 2C2MA 5I7RA 3G0IA 3SLRA 4DL9A 4FYXA 1HKHA 2IZ0A 1J5EB 1ESZA 1XQ9A 3HZHA 4LBYA 3KYJB 4KR7A 4ERXA 1LJUA 2CXUA 3L7OA 4LZLA 4J8PA 1XZFA 4ND1A 1U8XX 1R66A 4DCGA 3EA5A 4ZJZA 3DZGA 3VZQA 2BFMA 1C3EA 1CNEA 2CJFA 3NT5A 3JD1A 4FCVA 4FQ5A 3BTSA 3RD5A 2P6RA 2IZ7A 1HM5A 4CM5A 1CDDA 3A1VA 5HEKA 5BQ3A 1M2VB 2PKRA 3IESA 4CF3A 1PLLA 5C51B 4IFIA 3ZJ4A 2IS1A 3BXFA 2QL6A 3BEDA 4RF2A 3WKCA 1EPUA 2B9EA 3EXFB 3JD3A 2C59A 3QE0A 5JJ5A 5JUWA 4PHHA 1EFTA 1V45E 1VPEA 5TE9A 3SDBA 4BFYA 1TU4A 1LBQA 5JYCA 3LY7A 2QUZA 4EI9A 5HYVA 1NV8A 4H1UA 3FYUA 4WWHA 4BN0A 4ARIA 1GGJA 4I4IA 1IQRA 3HV2A 1LLQA 1M1ZA 2P2DA 2NZXA 2YVUA 3A3OA 3IVGA 4GR9A 4FGSA 2NZUG 5FPQA 5J4LA 5JZSA 2QTGA 1FY2A 5EMLA 5A04A 1XD2A 3H9EO 5H1YA 3BK1A 3KBBA 4CEHA 3LBNA 1TO6A 2HJSA 3DKIA 3FSEA 5K5EA 3L4EA 3JYNA 1OREA 3CMMA 2CXNA 4HLCA 4PCVA 2WA2A 2P8SA 4EW3A 3OM8A 4IHKA 4OJNA 2YASA 2BGIA 1ZUHA 1PUJA 2A86A 3DV2A 3KJEA 2NM0A 3BWYA 3AEQA 3EVNA 4TLEA 4II7A 4M38A 3LWDA 3MWYW 1HYGA 4LRYA 4MS4B 4ZQCB 4D79A 2TYSB 1A50B 1JJBA 1Z4IA 2H1OA 1CRPA 1SIOA 3T1OA 4C2TA 3UT5B 3E35A 3I9FA 2AQKA 2Z5GA 1OB2A 5H82A 3PFCA 3GLUA 3PTLA 4JI6B 5BNZA 5AKKA 1N5LA 3OQIA 2PZMA 4QUIA 2P6UA 1G59A 4HDKB 1LY1A 1E0DA 1PJAA 3EHEA 2HF8A 1RD4A 4MUGA 3VAAA 4DUGD 5FF9A 3ADCA 1QO7A 1UP4A 1ZUD1 1Z5UA 1FDRA 3O26A 4P83A 1T8UA 1NFFA 4ESVA 1OAKA 1GPMA 3PUKA 4FNOA 4J1TA 4OD0A 1E8DA 1RPNA 1UMCB 3U7QA 1Z6PA 4BNHA 3FOFC 1YXMA 1KU6A 4YO8A 5K3FB 3T4XA 3PGXA 1RYZA 2RKWA 4JNCA 1DAPA 5L45A 3NNNA 2BI7A 4LJ9A 3CRW1 5IJWA 3AFHA 1N4AA 4DLSA 3REQB 1A27A 1PTKA 4WRRA 4E4RA 4CQLB 1QHFA 3AETA 1N9ZA 3KKNA 1CUUA 3F5QA 5EXXA 2F3SA 1IQ0A 4FYYA 4OFWA 3H16A 3SMVA 3WZ2A 4IWXA 3KTOA 3R4VA 3FKSA 5GONA 3CR3C 1Z26A 3L07A 5A5VA 2F43B 1ZSVA 1HEYA 3EHDA 4QU9A 1V5EA 3QK7A 2QVBA 1QCCA 2XUOA 4R6XA 7AT1A 1R4NA 1N2SA 2P9FA 3BTVA 2UVPA 3AKZA 3I04M 1J56A 5TMBA 1KYXA 3UM9A 3TLGB 5CDTA 4IMIB 2XMRA 2KLBA 4BNNA 4BZXA 2ZJZA 4KIFA 4CKBB 4U2EA 4IJVA 5GVRA 2EBHX 5E2BA 3WKEA 3OECA 1F06A 3VOSA 4RZQA 5CB6A 4HTAA 1F48A 5JRJA 3FTQA 3U56A 1OYOA 4XEUA 1I0LA 2DUUA 1EUQA 4OU5A 3WI7A 1H8EA 2JIMA 3ETLA 3O1LA 3NIGB 1U0OC 3CA8A 2OQVA 4YCNA 1ZH2A 2PKXA 1M2VA 2E5FA 3GA0A 2PU7A 3PC3A 2R2AA 1E96A 2B1QA 2WZDA 1MNAA 2IYPA 3OKCA 1E1CA 4Y6RA 3T1QA 1JAXA 4G1MB 4FFLA 3UHFA 4HOYA 3MFQA 2A9PA 4WLFA 4M7WA 3GEEA 2FHPA 1JSCA 4JJEA 5EE3A 2GCEA 1G3IA 5JXGA 3B6JA 3R8CA 1DAEA 1T0JB 5BSFA 3BXHA 3GEDA 5CX1B 3GH1A 4RKYA 4P0QB 1BX1A 3QI7A 5J63A 3O9ZA 3KTFA 2NAFA 3TZBA 4MXDA 5MFZA 2EWVA 2ZYHA 2TMYA 4P5EA 4M3NA 4JNKA 4PCAA 5G0VA 5B2ZA 1P7PA 4DIMA 4E51A 3NUGA 3RS4A 3LXRA 4MYDA 4BVGA 5EE5B 4EVIA 4FFOA 2D1SA 5BWMA 4N5NA 1P19A 1ZINA 2PIDA 1O9HA 2XDWA 3ZN2A 1AA6A 1PS8A 4MDFA 4JROA 3JQ7A 4GLLA 5CPBA 3G85A 1EZ4A 4PPNA 3TRJA 3PFNA 2A1TR 2QTTA 2O57A 4X54A 5JCPA 2JLWA 5D3MA 4XCVA 4PYNA 2J1LA 2F6RA 2C82A 3KZVA 3DGEC 3TW6A 4TS1A 3L6CA 4R7GA 2O2DA 3CXRA 3W0LB 2B2NA 4EBBA 5F98A 3VGJA 4B80A 4JUDX 4F60A 3V1NA 3HJCA 3K4HA 4Y6SA 1NPYA 2ZJFA 4JEMA 4UJ3A 2VF2A 3WGQA 5IAOA 3PXUA 1M1UA 3PWTA 1A8QA 5HG0A 1EX6A 5K3AA 4DPMA 1JF8A 4C9BA 1KERA 3AUAA 3P2JA 1YH3A 1E2NA 4ITVA 2CVFA 4QIHA 3I9V6 3K5IA 4IICA 1VGVA 2G83A 1HRKA 1D4ZA 4XWWA 3ZD7A 2OXCA 2CXTA 1BN6A 1JEDA 1MRSA 3MLAA 2ZXUA 4JKYA 3R9WA 2QN2A 1C41A 1U2QA 3PEWA 3CZ5A 1DDIA 2O48X 2WFMA 2XQGA 4XX1A 5KYUA 2CV0A 3PJEA 5KO2A 2BKAA 4KO1S 1J7JA 3LY9A 3A4MA 3DFIA 4I6GA 3SR4A 1O0BA 1KH2A 1NR1A 1P2FA 2WICA 3DYIA 1JLHA 2OLKA 3FVVA 2QA5A 4LE0A 2O9JA 1RM4A 3EBLA 1UWVA 2XUAA 1SXJE 3GRRA 8ADHA 1YAJA 2W5UA 2WJAA 5J40A 3SC6A 4BFXA 3WLNA 1BCRB 4I8DA 2WKSA 3I28A 3MTEA 4HJRA 2OCDA 1L8LA 2X0NA 3VDNB 3GAZA 5BUQA 4MQFA 1G8KA 2AZMA 1S3SA 2XKAA 5F78A 3ZU2A 4YQFA 5KWJA 3O0TA 5FP0A 3BSYA 2B5OA 4GE3A 2OBMA 4L8LA 4O4IF 2PS0A 4Q3EA 1GADO 1P9WA 5J58A 4J0CA 3NDPA 5CDGA 1VHLA 3RT9A 2D6FA 4RL4A 3PG5A 2HHLA 1IDN1 2ZJBA 3QSYA 1UBKS 2P8JA 1EK5A 2VK4A 5LU8A 5LVAA 121PA 3AXTA 5HDQA 3L1IA 1OX4B 4XWTA 3KC2A 4MRMB 3RIMA 4CTNA 4XR9A 1DX4A 1GRNA 3ITKA 4YMGA 2WC1A 1V8FA 4HWPA 5AKEA 2J5RA 4EJSB 5TPWB 4WY5A 1SKAA 1GTMA 4DDMA 3OOHA 3DLBA 1Z5ZA 1QVAA 4LMAA 5AI9A 5BR7A 1T1JA 4QZVA 3ZDAA 4RA6B 2MWMA 1EMDA 4AZVA 1APBA 1U2SA 1N9GB 4YJ2F 2I2CA 3B2QA 3X2EA 1HO3A 3W1VA 5JNTA 4FZVA 5FI1B 2V5UA 5DX8A 1NW8A 5IT9A 4W5HA 3BJZA 5BN1A 1L7VC 2R8XA 1ESEA 5HF6A 1NI4B 2D3TA 2I1VB 4KKXB 1XJ0A 1XTBA 4QGBA 4RH1A 4LNHA 1ABBA 4ZQEA 1P5HA 1P3DA 3M3HA 5BQXA 1MGPA 3BMNB 1QVRA 3CNHA 2OBFA 2I67A 1P3Y1 1TJNA 2QPOA 4V0SA 5E7QA 3VC2A 2AMLA 3KKPA 1TK9A 2B82A 5TV2A 4D8YA 2D5CA 1XHFA 3G5LA 1RCUA 2CHVA 2RHBA 5JSZB 4Q34A 4TSFD 3REGA 1WHSB 2FN9A 4YUAA 5FNVF 4B5LA 1DCMA 1IM8A 2ZANA 3ANTA 3ADDA 4YMWA 1YZLA 4G25A 2XMQA 5KNCH 4QDXA 3FA2A 3A9RA 1R2QA 3I8SA 5K8TA 3T7AA 2EV9A 3F5SA 4XDGA 2PGLA 4G5XA 4H6PA 2ONYA 521PA 5FJJA 3OT4A 5BW8A 1X7XA 1ZUNA 4B4VA 4FHDA 4XARA 4JGIA 4F6CA 3FUWA 1W581 1NZDA 5F9FA 1WMDA 3OA0A 4MUEA 4EAAA 2WIFA 3IAM6 2BF7A 2KX7A 3P9QA 5HIIA 3S2SA 2MINA 5EXEA 3E1GA 5JR3A 4P22A 2ASVA 3R3UA 1L1EA 1J1UA 5EJ9A 1ADYA 3WBJA 4UHDA 3FTFA 4DCJA 3E2IA 4M1SA 1KZGB 2PT6A 4I1IA 1UEXC 1XUOA 3W9YA 4A92A 2QW0X 4OGWA 1BFDA 1JAYA 4MR7B 2WPDD 3QZUA 4I50F 1MX3A 2Z1NA 1LTHR 4DT1B 3BB1A 4ZAFA 5AKZA 1DAOA 3DNPA 3KUUA 5ALGA 5K3OA 1G21E 1FF9A 2JH3A 5B37A 3HKCA 4FN5A 2V6MA 3HB1A 3Q3VA 5ALFA 3UPDA 4A2PA 4OHWA 3ZW7A 5C5EA 1RABA 1X77A 4MUMA 3QWHA 4B6EA 3JAKB 1UM9A 3GLGE 3E1KA 4DIBA 1FBTA 4BFCA 3BCHA 5IASA 3T3HA 4OIMA 1YVDA 4DVJA 1EIWA 5EKUA 1IXRC 4ZI7A 2H7VA 4UBLA 4XDYA 5CFPA 2E48A 2F8MA 3G2PA 4XUDA 1GOTA 1W6UA 3AVWA 5TPZA 4MPJA 1ACMA 1A76A 1PVDA 2O05A 3I4FA 3A7EA 3KAKA 1D6SA 1K5PA 2GWHA 4AYXA 4B44A 2R7MA 2QROA 1ABFA 2GPWA 5H02A 4FLEA 4R68A 2IBSA 3FMVA 4RVSA 3THRA 1JEJA 1U2EA 4L8GA 1E4VA 4RE6A 4RV9A 1PFWA 1II9A 4OJYA 1ZJ5A 4RBNA 3JYHA 1MDFA 1VG1A 1FFDA 3GFFA 1Z06A 2A8YA 3NHJA 5H16A 4YAIA 4RK0A 1AHNA 5BWLA 2XMDA 2Q9BA 3ROTA 3H4TA 1USVA 4U9UA 2X7JA 2G6BA 1QPBA 2XDYA 2V7WA 3I5UA 3L46A 4A8PA 4KSYA 4BKPA 1ZCBA 5IK2D 2PUDA 4UMFA 1U6JA 3GJQA 2IPAB 3HXTA 1PX0A 4CHTA 1GRCA 2CK3A 4QEDA 4XGNA 1UPTA 2PS1A 5DT2A 3QLEA 5KX5B 3P9RA 5I6DA 1OVMA 1EGVB 1N9GA 3UN1A 4D4HA 3UJ9A 3OJ0A 4DSOA 2P7HA 1FVOA 5AH0A 4CKZA 2FG6C 2M6SA 1JDBC 2FRVA 3H2HA 1CIJA 3I4CA 3LOUA 4H4EA 4RGVA 3S5UA 1CY1A 1Y1TA 2BMDA 2PPLA 1R37A 1VMEA 1UIRA 3M9WA 2W90A 3GA5A 1XEWX 3OHMA 4HDRA 1Y6FA 3QJYA 3T7KA 1BG6A 2RAPA 4EUSA 3B82A 3JQGA 4MV9A 1CRWG 5BUSA 4R9UC 2IZOA 1WTAA 2YJ5A 5D51S 3I23A 4Q00A 1EBUA 1BGXT 3HXMA 1Y4ZA 2QLJA 1NONA 3RTAA 4KI0A 4XSGA 2C0CA 2X1MA 3GRPA 1Z7EA 4K9QA 4DA9A 4JQYA 4FCCA 3FHOA 4RANA 4Z7NB 1HFKA 3LL7A 1OBVA 1HLGA 1DMSA 1QYIA 1TMOA 3RV4A 2J85A 4RACA 4TYQA 1ZHOA 1CBUA 2UV8A 2EKBA 1E9DA 2V7EA 2QX4A 2O3SA 1ZOSA 4OI4A 4EG0A 4CDNA 5KVCA 3RLIA 2EJTA 5HF5A 5LXTB 3PWZA 1IJKA 1K2VN 1M74A 1AKVA 1QS0B 1QXSA 2H2DA 2YXBA 1SH7A 3MBKA 4NQZA 1F14A 1GTVA 4FC7A 2CCJA 5INTA 2B8NA 5KX5F 1VFNA 4II3A 4OYHA 2DLNA 3BFJA 2DR2A 1DJMA 5BNIA 1NPDA 4WZZA 2FMIA 4XVRA 2MHCA 1Y4UA 13PKA 4OHBA 3LUFA 4F06A 4YCMA 2WU4A 3RWBA 5AICA 2J4FA 5K0ZA 2JAQA 3R7FA 3ZV7A 1JA9A 2HOQA 3CRQA 3EXFA 3PPXA 3ZTYA 5HOEA 4U8GA 1NBOA 1E92A 1G6HA 2X1VA 5EGNA 4OHMA 2IVFA 4MZXA 4BU0A 4CM7A 3KKLA 4J29A 1BQEA 2CUZA 4OYRA 2J0SA 3TW8A 4KNWA 3KALA 1VECA 3BF8A 1IB0A 4RK4A 3M7IA 4EA7A 4RS3A 1G18A 1SBNE 5A7HA 2NZWA 4FYPA 4P81A 5FWNA 5LA6B 1EFLA 1N0VC 3EC1A 4DMFA 2KWIA 3PEUA 3KZOA 4PAMA 3RFFA 2NOAA 2WE7A 2FWNA 1RLTA 1B1CA 3ZDEA 1GHTA 2W6PA 3P20A 1CS0A 1JR6A 3R0IA 1VHJA 2VT2A 1KVRA 4KI7A 5NULA 2IODA 3EY9A 2WD8A 5M5BA 1OWPA 3ITDA 3ZGNA 1EP2B 1T2DA 1MO2A 4CTKA 3IXLA 4EFKA 3R3JA 1QGDA 3I1YA 3Q1LA 3EG9A 3RK4A 1DOHA 5BRJA 5A4JA 1BZYA 2NPIA 4MUFA 4ESEA 4LE1A 2EZ4A 5AI0A 1YGPA 4YK7A 5EN4A 2V7QD 3ZUPA 4B6OA 1X3LA 2XKKA 2IBMA 4PZAA 5JD4A 5A5GA 1TF2A 3HNRA 2QV7A 3PHIA 5DM1A 1GPH1 1GV0A 1IHPA 1UCFA 2CHQA 2DWOA 4L9SA 4RL6A 4QTTB 3UWKA 1N5OX 3ND6A 1DIBA 1SBHA 5BWBA 1FYWA 1HUQA 3SY8A 3FYHA 4ZI3A 4R9SA 1GSOA 3HJNA 3SYRA 4L02A 4ND8A 1Z2OX 5KKNB 3OOJA 2PPVA 3VNRA 1RZRA 1G21B 3DV0A 2G6TA 3DE6X 4RJTA 4QPNA 3U48A 4NFLA 5L4SA 5HZKA 1IN4A 5FAKA 4W5NA 3FHJA 4HSEA 3D2CA 3F96A 4RETA 5CJPA 4FUTA 4C1BA 1KS9A 1G5TA 1P9NA 2P41A 2Z4RA 2QRGA 5IT0A 1QK3A 4V0RA 4I5GA 4XIGS 5CT4A 4ZQHA 1X7GA 1JLLB 4PHTA 2G82A 2QMQA 3PSAA 2NO0A 2D06A 1B41A 3QM1A 2Q5JA 2DHRA 3MJVA 2CZGA 4FNMA 5DOVA 2HMYB 1R0KA 2PNFA 4B7ZA 4DIDA 1KJQA 4FIZA 4I3FA 4A8JA 5JZMA 2NP6A 2J4DA 2OMKA 3OZUA 4YV2A 2CMFA 3LGXA 2ZYVX 3P4YA 1QU3A 3L0SA 1QH8A 4XCQA 2FTKE 2WWGA 1G0NA 4HV4A 1C1DB 4BFUA 1A7JA 1FZTA 4XQGA 1ZEMA 1PP4A 3U7JA 4LOIA 3EE6A 2NYRA 1CUZA 1BMTA 2GJAA 1M6VB 3GYGA 3LKVA 1IXKA 3HXOA 4P53A 3NHZA 3ER6A 1CY7A 3QG5A 3T5BA 3ETEA 4TS3A 4KE6A 1NWCA 5AKLA 1P9OA 4M9XA 2XOXA 3QF7A 1EM8B 2IRWA 3KHUA 4DBLE 3D4LA 5AVXA 4CKBA 3ZNNA 2ZE6A 4S1TA 1HGXA 3SJUA 5B6IA 2WUWE 1MAAA 5DCLA 1TC2A 3UJ6A 2PH7A 4TTRA 1C3VA 1NU6A 3EYAA 3NWEA 4XUGB 3QEAZ 1C5KA 3H2BA 3UOGA 3ORHA 1BCSB 3R3SA 5ARBA 5LQCA 5KOHB 2PVSA 1RZVA 4N5HX 4RF4A 4D0RA 2F55A 1DUSA 4IUCS 1YBVA 1UEIA 3JQAD 1RBMA 2WAAA 1TPZA 4GNRA 4NC9A 1O03A 4P2BA 3LC1O 4UTZA 5LIRA 3T15A 3ZY2A 4RADA 2RHRA 4FD2A 5EWMB 1A9TA 1X1BA 3IB6A 3R41A 1R27A 2CJYA 2AC7A 5I8WA 2BCGY 1RYMA 1V16B 3FCCA 4IJUA 4PAOA 4QHSA 4DV7B 3L8HA 2IOQA 4V24A 9LDTA 1SCUB 1E1CB 4YH1A 4AS2A 3CUSA 1U28A 3K1AB 4CBVA 1XTJA 2WTEA 1BKSB 2BC9A 3OJWA 3JV7A 3OVMA 3ZXSA 5JAZA 1QIHA 1Y5RA 3VH1A 2YIJA 2PTGA 4TKUA 1UBCA 4ED9A 4X62B 2ZSDA 4JI0B 4DUPA 3STYA 1RXUA 3H5AA 3ZCTA 1U8AA 1TMGE 3REQA 3SICE 1PR4A 3Q15C 2XE6A 3ROGA 3RVLA 4C0BA 1HR0B 1GPAA 2BIFA 1CS0B 1ICEA 3FZEA 3JVIA 4PLPA 4CIAA 5FO1A 1G20A 3C48A 2VWHA 3IIJA 4BO2A 5LZ4A 1BTOA 1G2IA 4PQFA 2QWXA 4MV7A 2EEZA 2PEZA 1OY1A 4PN3A 4HWGA 4LWPA 2Q9UA 4TLMB 1H94A 5TX7A 3C5WP 3IQZA 1DQPA 1Z4MA 2ZU0C 3IDZA 4MUBA 4LOHA 3RIYA 1JE1A 2QMEA 5E6RA 4B3DA 3THWB 3UYKA 2V7UA 1J4AA 4PEVA 3FWNA 2C9DA 5T5QA 1COWD 1XV5A 3TZQA 2AJCA 1AQLA 1NAHA 1OHHD 3BQMB 3GGOA 4M7OA 3KZMA 5DBOA 1U3FA 3OOSA 3Q9SA 4G1BA 2Z5VA 5KTSA 4K6HA 3OWHA 3TTYA 1DC5A 1UZLA 3MB8A 1UKVY 2ZZMA 2PYZA 4P3OA 1DS6A 3QA3E 4QQRA 3RANA 3RCBA 4F84A 1JFLA 4OU4A 3DEYX 2FHSA 3A1WA 3KXIA 9LDBA 3TSZA 1Z4JA 2PV7A 3ENNA 5EYPB 1CR6A 1HDOA 2FWPA 2GNAA 1QTIA 3GGGA 2OHXA 2Q1YA 4LDNA 3JALB 3QVKA 3S40A 3STXA 2JK0A 1KE2A 3AUTA 3RVJA 1KO5A 2V1UA 1ZGJA 2BJWA 2BJHA 3AHEA 1ZW6A 2IHUA 4YP0A 3SHQA 3D8SA 2HRDA 4IHJF 4KE9A 1BXRA 1T0BA 4ROTA 4DPLA 5B6JA 2HQSA 4NDZA 1DGQA 4XM0A 4D81A 4GZ3A 1UBOS 3OQ1A 1YQTA 4LYYA 3HK2A 4RJLA 3WP0A 1NJFA 3EUFA 3OCJA 2XR1A 3RQSA 2PLRA 2E5LB 4KPUB 3NC4A 2UUCB 5TT1A 3IPRA 3CTMA 1F0NA 1X3SA 1EUZA 2P1RA 3WJ1A 2VXYA 3FDIA 3MJ4A 1DEKA 5JZBA 4XOUA 1ZIYA 3U4MA 4X90A 2VUSA 5ALRA 3L02A 1EJBA 1E8NA 1UJMA 3C14C 3L0OA 3KCNA 5CFMA 3LFHA 3ICOA 2FRDA 5CDYA 2F59A 1T36A 4RIIA 1JS1X 3ZZUA 1RVV1 4QWWA 1C8LA 2JIPA 1PHPA 3O74A 2ZU6A 5FPKA 4UMEA 3AR8A 4GFDA 2HJHA 3HRIA 1I80A 2GX6A 4YX9A 3B1YA 2Z4SA 4G97A 3FFAA 4NYMQ 1CEXA 2LDXA 2O8FA 4G8CA 3CGWA 3V9AA 1MJHA 1F60A 4FWIB 1YCFA 5JJKA 4FOPA 4JL6A 3VU8A 5BR4A 3J81k 2ZJ1A 2RBEA 1XI2A 1H22A 1JIUA 1XSEA 3I5AA 4R8SA 2VP4A 3X1MA 4FZ5A 4C1NA 4D42A 2RDMA 4YJKA 4X20A 1CJCA 1CYDA 3MJHA 4RWEA 3TQIA 1PJQA 1OQAA 3IS3A 4BFVA 3TO5A 1J2YA 4EYSA 3UJCA 1P2TA 2QTLA 2ZZKA 3MTGA 4BJ6A 2GHQA 4C7MA 1E2JA 1EAMA 1IM5A 2AH5A 1YRYE 4ACBA 1H8HA 5JD6A 3H5RA 4LV8B 2Q27A 2P35A 1MV8A 4I9UA 4MVJH 3KQUA 1UK6A 4C7JA 3O94A 3R6WA 5AW1A 4XIYA 5EGSA 1Q3KA 2FCRA 2XB9A 1OXXK 4O59O 5FBKA 5FOUA 3SCZA 2D2EA 4YRCA 1T1GA 2P75A 5AVTA 2GM5A 1JECA 4J7CA 4P33A 3HFSA 2JFBA 3OCCA 5CNMA 2PX6A 3DZBA 3K15A 3OZGA 2A9OA 4O2AF 3PHGA 4NCJA 1UKAA 5K01A 2G4CA 2Z08A 1LSJA 3QPAA 3MA0A 2OYSA 1VA5A 4ZWNA 3W7BA 2DFVA 4RY0A 5EXPA 5GMOA 4E13A 3EEIA 2ES4A 5ALMA 3ICCA 2Y0CA 4RKWA 4RF5A 1EEXB 3WB9A 3DHEA 2XD9A 3QVOA 4UU8A 4BLRA 1A2OA 1EZ1A 4G9EA 1TI7A 4KR6A 1SZCA 2Y1OA 4QYTA 3EMKA 1RI3A 1X1QA 3KKOA 3AJ8A 2J3JA 1NUTA 3F7MA 4ZO6A 1U0BB 4AG3A 1XLTC 5EC8A 2BBTA 5ESRA 1F0PA 1PQ4A 4NP6A 3QBTA 4C5BA 2X8AA 3TTVA 2WYVA 3ZU3A 4LCBA 2XV1A 3KPUA 5EPEA 4JLDA 3BZWA 4NV3A 3PQ5A 4HP8A 3DP7A 2PGAA 3F3KA 3FTNA 3E3NA 2B2CA 4WZBA 4BJHB 4EJSA 4KITB 1EFRD 1VKNA 2B98A 1OFHA 1QFJA 1GQFA 1OROA 4GI1A 1R0WA 3C8ZA 4MLCA 1OH7A 4FEEA 4RDIA 4UPVA 3ZGXA 2WG2A 1L5FA 2DUMA 3DSRA 5F4BA 5LOVA 4J3NA 1G8HA 4E3ZA 2GYYA 4DLBA 1Y7TA 4RHYA 1HQYE 4YRLA 2OCIA 1U8ZA 1E3SA 2VDRB 3H5IA 1QCDA 3FRHA 3PNLA 2HRZA 2VVTA 4GMXA 4P38A 4J1SA 5A0TA 2WKPA 3B36A 5IAJA 1XZMA 3H8JA 1E3WB 1HURA 3CNNA 3PL5A 1ISRA 1L5GB 2ZLBA 3JAKA 3KVYA 2A9FA 4H1WA 1N5DA 1AC5A 3VJKA 4NAUA 3O90A 1FDUA 4HQ6A 1I8TA 3EYWA 3HCFA 1RBYA 3AO0B 3HLTA 5F1YA 4IRXA 1GUZA 3JAWB 2D1FA 4ZZ2A 4G24A 3DUFB 4QD3A 1YR7A 5DB4A 4YMVA 4IKEA 3WYBA 4Q7KA 3CX4A 2O52A 4JI1B 1XMPA 1V2HE 1A4UA 1YE3A 1L2TA 4WNAB 3D81A 2IY8A 2HM7A 3C5VA 5SZHB 3V55A 3X1XA 4ZVTA 4OH1A 3TL3A 5BNFA 4QOEA 3WRXA 1UT6A 5HWSA 2DHQA 2P9ZA 2V6IA 5F35A 2O8EA 3TINA 1EHIA 2AOXA 4G81A 2ZBGA 4C89A 5B7NA 4Z4GA 1OV4A 3L0CA 1BH2A 3QU9A 1G64A 5D5QA 5DLDA 3W06A 2GASA 3WXBA 1QNFA 2Y66A 4M9UA 1FQOA 3AR5A 3FNFA 3R0ZA 4G0OA 4X66B 3KZNA 2NVBA 3WQSB 1FLAA 1INLA 1WU8A 1PJ8A 2H7XA 4QGSA 1X7XB 1ZUNB 2DQ4A 4UM9B 4ZDJA 1CERA 3HCDA 6ABPA 4W8GA 1DAKA 1ZDMA 2OFOA 1US8A 1XZJA 3G1TA 3M2PA 4DMCA 3NU1A 4J4TA 2AR0A 2CNOA 4MLPA 2XYVA 2MINB 2ENUA 2AC2A 1VLZA 1WM1A 2OLEA 2Q5CA 2QM7A 3B1JA 3DHWC 2P9BA 2Y27A 1WB5A 3BT7A 4DAOA 2I4TA 2VQSA 4RCYA 1N6IA 4PC3A 2AS0A 5IAKA 4NIMA 3CNEA 3EISA 4QXAA 4G01B 4LVCA 3JCZA 3V2GA 4R51A 3TXAA 1FW6A 4MI3A 1UC8A 4N5IX 1OR8A 2HAEA 3WLKX 4CIWA 2YBEA 3NVMB 2OAQ1 1X9GA 2O0MA 2Z2JA 5EWLB 4RQTA 4C87A 2ZRHA 2FSPA 2ZSIA 4IYRA 4QKQA 1UMBA 1BVUA 1WVIA 1WDTA 2HNKA 4H3SA 2ACWA 5K1ZA 1R88A 3WBFA 1YA4A 4EB6A 1UM9B 2HGZA 4W99A 2ON6A 4HXFB 4XM2A 3T5GA 3VAZA 3IJ5A 1HT1E 4QDOA 4OMFG 3V4OA 2NT4A 1ZLYA 2QR5A 5JRDS 4IS2A 1VBFA 1ZM9A 2ZQYA 4R8MA 4HSGA 4NVRA 4A6EA 5LQRA 1E32A 5JTTA 2JZOA 4ZAWA 3WLAA 3AI7A 2FSGA 3SXUA 5EZSA 4FVTA 2X3FA 4DSTA 1MEEA 3PQEA 3Q0IA 3NHUA 1PE0A 4OHPA 2EGUA 1KY5A 1IN6A 3RFXA 2IFTA 5LN1A 5ITSA 4KKVA 2JLUA 1RT9A 1L7EA 1TYEB 4AMZA 1Z5VA 2TRSB 1T4CB 4FGJA 2EKPA 1B16A 2PRIA 4GM4A 1ZC4A 5F52A 2DWPA 3W3ZB 2R5WA 3REOA 2GM9A 2ZROA 2OFFA 4Q9KA 2GEUA 4TXNA 3UO8B 2P77A 5EIOA 1NOJA 2IOHA 4G89A 1V37A 1U7ZA 1SA0B 3RWOA 4UOZA 3ENKA 4EYEA 4JP1A 2YWFA 4NWIA 1ESCA 3RVBA 3VHXB 1B76A 4UVIA 4Y0NA 2RI1A 2D59A 3QSGA 3GB9A 1N6KA 1J97A 4L8FA 4FZJA 4RY9A 3HJAA 4DG5A 2BELA 1REQB 3OLCX 1HSOA 2ZWPA 1LA2A 1QTQA 2BEUB 3T7JA 5AW6A 3W6UA 1E9EA 1CP3A 4REQB 2HDNB 2I6XA 4WXYB 4B3TB 1VE5A 1TTHA 2DMRA 3NTRA 5JOQA 3LCCA 1FTQA 1Z0AA 2Z2YA 4NYJQ 4OKSA 3LECA 1WXWA 4Q9HA 4G5QA 5BYAA 3NRJA 4EGSA 1WCIB 4IKOA 2C5EA 2AWNA 4LF4B 2ZSBA 3ANLA 3E4CA 4YWJA 7MDHA 1AM4D 1BAPA 4AIIA 4O0MA 3VJMA 3BSSA 4LF7B 1TRKA 3B6ZA 2IKQA 2NZJA 5C8VA 1Z13A 2H3EA 1E7MA 2WK1A 2YJNA 2XF8A 4HAZA 5J5VA 1VYVA 2HA7A 1H1LA 2C98A 4S2EA 3PF8A 3R3ZA 5F33A 1ZJYA 2HCBA 3R9XB 5HRAA 2ZI4A 2H4ZA 1P1FA 4DV4B 2JEZA 2WIDA 3SYNA 2DGDA 1W6RA 1F7UA 2D2XA 2VXBA 1ULSA 1JQDA 3PHCA 1W1IA 1BDMA 1V4BA 4F72A 5HJ7A 2C94A 3MYYA 1IEWA 2Q8NA 3LCRA 3TW4A 2IS6A 3SZRA 5ER9A 4DDUA 2G77B 3UMJA 3KTAA 5TY0A 3DVAB 1YDFA 4F8EA 4ESOA 4OB8A 4R31A 2P79A 4IILA 4QDTA 5ALTA 3SQOA 3OFSA 3CVXA 1IY1A 4KR9A 1VCNA 4TXMA 4B3IA 4F4JA 5JSHA 5LMCA 1VG0B 1GL6A 1QIKA 4GOXA 3TUJC 5IT4A 3V6LA 2E87A 3MT0A 1BE8A 1WNFA 2FJUA 3N2IA 3V1LA 2OEPA 4DLRA 1NA5A 1R0RE 3DNMA 4E88A 3OQBA 3N8NA 3BWMA 4K9RA 4MVYA 5JXWA 1OZ0A 1H6CA 3LQFA 4CQMA 1GITA 1Q12A 3R8XA 2OP1A 1S8NA 3D43A 2JVIA 4UHHA 5KBYA 5E38A 3OG9A 5LWHA 1ESNA 3HJTA 1W36C 4AJNA 5AESA 2Q0HA 3KR1A 2A9JA 1AQ6A 3B1VA 3IUEA 1I4OA 3GJXC 3LO5A 3TGPA 1FJGB 1E2HA 1FTGA 3D1JA 2CDAA 2JGJA 2QJOA 3JD4A 1JX6A 1LLFA 3QYFA 4GHWA 4IHAA 4NV0A 4DDTA 2GT1A 3EVAA 3QIAA 3MELA 4IH1A 5AVYA 3E9EA 5BSWA 3GCWA 4PFJA 2FPGA 1Y34E 1L4KA 3BWCA 4QQKA 3RKUA 3G7UA 3A36A 2VZLA 3HR4A 2OCBA 2YZGA 4KIJA 4KX3A 3T7TA 5HVNA 4FXPA 3H1BA 4HVTA 1K6IA 1DBIA 4RJKA 5LD2C 4GQIA 2VO1A 3DLIA 1KI1A 5C81A 4FYKA 1DB3A 1UFQA 2UZ0A 4H1VA 5KREA 4OPMA 5BSUA 4KXLA 3HUDA 1SK9A 4R1PA 4BMPB 2AX3A 2B35A 1GPJA 1CZHA 1MV5A 1TZKA 1F9AA 2PD6A 3KYBA 4A6XA 1QV9A 1H1TA 3BD6A 5GZ3A 2XZPA 1IBKB 1R4AA 3IOMA 1G8JA 2VAVA 2VDVE 4MVJA 2ZIXA 3WB0A 3AWIA 1VG8A 3LQYA 4P4UA 3EGOA 4IDPA 4ZARA 2QBYB 1F8XA 2X5OA 1XZBA 3A26A 3CR8A 3R5TA 2OM2A 4I99A 5HJ2A 4UXHA 5PNTA 2FSHA 5BW4A 2Q9AA 2JCVA 4J0QA 1MMFB 2C5LA 4ZT6A 3ONNA 3RTGA 4MA4A 1SO8A 3L49A 1DSSG 2M6LA 4YNBA 4K8OA 3GUVA 3IXMA 1QRSA 1JBKA 2IYOA 1C9NA 1UK9A 1O97C 5LPNA 1OLSB 5CVJA 2NUTA 4YRKA 3HYRA 4ZMRA 1C9YA 2IUSA 1YB6A 3G89A 3PVZA 4WBSA 4ZVSA 4CIVA 5EJEA 1C4KA 1MORA 5DPMA 5FYQA 4QEKA 1WMEA 4L2IB 5IJ0B 1ZH6A 2BCJQ 3RVKA 2QNIA 3DEAA 4Q4JA 3K0BA 2AQIA 2BEWA 3E9YA 4L5AA 3ZYCA 5JHGB 3N8HA 4QJBA 3RYHB 3EIFA 1IAVA 4O4IA 2QL7A 3ML1A 2ADMA 3JQ8A 4J3JA 3ONVA 1CUAA 1HV8A 3CJRA 3FM9A 4EARA 2AI1A 4BE7B 3BQNB 5DN9A 4J2TA 2P11A 4QVGA 1P2VA 4QDZA 1XXLA 1LDBA 2EWWA 3UXEA 5I7EA 4PNPA 4HQRA 4PPYA 4PZZA 4YUYA 1VE6A 4FW8A 4OJQA 5CNKA 2IZZA 4KP7A 4M49A 2B1IA 3NHFA 3W1WA 1ZNQO 4PLCA 2ZS8A 3P2MA 3PGLA 1AK9A 3EW9A 4WLVA 1PV1A 2ZYGA 5EIFA 3MS2A 1ECPA 1SCUA 4QQ8A 4FFMA 1P17A 3ZX5A 5HUHA 3KQHA 2GHTA 2G0TA 4DQVA 4K1LA 1VYHA 5ISMA 4D8TA 3TNJA 4MWTA 3N2ZB 3FPBA 3Q8MA 1L5KA 3BRSA 3IAAA 4ZT4A 1AS0A 2ZIWB 3ESYA 1AGNA 1YB1A 3L4SO 3TOXA 4EG3A 2CNDA 5E6UA 4D8UA 3HVRA 1DP4A 1DWUA 3N3AC 4I46A 3PR2B 4NDAA 4BN5A 2XA1A 3Q7PA 5ERXA 3WGGA 2VAWA 3BG5A 1XPUA 1ZP6A 2D8AA 1J7KA 1P77A 5DEOA 5T64A 3N7UA 1QSGA 1DIAA 4CM9A 5M7EA 2I65A 1NMZA 3TQCA 4BQSA 5ABPA 3K0FB 3U3KA 2FFHA 4HDNB 4FX2A 3QKSB 2MSDB 4ZICA 1EG7A 4OQZA 5CYGA 1TYDE 2ZRFA 2BDUA 3V1TC 1AXEA 2PRSA 3FCAA 2BGMA 1F8YA 1PWYE 3V8PA 1XIVA 3OEYA 4JK3A 4D9JA 3WYEA 1X13A 1L4EA 3MWLA 3WOHA 4DHWA 2F1HA 2PAFA 2Y1FA 1JWAB 1RW4A 4LV5B 4TYYA 2ZQ5A 3ZOZA 1Z0UA 2GJ8A 1BHO1 1D7AA 1TU0A 2C99A 2WEKA 1XZNA 3KJIA 3B3JA 4EPYA 1JA0A 3MTDA 4FOSA 3CCCA 4HRXA 4U2CA 4EX7A 3QVTA 5ICCA 5HXAA 1NVGA 2A30A 3HB4X 3UUFA 2WE8A 2ZAYA 1JTEA 3QFCA 3ZHQA 3H5LA 1QJ4A 3GI1A 1QG2A 2ZIGA 3MPOA 1IN8A 1YFZA 4GEKA 5DM0A 2IUUA 4G1EB 2G8NA 4L7QA 3UB4A 4F5ZA 1A9XA 3B38A 2Q6TA 4ZCQA 3V2UA 1LPOA 3VZRA 2NZYA 5KVAA 2ZRGA 3ILYA 2IK8A 2NZ2A 2QXUA 3GRVA 4JJIA 2OAGA 5LYJB 1P33A 3PKJA 1E0KA 3MN1A 4QLOA 1OYWA 1GAJA 1KJ8A 2NIPA 3QXGA 4URHA 5CLGA 2QD4A 3KPYA 3WGYA 1W9MA 4ZQBA 5F3RA 1B23P 3RSZA 5L3QB 4B5KA 5EJ6A 1Q3TA 3L79A 2WPDA 2EDCA 1DXYA 3DBVO 3DZDA 4JLVA 3CZMA 5J4HA 4B76A 4JIMA 4MWGA 1D0SA 3D1VA 4O1MA 2PSEA 1O0CA 2UZ1A 3K5WA 4GZ5A 4MR8B 3S1AB 4LK3A 1F7VA 1F3LA 3PI6A 4ZQGA 1M2WA 4ZU6X 2FEAA 3QEKA 4W9MC 1O94C 3WYGA 1BFUA 2XZLA 1GL7A 3DWIA 4Z7JA 1KYVA 3MMSA 3TOSA 3RUEA 3UQYS 3U3OA 5B1SA 4CF5A 2O1WA 3FR8A 3Q9UA 3NDRA 3G9ZA 4E7PA 4YI5A 4RHTA 2B20A 1MJFA 1A3CA 1WDKA 3NYQA 4JA2A 5DFAA 4F38A 1KVUA 4KDEA 2AYXA 2XXAA 4TYWA 4MUAA 1JEYA 2OR3A 1NN0A 2AXQA 3KQVA 1E2FA 1P39A 3P97A 3ABZA 4JEIA 1BH6A 2D4AA 2GFHA 3EVFA 4NBTA 4WZBB 5LZ7A 3RFCA 4AN4A 1YDWA 4XDZA 1RI2A 4BQFA 1V7QA 4LHWA 3CS3A 4UBMA 1R8XA 3CN9A 1J00A 1ILWA 2C92A 4WZAB 2F1KA 2QNRA 2FGJA 3NO4A 1XA0A 1XEWY 4IIJF 5EJ5A 1BWRA 1XF1A 3DS8A 1NHWA 2EFHB 1BQ4A 2C5SA 3OZVA 1WDLA 2B21A 3ZVLA 2A3RA 2QB5A 4BUJA 5I5EA 1ZM4A 4ME6A 2J3LA 2A94A 1E9CA 3WOVA 3A6KA 2B30A 1O6ZA 1T9HA 3CXUA 4IX9A 2VA9A 3M6XA 4G63A 4KX5A 3FAZA 2C7BA 5EZYF 4JBHA 4RWZA 4BS9A 3C15C 4OGLA 2XCUA 2JI6A 3DM9B 1V8DA 3AERB 2IP1A 2Q3MA 4JOCA 4F71A 1X74A 3JVVA 4GR4A 4MJ3A 1CX9B 1T3ZA 2Q41A 4KQCA 3OPXA 4MH0R 5L3ZA 2HV9A 1GV1A 1NLFA 3GP3A 3R3XA 3HYSA 3A6JA 2IPLA 3N70A 1NJ1A 2PMEA 4ZK2A 4FDAA 2EBFX 3O6VA 1L8AA 1VJGA 3A9TA 4KO2S 4V0QA 5KDLA 5ENZA 4GKJB 2I99A 1Z6QA 2G71A 3H1AA 3CMCO 3TIVA 4PYRA 3NAGA 1ZAYA 3O8QA 4N41A 4TZ6A 1CY6A 3PGA1 3PZRA 2XTAA 3JQ9A 3WXMA 3ZZ1A 3QW4B 1Z4KA 3VO1A 1GZ4A 4NFSA 1G3QA 5J2TB 3AJEA 1P2UA 2FDRA 3QXSA 2H6EA 5G02A 4QBHA 2X23A 1NULA 4LWOA 3ACBA 3RFVA 2ZS9A 3RM3A 2O20A 3ROZA 3BSWA 2O2HA 3NRCA 5GOTA 2QI9C 4ETMA 2Q50A 3IR7A 4E5SA 4F93B 2QUJA 4QASA 3D59A 3T4UA 4EG7A 1MO4A 2Q5IA 4MVXA 4S35A 1SBCA 3AEKB 5B1IA 5G3ZA 4GSYA 4UQOA 5A7GA 1J2RA 2QRNA 6AT1A 1TM3E 1XKTA 4OYYA 4WV3A 2AYZA 1KMNA 3EBPA 4PBRA 1Y6RA 2AW5A 3GT0A 3GN2A 3WLJA 3DJFA 2A14A 4ZYVA 4LFAB 4IIJA 5GWXA 1ISPA 4QSMA 3V00A 1H42A 5B7PA 4UFNA 5EIBD 1UMBB 1ZGCA 2DWCA 3ZYZA 5AUPB 1SOWA 1FXSA 1ZS9A 2RSLA 4MV0A 4TV9A 4CCAA 3DONA 3D3WB 1FVHA 4OATA 4D92A 1NHGA 1OPRA 3C8UA 1JFRA 2WZQA 3CF4A 4ILEA 2W2VA 4N65A 3D8NA 4FJ2A 4LKRA 4RH3A 4DRYA 2QRZA 5BW5A 5IXJA 4DXHA 1EK2A 4Q3DA 2WU0A 4MPTA 4F1KA 2IT1A 3CSDA 3CF6R 1PZNA 1U04A 2G25A 4KXUA 4TMTA 1VKHA 1Z2CA 2PSSA 3N1UA 4MINA 1FYEA 1PR1A 1QOZA 2P1ZA 3NANA 1UP7A 3MEQA 3UWPA 4BCDA 2CNBA 3H9JA 1WUJS 3WYAA 1YZUA 4ES6A 1PKEA 2W0SA 4HGRA 4JXXA 2N46A 1HI9A 3H87A 4OGGA 3ZE8A 4ETIA 3VPHA 2ZTSA 1ZONA 3K2BA 2JD2A 4DSNA 5AOVA 3GBVA 1G9SA 1LV7A 3FUUA 1AKEA 3IQXA 4XWAA 3U44B 1CY4A 1EINA 1WJGA 3T9DA 5HIAA 1RZRD 1RC1A 4Y6QA 4YRBA 2BUCA 3OC0A 4EX6A 4FK8A 5DWDA 1IVYA 4PWYA 5BQOA 1Q0HA 1N2OA 1NVVR 1UXHA 3VYVA 4NU8X 2OB1A 1U2RA 2WUVA 2XZTA 3PDUA 4Z86A 1TW2A 4ZVUA 3UT0A 4I4TB 3M6FA 4U7PB 1BRTA 5LLTA 3ZX4A 4C2BA 2RAVA 2HR1A 2VJDA 2FG7C 4Q4HA 1GU0A 4YWHA 2CB0A 4IDCA 3VU3A 2CLOB 2BKVA 2OWEA 3AERA 3WL7A 4D8XA 3TIIA 4QTXA 2P30A 2BFFB 3DVRX 2WILA 4U0JA 5AKXA 3RGWS 4BKMA 5E1MA 1UKYA 4L74A 4G41A 5F12A 4M22A 3GFSA 2YV3A 1FJHA 2HUPA 2JZCA 3K6JA 1TM7E 5FOWA 1TKAA 1YCGA 1BE6A 4JBIA 4DDWA 1THZA 3B89A 4Y1FA 1E63A 4TMYA 1E1QD 3SAJA 3V4ZA 2TMGA 4XZ3A 1JR3A 4HH0A 2H1WA 2X6RA 1JG1A 4FS8A 4HADA 4V2IA 1BXGA 1RXCA 3AONB 3KQQA 3U1TA 3UT6A 5A6VA 4PU0A 3CVYA 1OBHA 1GZ5A 1DO8A 2AFRA 3DWGA 3F2IA 4R8KA 1B3BA 3PDJA 4UVDA 5E4TA 4KFTA 3I2GA 5AM3A 1AJEA 1U3VA 5J5CA 4AZTA 8AT1A 1MH1A 2XYRA 2QNBA 1PG5A 4JC8A 2CFRA 5K3DA 3DZHA 4BYGA 1JE0A 1T0IA 4Q16A 1Q16A 3W5IA 1YIOA 2FK8A 2H11A 3HSSA 4Y7CA 4MHOA 3L7AA 3U4HA 1U9YA 4O5OA 1U3GA 4O4JA 5AJYA 4PLFA 4YUXA 1LTQA 5A5FA 2O3UA 1UAAA 1EYZA 3EZNA 5SZJA 1CIVA 3QLVC 1L5SA 2QPAA 1JSXA 2C00A 2AX4A 4GI3A 5CNJA 2VF8A 4HAOA 1DLIA 1I4EB 4ITUA 4MPDA 3FCUB 4TZKA 5COAA 3I64A 4RJIA 1JAHA 4BMXA 3JQ9C 3CCFA 4UTOA 2JC3A 2PBFA 5FL7D 3WLMA 3HA3A 3LFUA 4BB9A 5K0FA 3F4BA 4IIXA 2AOUA 2HD4A 5DJ5A 4HXYA 5I51A 1JHPA 1YZFA 3BIFA 2ANCA 2JD1A 3GLGB 1EFAA 4CL8A 4UM8B 3I0MA 3R1IA 4ZCIA 5JWOA 4TTIA 5LKAA 4TSFA 1NASA 2BZGA 4QOJA 2XX3A 2ZR9A 2Q2QA 4GPBA 4IW3B 2VDMB 5M3BA 3W6ZA 1ZZEA 4EQ6A 1UOPA 2JEYA 1H2RS 2ODNA 3KOZA 1U8TA 1VMIA 1VPLA 2FMKA 2H2FA 3EDMA 3GEGA 5FWAA 3SEAA 3OCVA 1JHUA 3ZDXB 4KAAA 4ZXFA 3G5UA 4KMSA 1L4GA 2A0KA 1X7ZB 2OCXA 1FW8A 3GJZA 6GPBA 4DIFA 4HMQA 1AO0A 1COZA 3VPCA 2J4CA 4RY8A 4L08A 3BIJA 1GR0A 3VHRA 4X24A 2BTEA 5TF0A 2ZGVA 2QUAA 2ID7A 2OAEA