2CNOA

Crystal structures of caspase-3 in complex with aza-peptide epoxide inhibitors.
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
146
structure length
146
Chain Sequence
SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords CASPASE-3 P17 SUBUNIT
publication title Exploring the S4 and S1 Prime Subsite Specificities in Caspase-3 with Aza-Peptide Epoxide Inhibitors
pubmed doi rcsb
source organism Homo sapiens
total genus 53
structure length 146
sequence length 146
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2006-05-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2cnoA00
1RWPA 3RJMA 3UOAB 1RWOA 3BIJA 1IBCA 4JJ8A 5IABA 1RWNA 3V4OA 2QL7A 3PD1A 3R5KA 2J30A 2CNKA 2C2MA 2K7ZA 4EHKA 5H0IA 5IBCA 2XYHA 3S8EA 3PCXA 1NW9B 2AR9A 3V4LA 2H51A 2C2ZA 2QLBA 3DEJA 4IYRA 2CJXA 2CJYA 4QTXA 3R7NA 1RWMA 3SIRA 4EHNA 4QUJA 5IC4A 1CP3A 4QUDA 5I9BA 3H1PA 3NKFA 4NOKA 1F9EA 3R7BA 5LUAA 1SC1A 3D6HA 1QDUA 2DKOA 4JJEA 4ZVOA 4DCOA 4JR2A 1RHJA 4EHHA 3IBCA 1RWKA 2J32A 1QX3A 2J31A 2C2OA 1RE1A 2CNOA 2H5IA 4EHLA 2NN3C 3ITNA 3V3KA 2FUNB 4JB8A 2HBZA 3KJNA 4FGUA 3R7SA 3DEKA 1RWWA 1RWVA 4JQYA 5JFTA 5I9TA 4NBLA 2C2KA 4EHFA 4IEFB 4JR1A 4ZVUA 4FDLA 4HQ0A 5LU8A 1PAUA 3H0EA 1BMQA 3D6FA 3GJRA 1SHJA 2H5JA 3KJFA 4QU8A 2XYGA 4QULA 4QUBA 4ZVPA 4I1PA 2H4YA 4QTYA 3K7EA 2WDPA 4I1RA 1K86A 1RHMA 4N5DA 3EDQA 1F1JA 1RHQA 1CVRA 2CNNA 3R5JA 4JR0A 4QU0A 3GJTA 4D3XA 1RHUA 3IBFA 4JQZA 4AW9A 4JJ7A 1QTNA 2QL9A 3SIPA 2HBRA 3DEHA 1NMEA 5IAGA 1K88A 4N6OA 4NOMA 2H48A 3H11B 5IBRA 3P45A 5IAKA 3S70A 3V55A 4FXOA 4PS0A 1NMSA 4D3ZA 5IASA 3KJQA 1SC4A 4QUAA 4LSZA 1SHLA 4PRZA 1ICEA 3E4CA 4ZVSA 4HVAA 2H4WA 3QNWA 4EHAA 5K20A 3V6MA 3EDRA 1M72A 4HQRA 2Y0BA 2QLFA 1GFWA 1NMQA 2C1EA 4QU5A 4N6GA 4ZVQA 2XZDA 2H65A 4QUEA 5IAEA 2HBQA 1RWXA 2XYPA 1JXQA 3GJSA 2P2CA 2QLJA 1I4EB 4N7MA 2FP3A 3NS7A 1I3OA 3PD0A 3DEIA 5IAJA 3V6LA 3GJQA 4N7JA 2CDRA 1RHRA 2Y1LA 3P4UA 4QUHA 3R6LA 4NBKA 2QL5A 4PRYA 3UO8B 4D3YA 5IBPA 4QU9A 5IANA 4PS1A 5IC6A 4M9RA 1GQFA 5IARA 4AWAA 4QUGA 4AWBA 2CNLA 1I4OA 3D6MA 4EJFA 1SC3A 3R6GA 5LUBA 4N6NA 4ZVTA 2FQQA 4NOLA 2H54A 4ZVRA 4DCPA 2J33A 3NR2A 1RHKA 4NOJA 3OD5A 4NBNA 3H13A 4DCJA 4QUIA 2HBYA 4EHDA 5LU9A 1I51A 4FEAA 2XZTA 3H11A 1KMCA 1PYOA
chains in the Genus database with same CATH superfamily
1SIWA 3F5MA 4MVYA 3U9SA 4FGWA 3PD1A 1P4HA 2PG3A 2GEVA 1H65A 2P62A 3BKWA 4IZ6A 2RH5A 3A25A 2Z6VA 1QBGA 4OH7A 3OUTA 1ZA1A 4JXKA 4OGWA 1YQ9A 1L6RA 2A88A 4PVCA 5JLAA 3TMKA 4DZZA 4RXUA 4EX7A 3A1CA 2X19A 1WMAA 3GIWA 4CRWB 4EI8A 1CEEA 3PICA 5DCLA 3WXBA 1DJMA 4UZSA 1EFRD 5IC4A 2QD2A 2RHRA 1PR4A 4YBRA 4IX1A 1SQFA 5I9BA 3TLKA 3VTZA 3DPIA 1WMSA 4Q7LA 1OX5A 1WB4A 2ZVQX 4UARA 3SC3A 1E9AA 2O7RA 3K96A 4HFJA 3R3VA 1DC8A 1KC3A 3KUKA 4XLLA 5CHYA 3RKUA 1KZ7B 1KJ8A 3CLRD 5B6PA 2IYQA 1BMTA 1QHGA 1UR5A 3S1SA 4I3HA 4ENRA 5KKNB 4Y1RA 5FLYA 1MC4A 2FMKA 2BEWB 2X5OA 3LA6A 2CNOA 3ZU2A 5AVSA 5HQJA 4GI7A 4BS9A 4Z49A 3QQ5A 5TT1A 4TRMA 4I3FA 3I4LA 2ABWA 4NEGA 2O2ZA 5TMEA 1NVEA 4IIGA 3UN1A 2CJFA 1R9JA 1UKEA 2A9VA 5FXMA 3LQ1A 1NXOA 1VLMA 3IBGA 5H83A 4EUNA 3RAGA 4ARBA 2EGGA 2JNWA 1M2OA 2NZVG 2H1LA 1OXKB 2BFCA 2FW1A 3ICCA 4XPIA 4ND7A 3U3KA 1Y1TA 2ORED 1SIOA 3L02A 3IR5A 3Q10A 4DWWA 1H8EA 1KJWA 1WXIA 1WABA 4HGQA 3NM6B 1K68A 5HG0A 5K8JB 2JCVA 4C87A 4FUQA 3OI7A 1I30A 3ICEA 3MTBA 1C7EA 3ZCRA 3DOIA 2CXTA 2RKWA 2C3PA 1SOMA 1FMTA 1LLQA 3N0TA 2PZ8A 3GZ4A 1U0EA 4M1MA 5AK5A 3ZDEA 1YE5A 1S02A 1ULBA 4GICA 1KYTA 3VYRB 1IN8A 3MBOA 4L1KA 3P0FA 2I1QA 1NVMB 3OPYA 3QVWA 2JAUA 3F8SA 4PS0A 4QPNA 3FLEA 5I4CA 1X1RA 4QQRA 5HFJA 1VOTA 1EWRA 1NF3A 2HLDD 3IOBA 1EVQA 1EG7A 3DP7A 2VKTA 4FC6A 1U8FO 2YY7A 1N6OA 5CNMA 3ZCUA 4YV7A 1A82A 3OX3A 1NLUA 1YBVA 1GFIA 5CVUA 4E5NA 4RK4A 3P9ZA 3U81A 2IUYA 4UVDA 3PS9A 1C3OA 1AQUA 1WTAA 5CJJA 1DC4A 3BE8A 5HFNA 5ILOA 2OHIA 1VHWA 2VQDA 5EKUA 2XLBA 2VHJA 3EYAA 1D6JA 1QYIA 4P7BA 4X94A 4B1FA 3I92A 5KTTA 1I3OA 1P4RA 3P0EA 1QUFA 5TQVA 1Z4LA 2JIDA 3IUJA 1HE1C 4LWOA 2G9ZA 3KV3O 3OZCA 4S1PA 4TTIA 1S2IA 2D2XA 4QICA 4AU1A 5CB6A 5HF8A 1QFMA 1U2TA 4LUCA 4JLNA 4CMIB 4OJQA 2CB0A 3O7MA 2I3GA 5F3DA 3O3OB 1ZD4A 4F3RA 4MDFA 3W78A 3HFSA 4FQ7A 2HA3A 2OZVA 1PYGA 4LNUB 4PIMA 4FFVA 5L7TA 3H5TA 1SBCA 1YE8A 4MIOA 2XJ4A 3H8WA 2QX9A 5BV1A 5D1HA 4NCIA 5DYIA 2ZJ6A 5HYVA 4PZZA 3DAFA 1FMFA 3JQDA 2J9FB 4JBNA 3Q7TA 3C6MA 3CX8A 3OCZA 3WX0A 1LXCA 5IUKC 2KX7A 1IG0A 3R2JA 1QPZA 3N2YA 2VJYA 3VMMA 1IXKA 4XB1A 5DGTA 3TSOA 1YS4A 2CYCA 3LUDA 4GUDA 3GLGE 2FJPA 4EM6A 3EHEA 2JGKA 1A2OA 3A3YA 4BX3A 3WMRA 3I61A 2PMEA 3PXXA 4IIXA 4IYJA 3SF0A 1SULA 4YRBA 2BFBB 2HLNA 1U7XA 2A1TR 2NXCA 3G17A 1ZJZA 4PX5A 3L7BA 1U99A 1G0OA 1XHFA 1P7WA 3AEUB 3EXHB 3N7AA 4R2LA 5EZ6B 2EAUA 4GSKA 3LKVA 4IIJA 3IMCA 5AKIA 4ZCQA 5HKKD 4P5EA 3KKLA 3GGPA 1S3FA 3ZHUA 3E53A 3FUTA 4HNAA 1RYYA 4OQXA 1EM8B 2XQKA 5TPZD 3COJA 1SC1A 4IHAA 1XKXA 4F0JA 2PX8A 3JATB 3NP7A 3MWDA 2FQXA 4ZI3A 4C0SA 5ALMA 1LC0A 4TYMA 4D97A 2AA3A 4UUAA 5KOIA 2DGDA 4RJJA 1P31A 4WHMA 3PNKA 2QN2A 4WOBA 4CI0B 1FP4A 2QT9A 1AURA 2ZIWB 2ZQYA 3NQ41 3WLSA 3OA0A 4J0KA 2D1TA 4K6FA 4NIMA 5DBOA 4P7FA 4CIYA 2I7VA 4HGRA 1MX5A 2JFPA 5GZ1A 2OAEA 2C98A 2Q49A 4RCYA 3FBWA 2IEZA 1YR3A 4F9GA 1UMKA 2PQ6A 4GP6A 1DEHA 3DOUA 1JEEA 2OCBA 4HLDA 1SBQA 2TYSB 4ZAZA 5CA1A 1JJBA 5IMBA 4OP2A 1CB7A 2J9ZB 3OH8A 1S0UA 1NVVR 3BGWA 5BQXA 1ZM7A 2WJYA 3TMYA 1SXJC 3HYNA 3K7EA 2ZUEA 5A0TA 2PX4A 2JFBA 3RYHA 3TTYA 2X76A 5ER6A 2J67A 3OT1B 2XVYA 4RFSA 3DZ8A 2GPBA 1YONA 4GC5A 1O7JA 1Z0IA 2YC4C 2FR8A 3E4DA 2C97A 3M1LA 3ZTTA 4C89A 3STXA 5CFZA 8LDHA 1MX3A 1KQFA 3VH2A 1UBTS 5D51S 4FHDA 2ZRIA 1Q7EA 1Q20A 5AQ1A 3MTGA 2D2EA 1GUZA 4CKWA 2CLMB 1ZU5A 3ZW7A 4KEAA 2JLZA 4IIBA 3SQWA 3DZIA 4DCVA 1MT0A 1HK7A 4ND4A 1ZCAA 3U1VA 1XZFA 3HO8A 5GM2A 2DWCA 4EHAA 4O2LA 2NU6A 5TDHA 4PU0A 3L6DA 1CS0B 2Y1GA 1T3GA 2OAP1 3OBBA 3T54A 1NUUA 4IGEA 3ZU6A 1G17A 2CCGA 1NQOA 3AZQA 4QLBA 1J22A 3RTDA 4UAUA 1J39A 4NK5A 1R37A 1NNEA 5KX5A 2DCUA 2E4VA 3A1FA 4G85A 3WGYA 3QBVA 2HJ9A 1SXIA 2I6SA 1TCVA 1IEVA 4CDGA 3Q4GA 4PXSA 4MMYB 3T9BA 3DCYA 3KEQA 4LYYA 3WK7A 5A4KA 1AQJA 1B43A 4BLWA 4PNHA 3MAAC 3S2ZA 1O5TA 2I2CA 4GRIA 2CNBA 3NHAA 5CURA 3U3OA 3ZVMA 2HDHA 5GJWC 1R5JA 4AM8A 2L17A 2W6ID 1X80B 3C5HA 4LCEA 4A5OA 4JVOA 4KN8A 1PWHA 3CV3A 4FMCB 3HCWA 1FW6A 3QLTA 2Z2JA 1KRXA 2ANBA 3WBFA 1G66A 1OXSC 2QYOA 2PGIA 2WPNA 3DQQA 4CF7A 1DGQA 4KVZA 1QOQB 1EUDB 1ICIA 2VSNA 3VC1A 3RT9A 3H11A 4OHFA 5DTJA 1JSXA 3AR2A 3JYOA 3LVQE 1JDVA 1I3NA 2FLVA 1HT0A 2V97A 1GGHA 3DZDA 4CN8A 1G5FA 2ONZA 2IYXA 2P5TB 3E7DA 1Y81A 4MS1B 1VLJA 1P44A 3RAJA 4Z1MD 4L22A 1QB7A 3G79A 4LEIA 4O6VA 3BTVA 1I3KA 4IMIB 4RD3A 3ANMA 2XGJA 4MV7A 1EDOA 1G9TA 4ARSA 1QG2A 3OZFA 4EL5A 2PL9A 2PL5A 1M83A 1Z6TA 1CR4A 1C7ZA 4FDVA 1CZNA 4U2DA 4Z7JA 3CSDA 3QOWA 1YZKA 2OP1A 2QRPA 2CHEA 3T0GA 2A7QA 4HAVA 5IEBA 4FFLA 3GP5A 5HF6A 2XOXA 3TKAA 4RLQA 1SZJG 4ZYZA 1FJHA 1FLAA 1JHZA 4FX2A 3CUWA 3LYHA 5AW3A 3EBOA 2ZSJA 1H2YA 1YZLA 2DZDA 4EKNB 2BH2A 4TTRA 4KUHA 4R9UC 3L4BA 2MR6A 3H3FA 1BCSB 1SVNA 1CY0A 4B3CA 3LZDA 3U31A 1R74A 3OC0A 4KJXA 1BEEA 3FOBA 3WOVA 1UWLA 4PR0A 2XNDD 5TR9A 3WK9A 4XQ9A 4F5DA 3F7OA 3AOEA 5IJWA 4Q39A 3PPYA 1TJ4A 1X1DA 3C2QA 1R8JA 2P3SA 1JR6A 1G98A 2O8FA 4JJ6A 2QMUA 5LL6P 3VTFA 2LIVA 1XNHA 2GVNA 2HIMA 1II8B 2J3MA 2ODTX 4OQDA 1CXZA 3P2IA 4QLOA 3CKLA 2VPIA 3HCPA 4WY2A 4RMNA 2H2DA 4DQKA 5LXTB 1A9OA 1TEZA 5I01A 721PA 3L77A 1B93A 5BN1A 4KQHA 1QJ4A 1SA0B 1HA3A 3CO5A 3VKUA 2RGXA 4E51A 5LLTA 1XK6A 5FEUA 1WE2A 5ICGA 1ZUWA 2I0FA 1V6CA 1XF9A 2AOUB 2I2FA 5CHEA 4BNHA 1B6TA 4B4OA 1F0PA 4YCSA 4WOJA 4A2QA 4C3OB 2AQHA 1P3Y1 3DC2A 1ONSA 3C7TA 3LP8A 4QUAA 3I9V6 2BFDB 4QQ8A 5CJ2A 1T2DA 5HF9A 4B3RB 5AHWA 4MYHA 1AKVA 4MNTA 5CMLA 3ZV5A 5A1JA 4YMLA 1EIWA 3TNFA 1XU7A 2HWUA 2BLNA 2FK7A 4BIIA 1YZGA 2C5FA 3IL2A 3WRXA 5JJKA 1MG0A 2YJZA 1XNRB 1DNPA 1NI4A 2JLQA 2FPMA 3N2ZB 5KWVA 1O89A 1QOZA 3OFJA 2ANCA 3E9YA 5A4AA 4LSGA 1K7CA 3QU2A 3VZPA 1KJ9A 2ZEJA 2XOEA 3D2BA 3JPWA 3AR4A 4IIUA 4KTVE 2ETXA 4J7CA 2J09A 4QSHA 1N5RA 5KAMA 1DKMA 4BAUA 2FG6C 3EMDA 3KQYA 3UO8B 2XSZA 3DFMA 1CJVC 4OVKA 3ETGA 3DOEA 2XKJE 5EG5A 1P9OA 2ECFA 3IIMA 4DSTA 4DMRA 3OU2A 2XA2A 5FI1B 4GYKA 4N0QA 4PIPA 1PJCA 2DECA 3QMWA 3WFZA 2ZLBA 2IHZA 1P5HA 4RXTA 2CLHB 1USUA 3QPAA 3JVEA 5IT9A 2RHDA 1CLUA 3E9ZA 5LD2C 1BMFA 4F2WA 3DL0A 5LQKA 3R3SA 3TXYA 6LDHA 3KT6A 1NR1A 5KQRA 3GU3A 1BX3A 1NBAA 5IXSA 1RYEA 4MGZR 2B8EA 3C8ZA 4ZQHA 4CYMA 2MSLA 3DDHA 4OHOA 1YZTA 3AETA 2V7BA 4BFTA 2I6XA 4O2AA 1V4VA 3ZBPA 1V96A 3P26A 4WY8A 4D3SA 4RF2A 3BJMA 9LDBA 1MJ5A 4WSOA 3I30X 3AUTA 3DS8A 2I99A 1VL2A 2L18A 4JP1A 1W5SA 1SHKA 2YZGA 3H1FA 1QLHA 5GJVC 2WYOA 2E5FA 1SOUA 3AF5A 1ZNYA 1Y3DE 1T36A 1K27A 4NECA 3UJHA 3R76A 4NICA 3UK0A 4NOKA 1F9EA 4QOFA 1SXPA 4U0KA 5LQAA 3HM2A 2Y1FA 2DKOA 4K5QA 4G5QA 1GTMA 3K6KA 3KO8A 3H0CA 3IKJA 2GA8A 3L04A 4J2TA 4YP0A 3RAPR 1PJSA 2NU7B 1ZD2P 4L2IB 4M76B 5C37A 1LU9A 2C2OA 4IXTA 2EG5A 3CCBA 4UFNA 3W8NA 1KEEA 1EM6A 2VJDA 3B7PA 1UBRS 1J1ZA 2EQAA 3OE5A 5AXBA 2OYCA 1QCYA 1JJIA 2IS6A 2WAYA 3S8YA 1MO6A 3EC2A 4ITRC 3SYNA 3DEKA 2QYTA 3M81A 2AOTA 3QUBA 5AI9A 1SVIA 1AUOA 1DQSA 1I2BA 1E8NA 3F97A 3KQTA 3L18A 3PRYA 4F04A 6Q21A 4IBOA 2OCKA 4YAUA 1EJ2A 3VTAA 1S1CA 3R5XA 1IJKA 1HX7A 2G80A 1UWCA 1GNSA 1WV0A 2J9GA 4HPXB 5BRJA 2QVCA 4XX0A 3PFFA 2K2QB 1F2TA 4DSOA 5K0TA 3RC8A 3RDPA 5SZHB 3ZR4B 5C7YA 3JQBA 1ZJYA 3AF1A 1EVKA 2R66A 1BGWA 2AN3A 2H18A 3C1OA 3TBFA 4BNUA 1I5OA 1X7ZA 1X77A 5K4AA 1Y4DE 1EEXB 2WJWA 4NOMA 5KHAA 1D5WA 2IIPA 4GNRA 3SHOA 1VJTA 1BGXT 2XMZA 5AM4A 5F1OA 4BFWA 4IGIA 4FK8A 4JJ4A 4AICA 1KZ4A 1TF7A 1ST3A 3P94A 4Z4CA 1U2DA 1SBNE 2A0WA 4MLZA 2RKOA 2VTDA 2EGHA 4GX5A 3MB5A 4YT8A 2QUJA 3ZLTA 2ZAOA 5DVZA 1TEVA 2CXUA 2AE2A 1FF9A 3HA2A 3E2IA 5GONF 1YC2A 1WZUA 2ZWIA 2PD4A 4IJVA 5AI4A 5FTKA 3H75A 1UOPA 4JC8A 4R9VA 2AEMA 1Z33A 1MV5A 2X7HA 3FTDA 4URXR 4KN5A 1D7AA 1MD9A 5J9FA 1N2CA 1G8HA 2ZYAA 5FPSA 1V43A 1D2NA 1C1DB 2RG1A 3VU9A 1GKKA 1E61A 4FJ2A 3KQMA 1QPBA 1BO6A 3ITKA 5FOUA 3F47A 5CB8A 5LKRA 2EL9A 3HKEB 3A0RB 5ARCA 3LDAA 5BV8A 2H0AA 2DCMA 4RULA 4N39A 1RPZA 3A1SA 3AP2A 4FFBA 3O38A 4QPCA 3STUA 1OH8A 3PTLA 1VZ3A 4D57A 3REQB 3UW3A 3WWPA 3HUEA 2R7LA 3OTWA 4AWXA 1RZ3A 2LPMA 2YWCA 4FOLA 2XRZA 1HFJA 3OD5A 1P45A 2Z5FA 4NZ9A 4PNZA 2ZIXB 3EGXB 1TZMA 2FDXA 3OKPA 4JJIA 3O2NA 2VDWB 3LFUA 1FZQA 2YMQA 3HYSA 3RU3A 2AMVA 2AC7A 2FSVA 1YCFA 1UEIA 3B52X 4URFA 3KOOA 5MGNA 2OHFA 3GH1A 1FW8A 1KE1A 1XD2A 5CBPA 2JVKA 2WWRA 3NTVA 3I0NA 3QPCA 2DH5A 2NUPA 4YAFA 3N6VA 4LYEA 1AO3A 1EFTA 5FAKA 1CJMA 3LHIA 5B55A 2ZBUA 3Q6NA 1B0AA 4IDOA 4YCAA 5JCZA 3M4NA 2SBTA 4Q6WA 4BBZA 1M10A 3HWX1 2UYQA 3SKVA 1SRQA 2XQIA 1Y80A 2PGAA 2JFHA 1OJLA 3Q3IA 3ZDYB 4FHFA 4YAKA 3OCCA 2PU5A 3AJRA 3W34A 5L53A 4MHTA 4II2A 4JBHA 3R44A 1TM2A 1Z39A 3BDVA 3T95A 4BZPA 1O2DA 1IIBA 4Z4EA 3N05A 2DFTA 3IHWA 4LDPA 4L9RA 3MT9A 1DELA 2IYYA 4NYIR 1ZLXA 1P2BA 3AIMA 2NVWA 1OIWA 1WR8A 2ONYA 4QJIA 4QO7A 2C7PA 4E5UA 3OKFA 4HN2A 3T9CA 4AG5A 3RU7A 3UQYS 2F48A 4KFUA 4TMZA 1JSLA 4P93A 2OZEA 1YFJA 3AVXA 1UM9A 4QXMA 2P9JA 3H05A 3EIUA 1U98A 2HIGA 4B80A 2H4ZA 1OLXB 2HA0A 3WIBA 2B6HA 5CIYA 1HDXA 1OZFA 3TZQA 5AUPB 2IP4A 4KL8S 2NMVA 1GNPA 2XIJA 1AB6A 1RXCA 1K63A 1RDFA 2DWPA 2BRUC 3OPNA 5IF3A 2W37A 3R6DA 5TC4A 3U39A 4MR7B 5IJXA 4ER0A 1SUFA 5FWAA 4BC0A 1YVPA 4F6LA 3A4YA 4TMFA 2W4IA 1ZU4A 4TQAA 3AM3A 4LA4A 1UPAA 5K2OA 2Q5LA 2YJ3A 1WETA 3PPWA 1N32B 1TYCA 3VKVA 4AQDA 2O0MA 2FE4A 3EODA 1FX0B 2W2XA 4TLLB 5ALFA 3QNWA 2XKBA 5EZQA 2CKDA 4NC9A 4BMYA 2YKGA 4HQRA 3HB4X 2D06A 3T3OA 5KSWB 3U37A 3JZAA 2FH5B 1EWYA 3VSAA 1CIVA 1RTTA 4WZBA 3U61B 1IMOA 3QPDA 5CYPA 4CKEA 1GL6A 4UBLA 3LGSA 1L7PA 1RCTE 2P9CA 2VXYA 2ZPTX 4ARZB 5A62A 1WSWA 2VHVA 3AR8A 2GYYA 2GAJA 2GAAA 3CRVA 3QPUA 3R6WA 4DFDA 3G8DA 3LX6A 1CZOA 3FZEA 4LMPA 2C54A 5CITA 3OY7A 5FFMA 4J0JA 2PIDA 4XUGB 2QB5A 5EINA 3U48A 2O8BB 3L0ZA 1SBZA 1NVFA 2N75A 4N8DA 2ESRA 3TSYA 4QJ3A 3JZDA 2QV0A 4YAOA 3GLFE 2WYWA 4AWBA 2ECQA 3B5IA 4J0HA 2YHAA 4WASA 5BWNA 3KSBC 2F8SA 2J3LA 1J8DA 4HO1X 4P8RA 5G02A 5TPZA 4X65B 1GZUA 4KPUA 1Y3HA 2OBNA 2HN9A 3KZXA 4H7IA 3QBJA 4JCOA 5DCUA 5GM1A 2QTFA 4A16A 3LE8A 4K03A 1K89A 3KR2A 2PTGA 4GP7A 4PF1A 4NLLA 2SHKA 4XA8A 4BQSA 1B7GO 5CGQB 4I55F 1PNOA 3B60A 1I51A 4PQRA 4CL8A 1PYOA 4XZ3A 4KR9A 4H7KA 1OY1A 5BYKA 5L9AA 5K09A 1DC3A 1AOXA 1W6UA 1DMSA 5J5AA 4F7DA 4UBJA 5EZYB 3PC3A 4KK4A 4NBUA 1YO6A 3E0QA 3WGGA 3ZDRA 3WNZA 1O97D 4M8SA 5CB0A 1ZK1A 3K05A 1U4SA 3SIRA 4YMTA 4EHNA 3PNPA 1QE0A 3TQHA 2QLTA 3THXB 3IV6A 1XZLA 1D1TA 1UZUA 5WRFA 3DAPA 2HX1A 3WHIA 3WLOA 4D5EA 5JTUA 4V0ME 3T41A 2OK8A 3GFSA 3G2IA 4TLMB 3S2FA 2EZ9A 3VR6H 2VNHA 2WC1A 1I33A 2PU7A 3EWNA 3ACDA 4OXXA 2QRJA 4M0KA 4G8DA 3FNFA 5HRAA 3FCXA 3MPUA 3HWWA 4JL5A 1LPAB 1CNEA 2BGTA 2BHLA 2DH6A 1Z5ZA 5LNK6 2A9FA 3CRQA 2PBLA 3WDMA 1F6DA 1LPMA 2PJZA 3OE7D 1UOOA 3U13A 4EI2A 3SYTA 3STTA 1PJLA 5FOXA 1XQ1A 1KY5A 4ZJPA 3U7QB 1VHDA 4E5VA 3OSUA 1ZNQO 3UUWA 2H59A 1R6AA 2P6UA 4K9PA 5A2QA 4ES6A 4UZEA 3C6BA 3ETLA 2ACWA 2WZDA 4NH0A 5K8CA 1E4EB 3T1YB 2C7QA 5SY4A 2VK8A 4LF4B 4FB4A 2F8MA 4W5QA 4RHYA 5LCXA 1I7NA 2R47A 3RRFA 3DR3A 1AV6A 1QVWA 1DRVA 2X9GA 3RJ5A 5BORA 5E7JA 4D9GA 3M6AA 3MAGA 4L0MA 3DF9A 5DPMA 3KT3A 5CAEA 1TGVA 4WKPA 3DZKA 2WD7A 4KACA 5C4GB 4AURA 4DV3B 4YJGA 1N0IA 4M7WA 3WGMA 3TLMA 3GPDG 3JQ6A 4DY4A 1E2NA 2Q5HA 1R6TA 4EY4A 5I9MA 4XYBA 1R5OA 1CZRA 1OX4B 1IU9A 3BCRA 1T10A 4OQFA 1U02A 4DR5B 2P8JA 3KQOA 3F4LA 1C9NA 3E18A 1USKA 2NVUA 2YQZA 1JRLA 3U5TA 4ENQA 1ADFA 1F8FA 1JIVA 1XO1A 3RSCA 4H0FA 2YOHA 1DIBA 2CL5A 4IS3A 4UU7A 2ZPAA 5AK4A 3SDSA 3V5NA 4ARVA 4AO8A 1XJ5A 2P2YA 2YJ5A 4TKUA 5DYWA 3TIXB 4C29A 4YR9A 4ZHSA 2DB3A 3LSTA 3GJ7A 3K0BA 1I2ZA 2C00A 5LA6B 4C08A 1T6XA 3QU9A 4MQBA 3K30A 1T2UA 1D4FA 3R20A 1W30A 2C96A 1U8CB 1Z75A 4Q02A 1XL0A 2VKQA 5TARA 2E1RA 2Q6KA 4IUDS 4Z1MA 3MTJA 4Z7NB 4BQIA 5AHKA 1RKUA 1WHTA 1DIAA 2CLEB 2MYUA 3B6EA 1JJAA 2FFJA 4YDRA 4W1RA 3AI1A 4DC0A 5KO2A 5SICE 2RBGA 1PQ4A 1UQRA 1VJ1A 2FN8A 3H3JA 3R6GA 3IEXA 3WQQA 1JEQA 2WR8A 1FYXA 1GPDG 3PC8C 1LX6A 4G01B 3ZI7A 4UHKA 4HZIA 1E79D 5C1BA 3IHKA 1Q7CA 1IZ8A 1WP4A 1N2GA 1W2HA 2ZRCA 1F2UB 1UMBB 4YCBA 2BT4A 4MV5A 5LFAA 2PPVA 1WF3A 2O59A 3RNLA 3TRKA 4LE1A 4ZMBA 2C7VA 4BKRA 4HX5A 4PGAA 2GZMA 3C6QA 1A9YA 1JJFA 3QA3E 4EG5A 4YMSA 1NATA 2Q4BA 1QO7A 4YUVA 3DLHA 1J25A 1XTTA 5CLHA 3P0JA 3VNVA 1QHXA 2ATEA 2NUAA 2VQ3A 1NL3A 1VCIA 2XNDA 4I1YA 3ORHA 4TL7A 4EAQA 4UTRA 3PC6A 2RGYA 1R3DA 2SCUB 4AMGA 4YV2A 3NV7A 4ZPXA 3GO4A 2XMQA 3JTEA 1JIQA 4GT1A 5ICEA 4NCAA 2VF7A 1R8SA 4HVLA 2Z98A 3LHKA 2PMKA 2MINA 4PC2A 4ERXA 1C0IA 2WE7A 4B2PA 1MB4A 2UVDA 2GCOB 3LVFO 4BEWA 1NAHA 2AKYA 1EFUA 4GD3Q 5CU7A 1NVWQ 4RZUA 1RBYA 2AD5A 3VH3A 1XZEA 4IZHA 2X77A 3L1KA 3OZRA 4WX2B 1R4MA 2YUTA 3T3NA 1I0LA 1PI3A 2IIBA 3ZEIA 5DTIA 1G60A 4E5DA 2V6MA 1TKAA 5AOVA 1XVAA 4Z5XA 4AMBA 1XMJA 3Q8KA 5IBQA 3WMFA 3THWA 2CGEA 4K9KA 4EHFA 1QGED 4P80A 1QRRA 4J7UA 1O94D 3FDZB 2H2WA 2C4HA 2W2OA 3D02A 1DKPA 1TKBA 5C1OA 4AZ0A 3D6FA 4NCNA 4RPHA 4A6PA 1X7XA 3IPLA 4OSEA 5HGJA 4Y8VA 3D0QA 1U7WA 4XTRA 1G5HA 2FP4A 2J0VA 3QTLA 1FX1A 1SRRA 2WUDA 1OV4A 1DAMA 5F12A 3TO5A 5BPFA 3OPMA 2G77B 2E55A 3IT0A 4BFZA 2JH3A 3HR4A 3N8DA 4C4ZA 3DPUA 4ZC8A 3GARA 2ZR0A 5EEHA 3CSSA 3DO6A 1WMBA 2G9RA 2YWRA 2B3TA 4UATA 4M46A 3DEYX 3EARA 4RPGA 5ARDA 4Q7QA 2JFOA 1FFCA 5JQGB 1TX4B 4NAUA 2VDNB 3I09A 4MW0A 1RM0A 2PH5A 4OHMA 4YWHA 1EWVA 5A03A 2FG7C 5K6RA 3ZY2A 1DX9A 3DHYA 2GXQA 2OFFA 4HDAA 2HSGA 3C5EA 3AUKA 4H08A 1A98A 1AGRA 2BHNA 4NBRA 3ZJUA 1YCDA 3D0OA 4PS1A 4JU8A 1V0JA 2HU2A 3QWHA 1TZCA 4AJPA 3QX3A 4UEJA 5ARBA 2BGWA 5F9HA 4DA4A 4ZKDA 1CUZA 4QQKA 1UDCA 1J49A 2AGVA 4V2UA 4ZAXA 3ZQ6A 4BQQA 5BRAA 1KI9A 2AK3A 4QM6A 1CYEA 4H16A 2Q1TA 3JQFC 1MEJA 4FEEA 4ABTA 4G5HA 3VPXA 4ARAA 2O8DB 2ZRLA 1VI6A 2V55B 1YJXA 2GN0A 3HDYA 4I46A 3LQFA 2PD6A 3U44A 2WD8A 1ZGJA 3DPSA 3UOGA 4C1NA 2IVFA 5G2OA 2F4NA 2UVPA 3FZYA 2H92A 1EQ2A 1AS0A 4AO7A 4IRMA 4XGNA 2E82A 1PFVA 2G1AA 1U0GA 1YB5A 3V8PA 1BE0A 3H18A 4B47A 4CTMA 1Q15A 2WIAA 1US8B 3IUQA 1WF6A 3P27A 3HUUA 5G40A 5JZBA 2A0YA 1I14A 3DV2A 1KIMA 4MYRA 3ZWCA 4CIDA 1ABBA 4OXYA 1Y9DA 3JD4A 5H3HA 2ERXA 2G07A 1YJBA 2QJWA 3EXG1 1MGOA 1YRBA 1GPH1 4J16C 3KELA 1QGZA 3NBQA 5EVCA 2Z9CA 4DCCA 1B8PA 2DQSA 5E6RB 9ATCA 4NBTA 2R1TA 3B3JA 2V7QD 3FZGA 2HRRA 1GT91 2GESA 4ZRNA 3UPTA 1OAOA 3WRVA 1J56A 4IHJA 4W6QA 2QYHA 3EZNA 3DAHA 3A9WA 5E3HA 1R9MA 2JZCA 3QWAA 5FTJA 5PNTA 2LGJA 5IZ4A 1D6SA 4U7JA 3MMZA 5L7YA 3ZCSA 3MA0A 3LM8A 4KNWA 2C5LA 2QL6A 4WNAB 5TMDA 4CMKA 4DA9A 2GCGA 1S4QA 1XVTA 3COVA 2JVJA 3EPRA 1JMYA 4H1HA 4N40A 4QOGA 4BNDB 4CLOA 4F4CA 3TLCA 4J75A 5AKJA 2CDAA 3OCUA 4E5PA 3ZWYA 1DADA 3JASA 4NCHA 4QM7A 2ORWA 1TXGA 3SF8B 3FYUB 4QHSA 2OE2A 1GTJ1 2X9VA 5B53A 3T3PB 1I1QB 3TLJA 5I9NA 4J29A 2WMNB 4XVUA 3RS0A 1TEHA 3BL6A 4LRSB 1TUBA 1DV2A 3QITA 4Y18A 3OZIA 4R31A 4C0JA 4B82A 4PE5B 1W0JD 1S3SA 5B1DA 1N9ZA 4HH3C 1NWCA 4P3NA 5G0WA 5KDLA 2PT5A 1D2AA 3JAMA 1B42A 3CNNA 3GNTA 4KIJA 5KOHB 3BCHA 1Z2PX 2BMAA 2FGJA 3DZHA 2I1VB 4B7AA 4DLTA 3GFQA 2NUTA 3D1LA 3NHPA 4ZGWA 5IAKA 1CZUA 2RGNA 5FR1A 1KI3A 4MUIA 1YHYA 421PA 2O8EB 2CXPA 2ZI5A 1EGVB 2GXSA 4IH1A 2O7NA 1JKJA 5LOVF 5EZSA 4BQPA 1WAMA 1BX0A 1E63A 2ZTUA 3NT2A 2JA1A 4LTNA 3WTBA 2DOKA 1UKAA 3EIHA 5EIBC 2BEVB 2QROA 3HWRA 1U7HA 4E1BA 3DB1A 5T8KA 2GB4A 4MR9B 3Q87B 2BUCA 1NM5C 1YRLA 2AC2A 1L4EA 4PYQA 3EEQA 2H1RA 2WIFA 2FSIA 3ZVNA 1YFZA 5EJ6A 2Y9MB 3IXQA 3BQNB 4S3MA 2I6FA 3L8HA 3LKBA 4WKOA 5EHZA 2YZNA 1JAIA 4P7JA 2C04A 1P9NA 3OZUA 1VP9A 1D4AA 2Y1KA 3QIAA 3Q9UA 5L4SA 4XDZA 1BDIA 1DE0A 4M83A 3N8KA 1Z4MA 4KXYA 5FJJA 1Y8RB 2E4UA 2EKDA 2EDAA 2WAXA 3HY6A 3OZAA 2ISQA 3TAHA 1NQTA 2PDAA 3EXFA 5B2ZA 4CM6A 2I1WA 3KKKA 2VFAA 2J7PD 2QN6A 5LLSA 2CD9A 3SQDA 4O4LA 1XVIA 1Y9JA 4M1TA 1Z0KA 1LF0A 3JSXA 3SZMA 5L6LB 1IUPA 4BB5A 1WOYA 1VKZA 2GJ4A 2ZAMA 4NE9A 3DGEC 3BMQA 1KVUA 2V0NA 1U7UA 3ZGOA 4IEEA 4X8HA 2CUNA 4MKGA 3S2YA 1X0VA 4Y2GA 3GLGB 2O2HA 3RKSA 4OREX 2R79A 3RVQA 3RYFA 1EX1A 3GFGA 1ADCA 5AWFC 3RFXA 1U0LA 2WKPA 5JD3A 4B6FA 1NW9B 1ZUNB 2XUOA 1ARZA 2ZYDA 3M4ZA 3NAQA 2J0UB 1IK6A 3HGMA 1I32A 4PBRA 2R5WA 1PSZA 5BVGB 1CZHA 1T8YA 4Z54A 1OLSA 4BUJA 1H2ZA 3HV2A 1NXQA 3FKJA 1RPTA 4HDOB 4R2HA 5ES4B 2R7KA 1FFXA 4OM8A 4QECA 5TQ0A 2H9AA 2YZKA 5JRZA 4GI1A 1RYZA 1VSUA 1LPBB 3AF4A 3MJFA 1Q1NA 4ZK6A 1PG5A 1IFXA 3NRJA 1A71A 1UKYA 4B79A 5BSUA 4OMCA 5IP5A 1TOAA 1TM5E 2O6HA 4G4SP 4HNQA 1O3YA 3ESCA 4KU4A 1Q77A 3IVGA 2OXEA 5G0UA 4RH3A 4TMWA 5BR8B 3IPCA 2A1UA 1IK4A 2NSDA 3S81A 5BV0A 1GGNA 4CEHB 1U0BB 3H2YA 1Z73A 2QZZA 1EX6A 1NT4A 3OWOA 4LHEA 4YT2A 1E0AA 1QIFA 4YYZA 5AJTA 3HBMA 1ND6A 2V6JA 1ULTA 4GF5A 1A88A 4OJTA 5LP6A 1J97A 4NY1A 3TW0A 2W6NA 5PGMA 5ESDA 2P3QA 3MLAA 1V48A 5LWQA 3O92A 1ZR4A 3TX6A 1HDRA 2C4VA 5CLLA 3LDUA 1EHIA 2VP6A 3NGMA 1DIOB 4NTZA 3ZQ4A 3C8DA 1SG9A 1HLPA 1PUIA 4IEIA 3E23A 4JLBA 4D4JA 2H4HA 4L6AA 2JLBA 4ZGGA 3TUZC 2E5LB 4MTCA 2ZTHA 4I6JA 3DFKA 4UEKA 3K1AA 4H1TA 3BHMA 4HWGA 4JQZA 4PIVA 2CK3D 2PBRA 1WPGA 2UZAA 3MMXA 1QHHB 4QGHA 4UPVA 4GVLA 4UULA 5AW1A 4L8WB 3O93A 5JMTA 1G55A 3R3YA 4Q4JA 2NUBA 3IDOA 1DDGA 1R0LA 3GVHA 2XUKA 3DOJA 4JBLA 1BXRB 5J5VA 4KE8A 3DEAA 2XUZA 3CZMA 3NW9A 5FRDA 3UMVA 1RVV1 2H2FA 1KMHA 1AK9A 3HSKA 4M7OA 4QDXA 4G0QA 2B4RO 3BSFA 4TKVA 4LDRA 1OQAA 2PLNA 5A3SA 1FSSA 3I45A 5D2CA 3U40A 1QLJA 4MV9A 3W3AH 3PWTA 5HDBB 3T3GA 2ZBPA 3C8UA 4JWTA 4M60A 4R0NA 2F8LA 3OTIA 3R0IA 3TLGB 2O8VA 3ANXA 3DM5A 2O0KA 2JFXA 1Q7BA 1U8UA 1DAKA 1W87A 2IKSA 2XTJA 3N2GA 3QVOA 3E82A 3T3HA 4Z0PA 5D3QA 5JS2A 2ES4A 3P4UA 4N03A 1H22A 2RE8A 3EVNA 1QH9A 4ENVA 3W5AA 1YV9A 3K9CA 1EZ1A 1JEYA 3OICA 3WL8A 4QRDA 1FDVA 1E1RA 3DOOA 3FOWA 3A6ZA 4NDZA 1HDOA 1I1NA 3I2YX 2ZJ8A 5LUBA 3VO9A 3JAKB 4H15A 4J4BA 1BCRB 5EJ5A 5J40A 5HRCA 4CU2A 3DZBA 1G8AA 3FWYA 3A2KA 2OSVA 4ZO8A 3UB4A 4Q5IA 3KPWA 4C7JA 3HBFA 3UICA 3IEVA 3GP8A 2GCPA 1A4XA 5ADHA 1JR2A 1MC1A 1FC0A 1RJ9B 5JJLA 4CMBA 1QGOA 4EFKA 5B36A 1WSBA 1Q74A 3LFHA 1ISSA 4V0QA 4ZVNA 4EHKA 2X0KA 4OHUA 1BKSB 1V47A 2FPWA 4DYDA 4DIEA 2QJFA 4IYRA 2JGDA 1LSSA 4JLJA 3LBYA 5I7EA 1OYOA 2P5YA 5K3FB 3SXUA 4ZIRA 1S3IA 3C8HA 3MAJA 4ITUA 2CV0A 2C20A 1MX9A 1KDTA 1W4CA 3LC0A 5KC9A 1HUQA 2B5VA 3ZKWB 5ADUS 3P5BA 3LC2O 3HKBA 3K0FA 2JZNA 8AT1A 5C5DA 5JXHA 4HK4A 4HVCA 3QFFA 5EE0A 1ZM2A 2FI1A 2WFMA 4IF4A 3C98A 3CZRA 4OAQA 1NOIA 2G9VA 3AIIA 1XEWY 1T0HB 4FLFA 4P3PA 2IS4A 2XD9A 3K0HA 4D2IA 3KJNA 2I8LA 1U9YA 6YASA 4LX8A 1MRSA 2IPXA 3PT9A 1NI5A 4LNAA 4Q16A 4Q7KA 4V0OA 3SWWA 4FKZA 5EL0A 3MQ4A 4OQLA 3V8QA 3GRRA 3EK2A 2ACVA 2COKA 2R85A 3AVQA 4G4IA 4PANA 1BYIA 2IYWA 2R97A 3L4EA 3FYCA 1FNNA 4WEOA 4LZPA 1FDWA 1KOFA 1N0WA 3PQ7A 1K86A 4DLVA 5KWIA 4LJ8A 1CX9B 4C7OA 5IZCC 4OPMA 1LPSA 3B3AA 2PR2A 1A8QA 5K3SA 4LCBA 3UXHA 3WG9A 1GAEO 3MGKA 3JQAD 4KKXB 2B2CA 2Y1EA 2GRJA 5EMNA 1AS2A 2Q6IA 3OEED 3PFGA 3SNHA 4C3UA 4UEWA 3OQMA 4IJQA 1Z37A 2I4NA 2ZTSA 2XDQA 2CMGA 1EFVA 3ILVA 4UC0A 1PJ4A 3V7FA 2C5AA 5T5QA 1NMSA 2PH1A 4LI0A 4RJTA 4B3XA 2ZIUB 1SBHA 2JEZA 3FY4A 4OATA 1O03A 3DDCA 4PX3A 4XGQA 2IU0A 1ZGZA 1IVYA 3WLQA 5AUQA 1FA9A 2ZSEA 5DN9A 5KWJA 3KK0A 4ZT5A 2QUKA 5M04A 1F1BA 3O8NA 4MR8A 5LMNB 1QTRA 3RSQA 2BJHA 3FSJX 3ZLBA 5TQ2B 2ZT7A 2EW1A 1C0EA 3F7MA 3IP7A 3QTBA 1TYAE 5A5FA 3TZ6A 5AHOA 4JX9A 1NOJA 3GBPA 3BWBA 3PVZA 3EZGA 5JNLA 3GLIE 4INOA 1NN5A 4F8JA 1TD1A 1VL6A 1UJNA 4G41A 1MXHA 5JSKA 4TV8F 5I5GA 5IAJA 3EGDA 2NZWA 2JFGA 3DTVD 4XD7D 3NX4A 3H2BA 4IX9A 1HQDA 2XYRA 4WK0B 2QL5A 1FVOA 3O3MB 2ZBGA 4AJEA 2XQJA 1N4AA 3RSOA 3RNOA 4XIJA 1RJDA 4AUNA 1VPVA 2GEJA 5F2OA 4PZPA 1N57A 1WHSB 5ANRB 4O4JF 3KYDB 1DIRA 3B7GA 5H9WA 3WGIA 2OO5C 1ZICA 4FGLA 3FE2A 1KVTA 4P08A 1NF8A 1EE1A 3KZVA 4D44A 2XDWA 4ZEMA 5JMWA 4DCJA 1EDEA 1P17A 1V25A 1LGYA 1YDFA 4UCFA 1KDZA 3ZW9A 4UVIA 3QJGA 1Z7YA 1RWPA 2QRVB 4E6PA 1YDWA 4F5WA 4ZU3A 3QJ5A 4FIDA 2HNKA 4EGSA 4DF3A 2XTAA 1TE2A 1T8PA 2O3SA 2YWGA 4MB6A 4X60A 3RS7A 1JWLA 3GHYA 2VP3A 3O8LA 5A05A 2WA2A 5JPDA 4ZJUA 2PZGA 3CR3C 2JFVA 3CZ4A 1ORHA 1I7QB 2YJ4A 4KGZA 2A2ZA 4N3GA 2XMPA 1O94A 5DSTA 1ELOA 2RGRA 1W5TA 1Z45A 2GBCA 4BZXA 3TTTA 5DLQC 1J07A 1MC8A 2G4CA 3GZJA 4QUDA 2VTBA 3MT0A 3PFNA 1RQ2A 1ORVA 1SKBA 1NN3A 1FU8A 4HTFB 2XCTB 9MHTA 3H8VA 1J20A 4HAUA 4GFDA 4XCQA 4G0VA 2J08A 3LXMA 3T9AA 5J2TB 2W8ZA 1PR1A 3AG6A 3KYJB 1FFHA 2C57A 1PJQA 4GXRA 4B5LA 4EPRA 2XCIA 3G9ZA 4MDEA 1TU3A 1SBTA 4GM4A 3BMXA 3ORFA 4PLWA 1CRLA 1LB1B 2GKOA 4PLPA 2ICAA 2OCAA 1Z35A 2REXB 3C7KA 4HEA1 4N9QA 1AHIA 4XOIA 5SYNA 1VBMA 5IRCD 3QFTA 4MWDA 1L4FA 1LTKA 1TJPB 3HWSA 4B85A 1R4NB 1YVUA 4W8HA 3AIOA 3W9BA 1Z17A 1J23A 2HQ1A 3AKZA 2G17A 1YIDA 5DGHA 3OX1A 4TXNA 5C80A 5JY6A 4H4DA 3GAZA 1UPUA 4ZQFA 4V2IA 3O8RA 4P0PB 2I71A 3CR7A 2H0RA 3PHJA 3O4GA 3IAEA 5F5NA 3X44A 2JLAA 3GW8A 4YJFB 4B4UA 3ZHRA 1Q91A 1IN6A 4H7EA 4Q9DA 4JJ7A 3UKDA 3GPLA 1YWGO 3BERA 2PIAA 5JD4A 1L9XA 1T1GA 4NESA 3HC7A 3BF8A 3LY5A 4BMCA 4KZKA 3RLFA 4C6SA 5JNRA 4HB3A 3VR0A 3TEFA 4H7PA 3BK7A 3K2IA 3CEMA 4OI1A 4KQEA 2ONJA 4I1IA 1SHLA 2W2LA 1NT2A 3NEPX 1QE3A 2OGUA 4RAOA 1CQJA 1G4HA 1X9IA 2HFJA 2Z3ZA 1LCIA 3QP9A 2H8KA 4JCCA 3LDHA 2ZJBA 4JHLA 4D0NA 5AW4A 1QMPA 2QG6A 3H7IA 4AJIA 4EA7A 3F6CA 1DBIA 2LUOA 4GMXA 4EMSA 3N0VA 4MW6A 4X71A 4F5EA 4G67A 5HM6A 4TYNA 3DHNA 3ESYA 3D7RA 4EG4A 4YHBA 5DEIA 4LHVA 4HSEA 4G1CA 2BMDA 2D4HA 2H0QA 1PEDA 3FRJA 3H2KA 3GMIA 5B1SA 3UT5B 4O29A 3UHFA 4TL9A 4EVIA 2GEUA 2VAPA 2X41A 4AI6A 1JXAA 4D3YA 1VE7A 5SV2A 3EA5A 3T4UA 2BP7B 4DXAA 1QR2A 4UUMA 5K6AA 1Z0JA 3PHGA 1R6BX 5DBGA 5EERA 4QKQA 3NDJA 2AJ8A 3KUCA 2QIPA 3W77A 3X0DA 3FOCA 3AIKA 5A3VA 4PZDA 1Q19A 1VMEA 3BBLA 4L27A 3VO2A 1P5JA 2I2XB 2WM2A 3V8BA 4F91B 2EF1A 1GQOA 3ZHTA 2FMIA 1C9DB 1JIXA 1HE5A 4A8PA 1Z5VA 5F64A 3PT5A 4QXRA 1JJ7A 4R2IA 1CEXA 4LHYA 2H08A 5CIQA 3J7AC 4XFJA 1T15A 2RIRA 1RKQA 2O07A 4F5ZA 4FCVA 2BL4A 2K7FA 1C5KA 2QD4A 3BHNA 3BTSA 3ZHXA 2VQ6A 2RHHA 3T0FA 3EIXA 3N8IA 4NE7A 4CCYB 2GFQA 2VA9A 5DULA 3CX4A 5C0OE 4BVLA 1FLDA 1CP3A 3O2JA 2B3DA 4DMUB 3UJ7A 5BPHA 5TRTA 4EYQA 3OPQA 2CMHA 3FWZA 1Q22A 3E3NA 3DH0A 1JR3E 3H86A 3GRPA 4Q4CA 1TMKA 3BAFA 1L7VC 1P4SA 3EEYA 3FPHA 4HDMB 1MJHA 1TO6A 2I9PA 2FZWA 4QNMA 1PJBA 1TPYA 3AX6A 1WM1A 2OEPA 3AW9A 3LF1A 3MILA 3NDRA 3QLEA 2JBAA 3C85A 4D9CA 2EC5A 4OBXA 5EJ8A 1EA7A 5IUNC 1GKUB 4Q19A 2HPZA 5F33A 2Z1DA 7MHTA 2NOAA 2OBLA 3PGVA 2HRBA 1XTSA 4GUAA 3BWXA 3LX4A 1F12A 2IY7A 2YV3A 1TL7C 2NSYA 1PDWA 3OFVA 1XOIA 2D5CA 2GUWA 2NPIA 3UC9A 1MZPA 5KYXB 4Y2UA 1XDUA 4UQOA 4KWIA 1MTZA 4NBLA 4R7GA 5JZOA 1NV8A 2ZSAA 2PKRA 3EZ9A 5F3RA 1ENZA 3QVTA 1Z25A 1E1DA 4ZEWA 4C1BA 3JY6A 1IZ9A 3E61A 4D9JA 3IMKA 2YS6A 4BNWA 3QMPA 1PFUA 3FMGA 5JDIA 3O8OA 4TTTS 1GN9A 2EWWA 1UC8A 4P33A 4PQYA 4QDJA 2VF4X 1A9ZA 2XUQA 3PDCA 5E3IA 3UT0A 3M70A 1Q0TA 3Q3CA 2O2GA 4CBVA 2I2AA 2Q45A 5ALPA 4V1CB 4A26A 1Y6GA 5H81A 1ZC4A 4EFNA 1W4RA 1DWQA 5BOSA 4M0CA 3ILXA 3KHUA 3WO0A 3SHVA 2Q3CA 121PA 1RI1A 1VDZA 1L5MA 3G9QA 1P5RA 1RIFA 2FVXA 3G2PA 3F3MA 3Q1KA 1X9GA 5DWQA 3VU8A 2FMTA 5EAIA 5E6UA 1AKWA 2J7PA 4YUWA 4KQIA 3TQCA 3VR3D 3I05A 2ZJZA 1QP0A 1ZR2A 4YPVA 4WOPA 1DCTA 4Z0NA 2NZXA 4CWAA 5LQJA 4XVCA 3HUDA 2CW5A 3V34A 1CUAA 3A31A 4O4HB 4RIIA 2HSEA 4TTVA 3VVLA 4MPPA 3B9QA 4NBVA 2OG2A 4B4WA 2ZSHA 3LCCA 5FWXA 4H1WA 4FFRA 2GGSA 3W7AA 3F74A 1E3SA 5AESA 2AOVA 3QOFA 1EK6A 5C18A 3S5JA 2O7VA 1AIPA 3M6FA 4OFXA 1QQ6A 4RA6B 4DSZA 4GS5A 1JFFB 1E8DA 3PDHA 4I9UA 1JQBA 2G06A 3DAGA 1XLWA 4PZLA 5AM5A 4ZEVA 4UFPA 1J90A 4WBNA 1UZAA 2IYPA 3LKZA 3NC4A 2A9RA 3F9CA 5DP2A 2J3QA 3T7EA 2HCRA 2HIHA 3IV7A 2JGNA 4ZO6A 1RD4A 3CH5A 1XVUA 3DMTC 3ZC3A 3ESBA 4MWEA 4E88A 3JCZA 1FTSA 4YRCA 4CODB 1PR5A 4DOMA 2Q1YA 1MIOB 4QBTA 4UBOA 2IIVA 5IWCA 4WNAA 5K6TA 5CPFA 5CFOA 1W36D 4RK1A 4GPD1 4F4UA 2GPAA 4YLEA 3L05A 2I78A 4CMHA 3IO3A 1UMCB 2B37A 3HL0A 3K70D 4CTJA 3EASA 3V1LA 1BCSA 2BDUA 2JATA 4FFSA 3EPJA 2AXPA 3LLVA 1KMNA 2VEDA 1V5WA 3FPLA 2ZB4A 2OESA 1H9BA 3V8VA 4IDNA 1N1MA 3CIOA 4TN5A 5EKTA 3T6KA 3ZY5A 3FTEA 1KI1A 3IIJA 3PQFA 4GQAA 2Q2VA 4W1PA 1UPCA 1NN0A 2FUKA 4LW8A 1XJQA 4XVRA 2CSUA 3WTCA 1RM3A 4XPZA 2I2WA 3EGIA 3TW4A 1JA0A 1SK9A 5LXTA 3IGFA 1GNRA 1DEOA 1FXWF 4QYTA 4URVR 3H6KA 1OC4A 3JWJA 3WGOA 1SA0A 2IU3A 2QAJA 4P9NA 2OORC 1FFGA 3W2FA 3TVDA 4BVEA 1Q7TA 5HTOA 3CE6A 3DEFA 3JSAA 1PL8A 3A6HA 2N46A 1CUVA 1R0SA 1E6EA 4KMRA 2RARA 4OQYA 3CLUD 1XA3A 3L1HA 4MUMA 4L78A 5LZ9A 3H9QA 2XUHA 2FUNB 3HZRA 4ITVA 4OJMX 4AN1A 3IE1A 4JGBA 3W9SA 1BXZA 1X13A 2QA5A 3ZVRA 3IBSA 4OOEA 5EUCA 4EHIA 1N6KA 2RAPA 1BQ4A 3ADKA 3P2KA 4WLEA 1ZCBA 5I45A 3HXMA 5IJ0A 5BW4A 2Q3JA 2YJTD 3DP9A 4JUIA 1OTHA 4QSMA 4JJKA 4R9NA 4X91A 3AL2A 3KEMA 4BO8A 1T3TA 1Q0ZA 5HP4A 2PKXA 2LDBA 3RTGA 2UV8A 1T6YA 4MGEA 3IQEA 2EYQA 4GX1A 4YRQA 4E03A 2LKDA 2ZUTA 1E3JA 1H85A 4WBSA 4BN5A 4LVOA 2J1LA 2BR3A 4QYXA 4LYGA 1QH0A 5IX8A 2Y1WA 1ISIA 4E21A 3PGXA 3NWBA 3R3ZA 1Z16A 2ZITA 3H5WA 3LOUA 4D3ZA 3T1OA 1VPEA 2CN1A 4MUYA 4YMIA 1N7HA 2RHWA 2FPPB 4LZAA 1I5RA 4FX5A 2BSQA 2LW7A 1HT2E 4I4TF 5TIIA 2QN8A 1TTTA 1PTJC 3ZWDA 1FFAA 3VKHA 4XD2A 4KQXA 2WIJA 4XLTA 1DTSA 3OZEA 1OI4A 1YS6A 2NO6A 3MMNA 5B58T 4TT3A 3VYSB 2ZDQA 1VJ5A 2PGLA 2B1IA 4WVFA 4YDQA 1OXBB 4DPKA 4BBPA 5U9CA 4RSGA 2WUEA 2B36A 3SHWA 3CUVA 5CVVA 1VSQA 1NVAA 2VHCA 3IEIA 3I42A 1BOOA 2G7MC 3KEFA 4BE7B 3CCFA 3WLJA 3LD9A 5C46F 5L8VA 5BMVA 5DNUA 3JTMA 3VH1A 3OEHD 1GTRA 2YFKA 1B15A 1T8RA 1TAQA 1Z3CA 2VPYA 3M5WA 1T1IA 1JT2A 1XFAA 3O4VA 4UAJA 4Y6LA 4IP0A 2O2YA 1BGVA 4N5IX 3UBTA 2V1UA 2RHOA 1NFQA 3R8CA 1S9DA 3TINA 2XIQA 1TJ5A 3H9CA 2I7DA 3T9DA 5F7OA 1XA4A 4W5JA 2NWQA 3CTMA 3UGQA 5ALXA 4YQFA 4CHTA 2O06A 4LF9B 3N5KA 1ORWA 3G2LA 2VP2A 3FMOB 2E1PA 2EIHA 3FF4A 2N42A 4QYWA 1UBGA 5DTQA 4B6QA 5C1PA 1T0PA 1HZJA 3E9RA 1TVEA 3Q7PA 1WKBA 4JC5A 1M1NB 4AN0A 1R8QA 3I9OA 1GILA 2HV9A 3PU6A 4HMQA 5AFSA 1T0UA 4OFBA 3ADPA 2W2QA 1BAPA 3AK4A 4BECA 4RL4A 5DX1A 1XZGA 1RWMA 1GUDA 4PCVA 1TB4A 4TKZA 5BR7A 3B9PA 5ENDA 2AFHB 1LSOA 2Q7XA 4CF3A 1JHAA 3C4JA 4PV7A 1FLNA 4IF6A 4AZ3A 4KREA 4URHA 4O0MA 2Q3DA 3A06A 3B2EA 1HDEA 1VSVA 4WT7A 2JAPA 1MH1A 2WU1A 4JKOA 3DONA 2GZRA 4MUGA 2P78A 2XAAA 2E4YA 1JWAB 1NYTA 1P6UA 2O19A 2B6NA 3GLFB 2C92A 3P9NA 3RB8A 1LQUA 2ODNA 3KOXA 3BGOS 1O6FA 4PNPA 3ZWAA 821PA 1ZI6A 4YRTA 4RTLA 2CVHA 2EP5A 2E49A 3OESA 1RWVA 1XEFA 3JQ9A 1I80A 2Q8NA 2XYVA 3COWA 2A1IA 3QENA 4NNJA 2QTWB 3GA0A 1ZKDA 1YR1A 2I3AA 2O6LA 2HB6A 4K40A 3QLVA 5EHNA 1V26A 3BJIC 3EGCA 4RCVA 1E59A 221PA 2YHBA 4F1KA 3UV3A 1VL8A 1JDBB 2GBGA 3T06B 5LLDA 2ZAIA 2H4YA 5FA6A 2Q1XA 2ZRJA 4C2AA 1CJTC 2J4CA 4F56A 5GVSA 2QVLA 2QSJA 1LD3A 1IOZA 1YOVB 3K2EA 5DW0A 1YVDA 2BR5A 3AUAA 1XXHE 2DKFA 2SKEA 2ZJ0A 3DDUA 4XD7A 3HVKA 4M36A 4L8FA 1JR4A 5JYEA 1IRIA 2ZZKA 1THGA 3VR1A 1LJ8A 1BWSA 4Y6RA 4ARCA 2WTAA 3S8MA 2WP8J 2QE7D 1T3HA 1H6BA 2LR0A 3PUVA 4BVGA 4XLZA 1UH5A 2UYOA 5AI0A 5D8DA 3O1HB 3Q9SA 3Q3EA 1P1JA 5EVJA 1W4AA 4ZVQA 1DBVO 2CVFA 4ZCTA 5MN5A 2W6ZA 2HBQA 2NVBA 3E9NA 3SJBA 1C8VB 4IRUB 1T0IA 1A27A 1DAFA 1CHNA 1H2AS 5DRYA 4M86A 5JO0A 4ZDIA 3CX6A 3H2IA 3SYLA 2XLCA 1BD3A 1A4RA 3TD2A 4PYMA 1NE7A 5BV2P 4I9HA 3BD8A 2WILA 4EWLA 4BHTA 1A76A 1K7SN 1U28A 2P9GA 4EGCB 2AT1A 4ZZ3A 1PNRA 1N5DA 2JKZA 1QRUA 3AVUA 1I7DA 2BFFB 1KVRA 4P5DA 1VCOA 3CUSA 1Z6XA 3ODGA 4WL0A 3IVMA 3VSEA 1YI0A 1I5EA 2YWJA 4LJLA 2WHPA 4X24A 4YRPA 4F9FA 1XDWA 1HSOA 1ZXBA 2EHJA 2VK2A 3U0BA 3OF2A 2FAXA 4Q15A 1NDHA 3U0VA 4BC1A 4HNUA 1IQRA 3GCWA 3D7NA 1HEYA 1MJGM 3GCZA 3OHSX 3C3MA 1LRKA 3P7MA 1V11A 4R51A 4YC7A 3U6BA 4RZQA 1KJYA 2KW5A 5DSZA 5CCDA 5F4ZA 3MTIA 4BQFA 1Q57A 4UJ5A 4ZOQI 4IIJF 4DR3B 4GI3A 1M8JA 3KYCA 2P9BA 4ZTBA 4AJNA 2YQ4A 4FFOA 5AXAA 5L4LA 4RMHA 3KT8A 1TMYA 2WHRA 3RCBA 1DS6A 3M4XA 3VHRA 4ZEXA 2JLCA 3BIWA 5GP1A 1Q2UA 4IXWA 1OGIA 2P0AA 2WSMA 1M2JA 5TX7A 1QF6A 2RH4A 1M2KA 2RHMA 4EX6A 1T34A 3ER8A 2QRHA 1OLXA 1SXHA 3FHJA 2J6IA 1ID1A 4A91A 4A0HA 1WBDA 2DMRA 3KQHA 2IYZA 3FRIA 1OT5A 3JX9A 2WRZA 1Q3TA 1PZNA 2WJIA 3NKFA 1Q44A 1IJFA 4TUYA 4EB6A 4X7PA 2F2TA 4L4YA 1ESZA 2CLOB 3M6LA 2PNJA 1VA5A 1SCQA 4INPA 4OHWA 1LS6A 2HO5A 4AYTA 3QFRA 3OMXA 3H1BA 2HM7A 1T8SA 4MR7A 1QH1A 1XVVA 1JQAA 1IN1A 3D8UA 3G6WA 3QBTA 5CA1F 3TLAA 1ZAKA 3BK1A 1XDGA 4PPGA 4NWIA 4HDSB 1WUIS 5AP9A 4MUNA 4BQRA 2YW9A 4ALLA 1MJGA 3W1VA 3IMEA 3HB7A 4B8YA 2Z8XA 1NY6A 4LVCA 4WESB 3K1JA 3NKLA 2XAUA 4UNQA 2MHCA 1KYWA 1XDBA 1MB2A 2BKVA 1GTZA 3DTVB 3MD9A 2VHWA 4IVRA 3ZEAA 2H4JA 1QCDA 1W47A 4RSHA 1BE1A 2NZ8A 5F52A 4GZ3A 3D3QA 3DLCA 4HQ0A 2IUFA 4DQLA 1G3QA 5ICCA 1DXYA 1MDBA 1JNXX 1WBJB 2IL1A 4ZVPA 4AMZA 4AF7A 2RI0A 1PQWA 3QZUA 4WW0A 5F73A 2ZETA 4EF5A 4QPJC 3SMVA 1C80A 4KIWA 1XDSA 2Z0MA 4N5DA 4ARZA 1RXWA 2D3TA 4WRRA 4R0MA 3F4BA 1CNFA 1X1TA 1QFJA 3DE0X 3JPYA 4CVNA 2Z95A 2ZUUA 3IJ5A 4BNLA 1BE6A 4D45A 2FW8A 4BWGA 4UD2A 3GMDA 2VDUE 4IWXA 1SXJD 2EL7A 2P7IA 2V5AA 4JGIA 1NU6A 3WLKX 4H60A 3U4CA 4A82A 1VLVA 1VE6A 4BXOA 1GPLA 4B76A 2ZYUX 3IBTA 1WCV1 5KX5F 2IUSA 4O59O 2AV6A 5C1IA 1FJGB 2PQMA 3V6MA 2V7XA 1M1UA 4U7PB 4A8JA 1YTUA 4ESHA 3C45A 3EFOB 3CLVA 1L8LA 3KPJA 4GR9A 1YJAA 3CF4G 3LTEA 3LPAA 3P97A 1E9EA 4G9GA 4PSVA 3BCUA 2GEKA 3QF4A 1J0EA 1EFHA 1YKGA 2BCGY 3REGA 5CXSA 1ZW1A 2PKQO 2GZ2A 4HVTA 1Z5WA 3JZIA 3NXKA 3WAKA 1DQZA 2ZS9A 2ERYA 3WKBA 3G02A 3IIEA 1FUKA 2JK1A 4UHCA 4CV3A 1KZ1A 3THXA 4YP6A 3AVPA 5L4NA 2R9VA 4KH0A 1T5TA 2BDTA 3D3JA 1A5SB 1NF2A 2J45A 4IIFA 1EBBA 2WMDA 3HZZA 4MAAA 3MLBA 5AJVB 4ZOEA 1CEQA 5DM2A 3N9IA 4IGFA 4AXXA 5J43A 2IH5A 1AC5A 3P9YA 4B73A 4I4LA 3FFBA 4PO8A 3WWZA 2JJQA 1P1CA 1W94A 4OXRA 1ZGBA 1G20E 1FNCA 2UUBB 4CT0A 3O1IC 5AI6A 1NVDA 3AF3A 4JNCA 4HTAA 1DEAA 4AXBA 4UQPA 5BNZA 1YRHA 5J2UF 1UP7A 4WA7A 3SQNA 4R98A 4CM7A 4M1EA 1X3LA 2QKYA 3KQQA 2OBYA 4YQYA 1WD7A 4KXFB 3BMNB 1IPEA 2WJ6A 1P7PA 2QSYA 4GOXA 1HLFA 1HGXA 1IZYA 1X1EA 4R7ZA 5LQNA 4X64B 5GVRA 5H9VA 1E5VA 3HPRA 1E1NA 3N7TA 4FYPA 3FCCA 1EX7A 3WMXA 3U4DA 3VTKA 3ER6A 1RQ7A 1JFRA 4C9BA 3ZJVA 3O7WA 2IXGA 2E7ZA 2AQKA 5ESWA 1M1YE 2ZTMA 1A7AA 2E9SA 4LC0A 3IR6A 5AJYA 3WLRA 4NAHA 4MUXA 3ED1A 4M1KA 4LE2A 1U5AA 2W2KB 4GEKA 3BZUA 1X2BA 1Z63A 1NQUA 1F8UA 5JVDB 3RUCA 1ZMXA 3HBNA 3QEJA 5AMXA 1LK5A 5ALIA 5JAZA 2PMCA 1E4OA 3FROA 3D3NA 4FU0A 4RZXA 4RABA 4RQAA 1RLTA 2CVOA 3C24A 4WE3A 1IOLA 1YS1X 3WAGA 4GKKB 1NP7A 5DYTA 3B9BA 4FHEA 1U1GA 1KR2A 1VIMA 1QWOA 4S1NA 4TPKA 3VR3A 2ZI6A 1IOVA 4CTKA 3EIEA 1CUEA 4MYUA 4KMMA 4I1VA 3G9TA 3SXJA 3E8MA 3RGGA 2PSFA 3KXPA 1HDCA 3UGKA 3K0EA 5KWEA 3RSSA 3I62A 2RC5A 3C3XA 1ZOOA 1DJQA 1NKTA 4FOPA 5I8ZA 1C3VA 1PFQA 1LNSA 3JVVA 2PCLA 3ST7A 3ZDDA 1RYHA 2JIZA 2VWGA 4GNKA 4CV0A 3KB1A 4PZYA 5JZMA 3UUGA 1IUOA 2QZSA 3QYAA 1YL5A 3AFNA 2JCYA 3PL1A 2BFAA 3EY9A 1E3TA 1K88A 2H8GA 4JY7A 3RE1A 4HB4A 4KN6A 5CVEA 4P4NA 3BRWD 3SEQA 2KSQA 1T5OA 4TKLA 3TL3A 4IQ4A 1GD1O 3AERB 3IDFA 3PGKA 2EX0A 4YNBA 4IQGA 3CZ9A 1V5FA 3UBMA 1R9GA 3PEVA 4GR5A 3GQBB 4RUKA 4Y0AA 4BTVA 1H4VB 3KVNA 2IXFA 2QQGA 2G3YA 4R2KA 1OVMA 3ESQA 1F2UA 2XEDA 2H9YA 1Q14A 5ERGB 1T4DA 4TRJA 4EEXA 3ACCA 4JROA 2G4VA 1FTGA 1YT5A 3FVVA 1ZBDA 2DG2A 3LBFA 2WM9B 1DPGA 1SCUA 2PUBA 4M54A 1CUJA 1GRNA 3H5RA 2X4GA 3HDTA 1AMUA 3JVUA 1XCLA 3K73O 2VLBA 3ISJA 2WM8A 4AC9A 1JEDA 1GQYA 1LDMA 3AUSA 2O1SA 1Q1GA 2VAMA 2BC9A 2ODQA 2X4LA 2X7JA 4J9UE 4R3NA 5ALLA 5LU8A 3MMPA 4O2AF 4EUHA 5FYDA 5EE1A 1WWKA 2A8YA 3GT7A 1VJDA 3LCJA 1CV2A 4N6NA 1PG2A 4ZVTA 3RRYA 3TQIA 1RMYA 2JCSA 4H4CA 4ZVRA 3UJDA 3ROEA 1YZNA 1EWQA 2DTEA 5F1KA 5LU9A 2IX9A 2QDKA 3G82C 2PKYX 2L82A 4EI7A 4NRDA 2X3YA 3KD2A 4HQKA 4J4HA 4JKYA 5EMJA 1TVKB 3TQTA 1G5TA 4JUAA 5CM8B 2QXTA 4QPDA 3PCTA 2VJNA 2ZRMA 4YB8A 2ZSFA 3PQ5A 3MJSA 4ZVLA 3GCDA 5P8WA 3V9PA 3WIOA 6PFKA 2BGMA 3ABOB 2IE0A 3WYNA 4MVJM 2XGOA 1NW5A 2QAGB 4MICA 1ZWKA 2EZ8A 3FLAA 2EEPA 4DJDC 4JVLA 2LD4A 1R15A 3L7AA 1R66A 4P38A 1MV8A 4RACA 2EIXA 5IN5A 4NYJQ 3ME5A 3DFZA 4DLRA 3U6KA 2GEDA 4Z8YA 4JOCA 5FB3A 1NNUA 1P62B 5G4KB 5JZSA 1BA2A 5IW8A 3BSSA 3GELA 3OIVA 2CBZA 1J6UA 4IOKA 5DE3A 2FRDA 2PPLA 1PV2A 2OM6A 2JI8A 5ABPA 3AVYA 1G8KA 1QIIA 1XCJA 1L1QA 3KKNA 4DJEC 5H82A 1IJEA 1LBHA 2OCDA 4LZWA 4RO0A 1XX6A 3TFQA 3R3HA 4RX1A 1K6XA 4KDRA 4MCIA 1K6EA 4DMMA 5C1DA 4XR9A 1T5LA 4PLFA 4N4AA 3UCXA 3B2NA 1CRWG 3F5QA 4DPMA 2F7SA 4IKOA 4CJXA 2IEAA 3K20A 4DSUA 2IF2A 4ZHQA 2O3TA 3YASA 2OLJA 1PWXA 1RI4A 2H5JA 2YRXA 2D59A 3C14C 3RR2A 1WV1A 1TAHA 3V1NA 3WHKA 2DQYA 1PNQA 2JASA 3J7TA 5E2AA 4YUZA 1JMKC 2VPZA 3HDVA 1BFKA 4MVJA 1QLWA 1YB6A 1EA5A 3GA7A 5HILA 3RRBA 3ZW8A 5H3LA 1YULA 1HYBA 4IGKA 1X19A 5H3CA 3ZBUA 2ATVA 4CG0A 5LQCA 3L6CA 2FF7A 2Z6UA 3AR3A 1W36B 3PQ4A 4BTLA 2PT9A 3E3OA 4I8IA 2O8DA 1Q0UA 3UG7A 4CQJA 1LBTA 1ZP6A 3ZY4A 5F1PA 4G97A 3BYZA 2Q46A 5CH3A 3QNMA 4MP6A 4N5HX 1M6WA 3OEHA 4R41A 3UWKA 1RWQA 3HBLA 3W8RA 5K0LA 1SELA 3OJFA 4DLBA 1UBLS 1R3UA 2HZ7A 1KS2A 1S1MA 2X86A 3U2QA 3PQ8A 4YTEA 1KZ9A 1MJFA 2XEXA 3HNPA 4BYMA 1W8DA 4OXIA 2B8NA 4R7TA 3SJZA 5G1NA 3GLIB 1Y37A 4BCBA 2ZWPA 1H2RS 4B6OA 2OUIA 1FSZA 1GADO 2A0FA 3I2JA 4D99A 3CMCO 3DHVA 5JJIA 3N76A 1SXGA 3G68A 4TMVA 5DKFA 3R8XA 4FINA 4DNFA 2A33A 5JSQA 3BDAA 1Y7IA 1KZGB 2VBIA 3AUJB 3MQFA 1JPVA 4G86A 3QWBA 2YVUA 5DM0A 2PGJA 5CFRA 4G8JA 3LRPA 3C87A 4LJRA 3LA8A 4QZVA 3ZV6A 3UAZA 3P9PA 2DWQA 5FTLA 2GZDA 2WTEA 2CNDA 4JVMA 4EYGA 2FSPA 4TZTA 2G0NA 1LLFA 3H13A 5C5EA 2X0EA 3S0JA 1JG1A 1KORA 4KXUA 5B1YA 3GZNA 3TPCA 3ZD6A 2VHYA 4NZOA 2D7DA 4JP5A 5AIAA 1U0OC 2ILVA 2LBPA 3MBIA 1IN4A 2Y92A 2NO1A 4QJ5A 5AO9A 4ZTZB 4EJSB 4Q4AB 5AI8A 1ONNA 2I66A 3NC0C 3NYRA 3PEYA 3VNUA 4GPIB 5CXXA 4TWBA 1BN6A 3L0CA 2QORA 4AUKA 2EP8A 3GNLA 2QN9A 4HL6A 4JLOA 1ZESA 2ERCA 3U9LA 2WSBA 3JZFA 4CV2A 1OFUA 4NS4A 3BXGA 2PFGA 3MHTA 1KBQA 2VXBA 3FPEA 4HNVA 2W6JD 3LBNA 1QK3A 1BW9B 1ODIA 2I4TA 4KGDA 2W0MA 3K8OE 4DDTA 3FKSA 2M6RA 4CL0A 1X1BA 3BG5A 1SQ6A 3D8HA 4B2IA 3I9JA 2X7XA 2Z9DA 4CNQA 4QASA 5JW6A 4DV5B 2PQ2A 2ZYIA 1YS7A 2TMYA 1WBBA 2DHCA 1NUPA 2PT7A 4E5YA 4BLPA 3NALA 2IPLA 3UG6A 2PZMA 2BD0A 1JP7A 3V8MA 2O8EA 3IV9A 4EHLA 1NSFA 2FPKA 3HA7A 2QVZX 4UU1A 5IN4A 2UYCA 3TSAA 3IYLW 5CFNA 1ESCA 1YVEI 2D0IA 1TM4E 3A70A 1S2DA 3DMFA 2CYAA 4V0LA 2B7BA 1UJBA 2OQ2A 3R40A 1OHHA 1IG3A 4HGOA 1S2NA 2QT0A 2J87A 2R62A 1I4WA 4IIHA 2EQBA 2GAOA 1UXJA 2IKQA 1E2DA 2GPSA 1L4KA 2WIBA 1AV7A 1HG1A 3PKZA 4QULA 4W7HA 4CG2A 1J99A 1GN8A 1EFPB 1I0IA 4JELA 2FEPA 3C3KA 1DHRA 3CPHA 4B3DA 1GGKA 2JKVA 1CQIB 3AUXA 4ZOLB 3NJ8A 4NX2A 3LLMA 2VYND 3RK0A 1VBNA 3OX2A 5FUBA 2W43A 1TJYA 2FG5A 1EU1A 1H05A 2QMZA 4Y67A 3AY6A 2JIRA 3GJZA 1QTNA 5IU6A 1Y63A 3ENKA 1Y8RA 3U9TA 3F5SA 2GN8A 4L0DA 1VFPA 5GONA 1CC1S 2QVYX 2NU9B 4BLQA 5C32A 3JQEA 4UMDA 1W93A 2BTEA 3F8WA 2CDNA 3FCEA 3K8ZA 3MWJA 4JU9A 3HS3A 4J3JA 2OBMA 3KZ1E 2GKGA 3E4CA 5EP4A 4V0SA 4TMTA 4E70A 1V9CA 2QP4A 2ZJYA 4GPTA 2V4UA 4B2LA 1F7UA 1UBSB 3I5YA 2HWKA 1EWTA 5DBFA 3WYGA 4BFLA 5KSOA 4TRRA 4HYEA 3I32A 1DAGA 2RGBA 3TKYA 4M37A 1GG8A 1N2EA 2ZIFA 4BP3A 3PRKE 4EKEA 4LVUA 1VLZA 4WLOA 3PFIA 1B8VA 1G16A 2P8SA 2J3DA 3NPAA 1ZKMA 4W1SA 4A27A 5IEJA 1OFGA 3W5DA 3TW8B 3LW8A 1CW2B 4C2UA 5ITSA 4CIBA 4Q9KA 1JB1A 3RK4A 4M7RA 2I8CA 3AEYA 4INZA 3WLEA 5CDFE 4H0NA 5A3RA 4OKIA 2X0RA 3FDIA 2WV9A 4PCUA 1K7YA 1Z0DA 1BOFA 2WSLA 3PXUA 1OI2A 2Y1CA 3R3WA 2GM9A 3ZZUA 3UHJA 1RTKA 1Z5UA 5D85A 4LC1A 5K03A 4E94A 1RCUA 2AK2A 1WIWA 2ZUCA 4RPLA 5CTAA 3W5IA 4G07A 1YZYA 2ODBA 3OTHA 5AM2A 2MCFA 3TDKA 3Q7IA 4KZPA 1N2IA 1NJ5A 4NEHB 3AEQB 3NM4A 4HNGA 2O5VA 4KAJA 5KYGA 2N1BA 2JC3A 5KHLB 3OQPA 2I9KA 5EXDA 1Z4QA 5F98A 2D2VA 1GNQA 1NQWA 5EC8A 2IUUA 2HHHB 3JWHA 1QO0D 1MR3F 4AULA 3PHHA 2DULA 2JLSA 3T38A 3BL5A 2C8KA 3HJCA 3H6GA 2H51A 1F6WA 2BMVA 2DT8A 3JARA 5TJ9A 3UK1A 2WWTA 4RV5A 2Z2IA 1LKZA 2EVWX 2HXGA 3OP4A 4Q9HA 4XDGA 5COQA 5AK6A 4CQMB 2Y66A 3USCS 2NTYC 5J47A 1CJBA 3VBCA 4BXOB 1DUVG 1NFFA 3D64A 3E22A 1U31A 3B70A 3HEAA 2BZGA 4P7GA 5D00A 3R7BA 4C7KA 2QNIA 4PGGA 3D4OA 4Q3NA 3HCFA 4B17A 1RKBA 2PVCA 4D26A 1VCMA 2EU8A 2VRWA 2B4QA 2W22A 1G2OA 1AT1A 3ZZTA 1YC5A 4ECEA 1OC2A 1J2JA 1E3WA 1JI3A 1RE1A 5M29A 4QTUB 2PBZA 5KOYA 1GVHA 1SXJA 4BLOA 4HH0A 3QWIA 1U7PA 4JC4A 2W83A 8GPBA 4DR1B 3EA4A 2R1VA 2YFHA 3DT6A 3R24A 5IK2A 3GCGA 1RWWA 4U2FA 3RTCA 3VC2A 4F3TA 1GPWB 2C2GA 2DUUA 4P58A 1C1YA 2C2KA 2AZXA 2POQX 4PG5A 4Q3EA 5DGDA 5C8YB 4HRAA 2RJ3A 3EMKA 3FA2A 1PV1A 5TVKA 3P2OA 1C3JA 3D6UA 2ZWAA 3TZLA 1EIZA 3M2TA 1ZK0A 2V98A 3NRCA 5COBA 3HACA 1CJUC 2PD3A 4ZCPA 3PXGA 2CZQA 4NJMA 4EUSA 5I7AA 3SC2B 3FPBA 5HDQA 1H4SA 2IJGX 4KIGA 4UTXA 4DJFC 5F9MA 1G19A 3ROXA 4RF4A 1Z5GA 4X66B 1E1YA 2BSXA 1HZZC 3CH7A 3OF3A 4YGYA 4LXQA 2QS9A 4Q1BA 2FPGB 2X6RA 2RGUA 4W8OA 1SC4A 3BIXA 3JAKA 3JQGA 1QVAA 2GPWA 3O5AA 4R2MA 3BVPA 4DGSA 2IYVA 3B1VA 4CM4A 4GPEA 3TECE 5IM4A 5FOTA 3WFIA 2QOEA 5EP1A 4LDNA 4QA9A 1KS9A 4N49A 4C0KA 3OA2A 4JXJA 1CRQA 1HI9A 1ZLYA 1DEXA 1IUKA 3Q0EA 2FR0A 3VOTA 3TTXA 1QP8A 2WA1A 4YS6A 1E5DA 4FMPA 3QE2A 3FWNA 4ZJZA 5C3MA 3QLUC 1VG1A 1JLLA 5FAXA 4C2BA 3G2MA 5TV2A 5I4IA 1LDEA 1ZCFA 3BB4A 1Z13A 1DTWB 3WGQA 3RS9A 2O54A 1N0HA 2R6ZA 4MA0A 3IESA 3EXAA 4RU1A 4RLFA 3TI9A 4HYTA 1DWOA 4BDSA 2WU0A 3HI4A 4I55A 4D5GA 4US2R 5CX4A 5JEDA 3DT9A 3I2IA 3E58A 3OOYA 3UMRA 3SSOA 1OBFO 2VAVA 3NUZA 5FCDA 3OQJA 2AUMA 2C1XA 2R2AA 3IB6A 3K1YA 2DRIA 1JT9A 4KGVA 3GUCA 2V5VA 4DJTA 3G2QA 5A3JA 1Q92A 1J2TA 3A1VA 3GEBA 3ILSA 5EZ5A 3BXFA 2JJMA 3NLLA 4JI6B 4LFCB 4DDWA 1WZNA 3HJUA 3WBJA 1V8OA 1IEXA 2OT3B 4PY2A 3K35A 4DRXA 1GZVA 2ZZNA 1HORA 1V7QA 4EVRA 3SYRA 5C8VA 2Q3EA 3ZWPA 1EVEA 2VH1A 2QNBA 1TTHA 1RM4A 4FLEA 4KODA 3S4YA 4CM9D 4EEKA 2JFQA 2WABA 1E5TA 1H9CA 2QW1A 1HYEA 5DTRA 1SUWA 4LPKA 1ZIXA 2JJ8A 3BMCB 3NTLA 3OQHA 3WZMA 3UMMA 3C3YA 8ATCA 3IR7A 3NYQA 3II6X 4GGMX 1GV0A 4NMHA 5ITZA 2Z6QA 2ZW9A 2IPMA 1PJAA 2BUBA 3M2PA 3I6IA 3K94A 4YK7A 5TMBA 3RUHA 3SE7A 5CCXA 2AVNA 4K9QA 4REOA 1NBEA 4UASA 3F6EX 5T67A 3RI3A 3AY3A 1XALA 3OEWA 4OBWA 3VX4A 3IOCA 4ALNA 2Z2KA 4Z53A 2Z3WA 3QEAZ 5L6MB 2WJHA 3MINA 1GCUA 4GW3A 3ETHA 2YNMC 3WHPA 5CXQA 5DASA 4DLPA 1HL7A 1QYXA 5EIAA 1RC0A 5KQPA 1G4UR 3ETNA 4K6CA 1FDTA 2B83A 1TK2A 3MUOA 3PGJA 3UB2A 5E1MA 4PSUA 3WNQA 1QANA 4ETMA 2AFRA 1YNSA 2FN9A 3KDSE 2RGAA 4BWFB 2A7XA 1ACMA 4ND6A 3SZOA 3KJZA 2ZJOA 1WB9A 1PW5A 4COKA 4Q1VA 2NXWA 3H1AA 1GU7A 3DO8A 3GDHA 3HDJA 3G88A 2XB8A 4OHRA 1ZIPA 1UDRA 3NJRA 1FTYA 1P0CA 3DDSA 4QTYA 4I1RA 1E6UA 2ZUVA 5BN3B 1ZY2A 5JATA 3QBDA 1LBIA 1NW6A 4O2BB 1RYFA 1LH0A 2QBYA 1BMDA 2ROQA 2WPDD 1TF2A 3KHSA 1SU8A 4XOUA 3QG1A 3H5LA 3NP9A 3RLIA 1Z6YA 2ECKA 2QI9F 3VO1A 2F55A 4K6OA 1HL3A 4WLUA 4PWZA 1FSGA 2C9ZA 4YJ2B 4EY3A 3F6BX 1JAYA 2ZIEA 4H6VA 4NHOA 1Y89A 3HR7A 1MORA 2VG8A 1W2WB 3CRMA 4GKVA 1GA1A 1GKLA 1JUDA 2VYVD 4JNKA 5DNAA 3BMOB 4EB0A 2JLVA 2EW2A 4DLZA 2B34A 4N9WA 1VPTA 1YVRA 1VECA 2OA0A 3EEIA 3TWOA 1HPLA 2HGZA 1U9CA 4QREA 4R69A 1AU9A 7REQB 4F06A 2DPLA 1XEAA 4C7BA 1XWFA 1V5IA 2DY0A 4DTCA 2WSSD 3RS4A 2IOFK 1JIUA 5DGXA 3I2KA 3NUQA 4LGVA 1FFEA 1GIAA 1H1TA 4TRNA 2KE5A 1L5QA 3V48A 4ABYA 1KYIA 3NEJA 4QEZA 2YVAA 3IOYA 4RVSA 3A28A 1ISGA 3OD1A 4P54A 1IY2A 1ZBQA 4R8VA 1IXRC 4DLAA 1DUIA 4GI2A 3OFKA 4E07A 2D54A 3AJ9A 1I7SB 4MUJA 2FQWA 2RI6A 4Y9DA 1GQFA 1TT5A 5F21A 4CT4B 5JCJD 5K8TA 4EYOA 2P2SA 1FYVA 5DXFA 4JHXA 5KUTA 3AM5A 4TXMA 2YFYA 2WWVD 2Q0HA 4RV4A 1UBCA 3ORQA 4M88A 4PZCA 3K09A 1Q0SA 2JA2A 2QV7A 4NOJA 1V1MB 3VYWA 1UMDA 3DA8A 1CIJA 1W5EA 2IH4A 4BZQA 1AXGA 1PQYA 5LVAA 4DR6B 2C29D 4Q7JB 3SGLA 3W4IA 2PNFA 3SJUA 4LXIA 1UDXA 3L7IA 2HA4A 1T43A 3PF9A 1O8BA 3RW9A 2X8WA 3JS5A 2C82A 4X3CA 2CNKA 5DCWA 4IHJF 1SUSA 2JHGA 2REOA 3FGZA 5TT0A 4DT1A 5ECGC 3ROTA 2OLEA 2C2ZA 3PQ6A 4MLDA 5JI3E 3E27A 4C4SA 4XSHA 3IOEA 3KKEA 3ZIAD 2Q5FA 2HJVA 4XM1A 2PJUA 1CE8B 3BM5A 1PFWA 2OKGA 3LUHA 2VHTA 5E7MA 2AEJA 1U1EA 5IDYA 4QGGA 2IXAA 5LZ8A 1QYCA 3HFJA 3RIMA 1XJWA 1X7HA 5IUJC 3FM9A 1NUSA 4QWMA 3F7TA 4K1LA 5KSPA 2YMPA 3IXLA 4EG0A