3T12A

Mgla in complex with mglb in transition state
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
182
structure length
176
Chain Sequence
INFKIVYYGPGLSGKTTNLKWIYSKVPEGRKGEMVSLATEDERTLFFDFLPLDIKTRFHLYTVPGQVFYNASRKLILRGVDGIVFVADSAPNRLRANAESMRNMRENLAEYGLTLDDVPIVIQVNKRDLPDALPVEMVRAVVDPEGKFPVLEAVATEGKGVFETLKEVSRLVLARV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of the Ras-like G protein MglA and its cognate GAP MglB and implications for bacterial polarity.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Hydrolase/signaling protein
molecule keywords Gliding protein mglA
total genus 60
structure length 176
sequence length 182
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2011-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3t12A00
4Q4AB 2JAQA 4Q4HB 1YZTA 4K8OA 2QT0A 2ZAOA 3SS8A 2XNDD 4D25A 2ZI6A 1E0KA 1QG4A 5DH9A 2QPTA 4YXWA 1FQKA 2NO7A 3OEHD 4PPGA 2IX3A 3TK1A 1LF5A 1E1QA 3H4MA 3LWNA 4Y0AA 1E2FA 5B57C 2O8FB 1BH2A 2PCJA 2MSEB 2YWFA 3NTUA 5DSZA 5EQTA 3RABA 1KI6B 2YKGA 3F3YA 2JLSA 4B3BA 4A8JB 1QHHA 1KO7A 1W48A 5KNCA 2QE7D 3DVLA 4V0OA 2BJVA 3THWB 1SZPA 2GBLA 4B74A 3QKSA 4EPWA 2PX0A 2VO1A 4DSTA 5IRCD 2JIZD 1TQDA 4Q66C 4ZIRA 5EJEA 221PA 2F43B 3ZYCA 1ZU4A 1KKMA 1KK2A 1ODFA 1T9HA 2EW1A 1E2QA 1XEWX 1ZM4A 5EP3A 3R8CA 1IAQA 2VRWA 1W2GA 2PCLA 1HE1C 1G8YA 2WBLC 5FPSA 5JI3E 4ESVA 2R2AA 2GEDA 1AZSC 4RD0A 1E6CA 4OI2A 4FMBB 2C77A 1ZRHA 4HB2A 2B7CA 2RHDA 2WMNB 3CWZA 4YDSA 1SXJB 5DN6A 3DOEA 1IN8A 3X1DA 2WZQA 4L9WA 1S1CA 1J70A 5CB8A 5FR2A 3NH9A 1ELOA 2CLSA 1P2UA 1Z6TA 2YC2C 5FOSA 1NKSA 1Z8FA 2H16A 1NMZA 4QXAA 2W0SA 3TSOA 3WP0A 1DG3A 2E1RA 3LD9A 2NQ2C 3AUYA 3WNBA 4EQ6A 1XCGB 2G88A 3U3RA 1R2QA 3T12A 2RCNA 4BEBA 2FGKA 3PUVA 4W7SA 121PA 1CXZA 1M1YE 2QT1A 4HAWA 2EFGA 3KXLA 2O8BA 1KSHA 5KDLA 1E0AA 4Z51A 4B3XA 1KO1A 4PAMA 3DZ8A 5IDVA 1OXTA 1M8PA 3H2YA 4BPBA 2D2FA 4KYIB 3TQCA 2AKAB 4IXNA 1OLOA 1P62B 1Z22A 2VIIA 4WAUA 3VNVA 1D6JA 2EWWA 2OG2A 2J87A 4X8LA 1UAAA 3SE0A 2KWIA 2HYDA 2F6RA 1KSFX 4ZIRB 2EYUA 2ZE6A 1G21E 3GFOA 1WCV1 2RMKA 2GRJA 2NO6A 4UNRA 1YR9A 1WBDA 4GP6A 4LBVA 1S9DA 5E3HA 1FTNA 1NG1A 1W36B 2DFNA 5FPHA 4AYWA 4D4KA 3QQ5A 1ZD1A 4QL3A 5BN5A 4Q02A 2EVWX 4DBLC 2BC9A 2X77A 3ADDA 2OHFA 2QMEA 4M1WA 1OE0A 1VG0B 2IYZA 2ZRBA 4HB3A 1A2BA 4B33A 3QKRA 1DADA 2FX3A 2ZYTX 1IHUA 4Q7JB 3VHLB 5A4JA 4C0BA 2QP4A 4D0LB 3R8FA 5ELXA 1X3SA 3C16C 2Q6TA 4DB2A 1AKYA 1FQJA 5DHAA 2C03A 1Z47A 5FR1A 3RAPR 2ZXUA 3VR5A 3WRYC 2CCJA 3AB3A 4L9SA 2W6IA 5F9HA 3IBYA 5B30A 3AVYA 4NBSA 3PXGA 4MA4A 2WV9A 2ZITA 3CRMA 1Z28A 2HXYA 2XB4A 2EU8A 3SJBA 1AJEA 3UWKA 4N0EA 4KI0A 2QMHA 4QGFA 1NBMD 2JJ1A 3CZQA 4XD7A 3U4QA 2J7PA 4PC6A 3I3SR 3VR1A 1KOFA 3P4XA 2JLZA 5CLQA 1NVXQ 2QTHA 2D7CA 1GRRA 1Z6GA 3QKRB 4PZYA 1YRAA 1UADA 2BIFA 3DM5A 1E98A 1I4DD 5LB4A 1Z6XA 1KJZA 3P1JA 5D3MA 4A1FA 2AWNA 3LH5A 4HLDA 2ZS9A 2ZVPX 3SJZA 3GLGA 4N3NA 3LY5A 2AN9A 2IHYA 2XSZA 3A1TA 3GJ6A 1E1QD 1X6VA 4MRRA 1JJ7A 1AS3A 1D9XA 1YQTA 2RGXA 2PT5A 2C96A 2WKQA 4HAXA 5E4FA 3QEOA 3T1QA 4NP6A 2W83A 1BIFA 1D5CA 1RKBA 1PV4A 4DEXA 2DWPA 1D9ZA 2DBYA 3ECCA 1XTSA 4Q1CA 5EP2A 3EPKA 3H86A 4TYNA 5F98A 4JL8A 4PQRA 1G291 4KFTA 2ZYUX 1G41A 2MSDB 1BKDR 2A5JA 4Q9LA 3VKWA 2XXAB 2CJWB 3TAUA 1KK1A 1R8QA 3X1YA 4GZMA 4A36A 1ZP6A 1GITA 4H9GA 4M1YA 2WHXA 3E5HA 2ASEA 1R5OA 2GVDC 3GLHB 4TL8A 5GJVC 2ZYVX 1AA9A 2WAYA 1IN6A 4HAUA 4B35A 1G8PA 4B75A 5F3WB 1OXSC 1JPNA 4L8GA 4KXFB 2CHQA 4LHYA 3E70C 4V0ME 2QBYA 1E2KA 2IYSA 3BS4A 2CCKA 1E9SA 3PEVA 4RKFA 1KKLA 2WSSD 2BV3A 4A82A 4CZ2A 4QBHA 3FDIA 1QDEA 1SHZA 3D8BA 5DN6D 3LBNA 4AYTA 4LV5B 4PSAA 3GJ3A 1YR7A 3OE7A 1PLLA 5C46F 4HAZA 3WRXC 1OH8A 3DHWC 3RDPA 4HZIA 2QM7A 4TYPA 3TR0A 2ZJOA 2QORA 3AF2A 4MKHA 1XD2B 1W4CA 1XWIA 4Q1FA 3SDZA 3WHKA 1GTVA 2FSGA 3QKSB 1J2JA 1KI3A 2N1BA 1F60A 4QHTA 3D3QA 4DSUA 1N6LA 1HY3A 1S1MA 4C2TA 4KCGA 1UBCA 1U8ZA 4RZ3A 1TX4B 2O8DA 1LF0A 1XD8A 2BCJQ 2QGZA 3LO5A 3AF1A 4JL6A 4PZZA 5HTKA 2ZU0C 4KHZA 2IA5A 4XWOA 4NYIQ 2EFHB 5HCNA 2QQ0A 3GD7A 5TMPA 3QNUA 2A7QA 1WMSA 2ZPTX 2KSQA 2WWFA 3SJCA 4ARZB 3K0AA 2W2XA 1N6IA 1TPZA 4KVAA 2PBRA 4PPQA 3WYFA 4Q01A 1E96A 2HV8A 1IJEA 4LV8B 3SI7A 2F55A 3THWA 2ERYA 3B1ZA 2FE4A 4ASUA 2WICA 721PA 3EW9A 1EFUA 2RHMA 3PJRA 3FB4A 1HQCA 2ERXA 2BBOA 1E32A 3LLUA 4PQYA 2HUPA 2VA8A 3WP1B 5HPYB 3N2IA 3V00A 3B60A 3I72A 2VH5R 2R44A 5DNYB 4F91B 2H92A 5HKKA 2DHRA 2BMJA 4LBZA 1OHHA 5GVRA 2WWHA 2GZDA 1B0UA 2QBYB 4FXPA 4TSFD 3W3ZB 3WYGA 4DUGD 1SKQA 4C7OB 3LA6A 1ZD8A 3ND8A 5DISB 3CKLA 4GSYA 1SXJA 1L4YA 2YINC 2QTFA 1XCPA 4KSBA 4ERNA 4TQAA 4DKXA 3B13B 2ZJ5A 2V3CC 3ND9A 3KKOA 1G8HA 4RD3A 2HCJB 4C0LA 4DLYA 4I81A 1P2SA 1VIYA 4G5QA 4MGYR 2BVNA 3RRNA 2WAXA 3T1TA 4CT4B 3FFAA 2QP9X 2DR3A 2ANCA 3WNCA 2ONKA 3KL4A 1TEXA 4ZDJA 1NN0A 1O87A 4PQFA 4QKQA 2SHKA 2ZI5A 1GRNA 1LS6A 4HB0A 3SZRA 3NWJA 1W4RA 2JGNA 1KO5A 2IYQA 3LX8A 5AUPB 3A37A 3BORA 3SHFA 2BHRA 4HZUA 1Z0JA 4OK3A 3KDSE 3BK7A 1XXHB 2D3WA 3D7MA 1E79A 2J7PD 5B58C 4UKDA 2NMVA 4LOAA 1G18A 4P33A 3TR5A 3MFYA 3NKVA 1T8UA 2CDNA 3BRWD 1JECA 3EWAA 5EE5B 4C4PA 4AKGA 2GXQA 5TARA 4E07A 5JHGB 3IO3A 3UANA 2ORVA 2ORIA 3EASA 4URZR 4LYJA 4Z1MD 4QM6A 2GWHA 3RS7A 2ZR9A 1WRBA 2GESA 2UZ3A 2VHCA 5FFMA 1NP6A 1M7HA 3AVPA 2VHQA 3SU8A 2VP6A 5GVSA 1JAIA 5CJ2A 4YMTA 1DELA 4OJKA 3OF5A 2BOVA 1OIWA 4R7ZA 2QA5A 1Z2CA 2FV8A 2FSHA 2IUSA 2B8WA 2ZSAA 3NH6A 4GL2A 2NZ8A 1Q12A 2JASA 3UMFA 4G0NA 1KI7A 5AUQA 3U5ZB 3P4YA 4LJ8A 1NG9A 1LV7A 4N0DA 4KVGA 1ETUA 3W8RA 4C0SA 3CO5A 4UNQA 1NSFA 2A3RA 3BIFA 3Q85A 3U61B 2PMDA 4IDQA 1N6RA 1W2HA 4QNRA 1YHNA 4X8HA 1QHNA 3X1ZA 4UNSA 1DO0A 4MYUA 2JLVA 5JFGA 3IPXA 2VSOA 5KOYA 2PH1A 4JLNA 1EK0A 1P7CA 2ZRGA 2W2VA 3KUDA 4KFSA 4EKDA 1EFRD 3NVAA 1FUKA 2V9PA 4DC9A 1ZNYA 4H1UA 1OH7A 4NPHA 4TMXA 3O8DA 2WPDA 4WZ6A 2JA1A 2BM1A 4C0KA 1SVWA 4QBIA 3KKMA 4NZYA 4JJZA 4P4SA 2RGGA 4RFSB 1E99A 2I4IA 2H18A 3ASYA 2AK3A 3OEED 2RGDA 1JBKA 3R7WB 4ZI2A 1NLFA 3U3KA 1TQ2A 5GJBA 2VSFA 2G1JA 4ACAA 3H1TA 1HYQA 2FPLA 5DHFA 3EXAA 4AD8A 1CR0A 1N25A 1XTQA 1YRBA 2BBSA 4O2RA 2ONJA 4BFTA 1CU1A 3BB4A 2QAGA 4X8MA 1T0HB 1TL7C 5JLJA 3A4MA 1ZC3A 1XMVA 2WSMA 2BJWA 4RCZA 4JLOA 3BAFA 5LPNA 4CT5A 1Y3AA 3GLGB 1RC8A 3EPHA 4ZCMA 1QVRA 2OXCA 4JLVA 5FOVA 3BC1A 1G7CA 4AWXA 1VYTA 4QC2A 2ZEJA 4C9BA 3MWLA 3TMKA 2F9MA 1GUAA 5GJCA 3TUIC 1CS4C 2LCFA 3PITA 2W00A 4RSGA 1P9RA 4FMDB 2QENA 2ZI9A 3A1WA 2AK2A 3NEJA 2ZS7A 2REOA 4BE7B 4FWTA 4XWKA 3B6EA 1WBBA 3NEYA 5JCPA 4PZLA 1A7JA 1ZBDA 2WJGA 1XZPA 3AQ4A 3QXSA 4A4DA 1CJUC 1N6KA 1OIVA 2Q0HA 2ZTSA 4EPYA 4BLPA 3F5FA 4EUNA 4Q9HA 4KJZA 4PO9A 3MJHA 1Z07A 1T4GA 4TTQA 4FMCF 5DE3A 3TNFA 1S0UA 3K70B 1SVMA 4M1MA 4ON9A 4ARZA 3GJ8A 4G1UC 1XMJA 5K8IA 1SXJD 1XEXA 1I4TD 4DT1B 1NN1A 3I92A 4X8OA 3KJHA 2BMDA 3EAQA 2NZJA 2J0QA 4C0HA 1G8GA 1SVSA 1XTKA 3AVUA 2O8EA 2VEDA 1C1YA 3FMFA 1A2KC 4CIDA 1S9HA 3BOSA 3HJNA 2B6HA 2R6FA 4C30A 3V4FA 2ATXA 1GSIA 2J5XA 5FH9A 1U0JA 3UWOA 4TYYA 1UDWA 4QJ4A 1KI9A 4BFWA 1F2UA 1OFUX 2ECKA 1GL9B 1T6NA 2JLUA 3KQKA 1P2TA 1XZQA 3AP3A 2OCAA 2C9YA 4MKGA 3ZVNA 4EPVA 1E2GA 1ZIOA 1IJFA 4PPFA 3HDTA 3PUWA 3EG5A 3ICQB 2ZYWX 2ZRAA 2ZUCA 3AH8A 4EFNA 1U8YA 2WWYA 2GCPA 4BFUA 1KY2A 4JVNA 1N5KA 1E2JA 3EZ9A 1MRSA 421PA 3E1SA 2GCOB 3RS5A 1E2MA 3I73A 2A9KA 4XWAA 3SBDA 5CDFA 1ZNXA 5IK2D 2F1HA 2FFBA 1DAEA 3NHAA 2IYXA 4JLBA 3WBKA 2RB4A 3RRMA 5FL7A 3ZIAD 4KLZA 2YVUA 4GPTA 1KTVA 3N5CA 4LK2A 4BLTA 2O8CA 2F43A 4LV6A 5CIQA 2FF7A 2OILA 1DVRA 2GJAA 5KDDA 1PZNA 1K8RA 4PTLA 1AQUA 1D2EA 4ZKEA 2VBCA 4A92A 1PUJA 4HYYA 3TUZC 4UXIA 1TNDA 1RRGA 4M9QA 4WXPA 1NN5A 3VR4A 2IYWA 1CKEA 2QE7A 4CEJB 4D2IA 3G0HA 4P4UA 4BZQA 3VQTA 2FG5A 3EZ2A 4UQOA 2YJTD 3O8CA 4D6PA 2B7BA 2HF9A 2WJHA 4B6FA 3RWMB 3VMFA 1OXVA 2DCUA 2JIZA 5GADl 5CDFE 1OB5A 1Z29A 1LVGA 1ZM9A 2WIAA 4DT1A 3B82A 1UJ2A 2IL1A 4I1UA 5KU1A 2J59A 4IVQA 3C41J 4PR0A 1VECA 2DWQA 1KNQA 3RHFA 3TKLA 4I1SA 3UMRA 1MV5A 5DIFA 3GLFE 3ADCA 4HDCA 3FE2A 2F3RA 4KITB 3QBVA 5J4HA 1YZGA 1M2OB 2AXNA 1FW6A 1RVDA 3K53A 1UBEA 4TLDA 3BH6A 4Q7KA 4RZXA 3D31A 4M1OA 4URWR 4CEJA 3GMTA 1G8FA 1N0UA 3SOPA 3NIBA 2BKEA 3Q7PA 3RS2A 2IS1A 2GK7A 4C0JA 1NVWQ 3A4LA 2WM9B 3A1VA 5CYOA 1T3SA 5BYKA 4PO1A 1G1MA 1TMKA 3EC1A 5BXQC 4BFSA 2VYFA 4EIWA 2J3EA 2JCSA 4JT4A 1Z6AA 2OFWA 1YE8A 5L3SB 2R6DA 1EGAA 4KFRA 3SQXA 4B3DA 4LHXA 2HF8A 1G17A 1E2HA 4LSGA 2FPKA 2BKUA 1MO4A 2YWGA 4GBMA 1GIAA 4GMXA 3GJXC 2K5UA 4TMWA 3C5HA 1CR2A 1VKJA 1HA3A 5EXPA 1QHIA 4LYAA 5SZHB 3WNDA 1FMJA 4XSGA 3VX3A 2GNOA 2OO7A 1Q20A 4D80A 3T34A 1DE0A 4C0QC 3W5IA 4DEYA 2GJ9A 3KQUA 4CGZA 3W5JA 3CUEF 3GLIE 4IXMA 1T8TA 4D4LA 3SYKA 1W49A 3EIHA 4P0TA 2RGEA 5JRJA 4MDFA 1RRPA 1YJ5A 3H0KA 3WBJA 3R7WA 1U0LA 1TU4A 2EQBA 5FPKA 2HLDA 1V5WA 2DB3A 2FN4A 4NCJA 3TUJC 1NIJA 5SZIA 4YQFA 2BCGY 3RLFA 1L8QA 2XTNA 3I8XA 2CCGA 2ZQ5A 1KJWA 1EFTA 2PMKA 1XMSA 1J99A 2QY9A 3GJ5A 4OHXA 3CF2A 1WQ1R 3PUXA 3QG1A 1E9CA 3CWQA 3FYHA 3KB2A 3MGCA 1VCNA 2XOKD 3A4NA 4DLZA 2C98A 3AVWA 3HR7A 1F6BA 1CRQA 1KDTA 5IF9A 3WMGA 3BH0A 3HR8A 2FH5B 5A5GA 4L5BA 3K0CA 1DAIA 3A58B 4IDNA 3LLMA 4K81B 1IN5A 3QVUA 5BW8A 3QBTA 3TH5A 1Q22A 3C14C 4TL6A 5IHPA 4LDJA 4XSHA 1BMFD 2Q3HA 3FKSA 1JXOA 1CJTC 1P9WA 5HCIA 4PC7A 3ZZTA 3C8UA 3N70A 4EPTA 4NYJR 2ATVA 2W6ID 1BYUA 2HXSA 2WKRA 2V7QD 2VP0A 1W5SA 1DG1G 1GDDA 2OM2A 4B34A 4O3MA 2CNWA 3UIEA 1UKZA 3HYRA 5JECA 1DOAA 1NBMA 4MYHA 5FTJA 3KTAB 2QAGB 2V6JA 1GOTA 3LVRE 3IQXA 4R2IA 1FOEB 2OUKA 5DYIA 1QHHB 1NN3A 1SVKA 3RRZA 1H8HA 4JS0A 5FTNA 5C2JB 4M2LA 3VKGA 1JR3D 1AS0A 5KSOA 5IK2A 4NONA 1HT2E 4MYCA 3P32A 2REXB 4JKIA 4B6EA 2ZRPA 5FL7D 3ZIAA 1ZM7A 3O47A 1ZUNB 2O8EB 2XXAA 3CIOA 1NLYA 2ZRFA 3KKQA 4URVR 2YYZA 2RGBA 4FCVA 4DLTA 4B73A 1KY3A 4V0KA 1Q3HA 4P3YA 4K46A 2OBMA 5AUOB 1CIPA 2FU5C 5JEEA 1OB2A 5G3YA 3K0FB 3TQFA 2AX4A 2C2HA 3ASZA 3AVOA 3ZZ0A 3E2IA 1N5IA 4PO8A 5GJWC 4Y0VA 3O8BA 2Q3FA 1D8TA 1QBKC 1G4UR 1EG7A 3CRQA 2XTMA 5LBIA 3CM0A 4DLVA 3ZS9A 4KV9A 4A8JA 3RS3A 1ZMXA 1GVNB 1QZXA 1KI2A 1KI6A 1W0KA 4HEJA 4NHOA 1NSTA 4UXHA 4A0FA 2NPFA 4JLPA 1R5BA 4FMCB 4EQ6B 2XZOA 3JZAA 3LXRA 5FUVA 4S35A 4OBEA 5E95A 1MKYA 1ZIPA 2C9CA 2G1KA 2YC4C 2WSSA 2XZLA 1JJVA 1RFLA 2AKYA 1D2MA 5BN4A 1WB9A 1JPJA 3GPLA 2ZRLA 1T3HA 1VMAA 3KQHA 3KB1A 2Y8EA 1GM5A 3OE7D 5JJLA 1E69A 4IVPA 5IT5A 2RH5A 4C3ZA 2PX3A 2FMXA 1AGPA 2HT6A 1OW3B 5CM9C 3SEAA 3OAAA 4EJSC 2OV2A 1EWRA 1TQ6A 3L0OA 3NC1C 1CR1A 3FKQA 1CF4A 5DYGA 4D82A 1DAHA 1KDOA 3ETLA 4FD2A 1II0A 3B1YA 5L3QB 1RYFA 3FMPB 4RD6A 4RVCA 4U5XA 5FTKA 3IEUA 1C4OA 1G9XA 1UKEA 3EZ6A 4QGHA 3SBEA 2VHJA 3FMIA 4HB4A 4II7A 1QHXA 2C04A 4DDUA 2X19A 1P60A 4UJ3A 3K8YA 5JWHA 4ZV4A 3IHLA 1KAOA 1S8FA 3ZVRA 4AK9A 4TLEA 4NYJQ 2HLDD 2ZIAA 1RPZA 2VHTA 4ASUD 2B8TA 1Q1QA 2KE5A 3CB4A 1T0JB 3A1SA 5K8LA 4D4MA 2V6IA 3GQBA 2CE7A 4G3XA 3MG9A 5G53C 4E09A 3U6BA 2IBMA 4RZ2A 1AM4D 2REBA 3OIUA 1P61B 2EFCB 5EXTA 2QMOA 2OCBA 2P6NA 1IM2A 1RE0A 5HKKD 2VP4A 3HU3A 4DCUA 1OHHD 2GF0A 2XOKA 1U90A 3RNLA 2O0HA 1Z3IX 1G7SA 5SZJA 1E9AA 5KSYA 5E7IA 2C5LA 2XTZA 4DIEA 4OI1A 1DARA 3I8SA 1OKKA 1SVLA 5B64A 4ZCIA 4M1KA 4DCNA 4B3GA 4KLNA 3VU9B 4EFLA 2GK6A 2OAP1 2ZRNA 4LJYA 1IXRC 3B7GA 4WZAE 4LBYA 1E2EA 4RKEA 3DKPA 4WXRA 2GKSA 3RYTC 3ZVLA 1VG9B 2H5EA 5JEDA 4B44A 4G5GA 2QRZA 3GEHA 1BMFA 2CK3A 2X1VA 3FKSD 2OAQ1 2IYRA 1XFAA 2A5YB 3KJIA 5C1BA 3AKDA 1FUUA 1G7RA 4RCYA 3VFDA 3L0SA 4HDOB 4GZLA 4YMVA 1VYUA 2NG1A 3IEVA 2V54A 2IF0A 3IILA 2CL7X 2FNAA 2GDJA 2IXFA 2IYUA 3HPQA 3L8YA 1P75A 3QXHA 4ZO4A 3GLHE 1R0YA 5HE9A 1CRPA 4NTZA 3ZS8A 2NO0A 4XVUA 2WJYA 3NBYC 2B92A 4WIAA 1JAHA 3W6PA 4YMUA 1SKYE 4DHEA 3GEIA 4IOLA 1U9IA 5FBWB 3UG6A 1JB1A 3FPAA 4IRUB 1JR3A 1XD9A 4M53A 1ZNWA 3D6TB 3QEJA 3SQWA 1Q44A 5KPJA 2IYVA 2IHBA 3ZGXA 1UDXA 3IIMA 2CEAA 3EPJA 1W7AA 1CBUA 2YOHA 2YNMA 4OL0A 1XJCA 2CJWA 4GNKA 4PAOA 2C99A 2KBFA 4LHWA 4YONB 1GWNA 1W5TA 4B2IA 1S3GA 4WA7A 1QG2A 3AVQA 3AF3A 4LJ9A 4EAQA 4MKFA 4RD2A 4B48A 3DDCA 3THYA 5D3QA 4FINA 1E2PA 3NHBA 2JJ2D 4NCKA 5FBQB 4A2WA 5EUQB 5CLLA 1LS1A 4CW7A 1F48A 1N6OA 3QF4A 5JMTA 1L2TA 3R9WA 1CR4A 2CMKA 3EIQA 1N5JA 3LRPA 1PLJA 4JBYA 3LNCA 4JLJA 4L15A 5AJWA 5CJPA 1F5NA 3K9HA 3W90A 2CHGA 1W0KD 2DFTA 3AVVA 5DLQC 3I4LA 3BE4A 5L3VA 3TW8B 1IONA 3WHLA 4LYFA 1E1RD 2J7KA 3T06B 1XP8A 2OBNA 1CULC 1DTSA 2WOOA 3LFUA 3PENA 4NH0A 3ZD7A 4OHYA 3QKUA 3TVTA 3ZZUA 3BFVA 4U02A 2B21A 5C4MA 5CM8B 2WPDD 5JI2E 4WW0A 3Q5DA 4JJKA 4KFUA 2QUZA 3AUXA 3KUCA 1X86B 1M7BA 3QJYA 2XAUA 3NC0C 1A82A 2Z43A 4P31A 2ZJBA 2RAPA 3GLIA 2FA9A 2CLDX 4NCNA 2IWHA 2WWIA 2TMKA 2FWRA 3OEEA 4JVLA 1ZM2A 1II9A 3OAAD 3W3AA 4NL4H 2CBZA 1YU9A 3JVUA 4HATA 4HSEA 4Q18A 1N3BA 2GEVA 4LJAA 1R10A 5EP4A 4FN5A 2XNSA 4FWIB 3VHXA 2GXSA 1XPRA 1IXSB 5KNDA 5J4LA 5TB5A 5FPYA 1DS6A 4PPNA 2XZPA 3LBIA 3SR0A 4HLQB 1GL6A 1KSJA 2ZJ2A 3CR8A 2H8KA 4KAXA 2ANBA 1KI1A 1GG2A 1HURA 2AD1A 3AV0B 4A6PA 3SN6A 4B43A 4URXR 2GJSA 4IOMA 3CONA 3AKEA 1AS2A 3IBGA 5AK0A 1KAGA 3BERA 4MRNA 1MOZA 4HI0E 4NE2A 3SYNA 4BFVA 1XF9A 1G19A 1ZU5A 4IDHA 4UXJA 3IIJA 3UK6A 2ZS8A 3KZ1E 4KYUA 3VX4A 1W46A 2O8BB 4YDHB 3ZVMA 1G20E 3GJ7A 1WA5A 4HUQB 1JXMA 8OHMA 2I1QA 2ODWA 5FOUA 3PEWA 2G77B 3WY9A 2FPMA 2D62A 4PHTA 4HAVA 5L3QA 5JS8A 1G6HA 5K8TA 4M8NE 4QHYA 3K70C 3U60B 1E9RA 4AKIA 1KIMA 1NMYA 2GF9A 3ZJYA 1S4QA 3OESA 1KJYA 2ZJ8A 1IY2A 4BGDA 4A0GA 4MRSA 2ZVQX 4A8JC 2ZR7A 2DFKB 4C0AC 4DDTA 3DZDA 2JDID 2AR7A 2VP2A 1UEJA 1TADA 3GJ4A 2YHSA 1LTQA 1OKKD 3CH4B 3PUZA 1U9IC 4JIMA 1MRNA 3C4JA 3AKCA 5BN3A 2J45A 3KJGA 4N1AA 3REFA 3B1VA 3DOFA 2ZAMA 2GXAA 2GAAA 3UATA 1W1WA 2ZRCA 1P72A 2GCNA 4C7OA 1VPLA 3U2QA 4EPRA 3RC8A 4NYMR 5A0FA 1E94E 5BYJA 5KO2A 3VR6A 1Y63A 3EA5A 3BFXA 5EXXA 2OESA 1PVOA 3FWYA 3LAWA 1E9FA 3CNNA 1G5PA 3ADBA 4BEJA 1BOFA 1WE2A 2WIBA 3OIYA 2G6BA 4FI3C 5FL3A 3RANA 3VNUA 3FHTA 1E0SA 1F2UB 4BZPA 5TV2A 3W6OA 3QSYA 3FHCB 4TT3D 3X2SA 3K0EA 3HP1A 4RFVA 2KBEA 2IF2A 1MT0A 4B47A 3F0TA 4BWYA 5J4KA 3SHWA 3ZD6A 4IFEA 2CVFA 2JLYA 5EE1A 5J47A 3B9QA 1S3SA 2BBWA 2UKDA 1CJMA 4OK5A 1ZNZA 3EZ7A 4L4UA 1OFTA 4AIIA 2A78A 5CYPA 4PAQA 1F2TB 2WVJA 1I2MA 1E4YA 4AKEA 2D2EA 4OI4A 2R6AA 3L82B 4QHSA 1EX7A 3K0CC 3M0EA 2NIPA 2JJ2A 4IHQA 5LB2A 1XJQA 4PXAA 5AJZA 2J1LA 3QXXA 2H17A 2ZSDA 1JALA 4JVMA 4NDZA 2OBLA 1Q1EA 3T15A 1YVDA 4AY2A 3K70D 1Q3TA 3EX7C 4D0NA 1RZ3A 2ZU6A 4ZCLA 3UPUA 3MLEA 1MR3F 2GZAA 1OIXA 3M4YA 1OT3A 3MWKA 1AK2A 3FFBA 4UNNA 4XH9B 1Q57A 3DEFA 1KMHA 5JHHB 1WDTA 3EC2A 4TZ0A 5JSZB 4TLBA 2JLQA 5DI3B 4LJ5A 1T5LA 1UPTA 1VHTA 1N6HA 4GOKA 4TLCA 1OH6A 4IW3B 1E1RA 4DLXA 2WJVA 5EXSA 3P20A 1Q21A 4OQXA 1IN7A 2V1UA 4JYCA 4DVGA 5TXGA 3CX6A 1GNQA 5FBRB 1XPUA 4JL5A 4M1TA 3TSWA 4TMZA 2RGNC 3T1VA 3G5UA 1W0JA 4QNMA 2O0JA 4RD1A 4US2R 2AL7A 3GFTA 1ANKA 3K0SA 3NDPA 5HZKA 3G82C 1LFDB 1MABB 1US8B 5F2EA 4IOKA 5H8WA 5KDOA 1E2DA 4OKSA 4EPXA 4A15A 2QEQA 1NVVR 2BM0A 2QQEA 2UZIR 4D0GA 1OPXA 5ANRB 1P4SA 4M9ZA 2QTVB 1AKEA 4HLUA 5DI9A 5FI0B 4BFYA 1TF7A 1KYIA 2OFXA 1UBFA 3RS4A 4P4SB 4LPSA 4DLUA 1T91A 4OHVA 1TEVA 4E03A 2PEYA 4OQMA 4RFSA 2GJ8A 2GEUA 3AEZA 4LRWA 2ZRIA 2QAGC 3CNLA 2AHOA 5KSPA 4Q4HA 2IS6A 4JSYA 3RRYA 1T3LA 1XJ0A 4AURA 1GKUB 1GAJA 1OH5A 2OCPA 3I5YA 1G4AE 3KXIA 3LVQE 4DLSA 3QIAA 1XMIA 3CRW1 3I5XA 4QFMA 1VDZA 3L43A 4FMDF 1JEEA 1GP2A 3WMEA 3NBXX 4Q1DA 1NJFA 3MMPA 1SGWA 4MRPA 1OSNA 3BH7A 3KQNA 1X8KA 5L8VA 2ZRMA 4PSKA 1W44A 521PA 3MCAA 4DXAA 3C5CA 5KTYA 5JSZA 3GCGA 2BEKA 4JVSB 5SZKB 3REGA 4HDQB 1KHTA 4MITA 4DCVA 2ZI3A 1CJVC 1WP9A 2EWVA 2GAOA 1SVIA 1HE8B 3PVSA 2IEZA 1EXMA 4UNPA 4ZDIA 1HUQA 3GLHA 2ZUDA 2CHVA 1EESA 3Q72A 1VIAA 1XTJA 2IYYA 5FPTA 2WJIA 2P67A 4HUQA 3QPUA 4LYHA 4OYHA 1X8JA 2MMCA 1U94A 3ZH9B 4W5WA 1YR8A 4KSCA 3Q9LA 2FGJA 2G83A 4WOPA 1CJKC 4B3FX 2Z6VA 1NY5A 4LHVA 2V7QA 2YWEA 1BS1A 1FFHA 3QPVA 1GKYA 4D81A 3IIKA 4O25A 3HWSA 5EE9A 2BMEA 2CNWD 4EJSB 4AG5A 2QSYA 3QOFA 4AI6A 2GJKA 3QG5A 5KUTA 2DY1A 3QI2A 4KBFA 1ZD9A 5LDDC 5CITA 1H8HD 1W47A 1GNPA 5AJYA 2HT1A 3MAAC 2E87A 3TJZA 3UG7A 1EFHA 1ZM3A 3AP1A 4DB4A 1UFQA 3QE0A 4OHWA 1GNRA 1VCOA 4WVFA 4QGGA 1SULA 3T35A 3W9YA 5DGXA 4DJTA 2LWIA 3EIEA 4G5SA 4M9SA 4A6XA 4DIDA 5FBVB 3NG1A 5JWOA 1HH4A 4RD4A 1LY1A 2G0TA 4KBGA 5E7MA 3DKVA 4B32A 4YMWA 2Z5FA 4URYR 4DDWA 2R65A 1KDRA 1ZUIA 1NIPA 2W0MA 3B1WA 1COWA 3MUFA 4TQ9A 3SYLA 3W34A 4GI7A 1G3IA 4LZZA 2HCBA 2CVHA 3CBQA 4DLRA 1ZCAA 1XDBA 2FFQA 4I1OA 2XEXA 1XX6A 4XVRA 4MQBA 4TTPA 4DSNA 3OZXA 1XNJA 1TUEA 1RYHA 2ZSBA 3CF6R 5FI1B 2JLXA 1EX6A 3QKTA 3O8RA 5L3SA 4OI0A 1SXJE 4MGZR 2ZUBA 4G5OA 2E9SA 4YLGA 4LBWA 2WKPA 2Z4SA 3RWOA 3EPLA 1R7RA 4BLRA 4MUAA 4F4JA 3B78A 1RIFA 1PUIA 1KSGA 1LB1B 2F1RA 4Z8YA 2IC5A 2R6GA 1OXUA 3B1XA 4PHGA 2BBTA 3CNOA 1NVUQ 1E9DA 1S2MA 1YZQA 3F8TA 4F7WA 1E2IA 3A8TA 2PT7A 1R0WA 1RW4A 4MUBA 2RGCA 1MH1A 4HZUB 2OSBA 3L8ZA 2W6JD 3AP2A 2A5FA 3VAAA 2IXEA 3IQWA 821PA 2GVZC 2I1VB 1QHSA 5CK5A 5JWRA 1K5GA 3H84A 1G6OA 2XITA 2F9LA 1FP7A 3KKNA 3S1AB 3WYAA 3U44B 4I99A 3ZQ6A 5TVKA 3C7KA 3WXMA 1JEDA 1QRAA 2FEMA 2X2EA 4LCBA 3DO6A 2P0EA 1G5TA 1ZYUA 3IGFA 4Q9JA 3OFNA 2X8AA 3Q8XB 3TGPA 3BGWA 1M7GA 4F4CA 3P26A 3VTKA 1A1VA 4Q19A 3X1WA 4LY6A 4M4SA 1NI3A 2CL0X 2HJVA 2XX3A 5FUWA 1DPFA 2BMFA 3EZFA 4LC0A 2WWXA 1DO2A 4FCTA 4NYMQ 4MKIA 5KNBA 3QF4B 3FOZA 2J41A 2DFLA 1IN4A 4KO8A 3KQLA 1P5ZB 2ZI4A 4MGKR 2ZRHA 4L16A 3U7GA 3TSZA 1FNNA 4GP7A 5FOTA 2I3BA 1KMHB 1E2NA 2OLKA 5FTLA 3OEHA 4E22A 3AVXA 2F1IA 1XXHA 3CW2A 1Z0DA 4JYBA 1G3RA 4OK6A 3BWDD 4ZDKA 2YZ2A 2P5SA 3MRSA 1OV4A 3LDAA 1P6XA 5AJVB 1HEIA 4QM7A 1Z5ZA 621PA 5UKDA 4XIGS 1HV8A 3FTQA 3CX7A 1XEFA 5JZVA 3SFZA 2P6UA 1TF5A 4MDEA 4LX0A 5JJIA 4PHHA 1AZTA 5D3MB 1N0WA 2ZROA 5EUMA 2CK3D 4B3CA 3W6NA 3NBZC 4QOSA 5J40A 1MABA 3CPJB 4Q4JA 4FIDA 1KO8A 5EE0A 2G9NA 4I4LA 1J8YF 4Q03A 1J7KA 3U3JA 2V55B 1WF3A 1YR6A 2MSCB 1XEXB 1P3JA 2OT3B 4V0LA 2QSZA 2IYTA 1X1SA 2GTPA 3CZPA 3PUYA 3UMSA 2H57A 4XOIA 4B2PA 3K0FA 2IK8A 4H1VA 4IDPA 3SC3A 4Q5IA 3A6PC 2QNRA 1ESMA 1LW7A 4AKHA 1E4VA 2J46A 2GA8A 2R62A 5TY0A 1U8AA 4JLDA 1WXQA 3BFKA 3FVQA 2ODEA 3T5DA 2NGRA 4G5RA 4ABYA 2QRNA 3AKYA 5G40A 1JR6A 3PV0A 2CXXA 1AN0A 1NBME 1M34E 5JBQA 4TTRA 2ZSFA 3TVDA 3AF0A 3DMDA 3BD9A 4V02A 1SHKA 4TMVA 1GZSA 4NKRA 3B2EA 3BBPA 4LJ7A 2GILA 1ONBA 4RJLA 2VHUA 2ZR0A 2P5TB 1NVVQ 2RGNA 3KKPA 4J0QA 3AGQA 1UM8A 1Z2AA 4B71A 4W5HA 1UF9A 1RJ9A 3R20A 2AFHE 2CLCX 4M1SA 2EFEB 4Q47A 4IVRA 4FW9A 1GRQA 3K09A 3VR3A 2HEIA 2KB0A 5TDHA 1NY6A 4Q21A 2IYLD 1W36D 1C9KA 1CTQA 3QVVA 2A5DA 4BFXA 3VKHA 1UKYA 2O8DB 3FGNA 3DMNA 2Q9CA 3M6AA 2J0UB 1E3MA 3AM1A 1FPMA 5EP1A 4B2LA 2XGJA 4JLAA 4CEIB 1KK0A 4JLKA 3LQRA 2JEOA 1J8MF 2EYQA 4JLMA 1AQYA 5KPDA 4GOJA 2A2ZA 2VPPA 1NLZA 3PFIA 5HE8A 2PJZA 2PZEA 2F3TA 2Q9BA 4BASA 3K0AB 2VF7A 2PZFA 4R98A 1J90A 3ONWA 2NTYC 2WOJA 3QF7A 2AWOA 1LNZA 2VLIA 1D2NA 4R9UC 3T61A 1G3MA 3THOA 1I2DA 2G0NA 4E5UA 5KYKA 3HPRA 2VL7A 2W6JA 3PR1A 2N46A 3CF0A 1Q1ZA 2FZLA 4IOJA 2YWHA 4ACBA 3IPYA 2NPIA 4F38A 3K9NA 2ZE8A 1E2LA 4JT2A 1VCMA 1O3YA 2GCOA 3I1FA 4A9AA 4CDGA 2NO9A 2D74A 3LQQA 2DWOA 2Z0MA 2QPAA 1N5LA 1AGRA 4Q00A 1NF3A 3B5JA 2P2LA 4ZPXA 3J81k 4BRWA 4OQNA 4S2EA 3U7EB 1W4BA 2L0XA 2OEPA 3K9GA 4OHZA 3QY0A 3LV8A 4TL7A 1TQ4A 1ZAKA 1RRCA 1MO6A 5HZHA 1X8LA 2NO1A 1KI4A 2IW3A 4AC9A 3K1JA 1H65A 2ZREA 2WTUA 1S96A 1Z83A 4TMTA 1TF2A 2D06A 1YZKA 4DRZA 2AXPA 1SKYB 2WMOB 1IBRA 5FTMA 1IXZA 1OYYA 4QJ3A 3IO5A 4TMKA 1DAFA 3SNHA 4BRUA 1W36C 2QL6A 1QHYA 2JJ8A 3IHWA 2XSZD 1R0XA 1EWQA 2JDIA 2Q9AA 1GKIA 3LX5A 2R9VA 3S1AA 2VP9A 5JCZA 1R6BX 1T5IA 3U4QB 3Q3JB 2FJUA 5J4VA 4Q7LA 4Q1EA 4LC1A 2A5GA 5C4GB 4URUR 4HLUC 2JLWA 2CE2X 4TN1A 1Z08A 3RSOA 2MMGA 3PIRA 2C95A 4QBFA 1NJGA 1R0ZA 1TAGA 1UKVY 3BJIC 3FHOA 4G01B 2VF8A 1KNXA 1VYVA 2OLJA 4IDOA 2ZANA 2R8RA 1Z0IA 3GP8A 1GL7A 1Z63A 3UKDA 1ESNA 3JZMA 5EZ5A 4B76A 5K8UA 2N42A 5B2ZA 2DYKA 4A2PA 2IEYA 1XXHE 3VU9A 1EFCA 2F7SA 5AJXA 2R6CA 3ZQJA 1HT1E 4BZXA 4I1VA 2G3YA 1ZUHA 2P3SA 4US0R 5CIWA 5AUNB 2QU8A 4CYMA 5FOXA 1ZCBA 4MRVA 4NCHA 2J0SA 1XCMA 1FP6A 4V0NA 4TT3A 3U3OA 2LKDA 2OCYC 3OIVA 3IUYA 4JMPA 4WBSA 3CLVA 3PQCA 4XTCS 3HYTA 4Z54A 5LD2C 3HU2A 1VG1A 1PLKA 3QXJA 3LBHA 4QBGB 4R2HA 4F4IA 5LD2B 2ODNA 1G64A 1VCIA 3OHMA 2QGNA 4Q4JB 1JI0A 4KU4A 2X2FA 1SXJC 1KZ7B 1AIPA 1X1RA 4P4TA 3V9PA 3BB1A 4JSTA 2OZEA 2FSFA 4PFSA 1TUIA 4NMMA 3ZDQA 2ZSEA 3I32A 3ICEA 3R9XA 1P2VA 1JR3E 2FEOA 1TTTA 1F3OA 1Q1BA 1U2RA 3M1IA 5EE3A 3PEUA 2ZETA 4RY2A 2BDTA 2YOFA 1XPOA 2OFOA 1G3UA 5H70A 3ZLJA 2WWWA 4CEHB 2C8VA 2V8OA 4Q48A 1P9NA 4C2UA 2QROA 3QPWA 5J4YA 3X1XA 4M0LA 2ZJYA 1QVAA 1FTSA 4BLOA 3V4RA 4Q1AA 3LXXA 4LJ6A 3EARA 3KJEA 2H7VA 3BXZA 5JS7A 1Z06A 2IUUA 2CL6X 4F93B 1II8A 3U6KA 1N0VC 3MSXA 4HUTA 4OQFA 2O8FA 4NCIA 1XB2A 2JATA 1FX0A 2PZGA 3TLXA 4V03A 1M6NA 2Q21A 4NU0A 4BECA 1BO6A 3CPHA 3VR2A 1RJ9B 4Q4LA 3W8NA 1W0JD 2GBLC 2NOAA 3KXKA 3ADKA 5JRZA 1H8ED 4PC3A 1SQ5A 1G16A 4MYTA 1JNYA 4FCWA 1VG8A 3DL0A 5HR5A 5CK4A 1DBSA 4TSFA 4Q9IA 3IKJA 1G3QA 3A36A 2BEJA 2QM8A 4LI0A 1OXXK 2ODBA 4Q7MB 3TBKA 4DUGA 1ZC4A 5L3RA 3L0PA 1XBTA 4PX9A 1U81A 4TLAA 3CH5A 1KDPA 4TZ6A 2VQSA 5F9FA 4Z8XA 2V1XA 1K6MA 1U0HC 2W2TA 2BWJA 2XJ9A 5G41A 4TYQA 4DSOA 4DCTA 1XU4A 4JZKA 2J0UA 4V0MA 3GLGE 1II8B 2HJGA 3FMOB 1KMQA 3CRRA 1US8A 3GFPA 4O0MA 4OJQA 3N2EA 2ZE7A 5DO9A 1ZINA 4AG6A 4HLCA 5FUYA 1DAKA 2WJJA 4TYWA 3EWSA 2O52A 4TWZA 1OFIA 2QMUA 5JJKA 1E9EA 1MO5A 2O8CB 2KJQA 1JQJC 5AWFC 4MGIR 3PCRB 1ZW6A 3KX2A 4LPKA 4D4JA 2J0VA 1GFIA 3QUSA 1E79D 4KODA 3JVVA 4YC7A 3OIWA 2IWRA 3WMFA 4D26A 1N6PA 4GFDA 1U98A 3A1UA 3K9LA 2J9RA 2PEZA 3CRVA 4GRAA 1Z6YA 1KGDA 3AGPA 3K09C 1NKTA 2FSIA 3RS0A 5EZ6B 1NNEA 2XNDA 3R9IA 4LWZA 4Z1MA 3TE6A 4YXWD 3C15C 1Z0KA 1FNMA 3MWYW 1P73A 1UEIA 4POAA 4IEEA 3TAHA 4DWJA 4CEIA 4US1R 4ILEA 1XEWY 2F1JA 1KI8A 2LKCA 1KZGB 3T5GA 1B23P 1CLUA 3B9PA 1RRFA 1KO4A 5BQ5A 4CVNA 3GLFA 4QG7A 3RVBA 1R5NA 4JBXA 2ZM5A 2O0KA 1OJLA 3BB3A 1XD2A 2ZI7A 1N6NA 4LJ4A 2FOLA 4JBWA 2QG6A 4IJMA 1GILA 2ORWA 2D4HA 1CP2A 5C18A 2H1LA 1OF1A 4PC1A 2PLFA 1HTWA 1FL9A 2OXRA 3T1OA 3HU1A 4XTRA 2PJRA 6Q21A 4GDFA 2IXGA 3CR7A 1CEEA 1IOZA 1TU3A 2FFAA 2A30A 4O2LA 1FZQA 5G3ZA 4HAYA 5KSZA 3UXMA 2ZJZA 4W9MC 1M74A 3CPEA 4DCSA 1EFRA 4GT1A 3SFVA 1W4AA 1F2TA 2GZHA 2IT1A 4DLWA 4TQUS 3U44A 1Z0AA 4PANA 3TRFA 2V4ZA 4OQLA 4BFZA 4WZBE 1NL3A 2PLRA 4EJSA 1OYWA 4RZUA 4F92B 2RKOA 2ZRKA 3KFVA 2Z83A 3PEYA 4ZDWA 5E7JA 4GOXA 1G5RA 4AYXA 4BQSA 4W5JA 1ZVQA 2IS2A 4LUCA 3TIFA 3THXB 2ZRDA 1Z0FA 4U00A 2JLRA 4MH0R 4M22A 2ZE5A 4UJ5A 3I61A 2HDNB 1U99A 3MWJA 2GXUA 2VSXA 3QENA 3L2OB 1G7TA 1VHLA 1E9BA 2FDCA 1COWD 1HQYE 3U7HB 2XB2A 3LW7A 1FMLA 2AD5A 3CX8A 4IEIA 4BLQA 3PG5A 4CRWB 4EFMA 4Q1BA 1UBGA 1OFHA 1PJRA 4JKYA 2YV5A 1QHGA 4Q4AA 3MD0A 3MJRA 2QP3A 3GLFB 3GEEA 1R4AA 3Q7QA 5J5CA 2XJ4A 1XTRA 2EFDB 2QZ4A 3THYB 5BWMA 2O5VA 3P27A 1YZUA 1I4LD 2P65A 3LW8A 1YZNA 1IQPA 4U7DA 1K5DA 1MO3A 3Q5EA 1SVOA 4XVQA 3U3MA 2IS4A 3NXSA 1YKSA 2VTKA 3DPUA 2ZRJA 4QRHA 4EDHA 2C9OA 2PL3A 1H8EA 1KK3A 1L7VC 2FFHA 4ESHA 4ZKDA 5FBLB 4YMSA 4A0HA 5FUXA 4R71A 1JQLB 3NDBB 4DZZA 2Q3MA 1L4UA 3RC3A 5DI3A 1NMXA 2DPXA 2YOGA 2GETA 1V43A 4IFBA 4ITRC 1IY0A 2IUTA 2AFIE 4M9XA 4QJ5A 1DAMA 2QI9C 4Q9KA 2GHIA 1BYIA 4P32A 5H68A 2QN6A 2RGAA 5M04A 1DAGA 3RSLA 4LHZA 4NYIR 3U7FB 4BUJA 3IDQA 1N2CE 1A5TA 3TW4A 4LGMA 1DEKA 3AF4A 4GMDA 4A0RA 2WWGA 3KTAA 1YZLA 2W58A 3AVTA 3GLIB 2UVQA 4PSVA 4XJXA 4DDVA 4ZI3A 4CF7A 2C78A 3THXA 2QPOA 1NRJB 2VP5A 3GJ0A 5P21A 1FX0B 5AR1A 1R8SA 4PHFA 5CB6A 1QF9A 2HYIC 2QAJA 3OFND 3L0IB 3KFXA 2FZ4A 2P6RA 1ZJ6A 2KI5A 5H1YA 2ZJAA 3B8HA 1A4RA 5FOWA 4BLSA 4TL9A 4QGAA 5KHOC 4M21A 2JJ1D 4XD7D 3I62A 1E0JA 1XRJA 3DM9B 3QXCA 3SJAA 4A2QA 2Z4RA 1Q0UA 1VTKA 3B85A 1IY1A 3EA0A 4CEHA 3NBFA 4PC2A 1XTIA 2D7DA 2OE2A 4IKEA
chains in the Genus database with same CATH superfamily
3EE6A 3OUUA 4P3PA 5K0SA 5EHIA 2QF7A 1BJKA 2Y1OA 1UXJA 1XQWA 3AI3A 2DPMA 2QT0A 4L5JA 3G7UA 5HCUA 2E4XA 2XNDD 2ZI6A 3OCJA 3SS8A 4D9EA 5DH9A 1JFFA 3N7UA 1FQKA 2NO7A 1GUZA 3OEHD 4XB6B 3FJYA 3DEJA 3UGQA 1LF5A 2OXFA 2O5CA 3ZY3A 2O8FB 1BH2A 2PCJA 2YWFA 3D2CA 3GLQA 1XROA 4ZAVA 1WXHA 3BBLA 3HCCA 1J8VA 1O6FA 4D9IA 1GPUA 3IT0A 5BQXA 5FFNA 3WTCA 1MOPA 2HN9A 4PRZA 2BSQA 3K9FC 4QLOA 2VK8A 2GZSA 2GBLA 4EPWA 3QKSA 3K20A 3OQMA 4O3FA 4HEQA 3I1YA 3VVCA 5B3JC 2ZZKA 4CTJA 2OCIA 3TFOA 3ZYCA 5DDIP 1CWUA 4C7KA 3IKMB 1J7JA 1M5TA 4MZXA 3T7IA 1YK1A 3HKBA 1ZM4A 3R8CA 1L5OA 1NULA 1IAQA 2PGNA 5CNIA 4AJHA 1W2GA 2XTAA 3E3NA 4WNIA 3PPWA 5JAZA 2I5PO 2LIPA 2PCLA 2RK4A 4FB5A 5JSFA 1R4MB 2WBLC 3BM5A 1O8CA 3MTIA 4ESVA 2BZGA 3WOVA 2GEDA 4Q9NA 1AZSC 3WYEA 5LMCA 2PS3A 3OX1A 4C20A 5SYNA 5A5VA 3QELB 2ALJA 1F4PA 2QYHA 2QOEA 2D13A 2LD4A 4RENA 2RHDA 5L53A 1FPQA 2HEGA 2P9EA 4H77A 3OJXA 1H3NA 1J70A 1GZUA 3Q8KA 2EHDA 3RTEA 3NH9A 4EG8A 2EKQA 4YRQA 3R7AA 1SCUB 3PRKE 3TEFA 1XRSB 3OQOA 3TLZA 1CUYA 4IIJB 2W0SA 3D0QA 1RM0A 2HTFA 2I9PA 5G0VA 3AL3A 2O8CA 3EB9A 3T12A 3OPMA 1QGYA 3L1VA 3LC2O 1ZD5A 4BEBA 2P4QA 2PK3A 3L1IA 2FGKA 4CHTA 2O23A 121PA 4K0RA 3G5MA 3PD7A 3CW9A 4KO4S 2X9NA 2VZ9A 5JTUA 3T6KA 3A04A 5EFZA 2EWMA 2VXCA 3NOQA 3WAKA 2X13A 4Z51A 5K8JB 1VP3A 1VLLA 4HX5A 4PAMA 2NTJA 1MDFA 1WCYA 3O83A 4JP1A 2IUEA 1IIBA 1X0XA 4NAUA 4RJKA 4NABA 1EMDA 1H22A 3CW8X 4P82A 4BJ5A 4KMRA 4EECA 1I4WA 2AKAB 1EG2A 1SZCA 3N8GA 4BN0A 2J4FA 3C6MA 2FZGA 3I9FA 5C5CA 1P62B 2VIIA 4CG1A 1X8XA 3PLNA 4CTKA 3ESBA 1JQKA 4I7EA 4X8LA 4ZEXA 5BSVA 2HHLA 2ZYSA 3OQ1A 4R0VA 1UAAA 1I1QB 1DTEA 1E5TA 1NPDA 3EA4A 4HQ6A 3RUCA 5CFQA 3JALB 3PHBE 2F6RA 2Q4BA 3RTCA 3M4ZA 4ZIRB 2PX8A 1G21E 4P3NA 3BXEA 3KIPA 4RVGA 8ABPA 4UNRA 4X1IA 3K0HA 4BMSA 5LIPA 4LBVA 1S9DA 4X20A 4EG3A 4I1YA 4EY5A 3SGLA 2I4MA 1NG1A 5LA6B 4XYMA 4IHJB 5IKOA 1QMPA 3UOGA 4Y6PA 4D4KA 5BN5A 5LLDA 5A4DA 3PUKA 1BE0A 2BC9A 1QIKA 2J67A 1WMDA 5C52B 2X77A 4MW4A 5CFNA 4RTJA 2Y2VA 1E4EB 1A50B 4QBTA 1GQQA 1OE0A 4A5SA 3EIOA 2IYZA 3L8GA 2ZRBA 5KNBH 1UAGA 3IAUA 1A2BA 4HGYA 4GZ3A 3LOUA 4R31A 3HDHA 3QKRA 1DADA 2AB0A 4GXTA 1NMEA 1XU7A 3P8ZA 3QLVC 3TIVA 3V1MA 2FQ1A 4C0BA 4D0LB 1CUXA 3RAGA 5EWLA 2QR2A 4CMIB 4D45A 1TRHA 3WL4A 4LXUA 1FQJA 5EEGA 1ARZA 3QIVA 3ZGLA 1DDOA 3R74A 1PWXA 2ZXUA 3LM8A 1EFDN 1M33A 3OTHA 1W2WB 5EJ9A 1C81A 5KQGA 5T3UA 1IWPB 4L9SA 4DCGA 4ETNA 4LFBB 3PXGA 1FU4A 2HK8A 4O1MA 3SJBA 4DV4B 1Z28A 2XB4A 1RZRD 2EU8A 2Q1WA 2W93A 4TWAA 3CWCA 5A6SA 1GR0A 1M54A 3FOWA 3OLQA 2GZ2A 4ZCPA 2QVCA 2O1XA 3RV3A 5F5XA 1EPUA 3KYJB 5K03A 4KHPB 3U4QA 2JJ1A 5DHUA 4YDRA 1W25A 2ZWMA 3PL5A 4PC6A 3OE5A 1E7QA 1VA5A 3P4XA 1RWMA 5CLQA 1UFRA 2QTHA 3T9AA 3UV3A 2D7CA 3BFPA 3LIPA 5D86A 2HHJA 3CLTC 5CT4A 1YRAA 3COVA 3QVTA 1Q0ZA 3BUSA 4BNYA 2QQGA 5L3ZA 1Z6XA 5LB4A 3DAFA 3NETA 3LCJA 4MR9A 3H65A 4HLDA 4F2DA 1F9EA 1PJTA 1E7WA 3LLCA 2YZNA 1FLVA 3G8YA 2RONA 1OBCA 3S0JA 5FD8A 2YWJA 4YUXA 1Y1TA 1VIDA 2ZBQA 1E1QD 1X6VA 3GJ6A 1JJ7A 3FA2A 3H13A 1WVGA 3UT5A 3FPFA 3CJQA 2O6HA 3RGWS 3VAYA 3RYCB 4JNKA 1P77A 2M1XA 5K0TA 1HR0B 4IWNA 1JTEA 4KPUA 4Q1CA 5ELMA 3VYVA 3H86A 4JL8A 2HSEA 3OMLA 3TW8A 2B7LA 2C2YA 4BVJA 1G41A 5FJIA 1BKDR 2A5JA 4GKJB 3GDWA 1OLUB 5I4IA 1EDDA 5IPFA 1A9ZA 1KK1A 4Y2YA 3UC9A 3X1YA 3F47A 1M2FA 1R27A 1NQWA 2X6RA 5IH3A 2VUTA 1AVTA 1I0ZA 2ZWVA 1GG8A 4H9GA 1MORA 3E5HA 3DMTC 2ASEA 1R5OA 3ITKA 4GGMX 2V3WA 2F17A 3G13A 3KU1A 3NHFA 2WAYA 1U3DA 2YVQA 4IYJA 1IN6A 3W9BA 3WV5A 4B35A 2Z09A 5EKSA 1TMOA 3ELYA 2AJLI 1BXRA 3LTEA 1PR5A 4KN8A 4LOHA 4LY3A 1YB2A 2L2QA 3OLZA 4LHYA 3BREA 1E2KA 5FNVA 3BS4A 1Z56C 3KZKA 3K3PA 1RQRA 1PNOA 1TUGA 3PEVA 4RKFA 4YHBA 3EGXB 3ONEA 5K05A 5K0JA 5DN6D 3AINA 4EMSA 2VT2A 2XOXA 3GUZA 3E7DA 3IBSA 2LIVA 3I9V6 3OPYA 3QVXA 4UPVA 2O4CA 2JRLA 4X6XA 4ZOBA 1P1CA 4K9DA 4HZIA 2VQFB 5FNZA 3HDYA 4FZRA 2W4MA 5BT9A 1XD2B 1W4CA 1U04A 4Q1FA 3AWIA 3VC2A 4JBHA 1GTVA 3O0TA 3O4HA 3G0IA 3JPYA 2W90A 4L50A 3DQPA 4QTZA 1C7ZA 4QHTA 5DWQA 3FTCA 1HY3A 4CE6A 1JAYA 2JFOA 5DM4A 2GAIA 4ZVQA 1Y1PA 2QJOA 4GR5A 2G07A 3SJ7A 4UM8B 2QRMA 4BLVA 5DM0A 2CXRA 4XIYA 1XD8A 4QAJA 2VZLA 3TGLA 2A88A 3V6LA 1E6EA 5AKZA 3LY8A 4ZJZA 3C7CB 1E8MA 5BSFA 1WOMA 3AZPA 4LOIA 5CNKA 2H11A 1QM5A 4NU8X 1J39A 4TLMB 4XPZA 2ZIUB 3NTQA 5F1YA 2ZPTX 4IF6A 4GOOD 2FN9A 3O9VA 4WINA 5JALA 2IP4A 4XDHA 1SC9A 1XR3A 2HNKA 3K0AA 2W2XA 3AG6A 3SJCA 1N6IA 1TPZA 2HRDA 4F3KA 2VYNA 1T1RA 1JP7A 2PBRA 5HJ5A 1YAJA 3WE7A 1UJCA 1V11B 5A1JA 2HV8A 4LV8B 2ERYA 3B1ZA 3NGMA 3UUGA 5EG5A 4HX9A 2Y6VA 3GT3A 721PA 1DIHA 1GG9A 4BZZA 3PJRA 3FB4A 4GYYA 1MP0A 1A9RA 5CXXA 4N8EA 2XUPA 4PQYA 1F12A 1EA5A 2H2WA 5LQAA 4BKOA 5EZYF 1SD1A 3NDRA 4N39A 4KGZA 4CM7A 4UTRA 3B60A 3TX6A 2ZYIA 4PZEA 2H92A 3ODPA 5ED0A 1UT6A 3K7EA 3G68A 1NW5A 3ANSA 4OU4A 2B99A 5GVRA 5LLTA 2VCHA 1R3UA 3HKCA 4UBLA 1B0UA 2FPGB 2VDLB 1BRTA 5AKXA 4FM9A 4DUGD 1JHYA 1SKQA 3S8MA 1ZD8A 2F90A 3ND8A 3ZH2A 5WRFA 4DQKA 1DT3A 4K1LA 1Q7BA 4GL4A 1KTIA 2RHRA 3CN7A 1Z2PX 4W1SA 5AQ1A 2VAMA 4V1CB 3LFHA 4ALLA 1I6MA 4H6XA 1EK1A 5B3LA 5AJWA 2C3YA 3ND9A 4C0LA 4RD3A 4XJTA 1USKA 4DUPA 1N7IA 4RH3A 5CX1A 1P2SA 3GNSA 4RYDA 3KVYA 4NBNA 4X84A 5GGXA 3RRNA 3UK1A 4B4OA 3Q0IA 2DTXA 1YR1A 2ONKA 3KL4A 4TYMA 4OP1A 1F06A 4CKXA 1EJ6A 2W7TA 4HGNA 5ITZA 3MA0A 4D5GA 4UVDA 1QC5B 3SZRA 1W4RA 4GPEA 4ZODA 2CDBA 3GHYA 4DVJA 3E5MA 3BORA 2H5JA 5KJCA 1VA4A 3NAGA 4HY3A 1Z0JA 3GVHA 3FFWA 4HPJB 1X1QA 3BK7A 3IJ5A 3Q1KA 5CR9A 2NMVA 3LHDA 2XCUA 2CXQA 1ADFA 5JYCA 1CVLA 3VR4H 5HYVA 1E3IA 2HGZA 2GPYA 1V6CA 3I8OA 4QEDA 1JECA 4R2LA 1QP7A 4UW9A 5D5PA 3T38A 1SXQA 4HYEA 2DHQA 2ORIA 2Y68A 3EASA 5DX0A 3T99A 2YNMD 4QM6A 3ZDEA 3B7WA 3A6JA 2ZR9A 5LBUA 2RG7A 2GGSA 1Y5LA 3NHRA 1A04A 1P80A 4M0KA 3S2UA 4LRXA 5LOVF 5GVSA 3QFSA 3OX3A 1HLDA 4N7JA 2H0QA 4WSOA 3F2IA 3Q9NA 4WERA 5EC8A 2FN8A 1OIWA 1K68A 1H0KA 4E5YA 2QA5A 1QAQA 3TXXA 1R4NB 3ZHTA 3NTVA 3UMFA 1KZHA 3V55A 1JG7A 1T6YA 4DMHA 5C5IA 5IJWA 1GNTA 2FPIA 3I05A 2RAUA 1CVIA 4IMIB 1IEVA 4BNNA 5IN4A 4B83A 2PUTA 1JFLA 4KVGA 3W8RA 3OT4A 1WS6A 4UNQA 1OQAA 3M8KA 4BTEA 3LUGA 2P2YA 4MLPA 1FB5A 2BTQA 3U61B 5GIPE 2IOHA 1K86A 2PMDA 3QVJA 4OSEA 3ZK9A 1W2HA 5DTJA 4Q3AA 1M83A 4QNRA 3CUSA 5DOZA 5CEJA 3TSCA 4X8HA 1JBEA 2G5GX 2NVUA 2YMQA 1Q15A 4NJEA 3SYKA 2JLVA 1A71A 3IXQA 5JFGA 2VPZA 3DEIA 3ND7A 3IV7A 2XB6A 2XIJA 4JLNA 3WKEA 2W2VA 3OQJA 3BK2A 1SKUA 3NVAA 1FUKA 4K9PA 3O4VA 4B80A 2XYRA 4NPHA 4I50F 4ZRNA 1JSCA 3KB8A 1U1EA 3S28A 5CB0A 4O1HA 1L8OA 2BM1A 1T1IA 1RZVA 2PGOA 2ZG6A 4HP8A 4MYRA 4P4GA 3UC5A 3H2GA 4BO0A 2Q28A 3KKMA 3R4VA 4NZYA 3KT6A 2JD0A 5C8ZA 2EDCA 2PBFA 2VJDA 3DQZA 4HBGA 4J9UE 4CPDA 1N36B 4L8LA 3UO8B 1YGYA 3BK1A 4LZNA 4F56A 1M75A 2A58A 4F96A 4F3RA 3KQYA 2AK3A 3H2KA 3ND6A 1NLFA 2QD1A 1BGXT 3PTLA 4BNDA 3UA4A 3URMA 4FGKA 4BMDA 4PLYA 4CL0A 2VSFA 2HDHA 3UHJA 1HYQA 2A57A 3RK1A 1NT2A 5KNDD 4L5AA 1QSGA 4DV3B 3JQ9A 4N3AA 2OA0A 1AA6A 5JPIA 2EZ4A 4BFTA 4C78A 5JYDA 3WIUA 1TA0A 3BB4A 4ZZ0A 4X8MA 1T0HB 1PYGA 2WIDA 5IT0A 3A4MA 2HIAA 2WVGA 2ZB8A 4XM1A 1SWWA 4HQNA 4RCZA 1B0ZA 1XAGA 2PPVA 2OXTA 3W7AA 2VHZA 4XYBA 1U7HA 1E7RA 1ZA1A 2X0FA 4CM6A 1U9JA 3DC2A 5FOVA 4AJ9A 4QZVA 1EQUA 5IYZF 4QC2A 3KUXA 4AWXA 2O3SA 3CZ9A 2F9MA 5GJCA 2E89A 4NESA 1KARA 2BM8A 2W2OA 3PITA 4I6EA 4RSGA 1P9RA 2CWWA 4JC8A 1R88A 2HWKA 3A9RA 5CW1A 2LNDA 3NEJA 3WK4A 1XDSA 2ASVA 1WBBA 2PMWB 2Q99A 1P1KA 1L6IA 3NEYA 1Y4DE 2CLHB 3F6SA 5EKDA 5KB3A 3FN4A 3SC6A 1A7JA 2WJGA 1MB0A 1N2SA 2I33A 4LXGA 1YS7A 4H60A 4A4DA 2Q0HA 1N6KA 3F9CA 1MIOA 3FVRA 4HCJA 4KWHA 2XRFA 4H1TA 1TECE 4BLPA 3FOEC 5KYWB 4P22A 3IBTA 3MJHA 2B25A 1XHLA 4K88A 3RU3A 1RI4A 4G1BA 4MUHA 4O4LA 2PYDA 1SC3A 3GCDA 1N1GA 1BU8A 4OL9A 4DMMA 1S0UA 1SVMA 3PFGA 4ON9A 4ARZA 4YY3B 3GVCA 4PN3A 5K8IA 1TXGA 5AJUA 2IYFA 1YFJA 2I62A 2OC9A 3CF4A 2A1TR 2Q2NA 1NR7A 1Z34A 3KJHA 2VHEA 5A4FS 4DMKA 3SP1A 1P6QA 4R83A 1JN0A 4DQXA 2VEDA 3FMFA 3AY7A 3SS7X 1QTNA 2I6XA 3DT8A 4YYZA 1FP2A 2WJ6A 1IOWA 1GSIA 3L7MA 4TYYA 2WHRA 1UDWA 5G4KA 5C35A 1CYDA 5LU9A 4I4TB 1O6CA 1KVTA 1DC6A 2C9DA 4WZBA 1R5JA 1CQWA 3OQIB 1T6NA 1MCZA 5EGSA 2JLUA 1D7OA 1J5XA 1D2GA 1FNSA 1P2TA 2JGJA 2PLWA 3AP3A 4CM8A 3B12A 2DHDA 1I3CA 2HSDA 5KJEA 3M6MD 4CV2A 3ZVNA 2KHZA 5F33A 4HV4A 1IJFA 3PX7A 3AHIA 4GVPA 1SH7A 3PU6A 3HDTA 3OVMA 3PTZA 3PUWA 4ZEOA 3RIGA 3ICQB 3H1PA 4UTZA 1JMYA 2XVAA 1PJ8A 1L7NA 3AH8A 1A2OA 1OC4A 1U8YA 2DQKA 3B9RA 3HA2A 3VYSB 5EJ4A 4JVNA 1E2JA 4RV4A 2GCOB 5E1OA 3RKSA 3GFFA 5A2GA 5TPWB 4Y2TA 4UM9D 1YRQA 1U2QA 4N18A 2F1HA 3NHAA 3WBKA 2IYXA 1PJLA 2ZTUA 3ZU4A 4AW9A 1R4ZA 3D3WA 3ZIAD 3L6CA 4KLZA 5ENDA 2GM3A 1NRWA 4GPTA 2ZM6B 2CW5A 4O0LA 4WZBB 3ZW9A 2VPQA 4AKTA 1E3EA 2PXCA 2Z8YA 5H81A 3Q6NA 4AJEA 4RHEA 3BCHA 5KDDA 3GCWA 2OSVA 5JJ5A 4UDOA 1AQUA 3EXHC 1AGNA 4HJRA 4KK3A 1QIIA 4TWIA 3UJNA 4UXIA 5KQSA 1SQ6A 3VR4A 3EWIA 4AP5A 2EX1A 1E20A 1UZMA 1MNQA 3Q40A 2WE7A 2H85A 5HIJA 5JYBA 2O57A 4G63A 2HU2A 3OURA 3BTOA 5DP1A 3VKUA 1I33A 5CTJA 3DD5A 3EZ2A 3HN6A 4ZOLB 5K01A 2C4VA 2C2WA 1V16A 2WJPA 3CG0A 1E5XA 1E89A 3OLYA 4GGPA 4IY1A 2HC9A 1N2BA 4EB3A 3O5AA 2DCUA 4GPZA 1FRVA 4UZSA 2HDWA 5CDFE 1GAWA 1Z29A 3T3GA 1OB5A 1YOVB 1UJ2A 2OZVA 1Z37A 3OD1A 3Q98A 2O20A 3C41J 4PR0A 2DWQA 3FTEA 5ICEA 3RHFA 2BFBA 1MV5A 1J21A 3L1UA 5DIFA 4EZIA 4HDCA 4DDMA 3HCEA 2QX4A 5F21A 3D43A 3QBVA 4X24A 1GNSA 1ZWKA 5I47A 4JELA 1YZGA 4ES6A 1RVDA 1U0TA 3K53A 3LYHA 1AKWA 4JP3A 3DEAA 3H8SA 4ZVNA 3ZXIA 4RTLA 5GTDA 3QYJA 4Z3OA 1F8FA 3GMTA 2JLBA 3M70A 4MRAA 3SOPA 1BRMA 3QOXA 2OZLA 3C70A 2X9QA 2HSJA 2OO5C 3E2MA 4AF6A 2VJKA 2W8ZA 1IZ7A 1V4BA 3PC3A 1EUZA 5CYOA 2EZTA 2P6OA 4FOSA 4DIBA 1AUXA 5BYKA 1G1MA 3EC1A 4RGQA 5BRNA 3T0FA 5L7WA 1FK8A 2CMDA 4D8YA 4F1WA 3U4GA 3QW2A 3H1FA 4I3GA 5TGDA 1TM4E 3EOAI 3WG9A 3GVXA 4GQIA 4CODB 1KU0A 1RHRA 3KVNA 1WAMA 1O0SA 2VJMB 2B34A 3KWLA 4I36A 4I8IA 4LSGA 3A1CA 1PKEA 5J5AA 2R8OA 4LMPA 2PVPA 2HSWA 2ECQA 1H1DA 2AFIB 2BKUA 2YWGA 1S4MA 3EVBA 5JNLA 1N77A 2XBMA 3C5HA 1FYEA 4H4DA 1F51E 1QHIA 2IPXA 3DCIA 3WNDA 3PBKA 4GE0A 1RYDA 2P40A 4KUHA 3VX3A 2GNOA 2OO7A 4OYLA 1TM1E 2NX2A 1J24A 4DEYA 1DE0A 3W5IA 2GJ9A 1M5UA 3NFYA 2G17A 3ICCA 1HG0A 3AFNA 4IXMA 4U6SA 1CUWA 4DIKA 1W49A 1IC6A 3FSJX 2X0IA 1Z2DA 2HWWA 5LP6F 1D0IA 4EVSA 1DJMA 1U1IA 1YJ5A 4NENA 4G86A 3D4LA 3R9XA 4MWBA 4QDJA 5SY4A 3TUJC 3U5TA 1B1AA 2H2FA 3FIUA 5DT9A 2RIPA 4RC9A 3S4YA 1SR8A 2BCGY 1NW6A 1CY0A 1NUUA 1QO0D 2OGTA 2YHAA 1XP5A 3AUJB 3GHHA 3KRTA 2ZJ0A 1CB7A 2AFHA 4O4LF 4V39A 4OB6A 3RH0A 1KAMA 4PCUA 5I45A 2XTNA 3DLCA 3FNHA 3I8XA 3K96A 4URHA 2X0RA 2JFPA 1EFTA 1MH9A 1OYVA 2QY9A 4TV8B 2OYCA 1WQ1R 2Z6QA 3PUXA 2C2XA 3KB2A 3FYHA 1G60A 1VCNA 3HUFA 1Z0UA 3IBFA 2C98A 4G0XA 5AI8A 3SBOA 5J3JA 3AVWA 3GRVA 1MTZA 3WMGA 3F4BA 2RHCA 5I7RA 2LDBA 2FW9A 4IXTA 3KPYA 3SSNA 1V25A 4RK5A 4X1KA 4BQOA 2CHUA 2PH3A 3MQ4A 5I7HA 4B3TB 4KN6A 1PJAA 4H7JA 3WQQA 3QBTA 4BV3A 1Q22A 1APBA 1DT5A 3P0RA 1NC1A 1KERA 5IHPA 1AUVA 1CY8A 3GV0A 1BE8A 1BMFD 3JQ8B 2Q3HA 4KQIA 4OHKA 4B4VA 1JXOA 1CJTC 1P9WA 3H9UA 5HCIA 5BSMA 3ZZTA 2CGEA 3VR5D 3ZUPA 1K8YB 1X9HA 4BYMA 3EXIB 3GDGA 1XGKA 3LECA 4NYJR 2AR9A 2G4CA 4UCWA 4A73A 4W9NC 3A10A 2QX9A 1I10A 2G06A 3EGDA 2R48A 3PEFA 4XUCA 4PPYA 3ZIUA 3UIEA 3B36A 1UKZA 3HYRA 4J03A 1DRUA 4D9FA 4NOLA 3JQQA 2VZEA 2BD0A 3TMYA 1DOAA 2PZKA 3KTDA 4I5FA 1J6UA 1NBMA 3E22A 4OYRA 5FTJA 4RHTA 4AMBA 5C8YF 4R2IA 3PJEA 2JGEA 1QHHB 3M4JA 1CE8A 3K9QO 1QXSA 4D46A 1YB5A 4MW0A 5KU7A 2BKAA 1J00A 3M6LA 1AS0A 3GA5A 3GBSA 3WLFA 1WZNA 3IEXA 3ZTTA 4NONA 1HT2E 1R12A 3P32A 1S8AA 4MYCA 4XFJA 5HJ2A 4E08A 2O8EB 1L8AA 3WVNA 1TEHA 2HH9A 3C4VA 3HXTA 4YAEA 5F1PA 2XXAA 5A0VA 3SFTA 3HLYA 4YRBA 2YYZA 4IXWA 4QTUB 2HFKA 3G2HA 1X1DA 4KJXA 4G8JA 4PAWA 2ZUTA 1Q3HA 3ML1A 3RSGA 4P3YA 4K46A 2OBMA 5AUOB 1KQPA 1MZPA 3ASZA 1KVSA 1EX1A 1Z5UA 2BFFB 3R7LA 4C2AA 2VF5X 2I4TA 4AZ0B 2BFCB 3O82A 3RTGA 3AYXB 1Y37A 4TGLA 1E61A 2WF9A 4DM7A 3RAFC 2QLNA 3DBVO 1XAIA 1SPBS 2ZT6A 3AY6A 3KHKA 1AB6A 1CSEE 3MCZA 4H17A 5LBIA 3SZMA 2ZRQA 4MK4A 3U9LA 1DEAA 4KV9A 4BBPA 3O91A 3SX0A 2Y66A 4TVSA 4A8JA 2OORC 3QWAA 4G9GA 1ZMXA 2VDWB 4PYKA 3VZSA 2Q7OE 4EJFA 2D5IA 5JD6A 4HEJA 3IVMA 3C6KA 4PGFA 1SK9A 4FE7A 4BNKA 1X14A 1JA9A 3GJSA 4U7GA 3MJFA 2XZOA 3EEYA 3LY7A 1JUDA 3QK7A 3GMIA 2OD2A 3AI1A 1MKYA 1ZIPA 2A4KA 3A4TA 2V96A 2PL9A 2C9CA 2YC4C 1C4KA 2EKLA 3JS5A 3LKZA 1LBTA 2WSSA 1WXWA 4FKMA 5ALNA 5TPZA 4CUJA 1JJVA 4F45A 5K5EA 4KQGA 2XE8A 1WB9A 1ZGGA 5CCDA 1UC4B 3H1EA 5FPPA 5LOVA 4ZT2A 1CRZA 1VMAA 1VSVA 2FMHA 3KTOA 4I3HA 1GM5A 1ISIA 2QYSA 1E69A 4IVPA 5JJLA 1U8UA 1O5TA 3NYQA 4C3ZA 1RYZA 4IIBA 3WL5A 2V9ZA 4OBBA 4Q3CA 1VE9A 3ROXA 3NT2A 4BO3A 2GUGA 2P3OA 4MAMA 3QEBZ 1YZYA 3MUEA 2GUWA 1TQ6A 4R7TA 1CR1A 1EBUA 2GAFA 5IUJC 3ZDYB 1YJXA 4C7JA 4D82A 1DAHA 1KDOA 3HKEA 1UBUS 1II0A 4XCVA 2FN3A 5EL0A 2ZWOA 4EEKA 3A6ZA 1EE9A 4B8ZA 1TAHA 1Y9JA 4DABA 1D03A 4U5XA 4RVCA 2IBSA 4EY3A 2AC7A 2XMBA 3PX2A 5FLKA 3ZHVA 5DM1A 1QOZA 1UKEA 2OOSA 2ZBRA 4FT2A 3WK6A 4K6MA 3P9SA 1C7FA 4IDFA 4L3WA 1DU4A 3CJTA 2C04A 1WKCA 1UWVA 1U0GA 2J85A 4UJ3A 3SKVA 1E60A 1IM8A 1AF7A 3H8WA 3HACA 4LISA 4C5BA 1YZVA 1WUTA 4EVQA 1Z4KA 4Y0NA 5EXDA 3EXHA 1S8FA 2AV6A 1RXEA 3ZVRA 1IHPA 5E4TA 3H2SA 1AXEA 1E5DA 1L7EA 1JYFA 1RPZA 3BWBA 2B8TA 3EQ9A 5HM6A 4TTJA 4IFTA 5DV9A 1ODTC 3EVDA 1T0JB 421PA 4BIMA 3G88A 3A26A 2I34A 2QW1A 3G5AA 4E09A 3AL0C 5FQOA 4RIEA 2UXDB 1NBWB 5E2IA 1PX2A 2VKQA 2QMOA 1TT5A 2P6NA 1SEPA 1IM2A 1RE0A 1YA8A 4INOA 2VP4A 1XRLA 4R69A 1OHHD 3ZU3A 1U90A 5LXTA 2XUAA 3DFKA 1R6UA 2X8BA 1OA1A 5JFOA 1Z7YA 1F8XA 3NIDB 1DARA 6REQA 5ECWA 2OV8A 3I1JA 1E1KA 4KLNA 2VTBA 1HLFA 4LNUA 1UH5A 2OAP1 1ISMA 2RKBA 2ZRNA 3B7GA 3AM5A 2H1HA 4N0QA 4NBUA 4PONA 3ENZA 4FU0A 5IBQA 4E7PA 5I5GA 4HWOA 2GKSA 3ZVLA 1E1CA 1WZ2A 3HKCB 3A2NA 2JFZA 2CK3A 2X1VA 1VKRA 2OAQ1 3KBBA 1PVVA 3KJIA 3MHPA 1PQ4A 4HHEA 1NDQA 1FS6A 2P9FA 1Q83A 2B61A 4MWSA 4YI5A 4M8KA 3L0SA 2Q41A 4L07A 1EDEA 1VL8A 3JTEA 3E4CA 3AJ9A 3DMYA 4D79A 4ZOEA 4JFRA 4X3OA 1PL0A 2O2GA 2XOEA 3HPQA 1CT9A 1M9NA 2IXFA 3BCUA 4QYXA 2LCIA 1YZ3A 1DQYA 2JI7A 4CKCA 4EY7A 2O7SA 3F49S 5TF4A 4U2EA 3ZS8A 2GSWA 2WJYA 1WW8A 3NBKA 3SC2B 4K87A 3H5TA 4YJKA 1JAHA 3T4XA 1YASA 2EL9A 5D5QA 1SKYE 4ZAGA 4DHEA 4YMUA 1RAGA 3O8OB 1W73A 3QWFA 1U9IA 4IOLA 5D3ZA 2NUAB 3FPAA 1PZGA 2DHCA 1XD9A 2G67A 1W1IA 4M53A 4DNFA 1KPHA 1ZNWA 4HQKA 3T5PA 3BXFA 2IITA 2HBRA 1AOXA 3S2FA 2PT6A 3SF0A 3HB0A 2CEAA 3EPJA 1P9LA 1CBUA 3SAJA 5JXWA 5MN5A 4REQB 2VNAA 4PAOA 4I9NA 5CW2A 2C99A 1CG6A 2C07A 4A8HA 1JZQA 1R8JA 3E4DA 4HMQA 4WFQA 2NW6A 2ORED 3NVMB 4Q7EA 4KNYA 2FOXA 5C80A 5BORA 1Z8DA 2PZJA 2GN8A 3B89A 3AEQB 1O4WA 3AVQA 3EGDB 2W4IA 3FCOA 3LGAA 3LT2A 3NASA 1UMDA 2WR8A 4JMLA 4JOSA 4MKFA 2OO5A 4B48A 4CG3A 4FLFA 1T9GS 4FINA 5D3QA 2EERA 3H5IA 3G0CA 1Z5OA 1RI5A 4NCKA 3X1KA 3CG4A 2REQA 4H3HB 4UHCA 5CLLA 4A2WA 3ZDZB 2OHVA 4RPCA 1QWOA 5JMTA 2FEPA 1JPUA 3TRKA 1Z16A 3DP7A 5J43A 1C4XA 2AG6A 3RIMA 4KH0A 3WHIA 3LRPA 5KOJA 4Y7CA 3L40A 3BMOB 3V8MA 2IIPA 2PAFA 2VRCD 2QPLA 2PV0A 1BU5A 2NADA 1G66A 3QWHA 3G7SA 5CJPA 1ZS9A 2I2BA 2YUTA 4Y2SA 2IKQA 1W0KD 3LA8A 4I0WB 3BTSA 1MNAA 3VZDA 1AE1A 5AW8A 2WZDA 1T2EA 4GI3A 1V7ZA 4D3ZA 1SY7A 5AW1A 1YVUA 1O96B 4N82A 1DO8A 1T26A 2GYWA 4DGSA 4OHYA 5C4MA 3BZUA 3N2GB 1WV1A 4FSXA 5KYYB 3NM4A 4WLVA 2WPDD 4NG4A 1EP1B 5ENZA 2IU4A 1EVKA 2H48A 4JJKA 4WW0A 4KFUA 1Z15A 4OXXA 3UB2A 2B1RA 1BH6A 1RXUA 4MQEA 1P0FA 1VLMA 4H27A 2H4XA 1KYYA 3NC0C 2Z43A 5GONA 5HIIA 2Z04A 4FS8A 2RAPA 1E0DA 2FA9A 3JWEA 2CNDA 4NCNA 2XBLA 2TMKA 3U16A 4EY8A 1Y48E 4UARA 4JVLA 1ZM2A 2A0WA 3ZDDA 4N49A 2QMZA 3W3AA 4NL4H 2YQ4A 1RRCA 1N3BA 4LJAA 3CHYA 4HN2A 1GFZA 1GQ2A 2H06A 4FN5A 4LGCA 4ZA2A 3VHXA 1LH0A 3W5SA 2Q29A 3TZBA 4HWSA 1NM5C 13PKA 2HPVA 1LSUA 3HV0A 5DYYA 1DS6A 1G20A 3HBMA 4PPNA 2D00A 1J2TA 2EZ8A 5FPYA 4MR8A 3SR0A 5KVAA 1UOQA 1KGSA 4HLQB 5JQGB 2ZJ2A 3NAQA 3CR8A 2O07A 3EN0A 4B4KA 3EMBA 3PGA1 4B43A 4A6EA 3RM3A 2GJSA 4RO0A 1JEQA 3CONA 2JRCA 3WSWA 2E49A 3OZ7A 1XVTA 4BKRA 8MHTA 1LZKA 1NHGA 2W11A 5T7BA 3HXQA 3ENWA 2NT4A 1B43A 1M8FA 1YQ9A 2YWBA 4HI0E 4S0ZA 2H4JA 1DKOA 4BFVA 2A33A 4UXJA 2IEGA 3OTOB 1N7GA 3HA3A 3IIJA 2IQ5A 3MCUA 1FRZA 4R8RA 1PNVA 2LDXA 3KZ1E 2I7DA 1BX0A 3ELUA 4IHJA 4KYUA 5GV8A 1RPJA 3SMQA 3VX4A 4BC0A 1S2DA 4LZWA 1W46A 4B2YA 4YDHB 2Q5HA 1G20E 3GJ7A 4MUXA 1DLJA 4KQ2A 8OHMA 2ODWA 4J75A 4MUJA 5FOUA 2XMRA 4CIBA 3X1JA 3G2PA 2G77B 4JUBA 2IHJA 2ZT7A 3O74A 3QJGA 1BTOA 5FWAA 4PHTA 3WY9A 5L3QA 4ZAZA 5JS8A 4OV6B 3IOYA 2E4ZA 1NMYA 3C3EA 2GKGA 4RVOA 1S4QA 3PJGA 1BMQA 3BMNB 2XUIA 3GPBA 1IY2A 1N75A 3RTBA 3R3JA 4A8JC 1G9SA 2Z6UA 3SSOA 1CCWA 5IMBA 2HMSA 3LFTA 3PJDA 4C0AC 4DCJA 2G72A 5ALKA 1ULUA 1JIXA 4Z4IA 3WIDA 1E2BA 1H5UA 3TCNA 3FCUB 1UEJA 5JDIC 3L7NA 4OSPA 1TADA 1XQ1A 2PFKA 5L6MB 4KXNA 1LTQA 1MC1A 3CLUC 3DAYA 1RHMA 1HQDA 2ID8A 4R54A 4JIMA 4C1NA 1E3WA 3WADA 2XTJA 3JAKA 1HK7A 3G1UA 4LOKA 3AKCA 5BN3A 1MIHA 2V59A 3KJGA 4UNIA 1OOEA 1CEYA 4KQJA 2FW8A 4MHTA 5I7FA 1SOMA 5JT1A 2EG9A 4CQNA 5E6SA 4DPKA 2ENWA 3R6TA 3EQ6A 4UREA 1Q7EA 1VPLA 3GUVA 3SVLA 4EPRA 3UMYA 3HRHA 4C7OA 1ES9A 2XLBA 4H7PA 3PYMA 4AM8A 3HI6A 5BYJA 1HRDA 3K2BA 3UEOA 4EK9A 1GQYA 5KO2A 1B00A 4DDKA 1SPXA 3V3KA 1AKNA 3BFXA 3W2IA 2OESA 3UOWA 1XNQB 1KFEB 3GLTA 1LC3A 1KRHA 2PS0A 3MVEA 4HC4A 3ROPA 4AJ2A 1G5PA 1KEPA 3FNFA 3Q15C 2WIBA 4O4IF 1DUSA 2YV1A 1CJBA 5FO1A 2BFEB 4FI3C 3ZHOA 5JS6A 3W8EA 1E0SA 5B7GA 3K2QA 2R7LA 3OQIA 2ZB3A 1TKCA 1E5LA 3GGCA 1C4WA 1WD7A 3N28A 3EGWA 4RGYA 4YMGA 3X2SA 3FPJA 2WQZA 3HP1A 4IJKA 2KBEA 4RFVA 2E5FA 2VOEA 3NBMA 4N7BA 4B47A 2PXXA 2E0IA 1IXYA 1PD0A 3ILSA 4BWYA 4JI8B 2AN1A 1EI9A 3ZD6A 1D6MA 4IM7A 4TTSA 4J0IA 1XNRB 2Y0PA 2ZJ7A 3W2GA 5ECYA 5IASA 1JKJA 1ZD3A 2WK1A 3I2KA 4G67A 4NMWA 1DCFA 3EZ7A 1ABFA 3N75A 1OFTA 2PGXA 4EMTA 4ZQBA 2OTCA 3LCUA 4PAQA 2WVJA 4PC3A 3JWIA 1WMFA 1NVTA 3I9MA 2CKMA 2D2EA 3KR1A 4RK6A 1QVZA 5TQ0B 1OFGA 4C88A 2YMPA 2FOIA 3K0CC 4OGFA 3AW9A 2FAXA 2NIPA 3C5EA 1QE3A 4BX0A 3ZDXB 4G56A 1WDMA 5H83A 5LB2A 5T3YA 2AOVA 4FFLA 4NULA 4PXAA 4YA6A 4D4IA 1YVRA 1XNGA 5ALPA 3ONNA 3CINA 5HF9A 5IP5A 3E7XA 2HWYA 4KO1S 3UGKA 2M9MA 3E81A 3MELA 4A91A 5TSDA 5EZSA 1ZJYA 3KXDA 4YCLA 1XZIA 4ZCLA 3RVNA 5BYAA 2A0XA 4WLFA 3R6WA 4X64B 2FQXA 3A6DA 3E9EA 3FFBA