3T12A

Mgla in complex with mglb in transition state
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
182
structure length
176
Chain Sequence
INFKIVYYGPGLSGKTTNLKWIYSKVPEGRKGEMVSLATEDERTLFFDFLPLDIKTRFHLYTVPGQVFYNASRKLILRGVDGIVFVADSAPNRLRANAESMRNMRENLAEYGLTLDDVPIVIQVNKRDLPDALPVEMVRAVVDPEGKFPVLEAVATEGKGVFETLKEVSRLVLARV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gliding protein mglA
publication title Structural analysis of the Ras-like G protein MglA and its cognate GAP MglB and implications for bacterial polarity.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Hydrolase/signaling protein
total genus 60
structure length 176
sequence length 182
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2011-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3t12A00
2DR3A 1OIWA 2YKGA 4XIGS 1NY5A 4KVAA 4S2EA 4P4UA 3IPYA 4TLDA 2ZRMA 1Z2CA 4DSTA 1LW7A 4KBGA 4V0LA 2RHDA 3HDTA 4US1R 1E2EA 3K9HA 3KJGA 4Q7LA 1N0VC 3CPHA 2P2LA 5FUVA 1U8YA 3SZRA 1A2KC 2OLKA 3BD9A 1XCMA 3GCGA 5LPNA 1KJWA 1EFRD 3QPVA 4MRSA 1EWRA 3UMSA 4LHVA 5CDFA 2G83A 4RCYA 1E4YA 2KSQA 4M22A 3AF1A 3NBFA 3PEVA 3T1TA 1CLUA 4PC1A 2BBSA 521PA 4TMKA 4BFUA 1TEVA 1OFUX 1T6NA 1MO5A 4TYNA 5FUWA 3OFND 1P7CA 1CJKC 4BLSA 1DPFA 4IW3B 2JLUA 4TTQA 5BN3A 4QBIA 2P6UA 3SYNA 4DUGD 5DGXA 1P9NA 4KITB 3THXB 4AG6A 1GL9B 3B9PA 2EFHB 2G88A 5ELXA 2H7VA 3Q7PA 3DOFA 1OYYA 1AZSC 1XTQA 1W0KD 2YC4C 2REBA 4PC7A 1NL3A 1OFIA 2DFTA 3T1QA 2E87A 2QA5A 5L3SA 5K8LA 2NPFA 3NC0C 4G01B 1DG3A 2W0MA 3S1AB 1E2NA 3NIBA 2PL3A 3E5HA 2GBLA 2W2XA 1E9CA 3SBEA 3BAFA 4X8MA 5M04A 3KQLA 5H70A 4WAUA 5JZVA 3TVDA 3SC3A 3B1XA 4CVNA 5FPSA 5HR5A 5JLJA 3I5XA 5AUNB 1K5GA 1BIFA 1Z0KA 1QHIA 4GZLA 2O8FB 4NYJR 1MH1A 4TMXA 3UMFA 1P2TA 3FHCB 3ASYA 1MO4A 2W58A 4DB4A 3AVUA 1MO3A 4KSBA 5AWFC 4DJTA 5KDOA 4XD7A 1W5TA 3EXAA 3L2OB 4JL5A 3SFZA 2GDJA 4PPFA 1DG1G 3SHFA 2W6ID 5BQ5A 2FH5B 1RW4A 1E9EA 1GL7A 4O2RA 1A7JA 4JLNA 4TLAA 2IWRA 3QI2A 2KJQA 4BFSA 2RHMA 3GLIA 1MRNA 1VCOA 1XRJA 5FTMA 1JB1A 3AH8A 3B8HA 1IY0A 3TNFA 5JI3E 4Q4LA 3LFUA 2FPMA 3CWZA 4JLVA 5KNCA 1S96A 4EPRA 1XEFA 4G5OA 4ERNA 4G5RA 1RIFA 3SR0A 3IEVA 2FX3A 2PZEA 3VKHA 3VHLB 5C4GB 4MUAA 2ZREA 3I73A 4DSOA 3UIEA 4RZ3A 3KXKA 8OHMA 3RVBA 4Q4HB 2ZJYA 1JAIA 4NTZA 5J4KA 1S9HA 2IYWA 2O8CB 2GCOB 1XTKA 2WTUA 2ZRLA 2J7PD 4WOPA 4TL6A 1OFHA 1E2PA 3B6EA 5E7MA 4EIWA 2BCGY 4EUNA 1IN8A 5FL7A 2QAJA 4TZ0A 1VHTA 5HKKD 4ITRC 2IYTA 3F8TA 3B7GA 3RS0A 421PA 4UXIA 4F38A 1GNPA 3HYTA 1A82A 4C9BA 1W4RA 3K0SA 4BEJA 1EFRA 5JBQA 2OG2A 1T3HA 2WWYA 5F9FA 4JBYA 3LBHA 2DPXA 4DLXA 4JL8A 4TYPA 2C78A 2JLSA 1G7RA 4D25A 2RGCA 2VQSA 2ZRPA 4QHYA 3WXMA 2DWOA 2QTHA 1KIMA 1OKKD 3LBNA 1JXMA 3CIOA 3CKLA 2NQ2C 2R6AA 1RZ3A 3BH6A 5AUPB 4X8LA 3CRQA 2FZLA 2IYUA 2BEKA 2GNOA 4URZR 1KI6A 2OSBA 3K9LA 4DUGA 2QT1A 3NBXX 4L9SA 4TQ9A 2AK3A 3AGQA 1E0KA 4Q7KA 2ZE8A 4PANA 5JRJA 4RD1A 2IS2A 5KDLA 2ZVPX 1YRBA 3L8YA 3O8BA 1O87A 4LDJA 1J2JA 2FFAA 3A4MA 1E1RD 4JSYA 3V9PA 1J90A 3SQXA 5KDDA 2ZI4A 2WM9B 2FF7A 4PC6A 5EZ6B 1Z0AA 4LJ4A 1W36B 4JYCA 3TK1A 4LUCA 4YMVA 4JLDA 4M9QA 2P5SA 1KK2A 4V0OA 4CZ2A 2HF9A 2P3SA 2W83A 3AKEA 3BC1A 2FPLA 4OHWA 4JVSB 3X1XA 1E2HA 5FTNA 2P6NA 3VX3A 3U7FB 3EASA 2CE7A 3Q9LA 4O3MA 1W47A 4XTRA 4I99A 2NO9A 4QM7A 2V1UA 1R8SA 4N1AA 1SHZA 4EKDA 4HAXA 2QGZA 1O3YA 2QRZA 3WRXC 2HLDD 3A58B 5FOXA 4NDZA 1UADA 3BGWA 4XSHA 4A6PA 5JJLA 1COWD 4C4PA 4R9UC 4A0GA 4BEBA 4D4JA 2PX3A 5TV2A 4D0GA 4RZ2A 3OEHD 4JLAA 2ZAOA 2EVWX 2J87A 1G41A 2IYRA 1E2JA 3CF0A 2WJVA 2GVDC 4RJLA 3KQHA 5L8VA 2MSCB 3WMEA 2CHQA 4NYJQ 4MDFA 1F48A 3QG5A 2XITA 4JBXA 1EFTA 1ZM7A 4URUR 5J47A 1FZQA 2P0EA 1Y63A 4V0ME 3OIVA 1M2OB 2N1BA 1ZIPA 2NZJA 3K53A 4AK9A 4L15A 4BECA 1LS1A 3TQFA 3VQTA 3F3YA 3F0TA 4D4MA 3KKMA 4DCVA 1IN7A 5H1YA 2BM0A 2A5JA 2VHQA 4JMPA 4NCKA 5TVKA 5JCPA 2OFXA 1E2MA 3W9YA 4B3FX 2ZRKA 1OH7A 3GFTA 4HZUA 3GJ0A 1XTJA 4IEIA 1HE1C 2G6BA 4HATA 3VTKA 4YDHB 3CZQA 2WHXA 2WWWA 5TXGA 2ZYTX 1NN0A 2V3CC 2BKUA 3REGA 3C16C 3OEEA 2B8TA 4OYHA 4G5SA 1W0JD 5FTKA 1U9IA 4FMCB 4DLYA 1E96A 2JDID 2XOKD 3CX6A 1G64A 3EWSA 3K0CC 2KE5A 2O8DA 4DCTA 1W49A 3PUZA 2H16A 4PX9A 3FKQA 5CM8B 2FZ4A 4BRWA 1G6HA 1CR1A 4AWXA 2XTNA 1KKLA 1OKKA 1Y3AA 2QPTA 3U7HB 1UPTA 2ZU0C 2GRJA 5DN6A 1KO1A 4E22A 3THWB 3K70B 2BCJQ 2QUZA 1AS2A 2OLJA 2QMEA 5FI1B 1Z0IA 2P67A 3MRSA 2BBTA 2XSZD 2VTKA 5JJKA 4LGMA 3C5HA 1FUKA 4DB2A 2D74A 2QAGA 3BBPA 1R5NA 2MMCA 2V8OA 1C4OA 1P72A 2ZJZA 3SNHA 1U81A 1UKVY 5CB6A 4HB2A 2FFHA 3QKUA 1QHGA 2QPAA 3EIHA 4RKEA 1GZSA 2XZLA 1N6KA 3LWNA 1U99A 821PA 4HB0A 4C0HA 5A5GA 2DWPA 2R9VA 3SS8A 4FWTA 4BPBA 4M9XA 2J7KA 5CYPA 1Z6YA 1E9FA 2H5EA 2IL1A 2IX3A 1Z6XA 2J41A 2W00A 4PAMA 5FR2A 4ACAA 1P61B 3KDSE 4QC2A 4Z8XA 1G4AE 1TPZA 3CNOA 4C3ZA 4PPQA 2FMXA 3QXSA 2LWIA 5DYGA 2GF0A 5TY0A 3AEZA 4RZXA 5D3QA 3RC8A 2HLDA 3IKJA 2XZOA 1CKEA 4JVLA 4DDUA 4QGFA 3CX8A 1XMIA 5J5CA 4TWZA 1COWA 4ZIRB 4GOKA 4V0NA 1R5OA 5AJXA 2HYIC 4NMMA 1IY2A 1RE0A 4R2HA 2GESA 4IOKA 1KNXA 2XJ4A 5DI3A 4QOSA 4OQMA 4WVFA 3OEHA 5KU1A 1KDOA 3N2EA 4LCBA 3SJBA 2IYZA 1FUUA 3BFVA 4JZKA 4PC3A 4JS0A 3FMPB 1OW3B 1G3MA 2FEOA 3NTUA 1BOFA 1NRJB 4JVMA 2FSHA 3LRPA 5KUTA 2AXPA 1T0HB 2R65A 2WMNB 1HQCA 3QBTA 4KVGA 4HAYA 1Z22A 4IXNA 5HPYB 2RKOA 2PJZA 1WMSA 4DLSA 4P33A 1E2FA 1CXZA 3H2YA 4TT3D 1R6BX 4DLUA 2OCYC 1FX0B 3RSOA 4KLNA 4C0LA 2GK7A 1YQTA 4F4JA 4QKQA 1GKIA 3M4YA 3W90A 2JLRA 3SJZA 2F1JA 2OXCA 4Z54A 4C2UA 1Z8FA 1E99A 2IS4A 1VYUA 1HQYE 1D5CA 4HLCA 5KYKA 2PEZA 1ZNWA 3GJ5A 2IEYA 4PSKA 3U2QA 1SVOA 1W0JA 4M1WA 1Z0JA 2JDIA 3NHAA 4TLEA 5JJIA 1CR0A 2VHJA 4C2TA 3VAAA 3V4FA 2ZRJA 3GP8A 4A92A 3MG9A 2XXAB 3FDIA 5EE5B 3VKWA 1JQJC 2C9CA 2ZJOA 3PFIA 1WXQA 1GDDA 4LJ5A 4JVNA 2YC2C 3RWMB 2BV3A 3KKQA 2OO7A 3J81k 4Q7MB 3KJEA 4CEHB 3BE4A 1W36C 2HF8A 4CT4B 2XSZA 2F55A 4US2R 3R7WB 1QVRA 3QY0A 1DAKA 3Q3JB 4G5GA 1Q12A 2IW3A 4A1FA 1ZNYA 2OAP1 1RVDA 1N5LA 4NCHA 1HE8B 4BWYA 3THYB 2C9OA 2ANCA 3UWOA 4DSNA 5CK4A 2I4IA 2EW1A 5JSZA 5EXPA 1YVDA 2QM8A 3FHOA 1J7KA 5FH9A 1D2MA 4Q1CA 2OBNA 4WZAE 1UEIA 3QKRB 4C0JA 4OQXA 1RPZA 2OZEA 2WVJA 3AVWA 1P73A 4N3NA 2H92A 2RAPA 4ASUD 3T35A 1OB2A 4A82A 1Z28A 2I1QA 3AF3A 3PEUA 3QKTA 4QJ5A 2GEUA 1MOZA 1UDXA 2O0JA 1DAIA 2G3YA 1FFHA 4MYHA 3EW9A 2WZQA 4DEXA 2CVHA 1VIYA 2GXUA 3KX2A 1KMQA 2IXEA 1ZUHA 4NZYA 4G0NA 4MYTA 1VECA 2Z83A 1L2TA 4Q1BA 3BK7A 4A8JB 3CF6R 2QU8A 2RGAA 1AS0A 2Q3MA 1AS3A 5D3MA 3OE7A 4CYMA 4MH0R 1N5JA 1G8GA 3BFXA 1IN4A 4TQAA 4QJ3A 1RRGA 2YZ2A 1R10A 2QL6A 2GETA 3D3QA 3MFYA 1US8B 4Q4AA 3EPJA 4XVQA 1T8UA 1KZ7B 1P2SA 2ZRGA 1LB1B 1N6HA 2J1LA 4BZQA 1RYFA 4LPSA 2QMUA 2KBFA 1KI7A 3X1ZA 4JSTA 4WXPA 2Z0MA 5CIQA 4TT3A 3UXMA 3E1SA 4C0QC 1SXJD 1XEXB 2PZGA 4GNKA 1CJVC 1DARA 1Z6AA 1IJFA 1C9KA 1GAJA 2VHTA 1JXOA 4PHFA 3MCAA 4BRUA 2KI5A 3P4XA 3CNLA 4D80A 4DHEA 1UBFA 4TMTA 2OCPA 1KHTA 1AN0A 2G1JA 3QXHA 2IA5A 3EPKA 3K70C 3ZGXA 2IUSA 2J0UA 4WIAA 1WBBA 1DAMA 3P32A 2EFGA 4O2LA 1AJEA 1PUIA 1RKBA 4B48A 1P3JA 1Q0UA 1XXHA 4PPNA 4EJSA 4PHTA 1JJVA 4XWAA 1OPXA 3GPLA 2ERYA 3QVUA 3A4LA 2PEYA 4LV8B 5C46F 1F2TA 3RANA 3OIWA 1NIJA 4CEJB 5EP2A 2QROA 2R6CA 1IXSB 1G9XA 1G7SA 1ZM2A 3DMDA 4L5BA 4OJQA 1KZGB 4Y0AA 2X19A 1ONBA 4GBMA 3ZQ6A 2WWXA 4A4DA 2O8EB 5FBRB 2EU8A 3SJCA 1WQ1R 1W5SA 1E9BA 1PLJA 5CK5A 2VP0A 4GP6A 4JKYA 1NLZA 4DC9A 5FTLA 3NBZC 1ZM3A 4ZDJA 4Q9LA 1OJLA 2Z5FA 4WZ6A 3SYKA 5DO9A 4LYJA 3C4JA 2ZR0A 4G5QA 2RH5A 5AR1A 3TUJC 1QHHA 4D4KA 1KK1A 5FUXA 2IF2A 2R6FA 1WB9A 5GJCA 1M34E 2O5VA 4GZMA 1FTNA 5J4YA 3B1YA 4M9ZA 1U90A 4KSCA 3Q5DA 4WZBE 1KI4A 3IO3A 2PH1A 3U7GA 1OB5A 4Q21A 4YMUA 3KJHA 1GKUB 4L9WA 3WYFA 4ASUA 2ZM5A 1E79D 3KTAB 3RRYA 3M6AA 2VEDA 4E07A 5GJBA 1D9ZA 1II8A 2B21A 5G41A 1F2UA 2X8AA 2ZJBA 3DEFA 2CCKA 2O8BB 5CLLA 1NVXQ 1QG2A 2WKRA 1KDTA 3QVVA 1J8MF 3SFVA 3IQWA 2R6GA 4Y0VA 2NGRA 1T5IA 3KB1A 3VR2A 4CT5A 1GNRA 3B2EA 3AVPA 2HXSA 4TL7A 3FOZA 2F1RA 1Q1EA 1SZPA 5CDFE 3EZ2A 1P4SA 3GLGA 2GF9A 1Z6TA 1D2EA 3SJAA 2WOJA 5DSZA 2YWGA 2QBYA 3MWYW 1SKYB 1ZJ6A 4M0LA 4QFMA 1P75A 2F7SA 3K09C 4Z1MA 4M1YA 1QRAA 3KJIA 4E09A 1UKZA 5J4LA 5L3SB 4I1SA 1LV7A 2GXSA 2OAQ1 2ZR7A 2ZSAA 4LPKA 4KCGA 2GWHA 1SKYE 2GJAA 4M4SA 3QJYA 3VKGA 2Z4SA 5KO2A 2NG1A 1Z47A 5KHOC 3MJRA 1DE0A 1E2LA 1QVAA 4KLZA 1X8JA 3AP1A 1N2CE 1XCPA 4IXMA 2BEJA 3Q7QA 5KPJA 3B78A 4FINA 4HLUC 4KFUA 2CHGA 2DBYA 2JATA 3GFOA 3BORA 2ONJA 3SE0A 5FBWB 1G3UA 2BMEA 3VU9A 5HCNA 3PUWA 4JJZA 1Z2AA 2OE2A 1KI3A 5CJ2A 3IUYA 4PFSA 1VTKA 1VKJA 2XB4A 4MKIA 3WYGA 1PJRA 2BM1A 1TF2A 3D8BA 1T3LA 4BASA 2PBRA 4UNQA 5FL7D 1N6LA 1X3SA 3DPUA 2OV2A 5KOYA 1FW6A 3LDAA 1GL6A 5BXQC 3GLIB 4JJKA 5JMTA 2B8WA 4ZKDA 1SGWA 3M1IA 4TMVA 4GDFA 2ZPTX 3IQXA 4RD3A 3TKLA 4MDEA 1Z06A 3H86A 1KI9A 3H4MA 4I1OA 1DELA 3WP1B 1CTQA 3GLIE 1W2HA 1GM5A 2CLDX 2JJ1D 3KB2A 3IIKA 1JNYA 4B33A 3K0AB 4LYHA 3A1WA 2AXNA 4AIIA 1CEEA 4RD2A 1VG8A 2GKSA 4LZZA 2OCAA 4FMCF 1G8HA 1X8LA 3U44A 1SQ5A 721PA 2ANBA 3DZ8A 3HWSA 5IF9A 1FOEB 1ANKA 1I2DA 1ESMA 3KXIA 1BYUA 1WA5A 2BMFA 4EAQA 3VNUA 3B85A 1NP6A 4DLWA 3TLXA 1E79A 2CL0X 1KKMA 3RRNA 5IRCD 1SULA 3QEOA 5TB5A 1XF9A 4NBSA 3EC2A 1T91A 4A8JC 3E2IA 3ZQJA 2NIPA 3IGFA 3NDPA 3EZFA 1G3QA 4H1VA 4FXPA 1EK0A 1QHSA 1W44A 2V1XA 2DHRA 4V02A 2F3RA 1XD2A 4UNSA 2FE4A 2QZ4A 2ODNA 4YC7A 2C04A 4B34A 4CW7A 4TL9A 2B7CA 3U3JA 3SQWA 2YWFA 4PPGA 3N5CA 4WW0A 1ZCAA 4A0HA 1UKYA 5AK0A 1KI6B 1N0UA 5EXTA 4U5XA 4YMWA 2V7QD 3I62A 3UG7A 2EYUA 3MGCA 3CRRA 2IWHA 5DHAA 4EPXA 1Q1QA 3FVQA 3ADKA 2NO7A 2PMKA 5LB2A 4D26A 1ZAKA 5EUMA 1MV5A 2XAUA 4YQFA 1ZIOA 4DCUA 4HYYA 1W7AA 3ZZTA 3IDQA 4MKGA 4NCNA 1KJYA 3CRMA 5H68A 3WNCA 1V43A 3BH7A 2BMJA 4OJKA 4U02A 1X1RA 3OIYA 1WRBA 1E0SA 4LOAA 4L8GA 5EP4A 1X6VA 4HAVA 4IVPA 2AWNA 3MD0A 3ONWA 4MGYR 1TQ6A 2PCJA 5EJEA 5J4HA 3O8CA 1TQ2A 3CO5A 4M1OA 1N6NA 1QDEA 4FIDA 4ARZA 2ZJAA 5KSZA 2PLFA 2VLIA 1XFAA 4CDGA 3PEWA 5DLQC 4D4LA 4F4IA 4HUQA 2BOVA 2JJ2D 3GMTA 4Q9JA 3PV0A 2C03A 2BJWA 1AA9A 1NSFA 4QM6A 3G5UA 2VP9A 3EA0A 3CM0A 1G4UR 3HYRA 1XMVA 2O0HA 4MGKR 3BB1A 4NKRA 2CXXA 3DL0A 2CCJA 4MGZR 3WBKA 1TF5A 3P20A 1CBUA 221PA 2XJ9A 2EYQA 1E4VA 1YZUA 1J70A 1Q3HA 3DM5A 1Q3TA 4P4SA 3OEED 4O25A 3TMKA 3VR1A 5DYIA 3C41J 2RB4A 3H1TA 5JECA 5FL3A 3LW8A 3O8RA 3OF5A 1NN3A 1X8KA 2JJ1A 4Q9IA 3L43A 5L3QB 2WAYA 3WP0A 2IYXA 5FOUA 4WBSA 2QRNA 3K0CA 3MAAC 2JCSA 1BYIA 1G6OA 5DN6D 1OIVA 1XBTA 2WJJA 3A36A 3QF7A 4OQLA 3SYLA 5CJPA 3KL4A 3THXA 5HTKA 2AD5A 3ZYCA 2RGBA 2ZR9A 3DM9B 1Z0FA 4I1VA 1RRCA 2A5GA 4ZPXA 4IHQA 4LHYA 2PMDA 3NH9A 3BOSA 4KV9A 4QBHA 1WCV1 4A2PA 4RFVA 4HEJA 3BB3A 1J99A 1KSHA 5DHFA 3ZZUA 5AJYA 5UKDA 3GJ6A 4B73A 2J0SA 3A6PC 1NIPA 4KI0A 2Q9AA 2UZIR 2A3RA 3PUVA 2CL6X 2FFQA 2O8DB 2Z4RA 2VIIA 3CPJB 3G0HA 4IOLA 2CJWA 4Q48A 1E2IA 2GA8A 3EC1A 4LBYA 2C95A 1NVVR 2X2EA 3LW7A 4AY2A 3DKVA 4BFZA 4KYIB 1Z63A 2CEAA 1SVWA 1ZBDA 2B7BA 2PJRA 2RGEA 2GXQA 1TU3A 3W34A 2DYKA 4AYWA 2V7QA 5LB4A 1NBMD 2GBLC 3DVLA 2IS6A 3VR3A 3ASZA 4B3XA 5AUQA 2HUPA 5ANRB 2QAGB 2ZI3A 1UEJA 3UATA 1DTSA 3WNBA 3LY5A 3AUYA 4Q03A 3TJZA 1XJCA 2AFIE 1DAGA 4RZUA 4NE2A 3SBDA 2CDNA 2A7QA 3PUXA 3WHKA 2Q6TA 3GD7A 3WY9A 1ZM4A 3VHXA 1P9WA 2D7CA 4LHWA 1Q44A 1SVIA 5F98A 3KKOA 2ZJ8A 2F43B 3EA5A 5EE1A 3T1OA 3GEIA 3C15C 4B44A 2PT7A 4D81A 4LX0A 4Q4HA 4Z51A 4CEIB 3QQ5A 2GCOA 1GUAA 3I8SA 4HI0E 2JJ2A 4LJAA 2JAQA 5E7IA 3QSYA 2FSGA 3FGNA 3MWJA 4P3YA 5GJVC 1JECA 1SVKA 1W2GA 1WBDA 3ADBA 2YWEA 1M7HA 1SVSA 1VMAA 1KDPA 2A5YB 3TRFA 2Q9CA 1M6NA 2OT3B 3GQBA 1CS4C 4UJ5A 4UKDA 3RS3A 2QP4A 3D7MA 1UBCA 1UF9A 1E2DA 1MABA 2FPKA 5DI3B 4Q01A 2F1HA 4DLZA 1YZGA 3SDZA 3RS5A 5FOWA 2V9PA 1L4YA 1U8ZA 1Z5ZA 4Q4JA 2WWIA 2ZE7A 4HLDA 5EQTA 4AURA 1OV4A 4KAXA 2SHKA 3WMFA 2HCBA 2LCFA 3AF0A 2WWHA 4LC0A 4OI1A 1UBGA 3OESA 4EQ6B 1X1SA 1DEKA 2VSXA 4H9GA 4Q1EA 2QE7D 3TBKA 2N46A 1YRAA 1JALA 2D62A 4NCJA 3KFVA 5TARA 3ADDA 1E6CA 1CRQA 1GILA 3TR5A 1GRRA 5TDHA 1NMZA 5B30A 4K8OA 2BVNA 4NCIA 2Z6VA 2OEPA 4AKEA 4DZZA 2F9MA 5JI2E 4A36A 4B6FA 4BLOA 4BZPA 4LC1A 2A78A 2D4HA 6Q21A 2HT6A 3NHBA 2ZANA 3ICEA 1TMKA 3A4NA 4H1UA 3UWKA 3RWOA 2X77A 2ATXA 5BN4A 3I92A 2NZ8A 1LNZA 3B9QA 4I81A 2QTFA 3EWAA 1ZU4A 4KU4A 4M21A 3THOA 4BZXA 4TTRA 4J0QA 4UNNA 4D0LB 4IVQA 2ECKA 1IN5A 2FNAA 5H8WA 1OH5A 2CNWD 3AVVA 1G1MA 1SVMA 3HU1A 3REFA 4MRRA 2HYDA 1YJ5A 1TQDA 1KI2A 1NJFA 1NBMA 1M74A 2WKQA 2H1LA 1Z29A 3AUXA 5KNBA 4PZLA 4R71A 1I4TD 1CJMA 2XEXA 3LQQA 5E7JA 3KQNA 1D8TA 4TTPA 1G7TA 4FD2A 2F6RA 4QGGA 5IHPA 3ZH9B 4U7DA 3D6TB 3AVQA 5G3ZA 4V0MA 4OQNA 4BQSA 1P5ZB 1XX6A 121PA 1LTQA 3NC1C 4PTLA 4XWOA 1EGAA 3X1WA 4ESHA 3AVTA 2ORIA 1NVVQ 2GZAA 3QXJA 3TR0A 5BN5A 3L8ZA 1U2RA 5G3YA 3HP1A 2D2EA 3EARA 3OE7D 1XPRA 1KGDA 1P6XA 2KWIA 1Q57A 4LHZA 3I3SR 1AGRA 2NTYC 3CRW1 1II0A 2C5LA 2UVQA 3BFKA 4A2QA 1T5LA 3C5CA 2WIBA 2L0XA 3O8DA 4IEEA 1XJQA 4N0DA 1A1VA 1NN5A 3GLHB 3U4QA 1KAOA 1OLOA 4PHGA 4Q1FA 1R0YA 3UMRA 1JBKA 2IS1A 3AV0B 3TSWA 1CP2A 4HB3A 2GK6A 2VP6A 3GFPA 4W9MC 2QN6A 4KXFB 5EUQB 4HB4A 3R9IA 3GLHE 4FWIB 2ZROA 2BHRA 1I4DD 3U3MA 1II9A 4CRWB 3AKDA 5D3MB 2DY1A 4C0KA 3NDBB 4GRAA 4JLMA 2AFHE 1DAHA 4LJ9A 2OXRA 4C0BA 2GILA 5FBVB 4Q4AB 2QT0A 4Q7JB 3U60B 2MSEB 4MRPA 3PR1A 2QE7A 4OHXA 2IUUA 2VL7A 1XEWY 2ZIAA 5FUYA 1HV8A 3KQUA 3B5JA 1KO7A 1S8FA 1U9IC 1W48A 1KMHB 2ZYWX 2P5TB 4LJ8A 3W6OA 1ZYUA 4KJZA 1W4CA 2VP4A 3ZVRA 4BLRA 5DNYB 2XNSA 2CK3D 4DEYA 2ZSEA 2RGGA 3LD9A 4TLCA 3EPLA 1GIAA 2PT5A 1BS1A 4NYMR 2ZE6A 1R4AA 2J0UB 2RMKA 4M9SA 2ZS7A 1KTVA 1TQ4A 3QKSB 3DKPA 5A4JA 1G5RA 5DI9A 4FMBB 3RS4A 4LK2A 1OF1A 4EJSB 1IXZA 1GKYA 2DCUA 1TUEA 4TMZA 3TVTA 1X86B 2ERXA 2QAGC 2ZTSA 4FCTA 1W4AA 4DDTA 1F2TB 4HSEA 4US0R 1E69A 2WSSA 2CNWA 2JLXA 1NVWQ 2XTZA 3V00A 4EFNA 1AZTA 4KFSA 4Q02A 2D7DA 1E9AA 1C1YA 2ORVA 3CH5A 1OXVA 2OHFA 1VCMA 4RFSB 2YOFA 2O0KA 4Q18A 3CW2A 4IDQA 3D31A 1E2QA 1NLYA 1IXRC 4Q00A 2WPDA 1A2BA 4ZCIA 1TADA 2ZUBA 2IYLD 3AQ4A 4ZIRA 5JWRA 1KYIA 4OL0A 1NI3A 1EX6A 1NSTA 1XTIA 3U6KA 5FBLB 1NJGA 2V55B 4A9AA 3RRZA 4LJ6A 2VBCA 2R44A 4RD4A 4ZCMA 3PCRB 4Q1DA 1FL9A 1JAHA 1FTSA 3TW8B 2VSOA 4Z1MD 2QP3A 3RHFA 5FBQB 3QF4B 2H17A 5C4MA 3HPRA 2ZRAA 3GLFB 1G5TA 4LJYA 2WBLC 3K09A 3M0EA 1SKQA 4Q9KA 3NWJA 4YDSA 1JQLB 2GJ9A 3ZIAD 1KO5A 1A4RA 1YE8A 3ZVNA 3GLFE 4HDOB 1N3BA 1ELOA 5GVRA 3GLGB 1G18A 2V6JA 5KNDA 2ODBA 3TQCA 1RFLA 3LLMA 2W2VA 4AKIA 3MJHA 4B75A 5LD2B 1S9DA 3CF2A 3P27A 5EE3A 3ZVMA 3A1VA 4JT2A 1E2KA 4MITA 3E70C 4HLUA 4KFTA 3DDCA 2P65A 2ZS9A 4IFBA 4XJXA 3GLGE 1XP8A 4Q19A 2XX3A 1IHUA 5B2ZA 3RS7A 1OHHA 2FSFA 3SN6A 3BERA 5CM9C 4HUTA 4OK3A 2J0VA 1G8FA 3ZLJA 2CL7X 1HTWA 2GJ8A 4UQOA 2GZDA 1SXJB 3FFBA 4G1UC 4HDCA 2J0QA 2GVZC 2NMVA 3GJ3A 2AKYA 4NONA 2C99A 3NEYA 3ZS9A 4FCVA 5DISB 1E94E 2D3WA 2QM7A 2Q3HA 2CK3A 1S3SA 1SXJE 2N42A 1N6RA 1R8QA 3RLFA 4RD0A 3CBQA 1K5DA 4P0TA 1GOTA 3SU8A 1HA3A 4DVGA 1GRQA 1VHLA 1VPLA 1EWQA 2ZE5A 3W3ZB 1MT0A 2CHVA 3PVSA 5E95A 5EE9A 4B71A 2YINC 1GTVA 3QKRA 1RJ9A 1YKSA 1M1YE 2Q0HA 3K0FA 2CVFA 3EZ9A 3EX7C 1CR4A 5AUOB 1XD8A 2GAAA 3A37A 3VR5A 3AGPA 3EIQA 1LFDB 1XCGB 1CF4A 4JIMA 4P32A 1U0JA 2IYSA 1NG1A 2ZUCA 2W6JA 4GPTA 3EG5A 1L4UA 2E9SA 1EESA 3N2IA 2OBLA 4NYMQ 2YOGA 5JRZA 2FV8A 5FPKA 1JR6A 2FGKA 4QHSA 4KO8A 2CBZA 1PVOA 4QJ4A 3TAHA 4XVUA 2QNRA 2C96A 4B47A 2DFKB 2D2FA 1TEXA 4LWZA 4TQUS 1HH4A 1W1WA 4M8NE 4MYUA 1FQKA 1UBEA 3NG1A 3QEJA 1GWNA 3CONA 1E0AA 2X2FA 1LVGA 1P2UA 3LV8A 2IT1A 1JR3D 1US8A 2VF8A 1Z6GA 4B43A 3CR8A 5FOTA 4BFYA 4EPWA 1XZPA 4IRUB 3U61B 3AF4A 2ZYUX 4RY2A 3ZD6A 2VHUA 3PEYA 3U6BA 4PAOA 4YMSA 3V4RA 5GVSA 4UNRA 2ATVA 2XGJA 3A1SA 2FU5C 3HU2A 2LKCA 2RGXA 2WKPA 3KUDA 4W5JA 1ZD9A 2QENA 3MLEA 3LXRA 1XD2B 3ZIAA 4DT1A 5FPYA 5C18A 4A2WA 1EFUA 4X8OA 5FPHA 1DS6A 3NEJA 4AD8A 2DFNA 4URYR 4OK6A 3UANA 5KSPA 3DHWC 5FOSA 1U98A 3TUIC 1PLKA 5AJVB 2NPIA 4D82A 4FMDB 2KB0A 4EPYA 2Q3FA 4V03A 3ETLA 1E3MA 3X1DA 3BS4A 1H8ED 3EIEA 1G21E 2HCJB 4UJ3A 2H8KA 1Q20A 5L3RA 3K8YA 4HAWA 2FGJA 1DOAA 3RS2A 4ZKEA 2J59A 1VDZA 4CF7A 2ZJ5A 5AJZA 2W0SA 1XU4A 3BWDD 3G82C 4JLKA 1XD9A 2QORA 1OFTA 2MMGA 3U3RA 1MKYA 3A8TA 2WJYA 3UG6A 5JEEA 2ZSDA 3L0PA 5B57C 4KODA 5B58C 4ARZB 4EJSC 3PQCA 4XOIA 4B3DA 4A0FA 3MWKA 4XTCS 1XMSA 1LF0A 1RYHA 2NO6A 3QENA 1HT1E 3Q5EA 2YYZA 2BWJA 4AYTA 1TL7C 2ZUDA 4R7ZA 1F3OA 1VYTA 4DCNA 2BKEA 5EP1A 1K8RA 1RRFA 4CIDA 4F92B 2IF0A 4PQFA 2Q21A 4KYUA 4LBZA 1VYVA 3FYHA 2FG5A 2F3TA 2R8RA 3NXSA 3QBVA 3KTAA 4HLQB 1T0JB 1IAQA 2FJUA 4OHZA 2ZITA 1KI1A 4POAA 1MR3F 3GEHA 3KFXA 4JLJA 1ZRHA 4M2LA 4B3GA 4P4SB 4W5HA 4C7OA 3LO5A 2O8BA 2XNDD 1XZQA 2C8VA 1AIPA 1KY3A 3GJ7A 2VSFA 1D9XA 5TMPA 1FP7A 5K8TA 1LY1A 5DIFA 4S35A 1R5BA 1R0WA 1GNQA 5E3HA 1ZC3A 1MO6A 3C14C 4IDNA 1Q1BA 5BYKA 1XTSA 1ZVQA 1JR3A 1P60A 3QUSA 3WHLA 4QG7A 1XEWX 1JEDA 1TTTA 3EPHA 3DMNA 1GITA 1AQUA 1A5TA 3C8UA 3LA6A 2NO1A 4QGAA 4UNPA 4DXAA 1P9RA 2OBMA 4DLVA 2RCNA 3T5GA 3AVOA 3GJ8A 3MMPA 2GXAA 3NBYC 5LD2C 4JT4A 4DDVA 1RRPA 4I1UA 4WA7A 1NY6A 3PUYA 1ESNA 3QXXA 2CJWB 4W5WA 1OXTA 5F2EA 5HE8A 1G8PA 4YONB 2GCNA 2GCPA 3FPAA 2A30A 3RNLA 1M7BA 2RGNC 2YVUA 1DAFA 1PV4A 4XSGA 3OHMA 1WF3A 1RC8A 1KI8A 4NP6A 2D06A 3RRMA 5HZHA 2W2TA 1SXJC 4IJMA 4BUJA 1VIAA 1EXMA 4BE7B 4G3XA 3BH0A 4MQBA 1H8EA 1N25A 3IO5A 3KKNA 4C30A 2G0NA 2IXFA 1T3SA 1ZINA 5CB8A 4IKEA 2WSMA 2UZ3A 4DCSA 2ZI9A 2OFWA 3ZZ0A 1UAAA 4TMWA 3LH5A 2I3BA 3VX4A 2ZEJA 2B6HA 3LXXA 1OH6A 3HPQA 4GOXA 3R20A 5JEDA 5IDVA 4A0RA 3T15A 3O47A 1AQYA 2BMDA 1SVLA 2ZVQX 4MGIR 1L7VC 1CJUC 1ZU5A 3L0OA 3K0AA 2JLZA 1SHKA 1XTRA 1TNDA 5CYOA 5SZJA 4AKGA 3K9NA 3N70A 4IDOA 2WIAA 1BO6A 5JWOA 2C2HA 4PC2A 3VR4A 3FHTA 2QGNA 2VP5A 3UK6A 1Z0DA 1B0UA 1M7GA 1VCNA 2ONKA 3CNNA 1Z83A 3B1VA 1VCIA 1JJ7A 4HZUB 1CULC 4ZV4A 3U5ZB 4LYFA 1MABB 1PLLA 3W5IA 4GFDA 4W7SA 3MUFA 1OXUA 1IJEA 4K46A 2R62A 4K81B 4F4CA 3R9XA 4JLPA 2QI9C 2ODEA 3CB4A 621PA 2J45A 3S1AA 1W36D 2XNDA 4Q4JB 1NG9A 3X1YA 3IEUA 2CE2X 2F9LA 2G1KA 3CLVA 4PHHA 1YHNA 3FFAA 4B76A 3TW4A 4MUBA 2H57A 3OFNA 1OT3A 3K1JA 3DOEA 1KOFA 1M8PA 3OAAD 2GEVA 5L3VA 4PZYA 3ZDQA 1B23P 2WWGA 2O8FA 4MKFA 1Q22A 3Q72A 4JBWA 4JLOA 1Z08A 1S1MA 2QPOA 3I32A 2GTPA 2FWRA 4FW9A 4GI7A 3I8XA 4M53A 1G20E 4PXAA 1W0KA 3ZVLA 4YXWD 4BLQA 3NH6A 5FR1A 2YJTD 2Z43A 3UPUA 3I5YA 1YU9A 1NMYA 5C1BA 1N0WA 2ZQ5A 4DBLC 4M1SA 3TSZA 1D6JA 4AI6A 4QNMA 3LAWA 2EWWA 3TH5A 2AL7A 3WYAA 4TYQA 2QMHA 1T8TA 1XJ0A 4Q1AA 3QG1A 3JVUA 1E98A 2EWVA 4QNRA 4QHTA 2FOLA 3I1FA 3T61A 1WE2A 5LDDC 3WNDA 3KUCA 3SI7A 3HJNA 4UXJA 3DO6A 2V4ZA 5CIWA 3VR6A 1N6IA 2QSYA 1E32A 2V54A 3AVYA 1ETUA 4IOJA 1DVRA 1YZLA 4NYIR 5JHHB 5KSYA 2YHSA 1G19A 1FMLA 2A9KA 2O8CA 3LNCA 4D2IA 2P6RA 2F1IA 3CWQA 1DAEA 3CRVA 4RKFA 4QXAA 3HR7A 2W6IA 4X8HA 3L82B 4NL4H 1HY3A 3CX7A 2ZRFA 3AM1A 5JS7A 1NBME 3ND8A 4HAUA 3KQKA 4LY6A 2ZRCA 3IHWA 3FMOB 2XB2A 2FN4A 1ZNZA 3P4YA 4C0AC 5CITA 1T9HA 2QEQA 2FEMA 2GEDA 1ZD8A 3T34A 1XPUA 1DADA 4A15A 2AR7A 5SZKB 5B64A 4DKXA 4Z8YA 4DLRA 4ZI2A 5L3QA 2VH5R 2ZRDA 2IEZA 1EFHA 2NOAA 3IBGA 2HJVA 2J7PA 4GMXA 2QG6A 2HDNB 3K70D 1TUIA 3I4LA 3RAPR 3U4QB 4I4LA 3R8FA 5EXXA 3AP2A 4D6PA 2JIZD 4R98A 3B60A 4OHVA 5HKKA 1XB2A 1S4QA 5FPTA 3KKPA 4KFRA 4PO1A 3TE6A 3TAUA 3CH4B 5F9HA 4Q9HA 3BRWD 4ZO4A 2Q9BA 4PO8A 5FTJA 2CLCX 2A5DA 1AKYA 1VG1A 3AKCA 1DO0A 3QPWA 2CCGA 3VMFA 3QNUA 1JPJA 3OIUA 4JL6A 5AJWA 5GJWC 1ZMXA 4URXR 1NKTA 4QL3A 5FFMA 4MRVA 2YWHA 5JCZA 4DDWA 2DFLA 3CZPA 2GHIA 3LQRA 5EP3A 3HU3A 2IXGA 3OAAA 5BW8A 2VA8A 2V6IA 1XNJA 1OYWA 2WSSD 3IILA 3IBYA 5K8IA 3ZD7A 3RSLA 3VNVA 2JJ8A 5SZIA 2IYVA 1HYQA 1NLFA 1WP9A 4B2PA 4DSUA 2HV8A 3CUEF 1OSNA 1Q21A 2G0TA 2ZI5A 4XVRA 4YXWA 4B3BA 1E1RA 1XMJA 1G3IA 2FA9A 1QG4A 4JYBA 4LJ7A 1CU1A 1KSFX 1ZUNB 4TN1A 2JEOA 2X1VA 3NVAA 1MRSA 1P2VA 3WMGA 1OE0A 3IIJA 2WPDD 4AG5A 1EFCA 5G53C 4EDHA 3ZJYA 2EFCB 2GJKA 4GMDA 4AKHA 4AC9A 3FMIA 1UDWA 3K9GA 5JSZB 3NKVA 1FQJA 1ZNXA 2F43A 2VHCA 2ORWA 3HR8A 1I4LD 4ILEA 4Q47A 4ZDWA 1AGPA 4DIDA 4CEIA 3QXCA 2FDCA 1R2QA 2JLQA 2IYQA 4PAQA 2C98A 2JASA 2G9NA 4DRZA 3LVQE 1NNEA 4BGDA 2VO1A 4HUQB 2ODWA 5EE0A 1XPOA 3A1TA 3F5FA 1EG7A 5P21A 4ON9A 1YZQA 1KAGA 2IYYA 4BLTA 3VFDA 5BYJA 4TYYA 2WV9A 1YR6A 3PJRA 4EPTA 2PCLA 1FP6A 3I72A 3W8NA 1K6MA 4DLTA 1KJZA 1KNQA 2DB3A 1OXXK 4GOJA 5K8UA 4IDPA 1BH2A 1FMJA 4KHZA 4GT1A 4LBVA 1KK0A 3FE2A 2JLVA 4IFEA 4NYIQ 4JLBA 4LV5B 1KDRA 3WBJA 4F93B 2IHBA 4EQ6A 2XZPA 4R2IA 2R2AA 3LBIA 5JFGA 4LV6A 2ZRHA 1IOZA 1DBSA 1NF3A 4E5UA 1IONA 4QRHA 2ZU6A 2FFBA 1GG2A 3SHWA 2JLYA 3THWA 1IQPA 5GADl 2WAXA 5A0FA 1GRNA 1OHHD 4PQYA 2EFDB 2OCBA 5IK2D 2E1RA 4OQFA 4FMDF 2JIZA 2J5XA 3P1JA 4NHOA 4LSGA 1W46A 1R7RA 1CIPA 4O0MA 3EZ7A 2MSDB 2OILA 3B1WA 1R0ZA 4BFVA 1OXSC 1QHXA 4IVRA 3R8CA 2ZAMA 2EQBA 2XOKA 3DZDA 2HJGA 4Q66C 4DWJA 3H84A 2OUKA 4QBFA 1P62B 4TSFD 3JVVA 2XTMA 3RYTC 2IC5A 1WDTA 1ZP6A 1GVNB 1NMXA 4MRNA 4M1TA 4YMTA 1UM8A 5SZHB 4BLPA 1TF7A 4KBFA 1TAGA 4D0NA 4Q5IA 1XXHB 1KSGA 2J9RA 4EFMA 3P26A 4ACBA 1E1QD 2HT1A 2IHYA 3U3OA 2OFOA 4MYCA 5DE3A 3EAQA 1YZNA 1Z07A 3RC3A 2PX0A 3PIRA 2BIFA 3LX8A 1KO8A 5EXSA 1F6BA 1XXHE 1JI0A 1BMFD 2W6JD 2WMOB 2J3EA 4OK5A 3TIFA 3SOPA 2ZJ2A 4FI3C 4ZI3A 4JKIA 1H8HD 1R0XA 3AB3A 4TZ6A 2OESA 2ZI7A 1JPNA 1QF9A 3Q8XB 2LKDA 5JHGB 1ZC4A 4HDQB 2CLSA 2QQ0A 1T4GA 3L0SA 3T06B 3I61A 1YR7A 1RJ9B 3GJ4A 1QHHB 1L8QA 1PZNA 3JZMA 4V0KA 1LF5A 2JA1A 3K0FB 2ZYVX 1IBRA 2OM2A 4MA4A 1G291 4NPHA 2QP9X 2ZXUA 4IOMA 4URVR 1E0JA 4URWR 4B6EA 4ZDKA 1JEEA 2PLRA 3B1ZA 2WWFA 2IK8A 3GLHA 3FKSD 1UFQA 1GP2A 3PXGA 1VG0B 3AVXA 2NO0A 5G40A 2DWQA 4BFTA 2VF7A 3TUZC 1KSJA 1OH8A 3FMFA 1AK2A 1II8B 1FX0A 4B3CA 1F2UB 3KZ1E 1XDBA 3GEEA 1BKDR 1U8AA 3FTQA 1OIXA 2HEIA 4PSVA 2AKAB 4OI0A 1AKEA 1U0HC 1W4BA 3PG5A 1KK3A 4WXRA 1FNNA 1ZW6A 3U7EB 4OBEA 4L4UA 4UXHA 1EX7A 4OHYA 1HUQA 1HURA 2WOOA 1E9DA 3UKDA 1YZKA 4B35A 4CGZA 2H18A 4LYAA 4RD6A 5DH9A 1E9RA 4AYXA 2QBYB 2J46A 3LX5A 3QIAA 4FN5A 2XXAA 2YV5A 2QQEA 3MWLA 4TL8A 2YNMA 3TGPA 3R9WA 2RGDA 3AF2A 3RABA 2C9YA 3ND9A 5KSOA 2ASEA 2WICA 1V5WA 2GAOA 1KMHA 4ZDIA 4CEHA 1KO4A 4PO9A 5IK2A 3W6NA 1KY2A 5FOVA 2CMKA 3FWYA 4GSYA 4MKHA 2BBOA 1HT2E 3ECCA 3T5DA 4DT1B 2UKDA 3Q85A 1S2MA 3AKYA 1G17A 3R7WA 5LBIA 5J4VA 2KBEA 2YOHA 4GP7A 1G8YA 2GZHA 2R6DA 3IHLA 1I2MA 4LRWA 3QKSA 4TSFA 3THYA 1U94A 3AP3A 1S0UA 3OZXA 3PITA 3CR7A 3VU9B 4F7WA 4PZZA 1D2NA 4B74A 3SEAA 4F91B 5IT5A 5F3WB 1PUJA 1S3GA 2IUTA 1GSIA 3BIFA 4HZIA 2QTVB 1ZCBA 3QPUA 4XH9B 3W5JA 2AX4A 1F5NA 4P4TA 3BB4A 2QMOA 1CJTC 1E1QA 2BC9A 1NKSA 1ZD1A 2ZRBA 3T1VA 3X2SA 2AD1A 5HZKA 4OI4A 4RFSA 4NU0A 3W3AA 4N0EA 3EZ6A 1N5KA 1QHYA 1BMFA 5JWHA 3FB4A 1FNMA 5EZ5A 4P31A 4YLGA 2K5UA 4QBGB 5BWMA 1G7CA 3B13B 1H8HA 4M1MA 4ESVA 1ZM9A 2AK2A 2PZFA 1YR9A 5J40A 3BJIC 3ZS8A 3B82A 2WJGA 5CLQA 4A8JA 4EFLA 4LI0A 3LVRE 4PR0A 4TLBA 1CR2A 4U00A 3RDPA 5JS8A 3C7KA 1Q1ZA 5E4FA 5HE9A 1U0LA 3U44B 1DO2A 2ZRIA 2Y8EA 2ZSFA 1J8YF 2AN9A 2VP2A 2WJIA 2VRWA 3T12A 2HXYA 2FSIA 2ZS8A 3GJXC 3IPXA 1GFIA 3QF4A 3CPEA 2REXB 4ABYA 4EPVA 2VYFA 4B32A 3IIMA 3GLFA 3H0KA 2TMKA 3W6PA 2C77A 3FKSA 4B2LA 3QOFA 1TX4B 4C7OB 2ZETA 1E2GA 3K0EA 5FI0B 1F60A 1HEIA 2GJSA 2BDTA 4A6XA 3BXZA 4HAZA 3ADCA 2O52A 3TSOA 1XEXA 2REOA 1UKEA 1NVUQ 3JZAA 3U3KA 1UJ2A 2QSZA 2BJVA 3WRYC 4OKSA 4RCZA 1QHNA 2EFEB 4RVCA 4XWKA 4ZCLA 1G16A 1YZTA 4FCWA 3LLUA 5C2JB 3PENA 2AWOA 1FPMA 4LHXA 4GL2A 4BFXA 1ZUIA 2I1VB 1VG9B 4C0SA 4II7A 4PQRA 4IDHA 2ZRNA 1IY1A 2ZI6A 4XD7D 1AM4D 3ICQB 1N5IA 4NH0A 4E03A 2JLWA 1IM2A 2RGNA 4M1KA 3L0IB 4DIEA 1CRPA 2WJHA 1H65A 1NN1A 1QBKC 1N6PA 1TU4A 2A2ZA 4BFWA 3W8RA 1JR3E 2ZSBA 1N6OA 1SXJA 4LBWA 4CEJA 2B92A 2IBMA 1ODFA 1XWIA 1G3RA 3A1UA 3MSXA 2O8EA 1Z3IX 1S1CA 1IN6A 3KXLA 1LS6A 5KTYA 5KPDA 4PSAA 5HCIA 2G77B 2A5FA 2BBWA 1G5PA 1QZXA 4RSGA 4B2IA 2QY9A 2JGNA 4TYWA 4OI2A 4L16A 3QE0A 4QGHA 2VPPA 1YR8A 1E9SA 2AHOA
chains in the Genus database with same CATH superfamily
5KZMB 3OURA 3T3MB 1VLMA 2Y0CA 3C3WA 1Y1LA 1I01A 1NY5A 4KVAA 1UDRA 3DEAA 3IPYA 2XWJI 4S2EA 4TLDA 4XR4A 3RADC 1HNZB 3HHEA 1LW7A 4KBGA 4V0LA 4OLJA 3FYCA 3GWZA 4ZHQA 1F7VA 3K9HA 5CJJA 4ZVTA 4L4SA 2A86A 2HRCA 3R3SA 2P2LA 3ZBTA 5EIEA 4X3PA 4EGQA 1Q0ZA 2Y1DA 3W9SA 2OLKA 3QX9A 5I7HA 1XCMA 2PKXA 4CHTA 1K2VN 2YDYA 3VUEA 5LPNA 4MWSA 1K75A 1E4YA 3I9JA 2KSQA 13PKA 2A9JA 3AF1A 4EYEA 1S89A 3PEVA 3T1TA 2QN8A 1CLUA 3DZBA 5HIIA 2CXTA 3ABZA 4PC1A 2YZ7A 3PNMA 1ZCJA 4TMKA 5SV2A 1T6NA 4U7WA 3K9CA 4QUHA 5EMKA 1U0FA 1Y1PA 2QVZX 3REQA 2MDTA 1WXDA 4EVRA 3X1MA 3AZQA 2R8ZA 4IW3B 1J23A 4TTQA 1PCXA 4UBOA 2R6R1 1RFGE 2P6UA 1YNSA 1ZMOA 2QLMA 2A0YA 4O4HA 4QBIA 5DGXA 3GAZA 3THXB 2GNAA 2WJ6A 3P45A 1ODSA 2LD4A 4QOIA 1E2UA 1BCSA 4MKZA 1IWPB 2J30A 4KQKA 4I3GA 1OYYA 1TMGE 3IKMB 4QD3A 4LFAB 5FBZA 4YRGA 3MLBA 4J4BA 3T9AA 1NL3A 2JL1A 2PKQP 3T1QA 5GIOE 2QA5A 1WVGA 2B25A 3C6YA 3NIBA 1T5HX 4QPJC 4L4RA 3SBEA 2ES4A 2YFKA 3A1FA 3FCXA 4FD3A 3UK7A 3UCEA 2EZ4A 4WX2B 4ZQCB 3CCCA 2B78A 2HD4A 5H70A 4WAUA 5EKDA 2SKCA 2OWDA 4CVNA 1IHDA 4KRYA 5AICA 1WUYA 4K03A 3EIWA 4IG9A 4O63O 4CU2A 5GONA 3UEOA 1KL7A 1QZTA 2O2SA 3QFHA 1QHIA 2I0FA 4KR0A 4K6FA 4NYJR 1ORTA 2I65A 3TCKA 4TMXA 2ICAA 3U26A 5CFPA 4WJZA 1MO4A 4RIGA 1VKOA 2AR0A 5AWFC 3HB5X 2NU8A 5KDOA 4RAOA 3EXAA 3SFZA 4JL5A 4ERXA 3FYUB 3RFTA 1BWPA 2GDJA 1LXCA 3N6VA 4CKEB 1SURA 4R2LA 2ZUFA 3CJTA 3KUXA 4F6RB 4DV3B 1GL7A 4O2RA 1S2OA 1GPAA 4JUAA 4U9HS 4Z53A 4WZZA 3H9CA 2HIGA 3VKFA 3IPLA 1MRNA 1XRJA 3GRPA 3B8HA 4F4DA 2E4ZA 1O9HA 3CXUA 3TNFA 1J9ZA 3B5EA 3JQGB 3LFUA 3KB6A 4OUDA 4E2XA 1E3QA 1KBQA 4ADSG 3UHOA 1PR0A 5MFZA 4EPRA 2CFTA 1XEFA 4YPVA 3LT1A 1RIFA 4G5RA 3SR0A 3AHCA 2Q45A 2H4YA 2ZVDA 5C4GB 2Q2QA 4CLRB 4P7JA 2OZLB 1PEAA 3I73A 1T2UA 3L46A 3LL4A 1XHFA 4KXQA 3KXKA 5EUBA 5KTOA 3RVBA 3IAHA 3EUAA 2JD2A 4KOAA 4NTZA 4FDVA 1SKBA 1UBOS 4I1YA 3TLGA 2GCOB 2WTUA 2R4UA 2AEFA 4R1TA 2ZRLA 2OPBA 3I1IA 5KWIA 1L5KA 2J7PD 4AZSA 4D3XA 1C0PA 1YS2X 3LUAA 2XYPA 2BCGY 3L1KA 5M2QA 1P91A 1X19A 4V1CA 1EE9A 1EVKA 5JZMA 2C8JA 2F3PA 4BX9A 3KG2A 3WICA 3FH0A 4NLLA 5DNEA 1VPTA 4ITRC 2XVYA 3TECE 3ILYA 4RADA 2CT8A 4RLSA 1JZQA 1O97D 3SAJA 421PA 1X74A 4UXIA 5K0SA 3EIFA 2QTZA 3HB1A 4F38A 3C1AA 1F8UA 2H0RA 1TKBA 5BSEA 4BEJA 2V7EA 1N9KA 4G8BA 2P2CA 3G17A 3PXCX 4MDYA 3ZK9A 5F9FA 4DV0B 4JBYA 3AB7A 1NI4A 5BV2P 1LBEA 4TYPA 4IMIB 2HMTA 2P4QA 1G7RA 4M86A 2B3DA 2MWMA 1E3WA 2ZRPA 2F1KA 4QHYA 2CFOA 1GPDG 2QTHA 3ZD9A 1GNVA 1ZD2P 1KIMA 1WEHA 3KOXA 2IDJA 1YCFA 1Z4KA 4MQ4A 3AUJB 2NQ2C 3BH6A 1RZ3A 3BL5A 4QU5A 1CJSA 4BWGA 1EM8A 1SC9A 1TRKA 3IKVA 3CRQA 2AMFA 2IYUA 4URZR 4G36A 4BKMA 4BQOA 4Z9AA 4ZHSA 1U2SA 2VZ8A 5ALJA 2ZTUA 4DUGA 2HCRA 1ZOOA 1DFGA 3B1JA 3VUFA 3BFJA 1RC1A 3ILVA 5JRJA 4RD1A 1PTJC 4R6WA 1FP4A 1M83A 1A9QA 1T5SA 1TCCA 4QVIA 2OB2A 3NV7A 2FFAA 4MO9A 3LLSA 1QC5A 4WNAB 1NNSA 3AO0B 3UAOA 2EKPA 3QW4B 3AIIA 5THXA 4HNVA 5JNRA 3IL2A 3H2JA 1I94B 2AV6A 4AICA 4LJ4A 3RQIA 1SXHA 1S2GA 3ZGZA 1NE2A 5DMHA 1QO0A 1RAIA 2G8NA 4FS8A 1C5KA 2V5VA 3S70A 1U5CA 4FHGA 1JIUA 1KDVA 1TK3A 1B8VA 4QBTA 5BN4B 4A73A 1S8AA 4OYLA 1CE8A 3ZHZA 1IJKA 2VQFB 3U7FB 3WB9A 1RHRA 1NXPA 1V3UA 1MW9X 1SHJA 2QY6A 3EVEA 1GPWB 3B6IA 1Z39A 4PCAA 3SIWA 3GZTB 1W47A 2Z9DA 3CY6A 2NO9A 4HEA6 4I9GA 4NOJA 4F8YA 4QM7A 3RAEC 5JCXA 4OHRA 2PX5A 3NRCA 1SHZA 2AN3A 4GYYA 4EKDA 3ZTYA 2Y1OA 5GY7A 4C3UA 4FC6A 1O3YA 3GWGA 4TM7A 1E7QA 4JELA 1I6WA 2QRZA 5IBRA 4ND8A 3HU5A 2H0QA 3A58B 5FOXA 1L3IA 3MTGA 4JJ6A 1UADA 3DFKA 4N5IX 4E5DA 5JZ9A 5AVRA 3N8GA 5ALSA 1V11B 2C4NA 1COWD 3RSFA 2Q1SA 3QU4A 4RVHA 3NNNA 3UMBA 2O7QA 4D4JA 3CJQA 2G40A 1E8NA 3QWFA 5DLYA 3CX4A 2PU5A 4D56A 4RZ2A 1JA9A 2EZTA 3OEHD 4XYGA 2GCIA 4MOWA 4ISBA 4W8OA 2ZAOA 2GI4A 4YRFA 1GPUA 2JK1A 3HYLA 3Q4GA 4DXHA 2WJVA 3E9QA 1WM1A 3I52A 2VKQA 2BRUA 1RAFA 2WF5A 4NEQA 4RJLA 5BN5B 5KOHB 2YJ6A 3AM4A 4Q0MA 1UMBA 1UXJA 3ESDA 3ZU5A 1QTQA 3OIVA 5JMPA 3GUYA 2IGTA 3ZE8A 2FPPA 4AK9A 5JAHA 2PRZA 4TWBA 4L15A 5U9CA 3FG9A 5CDTA 3ADPA 3ZGVA 1W85A 5DSXA 4DCVA 2Q62A 1TA0A 2PSHA 2XE4A 4GUDA 1CZKA 5H1YA 2BM0A 1I7NA 1YI0A 1E92A 4IDCA 4NCKA 2YV1A 5CVVA 2OFXA 1WSAA 3TWOA 4XASA 8ABPA 3W9YA 2WHPA 1PNRA 3E81A 5L6LB 1IY9A 3L77A 4D57A 2IE8A 5IJ9B 2G28A 3EVBA 1Y6RA 3DDUA 3SC2B 2WWWA 1UXOA 4FFDA 5CTJA 1TA4A 1NN0A 3OEEA 3WBBA 5C7IO 1CYDA 1CEXA 5DCWA 1FUIA 9ATCA 3VI3B 3GXBA 4J7AA 3TB6A 2VAWA 1XQVA 4AP5A 2XOKD 4BP3A 4C4RA 2ZW9A 2QYSA 5LQNA 1KY5A 4XFKA 5EZYB 1W49A 2IEGA 4G5YA 3HDGA 1ZL0A 1FCJA 4HXFB 3O4FA 1G6HA 3UAXA 3ANSA 2ZB4A 1D1PA 4AWXA 1RXIA 3OWHA 1KQ3A 1LPAB 2QPTA 3VVMA 4TVBA 2OZPA 2ZU0C 4WY8A 2GRJA 3K70B 3M6FA 3PYMA 4CDMA 1B3RA 1AMUA 1EVYA 3PRKE 2OLJA 1HL7A 1DWPA 2D0DA 5AKZA 3T6KA 3IAM1 4QDTA 2HW8A 4N7RA 2XLCA 2ZAIA 4LGMA 1C9DB 1JQDA 1L5ZA 4WQMA 1ZH8A 2C1EA 2D74A 3P9QA 2CXPA 1R5NA 2MMCA 1T6YA 3RROA 3X1KA 3CEJA 3SNHA 4LSWA 3C74A 2GZ2A 4P7GA 4PINA 4UTRA 4J94A 1SN7A 5HQJA 4A27A 5LOVB 4ZQEA 1YAJA 2IIBA 2HJWA 3PDJA 4XWYA 5LM3A 1P5RA 2F8SA 3DZGA 5IEJA 2PH3A 3SS8A 4DUYB 2J7KA 1J20A 3ZWVA 4D4HA 3RFFA 3BXGA 5KTKA 4PW0A 3R5SA 4CMEA 1DMRA 2YWDA 3NPMA 1MVLA 3D8RA 5F7JA 5AKHA 3D6AA 1P61B 4QC2A 4MK4A 1G4AE 1KJIA 2TS1A 3KS9A 5BNTA 4KUHA 4WY2A 1K9SA 3VHRA 5JT1A 2LWIA 1HRDA 3FDXA 5DYGA 3N28A 2JRCA 2AXQA 3O4VA 4UDNA 4X9XA 3ROGA 4H6WA 4Z1OA 1FEZA 1E66A 2V97A 2H1FA 5D3QA 3RYHB 3DWGA 4C03A 2NUPB 4DREA 1PNVA 5I7OA 4DDUA 3W5DA 1SC1A 1DX4A 2LR0A 2P1RA 3LVFO 3HYCA 4Y6RA 3ZZNA 1XMIA 5J5CA 2PZKA 4HO1X 4BNVA 1GO2A 5KNLA 2HYIC 1DKQA 4OB8A 1IY2A 2AZ4A 4R2HA 3VDQA 5A9TA 2ZBRA 1N4AA 2DPHA 1AKVA 2FPUA 2IYNA 2P6PA 5DOZA 5KU1A 3N2EA 4WCFB 2E49A 3I2JA 4LNHA 5JQGB 4MV3A 4OQQA 4OXRA 1FUUA 3LQ2A 1N8SA 2G5CA 4JZKA 1BMDA 3FTPA 2E21A 4NPCA 1MA0A 5EVJA 2FR1A 1BE6A 3P97A 2HA2A 4JS0A 4PC3A 5DWVA 3E9MA 3F71A 2A1IA 1NRJB 4IUYA 4QAJA 4F72A 2UUCB 1L9XA 3QBTA 1HQCA 1Z22A 2DHQA 4G23A 1TYDE 2PJZA 2GD0A 2ID4A 1E2FA 2OM6A 1HOTA 1Y1SA 4M99A 5JSKA 4DLUA 3CNBA 4ZAYA 1P2FA 2GBGA 3ACCA 1Y5IA 3KBBA 2AEJA 1YGPA 5AHKA 1U31A 3BQ9A 5ALPA 3RSOA 1YQTA 4HRXA 5MDHA 2I99A 1VZ3A 1VZ2A 2F1JA 4X1KA 2FW0A 1PHPA 4C6TA 4BGEA 1Z8FA 1YOVA 1E99A 1BEEA 4P83A 3V2UA 4WBNF 4HLCA 1D5CA 5KYKA 5M3BA 4P3OA 2GPNA 1VSBA 3E61A 5EUCA 1D2AA 4RE6A 2BEVA 3EC7A 2JDIA 4TLEA 3DBHA 1CR0A 5FORA 5G1NA 1LWOA 3ND6A 3RVLA 3WX0A 5F2NA 1PBNA 4BRZA 3HZOA 2XXAB 4FU0A 1PZFA 3QUQA 3ZCVA 5K0ZA 2ACKA 2H2HA 3CEMA 5CW2A 1JQJC 2C9CA 1QUEA 2P2YA 3NVDA 3O2JA 5EFOA 4FLMA 3L8DA 3ZDAA 2ADOA 3R74A 5J58A 4NWIA 4JVNA 3AG5A 5DPMA 2V7UA 3N05A 1I3MA 1VE7A 4PTZA 4RTMA 3J81k 2GTIA 4CEHB 1X7XA 4FYMA 5A03A 1RRKA 3QIVA 2ZG6A 1HNNA 2NZWA 4C1NA 3HO8A 2XSZA 2F55A 4US2R 1TCVA 2OORA 3L7BA 1ICIA 1QVRA 3R7WB 2DETA 5KJFA 1DX9A 4G5GA 1Q12A 1Y1TA 2IW3A 3M6VA 1ZNYA 3LT5A 4A1FA 3HTXA 4C6SA 3E3NA 1N5LA 2RKWA 4AF7A 1PVDA 2YS6A 2PMFA 5GMOA 4UHFA 5CK4A 3AY3A 1BVYF 5EXPA 4R81A 1RQ7A 1YVDA 2C7GA 2VPWA 1XO1A 3GT0A 3L0DA 3JTEA 3PQ5A 5EGSA 4Y2YA 4E5MA 4WZAE 4XWTA 1UEIA 2HK6A 3UV3A 1BGXT 4RM3A 4GMFA 3I05A 3Q41A 5AVSA 2YQ4A 1DHTA 1P73A 5A5DA 3AVWA 2H92A 2RAPA 3K5IA 3T35A 4HUJA 4MKXA 2BFFA 3EBLA 1N1GA 1K3FA 3EEIA 4O3FA 4QAQA 5IDXA 1QGUA 3T54A 1Z28A 2I1QA 3AF3A 3QKTA 1WAMA 1NA5A 5TGTA 4AIRA 3A9TA 2XUJA 2ZJ7A 3ESBA 2G3YA 2FKAA 1FFHA 3IDSA 3RTAA 5LFAA 3V4OA 3VR2D 5M34A 4WLEA 3NC4A 1J22A 2CL5A 3R3JA 4EG7A 5JV5A 1KMQA 1ML3A 1Z5PA 2IXEA 3TM4A 4PRLA 4MYTA 1VECA 1PJ3A 2J3MA 2X76A 3SQNA 3QFRA 1N2GA 2QU8A 3QOXA 1AS0A 2M98A 4JNKA 4OYRA 3GJZA 2Q3MA 3IUMA 5I51A 5C5EA 1VL0A 4MH0R 3EGXA 4C87A 1KY4A 4O5AA 4TQAA 2J85A 1R00A 1HDYA 3KE8A 3MUOA 3NWPA 2M2IA 2XW6A 1ZHOA 4OHFA 2GETA 3KOOA 4Q34A 1US8B 2BFDA 3HHPA 5EJ4A 2ZRGA 1Y1QA 3TDNA 4QATA 4LZNA 5DBIA 1F9EA 1RYFA 4E21A 1QB7A 3I61A 3G2MA 4P81A 3O9MA 1KFCB 1KI7A 1NUUA 2QMUA 4MARA 3ABIA 4WXPA 5DX8A 5JH7B 4B3RB 1LI7A 1UODA 2P5YA 3CV3A 5CG2A 4C0QC 4CQNA 3DV0A 2DBVO 3E9DA 1NV9A 1CJVC 1DARA 1IJFA 3EDYA 1XVUA 4PHFA 1I5EA 1QH1B 1RQXA 3UKOA 2IUYA 2N75A 3P4XA 4BRUA 3MTAA 1GAWA 3FPFA 4RKQA 1X15A 1QYXA 4JB0A 1VFPA 4TMTA 4ZOBA 4RE5A 1ISJA 4B3TB 2VJYA 1KHTA 2IHZA 4M0FA 1A27A 2G1JA 1UC5B 2O14A 3F97A 4MCJA 6YASA 4RULA 1OWLA 3MRTA 3EPKA 3VYRB 3BYZA 3R7AA 2CNNA 2O2GA 3P32A 4BLVA 2EFGA 3HXMA 1KOLA 1Y7TA 1GUFA 3NNDA 1RKBA 3HY3A 6REQB 3C4VA 3I09A 4IGIA 5D1HA 2EJCA 3E84A 3LY7A 2ZYAA 4GX2A 3UT5B 1EFAA 1OPXA 2QS9A 1AF4A 4C3VA 4K1XA 2YMMA 3OT1B 5C46F 2ZB2A 3K6JA 4YR7A 2H1IA 3JVDA 4WD3A 2EX1A 2QROA 5IAEA 1G9XA 4L5BA 2VDQB 4U2KA 5FV4A 3TR6A 3E5RA 1DQSA 2X19A 4GBMA 3ZQ6A 2WWXA 1QORA 3DAOA 4QFDA 2XYGA 3F2IA 5DZSA 2WU4A 4TV8F 3D81A 2C92A 1J1ZA 1P0FA 1E9BA 3TRJA 4MLDA 2OYSA 1YACA 2XUDA 4RNDB 4GI2A 5A4IS 4J0KA 1VL6A 1I2BA 5FTLA 3UJHA 1N75A 3WTCA 1ZX1A 1F8FA 3RG8A 3R3YA 4X97A 1SZCA 5DO9A 4N4AA 2VBGA 3EFBA 2BEWA 4BVJA 3HGQA 5AR1A 3ZI7A 3AY0A 1W6RA 4LWPA 2OV8A 4ZWNA 1M8KA 1KK1A 2E4XA 3OSZA 1F8GA 2IF2A 2G9ZA 2R6FA 2EQAA 3K5PA 4PONA 4AAYA 1SQ0A 2O5VA 1QYVA 1FTNA 3LHFA 2WFLB 4FGJA 4GZMA 4QQ8A 1H9CA 3HXPA 4KSCA 3KD3A 2H2WA 3HY6A 3DYVA 3NTRA 4J0CA 1GG9A 2EGUA 3U7GA 3IT3A 5CX4A 3TW8A 1XZLA 3LSTA 2OAEA 4L9WA 4ASUA 4BY9E 1E79D 2PYZA 3KTAB 5EZSA 2EF1A 3SHVA 4ZGBA 1R6DA 1ML4A 1TC2A 3JWEA 1EWYA 3RSQA 1II8A 2B21A 1KRHA 5G41A 2X8AA 4RETA 3TZHA 1OU0A 4YK7A 1DJPA 1Q0SA 4MI6A 1PEDA 5TQVA 2I78A 1J8MF 3LRXA 3NU1A 4IIBA 4XM0A 5KAPA 4YWJA 3UJDA 4BMPB 4Y0VA 1XZNA 4BP1A 1T5IA 4AJEA 2G1PA 2EC5A 3B2EA 3A6HA 2EIXA 4TL7A 3WXBA 5T4FA 5ELMA 5CDFE 2O5CA 4TVKA 3ZK8A 3ZE2B 3E82A 1RLIA 2GF9A 1SU4A 3FGPA 1OTXA 5E6RB 5BN3B 2GN9A 5TPZA 3SJAA 5IUJC 3WYEA 4GPBA 4JJGA 1HFEL 2VS1A 3NYIA 5LXTA 2Y05A 3MWYW 3BPSA 3GLSA 1P75A 1X9IA 4ZXPA 4Z1MA 4AMBA 2QJOA 4DCCA 1QRAA 4CQJA 3AKZA 1V1MA 2E4YA 4YI3A 4EJ2A 1YBVA 4R0VA 2CSXA 4RL6A 5L3SB 4I1SA 4CLDA 4LXIA 4LPKA 1Q16A 2QGFA 4YPOA 3VU8A 4M4SA 2GJAA 4G0QA 2IOFK 3QJYA 5BPHA 2PUFA 4Q3NA 3VKGA 1B74A 5KO2A 1E2LA 2NX2A 5JFTA 4BN5A 1O95C 3S29A 4AM8A 1HQDA 4PQEA 4Z0NA 1N2CE 2HK9A 4I8IA 3BFPA 3PR3A 5EN4A 4YAJA 4J3NA 3KZVA 3ED5A 5B3JC 1YL7A 3HG7A 2DBYA 1JI3A 2ONJA 5IC5A 3PHIA 1DV2A 3H8VA 5F2OA 1QFJA 3SE0A 3AT1A 3OPYI 1U8TA 2ST1A 4MI9A 1KI3A 1WKBA 3DZCA 6Q21A 4NH4A 1O1YA 3GVHA 2BM1A 3PQ6A 3TQQA 3PFHA 2SNIE 3LPCA 4O08A 3GPCA 4IUDS 4CFZA 4UNQA 2D2XA 1N6LA 3QRWA 3LT2A 3DPUA 5KOYA 1FW6A 5H59A 4IH9A 4BXOB 4Y2XA 1NDQA 1PE0A 2B8WA 3AHJA 3EQZA 3GB9A 1LD3A 2R8YA 3HJAA 3M1IA 4FNOA 1NXSA 3IQXA 4TMVA 4YB8A 4GDFA 2YBDA 3D3JA 1Z06A 5A3QA 4G0OA 2EZ8A 1QIGA 4QJIA 1KVQA 2VKTA 2PK3A 2B0CA 1V9LA 3E6AA 1GM5A 3BIOA 3KB2A 1BVUA 1E3JA 1U5BA 1FJ2A 2FSVC 3IIKA 4UUNA 1A5SB 3RU3A 3D3WB 1V4NA 2B5VA 3UJAA 1JDTA 1I6LA 2QXTA 2WW8A 3W8EA 5AW3A 5E6SB 5JASA 2YBEA 4RD2A 1VG8A 1DB3A 1D2CA 3FGOA 4Y9UA 4UTXA 4D9KA 2B20A 2GR9A 4LZZA 1WQ4A 1X8LA 1SQ5A 3PDIA 4Y1RA 1RKUA 2ANBA 3HWSA 3RB8A 1FOEB 4KAJA 3PGXA 4YP5A 4QGSA 3O95A 1CQPA 1U0TA 3B89A 5KQPA 1T1IA 1PT9A 4OSEA 2VSQA 4OHKA 3B85A 4LNAA 2VZEA 4CM9A 3E9NA 4EKEA 1FTYA 5DNAA 2CL0X 1R0SA 2XOXA 4D9GA 5IRCD 1SULA 3LG2A 5TB5A 4NCBA 4Y9DA 1PO7A 1KWGA 2WZCA 4H60A 2A0WA 1M2FA 1EM6A 1W44A 4MS4A 3IOMA 3UA3A 1QO0D 1KEEA 1Z13A 4BAGA 1WMBA 1FJXA 1Q7GA 3AEXA 3OZSA 3AF5A 3FN4A 1E6KA 3G2OA 5JC1A 4B4WA 2A6PA 3TQRA 4GWGA 4YC7A 5B7PA 4TTIA 3E3LA 5LYJB 1JG2A 2FXVA 2YWFA 1LBSA 1DC8A 1QQ5A 3ANTA 2M6KA 4A0HA 3SEZA 1KI6B 1N0UA 1IZ7A 5F3DA 3TIIA 3RCBA 4U5XA 1PSDA 4INPA 3UG7A 1GL3A 3I62A 1YRHA 3FVVA 3NR2A 4IXDA 2IWHA 4D9NA 4MP3A 1IC6A 1PQUA 2EIHA 1TLLA 3DKKA 3FUUA 1JG3A 3IB6A 3MM4A 5DHAA 5EIHA 2NO7A 2PMKA 5LB2A 3TINA 3NNSA 2FE1A 3ZWYA 1LU9A 3L7KA 4CCSA 5EUMA 1MV5A 3OZTA 1ZIOA 3KPVA 4E5VA 3LUFA 5HWSA 2ZBEA 1EINA 2BHLA 3TZCA 4K6MA 2Q8QA 3Q98A 4MCIA 4ARBA 1F2VA 3G59A 1X1RA 3SXJA 1UDCA 5BV7A 4LOAA 1A4IA 2X3FA 4HAVA 3GDFA 3WIEA 3CE9A 3D8SA 1E77A 4OMCA 3AEQB 4PYJA 2I71A 4WWHA 1AT1A 3KYCA 3Q0EA 4M1OA 1FTQA 2HQBA 3LCMA 1L5YA 1RJFA 1ULAA 4FIDA 1IPFA 4E4YA 2Q49A 3J81A 1Z4IA 4UASA 2PLFA 1CR6A 3VO1A 4CDGA 1N7HA 4OHPA 2BGRA 3D6UA 3PV0A 1DMSA 3HQ4O 4I9UA 4JWKA 3WL4A 2YWCA 4N03A 4FX2A 4BIMA 4FKMA 2AEEA 1NPYA 3ZXSA 2VP9A 4QQNA 4IIVA 4CQLB 3N74A 1XMVA 2O0HA 1EFLA 1JIXA 1V1RB 2CF5A 4KGDA 4MGKR 4UTNA 5AW6A 2UUAB 4MGZR 4Z4GA 1M9NA 1K3TA 1ZJJA 1XZ8A 5G4KB 1GYQA 2NQ8A 1E1LA 2EYQA 1L9KA 1YZUA 2F4NA 1GU7A 2R48A 3LFHA 3M5WA 3AWIA 3OEED 5CHYA 4MP6A 1DGQA 2AQ8A 2P4SA 3PA6A 5DYIA 3C41J 1A98A 3C4QA 2G36A 3HXLA 2AG8A 3LW8A 4G09A 4H4EA 1LFAA 4KJXA 5FL3A 3KQOA 2VN8A 4R1MA 2CB0A 2JJ1A 1C0KA 4DCJA 4ZAGA 2SBTA 2WAYA 4C3OB 3CMCO 3PGVA 1SG6A 5ICFA 1G2IA 4AP9A 4OP1A 4TVSA 2QRNA 2P9CA 4YMVA 2JCSA 1QLHA 3T3OA 2WE8A 3HLTA 2CJXA 4HSGA 1XBTA 4OQLA 3THXA 2VNIA 3UJ9A 3KL4A 4U7FA 3LWZA 1EQAA 1MUUA 3ZYCA 1H0HA 4YN3A 3AU9A 4QDXA 3RSSA 4ARVA 5B3KA 1RRCA 4I6JA 4TXMA 4MP8A 2C5AA 2B1QA 1WSBA 3R44A 4DGQA 2PMDA 3DNPA 3JQ8B 1RYZA 5BXYA 5FA8A 4HEJA 1RD4A 4UAUA 4IO1A 4DRXA 4ER6A 4XQCA 2ADFA 3GJ6A 2WIDA 2XMBA 4RIEA 2C31A 2Q0XA 3RUFA 3VSEA 3WOVA 4GKVA 5ALYA 3STTA 2J0SA 1GZ6A 1MJGM 3DE1X 4BUCA 2RD2A 1CK4A 1HDIA 1R12A 3RARA 7REQA 5G1PA 2BONA 1ZEMA 2Z4RA 3GNSA 4NNJA 3CPJB 4RHYA 4IOLA 1N2OA 4NV1A 3ZNPA 2CJWA 2FMIA 3HSKA 4KXYA 2GN8A 4OX9Y 4ZREA 3N59A 2GA8A 2GERA 3EC1A 3L3BA 2C95A 4WXYB 1W9HA 1WZIA 3DNMA 3LW7A 4Y1GA 4XEHA 4WNIA 4EHHA 3FI0A 4OA8A 1W88B 1ZBDA 3I4FA 4EVQA 3BZUA 1YD7A 2RGEA 3OTGA 3TZBA 1IOVA 5ALOA 4CMJA 2V7QA 1L6RA 3AHFA 5HG0A 5LB4A 1NU8A 1OBOA 1XQYA 2AFIB 3LGSA 2EATA 4TSRA 3ZLVA 3FYUA 2AG0A 1CYEA 4B9AA 3SIRA 4CKEA 2QAGB 1U04A 2DSNA 1UEJA 2O1XA 3G9UA 3TW6A 4YCAA 2X9NA 3ZY3A 5CB0A 1IN1A 2C59A 4O5OA 4F9FA 5TS3A 2IEBA 2G9RA 2GZ1A 4LJLA 3TJZA 1YDMA 2WJZB 2X9QA 1MN6A 4ZZ0A 1YMQA 4EL5A 3B12A 5AI9A 1ZI8A 3KAQA 3QY9A 1NBWB 3BMCB 2A7QA 3JQGA 4GSLA 2Q6TA 4H7KA 5ESDA 1GFSA 5C3UA 3U40A 2UXDB 1JVSA 4C4AA 5MFPA 5CCDA 5DGHA 2QZ9A 3OCVA 3EZLA 5AW8A 3RFXA 1Y81A 3BIXA 2ZJ8A 1GNSA 4M88A 5GTDA 3PL5A 2F43B 2PT7A 2ACWA 2UXBB 1YJAA 2JBHA 3CTPA 5KHLB 3F7TA 3QQ5A 2GCOA 5KTRA 2AJCA 4HI0E 1XVTA 2NU6B 3RIHA 1B16A 3OZVA 1CRLA 1T6XA 2IQ5A 3Q88A 4Y98A 5E7IA 2FSGA 3URMA 1GN9A 3EXHB 5GJVC 1SVKA 3ZIDA 3BX1A 1W2GA 3G13A 3DE6X 3FY4A 5FO1A 3MF4A 4Q3CA 3KZCA 2PZ8A 5A5FA 2YWEA 1M7HA 2HAEA 1SVSA 2EP8A 1WKCA 4B7ZA 4RTLA 1M6NA 2HXGA 3WDSA 5J1SB 1CS4C 2PV7A 2QP4A 4DDHA 3ANXA 1E2DA 4CLHA 3CJRA 1JSLA 1OV6A 1I80A 1QWSA 2N9UA 2V9PA 1U7WA 4GM1A 3HKBB 4H2DA 2O0MA 2ARKA 2YR0A 2I4TA 1YFJA 2JGLA 4C01A 3V46A 2HCBA 2WWTA 1MOQA 2GBCA 5HBRA 5HIMA 3A6EA 3K9FC 1X1SA 3DQZA 3NCHA 4RA6B 2FPGB 1I0ZA 4HXYA 1DJQA 4H9GA 4PIMA 2N46A 5AM4A 5EJ9A 1JALA 5TARA 2OXIA 3J7AC 3ADDA 1MZVA 1CT9A 2QLJA 3DO8A 3MW8A 3UOGA 3ZKWB 1QYCA 2JANA 2GZRA 3CF4A 4TKVA 3OFSA 4JP1A 2X3UA 1I6MA 3G2HA 3OG9A 4HDMB 2C4VA 4J16A 3DB2A 3I6BA 4K8OA 3ITKA 4C7XA 2BVNA 2HMWA 1EFPB 2Z6VA 4DA9A 4DZZA 3IIEA 1SUEA 2F9MA 4WNAA 3EXIA 5FYDA 2YRWA 1P0PA 1D2GA 1X1QA 3G2NA 3URKA 4C5BA 3OCYA 1UP7A 4PG8A 4LZPA 2ZVJA 3DHNA 3O3MB 4MPRA 1VIVA 2VWQA 3OJOA 2BTQA 3HRKA 2JI9A 3U49A 3ICEA 1TMKA 1CNFA 1UJ4A 1YR2A 4H1UA 1MOPA 3C97A 3UWKA 3SJ7A 5BN4A 1LPSA 4KMRA 2EL9A 4NFSA 2QB5A 2BGLA 4DLXA 1QP0A 1UANA 1H4VB 4ZCSA 1C2TA 4X20A 5HKLA 2XTAA 3IEMA 2J0EA 2R6JA 2PH7A 4B7XA 1EK6A 3AVVA 1G1MA 2P9EA 3EG9B 2GK3A 1NU6A 2X4GA 3HU1A 3MJSA 5JSHA 5D1NA 4MRRA 3S81A 5JYCA 1GFZA 5BSMA 4E51A 4U8GA 1SAYA 4MVJI 1X77A 2HA5A 3IXMA 4ES6A 5JW6A 4UTPA 2XB8A 1I4TD 1CJMA 2YMLA 5PGMA 4QODA 1V11A 3KT3A 3OC6A 4LGVA 2PWYA 1KETA 2LXNA 3DOIA 4QGGA 3DFUA 2F6RA 5IHPA 1WZCA 4CMHA 3BM5A 5CCXA 3MBOA 1HGXA 5DCLA 2J08A 4C78A 3NC1C 5LDGA 5CT5A 5JO0A 1D4OA 2ORIA 1GGKA 3IA2A 1PQ4A 5BN5A 3GLKA 3FOEC 2PUBA 2E2WA 4NHEA 1AQIA 2AW3A 2WFMA 3H8JA 3LCRA 5EWJB 1QQ6A 1ZVKA 1KGDA 2VJLA 4LHZA 1Q57A 1LVHA 2VYVD 4JOSA 3JRWA 3GXOA 2NTYC 3CRW1 1K8YB 3Q9SA 4IINA 1GQFA 3F6CA 3IS3A 3ZJ5A 3ZCUA 4A2QA 1T5LA 3C5CA 2WIBA 4DIBA 2WV7A 4J0IA 3DTNA 2RIRA 1A1VA 5CMLA 1P4HA 1YZFA 1UZMA 2QUJA 4EI8A 3U4QA 5FF9A 1KVSA 3IH5A 3DBRA 1R0YA 4E13A 1JBKA 1UBJS 2JA2A 1R0BA 2OCDA 2BRUC 4OX9B 4UE3S 3ZHCA 3SC2A 4MUEA 1EGVB 4IM7A 3GFPA 3R7SA 2I2BA 3L18A 4D6XA 3LNTA 2ZROA 3WLPA 3WHPA 5J2UA 1XTUA 1AZLA 2FR0A 3H6HA 4QECA 4C0KA 1WSDA 1OR8A 3NLLA 4M87A 3I83A 5EZYA 2Y1WA 3I01A 4GRAA 1B15A 1C8VB 2AFHE 4WTOA 4XIYA 4B3IA 1DAHA 4LJ9A 1O57A 3S1LA 2JIRA 2MSEB 4XFJA 4RACA 2JHGA 3T7RA 3RKRA 1J9EA 2IUUA 1WQ3A 3GEBA 5LIRA 4GOOD 2JGEA 2ZIAA 4MUFA 5FUYA 4D96A 1HV8A 4DJDC 1KO7A 1S8FA 2YN2A 3N7AA 4LE0A 4X0EA 2JRLA 1NASA 4IR7A 3ER9A 2H5LA 3WWCA 2VHZA 5K0NA 4LFBB 1Y1RA 2DPLA 5L45A 1ZYUA 1Y5NA 4KJZA 3ZW7A 1GA1A 1PJZA 2YH2A 3UMVA 4DJAA 1WOMA 4Y6GB 1VA4A 4TXHA 3HZHA 3RYCB 2JH8A 2C29D 3LPDA 4ZVVA 1FC0A 4X54A 4DCGA 4UVEA 4M6WB 4NYMR 2ZE6A 4KG7A 1LSSA 1QYDA 3FDFA 5DXAA 4EZEA 3FUVA 5A4MS 4WKNA 3QKSB 3DKPA 1QIMA 1WXEA 4EHBA 3H9GA 5JIBA 1R0RE 3D5TA 2LCQA 3UPDA 5MN6A 4LK2A 4C20A 4ZAZA 1G5IA 3ZV5A 4EJSB 2OVFA 5T7BA 1U0SY 2Y2VA 4TMZA 1AV6A 3L7MA 2WE7A 1SM4A 2ZTSA 2IKQA 1SCBA 1F2TB 1NQ5A 2PUWA 4HSEA 3ZG6A 3R0VA 2QVBA 2CNWA 2DPMA 3CCBA 1NVWQ 4OQZA 5FKJA 3V00A 2GVNA 1AZTA 1ACLA 2O8VA 4Q02A 3W7BA 5C31A 1CPYA 3LC7O 1OXVA 4LMRA 4TWJA 2X41A 3VVCA 2DUMA 2W4QA 3TZLA 3BD6A 1VE9A 2O0KA 4L2IB 3RK1A 3RYHA 2NTVA 2NUPA 3CW2A 1JHZA 3KQVA 3PIIA 1BS2A 5I9SA 1YS7A 4GD3Q 3L4SO 5LP6A 2RHLA 5IYZA 1JMVA 4FB5A 1E2QA 3PDWA 3H2SA 3S55A 4AJHA 5AVUA 4PZCA 4AZ3B 4D4IA 2ZUBA 3AQ4A 3HJUA 1JDPA 4N47A 4EX7A 3WGNA 3AERB 3CLRC 1W87A 4IX1A 2A1UB 1O5IA 2PD6A 4OL0A 3TW0A 1EX6A 5DCUA 3LYHA 3U6KA 3RRZA 4IIJB 5IC6A 4G9GA 2LE0A 2OUIA 1RRMA 2I7XA 3E3OA 3RHZA 4ZCMA 5CVTA 1K7FB 3GH1A 4LE1A 4UE6A 2QTBA 4TS4A 2OO5A 1TM7E 3TNDA 1ZHFA 3OOWA 4Z1MD 1ZMBA 2Z6UA 4MQ5A 1YJXA 3D2BA 3KETA 3JQRA 3ZCPA 4YRMA 2W11A 3FUXA 2ZUVA 4HVLA 1WULS 2XNJA 3IQFA 5F5LA 1QR6A 2R96A 2WBLC 3K09A 4RCVA 5TIIA 1DV1A 2DHEA 5FWNA 5D51S 1E1KA 2Q07A 4YDSA 1JQLB 2GJ9A 5ITWA 1U2DA 4JC0A 1KO5A 2XNCA 3RT9A 1ZK3A 2WT4A 4TMFA 2Q1XA 4ZT4A 3AFHA 4XFDA 4Q3AA 3GLFE 3C98A 3WLKX 2BMAA 2LP4Y 2V6JA 5KNDA 3U4MA 1VHWA 3LLMA 4AKIA 1J2UA 4B75A 1SRRA 2Y93A 4J9UE 1OVGA 1YTLA 1FYVA 2ORYA 1VKHA 2PZBA 2QKYA 1YT5A 3K9BA 3N3AC 4JT2A 1RPJA 4MITA 4CF4A 3EIOA 1Y8ZA 5F4ZA 2HK8A 3CEPB 4S0ZA 4Q19A 1VL8A 1IHUA 2XX3A 5B2ZA 5A4FS 3L4KA 4H16A 1P4AA 4DR5B 5ALKA 2FW8A 1I3LA 3BERA 3OKAA 4L3VA 4UHBA 3RC9A 4ARUA 4H1WA 3BWEA