3T12A

Mgla in complex with mglb in transition state
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
182
structure length
176
Chain Sequence
b'INFKIVYYGPGLSGKTTNLKWIYSKVPEGRKGEMVSLATEDERTLFFDFLPLDIKTRFHLYTVPGQVFYNASRKLILRGVDGIVFVADSAPNRLRANAESMRNMRENLAEYGLTLDDVPIVIQVNKRDLPDALPVEMVRAVVDPEGKFPVLEAVATEGKGVFETLKEVSRLVLARV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gliding protein mglA
molecule tags Hydrolase/signaling protein
source organism Thermus thermophilus
publication title Structural analysis of the Ras-like G protein MglA and its cognate GAP MglB and implications for bacterial polarity.
pubmed doi rcsb
total genus 60
structure length 176
sequence length 182
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2011-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3t12A00
1NF3A 2WWXA 2YOFA 1GKYA 2X2FA 2IYZA 2NPFA 2VYFA 4JL6A 1UF9A 4BUJA 2OLKA 4Q4JA 1QHIA 4C4PA 4DC9A 5HCNA 3OIYA 1G6OA 3IEVA 1YRBA 1L4UA 1G5RA 1T4GA 2GXUA 4XD7D 5G3YA 1G5PA 1WQ1R 4QGGA 4NYIQ 5CB8A 1M2OB 2GJSA 3O47A 1GRNA 1XNJA 5TXGA 2AWNA 3EZFA 3C5HA 3FGNA 3CPJB 2D2FA 1E0AA 3GJ6A 1Z5ZA 1ZUHA 2PMDA 3U7GA 2IX3A 1W36C 4V0KA 1EFUA 4TL6A 4WZAE 1E94E 1XCPA 4UNRA 2AFHE 2CVHA 3SJAA 2ZU6A 4HYYA 4I99A 2J87A 3HPRA 1TQ6A 3IPXA 2W6JD 3A1SA 3I92A 2GK6A 4Q7LA 4EKDA 2XTNA 4ZIRA 4PANA 4DHEA 5H8WA 2DFKB 3NG1A 2REXB 5DN6A 5FTKA 3EPKA 3EA5A 1JR3E 1O87A 1W4AA 2ODBA 4UXHA 4DVGA 4E22A 1RJ9B 3GP8A 2H17A 1EGAA 2J46A 3CRMA 3KQUA 2HLDA 1VECA 3PXGA 3RS3A 2QP3A 1ZNWA 2FGJA 4QNMA 4Q9KA 1KY2A 3WNCA 2V55B 1YRAA 2OT3B 1HH4A 2F7SA 3NEJA 3AUYA 5G40A 4ZKDA 2RGNC 1OB2A 3JZMA 2ERYA 3THXB 3A36A 5CIWA 4E07A 4N3NA 2HJGA 3BORA 4XWAA 4JL8A 1ZIOA 1GRQA 5EXTA 1GOTA 1WDTA 4PPGA 3SC3A 4AY2A 4NU0A 1WP9A 3KQHA 1EG7A 4JSTA 1QHGA 4MGKR 3I61A 3GJ8A 1X8JA 4UNQA 1PVOA 1QHYA 1RRFA 3MGCA 3KQKA 1N5KA 4G1UC 1GKIA 4TMZA 3B9PA 4D81A 1KAGA 1UBGA 4D4LA 4DWJA 1Z29A 5EXSA 4BRWA 4F4JA 2DYKA 4XH9B 3FKSA 1TADA 4LWZA 1BKDR 1OXXK 3K09A 4OJQA 1XF9A 3MUFA 3O8RA 4LPKA 4ABYA 1P75A 2ERXA 2GXSA 2HCBA 4C2TA 4A0FA 4TYWA 5L3RA 1CBUA 1NBMA 3B7GA 1Z2AA 1NSTA 1OFTA 2YZ2A 1XJ0A 1CR1A 1R7RA 3K9LA 3T5GA 5AUPB 1GKUB 3BB1A 1XMSA 2FEMA 2OEPA 4L5BA 2O0JA 3MWYW 4RZ2A 2VO1A 5CK4A 1TF5A 1KI1A 1XJCA 3WHKA 2ZTSA 2UZ3A 3BFKA 4TYNA 5F9HA 3NDBB 4M1WA 3AVXA 1K8RA 1E2MA 1E79A 4WBSA 1E2QA 1OFIA 2ZSBA 5FOSA 2WKQA 3K0EA 5BQ5A 3VNVA 2LKDA 3E70C 4HLUA 4P4SA 3CWZA 1DOAA 3C14C 2JLWA 2F1IA 3IKJA 3QBVA 4LYHA 3GLFE 1VHLA 1JECA 2DWOA 4ZCLA 2C03A 2WWHA 4P4UA 1EWQA 4RKFA 1TUEA 5TARA 4C0AC 5EP3A 4W5WA 4NTZA 3KXIA 4URXR 2WAYA 4PC7A 1KI6B 4A2QA 3FKSD 2W58A 3HYTA 3NC1C 4V0NA 1OH6A 5CYOA 4DZZA 2GK7A 3DVLA 1FZQA 3TRFA 2JDID 2QT0A 4IOLA 5AJVB 4G01B 5JWHA 2VRWA 5CDFA 3IIJA 4XSGA 3I62A 4DB4A 3TUIC 2JIZA 1NY6A 4RCZA 3QXCA 3EXAA 4I81A 5JEDA 2O8FA 3AVOA 3HDTA 4JT4A 1OKKD 4TWZA 2ZU0C 3WYGA 1AKYA 1T0HB 2CCGA 2RGAA 2GWHA 3LX5A 2D2EA 2MSCB 1W0KD 2VLIA 4OQMA 2OO7A 1AS0A 1Z07A 2GZAA 3LXRA 4FCWA 3O8DA 1O3YA 4BZPA 2QQ0A 3SHFA 4M9QA 1DVRA 4YDSA 1RVDA 1R0ZA 2C9CA 3TK1A 1P72A 1TF7A 2NOAA 4MDFA 2XEXA 5DH9A 3T15A 4V03A 1WE2A 5EXPA 1X8LA 1IY0A 1SGWA 2FJUA 1GNPA 1U0JA 3A1WA 1X1SA 4JSYA 3VR5A 1LF5A 3SFVA 1N5JA 1IAQA 3PEVA 1GWNA 1UADA 2AL7A 5KSYA 2JLYA 2XOKD 2EVWX 2ZS9A 3TR0A 3RS0A 2Q3HA 2CJWA 4PC3A 2J45A 1UKZA 3MWJA 1W36D 4B3DA 4OI0A 2N1BA 1CKEA 4O0MA 2QU8A 4QBGB 3WBJA 4KFRA 1KMHB 3RABA 4QJ3A 1F2UA 3GLGE 1YE8A 3VHXA 4JKIA 3V4RA 2PZGA 3LVRE 2J9RA 4B3XA 2HYDA 2GAOA 4JLJA 3CR8A 1U81A 3KB2A 4D4JA 1DADA 1J90A 4PFSA 3SYKA 4CVNA 3GJ7A 4TQ9A 1Z0KA 1AKEA 3H4MA 3X1DA 2Q3MA 5FL7D 1ZC4A 3MG9A 4CEHA 1UEJA 3ZIAA 1Y63A 2E1RA 2FF7A 1DO0A 2BMDA 2QL6A 3V4FA 2IXEA 1CJKC 4XD7A 4PC6A 1CU1A 2QMUA 1OXSC 3EASA 3EZ6A 4B34A 2YOGA 2A5YB 4G5OA 4A8JA 3LRPA 3U60B 1UJ2A 2REOA 3K70D 3RS7A 4GOKA 4KFUA 3FOZA 5FUVA 1SQ5A 2V54A 2DBYA 1E1RD 1AZTA 1KI7A 1NSFA 3QEOA 5GJWC 3PR1A 1FTSA 1U90A 3FFAA 4BLQA 1HEIA 2CJWB 3KJEA 2YC2C 3DMDA 4LJ6A 4UNPA 1E3MA 2FX3A 2NO1A 4DLYA 3SN6A 5KSZA 2GAAA 1A1VA 2O8EB 1R6BX 2VEDA 2X1VA 4U00A 1WXQA 1N5IA 2BBTA 1R10A 2MSEB 2QPAA 3K8YA 3P32A 1U9IA 1XPRA 2G3YA 4QM7A 1DPFA 3P1JA 2ZJYA 4O25A 2OSBA 3LW7A 2W2TA 2QQEA 3AVTA 5JECA 5JEEA 4D82A 3KXLA 1LS6A 2JLVA 4B32A 4BFTA 4BRUA 2NGRA 4PTLA 4YONB 3A4NA 1W44A 2ZR9A 2B8TA 4RD6A 2N46A 1X8KA 4HLQB 2J7PD 1R0YA 1E2FA 1Q57A 5JRJA 3F0TA 2FNAA 2ZI9A 3B82A 1L2TA 3AKYA 3LBIA 4MKFA 1MO6A 2BMEA 3VR2A 2ZRCA 2VF7A 3S1AA 3TSZA 1DG3A 5AJZA 3BWDD 5FPHA 1S3GA 3EWAA 4U02A 1DO2A 4KCGA 2ZS7A 2ZREA 4A82A 3QQ5A 4A36A 1BO6A 1I4DD 2IXGA 2JJ8A 3I73A 4JLMA 4IDPA 1IXZA 3ZZTA 2BDTA 5TV2A 3X1XA 2A30A 1LFDB 1FL9A 3OE7A 2WJYA 1MH1A 4LHXA 1CLUA 2H8KA 3ETLA 4BLTA 1AGPA 1D2MA 4IDHA 4NCHA 3C15C 4V0ME 3I4LA 2GCOA 4JVMA 1WF3A 1IQPA 1M74A 1YZKA 3BRWD 1P4SA 2JJ1D 2FU5C 5IDVA 1TX4B 2O8EA 3CRQA 3TR5A 5JRZA 4M22A 2VPPA 2DPXA 2EYUA 5J4YA 3NXSA 4NMMA 3CPHA 1XTRA 5JSZA 5DI3B 3TKLA 4Q1BA 5JWOA 4HUQA 5DE3A 1Z6XA 1IONA 3I72A 1Q3TA 2IEYA 2GXQA 2RGGA 2ANCA 2HLDD 3ZQ6A 5TY0A 1ETUA 4OI1A 5J4HA 3GLIA 3CNLA 4F93B 1RFLA 2FFAA 4HI0E 1X1RA 2B6HA 2IYUA 3CRRA 3LVQE 3K70C 1FNMA 2GESA 2FWRA 5HTKA 2ZE7A 1N6LA 4US0R 4B71A 1G3MA 4WW0A 2ZJ8A 3PUVA 4LBVA 1SXJA 3C7KA 4MQBA 3K70B 4HAWA 5FBVB 2GETA 2QROA 4EJSC 2V3CC 2OM2A 4IDQA 1Z8FA 4MDEA 5KNCA 5IF9A 2LWIA 4DCTA 5FOTA 1TF2A 1LY1A 5KOYA 1NKSA 3KKOA 1OYYA 1XEWY 4P0TA 4PAQA 1KI9A 1OV4A 2YINC 2O0HA 4ZV4A 5IK2D 2Z83A 1IN8A 3QEJA 1MT0A 1RIFA 1CULC 3WP0A 4KFTA 3IO3A 2KE5A 1AM4D 4GPTA 2GEVA 3SS8A 4WOPA 3AEZA 2OUKA 3D3QA 2V7QA 2C96A 5D3QA 2OG2A 1G7SA 2UKDA 1ZM4A 5CLLA 1XTSA 5BXQC 1XTQA 4ARZB 4TYQA 5DI3A 1T3SA 2J1LA 5F2EA 4FMCF 1BIFA 2OBMA 3Q3JB 4CZ2A 4D80A 1FX0A 2WTUA 2V7QD 5DNYB 3TH5A 3ONWA 2CEAA 1KYIA 1T5IA 2P67A 5GVSA 4KODA 3BJIC 4MRVA 3SDZA 2AD1A 4R2HA 4DBLC 2QBYB 1E2KA 1R5NA 2CVFA 2R9VA 2AKAB 4EPWA 2C5LA 2QTVB 1NN3A 3B1YA 2O8DB 1DEKA 2V4ZA 2F43B 1II9A 4Q47A 5FBQB 2FZ4A 2QORA 3MMPA 4MUBA 1P2TA 3OEHD 5IT5A 3ADBA 3VFDA 1QHHB 2Q9CA 4IXNA 1N6HA 4PAMA 4OL0A 2NTYC 4DDVA 1QVAA 4A15A 4AK9A 3ZQJA 1YQTA 4BFSA 5JI2E 1COWD 1NLFA 3FE2A 2O8BB 1VG8A 3D8BA 4JIMA 1SKYE 4V0OA 3AUXA 2Z0MA 4LSGA 3VR3A 1E2JA 2R6GA 1P5ZB 2PT7A 3KQNA 3RSOA 1KI4A 3WHLA 3H1TA 1E2GA 3HU3A 4L15A 1L8QA 5HZKA 1XJQA 2QGNA 2HCJB 2VA8A 4BLSA 4ACAA 2CLDX 2BHRA 4AI6A 1NVUQ 1XD2B 2CLSA 3GJ4A 3TSWA 1SXJE 5C2JB 3FB4A 1CEEA 2LCFA 2D3WA 1OIWA 5SZJA 3TGPA 3EIQA 4CEHB 2N42A 1JR3D 2XTMA 1GP2A 3DMNA 1S96A 1AIPA 1QRAA 4HZUB 4LV6A 4PQRA 4B6EA 1U8ZA 5L3QA 1T91A 1X6VA 2I3BA 2CCKA 2CL6X 1FNNA 2WAXA 4HB4A 1Q1BA 2OCPA 4Q7KA 5G53C 521PA 5C46F 1E9AA 1HTWA 2XAUA 4D0NA 3N5CA 1LF0A 1Q20A 2XOKA 2X19A 3CONA 4C30A 4AKHA 3B8HA 3SI7A 2BMJA 2HT6A 3QPWA 4KO8A 4ACBA 1G19A 2O52A 4HLDA 1KNQA 3W3AA 3B1WA 2ZRKA 3PV0A 3SJZA 4YLGA 1RRPA 1QF9A 2IBMA 2WHXA 5CJPA 5B57C 3FPAA 1AA9A 2CHGA 2ODNA 3NIBA 5IHPA 4XTCS 5FI0B 3HR8A 2QE7D 2G6BA 3P20A 4GZLA 3RC3A 1SXJC 1JXMA 2D06A 2J0QA 1RC8A 4LOAA 1Z0IA 2XJ4A 1US8A 2ZSEA 1GAJA 2JLUA 1A2KC 1IY2A 1Z28A 4I1UA 1C1YA 1ZNXA 1ZCBA 2NG1A 1TEVA 2CNWD 2R62A 3F8TA 4QHSA 2ZETA 2BBOA 3IHWA 3TIFA 2DWQA 1J8MF 3QXJA 3AP3A 2OCBA 4JBWA 3KXKA 1E9DA 1CR4A 1ZVQA 2ZYWX 3NTUA 5B30A 1W0KA 4PO9A 3KDSE 1EESA 1NVVQ 4Q9HA 5BN3A 3U4QB 3IBGA 1E0SA 4PQYA 4LJ9A 5EZ6B 2V1UA 4BFXA 5G3ZA 4FMDF 3CF0A 4IVPA 3CLVA 1S0UA 2CL0X 5L3QB 3LH5A 3FMIA 2DFTA 4C0SA 3QVUA 1Z6AA 4X8OA 4OK6A 2FN4A 3OZXA 3B6EA 4E5UA 5BN5A 1E0JA 1V5WA 4TLEA 3FDIA 2JDIA 2CK3A 1XDBA 3K0CA 3OEEA 4AKIA 4HAVA 3PJRA 4M2LA 5HKKA 1P2SA 4MH0R 1CJUC 4C0KA 3TAUA 2WV9A 3FHCB 1NL3A 2BBSA 3T5DA 4US1R 2WJVA 5C1BA 2ZVQX 1G7RA 2F3RA 1N3BA 3E1SA 3L43A 5DHFA 5BW8A 4I1OA 2Z43A 1VG9B 1ZUNB 3EG5A 4QBHA 3VU9A 2ZQ5A 3BS4A 5K8TA 4Q1EA 5JMTA 1E99A 1NN5A 1FOEB 2A2ZA 1RW4A 4C0JA 2QAGB 1P61B 4R2IA 1BOFA 1OYWA 1E2LA 1D8TA 2Z5FA 3TAHA 1TAGA 4ILEA 4OBEA 1NRJB 2WIBA 1SULA 1TEXA 2ZI3A 3QKSA 2AXNA 3CKLA 3CNNA 1G64A 3G5UA 3WY9A 4JVLA 2QUZA 2X2EA 3PENA 1EFHA 4CRWB 4DLRA 2ZRGA 2QRNA 4BECA 1KK1A 3KKMA 3AP2A 5JLJA 2R6AA 4I1VA 2ZIAA 1KAOA 4JKYA 1U0LA 3NWJA 4TMWA 3RVBA 4A1FA 4PZZA 3EIHA 1SXJD 3MJHA 4GP7A 2IWHA 2NQ2C 1HE8B 1D2EA 1W49A 3K53A 4HB2A 2OFXA 3VR6A 2VP6A 2IYVA 3W5IA 3WMFA 2YOHA 3I3SR 2BC9A 5FUXA 1Q3HA 1DAGA 4Q48A 4O2LA 5E7IA 1TQ4A 2RHDA 3WMGA 3U6BA 2XGJA 2EFHB 3DKVA 3DM5A 4UNNA 1OXUA 1SVWA 1DARA 2AWOA 1GL9B 2XNSA 1U9IC 2O8DA 2KI5A 1NN1A 3SQWA 2ATXA 3MFYA 2ZSDA 5J47A 4MYUA 4Y0VA 3Q85A 5JHGB 3B5JA 2IYXA 2XX3A 2OCYC 2AFIE 3T61A 3VR4A 2ZYTX 2QAGA 4W9MC 3ZD7A 3P4XA 2ZRBA 1KO4A 4TYPA 5FUYA 1FX0B 2CHQA 4ITRC 4DB2A 2QRZA 3LAWA 1HA3A 2VF8A 1KJYA 1ZIPA 4MRPA 4BLOA 4LDJA 4CT5A 2R65A 3EIEA 4Q4AB 3AKDA 3DL0A 1FMJA 3RC8A 1II8B 5P21A 3EC1A 2GEUA 1G9XA 4EPYA 1W36B 1T5LA 3IILA 4JYBA 4Q01A 4RZXA 1SVKA 3H0KA 3SQXA 3N2EA 1OPXA 4FW9A 3CRW1 3QE0A 3TVTA 3F3YA 4A6XA 4YXWA 4OHVA 4TZ0A 1MO4A 4AG5A 5E4FA 2O5VA 1OXTA 1ZC3A 1F2TA 1W47A 4JVNA 1N0VC 4FCVA 3RWMB 4MRRA 2W0SA 2R6DA 1Q22A 4FINA 4E09A 3QKUA 3H84A 4Q1AA 5FOXA 2ZSAA 3JVVA 3W9YA 1E1QD 1W2HA 4DCSA 4TMVA 5AUQA 4DDWA 2BM0A 3T12A 4RD3A 2HT1A 1T6NA 2YWHA 5EJEA 1CRQA 4NYJQ 1XZQA 2G1JA 1JXOA 4LJ8A 1Z0JA 2O8BA 1E79D 3HU1A 3PEUA 3EPHA 3UKDA 4V0LA 5LPNA 5KSPA 2ZRNA 1NG1A 5LD2B 2A5FA 3TUJC 1XTJA 2VQSA 1NVXQ 2WPDD 4IFBA 4BFYA 2IUTA 3EPLA 2BKUA 4CF7A 3PQCA 4PPFA 2YNMA 1N6KA 1ZJ6A 2J7KA 3NKVA 4PSVA 3HJNA 4RD0A 1P62B 1VIAA 2F9LA 1FUKA 4Q18A 1TPZA 5JCZA 2SHKA 2F55A 3KFVA 1UM8A 2OE2A 4Z54A 1T3LA 5DHAA 5JCPA 2GHIA 1KOFA 2BVNA 2FFQA 4HZUA 1ESNA 3A4LA 2IYTA 3PIRA 2CMKA 4FWTA 2WM9B 1XEWX 3W6NA 4GFDA 2XNDA 1OIVA 3U4QA 1TU3A 4ZDIA 1E1RA 2YVUA 2J0VA 3ZIAD 3AF2A 4JLDA 3AVUA 1KSHA 1NY5A 2EWVA 1ZINA 2ATVA 2GEDA 1I4TD 2P5SA 2YHSA 1KDTA 2I1VB 3THXA 3CM0A 1JI0A 1E1QA 2QMEA 2OLJA 4B76A 5C4MA 1Z47A 3REGA 3V9PA 4ZI3A 4XVRA 3WRYC 3LNCA 4RSGA 1UFQA 4KITB 1F5NA 2QT1A 5KO2A 4A0RA 5A0FA 1XMVA 3ZS9A 1PLKA 3K9NA 3R8CA 1HT2E 3CNOA 3NBYC 3NEYA 2X77A 3P27A 1MRNA 5FPSA 3GEIA 4UJ3A 2ZI6A 4JJKA 3UWOA 4PX9A 1HUQA 3NC0C 3QIAA 4NZYA 1P6XA 5FI1B 3SBEA 3LBNA 4IW3B 4B73A 3T06B 4RFSB 4C0HA 3X1YA 1KKLA 2KJQA 3CF2A 4LX0A 3QKRB 3RRYA 1DE0A 4OQNA 4C7OB 3IPYA 2FPLA 3GJXC 4PC2A 5SZIA 3X2SA 3CIOA 2AXPA 3IBYA 2R6CA 3AH8A 4PPQA 2RGDA 2IHYA 4YDHB 5DISB 3ZDQA 4HLUC 4JZKA 2P2LA 1XRJA 2D7DA 1U8AA 2MMGA 3ZZ0A 2QSYA 4ZDJA 4DSTA 3LQQA 4ZO4A 2IS6A 3B85A 3HU2A 2VL7A 2GTPA 3CH4B 4LHWA 4XTRA 4CYMA 2GXAA 2YC4C 3L8ZA 5FL3A 4B43A 1U0HC 4DT1A 4QGAA 3QSYA 1HT1E 3WRXC 3AF3A 3Q7QA 1Z0DA 2C78A 2GNOA 2WMOB 3ZVRA 2FFBA 3L0IB 2XSZA 2EQBA 2P65A 2YYZA 4B3CA 5A4JA 4PPNA 1X86B 4N0DA 5JFGA 5GVRA 3QKSB 5JJIA 4HDOB 4OK5A 5UKDA 3THWA 2GRJA 1VPLA 3VKHA 2FV8A 3WP1B 5IRCD 4CEJB 1G5TA 1II0A 1KDRA 1UDXA 4R98A 2C9OA 2LKCA 2OFOA 3ZYCA 3NH6A 5DO9A 2ZJAA 3B9QA 4JMPA 2HV8A 4X8MA 4E03A 3KJIA 5GADl 2QP4A 2VSFA 4HEJA 3KTAB 1H8ED 3E5HA 3LV8A 1AN0A 4C9BA 1N2CE 4M9XA 3ZGXA 2H1LA 2KBFA 2G88A 4NYMQ 4HAYA 1GITA 2PBRA 1MKYA 2HUPA 3UMFA 4OQLA 4QGHA 4TLDA 3SHWA 2QG6A 5LB2A 2ZJ5A 4A0HA 5HCIA 3M4YA 5J40A 2AKYA 4EQ6A 1GNRA 2AK3A 1G8PA 4C3ZA 2IS2A 1TMKA 2CK3D 2JEOA 3OEED 2NO9A 4BPBA 2P6RA 4V0MA 1YZQA 1VHTA 5HR5A 3BBPA 4KVGA 1WA5A 4POAA 3FYHA 4GMXA 3B1ZA 4DLSA 621PA 2Y8EA 3CO5A 3NVAA 5FOVA 2YJTD 3VHLB 1UKVY 4TL8A 4NCJA 2UVQA 2B21A 3BAFA 3PEYA 4A9AA 2OXRA 1XMJA 3N2IA 5FOUA 3SJCA 2WWIA 2VIIA 3RYTC 1XWIA 4XSHA 4FN5A 4CEJA 2J0UA 2WSMA 5TMPA 3KL4A 1F6BA 4F7WA 2J0SA 1YZTA 3DOEA 1IXRC 1M7BA 4M4SA 4B74A 4KU4A 2DFNA 4LC0A 3X1WA 4NPHA 5KSOA 1G20E 1QHNA 5EE3A 2JA1A 1CRPA 4ARZA 4BLRA 2I4IA 1F60A 3OHMA 1F2UB 2GJ8A 3B1XA 4R7ZA 4KXFB 1E69A 5EUQB 3MD0A 1HYQA 2F9MA 1F2TB 2ZS8A 3FVQA 4JVSB 1E9CA 5FUWA 4G5SA 1CTQA 1P9WA 4O2RA 3QXSA 1YR7A 4JLAA 2AN9A 4URUR 1NMXA 4A2PA 1ONBA 2PT5A 2A5DA 3FWYA 4DLUA 3TJZA 4MKIA 3VKGA 1M6NA 4GT1A 3KJHA 1HURA 1KGDA 3FMOB 1IJEA 4RZ3A 4URZR 3W6PA 1ODFA 5H68A 3L82B 2F6RA 5BN4A 1XD9A 3MSXA 3Q5DA 1E2EA 1NVVR 1GIAA 3LQRA 3BE4A 2OFWA 4MYHA 3K1JA 4QGFA 3UG7A 3I8XA 3ZLJA 1SHKA 2C04A 4ASUD 1CIPA 5B2ZA 4QFMA 1ELOA 1VYUA 1XEXB 1XBTA 5TDHA 4DEYA 2H18A 2VTKA 3K0CC 2J0UB 4RY2A 1S2MA 4ZI2A 3EC2A 3PUXA 2V6IA 2JLRA 1RE0A 3DOFA 4B75A 5BYJA 4XWKA 4GOJA 4OHWA 2WKRA 5A5GA 4JLKA 4RVCA 2FE4A 1XXHB 3RHFA 1P7CA 4A8JC 1I4LD 2HYIC 2FSFA 1KSFX 3VR1A 421PA 4A2WA 2W6JA 4DCNA 2AK2A 2DY1A 2F43A 4JBXA 2G1KA 3TUZC 1AQYA 2ZYUX 4B3GA 1DTSA 1M34E 5HE9A 1AS2A 1G3UA 1TQDA 2PZEA 2ZPTX 2ZJ2A 1SZPA 3LLMA 2G9NA 3QKRA 3T1QA 1DAMA 4C7OA 2IYYA 3KJGA 5CM9C 3AF1A 2B8WA 1OFHA 1TL7C 2R8RA 1W46A 4P31A 2RGNA 3B60A 4KLZA 5AUOB 1CJMA 2EFEB 1U99A 3UK6A 5E3HA 4ZDKA 1NN0A 3SR0A 3V00A 1QVRA 1OW3B 2GVDC 2IXFA 4X8LA 3S1AB 2W00A 3VQTA 3VTKA 2ZI5A 1P9RA 4AURA 3VNUA 4OJKA 1JQJC 4Q00A 2IWRA 5LBIA 2QAGC 1LVGA 2REBA 1Z06A 3CWQA 1KO1A 1H8HA 4G5RA 5H1YA 1DAHA 3K0FB 2ZEJA 1ZD8A 1GM5A 1CJVC 2K5UA 2ZYVX 4DUGD 1KNXA 3AQ4A 1KY3A 4LI0A 3QJYA 3AGQA 3CR7A 3R9IA 3MRSA 3W5JA 3TW8B 4GRAA 4DCUA 5BWMA 5FH9A 3BFVA 3MWKA 2GZHA 3ADDA 2RKOA 2Q0HA 1G21E 2AR7A 4OI2A 5FR1A 2YWFA 4IVQA 3PG5A 4LPSA 3PCRB 5CK5A 1KK2A 4DLTA 1SVMA 1W7AA 3BIFA 3ADCA 1NBME 4Q7JB 1ZD1A 4PHTA 1H8EA 1ZM7A 2RGXA 3W8RA 3IGFA 3SOPA 3TVDA 4H1UA 4NP6A 2GJKA 3GLIB 1C4OA 3CZPA 5EP4A 3RSLA 2EFDB 4GI7A 1EFRD 2IYRA 5J4KA 1HE1C 4LJAA 4OHZA 3ECCA 1NBMD 4GNKA 5FTMA 3QPUA 4DT1B 1N6IA 5JS7A 4JS0A 4NYJR 4TLBA 2WBLC 4U7DA 3K9HA 1NIJA 2ZRFA 1XFAA 4I4LA 4L9WA 1W2GA 2MSDB 2IT1A 4BWYA 3PFIA 1D2NA 1G41A 2QEQA 2HEIA 1AZSC 1XPOA 3ZJYA 2WZQA 4Q03A 3R8FA 2FOLA 4Q4LA 1ZW6A 2VBCA 3K0FA 4D0GA 3THWB 2GVZC 3EWSA 3KTAA 3GMTA 4G5QA 1RZ3A 1G18A 4P4SB 3WMEA 5FPYA 2PX0A 4D2IA 3AVWA 3EAQA 3ND9A 1JJVA 1E2DA 1N6OA 2Q9BA 3GLHB 1XCGB 5EQTA 3AVPA 3QUSA 4G0NA 5FBRB 1UBEA 3BH6A 3T35A 4EJSA 3C5CA 2VHCA 3QENA 5EP2A 4Q1FA 1OHHD 4YMSA 3BERA 3I32A 4IDNA 2WIAA 4BFWA 4DSNA 2GCNA 1S8FA 2ODEA 4A6PA 4EAQA 1TU4A 3LY5A 1YZGA 3O8CA 1H65A 2P6UA 3R20A 5TB5A 4AYWA 3AV0B 2NZ8A 4DRZA 4BE7B 1ZAKA 4PQFA 2ZRAA 1IJFA 1Z0FA 1ZUIA 1AS3A 2CE2X 3I5YA 4JLPA 4O3MA 2YV5A 4LBWA 1FQJA 3QXHA 4PSKA 5C4GB 5AJYA 1S9DA 1U2RA 5HE8A 4B3FX 4DIEA 3K0AB 2WOJA 5LDDC 4A4DA 4MRSA 2RAPA 1I2MA 2NIPA 4OQFA 1PLJA 1QG4A 3VAAA 4TMTA 3OEHA 1R8SA 2FA9A 1OIXA 3QF4B 2NO0A 3T34A 4B2LA 1WB9A 2VP2A 2JAQA 2ZJOA 4URVR 1QG2A 4QL3A 2JJ2A 3FHOA 4ESVA 2IW3A 3R7WB 3T1TA 2WMNB 3WNBA 4LY6A 5EXXA 4M1KA 4KSCA 1E2NA 4DXAA 4B48A 1KK3A 1G7CA 2GJAA 1Z0AA 3CB4A 1KKMA 3U3MA 6Q21A 4LC1A 3KKPA 4LCBA 1BYIA 1VCIA 4L9SA 3MWLA 4DUGA 1MABB 3DDCA 5SZKB 4IJMA 3REFA 2PX3A 3X1ZA 4Q02A 1IHUA 3W90A 1R5BA 4QOSA 4TMKA 2B7BA 2XNDD 4FMCB 3IIKA 1E98A 1XX6A 1FP6A 1YZLA 3EA0A 4MYTA 2EWWA 1MOZA 1Q1EA 3ASZA 2FGKA 3F5FA 1PZNA 1JB1A 3Q9LA 3QI2A 4FWIB 4BGDA 2F3TA 2QI9C 1J2JA 2V1XA 4Q66C 2IYLD 1L7VC 3PUWA 5HKKD 3SEAA 5FPKA 5D3MB 1D9XA 2X8AA 4QJ5A 2XXAA 4PHHA 2ZRJA 5KDDA 3ZS8A 5E95A 3E2IA 3O8BA 5AJWA 2HDNB 4UJ5A 1NG9A 3IUYA 3UATA 2NO6A 1JBKA 2D7CA 2CCJA 3RLFA 4BFUA 2AHOA 4C0QC 3BXZA 1OXVA 2A78A 1RRGA 2EU8A 1EWRA 5J4VA 5FL7A 4LK2A 3A8TA 2AD5A 1F3OA 4KBFA 5GJCA 1ZMXA 1G4UR 3M6AA 2E87A 4G5GA 4W7SA 1QDEA 2JLSA 1T0JB 1DAFA 2QA5A 3CF6R 1XXHA 3EZ9A 2EW1A 3R9XA 2QM8A 4RKEA 3RDPA 3QF7A 4II7A 1KO7A 2BWJA 1OT3A 3LW8A 2OAP1 4Y0AA 4WAUA 2WWGA 4OK3A 2C9YA 2MMCA 1MO3A 4FCTA 5J5CA 1AJEA 1IM2A 2FEOA 2W6ID 4U5XA 1IN7A 2ODWA 2VHUA 2GILA 2CHVA 3UXMA 1YR6A 1QHXA 4G3XA 2QZ4A 3IQXA 3KFXA 4US2R 5L3SB 4DKXA 1A82A 1KDOA 4F4IA 2ZANA 2ZJBA 4IXMA 5JJLA 2WICA 4NBSA 4R71A 1YJ5A 4IHQA 2DCUA 3CH5A 5DI9A 3U3RA 3SYNA 1HQCA 4FXPA 3RAPR 2WOOA 1E0KA 2PCLA 3TE6A 3KB1A 4ASUA 2UZIR 2YWGA 5EZ5A 2W0MA 3ZH9B 4DLZA 1YZNA 4DCVA 1VCNA 5GJBA 2D4HA 1VCMA 3KKNA 3GD7A 2VHJA 5AUNB 2QM7A 4BZXA 1Q44A 1NJFA 4LJ7A 1CS4C 5KHOC 1Q0UA 3FMPB 3B78A 3K09C 3SBDA 3OFNA 4HDQB 1KIMA 3AP1A 5F3WB 2QNRA 4PZYA 5DYGA 4WXPA 3GLHE 4GSYA 1ZYUA 1ZU5A 3BB3A 4CIDA 2GF9A 3DZ8A 1KSGA 2ZM5A 4ERNA 5JBQA 2ZI7A 2V9PA 1DBSA 4TZ6A 3U3JA 1BYUA 3VX4A 2AX4A 3UIEA 2WJJA 3W8NA 4ZIRB 5FTLA 5FOWA 4DLXA 2IF0A 4MGZR 1JPJA 1YU9A 1T8UA 3FFBA 2PL3A 3GEEA 3GLHA 3CBQA 2JASA 3AB3A 2ZRDA 1YR9A 1DAKA 3EPJA 4IOJA 1EFTA 1WRBA 1Q1ZA 1WMSA 3PUYA 1IN6A 2GCPA 2ECKA 3DKPA 4KV9A 1U8YA 3GLFA 5H70A 3W34A 2H16A 2ZITA 3WYFA 1CJTC 1RKBA 2IYSA 1VIYA 1OSNA 4OYHA 1E6CA 1XXHE 2A7QA 1ZM9A 2BMFA 3CRVA 4WVFA 1FP7A 4WXRA 2ZXUA 4TSFA 4CW7A 4P33A 4C0LA 2YKGA 4C2UA 4N0EA 721PA 3OIVA 1W4CA 4RD4A 2ZE5A 3GPLA 3UANA 2OXCA 3TW4A 5K8LA 1GL6A 4RFSA 5EE1A 1W4RA 5HPYB 4ZPXA 1N0UA 2IUSA 3B2EA 4EJSB 4JL5A 1K5DA 5JSZB 1JJ7A 3QBTA 3I1FA 3J81k 2OILA 2RGBA 1E96A 4LV5B 1N6NA 4K8OA 4V02A 5IK2A 5KNDA 1R8QA 2FZLA 4Q19A 3QVVA 2ONJA 1KO8A 1G6HA 3ZZUA 4IFEA 4MYCA 4IRUB 2BEKA 3IO5A 4W5JA 4F4CA 5L3VA 2FDCA 1XEFA 1S3SA 1B0UA 1Z6GA 1ZM3A 3TQFA 4RD1A 2QE7A 1LS1A 3P4YA 1I2DA 5KUTA 3OAAD 4Q9LA 3K0AA 3ND8A 4OHXA 4D4MA 4BASA 1MABA 2VP4A 3BB4A 5JS8A 3ICQB 1KZGB 4D26A 1AK2A 5FR2A 3EZ2A 1LV7A 3RWOA 1ZCAA 2O0KA 3THYB 1D6JA 1Z3IX 2J41A 2XSZD 3QF4A 3NDPA 1DG1G 3DO6A 1OFUX 4I1SA 3AVVA 4QBFA 2F1JA 3LLUA 5LD2C 4LHZA 4HZIA 1W1WA 3HYRA 4IOMA 4B35A 2O8CA 2FG5A 4H1VA 3RS5A 2PCJA 1W5TA 1HV8A 1KTVA 3ADKA 5D3MA 1N5LA 3AF0A 1HQYE 4YQFA 3NBFA 2XXAB 1R5OA 2D74A 3KUDA 1CR0A 3B1VA 1VYVA 1OHHA 1YZUA 3CPEA 4MITA 2WKPA 3AF4A 3RRMA 3MCAA 3EW9A 2W2XA 3QNUA 1P60A 1A4RA 4DDTA 2H7VA 4Q4JB 2JJ1A 4EFNA 2ASEA 2D62A 3P26A 1KI6A 4QBIA 3U3OA 3I5XA 1ZNYA 1PUIA 1S9HA 2BIFA 4M1SA 3RRZA 4AG6A 4MKHA 2HXYA 1EX7A 3LA6A 1P2VA 3SU8A 2QMOA 4QHTA 4TL7A 3WXMA 4RZUA 2QBYA 3B13B 3UPUA 2QN6A 4HATA 1G3RA 4M1OA 2H92A 3SYLA 4PO8A 2TMKA 3EARA 1XTKA 4GP6A 4WIAA 1GTVA 1W5SA 2NMVA 1FFHA 1FTNA 3Q5EA 5FTJA 1XZPA 3G0HA 5JI3E 3WYAA 4HSEA 1QHHA 4KI0A 2HXSA 2Z4RA 1KI2A 4GOXA 4UKDA 2FPKA 1N6RA 1R2QA 2ZJZA 2ZUBA 2VH5R 3LWNA 1COWA 4QKQA 3MAAC 3R9WA 2HJVA 3W6OA 1W0JA 2BEJA 2FSGA 2XZLA 2OZEA 1WCV1 4EPRA 1S1MA 2VP5A 2IL1A 4B44A 1JAIA 2R44A 3U7EB 1N6PA 3VMFA 4F38A 2ANBA 1UDWA 1KJZA 4CEIA 4TQUS 1A2BA 4QG7A 4AKGA 1SVOA 3GLIE 4JT2A 2HF8A 5E7JA 3Q7PA 2VP9A 5JWRA 3GFOA 1GSIA 2G83A 2C98A 1FQKA 2XTZA 4OI4A 3U44B 3EX7C 3QXXA 4WZBE 1XEXA 4EPVA 4NYMR 3NBXX 4B2PA 4L16A 3PITA 3FMFA 2WJIA 1M1YE 3ASYA 4WZ6A 8OHMA 1SVSA 2P6NA 2JCSA 5F9FA 4YMTA 1LNZA 4FIDA 4Z8YA 1AGRA 5ANRB 2ZUCA 1KO5A 1KMHA 4QHYA 5L3SA 4GZMA 4DDUA 2JLQA 3AKCA 1VG0B 4JLNA 2ZR0A 1G3QA 1QZXA 1BH2A 1XMIA 4ON9A 4BLPA 2ZI4A 1GNQA 2QSZA 4XJXA 1SKYB 1E2IA 4M9ZA 4AKEA 4LBZA 1NIPA 5K8IA 3GJ5A 3CX8A 1EXMA 2FMXA 4LUCA 5JHHB 2Q21A 4OHYA 2JLZA 5DSZA 2GZDA 2RGCA 1IY1A 2XZPA 4QRHA 2ONKA 2R6FA 1UEIA 1NP6A 2WWFA 3KZ1E 3L0SA 3OFND 4H9GA 4PSAA 1R4AA 2PJRA 4QM6A 4PZLA 4KVAA 5K8UA 4Q21A 1ZNZA 2P0EA 2CNWA 2C8VA 2IYWA 4NYIR 1KSJA 1FMLA 4AD8A 1Q1QA 5TVKA 4LJ5A 1Z22A 4PAOA 4TT3D 3PEWA 5M04A 1NJGA 1Z08A 2H5EA 3H86A 5KPDA 4R9UC 5CB6A 2QPTA 4AYTA 1N25A 5KYKA 1OJLA 4RD2A 5BYKA 4LZZA 1M8PA 2PMKA 4KYUA 4KFSA 1G8FA 3A1TA 3QKTA 3U7HB 3A1UA 5F98A 2KWIA 4JLOA 4PO1A 1ZP6A 2OAQ1 2OESA 4BEJA 3ZVNA 1JR6A 1EK0A 2H57A 3GLFB 2PLRA 2B7CA 3A6PC 1NMYA 2OBNA 2OBLA 3RNLA 4DSOA 3I8SA 3C8UA 3KQLA 1DS6A 1JEEA 4YC7A 5DLQC 2JLXA 4A92A 1FPMA 1WBBA 3C41J 4KLNA 2ZVPX 4P4TA 4F91B 4KAXA 2DHRA 2WSSA 4DSUA 3OIUA 1HY3A 3N70A 5DN6D 4TTQA 1J70A 3PVSA 3D6TB 4M8NE 4MGYR 3JVUA 4Q4HA 2EFGA 2ZAMA 4TLCA 1P3JA 3RANA 3ZVMA 3ICEA 2WVJA 1MV5A 1EFRA 4D6PA 4M1MA 2RB4A 4LHVA 1DELA 4DEXA 1G1MA 4MRNA 5JJKA 3OIWA 2IS4A 4FD2A 3THYA 3U61B 1Z2CA 4CDGA 1M7GA 3FTQA 4XVQA 5FFMA 3QY0A 5AJXA 4TT3A 4UQOA 2BBWA 4LV8B 4Z8XA 4IDOA 1KZ7B 2I1QA 4JLVA 1Y3AA 1P2UA 3HWSA 2BCJQ 4HUTA 5EE5B 5B58C 4UXJA 4ZDWA 1NVWQ 1P9NA 2GCOB 4NL4H 121PA 4BZQA 2J3EA 3BFXA 4J0QA 1SKQA 4Q1DA 3OESA 3LDAA 2J7PA 4B47A 2FSHA 1G8GA 3DPUA 2RGEA 5DGXA 5FTNA 3U7FB 3EZ7A 1T9HA 4JYCA 3FKQA 4HUQB 4Q1CA 1FUUA 1R0WA 1OH7A 1JALA 5EE0A 4B33A 1JQLB 2FFHA 4NDZA 2ZSFA 1XB2A 1MRSA 1W4BA 3GJ3A 1ANKA 3CX6A 2DB3A 3UMRA 5CLQA 4C0BA 4LRWA 1G4AE 2WPDA 3LBHA 4UNSA 3T1VA 1TNDA 2Z4SA 1BS1A 1KI8A 1UBCA 4IEEA 2GBLC 3DM9B 5FBWB 4JBYA 1IXSB 4RCYA 1XPUA 4P32A 1G7TA 4LYAA 3L2OB 3RS4A 4BEBA 4M21A 3C4JA 1K6MA 4LYFA 5FBLB 2JJ2D 5ELXA 2A5JA 2PEZA 1MR3F 1YR8A 3K9GA 4JJZA 1G3IA 1SVLA 2BJWA 4P3YA 3SFZA 3TMKA 1II8A 4PXAA 5EUMA 2GJ9A 1Z83A 4B3BA 3GJ0A 3TLXA 4DJTA 1UKYA 3MJRA 4A8JB 2QAJA 2QTHA 3JZAA 2Q9AA 4DLWA 1JNYA 1AQUA 5AWFC 1TUIA 3U44A 4EPXA 2F1RA 1KJWA 2RCNA 2CDNA 1RYHA 2ZRLA 5KDLA 4TLAA 5C18A 3M0EA 2FH5B 2OV2A 5KDOA 1ZRHA 2ZUDA 1DAIA 1L4YA 3HR7A 1PLLA 2J5XA 4QJ4A 5CIQA 5AK0A 1LW7A 3D7MA 2CXXA 2ZROA 4HAZA 1YHNA 3GFPA 1KI3A 2BV3A 2QTFA 2XB4A 3IIMA 3QG5A 4PHFA 3L8YA 3SJBA 3LO5A 2GF0A 4FI3C 4CEIB 4EPTA 3RS2A 3TQCA 3FHTA 1A7JA 1M7HA 1G8YA 2ORVA 2WJHA 1GDDA 2OCAA 1OLOA 2ZRHA 2KB0A 3HP1A 4AYXA 1XP8A 1E2PA 2GKSA 4BFVA 1KDPA 4EFLA 3K0SA 1ZBDA 4Q7MB 4K81B 2A9KA 1ESMA 1T8TA 4NKRA 4NCNA 4S35A 2ORIA 1OKKA 3TSOA 1C9KA 3GFTA 2QP9X 1U98A 4MA4A 1K5GA 4ZKEA 1NI3A 2JATA 1VKJA 1JR3A 1VTKA 3A37A 4HDCA 2GA8A 2IK8A 1S4QA 5G41A 2IYQA 2C77A 4BFZA 3L0PA 5J4LA 2HF9A 3BOSA 3LFUA 2NPIA 2ZAOA 3ZVLA 1CR2A 4LBYA 3NHBA 3QOFA 1OH8A 1Z6YA 4GBMA 1G16A 2WWWA 4EUNA 1UPTA 4NH0A 4M0LA 1IBRA 2ZRIA 1G17A 3LD9A 4EFMA 4GMDA 3BH7A 5E7MA 4UXIA 2XB2A 3CW2A 4XVUA 2VSOA 3SZRA 1E2HA 1Z63A 1ZD9A 1EX6A 2QY9A 2QGZA 1UAAA 3OAAA 3UWKA 2IS1A 4F92B 4OQXA 4TQAA 1GILA 1NMZA 2PZFA 5KPJA 3T1OA 5DYIA 3D31A 3Q8XB 1GZSA 4YMVA 1YKSA 1RJ9A 3VKWA 3KKQA 4Q5IA 821PA 5HZHA 4KSBA 1QHSA 2QMHA 3A4MA 5B64A 3ZD6A 1YVDA 1A5TA 3GLGA 3U6KA 3AM1A 1E9BA 4MGIR 3SNHA 3DEFA 1TQ2A 2EYQA 2A3RA 2Q3FA 1XTIA 2P5TB 4K46A 4M1TA 1OB5A 2PJZA 1H8HD 4IKEA 4AWXA 1Z6TA 2VHTA 3A58B 4YMUA 4QNRA 3GCGA 4CT4B 2L0XA 2QPOA 4MKGA 1D5CA 4TSFD 3U3KA 2DFLA 4KYIB 3THOA 3KUCA 1RRCA 5LB4A 1E32A 1EFCA 2W2VA 2EFCB 3H2YA 4Z1MA 2KBEA 1N0WA 2DR3A 1NKTA 1GG2A 1ZU4A 5DIFA 3QG1A 2NZJA 3IEUA 1NLYA 3CUEF 3CZQA 5L8VA 3DZDA 4FMBB 2RHMA 3U2QA 5JZVA 3L0OA 3MLEA 1CP2A 4NONA 2VP0A 1GVNB 4Z1MD 3BK7A 3CX7A 4NHOA 2B92A 2A5GA 5GJVC 2BM1A 2CLCX 4LHYA 2C2HA 1CF4A 4BQSA 5EE9A 3TBKA 4Z51A 1IOZA 4IVRA 4XOIA 2QENA 4AIIA 1GFIA 2PH1A 2Q6TA 4AC9A 1R0XA 4TYYA 1W48A 1UBFA 1QBKC 3WBKA 1G8HA 4Q4HB 1PUJA 4TTPA 5CDFE 4IEIA 3GLGB 4TL9A 3BH0A 4XIGS 1VG1A 1E4YA 1DAEA 1E4VA 4IOKA 4GDFA 1J8YF 1E9FA 1OF1A 2G77B 2ZE6A 1Q12A 3LXXA 4MUAA 5CM8B 4D25A 4PC1A 1UKEA 2XZOA 4XWOA 1SXJB 4JLBA 2ZRMA 4YXWD 4KBGA 2E9SA 1J7KA 4RFVA 5CYPA 1X3SA 1D9ZA 1VDZA 3PUZA 3C16C 4EQ6B 3OF5A 4Q9JA 5KU1A 3BD9A 4OKSA 4A0GA 4TMXA 1OH5A 4GL2A 3VU9B 1E9SA 2XITA 3IHLA 3AKEA 4WA7A 2G0NA 4L8GA 2WSSD 4D0LB 4NCKA 2RMKA 3VX3A 2CL7X 3R7WA 3GEHA 2ZE8A 1JAHA 1GL7A 2NO7A 1SVIA 2BOVA 2BCGY 2C99A 4NCIA 1RPZA 2ORWA 2ZRPA 4TN1A 5AR1A 3BGWA 4QXAA 1E9RA 1LB1B 3DHWC 3G82C 1G291 2GBLA 4ESHA 4HB0A 4M9SA 2XJ9A 4B2IA 1CXZA 3OE7D 1GUAA 2GDJA 1SHZA 4LJYA 4L4UA 3U5ZB 3AVYA 2W83A 2C95A 2OHFA 2P3SA 1IN5A 4QC2A 1OE0A 4N1AA 2PLFA 1RYFA 5CITA 5KNBA 3NHAA 2G0TA 3AGPA 5CJ2A 1P73A 5KTYA 3KX2A 4DIDA 2JIZD 4YMWA 1ZM2A 2BJVA 4KJZA 2IEZA 5FPTA 2Z6VA 3QPVA 3BC1A 3IQWA 3SE0A 4EDHA 4PHGA 3WNDA 2V6JA 2W6IA 2VSXA 1LTQA 1JPNA 3NH9A 4HB3A 2O8FB 1E9EA 2O8CB 1KMQA 1J99A 1JEDA 4Q9IA 4DLVA 1PJRA 1F48A 2FPMA 3LX8A 2DWPA 1NNEA 3HPQA 3NBZC 2IC5A 1B23P 5EP1A 2CE7A 4X8HA 2IUUA 2BKEA 2J59A 4URYR 2IA5A 4W5HA 1S1CA 4EIWA 4ZCIA 4HAXA 4B6FA 3IDQA 2KSQA 2F1HA 5SZHB 4M53A 2IHBA 1VCOA 1KHTA 2JGNA 2YWEA 3Q72A 4M1YA 3RRNA 4D4KA 2WWYA 2WJGA 3AVQA 3W3ZB 3A1VA 1FW6A 4URWR 4Q4AA 1MO5A 1XD2A 1US8B 4RJLA 2RH5A 4LJ4A 3TNFA 2ZR7A 4FMDB 3UG6A 2CBZA 1KK0A 4KHZA 2V8OA 1BMFD 1WBDA 4PR0A 4S2EA 1IN4A 2VHQA 3GQBA 1VYTA 3UMSA 4ZCMA 1T3HA 1XCMA 2FSIA 1XU4A 3M1IA 4TTRA 4LGMA 4NE2A 1U94A 1BMFA 1TTTA 1NLZA 1Q21A 2IF2A 1PV4A 2PEYA 4LYJA 1W0JD 221PA 2R2AA 4HAUA 1XD8A 1VMAA 1V43A 4CGZA 1GRRA 4HLCA
chains in the Genus database with same CATH superfamily
5KNLA 1NF3A 1O03A 2C2WA 2WWXA 5DT2A 4ENSA 1P1KA 1PFUA 3PQ7A 4LY0A 5FFNA 2OGUA 2VYFA 5AI6A 1LVUA 1AB6A 1TI7A 4JL6A 2SKEA 3P9RA 4O5OA 5SICE 4C4PA 4GLJA 3OIYA 1VMIA 1J56A 3IEVA 4ECEA 1G5RA 2SNIE 4IO0A 3D5EA 1G5PA 4CMEA 1UMBA 4MYDA 4NYIQ 1H5NA 1PK7A 2YYYA 5C5EA 1WTAA 3GUUA 2BGLA 2Q07A 3O47A 3TO5A 4O4HF 5E9WA 3EZFA 3FGNA 5AW1A 1USGA 3TYXA 1E0AA 1FP4B 2Q5EA 1SQFA 2PMDA 3U7GA 1Q95A 4C4RA 2Z6QA 2OD2A 3FYSA 2VQFB 1W36C 1UCFA 5LQUA 3H5RA 5AHXA 2WVAA 3ZW8A 2DHCA 4U39A 3VSCA 4HTAA 2WW8A 2ZU6A 1CK4A 4HYYA 2QUBA 4D9KA 4I50A 3GU3A 1N1DA 2J87A 4X9XA 1OXBB 1TQ6A 3A1SA 3IPXA 2JPDA 4Q7LA 3O7WA 4PANA 4YAOA 4RK6A 5FTKA 3HKEA 1JR3E 4RGQA 2ODBA 4E22A 1PQUA 5KTRA 5LXTA 2H17A 4EHIA 1GEEA 1KEUA 2HLDA 2QP3A 4TKZA 3IAS6 3SR4A 4QNMA 5E9AA 3RAEC 1PF7E 3HYSA 3ZWMA 1IEXA 2QLFA 1GSAA 2PX2A 3PDCA 1HH4A 2F7SA 3ABIA 1X1EA 3AUYA 3C4QA 3MTEA 3P5BA 3QFHA 4ILKA 3PXAA 4MRMB 1IC6A 2YIMA 3T41A 3WQHA 4ZKDA 4YUVA 3LCRA 5CIWA 4CQMA 3JW8A 4E07A 1I94B 3BORA 4RF5A 4ZYUA 1KRHA 5LUBA 2OQRA 3L5OA 1QE5A 4LY3A 4WV3A 2N75A 2PKRA 4XM2A 2EKPA 2H4WA 1EEXB 2XNKA 4NU0A 1WP9A 1RR6A 3D0RA 4EHNA 4F2DA 4DBVO 4UAVA 2ORED 3F7MA 4MGKR 4QQFA 1S02A 5EKTA 3E2PA 2EQ5A 4GZ5A 2DPMA 3IUJA 3IP6A 4QASA 4RCVA 1QHYA 1SC4A 2AV6A 2DOKA 2QOEA 1JYSA 1Z33A 2WHQA 4TMZA 3UZUA 2WUWE 4D81A 1YQXA 3COYA 5ALOA 1NPTO 4BP8A 3MBOA 4BV2A 1QDUA 1U0FA 2AOTA 3OY2A 1OLUA 3QK7A 4F4JA 4MS4B 1SEVA 2VYVD 5I7RA 4K9PA 1VBFA 1XOIA 1OXXK 3BXXA 1E1YA 4EHBA 2AN1A 1XYVA 4W8HA 3O8RA 2K7FA 1F0YA 3I4FA 1RJWA 1YUNA 1AQ6A 4ZO8A 1ORHA 4CG3A 5B3LA 4TV9A 3DGEC 4D6YA 1XLUA 1LJUA 3B7GA 1J2UA 5HG0A 1Z2AA 3RU7A 4BTLA 3O1JC 4QREA 1YB5A 1GZUA 2WHEA 1XJ0A 2AC4A 2YZ2A 1UFVA 4YAEA 5DEIA 3TTUA 1NUAA 4KI7A 3ZU5A 3BB1A 4KREA 3A9WA 1BQEA 1W29A 2FW6A 4XW2A 5K3DA 5IM4F 4F91B 2OL4A 1KI1A 3ETJA 3KSDO 1BHJA 3WRYA 1GPKA 2GLUA 1VI2A 3TI7A 2L17A 4YP6A 5F9HA 3HN6A 2QTWB 4X45A 4HAOA 3I0NA 3OP1A 3FLAA 4BMNA 1E2QA 2QYOA 1GA6A 2WE8A 2X23A 3ZUPA 1CEQA 1ISHA 2CLOB 2WSBA 5DOVA 3RF6A 1O97C 1V5EA 5FOSA 2BGKA 5TE9A 4DGQA 3QVJA 2UVPB 3VNVA 2BTEA 1GQOA 3DNFA 3E70C 2NTVA 4X84A 1DOAA 4INPA 3FPLA 4EYSA 4HVLA 5IULC 4CODB 4YAGA 4JXZA 4KJXA 3HI4A 1LJLA 1M73E 1VI6A 1Z8NA 2WSIA 3M82A 4K6HA 4YAKA 9GPBA 5EHZA 5M29A 4P4UA 4RKFA 1DUIA 1TUEA 1TW3A 2ATCA 3DMTA 2CB9A 2VRBA 4UVIA 2QNBA 3L46A 1QK4A 4F21A 3RTGA 4B4OA 5ICFA 3VYSB 4Y1FA 2WD8A 4BP3A 4R9NA 4J07A 2WFAA 3MC1A 3MF4A 3CT4A 3A6KA 3H9CA 1XROA 2GK7A 3L7CA 5EIOA 5L3ZA 1FZQA 5FADA 2QT0A 4R5MA 4F97A 1RAAA 3F67A 5CURA 5AJVB 4G9BA 3UTCA 4EKYA 2YRXA 1U5AA 3TS1A 4F1JA 5CXUA 2VRWA 2YXBA 3JQCA 5FHQA 3CUUA 5CVEA 4BYGA 2JIZA 3I62A 3ZV5A 3TEFA 2K6GA 3R77A 4OHRA 3EXAA 4H2DA 9LDTA 2O8FA 1EUZA 3N3BC 2VN8A 4LRYA 1PD1A 1RLTA 3VVMA 4HV4A 3WYGA 2G04A 2V6GA 1T0HB 2CCGA 1WDMA 3REOA 1UXGA 4OQPA 4OUDA 1MB2A 2HRCA 4CMAA 1TK9A 4OQMA 2PZLA 2G25A 3NFYA 3VDNB 3ILVA 4D56A 2GZAA 1Y5MA 4BDTA 1U4SA 2EP7A 1O3YA 2H54A 3L7AA 4BZPA 5EKXA 1U1EA 1TRKA 4WERA 3OOJA 3SHFA 2C8JA 3CG4A 5BQXA 1DVRA 4YDSA 1R4NA 3O3OB 3WK8A 4BQNA 2QVZX 3LCCA 5KQGA 3ZGNA 3GF4A 3BGIA 2RSLA 3NHKA 2Y6UA 1DKOA 1U0JA 3O0TA 1ATZA 1X1SA 3A1WA 4DEVA 4IILA 2A3NA 3EVDA 2AL7A 2EDCA 4LFCB 5D1HA 1GCAA 3R3SA 1JHVA 1FNSA 1ZMTA 2OHIA 3R9KA 1KYYA 2ZJ6A 4PG5A 4OGKA 4B6PA 3NYIA 4GM0A 3M6IA 4LKOA 1NONA 1SELA 2J45A 4PC3A 4ZOQI 3DDZX 1LPAB 1UKZA 3MWJA 3C6MA 3TIGA 1UBRS 2KLHA 5BYAA 1V39A 2CFIA 2GFQA 4UFOA 4KWEA 4KFRA 1GNSA 4JDPA 4LK3A 5AXBA 2AJBA 3FRIA 3HTXA 1YE8A 3V4RA 4JKIA 4BB0A 4QX6A 4B3XA 3GEPA 4F1KA 5LP6A 2O8NA 1BXKA 3D6NB 4FHZA 1FXSA 2OGWA 1U81A 4GLFA 1DADA 1J90A 3GFRA 4J75A 4C4ZA 3SYKA 3F1KA 3K73O 1X7YB 3FR8A 1W30A 3TSAA 1DJNA 2FEAA 4MQFB 4NLLA 1U8CB 2JHFA 5FL7D 4D3DA 3DG9A 3GOQA 4Z49A 1ZC4A 3KYBA 1GUYA 2YASA 3JQEA 4IDAA 1UEJA 4CEHA 3BXOA 1DO0A 2QL6A 5I7FA 2QUAA 3M9XA 2IXEA 1C3OA 1T2CA 2NUAA 4UHJA 1FLNA 4EY8A 3VR4H 2VG8A 4XD7A 4RTLA 4WJKB 1OXSC 2GPWA 3AI1A 4RK4A 2PQ6A 4UU7A 4ZXPA 4XIJA 1B3BA 2A5YB 4E2WA 1CNMA 1ZRSA 1VMKA 4NV3A 2VDNB 5AW9A 1UJ2A 2REOA 3E9MA 3IURA 2G7ZA 2A92A 1NR7A 2YDYA 4ZV7A 1YONA 5BSRA 4HT3B 1SQ5A 3RK4A 1MJGA 1UR5A 4X66B 4FLMA 3HXPA 3OBBA 4PY2A 3FFAA 3MT7A 1TVEA 1HEIA 1PEKE 2OQ2A 2YC2C 4UNPA 1N36B 4LKRA 2NO1A 4HS9A 1K0UA 3OWHA 4RA6B 3VR6H 1C9NA 1UIRA 3FWNA 1A8QA 3QIVA 2O8EB 1R6BX 2AOUA 4C01A 2FP4B 2F3UA 3S29A 3H2JA 3IQZA 1WXQA 1MJGM 1C9YA 5FFFA 1UK7A 4DADA 1V3TA 5JAIA 2X0KA 1U9IA 1TUBA 5K0FA 2QMYA 1F0KA 4BO9A 2ZJYA 2QVLA 1GAEO 2JGRA 4Q6WA 3PRHA 4IYJA 1VJTA 4AJ1A 1ZJWA 4OXQA 2NU7B 2XB8A 3PUKA 4D82A 3OFSA 1Y8CA 1LS6A 3IBCA 4JA2A 2OWDA 4PGGA 3RPEA 4B32A 1JQAA 5EJ2A 3DOHA 4M55A 4GWLA 4L9RA 4FDTA 3ZCTA 2ZR9A 1LSJA 4HLQB 1E2FA 1Q57A 4DR4B 2B61A 1JIVA 2HIHA 2OKGA 2FNAA 2R6JA 2JIOA 3B82A 4S1WA 4CCAA 1A04A 3AKYA 4HDNA 3LBIA 4MKFA 5ALIA 1FJHA 1RMYA 2ZRCA 3TSZA 2PR2A 3COVA 3V32A 2HO5A 3K16A 4BVGA 2PKWA 2WIJA 3QTBA 3FCOA 1P4RA 1P1JA 4KCGA 4A82A 1WSWA 3JQAD 1O7JA 3UC5A 4KAJA 4NXMB 3RYFB 3HJBA 1RP7A 1K4MA 3W7AA 3NYWA 3G88A 3ZZTA 5LM3A 5TV2A 2JL1A 3X1XA 4JBGA 2A30A 2P4EA 5HRAA 3OE7A 2WJYA 5CA0F 5I7VA 3OLYA 2OP0A 2P9CA 2GN9A 4ZT3A 2H8KA 3BCSA 3C45A 4BLTA 1T8SA 4ID9A 1PG2A 3NTRA 1SZJG 4OXXA 4R3NA 4WD3A 1Y3DE 2YQ5A 3QVMA 1N75A 1WF3A 3MLAA 4QSHA 1IQPA 1YZKA 4E33A 4I5EA 1P4SA 5IDVA 4Y6PA 1CDOA 2XQJA 3EGIA 1EE1A 4NJMA 4PN7A 5J4YA 4NMMA 1Z2DA 3CPHA 3G8AA 3KAKA 3KIPA 4MI3A 5E9JA 4B09A 4BIIA 3AJRA 2YJNA 2Q2NA 3PVZA 5IC5A 3LPDA 3W2HA 1PW5A 5TPWA 4WOJA 3WOHA 3G2JA 5E0KB 2W8ZA 4WZAB 3NGMA 3TBHA 3I72A 1DP4A 3MBIA 1Q3TA 3LUHA 2RGGA 4IEFB 1V47A 3ESAA 5A05A 4QUGA 3S81A 1TEZA 1O0SA 5TY0A 1ETUA 4EEXA 1QYWA 5J4HA 1MD9A 2YZKA 4GQIA 3WGQA 1GQ2A 2B6HA 1EJ0A 3M6MD 4NK4A 5HTKA 4EL0A 1N6LA 4US0R 2PFSA 3H8SA 4KQWA 1G3MA 3JQAA 4WW0A 1YB2A 2ZJ8A 3T9AA 4DYVA 3UCFA 2RCYA 2HDWA 1QYVA 4IQ0A 4HAWA 1CUBA 3PL5A 4E5YA 3A4YA 1ZH2A 2FPIA 1NI4A 4FNOA 1SAYA 4IDQA 4QOJA 5E1BA 1Z8FA 3EFOB 5K0EA 1OI4A 5IF9A 1K63A 3AHIA 3JQDA 4ZT5A 4DCTA 2HJRA 2Z2JA 4B6SA 2H0QA 1GDTA 1TECE 3KKOA 2NAPA 4BO1A 4EL5A 5HUJA 1O0CA 1DRKA 2YINC 3D81A 3E3AA 2M6LA 2A6PA 2HMUA 2PDAA 3QE9Y 3M3PA 4M38A 5F2OA 2ZT7A 1SOUA 3IO3A 4RSMA 4Z4FA 1AM4D 3AUKA 3DDWA 3R0XA 4GPTA 3QMMA 5M5BA 3AEZA 4B40A 4R2MA 2OUKA 1C0EA 1PR5A 2GD1O 2V7QA 1Y8RA 2R5NA 4JBIA 5D3QA 4D97A 5K3EA 1HQDA 1U6IA 1XTSA 1XWWA 4AJ4A 1XTQA 2D3TA 3U3DA 4MTLA 4MX8A 6PFKA 2RHOA 2J1LA 4FMCF 4AZ3B 1JHRA 3A3KA 2OBMA 3Q3JB 2NSLA 3UGTA 2AVNA 3ESRA 3TH5A 3VZSA 4DCPA 5EVCA 1YCFA 4HGOA 2XH8A 4MUKA 4RY9A 1Z2PX 5FORA 1GAQA 1HZZC 3E27A 4KODA 3SDZA 4R2HA 3RUFA 4DBLC 1E2KA 2YN2A 1Q92A 1ONOA 4JX8A 4I08A 1DXOA 3V7UA 4GLBA 1S5PA 1NN3A 3B1YA 4CT0A 1DEKA 2F43B 5BR1A 5KYXB 1QF6A 1DIRA 2VKTA 4D9GA 4P7KA 4B45A 1Z6PA 4Q47A 1XMXA 2FZ4A 2X4GA 4MUBA 4BNDA 1P2TA 1UMCB 3OEHD 5GZ3A 1TAHA 3SJUA 3VFDA 2G06A 5DM60 2PBLA 4PAMA 3VTZA 4F8JA 2PZ8A 1BFDA 3DQPA 4AK9A 2C84A 5JMOA 1COWD 2CFRA 1ZA1A 3LWZA 3T6KA 3FE2A 4D5GA 1OFGA 2O1WA 4JIMA 4L9AA 4V0OA 1YL6A 2I62A 4X91A 3AUXA 4LSGA 5FWDA 3R7LA 1E2JA 4IWXA 5E1DA 3VR3A 2PGJA 3KQNA 4EGQA 2F67A 2P9JA 4J0JA 4EECA 1M8JA 3HU3A 3K4QA 1L4BA 1ZI9A 1I14A 5AD1A 1C0IA 3KYDA 3KE8A 3PPWA 4PR3A 1XJQA 2A0UA 2HCJB 2NWQA 2QGNA 1X13A 3R5TA 3ITEA 1FP1D 2VA8A 4Z99A 2W37A 2E5FA 5EIBD 4ACAA 4BLSA 5C37A 4HWSA 1T8PA 1OT5A 2TMGA 3QFFA 3CX4A 2I2CA 3JWPA 3MT0A 1SXJE 1YSCA 5C2JB 5EGNA 1UWKA 2B1RA 1YQGA 5DBHX 2IDKA 1OIWA 5AT1A 1VJ1A 3TGPA 3R3XA 3E3MA 4WOKA 4DR5B 1KH2A 1GP2A 2XTMA 3FCYA 4RV4A 8GPBA 4LF5B 1P39A 4LV6A 4PQRA 2C3UA 5L4NA 5L3QA 1X6VA 2I3BA 3L8HA 3EVNA 2CL6X 1IRXA 4Q7KA 2WAXA 521PA 5G53C 2GT1A 4OQ4A 2DLDA 3ZS9A 4ALIA 1IXYA 2LCQA 4YRLA 4E1BA 1GAXA 2M9MA 3FUXA 1CFZA 2X19A 3CONA 3OQVA 1VE1A 2A9QA 2B2NA 1C8LA 4Z9XA 3FNQA 1DHTA 2QXYA 3SI7A 2FRDC 1W5EA 5I8ZA 1G19A 5AM3A 3PI7A 4E3ZA 1CIVA 4GVLA 5F2NA 1L4GA 5AW3A 3CF4G 3SJZA 3NV7A 4YCMA 4Q24A 4AS1A 1RRPA 1UQUA 1X77A 4L3WA 2G4CA 3FPAA 1AA9A 2CHGA 2ODNA 2J5RA 4NAUA 1QFZA 4XTCS 3VHQA 4QYXA 5IT4A 3WV5A 4UMEA 4RA9B 4C7MA 1WZUA 4OXIA 1P8JA 2IIVA 3DV0B 3U7RA 3ZHBA 1U7HA 4OX9B 2J0QA 4ZEWA 4LOAA 1I4OA 3G2QA 3D1VA 5CLHA 1BFKA 1E3LA 2ZSEA 1FU7A 3H2IA 4P5DA 4PZCA 2JLUA 3K6KA 3TRKA 2EJCA 1DX4A 4XDYA 4Q9AA 2WFZA 3IPRA 2ST1A 4MA5A 3UXYA 4L5CA 2BBOA 4MVJI 2D8MA 1WCWA 2I7TA 3WIUA 1LZLA 3K96A 3WLNA 2FKAA 4AJPA 3GD5A 2EXXA 3NTUA 4BVFA 3KDSE 1NVVQ 1PWHA 2WU4A 3SDSA 1XMPA 2ISSD 4RHCA 4UUQA 2OENG 1E0SA 1QH1A 2O1XA 1NDHA 4ENUA 5H16A 2XKKA 2AZMA 3ORSA 1XU9A 3V4ZA 1DDOA 3SS9X 4DSZA 4YPOA 3EXEA 3MJEA 4OGLA 5G3ZA 3CIFA 4YO8A 1T9DA 2B4KA 1S0UA 2GPBA 1ZQ1A 4HH4A 4XZ3A 3V97A 3G79A 4XVHA 4HADA 3WJ1A 2FEPA 1CQZA 1NHWA 1ZISA 2Z8XA 3R24A 3A9RA 5ARBA 5ISMA 5BN5A 1V5WA 2I7CA 3EGWA 1YFZA 2JDIA 3R09A 1RZVA 4Y2GA 3IVAA 1T9AA 1I2AA 1SXPA 1P7VA 1Y5NA 3EULA 3I1IA 4KIGA 2PZAA 2G8LA 2JHCA 4MH0R 4PX5A 5DOZA 1CUWA 1FUIA 3UPDA 3VYVA 2FDXA 2WV9A 4HNGA 1Y42X 3T5DA 3TRDA 3G5TA 3VNBA 1T9CA 1U8UA 2CXRA 5D5QA 1G7RA 2F3RA 1N3BA 3E1SA 4KDEA 3PHBE 2IV3A 1C0PA 4Y7CA 3OQIB 4FEAA 1YQWA 3N2GB 1QR2A 4QBHA 1L6RA 1V8FA 2I0FA 2ZQ5A 3BS4A 2G63A 3LQ4A 3P5SA 4OKIA 3WI7A 2R1VA 4ABTA 4P4LA 1E99A 3LGAA 5DBOA 1W5AA 1NN5A 2ZAIA 2YVLA 5D01A 1PQYA 2YN0A 1WZNA 1BOFA 1PJZA 4KOAA 5LYJB 1OYWA 2DPYA 5KYVA 3CGWA 4Q37A 1JEAA 5HDQA 4E2XA 3TSCA 3ETDA 3IOCA 1I8TA 1JUDA 1TEXA 2X58A 2W2LD 3QKSA 4CHGA 4B7ZA 3CNNA 3A32A 3IQDB 4RPCA 3S4YA 5LU8A 1BWSA 2P2CA 2PRSA 2Z58A 1NSYA 5TQ0B 4K40A 5JSKA 4P86A 2KX7A 1O54A 4BV8A 3BK1A 3KKMA 4NNJA 4DRXB 4DW8A 3E9EA 2FETA 5IP5A 3GFSA 2JZNA 2PU5A 2FFJA 1W581 2YWRA 4QFBA 3NWJA 1SK8A 3RVBA 4WHMA 3RYCB 2P9YA 3EIHA 4XKJA 2YS7A 2E55A 3QXGA 1LNQA 1NI4B 2HO4A 2NQ2C 1HE8B 1W49A 2IKQA 3CBGA 3GA0A 1NBEA 3K53A 4HB2A 3D4IA 3INNA 3W5VA 3X3HA 4LJRA 1RIIA 4CKZA 1F8YA 1I4WA 3GVXA 4MQ4A 4QPCA 1EI9A 4O6VA 1FLAA 3QKWA 1QB8A 3CLUD 4OCZA 1Q3HA 2P4SA 3TJRA 1XYGA 3EQ2A 2DSNA 2RHDA 3WMGA 1SG9A 3DM5A 3H5LA 3IT3A 3OZIA 5B1SA 4BMPB 1LQTA 2NYAA 2UZ4A 2X0IA 3CO0S 3DMFA 1SVWA 3L92A 5AI0A 4G0UA 1NP7A 2Z3ZA 2J08A 4KL8S 1BSVA 2NQ8A 8AT1A 2O8DA 3SQWA 2ATXA 3KSZO 1JHYA 3UMBA 2N0SA 5LOVA 5D87A 5ILGA 2ENWA 1A5BB 2X41A 1GZ5A 4MYUA 2HLPA 4L28A 1ZBQA 4Y0VA 1JV2B 3R41A 2IYXA 3HYNA 2EKBA 2OCYC 3T61A 5U4QA 2VPWA 2QAGA 2VSQA 2JIDA 2OBXA 3Q8MA 3ZD7A 3VKFA 4WL0A 2B98A 2BFEA 4JI6B 3WICA 2CHQA 3ESDA 3MIIA 3LAWA 2AEMA 2Y0EA 3DDHA 4MAMA 4R1NA 4PYLA 2FVXA 4GBGA 4II3A 3AKDA 1FMJA 4WY2A 3D6HA 2AMVA 1FP2A 5G0SA 4CMHA 4ND4A 1II8B 2F1OA 2VF4X 5P21A 4AX8A 1ISIA 1PRYA 2YXPX 4NQRA 1W36B 1OC2A 3BEDA 3AR3A 4G5XA 4N48A 4Q01A 4BNGA 3DHVA 3SQXA 5CPFA 2DRIA 2PFKA 1SCKA 4GI1A 1TO1E 1WKVA 2L82A 3CRW1 3AOGA 1GYRA 3TVTA 4INAA 3ZE7A 1X7ZB 1OWMA 2R6HA 2DUWA 3KWJA 1M6VA 1SXQA 1KAMA 4JMLA 5G0UA 3RREA 2ECQA 2BE7A 2O5VA 3N07A 1ZC3A 2E82A 3GBPA 3ILYA 5JDCC 5BOVA 1Z4IA 4PCVA 4E08A 3M49A 3ZBQA 1KEEA 4CCSA 5KYUB 3DFKA 3W04A 2PSHA 2ZSAA 1XTZA 3BRQA 4QVKA 1W2HA 1ECGA 3NVMB 4WN9B 3EBPA 1QVZA 2VYCA 2XPCA 3JQRA 3GRKA 4IS3A 2JC3A 5AUQA 3ZD9A 4AM8A 5IAKA 4BQEA 5EJEA 2IBSA 1IB0A 4TTIA 4NV1A 3G9ZA 5ENZA 3VX4A 5F12A 2ZRNA 3OJEA 3PJGA 2P90A 1NG1A 4Q3LA 5LD2B 3P96A 1L5WA 1E77A 1UP7A 2BL4A 1O6FA 1T35A 2WPDD 1W8DA 2LIVA 3FDZB 2EOAA 4COKA 4C03A 2Y9MB 2HQOA 3ITNA 5AH0A 1X0XA 2BKUA 4LCJA 3VOBA 3I0ZA 4E15A 1O95A 2VDMB 3GGJA 3INRA 1ZH4A 2GQ0A 4G0VA 1G5FA 3QJGA 3QOWA 1N6KA 2ZJFA 4KWCA 1NC1A 4RD0A 2B4QA 3QYPA 2ECOA 3QUTA 3ABSB 4B17A 4BWGA 5AKGA 1UM8A 1V2HE 3ZDYB 2JJMA 5IBCA 1T3LA 1FFAA 3CLRC 3L8EA 4G86A 4N39A 4QYWA 2B20A 5IARA 5BN4B 2RIRA 4ZTZB 3Q4GA 1OLSB 1CW2B 4GFDA 2XNDA 1C0KA 3I30X 4L3VA 4LWPA 4XIYA 3RT9A 4BLUA 2Z3WA 3ADPA 3PDIB 3VVBA 3ZIAD 4JLDA 1DT5A 3AVUA 1LLDA 4YTEA 3DYIA 1VOTA 4L51A 3WL7A 3QX9A 1KDTA 2QX4A 3QWAA 5KTMA 2C0PA 4KHPB 4Z7QB 4YJFB 2E1PA 1E1QA 4P0PB 3EJ6A 3KR2A 3B36A 3REGA 2G1UA 3V9PA 5ALWA 1T2NA 3DBHA 4BDSA 2E89A 3G7SA 3JPWA 3SK0A 4EX7A 5BPFA 4O2AF 1CZLA 2PWZA 4IP0A 5AOCA 2BEUB 2Q8QA 1F5NA 5KO2A 4D9CA 5A0FA 5JW6A 4EYOA 1XMVA 3SM9A 5KOHB 1PLKA 2FW9A 3BIXA 1LXCA 1U0RA 3W78A 3KYJB 3G0BA 5IUNC 1D6SA 3NBYC 5DYWA 2NNWB 1AX9A 4BNYA 1HYHA 1IHOA 2G71A 3GEIA 4IHKA 4KK3A 2FCRA 1CZRA 4QQ8A 3TN7A 3N87A 4JJKA 3UWOA 3NRBA 4PX9A 1TXGA 1EE2A 4Q3EA 3NC0C 1SQ6A 1UDCA 4IDFA 3LX4A 3HJFA 2NP6A 1JZQA 1YXMA 3LBNA 3OZTA 4B3IA 3K0HA 5E4TA 2DFVA 3KYCA 3PR2B 1THZA 2KJQA 2OKCA 3KAQA 1SOWA 2K2WA 3KPJA 2Q3EA 3QKRB 3RRYA 2HOQA 7REQB 3CTMA 1DE0A 4OQNA 5LWQA 3A9VA 2JIQA 5SZIA 4PC2A 5E4YA 3X2SA 2QZJA 4FXOA 3DLAA 2R6CA 3V4SA 1G2PA 1M10A 2RGDA 4PPQA 4YDHB 4D9MA 2VDLB 3GLVA 1QRRA 1AMNA 1X7DA 2MMGA 2XUOA 1C3OB 2NUAB 1N5RA 2OMEA 1PSZA 2VJLA 4G4SP 4DSTA 2C2BA 2OCXA 1I0LA 2VF2A 1A4IA 4GPZA 1ZUD1 3VUEA 4INZA 2IYEA 3HNOA 3OY7A 4O2AA 4YO7A 2VL7A 5BSEA 1FFWA 2GXAA 4XJTA 3ULKA 2YC4C 5FL3A 2F00A 4B43A 4GF5A 5I3CA 3PFBA 1QIFA 4H4EA 1HT1E 1QGDA 1WX1A 2D4AA 1CUXA 3AF3A 3Q0EA 4PFKA 3WRXC 4BQIA 1Z0DA 1Q17A 3FSEA 2V7XA 1U0BB 4JOSA 1YL5A 2GNOA 2A14A 2BF7A 1CRWG 1EM8A 2DMRA 3OOEA 1PCXA 1R9NA 2BFBB 2XKJE 5HOEA 2ZJ0A 3F9RA 3U13A 3H9UA 4IHJB 2EQBA 3ABRB 4JSRA 2P65A 4B3CA 2ZWIA 3GH3A 4RIHA 3A3YA 4BX8A 1FYDA 3RU9A 4R05A 4N0DA 2GZ2A 2P6MA 1D6MA 3BQMB 5KOJA 3QKSB 4HDOB 4ZMBA 2F90A 3CU5A 3THWA 2ASVA 2GRJA 1VPLA 4OYRA 3DKIA 3M7IA 4YRRA 5REQB 2W6MA 2NYVA 4YWHA 1HQKA 3AIKA 4NOJA 3ZYCA 3UJ3X 1EQAA 4FFSA 1GG9A 2C5FA 4X8MA 4E03A 4KDCA 3JS5A 3NIDB 4KBYA 4HEJA 3KTAB 3EFHA 1NUUA 4KGVA 3BXHA 4AY6A 1O2DA 3OSZA 4PYQA 2P79A 4FJ1A 4KWHA 3G2KA 2AYZA 2JKZA 5CAEA 1GITA 1MZVA 3I04A 3UMFA 2ES4A 5B1EA 4OQLA 4NR0A 1TRHA 5DHPA 4ER3A 4DBZA 2MYNA 1L4HA 2H8GA 3DYBA 5LB2A 3SLKA 3D7NA 2WTAA 2ILTA 3EOAI 3FNGA 1C2YA 2P8SA 3L1HA 4I4TB 3DR3A 2YZNA 1HZZA 1ZSVA 1EWVA 3WA6A 2AKYA 3OTHA 4G5YA 4KN6A 4EQ6A 4ZHQA 3ZV7A 4M0MA 2WU0A 1G8PA 2DY0A 2P91A 2IOFA 1CLEA 4B3SB 3G9TA 2IS2A 2PYDA 1CDEA 2CK3D 5D8DA 3R3HA 1RZRA 4U4AA 4YRDA 3O0DA 3H1FA 3QLVC 2IBTA 1A7KA 5ADUS 3BKXA 5LZ9A 2YHBA 5AYVA 2VVTA 1QUFA 3RSSA 4POAA 3FYHA 4O4LB 3R76A 2FPIB 4DLSA 4XQCA 3PC7A 5B55A 621PA 1OASA 4QU0A 2HA2A 1ORTA 3JYOA 4RQAA 4URHA 1R0RE 3CO5A 1FK8A 1IHYA 2YJTD 1R0LA 4MEAA 3HP4A 4J0IA 4TL8A 4NCJA 2UVQA 3R74A 3T1OA 4ANFA 4A9AA 3CISA 3N2IA 1XMJA 3SJCA 3KTDA 3KWMA 5HCUA 1XA0A 2WWIA 2VIIA 4H1HA 2X8JB 5HA5A 2YY5A 1KETA 3L0ZA 4PLCA 3JQFC 4RZQA 4XSHA 1QPBA 3BG5A 2P9QA 3HVKA 5EVJA 5I45A 3C1TA 4C3VA 1USKA 4F7WA 1JDBC 2RGWA 3OZVA 1NMQA 3DZHA 2AG8A 3V80A 3X1WA 2VHYA 3PTZA 3H87A 5EE3A 2D59A 1LUAA 1N1MA 3SQLA 1XAHA 2HRBA 4C7KA 4ZZ1A 3NORA 3NGLA 4ARZA 1U65A 5DNCA 1ZRNA 3DFZA 3OHMA 4QLBA 4MLCA 1F2UB 2GJ8A 3B1XA 4R7ZA 4ZYYA 3DCJA 1SKAA 1OI2A 1E69A 3MD0A 1F2TB 3V6LA 1TK3A 4H3HB 5FUWA 5DCUA 3NPMA 1PFVA 3I2KA 3OQJA 1KE2A 4IMJB 2FQYA 4DXDA 4B87A 3L7YA 4URUR 1NQTA 1NMXA 1E20A 1YA6A 1YZVA 3NBKA 2PT5A 5HYVA 1F4VA 4GYWA 3A3PA 3V7NA 1KS2A 3TJZA 1U80A 2H2DA 2TRSB 3NM6B 1GGJA 1JT9A 3VKGA 1V5FA 4R40A 5DFAA 4BMCA 4DAOA 4XVCA 4CCYB 2HZ7A 3AL2A 3HFJA 3IOEA 4QVGA 4RZ3A 1ODFA 1T2UA 3EGEA 4URZR 1HDIA 3SX4A 3NCHA 4WGFA 4W63A 7MHTA 2B5VA 1LBIA 2MSKA 1K7XB 3R40A 4K0RA 2DAPA 4N5HX 4P6VF 2CJFA 4PGAA 2BGWA 4FOPA 3LQRA 2COUA 2G9QA 2VUSA 5EJFA 2EBWA 1V8DA 3UG7A 4W6ZA 2CMGA 1EK2A 4QUKA 5I9BA 3TW0A 3VSDA 3ZLJA 2CFSA 4KN5A 3A2NA 5FWAA 4TM8A 1Q0TA 1IZ7A 3P2MA 1KYVA 4YMIA 4YPFA 4YPVA 5DGTA 1N2EA 5FV4A 1A1SA 1XJ5A 1EVKA 2VTKA 5T5QA 2J0UB 5BW4A 3HO1A 2CMFA 2OHXA 4ZI2A 1E3QA 3EC2A 4FONA 5IXSA 2DP4E 2ZIUB 2V6IA 2AZDA 2PXXA 3AYZB 4FGJA 4DQLA 2ZQYA 3L9WA 1J1IA 3ZCUA 2VJMB 2RK4A 1L9XA 3F6RA 3CVYA 2DJ5A 2WKRA 5T4BA 4LC9A 4RMGA 4JLKA 4ZC1A 2FE4A 1P1RA 2D5CA 4XGIA 1P7CA 4FYPA 1EJ2A 1I4LD 2VHXA 1KSFX 421PA 3ZV3A 4AUNA 4F3YA 2AK2A 2DY1A 1J20A 2F43A 1PE0A 5G4LA 5SY4A 7MDHA 1KP3A 1WSAA 4AFNA 3KVYA 5HE9A 6ABPA 1O1YA 1EHYA 2IY9A 2ZJ2A 3SP1A 3C43A 1J2YA 4X24A 3D9QX 3QVTA 3TE7A 1ADYA 1H3NA 3L1VA 1DAMA 4PNEA 1J0DA 4C7OA 2AJDA 4ZRNA 1P2GA 1U9JA 4QBKA 3GVHA 3HKEB 3NNNA 3KPVA 4YQYA 3C2QA 4P31A 2AYXA 3B60A 4R2KA 3GH1A 3NWPA 5CA0A 1QZZA 1VL5A 4U7HA 4MV8A 3CN7A 3P4UA 1KPIA 2BKAA 3MTDA 1OW3B 3R4CA 3SR0A 4E12A 1DBWA 2IXFA 1P4HA 2V7WA 2O0LA 2ZIGA 4X8LA 3S1AB 3GIDA 2OBBA 4JC0A 4OQZA 3VQTA 4KXUA 2QRJA 1SIBE 1P9RA 2D1RA 1C81A 4K9QA 3SFTA 2A57A 1IK4A 2QAGC 2OO5C 2D7JA 3EF3A 3ROMA 4X7PA 1CUCA 1RI3A 2PX5A 4RK1A 3R1IA 4C4SA 1ZD8A 1LPOA 3MYRA 2ON6A 2ZYVX 2VDJA 1NYTA 1KY3A 1QCCA 4EABA 4JXKA 3QJYA 3G5AA 4I3FA 3JWIA 4TXMA 4CUJA 3IOMA 4DCUA 2ZBUA 3GLUA 3ETNA 3MINB 1JDZA 2VYVA 1M6EX 3RVDA 1QQAA 4HGRA 2RKOA 1L5HA 4ZEVA 4KQMA 1G21E 5EFOA 1JKXA 1NLMA 3PG5A 3PCRB 4FP9A 4MV3A 2XDWA 4ROTA 1PJ2A 1JLLB 4ZOCA 2OOSA 1IUKA 3KL2A 3BIFA 4PTZA 4JKOA 2FWPA 1L8AA 4Q7JB 1CT9A 3D8SA 4JY7A 1PN3A 5B2EA 1Z68A 1RWNA 2CBGA 3W8RA 5ADHA 1UQRA 4PZ9A 3M4XA 5EWLB 1LRLA 4AKIA 2E4XA 3QU5A 4MWDA 3CZPA 3DOOA 2J0EA 2EFDB 3A14A 3RSLA 4NICA 3WO0A 2IYRA 1R0KA 1HE1C 2Y1KA 2AFHB 3COWA 3L6CA 4FNGA 1C1XA 3NATA 3QU2A 2J6HA 4OHZA 1DX6A 1QIDA 1MG5A 3D3NA 3FGOA 4CQMD 3QPUA 3CVVA 4DT1B 2I1WA 3IYLW 3NTOA 5EI5A 3K9HA 4C21A 1F4LA 3DD5A 1XFAA 1T6YA 3ACDA 2Q3LA 5H5JA 3NP7A 4RLFA 1CX9B 2GHRA 3G6WA 1TM2A 1VHJA 1U3TA 4NOLA 3ZDZB 4L2IB 1TT5B 3B6MA 4H08A 1S7CA 3PFIA 2DKNA 1D2NA 1GY8A 5IT0A 3VPGA 1AZSC 4GI3A 5I5EA 3V8RA 3OU2A 3AB7A 4TUYF 1ZW6A 5TEWA 3VBCA 1LBTA 3AV3A 3C5VA 3F5MA 3UW1A 2P35A 3H7IA 1CUGA 2J6CA 1T5DX 4CV3A 3D3KA 2I22A 5L6LB 2AE2A 4LQDA 3V33A 3D3JA 3EAQA 4KNWA 2ZUTA 1EQ2A 1QGUB 1XCGB 4JI0B 1IVYA 5EQTA 1M54A 3H0EA 1CJCA 3L7JA 1RM5A 4A27A 4KACA 1XVVA 2PH5A 5FBRB 3ZGVA 2QRMA 4BX2A 1KARA 3P97A 4BKOA 1UBEA 2I3DA 2XKAA 3BH6A 4UAJA 3UQYS 4DJAA 3U9SA 4L6IA 5JY6A 4YMSA 3SG0A 4IF6A 1BGXT 2PVSA 3IDFA 4MW6A 1S8FA 4DSNA 5CTJA 4G0QA 2WT8A 2CXHA 1QMGA 1Z7BA 1N7HA 1WU8A 2P6UA 3C8HA 2DLCX 2O2IA 4DRZA 4BB5A 3HSYA 3A4VA 4NBTA 4WLFA 1A9XA 1IJFA 1ZEMA 2AQ8A 1U8XX 1OZAA 1HFWA 1XVLA 1ZUIA 2YWJA 3IVXA 4JLPA 5DASA 3I5YA 2YV5A 3QXHA 2HH9A 5LC1A 4E6PA 4BQPA 1WKBA 5AJYA 5BSHA 5C4IA 1S9DA 1CUUA 4EKGA 3N2YA 4B3FX 5FWYB 1TVMA 3PI6A 4YRZA 1BX1A 1MIOA 4W5NA 3K0AB 1LX6A 2WOJA 4S0ZA 1O6CA 4PZPA 3FN4A 2RAPA 4TVSA 5LUAA 1O8CA 2WVHA 3ZY6A 2NIPA 2PLWA 4BB9A 1YNSA 1WCXA 5EZYA 3IUSA 2FA9A 1OIXA 3SZ3A 3DW3X 4OJNA 1ZK0A 3LY7A 1G2QA 3ZDEA 3VKUA 1AXRA 4IIVA 4D3FA 4R84A 5AKIA 4URVR 5LOVB 4BCCA 4NECA 4QL3A 2JJ2A 2XCOA 2AUNA 3WNBA