1NUUA

Crystal structure of human cytosolic nmn/namn adenylyltransferase complexed with nad
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
233
structure length
213
Chain Sequence
SRIPVVLLACGSFNPITNMHLRMFEVARDHLHQTGMYQVIQGIISPVNDTYGKKDLAASHHRVAMARLALQTSDWIRVDPWESEQAQWMETVKVLRHHHSKLLAVPELKLLCGADVLKTFQTPNLWKDAHIQEIVEKFGLVCVGRVSHDPKGYIAESPILRMHQHNIHLAKEPVQNEISATYIRRALGQGQSVKYLIPDAVITYIKDHGLYTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords FKSG76
publication title STRUCTURAL CHARACTERIZATION OF A HUMAN CYTOSOLIC NMN/NaMN ADENYLYLTRANSFERASE AND IMPLICATION IN HUMAN NAD BIOSYNTHESIS
pubmed doi rcsb
source organism Homo sapiens
total genus 75
structure length 213
sequence length 233
chains with identical sequence B
ec nomenclature ec 2.7.7.1: Nicotinamide-nucleotide adenylyltransferase.
pdb deposition date 2003-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1nuuA00
2A86A 3U1VA 4EG3A 2WQ7A 1N2EA 1DNPA 1BS2A 4S1OA 4MLPA 1OWOA 1WXEA 2PIDA 3GUZA 4OUDA 1EE1A 2CV2A 3IOBA 3TS1A 5FNZA 3X1KA 3N9IA 4CDMA 1ZJWA 1F7VA 1U3CA 1X8XA 5J58A 2J4DA 4EG6A 1OWPA 4P2BA 3FIUA 1NP7A 1X6VA 1VBMA 5KWVA 3L92A 4K0RA 5H7XA 2JAXA 3COWA 1N2JA 1G8FA 2D5BA 4NAHA 4K03A 4TS1A 4MVCA 1IVSA 1MRZA 5JBNA 1ZH0A 4CDNA 1TEZA 3VRHA 1O96B 2QJTA 3ELBA 2CUZA 3JXEA 2BTEA 4PBTA 1J1UA 2A84A 4JXZA 1XNJA 3NBAA 1F7UA 4ZT2A 3G59A 1FYDA 4U63A 3CLTD 1WKBA 1VL2A 1NSYA 3IMCA 1WXIA 4MW1A 4MVXA 3SDBA 3IDFA 2D54A 1B6TA 4MAFA 4XFJA 3RJZA 3COYA 1JILA 3F3MA 3KT8A 3SZGA 2CV0A 2QJFA 1TFUA 4MVWA 1O97C 1T6YA 4XSVA 2ZUFA 1ULHA 1S4MA 5AHWA 5BNZA 1YUNA 3PXUA 3MMXA 1MAWA 1YIDA 3CVVA 2V0CA 3FI0A 3QE4A 5J59A 2CFOA 1O0CA 4MUEA 5K0TA 1M8KA 2WSIA 1Y42X 3VGJA 2E89A 1N78A 3IUBA 1JGTA 4HJXA 2E0IA 2DXIA 3DLAA 1F4LA 2QUIA 4MW9A 1PFYA 3ND6A 3CVYA 2BYTA 1N3LA 5K0SA 3AL0C 1I6KA 2DLCX 1PFUA 1GPMA 1KP2A 3SEZA 4R0NA 3NBKA 1WXGA 5TGTA 3RK1A 3CLRD 1WQ3A 3A05A 3HZRA 4YP5A 4JYZA 1IQUA 2IP1A 2NSYA 3COVA 2QTNA 3K9WA 1EFVB 4X0EA 3H9BA 1VBNA 1YIAA 1TYCA 1NUQA 2YWCA 4ARCA 3ILVA 1OD6A 3ND5A 3G6KA 2V0GA 2AKEA 3AG6A 2YXNA 1YULA 4MUHA 1M8JA 1G8GA 1LI7A 4ZT7A 3H05A 2PZBA 5TEVA 3KT0A 2RE8A 1PFVA 1U7XA 3PRHA 3AKZA 3FG9A 3P0HA 4MW7A 1JIIA 1WJGA 3Q4GA 1QJCA 4MWDA 5LFAA 1WZ2A 2HGZA 3TQOA 1V8FA 3BL5A 2GM3A 2YY5A 3GMIA 3N05A 2DR2A 1J21A 5DASA 3N2YA 3IMEA 4MWBA 3TZLA 3P52A 3PNBA 2DUMA 3QTTA 1I6LA 5J5AA 3UOWA 4MULA 1KAQA 3P0JA 3TNJA 4MW0A 4ZT4A 1QRTA 1R6XA 3ZIUA 1IFXA 2WB2A 2AZXA 4I6GA 2J5BA 2X3FA 1PG0A 3MXTA 4CQNA 1XJQA 1ILEA 3HL4A 1D2RA 2YWBA 1O0BA 3LOQA 1NI5A 1O97D 2H2AA 3HMQA 1LI5A 3SP1A 3IOCA 1KORA 2J09A 4KPUB 2O8VA 2X1MA 4EFKA 3IODA 1FFYA 4QBTA 1VLHA 4ZCSA 2A88A 4AS1A 2R5WA 4PBSA 1EFPB 3KT3A 1M8FA 2PXHA 1WXHA 4ARIA 4EF6A 4UZFA 1HYBA 3P0IA 1OWLA 1COZA 1J70A 1O95D 2JA2A 4YP7A 5TEWA 4GU5A 4ZT6A 3IVGA 3FDXA 3PNVA 3CVUA 1H3NA 1H3FA 1KR2A 1T6ZA 3Q10A 4WNYA 3RFFA 2QTMA 4KKVA 2J08A 4EG8A 1YI8A 1N2OA 1IQ0A 3MLBA 1TYBE 1XNHA 3CLSC 2PG3A 2CYCA 1IHOA 3AIIA 1OBHA 2HMAA 4J76A 2CT8A 2C5SA 2PZ8A 1KQOA 4F4HA 1CT9A 3AG5A 2QUJA 3UMVA 1K4MA 2OQ2A 4JZYA 1WY5A 4MWEA 4NATA 2CV1A 1G59A 1EXDA 3CR8A 1KQPA 4U8HA 4KR6A 3SZ3A 4RPIA 3DV2A 1JHDA 1NYLA 3D6VA 4OUDB 4PY2A 1M83A 3KFLA 2EL7A 2QUKA 2EJCA 4G5FA 1IRXA 1UFVA 4E1AA 1M8PA 4DNXA 3LE8A 3CVWA 1KH3A 4DLPA 3FY4A 1K4KA 2D13A 5DK4A 5LM3A 1QRSA 1OBCA 2XRYA 3ZJVA 1O94D 4G5YA 2TS1A 1JIJA 1NZJA 4J75A 1NURA 4MWCA 4PBRA 3LCJA 2IELA 1YUMA 3SYTA 3IH5A 3FOCA 1H3EA 1J09A 2G36A 1T9GR 3PNYA 1JECA 1MAUA 1M8GA 2IJGX 4H3SA 4L2IA 1WOYA 3ZGZA 1JZSA 3G5AA 1JEEA 3IOEA 4QREA 1N2GA 3ND7A 4OJMX 2DERA 3X1MA 1TQ8A 3OTWA 2QTRA 3CLUC 1OWMA 3N8HA 1EUQA 3CLTC 4BWVA 3FHJA 3ZJUA 4MVYA 3SEQA 3RK0A 5HUJA 1T9GS 3ZJTA 2RD2A 1OWNA 2VXOA 4R2MA 3IVCA 5TS2A 3INNA 5DB4A 1QU3A 1J1ZA 1JIKA 3CLSD 3C8ZA 1LW7A 4MW5A 3UC5A 3DO8A 3HFJA 4DDKA 4HK4A 4WSOA 1M1ZA 3H9CA 4MW4A 1NUUA 3L93A 4UZEA 4F3RA 1U0BB 3H99A 1R6TA 1O96A 2H29A 4MUKA 1N75A 3TZEA 1G8HA 2Z09A 2E21A 4DE5A 4MW2A 3IVXA 1GTRA 1J20A 4DDMA 4ZCPA 4MUFA 1ZH6A 3CLRC 4MUIA 1GLNA 1WXFA 4QRDA 1O6BA 3D6UA 3RBAA 4EG5A 4G6ZA 1MBZA 2A1UA 2PZAA 3OP1A 1N2IA 1F9AA 4ZT3A 4JFAA 2CYAA 1N2BA 3MLAA 5EKDA 2A1TS 3S3TA 1XNGA 4ZCTA 2A7XA 4Q93A 4DJAA 4EG1A 4NDAA 1QRUA 2ZUEA 1KQNA 5KHAA 2JANA 2QUHA 4NX2A 1T6XA 3FH0A 5LLTA 1A8HA 2A4MA 1MJHA 2Z08A 1EJ2A 1NUPA 4EG7A 3HGMA 5F23A 1GTSA 1EFVA 5HUHA 3CLUD 3IMGA 3RHSA 3KT6A 1PG2A 1N2HA 2WQ6A 4GRIA 2XRZA 4KR9A 5FO1A 4R2LA 2GOYA 1KP3A 4KR7A 1GN8A 2DETA 4DDHA 2OV4A 3HV0A 4NZPA 4MQ6A 3I05A 4EG4A 1I2DA 2Z3VA 1WQ4A 2QJOA 2CSXA 3UK2A 4I6EA 4I6JA 3FWKA 4YP6A 4ZT5A 5HG0A 1N1DA 2A1UB 5FO0A 4FZJA 1GAXA 1ZUNA 1VBKA 3A2KA 1Q11A 1IQRA 1MC1A 1NUTA 3H97A 1GZUA 4JXXA 4ZCRA 2VTBA 1KH1A 5IJXA 4YBRA 1O95C 3COZA 3ISJA 3FETA 1PFWA 3A04A 2E18A 4CT0A 3E27A 4MUGA 4ND7A 2CYBA 4HJRA 4RUKA 4EGAA 1U7DA 1U3DA 3A4IA 1Q77A 1QNFA 3ZXIA 2HZ7A 1JZQA 4MW6A 4KPUA 1IH8A 1R6UA 3CA8A 2AG6A 5DEOA 1KAMA 2GKSA 2X0KA 1MB2A 1O5TA 2DEUA 5H16A 1EFPA 2NZ2A 1JMVA 3QTBA 4NAUA 1RQGA 4YMIA 3MUEA 5KCMA 3DPIA 3NV7A 1P7PA 4Q16A 2O5RA 2B7LA 4MUNA 1MB9A 4U7JA 2ZP1A 4ND6A 1TYAE 4AQ7A 1MOPA 1QQTA 1EUYA 2X1LA 1Q15A 3M5WA 3CVXA 1K97A 2VTBB 4MUJA 1N77A 1QTQA 3GLVA 3UY4A 1NUSA 3FNRA 2DPLA 5IHXA 3VU8A 2J07A 1KKUA 2A1TR 3ZXSA 3ZUGA 4L2IB 3IUEA 3AFHA 2I1LA 1K92A 1TYDE 1Q19A 1I6MA 3TQIA 2PFSA 4XFDA 3X1JA 1H1TA 1V47A 1O94C 1SURA 1JEDA 3Q12A 1QU2A 4ZCQA 4HPWA 3K32A 1KH2A 4A91A
chains in the Genus database with same CATH superfamily
4LWOA 1FVOA 4CKYA 4EG3A 1JW9B 1YE3A 1RZUA 1ZOOA 1A95A 1L8AA 1E9AA 2HU5A 4IFIA 5HCNA 1ZD2P 1DNPA 2OR3A 1PJAA 2OY0A 4FMDF 3H6GA 1VSBA 4UE2A 1OI2A 4X1KB 3SX4A 2FMTA 2NO1A 1MG5A 3CINA 1VPTA 5LD2B 2C20A 2I8AA 2YN0A 3FMOB 3S29A 3ZY5A 1L4LA 1JQBA 4CFYA 4D3DA 4BGIA 3ZVMA 1JHOA 1PQUA 2HRBA 1ODLA 5H7XA 8ADHA 3COWA 2P3LA 4M9XA 4NAHA 5FTJA 5KSZA 1XMVA 3PDIA 3ZWDA 2J3KA 1P4SA 2DT8A 2XWSA 3D2BA 3ZGYA 4FPXA 1ZH0A 5CDFA 5JZBA 2C7OA 2BBOA 4TGLA 1DX9A 2JI6A 3RF7A 1K6EA 4IDNA 2H7YA 2QBYA 1NRWA 5C1DA 3U7QA 1Q1GA 1XNJA 3X1DA 1EM6A 1ZH4A 4KWIA 4RVHA 3HJCA 1EK2A 3CLTD 1T25A 4J2OA 4WFKA 5KX5A 4G24A 4M1TA 1NSYA 2ACKA 5LLSA 2H51A 5JNUA 1ZX1A 3VOSA 1M5RA 1JNXX 2PHZA 2E4AA 1I94B 3TNDA 1IZ8A 1J8VA 3PC3A 1I5RA 2GB4A 2O2YA 3OOEA 5H59A 4K6GA 1TFUA 2ISSD 1RC8A 1C0IA 2HQOA 4CLEA 4NPHA 4XGKA 1RNLA 5B1DA 2AB0A 5CK5A 4LHEA 4BIMA 4KFTA 2IS1A 3LC0A 1CUSA 4C7OB 1MAWA 2ZR7A 4QVGA 3WBBA 1MTZA 3HXQA 2QR2A 1Q0ZA 5GONF 1T4BA 3L7JA 3QVMA 4IIVA 5ARCA 5HGXA 5JU6A 3DPUA 5CAEB 5JNRA 2O54A 4YRNA 5DX1A 4PCVA 5AW8A 4BVFA 1OAOA 2HSDA 3CKLA 3HE3A 5F3DA 2CNBA 1OMOA 3ND6A 2GPSA 2FEMA 1U2PA 3EDRA 1E7SA 3GRFA 5C8VA 1QH1B 1KP2A 3QEMA 3O8RA 2H1HA 4D4JA 2R1TB 2HQ1A 1B41A 1EZ4A 2HNBA 4PAOA 4YP5A 4PX5A 4KXFB 3ZQJA 2R65A 1N4AA 4JYZA 3JPWA 4KOEC 4EZEA 1F4PA 5TMDA 4E5YA 2QTNA 3ABIA 4BB6A 1GL7A 5FBLB 3CKYA 3ZCQA 4E5PA 3CKMA 4N5HX 3AYXB 4YCJA 4CQMB 2AE1A 3ILVA 4KQFA 2FPKA 3JWIA 4UBNA 5BMVA 2BM0A 3EUFA 3RRFA 4FFBA 4B4KA 2QB5A 5F76A 2JJMA 5JNLA 1QCZA 2FI1A 4N5NA 2OXIA 3D2CA 3V2IA 3BD9A 4PG5A 4GPD1 1QUFA 4MGYR 3EPRA 3FBWA 4JHLA 3KT0A 1IE3A 2X6QA 3JQAB 2HX1A 3CRMA 3BWBA 4MUBA 2XQVA 3F67A 4PSUA 1PZNA 4WADA 4WV3A 1WJGA 4JJZA 2F1JA 4NFLA 5C1IA 2CMGA 4M8IA 4R2XA 4DKJA 1AIPA 4LOHA 2Q27A 8GPBA 3W3AA 3M1YA 1C3LA 5K0ZA 2CL0X 1SCUB 4W1RA 1XD2B 5IULC 4NWIA 3WO1A 2J3EA 3T6KA 1L7VC 1NW8A 4MWBA 1F0PA 1VKRA 1BWPA 1MIHA 1IL0A 2ODTX 5EKTA 4O4IF 3DNPA 3GAFA 3UUWA 4MW0A 5JSQA 1QM5A 1M1YE 3OT4A 4G1MB 5DULA 2Q29A 3WB1A 2IP2A 1VKJA 1P18A 4PVCA 4WBXC 4CEIB 2DKFA 2YIJA 2VAWA 3CY6A 3TAUA 2WIDA 1XRNA 1EIWA 1C3JA 4EYGA 2YMLA 2QX9A 2ZUUA 1BCRA 2VKTA 4O2AA 5KNLA 4GGPA 1YT5A 2W2LD 3HVUA 2GCIA 1EFCA 4P9NA 3IOCA 3CSSA 4MCIA 4UD6A 4Q34A 2J45A 5AKHA 2X1MA 1G7CA 2RHMA 3WQHA 5LYJF 1WMBA 1E1RD 2FPSA 1C7IA 2ZYGA 2FZCA 2I62A 4NENA 1X2BA 1SBCA 2VAPA 1LV7A 2FW8A 3I9V6 5J4HA 2FW1A 4AKHA 1EUCB 1YU9A 2C29D 2NW6A 3NKVA 2ZVDA 3ZE6A 3IVAA 2YXLA 1WP4A 3GV0A 1GO2A 2JAOA 4XQ0A 5IRCD 1KXZA 4ZI3A 1Z36A 3TSOA 1PUXA 3AM5A 2A9VA 3E4DA 2FSVC 2WU0A 4ZEVA 5ALXA 2FFAA 3EIQA 4OIFA 1Y9DA 3FDXA 4Z0TA 4FBLA 2ZGVA 1IUOA 1QBKC 2VATA 3Q10A 4DWOA 3U4QA 2ZUVA 2W6MA 1WMAA 1JR3E 1YJ5A 3N86A 3K0CC 4LY0A 5DYYA 5A7FA 5IT5A 2W6JA 5TLSA 4I2NA 4PFKA 1PT5A 3HPQA 4US1R 4UBLA 3R7LA 1RWVA 5JTTA 3N5KA 3E0QA 2GVNA 3QPWA 1F0KA 5AK6A 221PA 2WR8A 4C4AA 4BEJA 1LRJA 1ZL2A 1GOTA 1NLMA 2VCYA 1BKSB 2XUDA 3IP8A 3LPNA 5L3ZA 3MTAA 1ES9A 1DAIA 1WAMA 3DT8A 3ESCA 4OAQA 3IAXA 1X8KA 4NEQA 4P22A 1RWQA 2VCHA 4QJBA 4U9UA 2WFMA 3RFTA 4EPTA 1TTHA 2BGIA 3R7FA 1KQOA 4HFRA 2B3DA 3B48A 3PGVA 2OYRA 4BMVA 2DUUA 4L4XA 3L7BA 3PQ3A 2QN9A 4YUVA 2VA9A 4UU7A 1E5VA 1S7CA 1N9GB 3DTNA 3K2EA 3AHFA 3N70A 2FRDA 4N49A 5G53C 2QQEA 4I1UA 4HUJA 1NHGA 1TVKB 1PUIA 3RYIB 1P0QA 3UNXA 2VF4X 1RXUA 3GZTB 3TZCA 4BX3A 4CCYA 3RTCA 2WJZB 3DKIA 4RPIA 4F46A 2I87A 3BMNB 1LLCA 3OEHD 5B4TA 4UNSA 1YV9A 2VTKA 3D6TB 4OD0A 3RRNA 5K9ZA 1AMUA 3U3XA 3DLIA 2XVAA 1XDUA 1XVUA 2P2NA 3E0XA 2Q4OA 3HWRA 4JI2B 1E94E 1PQPA 1Q6YA 1MOZA 2PX6A 2R3SA 3B1YA 3NALA 1KSGA 1Z0FA 1XRQA 3WXBA 4V0SA 3VU9A 2FDCA 2P0AA 2YXEA 3I12A 1VL1A 4RX1A 2VSQA 3O1HB 4XWAA 2IXFA 3S1LA 2W2TA 3KAPA 3TNFA 5K8LA 2BWJA 3MW8A 4PBRA 1N2SA 3HDJA 4KHPB 4R3UC 4UUAA 3T7CA 3QX7A 1QIJA 4KDRA 1W85A 1J0DA 1UKZA 1XUOA 5GM1A 1DRWA 2E7ZA 4Q9DA 3IQDB 1N2XA 3BF7A 3DCJA 3FFBA 4JL5A 3UXEA 4O6VA 5DOVA 3MD0A 3GLFB 2G36A 1P5FA 3LUGA 2R00A 1B6RA 4GPEA 3L7KA 2IJGX 5L3VA 1AXRA 1XQVA 4XYLA 2ONZA 2FP3A 4KVFA 3EGVA 5GVSA 3FOEC 4YCCA 4BNHA 1I2ZA 3QWFA 2YRFA 4JP1A 4EL5A 1K2WA 1UPTA 4W1QA 2QTRA 1E6UA 4YMSA 5IBQA 4K88A 4BKPA 1GXSB 1X87A 1J5EB 2YZNA 3AESA 2P5UA 3HKDA 1NJ2A 1E0AA 1P73A 4Y2RA 2OK8A 1UAGA 3AJ9A 4LF9B 2ZBEA 1EUQA 5AM4A 4RM3A 4XH9B 3RABA 1AN0A 3PXDA 5FTKA 3DAPA 3I32A 2FW6A 5F1OA 3C14C 4JL8A 1MT0A 3UTCA 4CIAA 4MKHA 1HMYA 2BFFB 2PMDA 1R0XA 1I9GA 1M3SA 3HB5X 3K4PA 3O92A 1YACA 3LUAA 4JC0A 4V0QA 2VIIA 2QTWB 1PR1A 2R1VB 3EGXB 4M3NA 5FNVA 4EHBA 4EPVA 2VJDA 1V2HE 1JIKA 3KPJA 2CHQA 2VP3A 4V0ME 5AM0A 4EA8A 4E4TA 4P84A 1QHSA 2JHPA 2D1TA 2LD4A 4KO1S 5JS6A 1BH6A 2IEZA 2QP4A 1HM5A 5FBKA 2P41A 3TBKA 1RYBA 5ETJA 1KPGA 3H9CA 2B1RA 3QKSA 4D8VA 1NAHA 3T95A 2JPDA 2VDPB 3EE6A 2IZ0A 4UHBA 1CR0A 4PLWA 3AU9A 1H0SA 5FPYA 4ZI7F 1NLZA 4GZ3A 4UBOA 3FMVA 2Z9DA 1LLDA 1YBVA 3EG9A 5LP6C 2Z0MA 4WKGA 3WL5A 2HF9A 3MQ2A 5DMHA 1LA2A 1QYXA 3FMGA 5E8RA 2B6HA 1SZJG 2ACVA 4DR2B 1RKBA 4C2UA 4PTLA 4F8JA 1Z28A 4ZO6A 3DFFA 4OHCA 4TWIA 2ZAYA 2FPUA 2VO1A 2IVZA 4U2KA 1QO0A 5DE3A 1TUBB 1G1AA 5DBOA 1SXJE 1WZUA 5KC8A 1DARA 1M7BA 1A9YA 3NIFB 3PWSA 2FQQA 3ZX5A 3PNKA 5JCXA 4CM4A 4PO1A 1K7SN 1TU0A 3ZY3A 4U2GA 4KJXA 2WIAA 2W00A 3A27A 3I6BA 5HBRA 3G13A 4CN9A 1G21A 4AYTA 4WI1A 5C2JB 3M5CA 4ZT3A 2HADA 3THRA 4PHHA 1C2YA 3WGKA 3WIEA 3LP8A 3KQPA 5CTAA 1BNCA 3ZWYA 3PXBA 1USGA 1WHTA 4I1YA 4BASA 3KKKA 5HBGA 1K5GA 5AJUA 3UUFA 2Q5HA 4S2UA 2YC4C 4A7PA 1T8UA 1MB0A 3Q3VA 1GQRA 1HDXA 2ZDQA 4F4IA 4NX2A 5KIAA 2PY6A 2G70A 2WSYB 2GPWA 3E82A 1BHJA 3ICCA 1HEIA 3HN7A 1NNUA 1VRWA 3HGMA 1OKKA 2GPTA 5KJ1A 1YDEA 5F3RA 5KOJB 3AJRA 4DB4A 3JYLA 4H08A 1KZ1A 4AJLA 1DCMA 5IK2D 1CS4C 3F78A 3GU3A 4KH0A 2D0OB 4O4LF 2PZGA 2VP4A 1WETA 4BFCA 2O2HA 1JDPA 2QTVA 3R23A 1E1QD 2G1UA 2PRYA 1U7OA 4QG7A 1JH9A 2WVAA 3FNBA 2CDBA 3C70A 3IQGX 1U3UA 3Q3IA 4HI0E 1A88A 4C6SA 4RDXA 2DETA 1VI6A 5TVGA 2JH9A 4C1NA 4PSCA 1PJLA 1JPJA 4RHFA 3TKYA 4CUJA 4R16A 1FRNA 1WXDA 1Y1SA 2RAUA 5TGZA 5A4AA 4DV3B 5DT9A 3OQOA 2QW1A 2BKAA 1KU0A 3E22B 3L1IA 4KXXA 3UJPA 3O4VA 4I6EA 4X54A 4D9BA 1X7YA 3KVOA 4MQEA 4OJYA 1N1DA 1NNSA 1FNDA 1V6SA 3B85A 3EXAA 1I7LA 2GUGA 4FZJA 4HVTA 3WLFA 2B4TO 4CCWA 5C8YF 5I7UA 1ZR2A 5BWOA 3DEHA 3EY9A 2AMJA 1LSOA 2IXDA 3I9MA 2PEZA 2F59A 4J43A 4BFVA 1JLMA 5JVDB 3J81k 4L75A 4G5QA 2B5WA 3GHYA 1MAHA 1WIWA 4QYWA 3JQRA 1F38A 3KJXA 4WKCA 4GOLD 2IZ6A 2GHRA 4M1MA 5CXQA 1BH2A 1C3OB 3GN2A 3R0IA 4RFSB 4KRFA 1HDCA 1EFLA 3P26A 4BB5A 3GZNA 3PUZA 1EWVA 1Y63A 2CWDA 2DTXA 4LOAA 1DC7A 2MU1A 4CEHA 1ZP6A 2REQA 1ML4A 2WSSA 3IS3A 3M9XA 1P2BA 4HJRA 4TV8B 4IYJA 4JBGA 3V7UA 1VHDA 5CDUA 2FMHA 1IXRC 2ZAGA 3JSAA 3RIXA 4OJKA 1WLYA 2D06A 3RFXA 1ADJA 3BSFA 3RF6A 2CCGA 3NHZA 3PSHA 4CM8A 1IPFA 3PC7A 3WRWA 2XCRB 1QHYA 3EXFB 5IKXA 2A9QA 1XZKA 2AG6A 4DMCA 3GLGE 2PUEA 3EPHA 2X0KA 1ZQ1A 1N5KA 1C1DB 4FINA 3BB4A 3VZSA 2V59A 3AOGA 3NH6A 2Q5FA 3PE3A 1TM1E 2O7VA 4UHJA 3VKWA 2VT6A 4Z3KA 1V5WA 2AQHA 2M1XA 3MK31 1O5IA 4L5BA 3ZNPA 3N0VA 1OAOC 1ORVA 4IAOA 1AO0A 5CJPA 1FPMA 1SRRA 2GZMA 4RF4A 3RB8A 4DWJA 5GZ1A 3PD7A 4DV7B 2IYOA 2EATA 2NU9A 1IZYA 2XDQB 2PLWA 3O8LA 3ONDA 4MS3A 4ARUA 4GW3A 2C1EA 3KPVA 4XEHA 3I9FA 1SELA 3HEMA 1W6RA 4R68A 1WULS 3LP5A 2VAMA 4WLOA 5JASA 1MOPA 1NXSA 1QVRA 2K4MA 2JL1A 4LN1A 3QKTA 3SD7A 1KGSA 2L17A 5EWLB 4HHEA 4PCAA 3OQ1A 3TUZC 3WLMA 1KO7A 1GG9A 1QTQA 2GARA 4ZQEA 5AJTA 1VHLA 3IKLA 2POCA 1JNYA 1NYQA 1Q0RA 1VJ5A 2HO4A 3C41J 4UFNA 4AZ0B 5E3HA 1CF9A 1AHHA 1QOZA 5EG5A 3RTAA 1ZM7A 4ZTZB 1KMQA 4QSHA 1TM7E 3H2GA 3HJRA 3TLMA 3OU7A 5KNCD 3VH2A 2BUAA 2PBFA 4PYLA 1NR5A 2DH5A 1DDIA 3GRZA 2GYWA 4XD2A 5HIJA 5KNDD 1COWD 4P38A 2ACWA 3RS2A 4BV3A 2FETA 1WV1A 5M5BA 1JFTA 4MARA 2VZLA 2BKLA 2RKWA 5F4BA 4IOJA 4X20A 2RGDA 2ZBFA 2Q6IA 3A2NA 3LV8A 2EF0A 1R0ZA 4XZ3A 4RGQA 4ZKDA 1DAPA 3U0BA 1KRHA 4H7FA 1FFCA 1FLNA 4IFBA 3W5CA 1JN0A 1OXSC 5EXXA 3DE1X 2Q9UA 3ULKA 4XCVA 4XYEA 4CMAA 1QZXA 3WNCA 1NBEA 2FFQA 4ABYA 4B80A 1NJ5A 1K27A 3WAKA 1H2BA 4CDMA 3EXHA 3VM6A 4TYNA 5EJ9A 2HA3A 1X8XA 2JGMA 3JCZA 4OU5A 4CQMD 5FUMA 1N6PA 2RGNA 3T38A 3DDCA 1VJ1A 2QU8A 1X7WB 4K0RA 4BQRA 3AH8A 5DM1A 4O2BA 2GJKA 4TS1A 1GQOA 2NX2A 3BQ9A 1A8IA 3LNCA 4FI3C 4TZ6A 3URKA 2HMVA 3G7UA 2OTCA 3U4MA 3DQPA 1UXIA 3IAM6 4ZMRA 4DMMA 3FOAA 1Z5UA 2X2FA 3JQAD 3PNMA 4I9HA 5CH5A 5BN3B 2BFEB 3C6BA 1A27A 4HWOA 3QBDA 1BJRE 4K1XA 2X8AA 3CWCA 2OZEA 4S12A 3O6VA 3K6SA 2R9VA 3INYA 4DCVA 4MW1A 1KY2A 2P1DA 4RZ3A 1FJGB 1V16B 1XKXA 5BURA 1PR2A 3ICEA 5LDGA 1M1UA 2D54A 3QWIA 1DAGA 5KOIA 2Y68A 5EEGA 4BZZA 1VLVA 2QDKA 3JAKA 3T5GA 1G2QA 3DVSX 3KT8A 5J4LA 4TKVB 3EW9A 4Y1FA 3UMYA 4MK4A 1DCTA 3EFOB 5DHPA 1EX6A 1IB6A 1YS2X 3JASB 4QEZA 2L19A 3CIOA 3PU6A 2ID7A 4E0BA 2HJGA 2B8WA 3QNUA 3UANA 3VPSA 2QUBA 2V0CA 2A0UA 2EX0A 4PZAA 1NQUA 1R0SA 4Z5XA 1M8KA 1JSCA 3UICA 2UAGA 3L5KA 3NBZC 1CP3A 4C21A 4M38A 4UQPA 1JTEA 3E1KA 3LQKA 5F1KA 5A6SA 4H35A 1N6NA 3T4EA 5AVSA 1SKBA 3AO0B 1CERA 3WGMA 1XGKA 2W8BA 5I7OA 2VJMB 2Y0CA 1I01A 2VCEA 3GEDA 4LJ9A 5BSUA 4ON9A 3THYA 2WD7B 8AT1A 1OLXB 2AK3A 2C42A 2QM3A 3TW0A 4JYMA 1IXKA 2OWEA 3OCYA 4QAQA 2F4VB 4B2LA 4E2FA 1RZRA 3D7SA 1FFXB 1GGMA 2QMHA 3GAZA 3LRPA 3RC9A 2BM8A 4PZDA 4CKWB 2ECPA 2QYSA 4KMSA 1EB9A 1I4TD 3WE7A 3ZDYB 1A82A 2NXWA 3PXGA 1YJBA 3STHA 4L73A 4LV5B 3KSZO 6AT1A 1F6WA 5DF1A 3BEDA 4JYPA 4LE2A 1NMQA 2QN6A 4AJNA 3ZZ1A 2COEA 5T8KC 3T1HB 1NJ6A 4KXUA 2FSFA 4F9TA 1E2FA 2FRDC 4AMZA 1UK9A 1SXGA 2CHVA 3UPUA 4IHAA 3TI9A 4DXHA 4EH1A 2AF4C 3AGPA 3LT4A 1OU0A 4MDHA 5DI3A 4X91A 2RE8A 3M9WA 3HDVA 2WFAA 3D7MA 2I9PA 1E2NA 4LCBA 4DLBA 4UAGA 4CCSA 3EAQA 2GBLA 4YACA 1UKEA 4LBWA 4BGVA 1AKNA 2Q6TA 4L16A 2FB9A 3TQOA 4AT1A 4DCOA 2QTZA 5CA0B 5CLQA 3D8NA 2BJWA 4HZGA 2JEZA 3H2KA 3SVZA 3TZLA 4WZBE 4BYMA 3LXUX 4IH9A 1JDJA 3ZGLA 1SG0A 1TAHA 3LLSA 4DDTA 5LZ9A 4XB2A 4H6VA 4HDAA 3DH0A 3NH9A 4GOND 3D6AA 4FFDA 1ZSYA 2HSEA 3LY8A 4MULA 2Q0QA 3H0EA 5ERXA 4DRYA 2PSEA 1QLWA 4MI1A 4B31A 1EHCA 5E7MA 3DD5A 3FPHA 5IDVA 2XAAA 3D5EA 1LNZA 4BDSA 5F9FA 1ABEA 1PUJA 3A1DA 3AFMA 1C2TA 3GGDA 3FBGA 5G41A 1YCFA 2XBUA 4K87A 5GMOA 5L95A 3ILHA 4C30A 4DCMA 5BXQC 2ZIGA 3NWJA 3QE2A 4MVJA 2DKNA 1L4FA 2JRLA 2HC9A 1BX3A 2C2BA 4NMLA 3WLPA 1KWGA 3IAAA 4UEQA 3BCUA 1RI2A 3QXJA 4XRRA 2IUEA 3OM9A 1APBA 1KNQA 3Q8MA 3U40A 1AS2A 1N9KA 1PGQA 2B8TA 2VJPA 3FNHA 4H1VA 4H1UA 4Z8XA 1EQUA 1OX6A 1QDLB 5EUMA 4ZCSA 3REOA 4DIKA 5DLPA 3ELYA 4UHCA 5D3ZA 2XNSA 5EESA 2XXJA 2Z2XA 3QQ5A 5ES3A 1HETA 2DJ5A 4YJHA 1EKXA 1T1IA 3J80A 3BA6A 2H07A 5EP3A 2XT0A 1EJBA 2I2XB 4A8JC 3GOHA 4YP7A 5TEWA 2CXOA 3HV2A 3UA3A 5ITSA 3GBSA 4KI7A 1XWFA 3IVGA 2GXAA 2IYVA 5JSUA 5IH7A 3L8EA 2AR0A 2OFPA 3KD3A 1QYWA 1DAKA 3B9RA 1GPDG 1VIDA 1R4NB 3I2KA 3QMPA 4I81A 5CMLA 4KKVA 1KSFX 2Z8YM 2X9NA 3HYTA 1ADFA 4MR9B 5COBA 3TZBA 1FRFS 4AYXA 5HZMA 2PL9A 2ZJ1A 1J06A 2IYNA 2QMQA 1YI8A 4IEEA 4JSRA 4R81A 5FOWA 3FYHA 4DLXA 2QY9A 5FQNA 1PKEA 4PN3A 4YLGA 2A4KA 1W49A 1FW8A 5TNXA 1KYTA 3W04A 1R64A 4O4JB 3L04A 4B82A 4OK6A 1IIBA 2I71A 1Z29A 4DUPA 4X71A 3E5NA 1T35A 2DFPA 4O25A 4G0MA 4XLTA 3VFDA 1N32B 5CLLA 5BUQA 1KHTA 4C5AA 2XQKA 3FZEA 4B6JA 4FHFA 4XDGA 9LDBA 2QEQA 3KTOA 1FJXA 2GXSA 3A28A 5FLYA 4O2LA 1H2FA 1M9NA 3NU1A 3PR2B 3T4XA 3EDMA 1CRPA 1RFLA 3GOQA 3U3OA 3IQXA 3MMPA 3HSKA 3IT1A 4KMMA 4R2IA 1M66A 3O3MB 1TPYA 3FNGA 4RZQA 4KWTA 3R5SA 4WZZA 3KZOA 3LYAA 3VPXA 5FBVB 1VMDA 1EDEA 1DIBA 3I4LA 5BV7A 1CB0A 2Q4DA 4J0FA 4A8PA 5K8CA 4UUBA 1ODSA 1NPTO 5JFGA 4PZPA 4NNPA 4NCBA 4UMEA 2QGNA 4EUFA 4WZAE 5KO2A 4M0PA 2QP9X 3HJTA 2B4QA 3IAFA 4BPRA 1VLJA 1PJQA 2CB9A 4ODIA 4PWZA 2FGKA 3CVWA 3KSUA 3SJAA 4OBEA 3E61A 4Q3DA 5JJBA 4ZTUB 4NYJR 1GUZA 2D5LA 4AJ2A 1Q0PA 4PSAA 1J2RA 4IZIA 1QRSA 4HPJB 3VYTB 1PR4A 5IABA 4JLDA 2FUKA 5K3BA 2EQ5A 1H69A 2A78A 5E0KB 3RO7A 4CWAA 4MDEA 2JGJA 4BNJA 4RHYA 5C1BA 4XXHA 3HJGA 3R5KA 1NG9A 4HWKA 4X7BA 1PJ2A 1T0HB 4DSZA 2WFLA 3A6GA 1J9EA 1J8MF 2IYXA 1P2GA 1TO1E 3ZCTA 1J8FA 1UM9A 2ZJ5A 3B9BA 1AKMA 4JQCA 5DSTA 1UC9A 4CIBA 1VMAA 1XA0A 4PS0A 5H0IA 3P9YA 1KBZA 3E81A 1YSCA 3VNRA 4OQLA 1OYOA 2IF0A 4YCMA 1AK2A 4G86A 4GR5A 4HXEB 1ZZEA 3BD6A 3M6XA 1AK1A 5C81A 4MWSA 1Z17A 3TQRA 3CX4A 3W1EA 1R6AA 5EI5A 4YCLA 1QHFA 1YCHA 5D86A 3DP7A 5DI9A 4F06A 3BWXA 2ZJ3A 1T9GS 5KB3A 4XWWA 4M9UA 5KYUB 2R47A 4KSYA 3FTEA 1QVZA 3WLSA 5DB4A 4TYYA 3KWMA 2ADOA 1J8QA 3O2SB 1PT7A 4L6AA 4GL2A 6GPBA 5KTNA 2XB2A 3QF4A 2FRVA 4AN1A 3COPA 1U8ZA 2YFQA 3KSDO 4X6UA 3RFVA 3C5HA 2J6HA 1MVLA 4HK4A 5DGDA 3R7BA 5ERYA 1H05A 2D5AA 3PFBA 5I5GA 1A9OA 5CTJA 4Q1FA 1RW4A 3MJSA 5ILQA 1XVIA 1MX5A 2BEWA 2GD0A 3BXXA 1GU1A 1PN3A 4C9BA 4F2HA 2WWTA 2RDMA 4FDUA 2P8JA 2Z09A 3Q15C 4PONA 3RRBA 4DE5A 4ZAXA 4G26A 3TXXA 5DCYA 3BXHA 4WWHA 4ZOAA 4DRXA 4TKUA 1WHSB 2FZEA 4WNIA 3TTTA 2O0KA 4F9GA 1SCDA 1TTPB 1OI4A 2QMOA 2R96A 3IJPA 1H6DA 1RBQA 4XJTA 3R9KA 1ZY2A 4AU1A 4AKIA 5E6UB 5U4QA 4DMKA 3JQEA 1QGUA 5HKLA 3HZOA 3NW9A 3DOCA 4G23A 3KX2A 4TN5A 5AKIA 3ELWA 2FEPA 4X64B 3K6RA 2PUDA 4F4FA 3N7AA 2YUIA 5CITA 4H0FA 1ZVMA 1EK0A 2CYAA 2QSUA 2X8WA 4X1YB 3VO9A 4AD8A 5C80A 5LQKA 4WY2A 1TEHA 2FFBA 4XIGS 4GMDA 4DSOA 2AJBA 4NJMB 2DHDA 1ZK1A 3ER6A 5K45A 1T8PA 5T5QA 1UBSB 2A7XA 2XMDA 5FWAA 5D87A 2NVOA 3CE6A 3M0EA 3OF3A 4QUGA 1SVWA 3RI3A 3BGVA 1ZU5A 4GNRA 3RBVA 5CVDA 4C87A 5KHAA 3IQZA 1QRUA 1Y8AA 2R97A 2ZUEA 1E3MA 1MR3F 4RWZA 2Q3BA 5K3SA 1A9XA 1BS9A 3QEKA 1VCNA 2JLVA 1PL8A 4JZKA 3KYCB 5I01A 2AN1A 2XGGA 3VPDA 4LF5B 2CNDA 2YCLA 4WLFA 1H8HA 1WDMA 1K89A 2ZYRA 5HOQA 1RTKA 2JEOA 2WKQA 3ISTA 4AJPA 5JJ5A 5ICSA 1GTMA 5KVCA 4JI0B 2ZTMA 1O1YA 1XZLA 4FJ0A 5FEUA 4HX9A 1SC6A 1KNXA 4ZYWA 5CCBA 1OYYA 4W8HA 1U90A 4FHEA 1NUHA 4YRBA 2GOYA 5IF9A 2C04A 3AOEC 3N2KA 2M6SA 2YHIA 3ZGOA 2BH9A 3G02A 4EHLA 4CU5A 4UOEA 1DB3A 2C4MA 5JSZB 1J24A 1G20B 3V1MA 3ZDXB 3PXXA 4J3JA 2HSJA 4LQDA 3BT7A 3GF4A 1RJFA 2JLUA 3EXHC 2GAAA 3ZHRA 5ALYA 5KYTA 2RGNC 1TUEA 2ZTUA 2V98A 1CIJA 2PFGA 1EEXB 4K9PA 2AT1A 3KXKA 1N0UA 4F3YA 3OT1B 5DGCA 4ZCIA 2D7DA 1N2CB 2WDPA 2RHLA 4XYMA 2AXEA 2ST1A 2FV8A 1HA3A 3SWWA 1NJSA 2O4CA 3HFGA 1BZYA 3QVSA 3OZDA 2PSDA 5AKJA 5DV9A 3ZGNA 5B5SA 2ZIXA 2DY1A 1A8QA 4OL9A 5EIXA 2IHKA 4DNPA 1ZD8A 4XVQA 4IUCS 2IPNA 5E9WA 5T4EA 4YCSA 3F71A 3ISJA 3ECSA 4FBGA 2BHNA 1KFBB 5TQ2A 2CNOA 4DBVO 1E9VA 2Q8QA 2PU5A 4ATNA 4Z4QA 2ALJA 1S01A 4ND7A 1NW5A 1CUVA 3AETB 3N8GA 4W6QA 1BDMA 1GA6A 3HB9A 4YJFA 4Z99A 5AXCA 5FYDA 5B58T 5BR8B 2B1GA 3UYLA 1UDRA 4GI1A 3BHMA 3ZXIA 2I29A 4IXMA 3LM8A 4G0YA 4FP9A 1YCGA 5AHOA 2QIOA 2XTMA 1TLFA 4IIJA 1GV0A 4EJSA 2GKSA 2LPMA 4N54A 5H9VA 4OJTA 3R0ZA 4BFWA 4GR9A 3R1IA 1NBOA 1Z22A 2H08A 2ASEA 2IL1A 2P9JA 3A3KA 4OSOA 1EFPA 5HQJA 3WWOA 3WYEA 3WQBA 3ZV5A 5CH8A 3I6IA 1FQWA 5FULA 1Z6AA 2YZ2A 3PHCA 3TOZA 3QTBA 3VISA 4FFWA 3FPJA 1GNPA 3KAJA 4NHOA 4GI2A 2QL6A 5C4IA 2IPXA 1FX1A 1P7PA 1WU8A 4UTXA 5ITWA 3ASZA 3VOBA 2R6R1 5B3LA 4RADA 3HKCB 4IWXA 3JX9A 3OOWA 3DXFA 5DYNA 1U2QA 3NTOA 1TM5E 4EI2A 3H2IA 2VKQA 3P19A 3Q5EA 2G1KA 1DTWA 3R0QA 4XX0B 5JEDA 1Z0AA 5DO9A 2KM1A 2FSSA 4CIWA 4ZIRB 1QTNA 1JTVA 1L2TA 4MV9A 4NFHA 1ODTC 1S4QA 4UNQA 3AU8A 3HN2A 4P7BA 4WOJA 1JU3A 1NZDA 5AUPB 1K88A 1WLSA 5I48A 3DGEC 3KKQA 3KOZA 4B32A 2W6PA 3O94A 2X7XA 4TL6A 2FN3A 5F5NA 1DOAA 3WDMA 1XCPA 2WHRA 5FV7A 4D4GA 1JIXA 2BRUA 2PWYA 4CLXA 2G4LA 3KDAA 3ZUGA 1GCAA 4UE6A 4KV7A 1GSOA 3WGIA 3HKEB 2E87A 2PA0A 4QGSA 2RK3A 5TPZA 4O5OA 4XM2A 2NP6A 2ZIFA 2IUYA 4GX5A 1X19A 4GEKA 1V71A 3AVVA 2ANBA 1UF9A 3EVFA 4QNRA 4G9EA 4YEDA 2CXTA 2PYZA 3BHIA 2X19A 3NIDB 3WZLA 4ZVPA 4A82A 1DPGA 5BMOA 1GZ6A 3O5AA 4MTLA 3EZXA 3MOIA 4KR0A 4MGEA 4YO8A 4DQVA 3L4JA 1RSZA 4JJ7A 3GBVA 3ANNA 1XROA 4QO8A 3F3YA 4KQKA 3U9SA 4RXTA 4AJOA 4JSTA 1W88A 3PB3A 1VZ3A 5EPOA 3X44A 3ACCA 2IUUA 1WUYA 4MLPA 1EVYA 4DV4B 2H4HA 2J41A 1Q92A 3IUMA 4DWVA 4DUYB 3ADDA 1N33B 4PICA 1PYGA 4GBJA 3T41A 4BNVA 4RESA 4AO8A 1X3SA 5AM3A 3KCNA 1CR4A 1ODJA 1T1GA 2ZUCA 3GUYA 3G2NA 3I76A 4WVLA 5LZ8A 3UJ8A 3OPNA 4X66B 1WMDA 3T54A 4LDNA 1I5EA 2J4CA 3FB4A 5CG1A 2BC9A 1TK9A 4ZO7A 3T3OA 2HH9A 4ZZ2A 3K0EA 4CDNA 4K0KB 1RRMA 3MINA 2NYRA 5FYQA 3DD1A 3X1ZA 3ZCXA 1H9BA 2DQ4A 5E38A 3WI7A 4Q9LA 4P98A 4NE2A 4XDZA 4G1VA 1HUQA 3IP6A 1FCJA 1PQWA 1SG9A 1VYHA 1H85A 3VUFA 4QXOA 2IWHA 3C1TA 2A7QA 1RMYA 1VE1A 2JGNA 4KRYA 4URWR 2CJYA 3Q9LA 4Q7EA 2Y1DA 4AN4A 2J0SA 3IDFA 3G23A 4M0UA 5B1EA 2OCDA 4PSVA 3HA3A 2UYGA 2VZEA 3C3JA 4D26A 2CGEA 2CMFA 1SVKA 4W82A 2J0UB 2ZB7A 5BNTA 2VBIA 1CV2A 4F12A 4RDIA 1L7OA 5JO9A 5JV5A 4GOKA 1R0CA 3TNYA 5BOVA 3D7KA 1CQIB 4F5WA 4G89A 5C5DA 1ULHA 2Q1SA 3FTNA 1T4DA 5ALIA 1BS1A 1GKIA 1N5OX 1YJXA 2XH8A 3PXUA 4BE4A 2OZKA 3EYWA 4AQYB 2G1PA 4O8CA 5LZ7A 1CKEA 1RAEA 3CCFA 5JE8A 3G0HA 4FYWA 2PUHA 3FZYA 2F7SA 1JSXA 3G8BA 3L8HA 4PCLA 4DMGA 3QG1A 2AHRA 4FHGA 3O4GA 4Q4HB 3E15A 4MW9A 4K9OA 1O7JA 3HNPA 1JLKA 2GUWA 4L51A 2PQMA 4MV0A 1JAHA 4IDQA 3HP4A 4OBBA 4OKSA 4WKNA 3WLRA 3CV3A 3KZKA 3UMBA 2VL7A 3UV3A 3VZCA 3MCUA 1CVRA 4HLQB 3RVOA 1GRRA 3CZ9A 3R44A 1GYPA 2H9YA 2ZBGA 5FUQA 2H48A 2NUPA 5FWNA 5ALHA 5EZYB 4E7PA 1VG1A 3H0KA 4D4MA 1P5ZB 2DAPA 5DCLA 3HYNA 1JQJC 2LTAA 1BXGA 3E9QA 3PKJA 3IUQA 1ESEA 3WNVA 3H8JA 1WY7A 2PS0A 3Q7IA 1JLLA 2C3UA 1EFDN 3SLRA 1AKRA 3FKSA 3N0TA 5B53A 3GIWA 5HWSA 3RRJA 1ZOPA 5KNBH 1FX0B 1ZA2A 1ZSNA 1P5RA 3QXHA 1DZ3A 2CD9A 2ON6A 3PHBE 4PLZA 5CFPA 1FFBA 2WNSA 3GVIA 3OFKA 3R6DA 1DRUA 1Q0QA 2ZJ4A 3K0KA 3QKUA 2V97A 5ESDA 3ZBPA 5AVKA 2JNWA 1OASA 2MHCA 2P4QA 1Z2AA 3HG7A 1PR0A 1PFVA 1SZCA 5CLHA 1NDHA 3ZZUA 3GDWA 2Y1XA 1MCZA 1W29A 2XMSA 2FMKA 4RA9A 3ZGXA 2HIAA 4JOQA 1G98A 3VR3D 4FB4A 1ZCFA 2B9EA 1IATA 1RYZA 1V8FA 1G3MA 3BL5A 5FOUA 2UVPB 4YQEA 3DAOA 2YV1A 1RJGA 5JHHB 3QF7A 2JJ2A 1ZYUA 3NM5A 2EG5A 1Z0UA 3FSGA 2QM8A 2OGUA 4NABA 3DMPA 3P52A 3PNBA 5FOTA 1I6LA 3GJ4A 3MXOA 4J9VA 4XW2A 1QTIA 3QQPA 3WYAA 2F3UA 3BL6A 1RI5A 3C74A 1M6VA 2Y92A 3L3BA 4JEHA 4H2DA 3JZMA 3ZTTA 4JX8A 7MDHA 2WU4A 4HAIA 4RIHA 4KH1A 4YRLA 1HTTA 3ZQUA 2GJ8A 1XZNA 2P4EA 4DJFC 1G0NA 1CQWA 1DKLA 1E0SA 5KOHB 2EAUA 2X4DA 2IWRA 2B20A 1UK6A 3I2IA 4QNNA 1XK7A 4HH0A 4AP6A 1RYMA 4M49A 1ICEA 2ZT5A 3ICQB 1O97D 4W7HA 1ESDA 1X86B 2XE7A 4CMIA 4EI9A 4RKQA 4XB1A 3RQSA 4DA6A 1NVEA 2X5JO 4EFKA 3ZK7A 3VPAA 3ZWAA 3RD5A 1O6ZA 3VBEA 1SKAA 3PRYA 4B2IA 1W87A 4LSGA 4Q9IA 4B5KA 1XIVA 4RY2A 4I8IA 4ETNA 3OPYB 4YPVA 1SR8A 3AI3A 4RHEA 1S8NA 1F06A 1NRJB 3KV3O 4DA4A 2ZEJA 1DXOA 4Y1EA 4JIMA 4PXSA 3AWIA 4HAYA 5AICA 3GRUA 4YREA 1C5KA 2FEAA 3H75A 4N7MA 1J42A 4J1NA 2CDRA 5CVCA 4ZO4A 5D5PA 4BLSA 1WX1A 5BSGA 2PMWB 3PYXA 4E07A 3TLAA 2HCBA 3DCIA 3LG2A 1FNCA 1JG7A 4XJSA 5FTMA 1VCIA 2OLJA 3PWKA 5D7BA 4HTFB 5GY7A 3QOYA 2AUMA 1ZWLA 4AMGA 2GDZA 3LYHA 1OI3A 3QVUA 2QTMA 3AKEA 4EABA 4G85A 1PR6A 5KX5F 1B15A 1ORIA 1ULSA 1I33A 3UGQA 5M2QA 1VIMA 3BIJA 3VZPA 4A1FA 4EATA 4B3BA 2YWHA 4JHXA 4MDFA 1ZVKA 3GQBB 3AVWA 4NXMB 1IQ0A 1IJBA 3V4VB 3LGSA 4IV8A 4YT4A 1TYBE 3PCRB 4L3WA 1IY9A 1XNHA 4KCGA 4IKOA 5EFZA 1KI4A 5LOVA 3H1TA 1ZXXA 4FW9A 4B9EA 4FNAA 2QSJA 2Z2JA 3OBBA 4YV2A 1RQ2A 4YRAA 3ENWA 4Z9AA 2FWPA 1GRCA 1VRCA 2YNMA 4BN5A 2PKEA 3TSAA 5DTEA 2WM3A 4D9CA 1TK3A 3T8YA 5BSMA 1RLOA 2PRKA 4URZR 5FWXA 1JDBC 1X1CA 1SWVA 4QTUB 5AW1A 3L8CA 3UJHA 4KV9A 1XTJA 3L6UA 1V7PC 3RRMA 4P93A 3QWHA 3C5CA 4US2R 1R4MB 1SO8A 4YPFA 1MXFA 1T5IA 3GROA 3IT2A 4YFYA 4F97A 3SQXA 3ACDA 1NYLA 2NU6A 3GGGA 3UKDA 2F8TA 1YB2A 4J2TA 1DT3A 4ZGBA 1G18A 1L5SA 3ORRA 1AGPA 2Q4TA 3Q3HA 1E89A 2DPGA 3BTUA 4FXPA 2FWAA 3JQCA 4I50A 4BL5A 3OPVA 2O8EB 1U0RA 2R6CA 1E3IA 4E1AA 3MTEA 1KAEA 3VPGA 2NMVA 1SKMA 2NVUB 2IHNA 1K4KA 2ZIUB 1K2VN 5HF9A 3W2FA 4JFRA 4DMHA 2BMEA 2BSQA 1BGXT 1MF7A 4CCAA 5BMVF 1SXPA 3P9QA 4RA6A 4D57A 4N8DA 2ZWPA 4UW9A 5EKUA 2P2ZA 3W6OA 3MTDA 1JA9A 4W1SA 4WUVA 2Z6UA 1IOLA 1KIAA 4IVPA 4J75A 1UOQA 3O91A 2YDXA 4FLMA 1P2DA 2N46A 3V1TC 1D8TA 2OESA 5E0OA 2B5VA 4L5YA 1IXZA 4N0DA 5JADA 3GHHA 4B3GA 2Y77A 3CW9A 3MB8A 3QVGB 1X39A 4IUBS 1MD9A 1C81A 1F1JA 2RHHA 4RXMA 4UTOA 4E14A 5IF3A 3IMFA 2V0NA 3WBFA 1WZCA 3B2NA 5T57A 1JT2A 4NL4H 4BX0A 3WHIA 1PI3A 4GC9A 3W7VA 4D5EA 5AUNB 1FE8A 4FLEA 1EQAA 5AW6A 3EX7C 4LYAA 2XTNA 4IHQA 4ILEA 1I7QB 2XBLA 4L8VA 4F60A 3OTQA 3PD0A 3U16A 4NCAA 1IY8A 4AQ7A 3F5SA 1YQEA 4G67A 5IJZA 1JQ3A 2AWNA 2VJNA 2XD9A 4BZQA 5H02A 4NXNB 1DCFA 2PLFA 5JCJD 2VH2A 4JY7A 3MJTA 1UWKA 3OLVA 3LWDA 5HS4A 5JRZA 2C3OA 1G5IA 1OR8A 2P6PA 1UPUA 4OLFA 3U44B 3SQLA 3LUKA 3ST7A 5JQGB 3RAGA 1ONBA 4FI3F 1DZIA 4J1QA 4TLAA 1WF6A 5KMGA 2QRGA 2CXSA 2E82A 2EBHX 3MTQA 4CQJA 2ZSEA 3A2MA 5HK9A 2A67A 4RTPA 4O2AF 1CZNA 1QTRA 2Y76A 4QU8A 1ZJJA 2B61A 5KEIA 1Z2PX 3P45A 4ZD6A 2BL4A 2P5SA 2R751 3MBKA 2O8BA 3DO8A 5I7FA 2O0LA 2RHOA 1L5YA 3RODA 1A7AA 4F3RA 1DG1G 2CCJA 1O57A 1CY4A 1Z7YA 1S02A 1V8ZA 4QBFA 4RPJA 5AW5A 4ZMBA 4KL8S 4V2UA 3PTAA 1XTZA 4LZLA 1NI3A 2NTYC 3LY7A 3WMRA 4DLTA 2C98A 3G3EA 3ONWA 2ATCA 5KHLB 1NWHA 2GHIA 2GLTA 2QTFA 3IKTA 3MWDB 4NMXB 3LW7A 4E03A 3OLWA 4EJSC 3NWBA 1ZGHA 4KOAA 1U4NA 4GPBA 5B7PA 3CLRC 5C1OA 2FN4A 4WLUA 1EVJA 4Q4JA 3NBQA 4PIPA 3NOQA 3ENNA 4YMUA 3OPQA 3F4BA 5EWJB 4IOKA 2CXQA 2F00A 4EG5A 4TXLA 1JVSA 1QG6A 2Z57A 4R1MA 5DM70 3DV0B 1II8B 3PX2A 1B73A 4TMTA 3Q7RA 1X9IA 1QH8A 1Z5VA 2DFLA 2IYAA 3IEVA 1CBUA 3GLUA 1P7VA 1XVAA 5SZJA 3OT5A 4ALNA 2HUPA 4BMXA 3FGNA 4OHUA 2Q7DA 4ACBA 3PLAE 3FNFA 4XIYA 6REQA 3T1QA 4OQXA 1KJ9A 3D5TA 5DHTA 2I03A 2X8LA 3PEFA 3RJMA 3PPXA 4ZHSA 5IXYA 4Q12A 5DN6D 4J0JA 4B4OA 1RJWA 1ZJ6A 3R6GA 4KN8A 4PTZA 4BATA 2RIRA 1ZW1A 2BT4A 4MTCA 3HXOA 1F1BA 3A2LA 3O4IA 1BVUA 1YQTA 4KSBA 5DWQA 3TM4A 2BRUC 1Y5IA 2JF0A 4GC5A 5AH0A 3DE7X 3KD2A 4Y2TA 3BG5A 2XXAB 2WJPA 2B2XA 1R6DA 1EWYA 1G55A 2W6ID 2Z43A 3CLUD 3QHAA 4R8LA 3IUSA 1XRRA 5EQJB 4FEGA 1BFKA 1P0CA 2CL5A 3GD5A 1HT1E 4HAOA 4MRSA 5KAPA 3REQB 3ZJ4A 4BYGA 4H17A 1Z0SA 1RWOA 2RBEA 3EHEA 4L8WB 4PG8A 4V0KA 1XQXA 2P2SA 1JKJA 5EXEA 3ICPA 1Z2NX 1BJKA 3TGWA 5IYZB 1V5IA 4YDRA 4I5GA 3MYYA 3OZRA 4QPCA 3OP4A 3THOA 4CKZA 1GR0A 4UMFA 1GT91 4FJ1A 1OZFA 5TQ0A 1DC3A 1JT9A 2DPXA 3QLVA 2X7JA 4FZVA 3QOFA 5L45A 4CKEA 5D1HA 1GAXA 1G4HA 2I80A 1HE2A 2AX3A 4Z2YA 3JD0A 4ZOLA 3NOOA 2OBMA 1IQRA 2BHLA 4UVEA 4ANFA 4EJ0A 2XNJA 2WWYA 1SEVA 4QPJC 2FPPA 1KJWA 3TCKA 1O6CA 4AS3A 4ZCRA 2HLHA 2NZ8A 2HWXA 4IS3A 1LY1A 3B5JA 4P3OA 1DE0A 4GXTA 4WNCA 3PRKE 2JFNA 4Q7MB 2WV9A 4FMCB 9ABPA 3S2EA 2PZKA 1YZFA 1K1EA 3BZUA 4TWJA 5DIFA 3DMHA 3W1VA 3SVLA 3O3CA 4CTNA 2E18A 2QL5A 4RTMA 4ENRA 2OILA 1ULBA 1DLIA 3BX1A 4PQRA 3KR1A 2K5UA 3QNMA 3QOXA 1U3DA 3CRZA 4Q3KA 1QNFA 2F62A 2LWIA 2X41A 2JGFA 1XMOB 4D8WA 4OBXA 5FUYA 1E5TA 3N53A 2CVOA 2QW0X 4N39A 2VPPA 3HMKA 5FNVF 4P54A 1T3SA 1JHMA 2REXB 1JG1A 1RAGA 2OGWA 2R6GA 1DELA 3NWPA 3P9PA 4NVRA 1LDMA 5JLAA 4WACA 1M34A 2CLKB 3BWCA 4JC5A 4E32A 4DDUA 3ZD7A 1L5NA 2NPIA 3G0DA 3KAQA 3I1JA 2VJBA 1QQ5A 3K05A 6LDHA 1OJ7A 3OG9A 5F4ZA 1AVTA 1QNLA 1R4ZA 2H11A 5EJIA 3R3YA 3VAZA 1O87A 2PX5A 1RYFA 5C7YA 1LEHA 1P77A 3V80A 3E3NA 1EAYA 5ICCA 2VTVA 4I4NA 1NBWB 2R11A 3KKMA 1XPOA 5F2EA 3I9NA 4L7VA 4O0MA 4EMTA 1AU9A 1G2OA 4K81B 4BLRA 2QX8A 4O33A 1QUEA 5KVQA 3ESAA 2HLNA 1IHYA 1GAWA 2QL9A 3GL9A 4NICA 1W25A 1GCIA 1YDHA 2OXEA 3GRAA 1YB1A 3VR5A 4AJ9A 2B1IA 4HNSA 4JA0A 5IHXA 3GFFA 3PQEA 4LJLA 1VXRA 4N8EA 2ZTSA 4E7OA 3HI4A 5EZ5A 4COOA 3PFWO 4MA0A 3QYJA 2GJ4A 3PR3A 4QPDA 1Q19A 2C57A 5JR3A 2NPOA 3GRPA 4L76A 3REFA 3SX0A 4BLVA 2R85A 1V47A 1PCXA 2EOAA 3W90A 2BZGA 2HBZA 3GG2A 3BIOA 2CDAA 4C78A 4W5QA 4X63A 3K9LA 2EP7A 1SWWA 2Q6KA 2QZ4A 2QZJA 3FUTA 4EW3A 3SSMA 1UMBA 1Q1AA 3BF8A 1ISPA 4OB7A 4QGFA 5E9QA 1B76A 5CVUA 1Y8QA 4MPTA 3GUZA 3F5FA 5HJ5A 3QLJA 4EUHA 3OAAA 2IK8A 3STVA 1QO7A 1PS8A 4YV1A 5C32A 3TW8B 4IO1A 4L02A 5AK4A 2X0RA 1TM2A 3PTLA 3UAWA 3TZHA 1JPUA 3ABSB 2HO5A 3LCCA 1ZLXA 1KA9H 1N34B 5BUSA 4BN0A 1UKBA 1FL9A 4RANA 2OP0A 2YXBA 2WMOB 1IVSA 4QGBA 2UUOA 3TSCA 4ASUD 4DTIA 1AQLA 1V3TA 3LC2O 4W5RA 4Q3LA 4KQ9A 3VRHA 4OFBA 4EVIA 3HH8A 3FJYA 3BH6A 1Q6ZA 4HP8A 5IFLA 2J31A 2A84A 1LLUA 3DYVA 1RM0A 1FRVA 3H9EO 4NBKA 3WGTA 4CDGA 4GGOA 5AWFC 1C9MA 2H4JA 3F6YA 1EFHA 1PBNA 1E1MA 3GLTA 3PF8A 2W2VA 4CR7A 3RKUA 2ZB8A 3M83A 1PYDA 3A32A 4HUQA 2ZR9A 2OV6A 3MCWA 4I55A 3BE5A 3EHDA 5TPWA 5ED0A 3SDBA 5F5LA 1MO4A 1E6CA 2J5XA 3CW8X 2X2OA 3L02A 1HFJA 3PWTA 2RHDA 4KNWA 2YASA 1KQ3A 4TZTA 3OIFA 2QPLA 2A92A 3TCNA 2ZM6B 3EGDA 1G7RA 2XLCA 3DBHA 5H5JA 2C7PA 1RR6A 4P5PA 1RWBA 1Y80A 4B71A 1XN4A 4TWBA 5EY5B 2AMYA 4JP5A 1NR7A 4Q1VA 1OU4A 4RD3A 2AZDA 2MYNA 1SUBA 1Q44A 4Q19A 2C0PA 4XSGA 5CNMA 3MMXA 1YIDA 1FUIA 4ITUA 3BDAA 1RMQA 3EWIA 5HPYB 3QEBZ 3K70B 2Z2KA 1D07A 2YVAA 3PX7A 3E5MA 3L0SA 4QO7A 2ZVJA 4BVBA 1JU4A 2KWIA 1E3DA 2AEFA 3L84A 1YS7A 2MSDB 4B7UA 2VHVA 1ENPA 4YQZA 4CEJA 2E0IA 3R40A 1UJMA 2QUIA 2XIJA 1PFYA 1QRDA 1XX6A 4KPFC 1DIAA 3CPHA 2RHBA 1EIZA 3A1FA 4FMDB 2Q7OE 4DV5B 3WHPA 1MB3A 1ZC3A 1NSTA 2OUKA 2PKQO 3L1VA 5HCUA 5GOTA 3RK1A 3WG9A 1R8YA 4NK4A 4PC1A 4GKVA 2AOUB 1IQUA 1G0OA 4HQFA 1W8IA 3N2ZB 4HV4A 5HNKA 2PUWA 1JQEA 2I33A 3LHFA 2XE6A 1ZNXA 1WUIS 3RNLA 1W5FA 5K8VA 1FSSA 2KQUA 4ARCA 1KDTA 4L5CA 4F04A 4F93B 1OFTA 1N2ZA 5EWMB 5YASA 4DAOA 2HDHA 5JS7A 1H22A 1PV1A 4B81A 4HZIA 3D7NA 5HIKA 1HNXB 2X42A 1XVTA 2ZKLA 1ZMBA 1XDZA 4P83A 2G82A 3A70A 4Y98A 3ZX4A 4TTRA 1C8VB 1T3HA 3ZEAA 3D1JA 3LKVA 1Z62A 1PT9A 4DDWA 5JXJA 3PRHA 1R00A 2BHTA 2H31A 3T1VA 5GV7A 2XCUA 1TQ4A 3ADKA 1K5PA 1U8YA 1PHPA 1ZK4A 2FEWB 4GKJB 5KYWB 4HLUA 3ABQB 3OETA 2E4XA 3IDOA 2EZ4A 1JAYA 2AUTA 3SDZA 3N2YA 3I37X 3JPYA 3K5HA 4YRFA 2O14A 1NJ1A 3OLXA 2B7CA 3LT0A 3RC8A 4B6QA 2NUAA 3VQTA 1P62B 4HRYA 4NY1A 1HTBA 4NCHA 4OQEA 2VHYA 5GONB 2V4UA 4IDPA 1KZ6A 5TIIA 1Y7PA 2X5XA 3WGUA 1ZG3A 1S9DA 1TO6A 3VR1A 1QS0A 1O5OA 1KYWA 1L7EA 2KBEA 1P9OA 1XZDA 1YH3A 3PF9A 4K6OA 2COUA 3C5WP 3HL4A 1CQZA 1D2RA 3KJFA 4QRIA 4V0LA 5AI6A 521PA 5BW5A 2YRXA 4J0HA 3N5CA 2C2GA 3T9DA 3QMMA 4MA5A 1GG2A 2O1XA 1Q12A 2OVFA 2IUSA 2QLNA 4KLNA 4GVLA 3WDLA 1W5AA 1C14A 4P3KA 2O1EA 2ZIVB 4KLZA 3A14A 1M75A 2DY0A 3VU1A 5H4GA 3HO6A 3GFOA 3SQDA 4BZWA 4UM5A 2JK1A 4KN6A 4LYJA 3QYAA 3O1LA 3UPDA 2H7CA 4B8YA 2F3PA 1UH5A 2R6FA 2WWFA 2PXHA 2EFCB 4O2BF 1TD9A 3QE9Y 3DE4X 3CH6A 4KQIA 1U1EA 1M1XB 1WR8A 2VTEA 1G8JA 3OJXA 4QHYA 3GNTA 3D3WA 2JA2A 1S7GA 4MYCA 4R8VA 5DBIA 1FDIA 3ITKA 2GPBA 3IP3A 2CL7X 3VH1A 4BMCA 4DJJA 3TAHA 2OCBA 4Q47A 2IOYA 1E1RA 4UEJA 2RKBA 4M8LA 4WJZA 4A3SA 4CLDA 5LMUB 1UZUA 1ZD1A 3CUYA 2J3LA 2EZUA 4H7DA 1F8XA 6Q21A 5EMNA 1OLSA 1IJFA 2O2IA 3A3YA 2EXXA 4JVNA 1PGNA 2VF2A 2ZYAA 2HXSA 2ZCVA 3HCEA 1HL3A 4PAQA 5IXSA 3KYIB 3LZDA 3G49A 3B6IA 1OXXK 2ZPAA 4D44A 4A15A 4K86A 2EFHB 2IZ7A 1QFJA 4AZWA 1U9JA 3PQFA 1MW8X 2ZRQA 1NQWA 3OKCA 1Z6XA 3U48A 1IHOA 2X4LA 4O4IB 3KIPA 3NVDA 2P6OA 3ENVA 1G5RA 1G60A 3GP3A 3JD3A 4F4HA 2PZ8A 4F2DA 2KPOA 2ENWA 2IYUA 1ADGA 5EJ6A 3QV2A 3TLGA 3UMVA 3FPLA 1O08A 2H1RA 4YCBA 3SAJA 4MPPA 3TINA 2OQ2A 5IANA 1YUBA 2AKYA 1FSFA 1Z2CA 4QU0A 2AI3A 3OPYI 3TLXA 2YV4A 2WVJA 1D6SA 5T4HA 1G59A 2G40A 2W2KA 2YZ7A 3QG5A 4AZVA 4B7ZA 4XUEA 2JHGA 5DLQC 1T9BA 3RS8A 2RHRA 2ANCA 4M2LA 3SZ3A 1I3OA 4F91B 2CB0A 2EJTA 3AXTA 4KXWA 5A02A 5LYJB 1SPBS 1GU0A 1UXKA 1ILWA 1CRZA 4LJRA 4AUKA 3K0FA 1DAHA 1FDOA 1ESCA 4CT4B 4DCPA 3GLSA 1YQDA 3LE8A 3R24A 5ALEA 1CEXA 3GVPA 1L5ZA 5DK4A 3UT5A 1A8SA 3HJUA 3M4NA 4ZOBA 1J99A 3GJ7A 1U80A 1YOBA 3HRHA 1O94D 3K0AB 5A3RA 3UJ7A 2B2NA 3CR7A 2C4NA 2COKA 2ZJ8A 5ERGB 1VLQA 4P5EA 3SKXA 2IHUA 2LCQA 4ARBA 3W8DA 3HO1A 2HK7A 5EKSA 4YTEA 2JH8A 3ROGA 2XWQA 2Q3FA 3EZYA 3HB1A 1CJMA 1BYUA 4NDNE 1YVEI 1S2MA 4YALA 3SC2B 1IN5A 3FPFA 2X4IA 3AVYA 2YWXA 3WLLA 3FRIA 2ZZKA 4QREA 3DVLA 1F51E 1FVHA 2EGGA 4WFJA 4Y6GB 3N8KA 5DVZA 5EEHA 5I9MA 3W2IA 3EQZA 3I9V1 3RIMA 1R74A 2CVPA 5JWOA 6CHYA 4EUNA 3I6QA 1L0BA 4LDJA 4DLYA 4TLEA 2VT2A 2XGOA 2E48A 3KETA 3QLVC 1OWMA 4BBJA 1T9DA 1QG2A 3WV4A 4CM9D 3WK6A 3VNAA 4DOMA 3PE4A 1X0XA 2PMCA 2IZ5A 3Q40A 1JIUA 3MBIA 4YAGA 4HXYA 5K99A 1A8UA 3A6JA 1I7NA 1Z18A 1XP5A 3AR9A 3NASA 2ZKIA 3PLNA 3R09A 2PT9A 3IVCA 4YFVA 1ULAA 1YB5A 3ENKA 4U1RA 1QU3A 4MVJF 1UKCA 3LDFA 4R2KA 1TIBA 2B4AA 1HE8B 1FU8A 3P9NA 2ZVPX 5BQOA 3TE6A 3OZWA 3R0VA 3TVTA 1R15A 3SF0A 3LUFA 3L93A 3PUYA 1L5RA 2FQYA 1PV4A 2JI4A 1HE5A 1WMEA 3FDJA 1LNSA 4NU0A 4ZC1A 3NANA 3GNSA 1U8UA 4EHNA 4CLOA 1NBMD 1PF7E 1PSWA 3CHYA 3OKPA 4QOEA 4RCYA 5HFAA 5IDYA 3RJTA 3TEJA 3VHLB 4IX1A 1ZGAA 1Q17A 2C0CA 3FWYA 1ZMTA 3Q8WA 3NIBA 2MMCA 3VUEA 2IHJA 3JV7A 3MBOA 5U1PA 4DXAA 1AZLA 1IOZA 2I6GA 5KKNB 5MGNA 2D8MA 1F14A 1LU9A 2XB6A 4AKEA 1HLFA 1K9SA 1CUIA 4IFTA 3ZIAD 4X6XA 4DR1B 1D5CA 1R7RA 1ZCAA 2D1FA 3GCWA 1G2PA 2ZT8A 4ZRMA 3RVBA 4PRZA 1O6BA 1ZD4A 3RUAA 1SHZA 1VC2A 1FDWA 2VJAA 3ZD8A 2EC5A 2E2WA 3LQYA 4B6SA 4TL7A 1O8CA 1MQ8B 3UOAB 2D2EA 2P30A 3CFYA 1SKYB 2GETA 3EFBA 4M7OA 5ALNA 3KJEA 2NQ2C 1MNQA 3LKDA 4OMCA 4WH0A 1MX9A 2EWWA 1NY6A 1QVVA 3DDHA 1XZMA 1BE6A 1TJ5A 1ZGGA 3TW6A 2QUAA 4EGFA 2K2QB 3MCTA 5BWNA 3HJAA 4HNUA 4AY3A 1AGYA 2PCJA 1FP1D 1PFGA 2HU8A 3KRTA 1PDVA 2AD1A 1A5TA 2L69A 2O52A 3A9WA 4QJ4A 1Y4AE 3NHRA 3SJUA 5A4FS 2W48A 4C03A 1C50A 1XCOA 2W5UA 1BQ3A 1RAFA 2EKQA 3D0RA 1B0PA 4D25A 1W96A 3FUXA 2R7KA 1MJGM 4D82A 3LRTA 3QITA 2ECKA 2IHVA 3HXKA 3GLHA 3NRCA 4C6HA 1EFVA 2NVBA 3ZV3A 5HUHA 4DTCA 3RHSA 4QYIB 4U6NA 4HMQA 3EXG1 4ZYZA 1AA6A 3JARA 1FQOA 5EN4A 3G1UA 3NZEA 4LHWA 3LVFO 2BP7A 3B3QA 1NN0A 1S3GA 3WWPA 3WKEA 2DWCA 2Q5JA 3DEAA 2X3YA 3D6MA 3CTMA 3UB3A 1C30B 3T12A 1HOXA 2PSFA 3P2YA 5F21A 5IJ9A 2V5AA 4RK5A 3R5FA 1U5BB 1W59A 3AUUA 4II7A 2QMEA 4JL6A 1VHTA 3NXKA 3UCEA 1U8CB 4IOLA 1UC8A 1T2CA 4I6JA 1T24A 4TKLA 3MJEA 3USZA 3ZD9A 5DNYB 1P1FA 4P4SA 4RTQA 1NASA 4QTZA 5ALDA 4BV8A 2HRQA 3DMDA 5DNWA 2QVXX 3X2EA 3DOHA 3CVOA 2D6FA 1KO4A 1M34E 3DQZA 1JHRA 3PDWA 4XPIA 3WYGA 5I4IA 5KYYB 2O3QA 2OBYA 1AZWA 2OENG 3L6DA 3WICA 4OGLA 4FYXA 4MS1A 1OTYA 1NF3A 1U7ZA 2WINI 2WUVA 2X6RA 1D0IA 3G17A 1AS0A 3HXPA 2X8JA 1CIPA 2IIBA 3ANYB 5CPBA 3WGYA 4D74A 2QTAA 2ORYA 1OILA 5BO5A 1SHLA 1E6LA 1YASA 3CN7A 5AI5A 1QWOA 3LFTA 5B1YA 4M9CA 4YP9A 1FUYB 1XMPA 1YQWA 2PH5A 2IEIA 2PH1A 2VQ3A 3F4KA 3U49A 3UH0A 3H9QA 2CYBA 3RVDA 2Y4OA 2GJ9A 5JYBA 1ZVQA 1QH9A 2H5JA 1KRXA 3W7BA 4D9HA 1FDVA 2AGVA 1UJNA 1EP9A 1GIAA 1VA5A 2AJTA 2HFKA 1XN1A 2OWDA 3ZH9B 1Z08A 4TWAA 2P9HA 5AKEA 3TIVA 4Z49A 3BH0A 3E7FA 2PVCA 1O5TA 2XODA 2H0AA 5F3WB 2JRCA 1CUCA 2EEPA 2F1OA 4QBKA 4Q37A 3AI2A 4HAXA 2B5OA 2ZW9A 4Q3NA 4XYBA 3DWEX 3CNBA 3T3HA 4LC9A 4O4LB 5E1DA 2ORED 3BVPA 3K9CA 3M34A 5CT6A 5FBZA 4AECA 3CX6A 4X92A 3IIMA 1LKZA 2CLCX 4ZEMA 4WA7A 1D04A 1AK9A 1SN7A 3IERA 5K8UA 2P9GA 4FHCA 2GK4A 3A1SA 3FVTA 3V2GA 4IIGA 1PS0A 1ZL0A 2HA7A 1G1MA 3PEUA 5F2OA 3BD8A 1XTIA 4XD7D 3IULA 3KXPA 5B30A 3THXA 3I72A 2D3WA 1GPUA 1KI1A 2EJWA 1Q15A 3M5WA 5ARBA 3VDQA 1G20E 4TS4A 1T34A 2DWQA 2HD4A 4XEUA 4IIXA 4RKEA 2BI8A 1GA4A 3HBMA 5C8YB 4IIEA 3UY4A 1C4OA 4Q1CA 1VRVA 4CF6A 2H1IA 2ZR8A 5K2OA 3BE6A 3JVIA 3K70D 5LQSA 3ZXSA 2Q0SA 4L2IB 2YCBA 1A77A 2FWRA 3U4IA 3OF5A 3QSYA 2GO1A 4J3FA 1KMCA 3K9NA 1PEAA 4HNAA 4X3PA 3VHXB 4RW0A 1XELA 2YN4A 4RLFA 2CLEB 1H1TA 4FHZA 3PHHA 3EWSA 1YJQA 1XF9A 3C48A 3ZK9A 4MV7A 1AGXA 1GTG1 1OPRA 4M86A 4EY8A 3FVRA 3OE4A 5AXAA 2JGKA 4BJ6A 1OXVA 2YYYA 1X7HA 4HLUC 4K9RA 5AUQA 3IV9A 3MGAA 3AX6A 3AV3A 3FLBA 3JATB 1L6IA 1AQJA 2FVYA 2QG6A 5CAEA 1QPZA 1VKOA 4S1OA 1GHTA 5EIEA 3JR7A 2AX4A 1HG0A 3N3BC 4PAWA 3AHEA 2P9FA 3W78A 4Y2JA 4WESB 5GINE 2ZZNA 3JQDA 1DBSA 3O9MA 1PU2A 1T36B 4IHJB 2WMDA 3BGDA 4JYBA 4U5XA 3W7AA 1X6VA 1L1RA 1I8TA 2R1TA 3O3NB 2QQGA 1XDGA 3KAKA 3OIDA 4GWLA 3D7LA 4Q15A 3P8ZA 3RYCB 2X15A 1DBVO 4I9NA 4K03A 4M9QA 3NHFA 1BDHA 3H17A 5K3CA 3RV3A 2XTJA 3ZWPA 4AG5A 1BWSA 4TX1A 4BBPA 3DHWC 3HCWA 1G19A 2IHTA 2AN4A 1B2RA 1ZJ4A 2RC6A 5EHQA 4RULA 3GPDG 4ESOA 3ZCVA 1UMDA 2NOAA 2XUAA 4HDQB 3DXZA 3U4AA 3PGKA 3ICOA 1CC1S 3VAAA 4LTNA 1QX3A 1HK7A 2QGZA 2OGTA 3DAGA 2ZANA 3OIYA 2OXFA 1V2GA 3R3SA 5B7NA 1JFVA 4FFOA 3UXYA 2ZS9A 2NTNA 1T3LA 3B13B 5E9AA 2QDXA 1Z83A 4RVCA 4A4DA 3ERCA 1N8TA 2JGDB 3QFFA 4FEAA 3VC2A 2PPLA 2I6XA 3LBAA 3KOUA 3O74A 4F92B 3VZQA 1NBAA 1Z5NA 1L6RA 1QBGA 4Z8YA 1BX0A 1UT8A 3H5IA 4MSUA 2PWZA 2G5PA 4YCNA 4B3TB 2YV2A 1LCIA 2NZXA 4M1EA 4DLAA 5H8WA 1LDGA 4RPLA 4FOPA 4KW7A 1YRYE 3PFHA 5F5XA 1MEOA 3UMSA 5L4LA 2IDJA 3C7KA 4JA2A 4C2AA 2C78A 4BTEA 2D0DA 4KNVA 5C5CA 2ZPUA 1B2LA 3LW8A 3O8OB 1LSSA 4A2CA 2WJYA 1CEQA 1PQ4A 3IVRA 2YMPA 1JWBB 1NKVA 3Q3GE 3W2EA 1RCUA 3DLPX 4B4VA 3DDOA 3SR4A 1UFQA 1RYNA 2ECFA 2H9AA 3KEMA 3O31A 1OIXA 4K05A 5LCXA 1GQQA 4QAJA 4EP1A 5JANA 3EZ9A 2R68A 4IIJF 4M54A 2NSYA 2OVBA 5TT1A 3SM9A 5KTPA 3RRXA 1TGYA 1DKRA 2W6ZA 1YIAA 3A7EA 4FXOA 5IC5A 4MMZB 2RHGB 3ZLUA 5MFZA 2BF7A 3OFND 4Q9NA 4NBUA 5GAJA 3W6UA 4CG3A 3RAEC 1EX7A 4PC6A 3TSYA 5ALFA 2GDJA 4FCWA 1CS0A 3M9LA 5T64A 5I45A 2QQ5A 4E6EA 4B2YA 1DJNA 1M2WA 2UV8A 4ZMSA 4LXIA 3DE0X 1DLJA 2NZJA 4IV5A 4UUQA 5KQLA 3EPKA 4ZKEA 1FFWA 1RI3A 5ALVA 3RSCA 3ZZNA 4PHTA 4BNGA 5CX1A 5LJIA 3RE1A 1NW3A 3RVKA 3ER9A 1E7MA 1C9YA 3U61B 1EWQA 1M2VA 4PQYA 5C1PA 2EKBA 2J9YB 4ZZ0A 2YZMA 4RL6A 3R3ZA 2HIHA 4Q18A 1ENZA 3CXRA 3KHSA 3SMQA 2HT6A 3RYHA 1AXEA 3PE6A 4DBZA 4LC1A 3ZE8A 4JU8A 1UEJA 1GPNA 3V8PA 3G0IA 1YNOA 5FA5A 1L4UA 3UH1A 2G5TA 3CJRA 3SJCA 2C7QA 3SHOA 4B3RB 1DEAA 4S24A 2XCSB 4KO8A 1EWTA 2QN8A 3IAM1 4K8RB 4J3NA 4ZT4A 5EFOA 3BREA 1UCFA 3ZIUA 3A36A 3U3ZA 1WBBA 1PNQA 3GDFA 1KEUA 5FPSA 1FDTA 2AZXA 2OD7A 4G4SO 2GYYA 4ZVKA 2PXAA 5K51A 4K9SA 5A03A 2HCTA 5AQ1A 3NX4A 1ORTA 4BRSA 2Q9CA 3C6MA 3T7RA 2UYOA 2ZK7A 3CEHA 4ZO8A 2H2AA 4DS3A 2ZYHA 3N87A 5KTMA 3IL2A 3B3JA 1KI8A 1OW3B 3KB1A 3N75A 4Q9AA 4MR8A 4GYYA 4HXFB 1G3RA 1IEQA 1CY0A 3A9SA 4QXQA 3RC2A 4MV8A 4F5YA 2CUNA 1Q74A 2OAP1 1LLQA 2BZ0A 2QLTA 4QBTA 4DCUA 2CJWB 3F3SA 1QIHA 2XUOA 1OE0A 2E1RA 2F1HA 3LBYA 4LY3A 4OQFA 1DTEA 4PBSA 4ZQBA 4DPLA 4H18A 4HEJA 1T15A 3HWWA 4WUTA 2RH8A 2WT4A 3HU1A 1J33A 4FZ5A 4M8NE 4UZFA 4C4OA 4OB6A 4CETA 1ZIYA 2QN7A 1QAOA 3MN1A 4JBLA 1Y81A 3DZBA 4B8WA 4ESHA 4OH1A 2WT9A 3ZU4A 4F4CA 3LHIA 1Y8RA 2BEUB 5K0EA 1UPAA 3ETJA 2JG3A 5DWVA 4QFMA 1Z4IA 4ZYXA 2IH2A 2BFBB 3OCVA 1BTOA 3EZFA 5TF0A 4CHGA 1AQNA 1T0JB 2CMHA 1VSQA 4QG3A 2C31A 3OH8A 2I6SA 2C9YA 5C35A 3VNVA 2JDID 2R7LA 4JOBA 4NH0A 4BUJA 2QRHA 4KYUA 4NPCA 5FBQB 2JCVA 1FRQA 3ROFA 5AOAA 3MLBA 5CVVA 3UK2A 1DS6A 1QHIA 5K01A 3DMNA 3C4JA 1LBSA 2E37A 4AG3A 2OD9A 4UPEA 3O8DA 3GLFA 4FFVA 1BQEA 2XYQA 4K46A 2H5IA 3N0XA 2JHAA 1EBFA 2CT8A 2C1ZA 2GAJA 3R9WA 4ETMA 3CRNA 3H11A 3K6KA 4I1VA 1R18A 2VDKB 2M98A 1E1DA 4M1QA 5ITZA 2QUJA 3FPBA 2DTDA 4G0NA 3D0KA 2WAMA 3WOVA 5C8XA 2VJYA 2HWUA 4K40A 4RZUA 2AR7A 2IP4A 4ZYUA 4H15A 5JXIA 4IXTA 3TUIC 4YXFA 3IA7A 3R9XA 1IWOA 2JJ8A 4HNVA 1MVOA 1Z8DA 2YWFA 1DBPA 3CBQA 3JY6A 3L7MA 4HQNA 4IYRA 3TRHA 3H2ZA 4BVJA 5ADUS 1E0JA 3MS4A 2YWJA 3HSSA 1UBJS 5D85A 5GP1A 3RAFC 4IOMA 3DVAA 4ZZ1A 3F47A 4PY2A 5JNWA 1XBTA 5B4UA 3TMYA 2VR1A 4MLDA 2X0FA 3PTZA 5F35A 3L1HA 4XWOA 4V03A 3KYDB 2I67A 4MH0R 2INGX 1PK8A 4DM4A 4JWKA 3AKDA 4Y7DA 2KBFA 2ID4A 2HWWA 3J7TA 5E8JA 2C3MA 3F49S 3MUNA 1E5QA 1XFAA 4FFRA 1YDGA 3SS9X 3HRIA 1IZ7A 1XTRA 4DA7A 3WWDA 1NURA 1UBTS 2CF6A 2YZKA 2BPOA 1RWXA 5E7QA 3UJCA 3SYTA 4OBWA 1S8FA 1FBNA 1I2CA 1JDUA 3FZGA 4WNAA 1SULA 1BE8A 1P9RA 2IYRA 3PHLA 4MKRA 3L1UA 2QE6A 4PO8A 4ZO9A 3UHPA 3R7SA 3PNYA 2MWMA 2IY9A 4N9WA 4GOJA 3K96A 4OATA 4XAQA 3W0LB 4WA8A 3BBLA 3GJXC 4R8MA 1WV0A 4X8MA 2WJIA 5KDLA 4OJMX 4YB8A 1E4EA 1TJ4A 2GSDA 3MT7A 1E8DA 2WY2D 1WTCA 4F72A 4FFPA 3F5DA 3C3CA 3GK3A 4HQ0A 4B40A 1SD2A 4RH1A 3L6BA 2O2GA 4YONB 3N8HA 3RS0A 5IFKA 2QZ9A 3ZJ5A 2XXBA 5LP1A 1PK7A 2PGXA 1K0UA 2JLRA 4IUDS 2ZATA 2VRCA 1W2WB 2YVUA 3C15C 4QUHA 4NC9A 1D2HA 2I76A 1U9CA 1CLEA 1S8OA 1QGOA 2PQ6A 2VAXA 2JFQA 3BZBA 3IILA 4I9GA 4M9ZA 4FW8A 2QD3A 3AY3A 2G6TA 4LSMA 3GFTA 2NZVG 2UYQA 2MR5A 2F6RA 4UVDA 4R2MA 4XWGA 1MO2A 2PX0A 5K2MA 4D46A 2LIVA 4ZK2A 1V4VA 1Y0BA 1YE5A 2F3QA 2Q1YA 1UMCB 1PQYA 1RE1A 3B6EA 3UJBA 1WPXA 3D8UA 2JZNA 2LR0A 4MW5A 2YJ5A 5KNBD 5DYIA 2CK3D 3K3PA 5CEFA 1P4JA 2O8NA 1BD3A 3PNPA 3ZWCA 2H1OA 3KVRA 4XASA 1EDOA 3MT8A 1G2IA 1OOEA 3S7ZA 4E5KA 4AM8A 1N75A 1UWVA 3H5AA 3H5WA 1MDFA 1ZFNA 2Z95A 1DQNA 3HLKA 5DYGA 5C7IO 3M6LA 1BKDR 4YLYA 4GKAA 1QF7A 2K87A 2XE4A 4XOUA 1K86A 2WJAA 4KTTE 5T6BA 1G8SA 3KSAC 5JY6A 1Y3AA 1MPTA 2Z3ZA 1YKSA 2RGWA 1H0KA 1EU1A 4PW0A 2ZSIA 4DDMA 1L5OA 3GCXA 5IJ0B 1NAIA 3P4UA 4C2TA 2V6JA 3W5IA 1SK8A 4U7WA 4ZQIA 4ENWA 4XQGA 3YASA 1GLNA 1WXFA 2Y1EA 4RK6A 3H7AA 3LY5A 4JODA 3E22A 3UQYS 4E4YA 4J7UA 4HDMB 4TWRA 2B6NA 3IBGA 3T1TA 5FFFA 5GZ3A 2MSLA 4BY9E 1GKKA 1EXNA 4KK3A 3X3HA 4U9HS 3RC1A 3EIEA 5PNTA 2C5LA 4MV3A 4YA6A 4GZ5A 3PFKA 2DOKA 3FDZB 1OTXA 4RS4A 1NM5A 5LBTA 2AW3A 5BSTA 5FHRA 2WKWA 4WMLA 1ZNQO 1YDMA 4GUAA 3WNZA 4Z4CA 4YIKA 5LOVF