3T12A

Mgla in complex with mglb in transition state
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
182
structure length
176
Chain Sequence
b'INFKIVYYGPGLSGKTTNLKWIYSKVPEGRKGEMVSLATEDERTLFFDFLPLDIKTRFHLYTVPGQVFYNASRKLILRGVDGIVFVADSAPNRLRANAESMRNMRENLAEYGLTLDDVPIVIQVNKRDLPDALPVEMVRAVVDPEGKFPVLEAVATEGKGVFETLKEVSRLVLARV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gliding protein mglA
publication title Structural analysis of the Ras-like G protein MglA and its cognate GAP MglB and implications for bacterial polarity.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Hydrolase/signaling protein
total genus 60
structure length 176
sequence length 182
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2011-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3t12A00
1GL6A 3B1YA 3LWNA 1ZBDA 4YQFA 1H8EA 1VYUA 3E70C 3NDPA 1IHUA 2ZE8A 4Q1EA 1TF7A 1V43A 4XVRA 4TTQA 4WBSA 1B23P 4DT1B 3HPRA 3WNBA 2MSDB 4AKIA 4B43A 1NVUQ 3Q3JB 5GJBA 1XCPA 1ZJ6A 2OFOA 1RE0A 2I4IA 5H8WA 1XD9A 3UK6A 3T12A 1J90A 4MDEA 2VP6A 3CM0A 4UNSA 3Q5DA 3U7HB 1NSTA 1IN8A 3QIAA 4B47A 2PEZA 4FCTA 1P61B 4M2LA 1E2MA 1Z08A 5CIWA 1SXJC 2GJ8A 1F2TB 1XTQA 3B60A 1NIJA 3H4MA 4EJSA 4KI0A 5H70A 3U3MA 2V1XA 3B1VA 1XB2A 2IXFA 5TVKA 1KMHA 1VTKA 2FSIA 3OESA 5F98A 4PC1A 1SKYB 3F5FA 2QROA 5TXGA 1Z22A 4OJQA 1U2RA 4KYIB 4AKGA 4M1MA 4MRNA 2P6NA 4Q7MB 5A5GA 3TAUA 4AYXA 1E0AA 3TK1A 4MYUA 4PPFA 1A82A 2KBFA 2OCAA 1E0JA 2X8AA 1EWRA 1KNQA 2V4ZA 1NY5A 4QJ3A 5E7MA 2D3WA 4D0NA 4NMMA 1YVDA 1Q20A 1QDEA 3B5JA 1GKIA 1JJ7A 2RAPA 4JBYA 2GXUA 2GESA 4DDUA 4QXAA 5CYPA 1FMJA 2ZPTX 3NC0C 3KB2A 1XTSA 3WNDA 3R9WA 2IYQA 1P2UA 1R4AA 2FH5B 1VIYA 3KTAB 3LO5A 3EPLA 2HLDD 2QL6A 2ZR7A 3GCGA 3EC2A 1E2PA 3VHLB 4DKXA 1QHHA 1LF5A 2CHGA 1EK0A 2QMHA 1ONBA 4JLVA 2BEJA 1XZQA 4A0FA 2VSFA 4IOKA 3RRMA 2D74A 2R9VA 5L3VA 2CNWA 3CH5A 4HLUC 4M1OA 4P32A 5JI3E 2GJSA 2AN9A 3LFUA 1CEEA 2JDID 2LKDA 4KJZA 3NHBA 2QM7A 1NVVR 1W36C 2VSXA 2YZ2A 1Z6TA 1KK1A 2AFHE 4HAYA 2C5LA 3QXCA 4BLQA 2GXQA 1YRBA 2QU8A 1Y63A 4FWIB 4Q9IA 1SVOA 1YR8A 3BXZA 2CE2X 3TLXA 4MKHA 3UXMA 1M2OB 3QENA 4PO8A 1UJ2A 4JSTA 4URUR 4LOAA 4LJAA 1E96A 1FTNA 4MRSA 3QXHA 4XVUA 1VYVA 3GLFA 2JJ2D 4LJ8A 1AN0A 3C16C 3ZVRA 3MWKA 3HR8A 4DLYA 1ZM7A 1JR3D 1ZRHA 2BCJQ 4GOKA 2KB0A 4C9BA 1KI6B 1DAMA 3B1WA 3MUFA 3X1YA 1WMSA 1IOZA 3T1TA 3P4YA 2C77A 3VHXA 3WMFA 1R8SA 3B1ZA 1OH6A 4AC9A 3I92A 1CLUA 2QBYA 4NKRA 1FQKA 2NO6A 3CX8A 5FL7D 1ZCAA 1N2CE 4TYYA 3DZ8A 1KY3A 2FSHA 1IXRC 3LV8A 5AJWA 4EQ6A 3BH6A 4FIDA 2P5TB 1T3HA 2EU8A 3DEFA 5AJVB 2ZREA 2IEYA 2PL3A 1U8YA 4EAQA 3SEAA 4E22A 1XJQA 3U6KA 2CJWA 3CF6R 2FDCA 1KGDA 3K53A 5LB2A 3ZLJA 1OV4A 2ANBA 1W4BA 2ZRKA 2ZS9A 1EX6A 2H5EA 3OE7D 3GLIA 4BZXA 5AUPB 4LC1A 4PR0A 3ICEA 1G8YA 3D3QA 2ZRJA 4PC2A 1QG2A 4RD3A 5FOXA 3N70A 4QJ5A 4ASUA 4KLNA 2IX3A 2O5VA 3FTQA 1G7SA 4WZBE 4JKYA 4B6FA 5DH9A 3QKRA 4I4LA 4PAOA 3SBEA 1N5KA 5FUXA 2NO0A 1NBMA 2QPAA 3B13B 4A2WA 1BKDR 4WIAA 5TARA 1SVMA 1DARA 3VAAA 3PQCA 1TUIA 4ZO4A 1OYWA 1NN5A 5KTYA 1R7RA 1TADA 4Q18A 1DTSA 2YV5A 4CF7A 3G82C 4M1SA 2J5XA 3KJGA 4GMXA 1UDWA 2OFXA 2J0UA 3RC3A 5EQTA 5JHGB 3ADCA 2F1JA 2JIZD 2ZSBA 1VPLA 5GVRA 3VU9B 4DCSA 3CZPA 4JJZA 5DI9A 1O87A 1XEXB 3AGQA 4AIIA 1W4CA 3AVUA 4DLTA 1F3OA 2Z83A 4URXR 3X1ZA 2Q3HA 3VR1A 2VIIA 1OE0A 2ATXA 3QJYA 2IBMA 121PA 3QPVA 4HUQB 5HTKA 4BUJA 4I1SA 4RD0A 2GVDC 3EARA 2NOAA 2ZUDA 3H0KA 3LX5A 3RS4A 1R2QA 1SVSA 4PZZA 1ZNXA 3TJZA 3SYKA 1KDOA 2P2LA 5DSZA 2WJVA 1NN0A 2R6GA 5DNYB 4JMPA 1I2DA 5DYIA 4YXWD 3LD9A 3AP2A 5E7JA 3TW8B 3DKPA 2H92A 4BFVA 1I4DD 5FBWB 5FR2A 3K70B 2BBOA 3AM1A 3V4RA 2GAOA 1QZXA 4A8JA 4F92B 1UM8A 3K0SA 2VH5R 2CBZA 3SFVA 2VSOA 5K8UA 1JAHA 1P6XA 2AWOA 4RZUA 1CS4C 3EC1A 1TAGA 3RAPR 2IYXA 2GCNA 2ZITA 5HZKA 2ZI6A 1DAHA 4RY2A 4DC9A 1JB1A 3A4NA 3K09A 1OXUA 1IJFA 1I2MA 1Z83A 3H1TA 3P26A 2O8EA 4IOMA 1G8FA 2W6JD 2DR3A 3LNCA 3Q85A 3JZAA 3VX4A 2ZI7A 5JS8A 4IDOA 1T8UA 1C9KA 1J70A 4FXPA 4PANA 4I99A 4BECA 1KO5A 4OJKA 3U60B 3IUYA 2NO1A 3FMIA 4KV9A 4M1WA 3C8UA 1UKZA 2VP2A 1N0VC 2XSZD 4L4UA 2ODWA 4IRUB 3LDAA 1XD2B 3UG7A 1P62B 5F3WB 3CIOA 4C0JA 5KPDA 4ACBA 5FFMA 5KPJA 1KZ7B 2OEPA 2OE2A 4FW9A 2QP4A 2QMOA 1XXHA 1ANKA 3TNFA 1SQ5A 4P31A 3SR0A 2GKSA 5JJIA 3AEZA 2ZYUX 1Z63A 2WAYA 2HXYA 1ZIOA 2OG2A 2VPPA 2F7SA 3NBFA 3K8YA 3EASA 4DDVA 1KK2A 1M7HA 2HUPA 1OF1A 3AUYA 5SZHB 3R7WA 4AYTA 3MAAC 3AVQA 1Z0IA 3KZ1E 1XMSA 4C0AC 2VTKA 4HATA 2B7BA 4QBHA 3ZVLA 4Q4AB 1F2UA 2ZIAA 3IKJA 3F8TA 4NYIR 1DO0A 3IEUA 1DELA 3QY0A 4M21A 3AKEA 2O8CA 1SXJB 1W0KD 1BS1A 1FUKA 3R20A 4D6PA 4ZIRB 2H7VA 3B82A 4CIDA 1D2MA 3VMFA 1WE2A 3S1AB 1IY2A 1BH2A 5SZIA 2VL7A 4GNKA 1AS0A 2BBTA 2CCGA 4NONA 4DEYA 3TH5A 2Q9AA 1GL9B 1N6OA 1RW4A 2C98A 4AI6A 2J0QA 4RD2A 4HYYA 4PSAA 2Z4RA 4BFYA 2W58A 3IBYA 5IT5A 1RYHA 1FX0B 1A5TA 4WXRA 1E9AA 4DXAA 3GMTA 3Q7QA 5EXPA 3WY9A 4D4LA 5J4LA 1W4AA 1KNXA 2NG1A 3AF0A 3FWYA 2ZEJA 2G83A 2ZRPA 5TDHA 2HYDA 3QXJA 3TSZA 4RCZA 3DZDA 1OH7A 2D4HA 2PLRA 4KVGA 3OZXA 1TPZA 2SHKA 2QMEA 4QM6A 2RHDA 3W90A 4NDZA 1Z3IX 4QC2A 1YZQA 1E4YA 4PHTA 4KITB 2YVUA 2ZE5A 3CF2A 1OFTA 3QF4B 4LHZA 1RRFA 4ZI3A 3NBZC 3A36A 1H8ED 3U2QA 1R0WA 4TLAA 5F9HA 2NMVA 4URYR 5G53C 3P20A 3IPXA 3SDZA 4HLCA 4FINA 5EP4A 3TAHA 3UPUA 3BH7A 3WRXC 1CIPA 4LHXA 4UXJA 4I1OA 3QXSA 1U81A 3KJIA 3WRYC 3HPQA 1W36B 3H2YA 2A2ZA 4OQXA 1K5DA 1LW7A 5CK4A 3ZIAA 2J7PA 2AKAB 2QSYA 1P72A 4BZPA 2QORA 4W5HA 1LV7A 3PUYA 3W6PA 5FPSA 2NIPA 1E9EA 1E99A 2PMKA 3DM9B 1T0HB 4R71A 1H65A 5HE9A 3GLHE 2QSZA 4OI2A 3AVYA 4Q7JB 4URWR 4CDGA 1RC8A 2JJ8A 4C0KA 3A58B 1RKBA 4P0TA 3IIKA 3KKMA 4B3FX 2CVHA 1ZU5A 4YMVA 2CK3A 2RCNA 2Q9BA 3IIMA 4QBFA 2WJJA 1U0HC 2YWHA 4R9UC 1X1SA 1ZYUA 3KQUA 3ZJYA 4WXPA 1DE0A 1IN6A 1KO8A 1AGPA 1PVOA 2BVNA 2HJVA 1D5CA 1YU9A 1KZGB 1FL9A 2WWIA 1BYIA 1AZSC 5E7IA 3L2OB 2E87A 2IF2A 3VR6A 2KJQA 3U3KA 1XX6A 3EPHA 2R2AA 1XD8A 2J3EA 3OEEA 4CEHA 4US1R 2VO1A 3CNOA 4S35A 1Z29A 3W3ZB 1IONA 4LYAA 2C95A 2VBCA 5JWHA 4M1YA 1VCMA 2I3BA 1Q12A 4ITRC 5ANRB 3SHFA 4DLXA 4LJ5A 2D2FA 1D2EA 3RSLA 5HR5A 3QKSB 3PEYA 2ZJZA 3TSWA 5FOTA 2GBLC 3NIBA 2ZRBA 2IYYA 4PC7A 4B3CA 3A4LA 5EUMA 4Q1AA 4PC3A 4PSKA 1NMYA 4HDCA 1WCV1 521PA 2OCYC 2CNWD 3LBNA 2QE7A 2C96A 3EZ9A 2RGDA 1E2IA 2YINC 2O8BA 2PZFA 4O25A 4LPSA 1N6PA 2IUSA 5EE5B 4ZDJA 3SQWA 3BC1A 1JECA 3THWA 2PMDA 1N6NA 2C04A 2OILA 2ORVA 2UZ3A 5M04A 1OFUX 4B74A 2JAQA 3PV0A 4ZDKA 3UKDA 2CL6X 2GCOA 4TMXA 2P3SA 4EKDA 2GEDA 3TBKA 1E2KA 1KTVA 3LA6A 1KOFA 4OK5A 5EJEA 1KI2A 4HB3A 1TL7C 2EFCB 1G16A 5BWMA 3I5YA 4JYCA 2CLCX 2CVFA 4TQAA 2FSFA 3Q9LA 1ZUHA 2IUTA 3LVRE 2C03A 2W2TA 1TQ4A 1S8FA 4TZ6A 2WKRA 1G17A 3MWYW 4BLSA 2WWGA 3SNHA 1UDXA 4A8JC 3RNLA 3T1VA 4ZKDA 4TSFA 3SJBA 4F38A 3R8FA 2IS6A 4ZI2A 2P67A 4IW3B 1EFHA 4BQSA 2UZIR 2C2HA 1UBFA 2IYWA 3NTUA 5L3SA 2ZSFA 3THXB 1ZVQA 3ZDQA 2AX4A 2VQSA 3K9LA 1OIXA 1G5TA 5HCIA 1VDZA 1MKYA 2XTZA 4OK6A 5EP2A 3MCAA 3L0SA 4NCNA 3T15A 4OHZA 2O52A 4F4CA 4C0BA 2YWGA 4MRPA 1Z2AA 2V54A 3K0AA 3RWOA 1SKYE 4TMKA 1UKEA 2NPIA 3UWOA 2VLIA 4JLOA 2O8DA 2YC2C 2OESA 3TVDA 4B33A 1W4RA 2A5YB 1KO4A 2DFTA 2PBRA 4DCUA 2QRNA 4ASUD 2WJGA 2DBYA 4LJ6A 2HV8A 4DSUA 4JKIA 1XP8A 2A78A 2BJVA 2QEQA 1NBMD 1N6KA 1Z6XA 2X2FA 4BFXA 2GDJA 2Q6TA 5JSZB 2QZ4A 3OIWA 4Q1DA 4FMBB 3T1OA 3A6PC 3BK7A 1A2KC 1M1YE 5CB6A 4US2R 2XSZA 3KXIA 2REOA 3DKVA 3EZFA 3K9HA 4QGHA 5CLQA 3P4XA 5IK2A 3NVAA 4ZDWA 4MYHA 1CJVC 2R6AA 5DE3A 2C9OA 4I1UA 1WP9A 2IF0A 1E1RA 5D3MA 5JMTA 4Q1FA 4L15A 3THYA 3QE0A 2CL0X 4XD7A 2UKDA 1ZM2A 4OI0A 4M1KA 3K0CA 4LWZA 5DHAA 4A0GA 4CEIA 1P9WA 1AKEA 1GRRA 1GNRA 2HEIA 3OIVA 2ZUCA 1AKYA 2FPMA 1NVWQ 4EPTA 4D80A 3RS5A 4GP6A 3IGFA 1HQCA 2OLKA 3FHOA 3U5ZB 4OL0A 1CRPA 2YJTD 1SZPA 2ODNA 4RJLA 5AR1A 4LX0A 1P73A 1DO2A 2AXPA 1OH8A 1NRJB 4GZMA 3GJ4A 4NP6A 1G18A 1VHLA 3I1FA 4DBLC 1RRPA 1JEEA 2OV2A 2Q0HA 3WYFA 5G41A 3TW4A 1LNZA 3KUDA 4M1TA 5DIFA 3WMGA 2A5JA 4MRVA 4V0NA 1FP7A 2ORWA 5JRZA 1I4TD 4TMTA 4IKEA 3Q72A 1XPUA 4DCNA 4CVNA 1YR7A 4RSGA 1IN5A 4JLPA 4QG7A 1G3UA 2C99A 2ZROA 4B2PA 1Z07A 4B48A 2EWVA 3RVBA 1P5ZB 1IXSB 4P33A 3SJCA 1KDRA 3A1VA 4UKDA 4GMDA 2XXAB 3ZVMA 3PCRB 4C0QC 1A2BA 1MO3A 2KSQA 4C0SA 4MGIR 3A1WA 4GBMA 4PHHA 4TMZA 4JSYA 3P1JA 1P2SA 1CR1A 4AWXA 1G64A 3ADKA 2OCPA 3BRWD 1YRAA 2OSBA 4R2HA 3MMPA 3B7GA 3VTKA 2AWNA 1VG9B 4E07A 4OI1A 1OB2A 1M7GA 1G4UR 1ZAKA 3FB4A 3EIHA 5FTMA 1LS6A 4UNPA 2REXB 1QHHB 4UXIA 5FOWA 3AF1A 2ZM5A 1TF2A 4DRZA 3VR3A 4NCJA 4IDHA 2REBA 5HKKA 1NMXA 1X1RA 4WAUA 1KAOA 4ACAA 4DLZA 2IS2A 4OHWA 1KYIA 1ESNA 4X8LA 3B8HA 3BB1A 4A82A 3P27A 2ZRNA 4JT4A 4YONB 1TNDA 3T35A 4L5BA 3OEHA 1JR6A 3HYTA 1QHIA 2WVJA 2IXGA 4Z54A 1P60A 2QG6A 3REGA 4I1VA 2QAGA 2R62A 3IILA 1SULA 1E1QA 1VCIA 3ECCA 4II7A 5HCNA 3GLFB 2FE4A 2JLYA 2DWQA 3L82B 3DMNA 4Q47A 3MFYA 3TQFA 5ELXA 3VFDA 2KI5A 3PUXA 1VYTA 3MRSA 2PZEA 1UEJA 4NHOA 2J87A 4A15A 5H1YA 1X86B 421PA 2IYTA 3EWAA 3JVUA 4US0R 4QBIA 4I81A 2QBYB 3LVQE 5KNBA 2J1LA 2BM0A 1TUEA 2V3CC 3OIUA 4U7DA 3K9GA 3RHFA 4M9QA 4C0LA 4EQ6B 1OXVA 2WKQA 3EA0A 2BMJA 1Q1ZA 5CLLA 3T5GA 3UG6A 2G1JA 4NCIA 1JPJA 4W5JA 5EE1A 2ZJ2A 2JA1A 5J4HA 1D8TA 2CJWB 2NO7A 4POAA 3RC8A 2P6RA 2FFBA 2FGKA 3VNVA 3GLIB 1DG1G 1EXMA 2WWXA 2F1IA 1XRJA 5EZ5A 1RRCA 3DVLA 3AP3A 2GZAA 2QN6A 1AQUA 2VA8A 3B2EA 3QSYA 4LY6A 3I72A 3HYRA 5FPKA 2F55A 1QRAA 3RRZA 3QKRB 5TB5A 3O8RA 3V00A 1NF3A 4TLBA 2E1RA 2ZI4A 4BFZA 2QP9X 3D8BA 3FGNA 4L16A 3ZZUA 2BKUA 2ZJOA 4PQFA 2D06A 2ZYWX 1WDTA 1NLYA 4FMCF 1ZD8A 1Z6AA 2FPKA 1NG1A 3FKQA 4KYUA 4E09A 4D81A 1QHSA 1D9ZA 2NQ2C 3VR2A 3W6NA 3QKUA 4GT1A 3X2SA 4NCKA 4O2LA 3TGPA 1FZQA 1CJTC 4TMWA 3TRFA 1KJYA 1PLJA 2WJYA 2RGAA 4Q48A 2V8OA 4RD4A 5BN4A 2QMUA 3BFXA 3FMOB 4RKEA 1ZM3A 4JVLA 1HTWA 3UWKA 5JBQA 3SZRA 1AZTA 2QA5A 4TYPA 2GJKA 3AVPA 2AFIE 1T8TA 4EUNA 4DT1A 4BEBA 1FW6A 3KXLA 2GAAA 4NH0A 3FMPB 2JLQA 3ZIAD 5AK0A 2J7PD 2WJHA 4R7ZA 2IYVA 5DHFA 1TU3A 1R6BX 2AXNA 1AQYA 4XWAA 1VG0B 2GJAA 4CT4B 1XTIA 1QVAA 1UF9A 4ESHA 4KFTA 1OXSC 1P4SA 3KKOA 2IYLD 1II8A 3I32A 1CULC 2WIBA 2C8VA 1S96A 1F2TA 5E4FA 4TYWA 4KAXA 1VG1A 4JLAA 1GRQA 1YZGA 2CK3D 2ZR0A 1JR3E 5L3RA 2JCSA 5IHPA 4W7SA 4Q7LA 3B9PA 1R0YA 4A8JB 1EGAA 4PO9A 5FTJA 3M0EA 4DLWA 1US8B 1Q1QA 4XJXA 1G3IA 4BFUA 1NN3A 2FX3A 2NO9A 3E1SA 5TV2A 3L0PA 2J0VA 2W6IA 1E9FA 1SXJE 2OM2A 3OEED 1W48A 1YE8A 3AV0B 2IYSA 4GZLA 3ND9A 2FEOA 2ANCA 1VIAA 3GLGA 4XSGA 4LI0A 4OHYA 2WOJA 3SS8A 2OO7A 1ZUNB 2O8EB 2XZPA 2AHOA 2ZANA 3HU3A 2DCUA 3RWMB 2HCBA 3VNUA 5FTLA 4AG5A 4Q7KA 5LBIA 2ZS8A 1Z0AA 1DG3A 1AGRA 3KXKA 3U7EB 3NEYA 3KKNA 5FTKA 3PR1A 3ADBA 4OHVA 1QVRA 5SZKB 2QE7D 1XPRA 1T9HA 1IM2A 4IEEA 3K1JA 4Q1BA 1HE1C 1ZP6A 3BIFA 4TT3A 4BLTA 1E3MA 1G8PA 4KSBA 2GTPA 4MH0R 5G40A 3HP1A 1XPOA 1R0XA 1TEVA 1G6OA 2RGGA 5B2ZA 4F4IA 1OKKA 1KJWA 2RGNC 1U98A 1XCGB 2I1VB 2BMFA 2RB4A 4PO1A 5KDLA 3PUWA 3V9PA 2RMKA 3W3AA 3LLMA 4RKFA 3C5CA 2X1VA 5EUQB 3R7WB 1WB9A 1M8PA 2B8WA 3FHCB 3REFA 4JBWA 2J59A 4PPGA 3TKLA 2OUKA 2NTYC 2GEUA 1F2UB 1U90A 1RJ9A 2DY1A 5L8VA 1DAEA 1KI6A 1QBKC 1N5IA 2PJZA 4DSOA 2RH5A 4F7WA 1VCNA 4TL9A 2O8CB 4TSFD 1S1CA 5FOUA 1ZNYA 1NLFA 1E2NA 1UBCA 5CJ2A 1TQDA 2FA9A 3EW9A 3I4LA 4JLKA 4GP7A 3BJIC 2WIAA 4QGAA 4LJYA 1OFHA 3PFIA 1R5BA 4A6PA 1F5NA 5L3QB 3HJNA 1PLKA 2XTMA 4QM7A 4U5XA 3SI7A 1UEIA 2WPDA 1QHNA 1KSHA 1MO4A 1PUIA 1GKUB 2IC5A 3TUZC 3QI2A 1BIFA 2FF7A 1WBBA 3PENA 5KDDA 4BPBA 1GM5A 3FDIA 1OXXK 4ZCLA 1H8HA 4R2IA 1Z0KA 4LYHA 4LBZA 1JQJC 2FEMA 4AKEA 4N0EA 5CM8B 3RRNA 1T5LA 5KDOA 3QG1A 1RZ3A 1IJEA 2ECKA 3CR8A 1T3LA 4D0LB 5JWRA 2FOLA 2QPOA 4EFLA 1E94E 1YZLA 3CRVA 5CITA 5KSYA 3GJ0A 5EXSA 4YC7A 2ZRGA 1ZIPA 4X8HA 1MO5A 2D62A 3JZMA 1GIAA 3AF3A 3KQHA 3BB3A 5B30A 5IK2D 1EESA 3LW8A 1MH1A 1EX7A 4V0ME 3FMFA 5FL3A 4H1UA 1CR4A 1E1RD 2WOOA 3BS4A 4TZ0A 2GEVA 4EJSC 3BOSA 5AJYA 4BLRA 1CKEA 4OYHA 4XD7D 1XTRA 4ESVA 1HV8A 1YZTA 3GQBA 4EDHA 3ICQB 5J40A 4Z51A 5KUTA 3GJ7A 3CF0A 1AK2A 3TIFA 2MMGA 3OF5A 2RHMA 3VU9A 1ZU4A 3PEWA 2CLDX 4QHYA 1EG7A 4PPNA 2IA5A 3KKQA 2QGZA 4V03A 4TTRA 1E2QA 4MRRA 3X1DA 3KQKA 1N5JA 3EX7C 1L8QA 1J2JA 2BIFA 2G0TA 4PTLA 1HQYE 4HUQA 2QENA 4QGGA 3SHWA 4BLOA 4JLBA 3GFPA 4O2RA 3F3YA 2GXAA 1E32A 1N6RA 1T0JB 3GFOA 1P3JA 1U0LA 3FFAA 2ODBA 4TMVA 4WW0A 3A37A 2OAP1 2DYKA 1N25A 3MD0A 2V6IA 1OH5A 4PQYA 2Q21A 1K5GA 4KFSA 5CJPA 1QG4A 1XMVA 2IYZA 3CX6A 4KHZA 4V02A 2BEKA 4FMDB 4MKIA 4GPTA 1T5IA 5DLQC 5K8TA 2WSSA 3K0EA 3BFKA 2ZU0C 1NNEA 3NC1C 1WA5A 4Z8YA 2BMEA 2V9PA 2F43B 4HB4A 3BBPA 3HR7A 3MSXA 2G9NA 2VP9A 3BB4A 4GDFA 4FCWA 5J4YA 1MABA 1VKJA 3PITA 2H17A 4EPVA 5BN5A 2F3RA 2YOGA 4IOLA 5C2JB 1Z6GA 3ZGXA 1Q57A 2JLSA 2EQBA 4PC6A 2GCPA 2ZAMA 1G1MA 4IVQA 5CDFE 5C4GB 1UBEA 2EYQA 3AB3A 4JL6A 4O3MA 1W49A 3X1WA 4DHEA 5JLJA 3RS2A 4OKSA 3K0FA 3RSOA 1A4RA 3TMKA 4TL7A 5HKKD 3T5DA 1T91A 1K6MA 2GK7A 2PH1A 3C4JA 1A7JA 3RYTC 1IXZA 4MYTA 5HPYB 2C78A 1ZW6A 4BASA 2O8BB 2CCKA 1QF9A 4M0LA 3DPUA 1J8MF 4CGZA 2PLFA 3THWB 2FFHA 2HDNB 3OEHD 1YR6A 5C18A 2FSGA 4N1AA 3OFNA 3MGCA 4YDHB 2GCOB 1KDPA 2QPTA 3A4MA 1KSGA 3I62A 2ZQ5A 4Q4LA 4ON9A 5FI1B 4B3DA 1D6JA 1N6HA 1G291 1E1QD 4L9WA 3SJAA 1SGWA 3LW7A 1Q0UA 2N1BA 4DCTA 1KO1A 4Q9KA 3T1QA 3ZZTA 1LFDB 2XNDA 4Q5IA 3SJZA 5JEEA 1KY2A 5C4MA 2ZYVX 3C15C 4JL8A 4A92A 2H1LA 3CO5A 4Q02A 2OAQ1 3O8CA 1WXQA 2YOHA 5IRCD 2G88A 2JASA 4N0DA 3EZ7A 3KKPA 3B85A 4Q19A 4IFBA 1E2JA 3EAQA 5UKDA 1E0KA 4PZYA 4KVAA 2F9LA 1IY1A 1XZPA 5L3SB 4NYJR 5FPHA 3CPJB 4RD6A 4A6XA 1VMAA 2EVWX 2JJ1A 1PZNA 3CWZA 5E95A 1Z0FA 3KFXA 1XEFA 2V7QA 2YYZA 5KHOC 2ORIA 4C2TA 3WXMA 3BD9A 3CUEF 4HAWA 4LBYA 4IDNA 2VHJA 4GOJA 1W1WA 2ERXA 3DMDA 5DI3A 3AVTA 1U99A 3K0AB 3S1AA 2XZOA 3AF2A 2O8DB 1R8QA 2PCJA 3ONWA 2CE7A 2XNSA 1G5PA 2BJWA 4EPYA 4HZUA 2ZJAA 3LAWA 1HUQA 2FWRA 4HLQB 5FOVA 2YKGA 5AUOB 4E03A 1DBSA 5GADl 3DL0A 1FX0A 2WHXA 2DPXA 5A4JA 4KFUA 2CHQA 5TMPA 1IAQA 4P4SA 2N46A 1ZC3A 2W0SA 2KBEA 4LDJA 2IS1A 1AA9A 3KFVA 3IPYA 4R98A 3FFBA 2WKPA 4MUAA 1F60A 3U44B 1FUUA 1EFCA 2BCGY 4AYWA 1CRQA 3A1UA 1X6VA 3I73A 3CW2A 4W9MC 2ZI3A 1COWA 4GFDA 1GFIA 3MLEA 3DOEA 3U3RA 3THYB 1S1MA 3ZS8A 1W7AA 4CEJB 2PEYA 3T06B 2VRWA 3DM5A 5EZ6B 1UAAA 3EZ6A 3ZQ6A 1W0JA 4G5QA 3U4QA 2GVZC 2WM9B 4DIEA 1CTQA 4WVFA 4OK3A 4RZ3A 2ZSDA 1G3RA 3W34A 4M9XA 2D7DA 1XEWX 2ZRCA 2XX3A 3AKYA 3IDQA 1X8JA 3ASZA 5JZVA 4ARZA 3UMRA 2ODEA 2NZJA 1P2VA 3UANA 4DDWA 1DOAA 1GAJA 1Y3AA 1GOTA 1L4YA 1NJGA 3GLFE 1G4AE 1AS3A 5CK5A 1XFAA 4F4JA 1DAFA 4U02A 1NY6A 3WBJA 4EFMA 1XDBA 4A1FA 2Z0MA 4PXAA 3K09C 4MITA 3HDTA 4KBGA 2ZI5A 1Q44A 4AY2A 2O8FB 3A1TA 3GD7A 4V0OA 4WOPA 4PHFA 4JBXA 1OFIA 3U7FB 1O3YA 2E9SA 3ASYA 2J7KA 5HE8A 1DADA 2ZYTX 4A4DA 3BH0A 4H9GA 4G1UC 4NZYA 2ZRMA 1YR9A 4YDSA 2W6ID 2YWEA 4UXHA 1KKMA 1ZD1A 1G8GA 2J9RA 5DO9A 5KOYA 5KO2A 821PA 1GG2A 1UPTA 3QXXA 1NVVQ 1XCMA 3CPHA 2O0KA 1NMZA 2BHRA 5CIQA 4AURA 2ASEA 1WQ1R 3BAFA 3AVXA 4HLDA 4QKQA 4ZV4A 3GLIE 1G41A 4XWKA 2K5UA 3PG5A 2D2EA 4Q03A 3AF4A 5EE0A 4M9ZA 1E4VA 1XF9A 2QTVB 4NBSA 1LF0A 4C7OA 5JEDA 3VKHA 2H18A 2WV9A 4TQUS 1Z47A 4B73A 5FOSA 2WWYA 2OT3B 1LVGA 1Z6YA 3E5HA 4MYCA 4B75A 3EPKA 5JS7A 1NBME 2G6BA 2F1RA 4TT3D 3RS3A 2IXEA 2AR7A 2QAGB 1E2LA 1IQPA 2XTNA 2A9KA 3C14C 3QVVA 3SOPA 1N6LA 4F91B 2IS4A 4M4SA 2JLZA 1GITA 1YQTA 1OKKD 1XTJA 4D4JA 4EJSB 2FU5C 5HZHA 3GJ8A 2CCJA 2PJRA 3FHTA 4G3XA 4DZZA 2ZSAA 3QBVA 4S2EA 5FUWA 4LV6A 4AD8A 3FYHA 3WP0A 1KMHB 1M6NA 4P4UA 2QQEA 1MO6A 3AP1A 3TR5A 2VP4A 2EFDB 1E2EA 4DSTA 1OIWA 2WICA 2EFGA 3W8NA 2OBMA 1OPXA 1UFQA 5BN3A 4MGZR 1JBKA 1N5LA 1P7CA 2EFEB 4A0RA 1WBDA 3QKTA 2FMXA 1W44A 3KB1A 3I5XA 4AG6A 2OHFA 2WJIA 1TX4B 4YMSA 1TU4A 1X8KA 2QP3A 5CM9C 2KWIA 2RKOA 2KE5A 3IHWA 1QHYA 4QBGB 2FFAA 1J8YF 3D6TB 1HT2E 1W46A 3CONA 3THXA 4QNRA 1W2HA 4L9SA 2WPDD 2ONJA 3U3OA 1LB1B 2VF7A 4V0LA 3IQWA 4HAUA 1E98A 1FQJA 3BWDD 2J41A 5FR1A 5IDVA 3IO5A 3R8CA 4EFNA 4P3YA 1CR0A 3IQXA 4B3XA 2GZHA 1H8HD 4PZLA 3RABA 3SYNA 4M53A 4Q4JA 1IY0A 2FFQA 3VKGA 3CH4B 2GHIA 5FBVB 2ZVPX 1DAIA 1VG8A 5C46F 4DLVA 3W8RA 5F2EA 5DN6A 2BV3A 4G5SA 4XTCS 1KI1A 1NLZA 3U61B 2HXSA 2ZAOA 2X2EA 5JSZA 3VX3A 1Q1BA 1ETUA 2ZJYA 5JJKA 4LPKA 3ETLA 1E9BA 1XU4A 1CJMA 2MSCB 4FI3C 4F93B 4DB2A 3DO6A 2BKEA 4D25A 1JXMA 4IXMA 1EFUA 3GLHA 4LYFA 1CJKC 1Z28A 2BBWA 3LQQA 4TYQA 5C1BA 1XMJA 2NZ8A 3NH9A 2AK2A 5DGXA 3VR5A 5K8IA 4LJ7A 5CYOA 1PV4A 2GF9A 2B7CA 2CL7X 5J4VA 1GKYA 3EXAA 2V6JA 2Z4SA 2OLJA 5FBQB 2GETA 4CW7A 1NKTA 3CPEA 2VP5A 4BLPA 4RZXA 3ZS9A 4A0HA 4BZQA 1PUJA 3AKDA 1DEKA 1F48A 2CLSA 1HA3A 1XNJA 3NWJA 1Z5ZA 4OI4A 2VHTA 3QOFA 1GRNA 4TL6A 3ZVNA 3UIEA 5FI0B 1II8B 1XXHE 3THOA 2ZUBA 3I8SA 1CJUC 4D26A 4DLUA 1OIVA 4QFMA 1X3SA 2XJ9A 5TY0A 3GJXC 4URZR 4M22A 3DHWC 3R9IA 4TLCA 3EG5A 2ZJBA 4Q4HA 2ZSEA 2Q3MA 1GUAA 2IHBA 2HJGA 3C7KA 3J81k 3SN6A 4JZKA 1Z8FA 3O8BA 4YMTA 1IN4A 2XOKA 3SBDA 5KU1A 1SVIA 5GVSA 2WSSD 3B1XA 3CKLA 4YLGA 3K70D 4JVNA 1W5TA 1Z06A 2FG5A 2P0EA 3VQTA 2IL1A 2ZRFA 1NVXQ 3W5IA 4OQFA 1D9XA 4LJ4A 4UNNA 1E9CA 3T34A 2X77A 2PX0A 2JGNA 1R5OA 1JJVA 4Y0AA 5BXQC 2DB3A 2LCFA 2J46A 2EFHB 3GLGB 2A3RA 2XXAA 1ZC4A 3TSOA 5EXTA 1Z0DA 2JLRA 2HT1A 1E2HA 3G5UA 4V0KA 4RFSA 4B71A 4JT2A 1G3MA 3OAAA 3QNUA 4ERNA 4KXFB 2J0UB 4DEXA 4E5UA 4O0MA 1FP6A 5AJZA 3LX8A 4A2QA 3MWJA 5K8LA 5KSOA 2OXCA 1W47A 4EPRA 4RFVA 3EPJA 3KJHA 2ZRDA 2RGBA 3GJ5A 2B21A 2WMNB 4NU0A 2QI9C 3GEHA 1C1YA 1ELOA 1G7CA 2PZGA 4PAMA 3OFND 3QEOA 5AJXA 5KSZA 4DSNA 1M7BA 2H16A 4JS0A 2OBLA 5LB4A 5J4KA 3D7MA 4NYIQ 4HAZA 4PX9A 2IUUA 4BRWA 1KK3A 2F9MA 3W5JA 1XJ0A 2V1UA 2FV8A 2OBNA 3DDCA 5KNCA 4B3BA 2LKCA 3WNCA 4A9AA 3A1SA 4RZ2A 2DHRA 2W2VA 2AD1A 2XNDD 3ZD6A 4MUBA 1KI8A 1RVDA 4LC0A 4DCVA 4BFWA 1RPZA 3R9XA 1KI3A 2QM8A 1X8LA 4DUGA 1G7RA 1RJ9B 4LHVA 1G3QA 4NYMR 2ZETA 4Z1MA 1U8AA 4OQLA 5FUVA 1G19A 1MR3F 2O0JA 1F6BA 2LWIA 2BWJA 1J7KA 4B2LA 4B6EA 3QPWA 5BYJA 3AVVA 1GP2A 4W5WA 2JJ1D 1E6CA 4PPQA 1OB5A 3SYLA 4TWZA 2V7QD 2UVQA 4MDFA 1SXJD 4XSHA 3MJRA 4Q21A 1FNNA 3EA5A 3PIRA 3TVTA 1FTSA 5JCPA 3PUZA 1NKSA 1I4LD 4DVGA 1FPMA 1KMQA 2CDNA 2FN4A 4DIDA 4LYJA 4BRUA 1OHHA 5KYKA 3K9NA 1N0WA 1SHZA 3KUCA 5BQ5A 3AH8A 2EW1A 3WYGA 1OLOA 1R10A 4UJ5A 4TYNA 3I61A 5AWFC 3CRQA 2WWFA 3IIJA 3NG1A 1P75A 4C30A 3CRMA 4XH9B 1II0A 5KNDA 3KTAA 4OQMA 2W83A 5AUQA 4UNRA 3K0CC 3AVWA 4B34A 1OXTA 1SVKA 5EXXA 2YWFA 3U3JA 4HI0E 2BMDA 1HURA 4NTZA 4AKHA 2EYUA 2J45A 2G0NA 1IBRA 5FBRB 2WWWA 4DJTA 4KFRA 5FH9A 2R6CA 3LLUA 1YHNA 2P5SA 4Q9LA 4K81B 4LBWA 1COWD 1XXHB 721PA 2JLVA 2FNAA 3UMFA 4QGFA 2QY9A 2GBLA 3N2EA 3GFTA 4BFTA 1CU1A 2HCJB 3RANA 3IHLA 2EWWA 1S9DA 2BDTA 2RGEA 4YMUA 3EIEA 2DFKB 3LY5A 5EP3A 1SKQA 3SC3A 4GRAA 1W0JD 3ZYCA 3SU8A 3NH6A 1EFRA 5IF9A 1W36D 5H68A 2GJ9A 1TMKA 4MGKR 4C2UA 5AUNB 1U9IA 1LTQA 3QPUA 3QVUA 4LJ9A 2FZ4A 2XZLA 3LXXA 4NYJQ 4Q00A 1OYYA 1LY1A 4HDQB 4JIMA 2GK6A 1HH4A 2A7QA 3IO3A 5JHHB 5EE3A 2ATVA 1L7VC 1GZSA 5JCZA 4X8MA 4WZ6A 3WHKA 1JI0A 1GDDA 4RD1A 3CBQA 5LD2C 4JYBA 2JLWA 5CB8A 2RGXA 2IHYA 2F3TA 2MSEB 3QF7A 4MKFA 3QEJA 3TR0A 4JLJA 4LRWA 1AIPA 2ONKA 1W2GA 4G01B 4B32A 1NN1A 2DWPA 4KO8A 2YC4C 3ZQJA 1QHXA 1E79A 3V4FA 4HDOB 1HEIA 1US8A 1JAIA 2OCBA 4IOJA 5B58C 4M9SA 1BMFA 1MABB 2R6FA 2DWOA 2ZRAA 4UQOA 1CF4A 2QQ0A 1S3GA 1P9NA 3QG5A 4QHTA 2X19A 3FKSA 1YZUA 4J0QA 1FOEB 1GNPA 3WMEA 1E2GA 4NPHA 1PJRA 3GPLA 3LH5A 2HF8A 3CB4A 2CEAA 3K0FB 2QAGC 3H84A 3TQCA 5J47A 3HU2A 4P4TA 4RCYA 3BFVA 3NDBB 2MMCA 2ZJ8A 3AGPA 1DS6A 2WTUA 2V55B 3Q8XB 1Q1EA 4BEJA 3FOZA 4TQ9A 1AS2A 4KBFA 3RS0A 2AL7A 3IEVA 5E3HA 1S3SA 3ND8A 1ODFA 3WYAA 1XTKA 5GJVC 1NSFA 5JRJA 1IN7A 4XIGS 4C4PA 1T3SA 1XMIA 1XEXA 1ZD9A 5FTNA 4PHGA 5LPNA 4ZCIA 1S0UA 5JJLA 2R65A 2IWRA 3I8XA 5P21A 3KQLA 2VP0A 4XOIA 3WBKA 2WZQA 2PCLA 1G7TA 3KJEA 4H1VA 5BW8A 1ZUIA 4PFSA 1OT3A 3OIYA 4WZAE 3L43A 4M8NE 1MRNA 1AJEA 4IJMA 1Q21A 1LS1A 2DFNA 2R44A 4UJ3A 2BC9A 2GRJA 1E0SA 2GA8A 1P9RA 5JFGA 2B92A 2XEXA 1DAKA 2W2XA 5DYGA 3SQXA 1KO7A 4HEJA 4MQBA 2YOFA 3O47A 3HU1A 4OBEA 3OHMA 2R8RA 3VR4A 3W6OA 2J0SA 3CRW1 4YMWA 1QHGA 3WP1B 2HYIC 5DI3B 1L2TA 4CEHB 2OXRA 2Z6VA 2ZTSA 2PT5A 2DFLA 3L8YA 4FD2A 4TL8A 1C4OA 5EP1A 1G5RA 2A5FA 2AKYA 2G77B 3MG9A 1S4QA 3PEUA 2A30A 4HZUB 4JLNA 5L3QA 1HYQA 1FNMA 6Q21A 2R6DA 1VHTA 3CWQA 3I3SR 2H57A 3EWSA 4Q9JA 4Q66C 3W9YA 1ZINA 4DLSA 2BBSA 1K8RA 2FJUA 4QOSA 3TE6A 3MWLA 4P4SB 5EE9A 5FUYA 2HLDA 4LCBA 1NL3A 4EPWA 1CR2A 2ZI9A 2ZXUA 3ZZ0A 3GP8A 4C3ZA 3KDSE 4HB2A 3B78A 1U0JA 1NIPA 2ZJ5A 4JVSB 5DN6D 4OHXA 4D0GA 3L8ZA 4XTRA 2JDIA 1KDTA 3AKCA 5GJCA 2JATA 1KJZA 2CXXA 4IDPA 3G0HA 3GJ6A 3RDPA 3KL4A 3QUSA 1N0UA 4ZDIA 5B64A 2WMOB 4UNQA 2VF8A 1XD2A 4B3GA 1XWIA 2Y8EA 2XAUA 2PT7A 1KHTA 5KSPA 4ABYA 4MGYR 2GXSA 1B0UA 1OSNA 4AK9A 2Q3FA 5D3QA 2JJ2A 3U4QB 1YZNA 4BE7B 4XWOA 3PXGA 1R5NA 4RVCA 4BGDA 1JR3A 3GEIA 2FPLA 2GNOA 3BORA 4TLDA 4MA4A 4Z8XA 1R0ZA 2H8KA 1ZM4A 3WHLA 2O0HA 1MOZA 4DDTA 1JQLB 1S9HA 1RFLA 4ARZB 2GZDA 4NCHA 4LBVA 2RGCA 3GJ3A 4Q4AA 4LV8B 4U00A 4Q9HA 5FL7A 5B57C 1Z0JA 1ZNWA 2P6UA 4G0NA 2XGJA 4DWJA 1SXJA 2IEZA 3NBYC 4ZIRA 1GSIA 1MV5A 4LK2A 3TUJC 2VHQA 4LHYA 1E9SA 1A1VA 1HE8B 2OFWA 4EIWA 1W5SA 1U94A 2WAXA 3M6AA 5G3ZA 4B76A 2FZLA 4D82A 1E9RA 2QRZA 5JI2E 2JLUA 1WRBA 2VHCA 2XOKD 1XJCA 1J99A 4QJ4A 3OE7A 3NXSA 1AM4D 1CXZA 2AK3A 4KSCA 4B44A 1Z2CA 3IBGA 3NBXX 5FBLB 1BO6A 4GI7A 3F0TA 5JWOA 3RLFA 4KCGA 1NI3A 4FMDF 4NL4H 8OHMA 3M4YA 1D2NA 3LBIA 2YNMA 4BFSA 2F43A 2IYRA 4K8OA 1KK0A 1G8HA 3PJRA 4QL3A 4Y0VA 4CZ2A 1CP2A 2WSMA 3D31A 4HAXA 4IDQA 3HWSA 2QTFA 2GWHA 3OAAD 3CNLA 3E2IA 4C7OB 1NJFA 5D3MB 1KI4A 1Q3TA 1T4GA 1XEWY 3P32A 1PLLA 1HT1E 4CRWB 2QTHA 3B6EA 3QF4A 1M34E 3UATA 1MT0A 4TN1A 1ZCBA 2ZR9A 4HB0A 4QNMA 2L0XA 4ZPXA 4CEIB 1G6HA 2YHSA 2I1QA 2JIZA 2QUZA 2GILA 1G21E 1TEXA 2WWHA 2QNRA 2F6RA 1E2FA 1VECA 1L4UA 2FGJA 4HLUA 1WF3A 2P65A 4IVPA 1ESMA 1JALA 3Q7PA 1GTVA 2VHUA 4MKGA 4TLEA 2TMKA 2HF9A 2XITA 1RIFA 1U9IC 1S2MA 4DB4A 4QHSA 1BYUA 4EPXA 1EFTA 2GF0A 4XVQA 1UADA 4ZCMA 1OJLA 2ERYA 2Z43A 3LRPA 3N2IA 2QT0A 2G3YA 3ZD7A 2VYFA 5J5CA 3Q5EA 1KI7A 1GNQA 2BOVA 4ZKEA 3DOFA 5DISB 2XB4A 1SHKA 2NGRA 1TTTA 1Q3HA 1KSFX 3T61A 4DUGD 3KQNA 1BOFA 1RYFA 3EIQA 3BERA 5LDDC 4Z1MD 4YXWA 1N6IA 3LQRA 4LGMA 5BYKA 4LV5B 1SVLA 2CMKA 3RS7A 1DVRA 3EZ2A 5SZJA 4HZIA 3SE0A 4PQRA 2C9YA 1MRSA 2CHVA 2IYUA 1XBTA 3CZQA 4N3NA 4NE2A 4IFEA 5LD2B 3FE2A 1U8ZA 4GL2A 2B8TA 4IVRA 2OZEA 1GILA 4FN5A 1E69A 1OHHD 2A5DA 2NPFA 1KKLA 3LXRA 3BE4A 4LHWA 1NG9A 2Q9CA 1DPFA 5F9FA 2HT6A 4Q4JB 4V0MA 4HSEA 4GSYA 1KSJA 3RRYA 2W6JA 4JVMA 2W0MA 4KLZA 1Q22A 2D7CA 3QKSA 4ILEA 3NEJA 3CLVA 1RRGA 1DAGA 4L8GA 3JVVA 1TF5A 4IEIA 4HUTA 1GVNB 5G3YA 2ZE7A 1G9XA 1II9A 4Q1CA 3L0IB 1FFHA 1UKYA 2IK8A 1ZM9A 1JNYA 3C41J 3NKVA 3PEVA 4TTPA 2W00A 4D2IA 3GLGE 1CBUA 3NHAA 4FWTA 4G5OA 3U44A 2ZU6A 3MJHA 1V5WA 1FMLA 4B35A 3GEEA 3GLHB 3CR7A 2B6HA 3SFZA 2F1HA 4JLDA 2ZRLA 4CYMA 1G20E 1YJ5A 4A2PA 4CEJA 1T6NA 2JEOA 2BM1A 2N42A 3VKWA 1M74A 1TQ6A 1YKSA 4NYMQ 1SVWA 4X8OA 3H86A 4GOXA 3FVQA 3O8DA 2C9CA 4DLRA 2A5GA 4JL5A 1E2DA 1E9DA 221PA 2JLXA 3C5HA 3PUVA 4JJKA 4G5RA 1EFRD 2ZRHA 4PAQA 4PSVA 3CRRA 2ZE6A 1UBGA 4B2IA 3U7GA 3K70C 4C0HA 3PVSA 1NP6A 3ZH9B 5FPYA 1P2TA 1OW3B 3KX2A 2IW3A 1JXOA 5FPTA 2RGNA 1W0KA 4HAVA 3A8TA 1YZKA 4QRHA 4OQNA 3CNNA 4LZZA 2QGNA 1JPNA 2VEDA 4K46A 1UKVY 4LSGA 4Q4HB 4D4MA 4URVR 4LUCA 3QQ5A 3ADDA 4A36A 2IT1A 1N3BA 1HY3A 3N5CA 3UMSA 1EWQA 3CX7A 5CDFA 3BGWA 3TUIC 2PX3A 3B9QA 5GJWC 3X1XA 1GL7A 5JECA 3LBHA 4D4KA 2IWHA 5A0FA 1E79D 2O8FA 2XB2A 3M1IA 2ZVQX 3QBTA 621PA 2QT1A 2G1KA 1GWNA 3FPAA 4KODA 3AQ4A 1BMFD 1KAGA 4IXNA 1ZMXA 4FMCB 1TQ2A 4RFSB 3AVOA 3FKSD 4G5GA 4JLMA 4CT5A 1KIMA 4KU4A 2AD5A 4IHQA 4Q01A 2ZRIA 4WA7A 3AUXA 1ZNZA 3L0OA 3U6BA 2ZS7A 4FCVA 2QAJA 2WBLC 2Z5FA 2XJ4A 4BWYA 1KI9A 1JEDA 1VCOA
chains in the Genus database with same CATH superfamily
1KP2A 1QPGA 3B1YA 1BQEA 1GPUA 1P4JA 3OEYA 5BO5A 4RQAA 2EOAA 2L19A 3HJHA 3INRA 4ZO6A 1BHQ1 3LHIA 3SAJA 3UA4A 3ZUGA 3ZJVA 1V43A 4XVRA 4WBSA 1B23P 1GTSA 2E4WA 3BFJA 3T4PA 3DVRX 3PC8A 3PRKE 2HLHA 1VFNA 4UEJA 1QAQA 3ND7A 1DEOA 3ETDA 4KV7A 5DWVA 3WNBA 1GAXA 2J33A 4R2JA 5A03A 5EJ5A 4AKIA 1FFGA 5F3DA 1L5WA 2R5NA 3E3MA 3TXYA 3DGEC 2AIRA 4LI3X 1XO1A 2YXNA 1USKA 2I4IA 1XD9A 1DTWB 1KJ9A 2B9VA 3H83A 1J90A 3GA0A 3OIGA 3WJAA 2VP6A 2AZTA 3T7EA 1PJCA 1QHEA 4M0UA 3Q5DA 2Q27A 4HDMB 4X90A 3BIXA 1ADYA 5IVKA 3QIAA 1FRNA 2PEZA 2VPQA 1QX4A 1UXJA 2W48A 2XHZA 1N7HA 4RUKA 5JO0A 1E3WA 4N6NA 2AEFA 3EK2A 2C57A 4O3MA 1JEQA 4RORA 4ZT7A 3D5TA 2A1UB 3WO0A 3CRZA 3EQ6A 4KI0A 5IANA 1BDBA 1QJ4A 3U3MA 1R0KA 3DB2A 2IXFA 5DLYA 1KMHA 2FSIA 3ESCA 1TT5B 4IIVA 1KEVA 4MA5A 4PC1A 2P2CA 4HNRA 4YO7A 1OBFO 3D43A 1FMTA 3UAXA 3WGUA 4AKGA 2H48A 2P3QA 2QRHA 4ZAWA 1X0XA 3GDGA 3VJLA 3E9DA 4QOIA 4XYMA 4Q7MB 5A5GA 4BX8A 4YI5A 4OCZA 4AYXA 4MW0A 3BE8A 1ORRA 4XQCA 3ZEAA 1U9YA 3VH4A 1ZH0A 4X1KA 3VR4D 4RACA 1DIRA 1HPLA 1C3OA 1ZJYA 3KLPX 4PIVA 4QELA 1P44A 4PBRA 1Q20A 2CKMA 3V1LA 5JMOA 4F1KA 3B5JA 3DE2X 3NIWA 3O83A 1QQAA 3IR5A 4XPIB 4UM9B 1FFDA 4M88A 2A88A 5FO0A 4XYGA 4BKUA 2RHCA 3EQZA 1VLMA 3IBTA 1WXHA 1YB4A 3HHEA 4P58A 5JAPA 3VXKA 2GESA 4D6YA 3VU1A 2HMTA 4PBSA 5E9WA 4QXAA 4DDUA 5CYPA 1DQPA 1MQ9A 2ZPTX 1X1CA 3DB1A 2IYQA 4RL4A 2FH5B 1VIYA 3LO5A 3EPLA 2HLDD 1N2SA 4AO7A 5LOVF 2B3TA 4JGGA 1JSLA 3KV3O 2E5WA 1LF5A 2AJ8A 1Z4QA 2Z8ZA 3CJRA 5ADVA 4K9LA 3FSJX 4YUWA 3RRMA 1XNQB 1DFHA 4DGQA 1UK8A 2ZP1A 1KFCB 3CH5A 3OZSA 4HLUC 4O4JB 1EVJA 2FOIA 3ZGZA 4Z4EA 2C3PA 3ANYB 3I05A 2HTFA 2JDID 5JD4A 2QM7A 1NVVR 1F0PA 2PMFA 2AJTA 1W36C 1Q83A 2VSXA 5LZ5A 1Z6TA 3REOA 3ISVA 2AFHE 3NORA 1M66A 2C5LA 4HAYA 3GCZA 3QXCA 4IZ6A 4LYYA 3CLRD 2QU8A 3A27A 4Q9IA 1HYGA 3LJKA 4YJ2A 4DR2B 1YR8A 3WFZA 4H7FA 1EFVA 2BGIA 2CE2X 4XM1A 1M2OB 3TLXA 3QENA 4F56A 4HGQA 1UJ2A 4JSTA 1VMIA 1GARA 1PQPA 4RGQA 5JDIC 3QXHA 1OMOA 1VYVA 2JJ2D 1M2KA 1VQ1A 2RC6A 4LJ8A 4NJMB 4MHSA 1PGJA 1X1AA 3QUAA 4WKOA 2HUNA 1ZRHA 3RFFA 3OT5A 3ICCA 4GOKA 4KK3A 4CF4A 4M8LA 4C9BA 1LPAB 1KI6B 3T3EA 4EYKA 4F2GA 1E5LA 1MJGA 4B0PA 3X1YA 1IOZA 2C77A 2E37A 1V8DA 5E0KB 1CLUA 2QBYA 3BQNB 3ORHA 4LSMA 5FL7D 4LF7B 3TVYA 3TECE 1NBIA 2BELA 4EGSA 3LV8A 5A7GA 3BH6A 2H3HA 2HA2A 4IF4A 3FWHA 3KETA 2LZ0A 4I8XA 2WT4A 1V48A 2IEYA 2I55A 1O0BA 2WDPA 5HF9A 1WSWA 1F38A 3VGJA 4D7AA 2CJWA 5JD3A 3BWCA 1UPUA 2OBBA 5LB2A 1Q91A 4K40A 4QXMA 1VXRA 4BZXA 3NIFB 2B1IA 2XADA 3FVVA 3TPZA 1G8YA 4MULA 3TJRA 3QTBA 5LYJF 4GZ3A 4PC2A 4BCBA 1CE8B 4OGKA 5MFPA 2YXBA 3N70A 3FWKA 4QJ5A 2IX3A 4FU0A 4QODA 3FTQA 1G7SA 2Q5FA 2GBIA 2QG9A 2YJ3A 4JKYA 4B6FA 5HUQA 4B7UA 5FUXA 1N78A 5COBA 5DYWA 3WOHA 4B3IA 1GSOA 4MVJA 3ZUPA 3PHHA 5F12A 4HEA6 3UOGA 1O2DA 3B1FA 5TARA 1XU9A 3IDSA 1DARA 3VAAA 2AOTB 1S3FA 5KJCA 1DKNA 4MI6A 1ODJA 3WIEA 2YV5A 3CEJA 5ALDA 2D1YA 5IX8A 3OWHA 4IIUA 3VC3A 3G82C 4EMUA 3KJGA 4GMXA 3RCBA 3I04M 4FSXA 5E9AA 3RQIA 2VF4X 3AG5A 3S44A 4P0QB 4Y6OA 1J2TA 1FBTA 4XIYA 1DKOA 1LK7A 2ZSBA 3FH0A 3CPSA 5GVRA 2O2DA 1I1NA 3CZPA 4I3HA 4U7HA 1XEXB 3V4PB 1W4CA 4DV1B 4BQIA 4URXR 5JNSA 1XNHA 4PLTA 1JUDA 1V8BA 1GGEA 1QH0A 2YDXA 2VIIA 3D9QX 3IP7A 4EYQA 3H8JA 1C7EA 2YXEA 4OU4A 3O90A 1Z38A 3AI1A 3HYLA 5HTKA 3VPXA 1E62A 2X8JB 4AJLA 1GQ2A 1N0HA 3K5IA 3H0KA 3KXDA 3PQDA 5JCJD 1JHAA 1RWPA 2Q4EA 4RK5A 3A6JA 1RJWA 2R79A 1MXFA 1NW4A 3TRIA 5DFAA 1BX0A 2ZB3A 1OGIA 1NXPA 4HVTA 2RH9B 4YTEA 4RKWA 3G2OA 1I2DA 3V2IA 3WLQA 2DHEA 5DYIA 4LF8B 3WE7A 2W11A 4FK8A 4OIFA 5EWMB 2YMPA 4H7EA 5ENZA 3AP2A 5E7JA 3FDXA 4JKOA 4BFVA 5FR2A 3AM1A 1U6JA 3V4RA 1PT6A 4F92B 1DUSA 2AI2A 1UM8A 2ZTLA 3NOOA 3I83A 3UMYA 2HQSA 4OV6B 5TC4A 3SFVA 2X0DA 3DYIA 5B58T 3UENA 3FYTA 3BCUA 3L1HA 3JQRA 3IERA 4GC9A 4DGSA 1JAHA 3ABRB 3IUPA 3OICA 3OJ0A 2O7VA 3P96A 4HN9A 4PYMA 1TVMA 2NNLD 4L07A 3O03A 4U4AA 4TKUB 3TLBA 2OD9A 4W6QA 1H05A 4FD3A 2QLJA 3O4HA 4N76A 4QDXA 3WGNA 2DU8A 2W8BB 3BRWA 3FWPA 5IJ0B 2QV0A 2VYVA 2XUFA 5K09A 3K09A 3R7BA 4ZYVA 5LP6A 2JD1A 2V0NA 5T41A 3TEFA 4MS4B 2QXTA 3KXPA 1ZUNA 3BXFA 3H1TA 3KEMA 1HDCA 4HDRA 3B3QA 3EPJA 1W85B 3DC2A 3Q85A 3JZAA 3MERA 3MRTA 4ECEA 4JB0A 4S1WA 4QOGA 2OCIA 4R1NA 1C9KA 4ZP1A 3A9VA 1J70A 4G1EB 4G8BA 1RLUA 2NPOA 3CUWA 4FXPA 2IYPA 2NSHA 4W8HA 4BU0A 1ADBA 5FBKA 4BVBA 1SRRA 4X7BA 4EY6A 2JH9A 4ZJPA 2A6PA 2I71A 1MP0A 1XZLA 2NO1A 2PL5A 4KV9A 5SYMA 4EVIA 1T5BA 4BV2A 1N0VC 1ODKA 2ODWA 4Z7OB 2FZKA 3HI4A 1DAPA 1P7PA 1VSTA 2A4MA 4IRUB 1A3CA 1CY4A 4PLVA 1K3UB 2R8PA 3EIFA 5BQPA 3BL6A 5KPDA 4ACBA 4B3TB 5KPJA 5DW3A 2E2WA 2OEPA 1L7OA 1QV7A 2Q62A 3E2PA 3KHSA 3LT2A 4FW9A 1B6RA 2QMOA 2W6CX 4IGAA 3NJ8A 3WMXA 4BKMA 5GINE 1B8PA 2JBWA 1SQ5A 3HI6A 4RVSA 2CNDA 3WLKX 3AEZA 5MDHA 3OCYA 4BECA 1TO1E 2B4YA 1W73A 2EG5A 3DDZX 4QDKA 2OG2A 2P9JA 2VPPA 3NBFA 4WD3A 5ESDA 1WUHS 3TIGA 1KKUA 1KK2A 1M7HA 4BRSA 3AUYA 4AYTA 3D3EA 2P91A 2JVIA 2OCKA 2L69A 2Z1NA 1KAMA 3H9UA 3IVXA 3R24A 1Z0IA 4L8YA 5EKTA 3W3AH 1JPVA 3KZ1E 4LS3A 4P80A 4HN4B 3RTAA 3SZGA 3CVWA 2B7BA 4GM4A 1TZ2A 1YKGA 3KEQA 2ZJ6A 3ZVLA 4CM3A 3CUVA 5FX2A 4NYIR 4YCNA 2Z2ZA 1DELA 1M2JA 2O8CA 3P9XA 3KC2A 4ZIRB 3BXPA 5REQA 5DM1A 1RSZA 2HSWA 4S1NA 1QFYA 1J1UA 1FRFS 3SYMA 2EJTA 4R3WA 3F9RA 2C29D 4QQFA 2BGWA 5LL6P 3BKWA 1BN6A 5M34A 5AM1A 4MWDA 4NONA 4D92A 1OXMA 3TDMA 4DDHA 4W9NA 3TH5A 1GL9B 4C0XA 4FE3A 3IHKA 2C98A 1USGA 4IEFB 4BNFA 4P54A 1I0IA 3IBYA 4PR3A 4RHUA 1CIVA 4ZHQF 4DXAA 4C87A 1QZZA 3W1EA 3COWA 3NM4A 1SUAA 1KNXA 1J6UA 2WNHA 2ZEJA 3QMVA 2E89A 5TDHA 4EG3A 4NRDA 2HYDA 4F2DA 3I9NA 1F0NA 1ZOSA 3DZDA 3ED5A 4O4LB 4QPCA 4YQEA 4BX2A 2PLRA 1VPEA 1Y9ZA 3MEQA 2BSQA 3ANSA 4NY1A 1H5UA 2X4LA 1IWPB 4J0JA 5KIAA 3P45A 3VPDA 2RDMA 1TFRA 2JCVA 3ONEA 5TT0A 3CLUD 2YVUA 2XCLA 1OFTA 3QF4B 3NNDA 4JQCA 1GEEA 1YDMA 5K0NA 1H8ED 2VXYA 1QB7A 1Y6QA 1BAPA 1NPDA 2G8LA 1R0WA 4WDQA 5KYVA 3SVLA 4BMPB 1BWRA 1SVNA 3O84A 3QELB 1C8LA 1XMPA 3LBFA 4HLCA 3SDZA 4FINA 1ITZA 1IQUA 3ABZA 1WS6A 5IHXA 3BH7A 3G8YA 4IV8A 4IHJB 4BYGA 1Y6FA 1KRHA 4FS8A 1T9BA 3UW1A 2O07A 1KY5A 4IFTA 2C7QA 1T4CA 3H2YA 4PZ0A 3ZU5A 3DZCA 3NYIA 5CK4A 1MHPA 2E4UA 2C7RA 2BAGA 1Y4UA 2J7PA 3QWIA 1MEOA 2QSYA 3SGLA 4EHDA 5HW0A 2QORA 1J23A 4G41A 4Q7QA 1TA9A 1SKMA 3OJLA 5AI0A 2JANA 4LF6B 3ETCA 3BBLA 4F72A 4K8RB 3ZHXA 1E9EA 3G0BA 2IH4A 1E99A 2PMKA 3DM9B 3LCJA 4EDFA 2L42A 1P7WA 3GCDA 2AE2A 1NXVA 3DF9A 4NS4A 1XZEA 4WN3A 4WY8A 2AHRA 5B1SA 3PC3A 4KDCA 4Q7JB 3ZX5A 4RTPA 4LJRA 3PGXA 2JJ8A 1FRZA 4PNHA 1RKBA 5MGNA 4CR8A 4UDOA 5JYDA 5JCXA 1JHXA 2FN9A 3VJKA 3HO6A 3LXMA 3JARA 1JA9A 1ZU5A 5KB3A 4KMRA 2IU0A 1T9GS 3IIMA 1ICEA 1BFDA 1AB6A 3E4CA 2YWHA 1EXVA 5EJGA 1D6MA 4B8ZA 2CF5A 3TDKA 1ZYUA 4C14A 1T34A 1TAQA 2BFNA 3ELBA 4IIJF 5IEJA 1PVOA 2V96A 4NENB 3TXXA 2XOEA 1OBHA 3KZXA 1FYXA 3L6RA 1EXNA 1ZCZA 1YU9A 2VJNA 3I01A 4O2AA 1CVRA 2PDAA 5LQMA 5K7SA 4KIFA 4GLOA 2GPNA 3EPHA 1J0CA 2R2AA 3WQRA 5JYBA 3JQCA 3TOCA 1JFFA 3CCFA 2VO1A 1ZS9A 2V6FA 4TS4A 1Z62A 5ALIA 3RU9A 5CA0B 5IAOA 1YVEI 1Z29A 2YY5A 2ZW9A 1IONA 3PWZA 2C95A 4XQ9A 4QQRA 3STVA 2ALJA 1JLSA 1HLFA 5H80A 3KQWA 1VCMA 2I3BA 1Q12A 5ANRB 4NBKA 5E6RB 2VWHA 1D2EA 1RQNA 1BKSB 1UBUS 2PQ0A 1CHNA 2ZJZA 2M1ZA 3OFSA 5FOTA 1YVUA 3PT5A 4MJXA 3S99A 3M3HA 3AUKA 4BVAA 2DAPA 5C1DA 3RJZA 5EN4A 2CNWD 1UAYA 3VPSA 3S81A 2QE7A 2OZLA 5HF6A 1UC5B 3EZ9A 3W2TA 2I65A 2D1FA 5JANA 4JNKA 4DA4A 4XUCA 1H22A 2FEPA 1ISRA 2JW5A 3HCCA 1N6PA 3OOSA 4OHPA 4CLXA 3WGQA 4ZDJA 3KVYA 3RRFA 3ER6A 4NPAA 4KK4A 4AP5A 1JSZA 2WW8A 3KHTA 4I5EA 3NTLA 4G56A 3TZHA 1S2OA 1YR2A 1EIWA 3AUSA 1R16A 4CKBA 1K0UA 2A1IA 2M6RA 3PDIB 4KQJA 4F4DA 3DXXA 2GEDA 3MS4A 1EJ2A 1PFKA 2ZDHA 1WXIA 3AI3A 1PT9A 2PD4A 3HJFA 2IPAB 1WDKA 3I5YA 3HY6A 2PTGA 4OP2A 4BQRA 2UZ0A 4TQAA 3M3DA 1Z39A 2FSFA 1EEXB 2CXQA 4F5ZA 4JXXA 3VJMA 1FU7A 2W2TA 5DPMA 1S8FA 2B9EA 2LGJA 5EVCA 2QTWB 2O2EA 3H75A 3UV6A 1UT8A 2QVLA 3URKA 4WI1A 1UDXA 1QYWA 3RNLA 3ABQB 3SNHA 3T1VA 1UK6A 1YCGA 3TLGB 1D1QA 4ZKDA 3C8ZA 5AK4A 1E4EB 1EFHA 4EJFA 1CUBA 4OXQA 3JW8A 4KXUA 3MJ4A 4YRSA 3VO9A 2ZFUA 1GQOA 3EYWA 4OMUA 1DKRA 1ZVQA 1RM0A 3ESQA 4RHTA 4BATA 3NOVA 2AX4A 4X97A 4RTQA 2PUTA 1OIXA 2HO4A 3K9LA 3PA6A 5K03A 4LDAA 1MKYA 4OK6A 2EJCA 4H6PA 1CK4A 1CUXA 1Y34E 4G97A 4NCNA 3AOEA 4L02A 4MRMA 4P4GA 1CYDA 2VBGA 5TQJA 4F4CA 2I4MA 4N41A 1PR2A 3FLEA 1YIAA 3LFHA 4TROA 4ZGGA 4TTJA 2QZ9A 3HSKA 3IUMA 1UKEA 4FN4A 1TAUA 3ITDA 3PTLA 5F5LA 2O8DA 1G8KA 1HFEL 3UW3A 2H2WA 1F17A 2I2XB 2M32A 2RHRA 4B33A 3GFQA 2DFTA 4B5LA 4K87A 5KYTA 1HE4A 1NW6A 2WA1A 2WJGA 2DBYA 1STOA 2E1PA 3OSUA 3VV3A 3TTWA 4LKOA 2A78A 3TRKA 2R7LA 3DL7A 5HDBB 1Y8AA 1K4KA 2PIAA 1X42A 3OT4A 2GDJA 3ZV7A 2Q6TA 3IAAA 4JBIA 2QZ4A 1QS0A 3Q3CA 2Q28A 4CLOB 5K3SA 2GD0A 1RVV1 1M1YE 3GEDA 3D4BA 5CB6A 2JZOA 3NJ4A 3EZFA 3K9HA 2OKGA 2XB9A 2Y0EA 3S68A 1SCQA 3P4XA 2I9KA 5KJ1A 3P19A 2GA9A 4MYHA 1CJVC 1MVNA 4IGEA 4YFVA 5DE3A 4ZALA 3HXPA 5D86A 2R1VB 1WP9A 2IITA 1E1RA 2QIOA 5JMTA 3W5CA 3FSEA 3ZHOA 1QG0A 1PZFA 2C94A 2CNLA 2HZBA 2BGGA 1DQNA 2CL0X 4XD7A 5E1BA 2UKDA 2C97A 1ZM2A 3B48A 4NFYA 5ER9A 4OI0A 2IPXA 1CERA 4M1KA 3K0CA 4P8RA 2VH2A 4A0GA 1LPNA 3M2PA 2YN4A 1A9QA 1F8XA 1TUBB 5A0VA 1A8SA 1HDYA 4MR7A 1GRRA 4GMHA 3OIVA 5TX7A 1Z8HA 3BGDA 4GXRA 4WCFB 2FPMA 4MX8A 5CPFA 2HHHB 2QVXX 4DC1A 3L46A 3RS5A 1N7JA 4IH1A 3ZWWA 3U5ZB 2Q2VA 3DWEX 5DHTA 4AO8A 1SZPA 4FX5A 1U7OA 1L5GB 2PR2A 3KUKA 3VC2A 4LX0A 1A8PA 1DO2A 2AXPA 3K9WA 4GZMA 4NP6A 3GJ4A 5TPWA 4YMGA 1OH8A 1QIFA 1FFXA 4R6WA 2JGMA 2AT1A 3GP5A 1ONNA 3G8DA 1TZMA 5ECWA 2JFXA 3TW4A 2ARKA 5H3HA 4M1TA 5DIFA 1QANA 3WMGA 4R81A 4V0NA 1FP7A 1NE7A 1SD2A 4DLXA 4TMTA 5BV1A 2QN1A 1XPUA 4DCNA 3NDIA 3UF0A 2LCIA 4RSGA 4EB3A 5F33A 3GUUA 5IMSA 5JD5A 5I7UA 2OWDA 1KPIA 1JR4A 4OQEA 1A97A 4M7RA 1NKVA 3KZMA 2QT9A 4KQ6A 4MI1A 3KVVA 3NUQA 5EMMA 4RF2A 3S55A 5FCDA 1G2OA 1PNOA 5JTTA 2BKAA 4UKDA 2XXAB 5JV5A 3U26A 3B5EA 1YGYA 4C0QC 1MO3A 2KSQA 4C0SA 4PGGA 1PTKA 2ZYSA 3WYNA 1QF6A 2J67A 1P91A 3LOQA 3DVAB 4H3KB 4TV8B 2XGMA 5L4SA 2H7YA 1SXHA 2C59A 2D4AA 3P1JA 3ZV5A 1AH2A 2CMFA 1ZJWA 2EATA 2OSBA 4R2HA 4A16A 3TG2A 4ZI7F 3SIRA 1YS6A 3P2OA 2G25A 1VG9B 2FR8A 1BWQA 5GV8A 4XVCA 3FI0A 1M7GA 3FB4A 2G67A 1NVKA 1LS6A 2Y92A 1L7DA 3E6AA 4OPMA 1BCRB 2YUIA 3AF1A 4WACA 3WWEA 1XLVA 5CNKA 3VR3A 4MQ4A 3HKBB 2NU9A 4PIPA 3I1IA 5HKKA 5HVNA 3R3HA 1X1RA 2WYUA 2XAAA 3IBFA 4OHWA 4XGNA 1KYIA 3MTQA 1KHHA 2DE0X 3BB1A 3KPUA 3P27A 3B53X 1QH8A 2ZRNA 2BFBA 3A6GA 4IUCS 1K6JA 1HZJA 1TNDA 1T10A 2EW8A 1BZYA 4L5BA 2CWDA 1N2EA 4RV5A 4TRRA 3T35A 3HYTA 5ECGC 1QHIA 5BSWA 5CBPB 2WVJA 5HOQA 3AHJA 3I76A 2KLBA 4N5MA 1E3DA 3BHNA 4G1MB 5I9SA 2QAGA 3C8DA 3JQ8A 3LYUA 3DUFA 2Y99A 4RPGA 3SIPA 1BU5A 5GONB 4II7A 4MUHA 2FE4A 4K9NA 3R9KA 4KAJA 3L82B 2RAVA 1EDBA 5EQDA 4W5TA 2Z1DA 5CVTA 2ADFA 2FW0A 3MFYA 5FLXA 5C52B 2MSNA 3KQOA 4ARCA 3K71B 1P0PA 3PUXA 4KKVA 3RR2A 2D54A 3MRSA 3EXG2 3MQ4A 5KAPA 2FR0A 4CIVA 4FOOA 3WGKA 1WCIA 1L5SA 1LZLA 3HRKA 2IYTA 4WE3A 1TB4A 4US0R 1BD3A 4I81A 3KQVA 4DV6B 1O96A 4JAVC 1LSUA 3C70A 2GCIA 1RYEA 4YV0A 4PZCA 1V8ZA 2WFMA 1TUEA 3DP9A 2VNSA 3ZWPA 4U7DA 4Q6WA 4WRRA 4M9QA 4X91A 3RVPA 2MR6A 1L4FA 3ST7A 3VOSA 1Q1ZA 2NXEA 2VT2A 3EEBA 4N5IX 4QULA 5G4KA 3T5GA 3V4OA 3WV4A 2APJA 4JQZA 4W5JA 2CHFA 2DOKA 1SD1A 1J39A 2I2AA 2JA1A 3ZDYB 3ZV4A 3ZU3A 5J4HA 5KX5B 1FPQA 3GI1A 4POAA 3RC8A 1RACA 1SVUA 1O54A 2PGJA 3AR4A 1DV1A 3W8DA 2C2GA 1EXMA 1ZN9A 2QLFA 3ESBA 5I4CA 4TS1A 1XRJA 3I39X 4M7OA 5CLIA 3ROZA 4CNBA 4MHTA 3AP3A 2GZAA 1H69A 1ZUD1 2OYSA 2QN6A 2RI6A 3DAPA 3H11B 3OKFA 2A0YA 2VA8A 4BAZA 6YASA 5HKAA 3I72A 3BTUA 4M7PA 4QPPA 3TQIA 1BJTA 3EUFA 3P2IA 1GQRA 1CYEA 4G23A 1E5TA 1O6CA 1QGAA 2GN8A 2WJPA 3V00A 1BHJA 1CQJB 3HB4X 4MLPA 1SM4A 2JCGA 1GFSA 3GRVA 4KO4S 4ZRNA 2FEWB 4Q82A 1I7QB 4R7TA 2QOEA 1JILA 2JCYA 4OXIA 3SC2A 3FGNA 4L16A 2DVMA 4DQVA 4ENTA 4PQFA 5KYWA 4MQUA 2ZBVA 3TZLA 5K3EA 1UBKS 2CLKB 5BV7A 2PX2A 1NLYA 3PCTA 3F6EX 1Z6AA 4LJLA 4AUNA 1B8OA 4J03A 3ANNA 3FVWA 1ZRNA 1J25A 2ZULA 1EDDA 3QKUA 4DAEA 3X2SA 1PDWA 1T35A 4HKTA 4NCKA 4O2LA 3WSVA 1FZQA 2RK6A 3H9EO 4FZRA 4ZVRA 3WK7A 4TMWA 3WYDA 1KJYA 5BQFA 4DUZB 2RGAA 1XIVA 4O1MA 5C8YB 3R76A 5TVGA 5AK6A 5BN4A 1XYVA 4FEGA 5K6AC 4JIGA 2IYOA 3OTGA 3D2AA 4RKEA 1QK5A 3UY4A 3AR7A 3R74A 3QEAZ 1HTWA 2WVAA 4HDNB 5NULA 3UWKA 4HBGA 1AZTA 1WMDA 4HG2A 2QA5A 1YCDA 2QRJA 2GJKA 3MJTA 3AVPA 3DAFA 1KYXA 3MN1A 4JB2A 4JENA 1BU8A 3C6BA 3KXLA 4U0KA 5B7GA 3B3AA 2JLQA 2YS7A 4M3NA 5AK0A 1U63A 4EJ0A 4NS1A 4R7ZA 1VI6A 2W7TA 3EGWA 4NNPA 4RA9A 5DHFA 3VR5H 1ODTC 2F3SA 1R6BX 3LYLA 3GFRA 2XV1A 1J5EB 1U8XX 1X7HA 3HUUA 3OIDA 2RGYA 4NOJA 5ALEA 1T9GR 4RABA 1PR9A 1Q0PA 1JHUA 4HDSB 1OXSC 4PFKA 3SQDA 3KKOA 3LK7A 2X4IA 1II8A 3M6UA 1CULC 1Z4LA 1XZCA 2YDYA 4HGNA 5I8ZA 4PXSA 1F2TA 3WICA 2HNAA 2PKYX 3MFQA 4CM5A 3A10A 4TYWA 3CEPB 4FFBA 4JLAA 1PS8A 5L3RA 2IZ7A 4FJ0A 4F8EA 6REQA 2P40A 3B38A 2PUGA 4OHFA 1S4MA 4KZKA 1VP9A 1QWSA 1U2DA 4NBUA 1R0YA 1NMSA 2HRCA 4Q7LA 4BO1A 3JQGA 4F6CA 2ZJFA 3U1BA 3UV3A 2R5FA 2GM9A 2BM9A 2Q5HA 2CDAA 2Q45A 3C74A 3HS3A 4DLWA 4ZICA 3RIGA 1GG9A 3KPYA 3D02A 4DY6A 5AVQA 5EIFA 2I1LA 4BNYA 4YMIA 1O6GA 3MT0A 2YHAA 3VU0A 2R8YA 1Q11A 3BG5A 1SIBE 3E1SA 3IKLA 5TV2A 2C7OA 5HBRA 3RVRA 5IJZA 3OEED 1W48A 4TTSA 4J1NA 2NZ2A 3COVA 3H5TA 1UIRA 3W04A 2IYSA 1M2GA 2YCBA 3G9UA 4P3NA 3ZZMA 3W5AA 1THMA 1Z6QA 2ZRQA 2OO7A 4J3NA 2FQWA 3LHKA 3F5SA 2UZ4A 2O8EB 1L8OA 3NHUA 2F62A 4G0XA 5ILGA 4F11A 2XZPA 3FFTA 2AHOA 2ZANA 4K6FA 5JBIA 1ZQ1A 3HU3A 2DCUA 1KAQA 2MT9A 3J81A 4PYKA 2WU4A 4WCVA 5F1OA 2M2IA 1T4BA 3PNVA 3RYCB 5JO9A 1G20A 3KXKA 3GRKA 5I9NA 1TO2E 1I3NA 4U3JB 4KPYA 1F9AA 2ISQA 4RJKA 1QVRA 4H7IA 2VRCD 1XPRA 2BHLA 5ULLA 3V2GA 1YR3A 1IM2A 4D43A 4FGJA 2GPWA 4IEEA 4BLTA 5HM6A 3N59A 1NU6A 3JRWA 1H2YA 1H6BA 5G40A 1E9VA 3INYA 1IHYA 3ORRA 5EC8A 1T8YA 1Y1RA 1GQQA 3UXYA 2HFKA 3A3KA 3IJ5A 5B2ZA 4MQ5A 4G86A 1T4DA 1XCGB 2SNIE 4NMWA 4Q37A 2ACEA 4ZVTA 3GT4A 2RB4A 4PO1A 3PUWA 3V9PA 2RMKA 3EMBA 3LLMA 4MW2A 1J7JA 5EUQB 3H99A 2W2MA 2V65A 1JTFA 2HY7A 1U2ZA 1RMYA 2VDLB 1O9HA 4X95A 1SC4A 3REFA 3VZCA 2DM6A 2J59A 4PRLA 4TKVA 4IJUA 4H17A 4EF5A 1XVVA 4HWRA 1PL0A 3G5LA 2ZUVA 3TTTA 4E08A 3CA8A 3JYQA 5ILQA 4F7WA 2PJZA 2NUAB 3EY4A 3PGVA 4BO3A 5AM3A 1FDSA 1QP7A 2ZPUA 1R00A 3FPHA 4TSFD 1UXOA 3PFFA 2VR1A 2GTHA 4IVNA 3GT3A 1NQVA 1TYDE 4JLKA 1Y4ZA 2WIAA 4QGAA 2P4EA 4JH0A 2VDNB 4WN9A 5HSGA 1OFHA 3ELYA 1R5BA 2VPWA 1SB8A 5A3SA 2IBTA 2HM7A 4Z4IA 1PLKA 4CMAA 4E0BA 5C8VA 4QM7A 2H51A 2QSJA 4L6AA 3IKMB 4QTUB 3PHCA 4G5FA 1T5DX 2QUHA 2ZYGA 3PFBA 3ZLTA 4ZYWA 3LBYA 4JJFA 5KWJA 1GKUB 1T1GA 2IC5A 1P18A 2F8SA 5CVJA 3TUZC 2H1CA 3KG2A 3IAEA 2NZYA 4MKZA 3C3BA 2HDHA 1KERA 2REQA 4GKKB 3JD2A 2FF7A 5I6DA 4BPBA 3PENA 5K8CA 4J0GA 1GM5A 5JZSA 4HH1A 3FXAA 3IRVA 1CNMA 5EYPB 1GGFA 1DCTA 1FQOA 2DT5A 5JXHA 1H8HA 1QORA 1Z0KA 3IKTA 2BKVA 5LCXA 4B4WA 4CM8B 1JA0A 3RRNA 1T5LA 4H35A 4X7MA 3HU5A 2B2NA 1T3LA 1GUYA 3RTCA 4D0LB 5JWRA 1Y3IA 2QPOA 4DBZA 1YZLA 2ABWA 3AWDA 5ITZB 3MINB 5KSYA 2KPOA 4OGWA 2LP4Y 2XA9A 4HS9A 2WSYB 2JLBA 5HTOA 1RYDA 2HO5A 2M6SA 4RESA 2DPHA 2W2NA 3G8CA 3IUBA 3LW8A 1MH1A 1EX7A 1BFUA 1KBZA 2D2XA 4OIMA 4V0ME 5FL3A 1CR4A 1H2BA 4K1LA 4B17A 1U2EA 3UHAA 2PX4A 3BOSA 5KYNA 4AY5A 4TZ0A 1MEJA 3UGTA 2XKAA 2BGTA 3LRTA 1CKEA 4BLRA 4J4TA 2VATA 5A4MS 3HNRA 1M2WA 1CLEA 4GG1A 4ESVA 2FWPA 2QW0X 1IEQA 3L9XA 4JROA 2YV3A 2J30A 3WK5A 1VGRA 1SRQA 1AK2A 3CF0A 2OENG 4KDFA 1P74A 1GA4A 2YX1A 2RHMA 3VU9A 2BFFA 3G2MA 4F4FA 5P8WA 2JJMA 3O9MA 2ZYAA 3RKSA 2GLXA 3CY6A 5CA1F 2ILVA 4MRRA 1QK4A 2PZLA 3UAYA 3X1DA 4R1OA 4W6ZA 3F90A 4UCFA 1ZLYA 2WUEA 3C1AA 3X1JA 5DMHA 3GFPA 1VIDA 3JYLA 2GXAA 5IF3A 3KVOA 2IYAA 5DSXA 1E32A 3HK2A 1AQIA 1P3JA 1U0LA 3ZHCA 3E84A 3N07A 5KTNA 4ZEOA 5ESWA 1RE1A 1QTIA 1VI5A 2POQX 3DMTA 4JC8A 2OAP1 2PQMA 3X44A 3RGGA 1N25A 1OH5A 3MILA 5FI5A 1T2EA 2Q21A 1E5DA 1K5GA 4M8SA 1ZAYA 2B1JA 2HA3A 1W5EA 3CX6A 1Z74A 4W1RA 3G0CA 4MKIA 5ALRA 1L7EA 3OFJA 4E5VA 2GEJA 5H83A 2WSSA 3K0EA 1AD2A 2VDUE 3BFKA 4IIFA 4O29A 3WIDA 2E7ZA 4NAVA 3DYVA 4HNAA 5JW6A 2BMEA 3S27A 3EGXA 1TT7A 1GN9A 4EITA 2A3NA 3JY6A 4KPEC 3DLHA 4PCLA 3MSXA 3HR7A 1Z7BA 5I01A 1CG6A 3FI9A 2G9NA 1KQOA 5JXGA 3BB4A 2V5UA 4EKIA 4FCWA 3UPTA 1UC9A 4LE2A 1M6VA 2YOGA 2AN1A 4IOLA 4Y6PA 3H5LA 3ZGXA 2EQBA 4IGKA 2ZVJA 4N40A 4PC6A 5BQXA 1G1MA 4X92A 1DJPA 3GZTB 1EP1B 1PNVA 2KLHA 5FKJA 5C4GB 5B4VA 2HKIA 3OQ6A 3X1WA 2WEKA 1GD1O 3II6X 1HSZA 3FYUB 1P1KA 3OLQA 3E0XA 4O5AA 3RS2A 4DM3A 3TMKA 4LWQA 4FGKA 1GYPA 1K6MA 2Y4OA 3HLKA 1A7JA 3RYTC 5J43A 3RUDA 1REQB 2D0OB 3D6AA 5HPYB 3V6MA 1ML3A 2ACWA 3E9YA 3IUEA 1FA9A 5IP5A 4BASA 5BV8A 5B1IA 3G3EA 2WU0A 2DQ4A 5HNKA 1QF9A 4FKBA 4M0LA 3R1IA 2P0YA 4CGZA 4KE6A 1EFPA 1DQRA 2HDNB 3G85A 5C18A 5FNVB 3CYFA 2W98A 4N1AA 3IMCA 3T3DA 1YB2A 1JDJA 1HORA 1LLCA 2OKCA 4YDHB 2FWNA 2EEPA 2VJYA 2QPTA 2E4AA 2N3ZA 2ZQ5A 3FM9A 2IZ1A 3SKXA 5FI1B 3B8EA 2ZTHA 3ICWA 1D6JA 3G6KA 4MCIA 4AFNA 3FTEA 4TVBA 2FPGB 2IZOA 3LPMA 4XE5A 1MB3A 4CQMD 3H9GA 4XIIA 3MOGA 2EZ8A 3GMSA 5JJ5A 2ZB4A 3ZE2B 1BS2A 1LFDB 5EG5A 1SBYA 1ESCA 1XJWA 2PKWA 1KY2A 4KR0A 4Q5IA 3SJZA 4RULA 5TR9A 3F9IA 2JFGA 1AF7A 3NHPA 4LMAA 4Q02A 5CBKA 2AMLA 3VTZA 3JYNA 3KEOA 1P3DA 1GXSB 4DQKA 3W06A 4N0DA 4BC0A 3EZ7A 1R3DA 3B85A 2P3LA 7MDHA 3OA0A 3BMOA 5UKDA 1KOGA 2O48X 4PZYA 4Q15A 2F9LA 4GXTA 2ZXFA 1CUSA 3HJUA 4KNYA 1YCFA 1JFVA 4A6XA 4DE5A 2JD2A 5BMVB 1NBAA 4B40A 2CDBA 3CWZA 5E95A 3UMVA 3KFXA 1VM6A 3D3JA 4EX6A 2ORIA 2V7XA 3WXMA 3BD9A 3CUEF 3N7AA 2Z2YA 2VHJA 3O8QA 1IG3A 1MJNA 4TSKA 3DMDA 1P6UA 4GOMD 3TWOA 5A9SA 3AY3A 4CLDA 3RADC 3C3KA 1U2PA 3HQ4O 3AF2A 3MTIA 2WJ4A 2EX1A 3HLTA 1CZLA 2PCJA 1JKIA 4W63A 5CXQA 2WTEA 4BO2A 3H87A 2LIPA 3V2UA 1O0SA 2O3UA 1HUQA 4FYKA 1AA6A 3MLAA 1WUIS 1KOJA 2I7VA 3M5PA 5JNWA 4E03A 1DBSA 2ECPA 1I4OA 3C98A 3O1LA 3DL0A 4PW0A 5GADl 4IDFA 4Q4DA 5MHTA 1B2LA 1UFKA 2O7QA 5KC9A 3NHKA 5I5EA 4FYWA 4CJXA 2N46A 2GD6A 1N3YA 2EW2A 3IPCA 3M7IA 1MPTA 4PQEA 4DM4A 1EM6A 1QIJA 5B7NA 3VPGA 4BNWA 5E38A 4RIGA 5EIWA 3AQIA 4GR9A 4MAMA 2WKPA 3NRJA 3I9V1 2BTQB 2JZNA 1SBZA 3E8MA 3DFIA 4AYWA 2O3TA 2YVLA 3VR2D 5EFOA 2HIMA 4UFOA 2IQ5A 4R0VA 3PXAA 3I73A 4P98A 3FWZA 4GFDA 4DMMA 4ZGBA 1LBEA 4Q4CA 3CG0A 3G2PA 4CEJB 2YJ6A 3JRNA