4M9QA

Crystal structure of c-terminally truncated arl13b from chlamydomonas rheinhardtii bound to gppnhp
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
196
structure length
195
Chain Sequence
GPRKITIALLGLDNAGKTTLLNSIQGEDRDTTPTFGFNSTTLNEGKYKIEVFDLGGGKNIRGVWKKYLAEVHAIVYVVDAADPGRFEESKMTMAEVLENQFMRDKPICIFANKQDLPTAAPAAEVVKGLGLATCRNSHNVFPCTAKMPAGQDVDHRLRDGLKWLVGTVDREFGRLDPRVQTEAEEVRQEEARKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the small G-protein Arl13B and implications for Joubert syndrome.
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Hydrolase
molecule keywords ARF-like GTPase
total genus 71
structure length 195
sequence length 196
chains with identical sequence B, C
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2013-08-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4m9qA00
4HLQB 1U99A 4KYIB 2CCGA 3IHWA 4V0LA 1G9XA 4M1OA 3EIQA 5TARA 4EAQA 3AVPA 1GKYA 3LRPA 3A1SA 3NBFA 3IEVA 2P5SA 5HZHA 2ZSBA 2ZRIA 2G9NA 1D9ZA 4YMTA 4YXWA 1UKEA 4Q1FA 3HPRA 4GL2A 1E2IA 4QGHA 3OFND 2V55B 4QJ5A 4P32A 4TQUS 4EPRA 2J59A 3RDPA 4TL8A 5KSYA 4US0R 4LYJA 4JBXA 4E09A 3PUYA 1I4TD 2WWWA 2NPIA 4MKFA 3AF1A 4DDTA 4ASUA 2XZPA 2WJYA 3IBYA 1Q1EA 4RZUA 4BFYA 2EQBA 2O52A 4OQNA 1QHHA 5FPYA 1DELA 2QE7A 4JJKA 1U0JA 1FTSA 4WXRA 3VR2A 1R4AA 5FTNA 3BH6A 2C77A 4DIEA 1IY1A 3ZYCA 2G0NA 3CWZA 3SFVA 3KQUA 4QBGB 4G1UC 4G5SA 4Q00A 4CYMA 5LD2C 2XSZA 1U0LA 1YU9A 3ADKA 1XTJA 1ZM3A 1NSTA 1EFRD 1Q1ZA 2QRZA 2VP0A 2WSSA 4PAQA 1TU3A 3AEZA 3IEUA 1HTWA 4QGFA 4DLWA 3GQBA 1JEDA 4OBEA 4LCBA 4DRZA 5C2JB 3J81k 3JVUA 1VCMA 1P6XA 1ZNZA 5C18A 3PITA 4Q1DA 5UKDA 4HAUA 3MWKA 1U8ZA 1NBMD 5HCIA 1RW4A 3ICQB 3RS5A 4B32A 2Z43A 3THWA 2ZRPA 1GNRA 1CR2A 3THYB 1W5SA 3AVXA 4N0EA 1VCNA 2G88A 3FMOB 4C0HA 3GJ7A 2AN9A 2R6GA 3CONA 1LS1A 3CRW1 5FR1A 2ZVPX 4ZO4A 2ZR7A 5M04A 1TTTA 1LFDB 3GLIE 3EA5A 3PR1A 2OFWA 1EFUA 621PA 2YJTD 3KQKA 2F1IA 4BGDA 4JLJA 2C5LA 2ERXA 5E3HA 1U8AA 3TSOA 5JMTA 3RC8A 3AGPA 3PEYA 2GKSA 1M6NA 3OIUA 4KITB 1ZUIA 1E2GA 1VIYA 4IFBA 4JS0A 4NP6A 4UNSA 3RC3A 1KSFX 1VHTA 4P33A 3WXMA 5JCPA 1KO5A 3NIBA 4I1UA 4C7OB 4TYYA 1SVSA 1W4AA 1XNJA 4LPKA 4DIDA 4DSTA 1HY3A 2CBZA 3C5CA 3U5ZB 1BOFA 1QHHB 2QNRA 4EJSB 2VA8A 2ZTSA 4JLMA 1M7HA 1Y3AA 1IJFA 3TUJC 4H1UA 3OESA 2QUZA 1Z07A 4R9UC 1XTRA 4HLUC 2J9RA 3RWMB 3HPQA 3KXLA 4OQFA 1E2PA 2CHQA 3IQWA 3QPUA 5FPHA 1OHHD 4CDGA 1Z63A 1YR8A 4M1TA 4QGGA 4PO1A 2MSDB 3KUDA 3UANA 3VX3A 4B76A 4KVGA 2RKOA 3LW8A 1UKZA 4LHXA 4LPSA 5EE1A 1NY6A 1CBUA 1KAOA 4NONA 2C8VA 4RFSB 4E03A 5J4KA 2FFHA 5TMPA 1E99A 4DLXA 4HB0A 1W7AA 2VEDA 1E9AA 1RRGA 4ERNA 3ND9A 5GVSA 1MH1A 3THWB 3BD9A 4DXAA 2AXNA 1IJEA 1RRFA 3SNHA 3U7FB 4I81A 1D2MA 4LK2A 4EQ6B 2B7CA 5TXGA 3HWSA 1N6OA 3CF6R 3LX8A 4U7DA 1AIPA 1JEEA 4Q1CA 2XNDA 4LGMA 1LY1A 4F38A 4POAA 4DUGA 4DJTA 4XWOA 1H65A 3P20A 1RYFA 2H5EA 3UMSA 3GJ3A 4MDEA 3BBPA 4B2LA 2X8AA 2ZANA 3BERA 1M8PA 1A82A 1OXTA 2H16A 3AV0B 4D4MA 4EPVA 4A2WA 4BFUA 1NNEA 3H84A 5AUPB 3M1IA 1RFLA 2W6JA 4LOAA 1EWRA 2R65A 4DCTA 2J0UB 2J0VA 4JVSB 4ZI2A 5FPKA 3CW2A 4BEBA 3IBGA 4TYWA 3EZFA 4Q9KA 3KKMA 4MGZR 4ESVA 4Q9HA 2ERYA 5EP1A 2WIAA 3K0CC 4E07A 3LV8A 3KJGA 1W0KD 2DWQA 2IT1A 3LD9A 3PEUA 4KI0A 4TZ6A 1KI9A 2GXAA 2HDNB 1GRNA 3PG5A 5EZ6B 1GP2A 2HJGA 3R20A 4NYMQ 4D6PA 1N6RA 2ONKA 2WKRA 4IDPA 4HDQB 1QF9A 1WB9A 2QU8A 3ZQ6A 1G7SA 2ZJ5A 5JEEA 1NJFA 3KQNA 2F7SA 1E2JA 4TTRA 2ASEA 4HDOB 2JJ1A 4JLKA 4PC1A 4V03A 4GNKA 5H8WA 2FFBA 4GMDA 5LB2A 1CTQA 2G6BA 3EZ6A 5DYGA 4B3XA 4C0LA 2NQ2C 3EZ2A 3BJIC 4QXAA 4FD2A 3R7WB 1PV4A 1D9XA 2B8WA 4HAWA 3KXKA 2VP4A 2JLYA 3HDTA 4Z8YA 4ZV4A 2XX3A 1AS3A 3AQ4A 4BLQA 4HEJA 2C9OA 3B78A 4Z1MD 1HUQA 1QHNA 1GZSA 1JR6A 4EQ6A 2ZJZA 1IBRA 2RGEA 2W0SA 1D2NA 2KBEA 4DDUA 1R10A 1XD2B 1RC8A 2OHFA 1N25A 2ZETA 3T5DA 4Z1MA 5GJVC 1PVOA 2UVQA 5CJPA 4DLSA 3IKJA 2FEOA 2WV9A 4DEXA 1T6NA 2DYKA 4GP7A 1YRBA 3FMPB 3ZVLA 2XZLA 1N5KA 4RKEA 3RS7A 5L3VA 2ZSDA 2O8EA 1R5BA 1OV4A 1YR9A 4LC1A 4DT1B 2ZI4A 3LO5A 1RRCA 1ZD8A 5E7MA 3EC1A 3U4QA 3AF0A 1QG4A 3KQLA 2CNWA 2JCSA 1DAFA 2QM8A 4PC3A 2IYWA 3A1UA 4JVMA 4AYWA 2H17A 4PPQA 2NZ8A 2WJGA 1KI3A 4YMWA 2VHUA 3JZAA 4CEHB 3SC3A 3K09C 3MCAA 2IYZA 2X1VA 2O8FA 1RE0A 3GLGB 1TEVA 2JA1A 1KI7A 5KOYA 4HAYA 2PZFA 1FQKA 3P32A 5CJ2A 4Z8XA 5FL7D 3BFXA 1A2KC 1AS0A 3HU1A 1KJYA 4CEJB 3UG7A 4X8OA 4PZLA 5CYPA 3RLFA 2XB2A 2IS2A 5L3QA 1A4RA 5KNDA 3K70C 2K5UA 4NZYA 2JATA 1NY5A 1ODFA 3I92A 2IS6A 4KO8A 3GPLA 2P3SA 1II9A 2Q9BA 3QSYA 2FWRA 3C14C 1N6KA 1XXHE 2QMEA 3P4XA 2QM7A 2WJHA 2R9VA 1GRQA 4CRWB 4DDWA 1EWQA 2V54A 4OQLA 1KO4A 1LVGA 3ZZUA 2V1XA 3B2EA 4NYJR 4BFTA 1EGAA 1XEWX 3QF4A 3EPJA 3D8BA 5DI3A 4YMSA 5BN5A 2UKDA 5F98A 1FMLA 1QHGA 5DE3A 1FTNA 1DAMA 3NHBA 5JS7A 3GLHB 4ZDWA 1WF3A 1G7RA 4M1YA 3THYA 1E79A 2OV2A 5BQ5A 4V02A 4WOPA 1VHLA 3TKLA 3U3RA 3B82A 1I2DA 1MT0A 3GFTA 1HYQA 4H9GA 4JLAA 4NTZA 5FL3A 1AKEA 2W6IA 1FNMA 3AVVA 4YLGA 2JGNA 2IUSA 4O2LA 1NVVR 3SN6A 3BRWD 3ZD6A 5LB4A 1E2EA 2JEOA 4S35A 2ZSFA 1P5ZB 4TTQA 2BHRA 3CRRA 1XD8A 1E3MA 2HXYA 3QEJA 4V0ME 3EX7C 4TSFD 3Q5DA 3GLIB 4MRPA 5KPDA 1QDEA 2GETA 2ATXA 4EPXA 2B6HA 4DZZA 3G82C 3PIRA 4Q4JB 4EJSA 2A5DA 4LV6A 5JS8A 3V4RA 1XPRA 4FWIB 1JR3E 1IM2A 4CW7A 2ZU0C 2AHOA 4LBVA 1KJZA 1SZPA 2PCLA 3A4LA 4PHGA 2EU8A 2NO0A 2A78A 2GVDC 4B6EA 4JLPA 3T1OA 5BW8A 4HYYA 3SHFA 1DBSA 1P75A 2H1LA 1II0A 4FIDA 3JZMA 2QA5A 5FPSA 3ZZTA 4JKIA 4HB3A 4ARZA 2WJVA 3V00A 3R9WA 1W48A 4YDHB 5A0FA 4HZIA 1ZVQA 3CBQA 1UBEA 2J87A 2WWIA 4MUBA 3BXZA 4GZMA 1AKYA 2J45A 2J7PA 2QPTA 3MJRA 3LXRA 1S3GA 2G83A 1D5CA 1ZU5A 2GCOA 3DZDA 4QHSA 2D4HA 2WWHA 3LLUA 2IBMA 1HE1C 2WAXA 1DTSA 2A3RA 3OFNA 2IHBA 2DWOA 4V0OA 4D0GA 4HUTA 3SFZA 3QKSA 1YRAA 5KO2A 1GIAA 3UMRA 2RH5A 1W5TA 2YINC 3SJBA 2C95A 5CM8B 3WHKA 2BBOA 1AK2A 4JL6A 3T1QA 1PJRA 1XMSA 3RHFA 2QTVB 1FP6A 1N5JA 3U2QA 5AJZA 2IA5A 4LV8B 3H4MA 4MRSA 1MABB 3VR5A 2P67A 2F1RA 2FDCA 3ZIAD 2VHQA 3VHLB 4AWXA 3NVAA 3K9HA 2QGNA 4EFLA 4K46A 5EP4A 2ZRNA 4YONB 4YQFA 1E1RD 1SXJD 2NO9A 5AJXA 3L43A 3OF5A 5FUYA 2BEKA 2WZQA 5CDFA 4AK9A 1GKIA 4D4KA 2PEYA 4EDHA 4PAOA 2BMFA 3GFPA 1G41A 2F3TA 3LLMA 1FUUA 1KI2A 1RKBA 4M9QA 2P6UA 1E9BA 4TL9A 4DSNA 4ESHA 2IX3A 4A8JC 1P7CA 2Z83A 4CGZA 1Z0KA 2RGCA 4RFVA 1GAJA 1OJLA 2Q21A 1IN6A 3GJXC 5CITA 2IXFA 2QMHA 3IPYA 2IYVA 1L7VC 2JLRA 1Q0UA 2BMDA 1E9DA 4XH9B 3GJ0A 3KKOA 4URWR 4BECA 2XJ9A 1E4YA 2IL1A 3IHLA 5FPTA 1XMVA 3KXIA 5FI0B 4B2IA 4LSGA 3W90A 4FCTA 1IQPA 1GRRA 2Q6TA 2WMNB 5G40A 4B6FA 2HF8A 1KK3A 5D3MB 3UIEA 3CZPA 3WMEA 1TF2A 5EE0A 1MV5A 4FMCF 1YZTA 3DL0A 1XCPA 3GLHE 5FBLB 3RRYA 1E2MA 1RIFA 3EPKA 1OFIA 4PANA 5ELXA 2BJVA 4TMVA 4CVNA 1MKYA 2ZJ8A 2ZRMA 1GOTA 3TK1A 1K6MA 3D31A 1UJ2A 1TADA 2AX4A 2AXPA 4BLPA 4D2IA 3BH0A 4LHZA 3K0FB 3GLIA 2GJ9A 4V0KA 3A58B 1JB1A 1G18A 2XXAA 4TMXA 1E0KA 3B85A 4XIGS 3T34A 3WYGA 1ZJ6A 1P9NA 3CLVA 5SZKB 1G3RA 4KLZA 1ZIPA 2XTMA 1Z0IA 1COWD 1WQ1R 4BFZA 2R6AA 5DHFA 1XFAA 3RS4A 4JLNA 3GMTA 4BFVA 2IUUA 3P27A 4PHHA 4B48A 4DLRA 5L3SA 2JAQA 1DAIA 2JLUA 2FMXA 2L0XA 4L15A 4IDOA 2YYZA 3U7GA 3PJRA 3VKHA 4OI4A 4WZBE 1S9HA 3WYFA 2E87A 4D4LA 3GEEA 3Q5EA 2NPFA 1CJMA 1CJUC 4UJ3A 1F2UB 1E9SA 1ZCAA 2G1KA 1IN7A 1OYYA 2OEPA 2QENA 2NGRA 4IFEA 4EUNA 3H0KA 1KGDA 3I32A 2WICA 1OT3A 4LRWA 3V4FA 4JLBA 2REBA 5TVKA 3QUSA 2ODWA 2VSOA 4FINA 1VYUA 1E1RA 2BKEA 3MRSA 4E22A 1AQUA 3OE7D 3TNFA 5FOSA 5KPJA 1CRPA 4US2R 3TJZA 1G1MA 4Z54A 1AM4D 2IW3A 4I1SA 4NCHA 4Q18A 4A82A 5IT5A 3D6TB 3BC1A 2GRJA 1FNNA 1JALA 3QE0A 5AUNB 5GJCA 1R0ZA 2NO1A 3NEJA 2QY9A 3I5YA 5K8UA 4F7WA 2YC4C 3VR6A 1ESNA 3W6PA 2VH5R 3NBYC 3NH6A 3CM0A 3WRYC 1SGWA 3SI7A 2Q3MA 3VNVA 2B21A 3BB3A 1Z2CA 3U3KA 4TL7A 4LJ5A 3C7KA 4EFNA 1LF5A 2YNMA 1OIVA 3B1ZA 2ZR9A 4RZXA 4HLCA 4YC7A 3IILA 2DFTA 3F8TA 5HZKA 1P2VA 1WA5A 1KYIA 1YZGA 2ZI3A 4DHEA 1K5GA 5JWRA 3NKVA 1OSNA 4LJ9A 4B71A 4KXFB 1P4SA 2AWOA 3QXHA 3P1JA 4MA4A 2C2HA 2A5FA 1UPTA 5DI3B 2FX3A 4Y0VA 3K09A 3S1AB 1CRQA 2V4ZA 721PA 4Q4HA 1JR3A 4MDFA 5F9HA 3HU3A 4N1AA 4UJ5A 1Z0DA 4R2IA 1XB2A 1Y63A 1XBTA 3ND8A 2H57A 4PQYA 4XSHA 2OT3B 5FTMA 2AK2A 1CS4C 1G19A 2REXB 1Z83A 5E95A 5AR1A 3CX6A 3NDBB 3LH5A 3IIMA 2CHVA 3KZ1E 2ZJYA 1HT1E 1M74A 1JR3D 1ZC4A 4HUQA 5CK5A 1NBME 3H1TA 4U5XA 3TR5A 5HKKD 2XITA 1NG1A 1Q21A 4DCSA 5HTKA 4B74A 1Z29A 3AH8A 1QG2A 1XX6A 2PZEA 4PSKA 4A4DA 2BDTA 3UXMA 2WWYA 2VP5A 5DYIA 3TQCA 2OCAA 1SKYE 4JLDA 1C4OA 4TT3D 3CF0A 1HV8A 1P62B 3W3AA 1GG2A 4G3XA 5G3YA 1Q57A 4KVAA 4DDVA 3G5UA 4JYCA 4DCNA 5JECA 3OEEA 3FMIA 4P0TA 2ZM5A 4TLBA 4A92A 4G0NA 4V0MA 3I62A 1R0XA 4A1FA 5DNYB 4MGKR 2O8EB 4AKGA 1P2TA 1PZNA 3EZ9A 2FSGA 3QIAA 1OIWA 4BFWA 1Z2AA 1I4LD 4PR0A 3NBZC 4F93B 2IYLD 2NMVA 5IDVA 1JAIA 1BO6A 2IYYA 3Q3JB 4DLVA 5JHHB 3UATA 1U94A 4KYUA 1KI6B 2OO7A 4QJ4A 2C9CA 4Q4LA 2ZRAA 3I61A 4NBSA 3LNCA 3N2EA 3TUIC 2ZRBA 3T15A 1JQLB 2XAUA 5B58C 2FNAA 5DI9A 2HEIA 3NWJA 1NMXA 2QPOA 5FOUA 2D7DA 3X1XA 2I1VB 3SYKA 3GJ6A 2CE2X 1GL6A 4BZPA 1JPJA 2ZRGA 2ZRCA 2KB0A 2QI9C 1N6HA 5JJIA 1NN1A 1W0JA 4R71A 3S1AA 1P2SA 1MO6A 2GEUA 2RMKA 2WWFA 1I4DD 3O47A 4AC9A 4Z51A 2RGBA 4BLSA 1ZM2A 2OG2A 4E5UA 5J4LA 4M9ZA 1ZUHA 2F9LA 1EX6A 4O25A 1XU4A 2NG1A 4ZCLA 2CJWB 4BEJA 5KDOA 3T61A 4ZIRB 4QL3A 2BWJA 2GEVA 1LB1B 2VO1A 3DMDA 1NLYA 1N0WA 1TU4A 3EIHA 3L8YA 4AYTA 2F43A 2R44A 3DEFA 1W36D 4TLCA 3I4LA 5GADl 2GDJA 4A0GA 2CL7X 2GCNA 3CR8A 1OB2A 4A15A 3M6AA 2G3YA 2ODEA 4Q1BA 2F3RA 5J4HA 1ZIOA 4C4PA 1KOFA 2CHGA 3K9NA 3KJEA 4OHYA 3QOFA 3L0PA 2RCNA 1SVLA 4D26A 2RGGA 5L8VA 2ZXUA 3AVOA 3AGQA 3FKSD 4XD7A 3MWLA 1RRPA 3CPHA 1X86B 5EE3A 1GNPA 4HZUA 4P4TA 5AJVB 1CJTC 1G8PA 1N6NA 2C03A 3Q85A 2FF7A 4OYHA 4Q4AB 3TIFA 1OFHA 3OEHD 2ZS8A 2FFQA 3RRMA 4IVRA 4IXMA 3RANA 4Q4HB 3TMKA 3CH4B 1KO8A 2PBRA 1KI1A 1IOZA 1IN8A 2Q3HA 1E2DA 1R5NA 4RCYA 4JJZA 5F2EA 1CXZA 2JLXA 2PT7A 2JDID 3X1DA 2OZEA 5EE9A 4TQAA 2P0EA 3AKDA 1XP8A 3PUZA 2I1QA 2FV8A 2F55A 3FPAA 2BIFA 5FBRB 3VKWA 3PEVA 4OQXA 4EIWA 1GILA 2VRWA 1MRNA 5TY0A 3H2YA 4GPTA 3UMFA 1MO5A 1CU1A 2DFNA 5FBWB 3DOEA 4X8HA 4URVR 5KSOA 3U3JA 2WOOA 2ZUBA 4LJAA 2FGJA 2BV3A 2YV5A 3A1TA 3C5HA 1BMFD 3MMPA 4V0NA 8OHMA 2DB3A 4L16A 1IONA 2WAYA 3OIWA 1OW3B 1OXXK 4NHOA 1OKKA 4L9WA 1XCMA 2BBTA 4IDNA 3LQRA 1XEXB 2GWHA 4NCNA 1M34E 1Q44A 1XTQA 1IAQA 2C78A 1P2UA 1VYTA 4TZ0A 4JKYA 4BLRA 3LBHA 3FFBA 4B3BA 4ZPXA 2O8CA 3WRXC 2ZE5A 3TGPA 3BWDD 4XTCS 1E0JA 2GZAA 1VECA 5J5CA 3ECCA 4D81A 1R6BX 2UZ3A 2OXRA 2PT5A 1UAAA 2REOA 3PVSA 4TTPA 1SXJA 4QHYA 4PZYA 3ZD7A 1CLUA 5KSPA 1HEIA 2YWFA 1H8ED 4L5BA 1ZU4A 3RSOA 2J3EA 1YQTA 5D3MA 4C0QC 1ZUNB 3ZIAA 1B23P 2EYQA 3RRNA 1OKKD 5HR5A 1S4QA 5KDLA 1GUAA 2FJUA 3UKDA 3GFOA 1MOZA 2QQ0A 5EP3A 3EG5A 3EPHA 1G17A 4XVRA 2YKGA 1A2BA 3LFUA 5DH9A 5DN6D 1G8YA 1KY3A 1W2HA 2ZI5A 2GCOB 3X1WA 1FUKA 3F3YA 2I4IA 3D3QA 1BYUA 2QZ4A 2WPDA 2E9SA 4O0MA 2R62A 1T0HB 3BIFA 4RD1A 1IXSB 3GJ4A 1Z6XA 1W0JD 1G291 2ZRFA 4PO8A 3CPJB 1T4GA 2ZRJA 3I3SR 3FKQA 3BAFA 4KCGA 2ZRLA 2EFEB 4NL4H 1NRJB 1KY2A 1DG1G 1PUIA 2CLDX 1VKJA 3KL4A 1UBGA 4K81B 4IDHA 3DKPA 4CIDA 1P9RA 2OXCA 4Q7KA 5BYJA 4HAXA 4HAZA 1M1YE 1JAHA 4ACAA 3AF4A 5FUVA 521PA 3K0SA 1ZNWA 2VL7A 1VMAA 3MFYA 4AY2A 3OZXA 1P72A 3A4NA 3OIVA 1Z47A 4RJLA 1VCOA 1K8RA 2ZJBA 1G4UR 2BJWA 1AQYA 3BB1A 4JBYA 4KODA 1YZQA 3SYNA 4LBZA 3U7EB 5J4YA 5IRCD 2OILA 1IY2A 1OIXA 4RZ2A 2V1UA 2XOKD 1NG9A 2O8BB 1DE0A 1T8TA 4BUJA 3WMGA 3K9GA 3ZDQA 4NU0A 3P4YA 4LX0A 1WXQA 1LTQA 1KDTA 4N3NA 2C99A 4NKRA 5FTKA 4ON9A 3DHWC 3CRVA 4PXAA 1R2QA 3QG5A 3QXSA 1E98A 2R2AA 5TV2A 5BN3A 3QKSB 3NDPA 2QAGB 5C4GB 3NXSA 2VP9A 1WCV1 1R7RA 1OFUX 1FFHA 4C2TA 5HKKA 4XWKA 1VCIA 2W6ID 3ADDA 2Z5FA 5JWOA 2ZITA 2JLVA 5K8TA 3M0EA 3BFKA 4R98A 1U9IC 1TQ6A 1FW6A 2MMCA 4D0LB 3W8RA 1EK0A 4IOKA 1S1CA 2GXSA 5JLJA 1L4YA 4NCJA 4DLYA 1XF9A 2GK6A 2QN6A 3VFDA 1W46A 2ZJAA 4TQ9A 2ZEJA 2PEZA 1WBBA 2A7QA 5H1YA 2GILA 2GF9A 3QKRB 4MKHA 2NZJA 3C8UA 3SU8A 2HT6A 2WSMA 1EX7A 2YC2C 4MYUA 1T3LA 4NPHA 4TLEA 4TMWA 3C16C 3RS3A 3VR3A 2QE7D 1Z6GA 1GITA 4JSYA 1OXSC 5CIWA 1JNYA 2IK8A 3FE2A 1S0UA 3PV0A 5H70A 1Z22A 4MYTA 2P65A 2WIBA 2O8DA 1T5LA 3QY0A 4MRNA 4PSAA 1CR4A 1E32A 1XEXA 3QXJA 1LNZA 3QKTA 1T3HA 2F43B 2BCJQ 2VQSA 3GLGE 1E9CA 4D25A 3HYTA 3OEED 2OLJA 1J8MF 1GFIA 1IHUA 1N5LA 1X1RA 3B8HA 3QBTA 2AR7A 4AKHA 4PC7A 4X8LA 4L9SA 3GLHA 1Q22A 1ZC3A 2YVUA 1Z08A 3BB4A 4Q7LA 5JSZA 4XJXA 2GBLC 2KI5A 4LYAA 2ZRDA 5D3QA 4O3MA 1XCGB 1TPZA 3EA0A 3U3MA 2GJKA 3NC1C 2C9YA 1QRAA 1U9IA 4F92B 5L3RA 3W9YA 2RGAA 3X1YA 2QP3A 1FOEB 4C0BA 2OAQ1 1UKVY 4JVLA 4PPGA 821PA 4W7SA 1QHIA 5L3QB 2PMKA 4A36A 2R6CA 1ELOA 2ZI7A 3TSZA 4TLAA 2QBYA 4D82A 2HYIC 2YWEA 4A2QA 2CMKA 4M1SA 2FH5B 3VU9A 1ZD1A 5FOTA 4JMPA 3WBKA 4ILEA 2HT1A 3RS2A 3F0TA 5KHOC 4Q4JA 3CZQA 3U6KA 2KJQA 5K8LA 4DB2A 1ZNYA 2OCPA 4LBWA 4UKDA 3LW7A 1E2QA 3LX5A 1F6BA 4P4UA 3QVUA 3BOSA 3IO5A 4TLDA 4B3CA 5KDDA 4CEJA 4C0AC 1A1VA 3EASA 3Q9LA 3HJNA 2QSYA 3FFAA 1KNXA 2BM1A 4QOSA 3GLFB 3K0CA 4LJ7A 1BS1A 2DR3A 4I99A 3AP2A 3A8TA 4NE2A 3TW4A 4WXPA 3SJZA 2GTPA 2QQEA 1OXUA 3WNDA 2H18A 3CNOA 4D80A 3TBKA 4YXWD 2LKDA 2EFDB 2OESA 2VHCA 1G8GA 1R8SA 4MYHA 2O0JA 3MLEA 4ZIRA 4TMTA 3W6OA 3SQWA 2IS1A 3QNUA 4RD6A 1RPZA 3CO5A 3R8CA 1YR7A 2CCJA 1N0VC 3I73A 1AN0A 5JI3E 1XZQA 2ZR0A 4QNMA 4W5WA 1FL9A 4KU4A 3VTKA 3VX4A 2OBMA 2PZGA 2SHKA 3D7MA 3IDQA 1EXMA 4B3GA 3A37A 3TVDA 2OFOA 1KKMA 1T0JB 2QT0A 3AP1A 4TMKA 4OK3A 1OE0A 1J99A 3I5XA 1G5RA 4UNNA 4MRRA 4OI0A 2ODBA 3UPUA 1UM8A 1GL9B 2FE4A 2JASA 1XRJA 2PMDA 3DDCA 4PHFA 2DHRA 2R6DA 2WPDD 4OHZA 4M9SA 2GEDA 4NCIA 2QORA 3EW9A 2MSCB 3GD7A 2CE7A 3NTUA 4KFUA 4MQBA 3SJAA 2WJJA 5EUMA 1DAHA 1W47A 3DPUA 3R9XA 1PLJA 3LY5A 5DN6A 2CNWD 4WZ6A 1PLLA 1A7JA 4UXHA 4HB2A 5FI1B 5GJWC 1GVNB 5JBQA 2CK3A 2FA9A 1HURA 2FOLA 1QZXA 3QXCA 5C1BA 1XJQA 2VSXA 4NYIQ 5KNBA 2ANCA 5EXXA 5IK2A 2X2FA 3SDZA 5AJYA 1O87A 1NN5A 1NN3A 3DM9B 5FTLA 1E9EA 1NMYA 5EXSA 4LHVA 1QHYA 1OFTA 4IEIA 5B2ZA 2RGNC 4JSTA 2J5XA 3BORA 1F5NA 4EJSC 2O8BA 4LBYA 3QPWA 5KUTA 1COWA 1E4VA 4X8MA 3TQFA 4FXPA 3BFVA 1OXVA 4A8JB 4PFSA 1NN0A 1XTSA 4QG7A 3K8YA 2NO6A 1P3JA 4JT4A 1UBCA 3JVVA 5J4VA 4AG6A 2YWHA 3AF3A 3AF2A 4XWAA 2JLSA 4QRHA 1NSFA 4B33A 1S2MA 2EFCB 1NF3A 2IHYA 1HH4A 1X8LA 2V8OA 4GP6A 1II8B 5HE8A 3OAAD 4ITRC 2RAPA 4KHZA 1VPLA 2AKAB 2P5TB 5AUOB 3CIOA 1W4RA 1JQJC 2RGNA 4B35A 5BN4A 5J47A 1D2EA 3T35A 3TVTA 1M7GA 1OB5A 3KJIA 4UXJA 3WYAA 2ZE8A 5C4MA 2VPPA 2HV8A 2FZLA 2VLIA 3DM5A 1GL7A 4IHQA 4NH0A 4BE7B 4BZXA 2KSQA 2VF8A 1AJEA 2FSFA 2VSFA 2ZREA 3KKNA 2V3CC 4CEIA 4UQOA 1CULC 3SS8A 4RFSA 4B43A 2CDNA 2QGZA 1KZGB 4BZQA 4QHTA 2CXXA 4Q21A 3ZGXA 4B2PA 3SQXA 4AI6A 1WRBA 4LJ8A 1EFTA 1R5OA 4LY6A 1LV7A 2EFHB 5B30A 1TAGA 1E0SA 4URZR 1U8YA 3ZJYA 4M9XA 2Q9CA 1YE8A 4GFDA 4KLNA 5CLQA 3SEAA 3QJYA 2B8TA 3VHXA 3KFXA 5JFGA 4A9AA 1Q20A 2B92A 4W5JA 4ACBA 3ADCA 3WNCA 3W6NA 3KQHA 4F91B 2HXSA 5BWMA 4JBWA 2QAJA 4MITA 3CX8A 4DUGD 2IEYA 1N5IA 3PFIA 1IXZA 2DPXA 4RZ3A 1L4UA 1Q1QA 2J0SA 5EXPA 2X2EA 2JLQA 4Q48A 2QRNA 2WM9B 4RD0A 2X19A 1KI4A 3FB4A 5DIFA 4DLZA 3L0IB 4I1VA 2VHJA 1XWIA 1B0UA 1GTVA 4GBMA 4YMUA 3VR4A 2X77A 4NDZA 2QBYB 1AZTA 4URYR 4OK5A 4BASA 3DO6A 1DADA 1XPOA 1DAKA 3T12A 1W1WA 2BMEA 4R7ZA 4TMZA 4QKQA 2GJSA 5BYKA 1P61B 1NI3A 2AL7A 4DCUA 2BBWA 2CL0X 4URXR 4ASUD 3U61B 2J1LA 2PCJA 2ZS7A 4XVUA 4LJYA 1FX0A 1US8B 2EWVA 2QAGA 2BKUA 2B7BA 4DVGA 5EE5B 3QPVA 5CLLA 4Q9LA 3MWYW 5JZVA 4Q01A 1G8HA 4JZKA 1RZ3A 2XOKA 2IC5A 3A4MA 1E79D 1E2NA 4GRAA 4MKGA 3TRFA 4AIIA 3PCRB 2NO7A 1XJ0A 4OJQA 1E9FA 2ONJA 4PSVA 3A36A 2QP9X 1NL3A 5J40A 3FDIA 3VR1A 1XMIA 1RJ9B 3A1VA 4AD8A 1ZP6A 2J7KA 2ZE7A 1NMZA 2FSIA 3KB1A 4GMXA 5G41A 3IUYA 1Z8FA 2C98A 4W9MC 3B1YA 1J70A 2PLRA 2D74A 3FVQA 2HF9A 4Q4AA 3O8CA 3TR0A 1P73A 1XPUA 1E2HA 1CIPA 3MUFA 4C7OA 4F4JA 5FTJA 4DEYA 2QG6A 4ZKEA 3BGWA 5KYKA 3K0FA 1N3BA 5AWFC 1SHZA 1DEKA 3I72A 1U90A 3FHOA 3SOPA 3B6EA 3CNNA 3VMFA 4DCVA 3NBXX 1SXJC 3AVYA 1CR0A 2PX3A 2DY1A 3LQQA 3T1TA 4JLOA 3AVWA 1D6JA 3EZ7A 4R2HA 1WBDA 3Q7QA 3ASYA 4WW0A 1NVUQ 4TT3A 1SVIA 2WVJA 3E2IA 3CKLA 1OH5A 4EPWA 4HI0E 4P3YA 1KZ7B 3REFA 2VP2A 4ZDJA 4C2UA 2IYTA 2QMOA 3LWNA 2V6JA 4LI0A 3AKYA 4RD4A 2AK3A 3F5FA 3KFVA 1AGPA 1SULA 2GF0A 2RB4A 3VQTA 3IIKA 2ZAMA 3K1JA 1UEIA 1VG8A 4IXNA 5JCZA 1WP9A 1Z3IX 5FUWA 2VHTA 2VP6A 4C9BA 3B7GA 2HJVA 4DLTA 3CB4A 5FBVB 2O0KA 1H8HA 2YZ2A 3CUEF 5AJWA 4IJMA 1YVDA 2H7VA 1JECA 5EXTA 2Z6VA 3AUXA 3KKPA 4URUR 5AUQA 2OFXA 3QF7A 5TB5A 2ZRHA 2AFIE 2ECKA 3TH5A 1E1QA 2BBSA 1MABA 5FOVA 2A30A 3LVRE 4GOJA 2D2FA 2N42A 2QT1A 5LBIA 4PQRA 4OK6A 2A9KA 2WKPA 3B9PA 1Q3HA 1NJGA 2CVHA 2GA8A 4QC2A 1XMJA 4M1MA 3B60A 3W3ZB 2IYRA 1ZMXA 1KI8A 1GSIA 1GDDA 3CF2A 3E1SA 5FH9A 1KDPA 1KJWA 1GKUB 4KBGA 1U2RA 3CR7A 5B57C 2F1JA 5JJKA 4WA7A 5JJLA 5FOXA 1YZKA 3FTQA 1A5TA 4TYQA 4YMVA 2IWRA 1F60A 1RYHA 1YZUA 4DKXA 1F3OA 1DS6A 2WTUA 1FX0B 1US8A 1X8JA 3NG1A 4ARZB 3Q8XB 3ASZA 2LKCA 3C4JA 5FR2A 2Z4SA 1G8FA 1QVAA 3RYTC 1CJKC 2ZYTX 1F48A 4FI3C 2ANBA 3GJ5A 3CH5A 1N0UA 5EZ5A 4A0RA 3O8DA 5DO9A 4N0DA 4UNRA 1O3YA 1Q12A 1E6CA 1BH2A 4NYJQ 4M8NE 4D4JA 2GAAA 1Z5ZA 1G3UA 2V6IA 3BS4A 1DAEA 1ZBDA 4L8GA 3ZH9B 3U7HB 1H8HD 3RNLA 1E2FA 3SBEA 5BXQC 3QG1A 2CLCX 4TYPA 3X1ZA 1VTKA 5CYOA 2NTYC 4L4UA 1JI0A 3IPXA 4F4IA 5DGXA 5JSZB 3QBVA 4U00A 2FZ4A 5TDHA 2QAGC 1S3SA 1F2TA 3TAHA 4QM7A 4DC9A 2CVFA 1JXMA 2G0TA 3AKEA 4RY2A 5HPYB 2QPAA 3Q7PA 3V9PA 3GLGA 4DLUA 1W36B 4ABYA 1MR3F 2FPLA 2XB4A 5KTYA 4BLOA 2QTFA 3FHTA 4KBFA 4FCVA 4Q1AA 1XXHA 1P60A 2LCFA 3TAUA 3IGFA 2OM2A 4LJ4A 1LS6A 5SZIA 2XJ4A 3H86A 2KWIA 2W2VA 2ZRKA 2WWGA 4HLDA 1SVWA 2YOGA 4CT4B 4AG5A 2ZSEA 2OBNA 1EG7A 3AM1A 2XEXA 4FMCB 3CRQA 1C1YA 4QBHA 2PL3A 2W0MA 1Q1BA 4LWZA 1N6PA 4JT2A 3X2SA 4KFSA 4UXIA 3QKRA 5GVRA 2HYDA 2ZYVX 4QBIA 1KSHA 1ZAKA 1ZD9A 2DBYA 3QVVA 4BRUA 4B73A 1E1QD 1II8A 3UG6A 3PQCA 1G7TA 1UF9A 3FKSA 1TQ2A 2Q0HA 2GBLA 1TF5A 1V43A 2EFGA 5G3ZA 1ZCBA 3ADBA 4JYBA 1UEJA 1KAGA 1KDRA 2FSHA 3R7WA 2W58A 1KK0A 3K53A 4HZUB 4QM6A 3LA6A 3AP3A 2ZS9A 1CKEA 5IHPA 4EPTA 4M1KA 1M7BA 3NC0C 3KDSE 1XEWY 2ZPTX 4HSEA 2RHMA 3ONWA 4H1VA 5FFMA 4MH0R 1WE2A 1SQ5A 5AK0A 2C04A 4IEEA 4II7A 3HR8A 3C15C 2CLSA 2QTHA 4BFXA 2XZOA 1NIPA 2GESA 1TQDA 3THXB 2H8KA 1N6IA 3GJ8A 1KKLA 1XXHB 2ZSAA 3WY9A 2O8FB 1PUJA 1ZM4A 4CEHA 4Q5IA 2FGKA 2FU5C 2YWGA 1N6LA 3MG9A 3SYLA 4MKIA 2PJZA 1J7KA 5CDFE 4RKFA 4HB4A 2O5VA 2QP4A 2XTZA 3THOA 2WSSD 4IOLA 1NLFA 3LBIA 1JPNA 4IOMA 1G3QA 2H92A 4LYFA 1KMHB 3MJHA 4A6PA 4Q9IA 3W5IA 4PZZA 2N1BA 4PC6A 4BRWA 3B1VA 1T9HA 1Z6TA 1OH8A 4PQFA 1Q3TA 1R0YA 3EPLA 1QBKC 2AWNA 3I1FA 1G4AE 3ZS9A 2Q3FA 4M22A 2Y8EA 1E94E 3M4YA 2RGXA 2IF0A 3N5CA 1HT2E 4B34A 4D0NA 2OSBA 2IXGA 4LHYA 5CIQA 1NP6A 4Q02A 1ZW6A 4NYIR 2D2EA 4KAXA 4CF7A 3DKVA 421PA 3I8XA 3RRZA 2GXUA 5JRJA 1HQYE 2HCJB 2C96A 2A5JA 3CX7A 2ZI9A 4C3ZA 5F9FA 1R8QA 3K70D 1XTIA 4BPBA 1EFCA 4A2PA 3OIYA 5E4FA 1ZNXA 4GT1A 4MRVA 4TSFA 3L0SA 3FYHA 3PUWA 1UKYA 3CRMA 2ZIAA 4QGAA 4C0KA 3IIJA 4HDCA 1HA3A 3GLFA 3K70B 1VYVA 4WBSA 3SR0A 3GEHA 1S9DA 1E2KA 4C0JA 1NBMA 3SHWA 2ZI6A 4B44A 3TW8B 3BH7A 3BE4A 3K9LA 1G6HA 1G7CA 2J41A 3AB3A 4GZLA 4AKEA 5FBQB 1Z28A 3SJCA 2VBCA 4NCKA 5B64A 1L8QA 1G3MA 3MAAC 1H8EA 1W4CA 3KX2A 1EFRA 2UZIR 4BWYA 4KV9A 2XSZD 2O8CB 2JIZD 1JBKA 5KNCA 1YHNA 4HUQB 2J0UA 4RVCA 1X8KA 2EVWX 5CB6A 3R8FA 1UDWA 4IVPA 1J2JA 5F3WB 1KTVA 3ETLA 1KK1A 3N2IA 2QEQA 3NH9A 1U98A 4KSBA 3GLFE 4J0QA 4PPFA 1ETUA 2JJ8A 4DWJA 2FG5A 1MO3A 5FUXA 5P21A 1GWNA 4ZI3A 5IK2D 2W83A 2IEZA 2W00A 1FMJA 3GCGA 3LVQE 3U44A 1DO0A 3U3OA 2IWHA 4FW9A 3PEWA 1YZLA 4LUCA 4AURA 3HYRA 3SZRA 2BMJA 1T5IA 1E0AA 2IYUA 5KU1A 4M4SA 4US1R 5DSZA 1SVOA 2VTKA 2YOFA 1NVWQ 3KUCA 5HE9A 5FL7A 3W34A 4BFSA 3FGNA 2RHDA 4MGIR 5CK4A 2GCPA 1NLZA 5CB8A 5L3SB 4PHTA 2ZAOA 3ZVMA 2IYSA 3U6BA 2IS4A 3K0AB 4B47A 1UDXA 2JDIA 2O0HA 2PLFA 4QFMA 3E70C 1G20E 2GNOA 3ZVRA 2WMOB 4A6XA 2ORWA 4Y0AA 4IKEA 2MMGA 2IYXA 3OAAA 1NVVQ 4TN1A 3WMFA 4ZKDA 4WAUA 4RD3A 3B13B 1YKSA 3EWSA 4DSUA 4CT5A 3L82B 3WBJA 3OE7A 1C9KA 3L0OA 4WIAA 1SHKA 2NOAA 1E2LA 2OCBA 3P26A 3UK6A 2IXEA 1LF0A 1S1MA 3HP1A 3ZVNA 3T5GA 1AGRA 1MO4A 4S2EA 1OF1A 3SBDA 1CF4A 3CPEA 2FEMA 3KB2A 1RJ9A 3L8ZA 1UADA 3TSWA 4TYNA 1OLOA 3QQ5A 1Z0JA 1BKDR 3L2OB 4GSYA 2OCYC 4M21A 4EFMA 2OUKA 2CJWA 1G5TA 4G5RA 3ICEA 1ZYUA 2ZJOA 2CK3D 1BMFA 2CL6X 4WZAE 3K0AA 4ZCIA 2JLZA 3LDAA 1ZRHA 3MGCA 1IN4A 1S8FA 1V5WA 2MSEB 3U44B 1TX4B 3AVUA 2V7QA 3LBNA 1IY0A 2JJ1D 3CNLA 4JL5A 1ZM7A 3PXGA 1DOAA 4OHVA 3RABA 3QKUA 1GM5A 2RGDA 5SZHB 4BLTA 2W2TA 4G01B 1VDZA 3MWJA 1DARA 2JJ2A 2ZE6A 4AYXA 2XNSA 2AFHE 1KI6A 3UWKA 4G5GA 4MGYR 1FZQA 4PPNA 2AD1A 4KSCA 1VG9B 5IF9A 1VG0B 2HLDD 4A8JA 3DZ8A 1E69A 2GJAA 3A1WA 2D7CA 1DO2A 2FFAA 1RVDA 2WBLC 4C30A 4Q9JA 4FCWA 2Z0MA 4BQSA 2WOJA 3OEHA 5CM9C 3KKQA 4QJ3A 4LDJA 1HQCA 1W49A 3GEIA 4PX9A 4KFRA 4K8OA 1YJ5A 3FWYA 4F4CA 3PUXA 3WHLA 2GZDA 2XTNA 1AZSC 1CEEA 3T06B 1IXRC 1NVXQ 2EYUA 2FPKA 1G21E 3FHCB 3MSXA 1FP7A 2TMKA 1I2MA 2ATVA 3REGA 1J90A 3B9QA 1YZNA 2NIPA 1QVRA 4Q1EA 4A0HA 1DPFA 2J7PD 1QHSA 3QXXA 3PUVA 4M1WA 5EJEA 1NKSA 2GXQA 5JHGB 4U02A 3U4QB 2QSZA 4CEIB 4G5QA 3AVQA 1D8TA 1VG1A 1XDBA 1TUEA 4Q7JB 4IDQA 1UBFA 2OE2A 5E7IA 3SE0A 3G0HA 3KTAB 4NYMR 2GZHA 2DCUA 1SVMA 1DAGA 1TMKA 2GK7A 4G5OA 4WVFA 3WP0A 4DB4A 1SKQA 2F9MA 4AKIA 5GJBA 1OHHA 2P2LA 1CJVC 3B1XA 4MUAA 1EESA 4RD2A 1SXJB 3FOZA 5LDDC 4PAMA 3R9IA 1G6OA 1NIJA 2Q9AA 2A2ZA 2G77B 1N2CE 2ODNA 3CWQA 2W2XA 1KO1A 1TUIA 3PENA 4P4SB 4OJKA 4FN5A 3UWOA 1W2GA 5LPNA 4KFTA 1ONBA 4GOXA 4M0LA 4QBFA 4EPYA 2BM0A 1T91A 3KJHA 1BIFA 1TF7A 2P6NA 2GVZC 1J8YF 4JVNA 1KNQA 2GHIA 3IQXA 4PO9A 1XZPA 5E7JA 2J0QA 2D3WA 2IYQA 2J46A 2ORIA 1T3SA 2DWPA 2G1JA 3TUZC 1KMHA 4UNPA 4NMMA 3TE6A 1W44A 3E5HA 1DVRA 3RAPR 3RVBA 1U81A 1MRSA 4TL6A 2YOHA 1KK2A 3VKGA 4I1OA 5JWHA 5LD2B 3OHMA 4Q47A 2DFLA 4LHWA 4HATA 3LXXA 4GOKA 4IOJA 1X3SA 1Z0FA 3QENA 1ESMA 1G5PA 1OPXA 1P9WA 2R8RA 1F2TB 2D62A 3RS0A 4M53A 3AUYA 4M2LA 2PJRA 1CR1A 1UFQA 5KSZA 4Q19A 4ZCMA 3QF4B 4GDFA 2BVNA 4KJZA 4QNRA 2PH1A 121PA 2ZYWX 5G53C 3NEYA 2ORVA 5JI2E 3VNUA 2Z4RA 4DSOA 4IRUB 3ZLJA 1G3IA 4LZZA 3VU9B 2ZJ2A 1T8UA 4LJ6A 4HLUA 3RSLA 1Z06A 1TNDA 2HCBA 4P31A 1LW7A 2QMUA 1SVKA 4FMDB 3QEOA 4ZDKA 5HCNA 4IVQA 4OI1A 2BEJA 4OI2A 1ZM9A 2YHSA 2A5GA 4W5HA 4XVQA 1SXJE 2OLKA 4HAVA 6Q21A 2AKYA 1KDOA 2WKQA 4I4LA 1JJ7A 1F2UA 1U0HC 4Q7MB 1R0WA 2I3BA 2ZROA 1NKTA 1FQJA 2QL6A 1XD9A 3HU2A 1L2TA 2V7QD 4XOIA 1DG3A 2VF7A 2CCKA 4GI7A 2ZQ5A 1AS2A 1TL7C 1YR6A 3ZQJA 2IF2A 4XTRA 3HR7A 3C41J 5EP2A 3W5JA 4JIMA 1IN5A 2R6FA 2F6RA 4TWZA 2HUPA 1OH6A 3TLXA 3ZZ0A 3EAQA 2VIIA 4OQMA 5DHAA 1M2OB 3B1WA 3EWAA 3W8NA 2O8DB 3THXA 3EIEA 1G64A 3MD0A 1KMQA 1HE8B 5JRZA 2XXAB 4B3DA 1KO7A 1KIMA 5DISB 4FMBB 2EWWA 1E96A 1OYWA 2DFKB 3QI2A 4OHWA 5EQTA 2CEAA 3DMNA 4MYCA 1JXOA 1TQ4A 2GAOA 1EFHA 1XD2A 3IO3A 2A5YB 2EW1A 2OBLA 3B5JA 1XEFA 1XJCA 3A6PC 1Z6AA 2KE5A 2N46A 3T1VA 4RSGA 2WHXA 4LYHA 4B3FX 3WNBA 3FMFA 2LWIA 3EC2A 4EKDA 1TEXA 2HLDA 1ZINA 2WWXA 3VAAA 2XGJA 2V9PA 3DVLA 1KSGA 4UNQA 3U60B 4JLVA 1KHTA 1GNQA 2FN4A 4B75A 2JJ2D 1AA9A 2ZU6A 2AD5A 1VIAA 1G16A 1Z6YA 1X6VA 2KBFA 2ZVQX 1OH7A 5DLQC 2PX0A 1JJVA 1XTKA 3EXAA 2E1RA 2ZYUX 2FPMA 3O8RA 3N70A 5K8IA 2P6RA 4JL8A 5FOWA 4XSGA 1ANKA 3BK7A 4FMDF 1E9RA 4OHXA 3GP8A 1Z0AA 2VYFA 1W0KA 4C0SA 2JLWA 3WP1B 1FPMA 3AKCA 1K5DA 3LAWA 4A0FA 2F1HA 2WJIA 4PTLA 5EUQB 4ZDIA 2GJ8A 1S96A 3RWOA 4Q03A 3O8BA 5SZJA 5JEDA 2W6JD 2IUTA 2BCGY 3K0EA 2D06A 4OL0A 1W36C 1KSJA 2OAP1 4IW3B 4LC0A 4DT1A 2BC9A 4DBLC 5A4JA 3ZS8A 2ZUCA 3DOFA 4XD7D 1WDTA 4P4SA 4O2RA 4PC2A 3AVTA 2ZUDA 2BOVA 4OKSA 1PLKA 1BYIA 221PA 3I8SA 1QHXA 4CZ2A 5A5GA 3NHAA 4Q66C 3Q72A 4FWTA 2XNDD 2JIZA 4LV5B 5C46F 2QROA 1CP2A 1W4BA 5ANRB 1WMSA 4YDSA 1SKYB 1X1SA 5H68A 4RCZA 3KTAA 3EARA
chains in the Genus database with same CATH superfamily
5CGQB 4YMIA 5JAPA 4MVJE 2GPBA 3I01A 3Q12A 4RY0A 3EVCA 4TZTA 4G4GA 5TARA 4A8HA 5IS2A 2UYYA 2UXDB 3I34X 4XQ9A 2F17A 5EUBA 4X24A 2QE6A 3UJNA 3OCCA 3C8HA 3M5DA 1GPLA 1HL7A 1SBTA 3L1IA 3E35A 3L49A 3R0QA 3TZLA 5I7RA 4BNDA 3OQBA 4DCOA 4O5OA 4CFSA 4YMTA 2IH4A 3TNDA 3HPRA 2R8OA 5IDYA 3NTRA 4Q3AA 4EUSA 5BORA 2E4XA 2J4FA 3LLVA 1TIBA 4L73A 1V8OA 4GL2A 1HE5A 1QNFA 2X7JA 1CYEA 2V55B 4U2DA 2BFWA 4X6LA 2H31A 2JB9A 5CNKA 2FR1A 1JWLA 4BBZA 2IX9A 4E09A 3PUYA 1FYWA 2XCUA 1WW8A 4HRAA 3O7MA 2F67A 3UO8B 2X86A 3UZUA 5I7UA 5IAOA 3DFZA 2VTEA 3DT8A 4MKFA 4OXIA 1I7PA 5EMJA 1ZMTA 3I53A 2DKOA 2NTEA 3PFCA 2XZPA 1ENPA 2WT9A 3PIIA 4O4IB 2BEWA 3U7QA 1MX5A 2HQSA 2W6ZA 3GPCA 2EQBA 1QYRA 4MYRA 1FNSA 2I1LA 5ECYA 1QHHA 3RVLA 2VJPA 2P4UA 2QE7A 1N9KA 1KJIA 2CDAA 3FRIA 4ZVKA 1L5WA 4JEIA 3RWBA 1FDUA 4AJHA 1IM5A 1FTSA 4WXRA 1IN1A 1S8NA 1SHJA 3MM4A 1MC8A 1PFVA 1J7JA 2C77A 1OD6A 1CERA 3IAAA 3SR3A 1XCLA 5K3EA 3BT7A 1QCCA 2V7PA 3QLVA 3H1AA 3ENNA 1OLXB 2LV8A 3CWZA 4J16A 3KQUA 5CP8A 4DCGA 1OV6A 4KJXA 4Q00A 3K9CA 5LD2C 3K8ZA 4OPMA 4QEZA 3RSZA 3U13A 1T15A 2GEFA 3EULA 2IHTA 3AEZA 1VLQA 4JEHA 5JARA 4QGFA 2ZB8A 5F12A 4ZEXA 3S2EA 3V42A 3GQBA 1X1QA 1U3UA 2ZSHA 4ZQBA 3IKVA 1LK0A 5C18A 2JJMA 3PITA 4JU8A 2VJMB 4HAUA 1H66A 5ALDA 3K1YA 3TTYA 2IU4A 2UVDA 4X1YA 3EQZA 1SCQA 5KVQA 5D01A 4B32A 2I2BA 3ICQB 1J25A 1GTZA 4CHTA 1ODIA 2ZRPA 1XROA 4MVCA 1CR2A 3UAYA 4KACA 2JIMA 4QDUA 1EZZA 3D9QX 4BWVA 2OHIA 3AVXA 3KQSA 1UWCA 1VCNA 3FMOB 4N0EA 1FS6A 4IYJA 4KLRA 2BONA 4JYMA 3VOBA 4C0HA 1CR6A 1Y4SA 3CRW1 5FR1A 5JASA 2WTXA 3H2IA 2GX6A 5AW4A 4UTNA 2ZR7A 3W5DA 1UC8A 4P08A 2YXPX 5KYXB 2WZBA 3HCRA 3MB8A 1N2EA 4LYGA 4W8OA 3PR1A 3TW6A 1EFUA 2VJLA 621PA 2Q0XA 4I6GA 3M9XA 4IBOA 2ZIVB 2DH5A 4BGDA 2HCTA 1HDYA 1WABA 3H83A 5DKFA 3LKDA 3RC8A 2FE1A 3AGPA 3QPCA 3ZW9A 3QTBA 4OL9A 2IV7A 2ZVJA 1U2GC 1E1CB 1V7ZA 5K6AC 4YQEA 2E89A 5ALXA 4IFBA 4WY8A 1SMKA 5JAIA 1GGMA 4P33A 5BSTA 5ES4B 1VE1A 4TYYA 4A10A 5K0ZA 1Z4IA 4JJ6A 2Q5FA 2MYTA 2DTDA 2QNRA 2X3UA 2Z09A 3PHLA 5A4AA 4UMDA 4QO8A 4IHJF 1WVIA 2AOWA 4CM9A 3F6EX 3WLSA 5EINA 1IOWA 1P7VA 1QNLA 4E32A 1XQVA 2WTBA 3FI0A 1Q2UA 3E7WA 4CMEC 1NDUA 4EUFA 1KEVA 5ULLA 1GYPA 1Z4NA 2PVCA 3Q8MA 1Z63A 1YR8A 1YSCA 5HFAA 2L19A 2MSDB 3UANA 1NYTA 1FW8A 3A9SA 4EL0A 3LW8A 2O7VA 1UKZA 4HFMA 1M5UA 1T5HX 1EUZA 1U0SY 5JNUA 1MC4A 5CU7A 4B9AA 4GQIA 5TMPA 3MOSA 2FFHA 2VWGA 2GYUA 4RK6A 2SKDA 2VEDA 3KUKA 4AN0A 4D44A 2BGKA 3DXXA 1D2AA 4OATA 5IN5A 4P3XA 3LC7O 3B7WA 4RCVA 3THWB 2AXNA 3G8YA 1IJEA 5HP4A 3GEGA 1I0LA 1D2CA 1YJXA 4B9EA 4O8CA 4WCDA 5TXGA 1EFKA 4HVLA 2B61A 3CF6R 1AIPA 4BP8A 5DX1A 1LY1A 1OFGA 1XA0A 4OGLA 4POAA 1XCOA 3TI9A 4CUJA 1GKLA 3LC0A 4B3IA 5TT0A 2H5EA 4CM6A 1XZGA 3A9UA 4TZKA 4MDEA 1J07A 2BI8A 2J3JA 3BERA 2P9JA 4YP1A 1IUNA 3WL6A 2ILVA 4EPVA 1E7RA 4ZCRA 2G4CA 3VRHA 2GUGA 5AUPB 1PHPA 2YASA 2DRIA 2HJSA 1RFLA 2Q4TA 3D54D 3LK7A 3M1IA 1EWRA 2VH2A 3A25A 4Z7JA 2EBHX 2J0VA 1Y98A 1ZNQO 2F62A 1DHRA 5FPKA 3T3HA 4LIPD 4Q9KA 3KKMA 4MGZR 1EXDA 1OCEA 3DR5A 1F4VA 3MBKA 4LF4B 4JAVC 1V26A 5THXA 1OAKA 2WIAA 3AR7A 2VUHB 3NTOA 4Z4EA 1W0KD 2DWQA 3RG2A 3LD9A 1XT6A 3TF5A 1KI9A 4O4LB 3B52X 1GRNA 3B3GA 1CZHA 4NYMQ 3BWXA 3R20A 4N47A 4D6PA 1N6RA 5DNDA 5BV0A 5DBIA 1DTWA 1WB9A 2QU8A 1ODLA 3WLMA 3SHTA 2F7SA 3K30A 2ZYGA 4KQ6A 4JLKA 2IKQA 4V03A 1ZD3A 1JH8A 4F45A 2VJBA 2FFBA 3Q7RA 3R74A 1CTQA 2G6BA 3EZ6A 5DYGA 4DMUB 3EZ2A 4B3SB 5DB4A 3ZEAA 3ER9A 2LCQA 1FBTA 1P0CA 1JHMA 4TTSA 3RAEC 4IIDA 3TG2A 5FOQA 1PV4A 1Z82A 4ZTBA 1BD4A 3S1SA 4Z7NB 1JT2A 1ZI9A 4HAWA 2JHAA 3MUEA 2BSQA 4ZV4A 4ZAFA 4II2A 1X7GA 2NW6A 1ZRSA 4NE7A 2PUBA 4P38A 1U4OA 3TZ6A 1H5UA 3EGOA 2ZUTA 1IXYA 1GZSA 4FYPA 1PUXA 1IBRA 5IU6A 4JX9A 5ED0A 4ZV9A 3M8KA 4ZICA 1H2YA 3SEFA 1E60A 1G9TA 2I5PO 3CZ5A 4QUAA 1I7QB 1RC8A 2ZETA 5AKLA 3QYAA 2PBLA 4Z1MA 5DLDA 1THMA 5EIHA 1RMTA 2PRZA 4NK4A 1PVOA 1ARZA 4DLSA 4EDFA 2WV9A 4C88A 1X94A 2PMFA 1L5HA 3VU3A 3ZLVA 3K9BA 5IAGA 4F6CA 2VNSA 4I4TB 4RKEA 3R09A 3L07A 4BCBA 2X0RA 2OV4A 1OV4A 1YR9A 1PT9A 1EJ0A 1IEWA 2DULA 1D5WA 3ABRB 4PN3A 3LO5A 4R0MA 3BJZA 2WYIA 1ZD8A 3DW1X 2ZUUA 4H15A 3AF0A 1NHWA 4HYQA 4C4TA 1H22A 1E5VA 2FETA 1J1ZA 3EZLA 4QBTA 1VJ5A 2RHHA 4M37A 1PN3A 3TLJA 1VYHA 1XE3A 1B3BA 2RI6A 2VHUA 1EKXA 3NBQA 4J75A 4GYKA 3SC3A 4ZU1X 2O8FA 3JQ9A 5A4FS 1DIRA 4K3VA 1TEVA 4IICA 1GZ6A 1TDJA 1F6WA 2JA1A 2POQX 3ANSA 2PZFA 1HBJA 3R3VA 3HJUA 4Z8XA 1QTRA 2IUYA 2C8LA 4QTUB 1VPWA 4L5YA 1FMTA 1NW7A 3A04A 2WFZA 3F4BA 1R66A 3GRPA 1RQXA 1P45A 2DR2A 5CYPA 1KAQA 3FNQA 1L9KA 1A4RA 4NAVA 1MB0A 1J1IA 2DP4E 2BZSA 2K5UA 4OXQA 1MPTA 5HCUA 3UUFA 3I92A 3DO8A 3L7LA 3OX3A 4KO8A 1R12A 1RVV1 4KPFC 3BWVA 4Z4FA 8MHTA 4EL5A 1XXHE 4RTJA 4OMDA 1EWQA 2DVMA 4R83A 3ZCSA 1IXKA 1XEAA 1A9YA 4WLUA 4Z0HO 4NYJR 1QRRA 2Y9PB 4QAQA 4TTJA 3W4JA 4FC7A 1XZCA 5F98A 3MS7A 5B2FA 1QHGA 3D0QA 5AO9A 4EG4A 1FTNA 1VLHA 3KLBA 3N05A 3NHBA 4HUJA 2ZBGA 3C1UA 5CW1A 4ZDWA 4E3ZA 5JS7A 4M1YA 3N8KA 5I7HA 5BQ5A 2JFFA 3PTLA 1NXQA 3PQ8A 2IXTA 3U3RA 1VHLA 4AF8A 1LQ2A 1I2DA 4CBVA 3Q3CA 3A28A 1YQWA 4FKBA 1I8TA 1XDZA 4JLAA 4NTZA 5FL3A 2DHCA 3TTTA 1FNMA 4MCHA 4PBSA 3ZD6A 3TLAA 4UEQA 1E2EA 3UAOA 2YWJA 3C8DA 4U7JA 3O3NB 2QSUA 4F60A 4CDRA 2W11A 3TLEA 2GTHA 1BA3A 5F4ZA 5B53A 5KQSA 2HXYA 3ST7A 2FW8A 3LZDA 2AVDA 2A8YA 3Q5DA 1TYCA 2WUDA 3ZEIA 5KPDA 4KO4S 2GETA 5A7GA 4ARCA 5IANA 2H59A 2IU6A 3MYYA 2B2XA 1T2UA 3G82C 7REQA 5ALZA 2B78A 5IVHA 3WC4A 3TCXB 3V4RA 3FVVA 3STXA 1Z5UA 2DSNA 4FWIB 1LLUA 2FOIA 3CU5A 4I66A 1I3LA 2Q45A 3T7DA 5G4KB 4A16A 1IM2A 3DNPA 1WPQA 2PCLA 4ZAVA 1IVYA 5JAUA 3A4LA 1L4BA 4YJ3F 2IDZA 5AM5A 2GVDC 3ID6C 3I9FA 4JLPA 3W4KA 3HM9A 2DE0X 2O3RA 4HYYA 5DX8A 5BW8A 4BNGA 1XJ5A 2H1LA 4DV0B 3AUUA 4BGIA 4FIDA 3GRFA 4WCVA 3BSSA 4WD3A 3QNWA 4ZT5A 2X40A 3I2GA 4C7BA 3I6YA 3AEKA 5TQ2A 3V00A 5A0FA 1ZVQA 2JAUA 2WR8A 4QE3A 1HYGA 3KSZO 4BO7A 1CV2A 6LDHA 3BGSA 5KYXA 2A5LA 4TLLB 4YCNA 3AFGA 3PQ6A 3D8SA 3V4PB 1JHOA 3WWYA 1TCBA 3A27A 4GXTA 2GCOA 5DT2A 2VDUE 4S1NA 2HX1A 1H2WA 5KNDH 2RHTA 3ECSA 3HJRA 1F20A 2CVQA 2V03A 5IVIA 4V0OA 3E58A 4GWKA 1VRWA 2W4MA 3UAVA 1YRAA 5F7OA 5KO2A 3OKFA 1EGQA 3EB9A 3N0XA 4FGLA 3RAJA 3SJBA 1KEWA 4BVAA 2C95A 2I6QA 2LE0A 3IMCA 4B81A 5C2JB 3GA0A 1AX9A 1IMJA 3P0FA 1Z5OA 3WK7A 5BW4A 5AVZA 2D3TA 1NNI1 1O03A 1V71A 4WCFA 3G7SA 4OQ4A 1A7AA 1HT0A 1QYDA 2C31A 2B25A 1N5JA 4YI5A 4CNBA 4N0QA 4MRSA 4XYMA 4HDNB 1EWTA 2OM6A 3VHLB 4B6RA 2BL4A 1E7YA 4JP3A 3TXAA 3WFJA 2QGNA 1C1XB 4EFLA 5LXTB 4KI7A 4HX9A 3WBKA 3P96A 1AQJA 2ECOA 3SIPA 1JDBC 1YJ8A 3CLUC 1K86A 3GCDA 1GKIA 1SBQA 2W2PA 3PKIA 4R1MA 4R9SA 2BMFA 2H5LA 4I3FA 4OAPA 4U9HS 2F3TA 1I6WA 2GD0A 4KZPA 1RKBA 1BDJA 2YV1A 2G36A 4M9QA 4Z9FA 2WVGA 4DC1A 1P7CA 2VTDA 3PWZA 4B2YA 2RGCA 1FDTA 2QTTA 4BFYA 2ONCA 4CQLA 1C3JA 2Q21A 4C6TA 4HWGA 3NHUA 4QVIA 3HKDA 3RROA 4QT4A 2X5KO 1E63A 1Q0UA 1QVVA 3BE8A 5IN4A 2B83A 5E1MA 1Z15A 2XJ9A 1FXUA 3G7NA 3P2IA 5G4LA 1J22A 2DF8A 2CMGA 1U2DC 1Z6PA 3L8CA 1JHDA 4GIBA 3W90A 4UTPA 1GRRA 1KZYC 5D3MB 3UIEA 3PL5A 3WMEA 4DREA 2W2LD 3WV4A 3VNQA 4IZ6A 1KTIA 3DL0A 3S0JA 3HDVA 1XZMA 5DWQA 3K32A 1VHWA 5E6RA 4ZJYA 4BQPA 1A0OA 4D9KA 4KGXA 3LF2A 1JHQA 4U2FA 5ADWA 2D1RA 3DYVA 5B4UA 4PLYA 2QL5A 1GJRA 1MKYA 4DDHA 3PK0A 1WU7A 4KB5A 4DQUA 3L3BA 3F3SA 4FBLA 3TSCA 4I50F 1Z38A 2AXPA 3I2JA 3EA4A 1W96A 4WX2B 5IWAB 5AJUA 2A7XA 3RYIB 2C4WA 2VSQA 2SECE 1L7RA 2JHCA 4YRMA 3GLIA 4V0QA 3VDRA 3GH1A 1IQ0A 4TMXA 1GG8A 4BNWA 2XB9A 1MGOA 2AEJA 5KAMA 3CLVA 4BRSA 5IABA 4RZQA 3CZ4A 2I6GA 1ZJZA 1MB3A 1GGVA 1QGOA 4LXGA 1DT3A 2OOSA 1NI4B 2D54A 1GPH1 1GAQA 3HC7A 4OH1A 2RC5A 4D9BA 5LMUB 1WQ1R 3CG0A 2AXQA 5M2QA 5DHFA 2WU3A 4IIHA 2HBRA 2OBBA 1DJNA 2X4DA 4F9FA 5KYGA 2IHZA 3A0RB 3GMTA 4JLNA 4BFVA 4A73A 4I46A 2P9YA 1IWPB 3U9LA 2JAQA 4IYRA 3NC4A 3T5PA 5IH3A 5F7XA 3VKHA 1YKFA 3PLNA 3DFIA 1OWPA 3QFFA 1XNQB 1H0RA 1NJSA 3CNQS 4WK4B 3LLCA 1K7YA 2OCXA 3K1TA 1J9ZA 2ZT7A 2O7RA 4POOA 1E9SA 3CZCA 4AMZA 1OROA 1OYYA 1EDDA 2VJMA 1N92A 1JDTA 1XZLA 2GO1A 3QJGA 4G5FA 1DC6A 1GPKA 3DC2A 1Z35A 3H2ZA 3EXHC 1DOZA 5LOVB 5TGTA 1OT3A 1UK8A 4QVKA 4CE6A 2A0FA 1RQRA 5FD8A 4RHFA 1EEHA 5LVAA 3QVKA 4JLBA 2REBA 5GWXA 3QUSA 1VMEA 3KVVA 4YREA 2JIRA 2VSOA 5T8KA 1CCWA 3ZCRA 1P2GA 1TM3E 3TZCA 2ERCA 2BKEA 2Y6VA 1JSRA 1KYZA 3OIGA 1AQUA 1FNBA 1KMMA 3OO1A 7GPBA 1MFZA 1Y6ZA 1D2HA 3OD1A 1LBSA 2FPWA 2FG7C 1I0ZA 1K2VN 3E8XA 4L78A 4G0QA 4PV7A 4R7GA 5A7HA 4D8XA 4TKUB 3INYA 4NCHA 4Q18A 4AMBA 5BR1A 1ZHHA 5IT5A 2VUSA 2BLLA 1UP6A 2GRJA 3IVAA 5BO5A 3DQZA 3H1BA 4GQAA 5KVSA 2X41A 4EG1A 4O2AA 3ZV4A 5JZ9A 4N8EA 1Q95A 3L84A 3OY2A 3R6LA 2RJOA 2NO1A 1T5TA 1FBNA 2CF6A 3GA5A 5K8UA 3ANMA 5AI8A 3P7MA 1KEZA 3VR6A 1IHOA 2E6KA 2RC6A 4GR5A 2VH5R 5DRTA 3GT0A 4D02A 5IYZB 2ZYHA 3CM0A 1JSLA 1PG0A 2I71A 5DM0A 4GVPA 2F4NA 4KAAA 1GCUA 3BMCA 3D43A 3B3FA 4MUGA 4NENB 5KOIA 1RHJA 2P7HA 1VKOA 2O8DB 1L5LA 1LDEA 2Z04A 4EFNA 3T4EA 5JD6A 4UCFA 4KXWA 3A6LA 4LDNA 3IA2A 4M38A 1RM0A 1RRMA 5CLGA 5I7VA 1YFZA 2FYTA 4HLCA 4JXKA 3GCWA 2RIRA 3IILA 2D7JA 2XGGA 1W1IA 1HRDA 2GBGA 3RU9A 3QLUA 3W5BA 1X1CA 2CJXA 1Z2OX 4DHEA 2MDTA 5JWRA 5DBHX 3NKVA 3OHPA 1MAAA 2DPGA 3MMZA 2AWOA 2HNAA 1M0SA 3X1KA 2NU7B 1XU9A 1PJ8A 2XY4A 4CKZA 5DI3B 3JQ8B 5E4TA 2YMPA 4DM3A 1YQ9A 5EJ6A 1AQ6A 721PA 3L41A 4RF5A 5H82A 5KQGA 1DCKA 4RTPA 4MDFA 2WYHA 5BN4B 1W4ZA 3KTOA 4XB1A 1XBTA 2H57A 1TJYA 2EL7A 2OT3B 2G9VA 3EUAA 2CUZA 4X44A 1CS4C 3CVOA 5DCLA 1Z83A 2ISCA 3OH8A 2C3UA 2GTIA 2VA9A 3IIMA 3CHYA 5DM4A 5ITWA 2OD9A 1M74A 5CK5A 1ZC4A 3BKWA 4HUQA 2NAPA 4W5OA 3H1TA 3SSMA 2BI7A 5HQJA 3IMEA 1HWYA 4DCSA 1Q21A 3SDBA 4YCMA 2EZ9A 1PT8A 2Y93A 1Y5IA 2PGOA 1XX6A 4XQCA 1UT6A 3H9BA 1G6KA 2XUGA 2BDTA 4KVFA 4PSKA 4XM1A 5AI9A 5F5LA 3ZCUA 3X44A 5JBIA 3MGKA 1C4OA 3R41A 4TT3D 2HIMA 1GTJ1 3CF0A 3LHFA 1BQ3A 2GPWA 1P62B 3W3AA 4FNMA 3U7JA 3GG9A 4FEEA 2ZFUA 3ZWMA 5A06A 4TVOA 1Q57A 3CT6A 3TW8A 1SURA 2X5OA 3G5UA 4DDVA 1A95A 3AFMA 2DZDA 3ANYB 2Y76A 1ZR4A 4HWPA 3OEEA 1FTQA 1PFUA 5DULA 4C2BA 5HTOA 2WNHA 4TLBA 4CJXA 1OBVA 2HA6A 3I62A 1R0XA 3VDXA 1KZ1A 2HMYB 2XGOA 2XYHA 1LLQA 1VMDA 1MEJA 1OIWA 4BVKA 4BXOA 1GV0A 1HEYA 1UBLS 1ZVJA 5IW8A 2HSGA 1IE3A 2C92A 1R64A 3ZDFA 2B8JA 5K2OA 3UH0A 1O0SA 3E7PA 1L4HA 1T6ZA 4FOSA 2NMVA 1FLNA 2IYYA 1DOHA 1B2LA 1A71A 1U94A 3EZYA 3NFRA 2OO7A 2BUCA 1LLFA 3BPSA 2C4KA 4MUHA 4QJ4A 3JTMA 1DIBA 3E15A 4RENA 4NBSA 1DKNA 1UINA 3LNCA 3N2EA 3MS4A 4MPJA 5EHQA 2ORED 5GM2A 4ENSA 2ZRBA 5FHQA 6YASA 5GZ6A 3HI4A 5B58C 1YQGA 5DI9A 2HEIA 3I01M 1GY8A 3KHSA 5FORA 2D2IA 1XMXA 3NKLA 1XRSB 2D8AA 2WE7A 3SYKA 1LD3A 3PHJA 3GVHA 5AI6A 4HH4A 5E1OA 2KB0A 1SKBA 4W82A 3U7RA 3RHTA 1TA9A 3VZSA 5ADUS 2JGDB 5TEWA 1MO6A 3FGPA 1DV1A 1I4DD 2H65A 1GN9A 2RAFA 2RGBA 3G9XA 3QY9A 3TNLA 4E5UA 4AZ0B 2F9LA 1E7MA 1V95A 2IIVA 4ZQCB 5ERYA 1AHIA 4YRFA 1IOVA 4HFNA 4MI6A 4PAWA 3RGWS 4ZIRB 3GJZA 3ASUA 4ND4A 3HHEA 3OTHA 2VO1A 3RQIA 1NASA 2IP4A 4HDKA 2M6RA 4UBLA 4IDCA 3I4LA 1UBKS 5GADl 4A0GA 3CR8A 7ABPA 4A15A 2R6HA 2B5OA 1NI4A 2G3YA 3IUEA 3M6AA 4KYTA 3WISA 3ZY5A 4HT3B 1NT4A 3A1DA 1A50B 3CLTD 3MWEA 1U3CA 1AZLA 1KOFA 4WV3A 4R8KA 1S4MA 1NX9A 1AVTA 4RLFA 4U7FA 1MOSA 5DSTA 3OOHA 4L0CA 1ZOSA 3C24A 2RCNA 3NQ41 1GGEA 1M8JA 2PV7A 5L8VA 1YFLA 3AGQA 4XD7A 5U1PA 2AYZA 2Z1NA 1NF2A 3CPHA 5EE3A 3UJ7A 1VGQA 1NOIA 1UQRA 5EJ5A 5IKPA 1N6NA 1G8PA 1Q0LA 1VGRA 2C03A 2FF7A 2WNSA 1GCIA 3Q85A 3QOXA 4OYHA 4WNCA 5GONF 2ZS8A 2A1IA 3WR5A 5SY6A 1X92A 4CWAA 3GAMA 1U28A 4UUNA 4RF2A 2KM1A 3TMKA 3PHIA 3PNSA 5CBPB 4UD6A 2Q3HA 3OM9A 1E2DA 2CN1A 4C06A 1Z0SA 2RBKA 1HDRA 1Q7CA 2VUTA 3ZWOA 3DE5X 2OAGA 5GIPE 1IBSA 3QU4A 4WNAA 3WYBA 5LYJF 1Y8QB 2ID4A 4P3PA 1VJ0A 3HS3A 4L5CA 3FCUB 1B26A 1CQZA 2CJFA 3RAGA 5LMZA 1Q50A 3E2MA 3ROXA 2PSDA 1G2QA 4UFOA 1UDRA 3AMVA 4ZVSA 4C4XA 5A5FA 1QDLB 3AL2A 3DVAB 3PEVA 3R3HA 4KE9A 5AM4A 4DNOA 4EB3A 5JSHA 4Q9NA 2VRWA 4ZVPA 4E08A 4GKKB 4E30A 4GPTA 1T1SA 3AILA 1MO5A 4UMFA 1CU1A 2CNDA 4RUKA 2ICAA 3HGMA 1MUUA 3OUTA 3C5HA 1BMFD 3MMPA 2DB3A 1T9GR 4KMSA 3ZE9A 5E0KB 1ZGJA 1IONA 1UKCA 3OIWA 4CG2A 1OXXK 1W88A 1AD2A 2Q6VA 1XCMA 2BBTA 3FJ1A 5I48A 1Q44A 1XTQA 4I1YA 1IAQA 2C78A 1P2UA 2QRHA 2Y67A 4JKYA 3VNRA 2B4AA 1W30A 2JFBA 3FFBA 3GXBA 4PLPA 4DMCA 5C7LO 4BV3A 5KWJA 3WRXC 2Q4EA 4XTCS 3AHDA 2DM6A 1FZTA 3C3EA 1XRLA 3VYTB 3KV3O 4HR7A 1BDBA 3ECCA 2PMCA 2QRKA 2VZLA 3AINA 2SICE 1ZIYA 5HVNA 1UAAA 4BNMA 2REOA 2OORA 4YV1A 3AK4A 4TTPA 2PPVA 1K6XA 4QHYA 1BHO1 5DSXA 1FU7A 1SBIA 4WCFB 3SQDA 3RT9A 1V48A 1CLUA 1SQ0A 4PX2A 3JRWA 2YWFA 3RSOA 1IFXA 1ZU4A 2J3EA 3QZUA 3HI6A 1YQTA 3UF0A 4JYZA 5JC8A 3A3PA 2D4AA 3RRNA 3OQVA 2N47A 4IHJB 4D8UA 2CFTA 2NVUB 2ONZA 2GNAA 5KDLA 3OI7A 1GUAA 1I5RA 3RH0A 3IVCA 5FLKA 4NV1A 5DNCA 4ENVA 1MOZA 2H2AA 1OI2A 4LKRA 1GN8A 1G17A 4RQUA 1A2BA 3W5CA 1E61A 1NTOA 1GTRA 3DYBA 3CTMA 1W2HA 2BR4A 2GCOB 4W4TA 1C4XA 4XRRA 5H4HA 4F0JA 5BN1A 2JBWA 3DKIA 2I4IA 5CTJA 3L6OO 1AQLA 1BYUA 4KXUA 3KU1A 4DEVA 2VZ0A 4RD1A 2ZIEA 1VA4A 5J58A 2ZJFA 1IXSB 3ZDZB 1W0JD 1G291 4DR6B 3K2BA 2Y99A 2PRIA 1CUAA 2ZSKA 1WCWA 5AHRA 3ZBQA 1IEXA 2ZRJA 2W2KA 3I3SR 1YHZA 4KCGA 2UUAB 3SOZA 5ALLA 3O1JC 1W73A 4H60A 3KSUA 1A5AB 1NVKA 2CLDX 4X6XA 4D7AA 2BFPA 2QJOA 4YI3A 2CUTA 5ILQA 2I3AA 4QICA 3G5TA 2QVCA 4BJHB 3VZRA 4CIDA 2HC9A 4Q7KA 5BYJA 3OPMA 4HAXA 4G86A 3FH0A 5ER9A 1D4AA 1JHXA 4FE4A 3QLJA 1K0UA 1NR5A 4ACAA 1U0BB 2VL7A 4V3CA 5EMLA 4AY2A 1XC7A 3TW0A 4DLKA 3OIVA 1Z47A 4TSKA 1LDMA 1G55A 3P0EA 2Q7XA 5T3UA 1VCOA 4YP6A 1K8RA 2ZJBA 3Q40A 4JOSA 3TTSA 7REQB 5C9ZA 5J23A 1AQYA 3MPOA 1A8IA 5GPBA 4XWGA 1NXSA 3EYAA 3RC9A 3BHNA 4XDYA 4I5GA 3TXXA 4D9JA 2Z4TA 3IUSA 1IY2A 1OVGA 4KQJA 3AJDA 5AOBA 4BO3A 1P80A 5IRCD 2I8AA 1HSOA 3V4VB 2R8PA 2F2TA 1PNRA 1FY2A 1TVCA 4FT2A 1Z2DA 1BAPA 3T94A 1BHSA 2O8BB 1T8TA 3OWOA 3K9GA 5K2MA 3ZDQA 2RIPA 4C3UA 4NU0A 4M8LA 4MP3A 1WWKA 1AB5A 1KDTA 2C99A 3VPSA 4NKRA 1LPNA 5FTKA 3TIXB 2W6OA 3DPIA 2XDYA 2VUUA 3QG5A 4FFVA 4JBHA 3CLRD 5I45A 5BV8A 2XBUA 1MA3A 2QAGB 5HQ3B 3OT4A 1O0BA 1NATA 2FEWB 2PU5A 3FUXA 3QMWA 4E15A 2VP9A 4IIUA 3L1HA 5BSFA 1DKQA 2EXXA 2JH3A 1FFHA 2EFYA 4IDEA 4DF3A 2XIJA 1PR2A 3FOWA 1VCIA 2W6ID 1F5SA 3ADDA 5JWOA 2OMKA 2ZITA 3QPDA 3ESCA 3ZBTA 3T6KA 1JQ3A 2VC2B 1ZA1A 4MIYA 2VQEB 1Q14A 1GG9A 4EP1A 4KAJA 5IVDA 4MZXA 1WG8A 1Y1RA 4ZZ2A 2Z3WA 3UB4A 2AI1A 3EDQA 4UUPA 3FG9A 3LPMA 4F6RB 5JLJA 1OI3A 1XF9A 3CVVA 3LYHA 4IHJA 1WBBA 4P5PA 3HJGA 2RKWA 1EQAA 1PJZA 4MICA 1QC5A 2JFWA 4CI0B 4Z5XA 3QSGA 4MKHA 5K6TA 1ZICA 2NVWA 4Z9BA 4MRMA 4P83A 3T3PB 4KXYA 1KORA 3FM9A 1Z4OA 4EKYA 1JIJA 4KBYA 2J85A 2VDOB 1DLIA 4I1IA 2FZCA 2ES4A 1ONSA 4N12A 5EFZA 4TLEA 3RB8A 4CLRB 2XT0A 4EY7A 4RE6A 1ODKA 3HDGA 3PC4A 1HNNA 1VRCA 1GITA 3NYIA 3ESRA 2DXIA 3JATB 2QTNA 5CIWA 1YZVA 4F8YA 2I6FA 3NCTA 2D6FA 2VQDA 4G9BA 1S0UA 3PV0A 4NBWA 1WZ2A 1SG0A 2F3SA 1D0VA 1E1DA 2GD6A 3SEQA 3UTDA 4ZI7B 3ISVA 2JLCA 3NTVA 2O8DA 2QUIA 1G21A 4MRNA 1A77A 2HOQA 3ZCVA 3QXJA 3DVAA 1YQUA 3DDWA 1T3HA 4H6VA 2BCJQ 2VQSA 4DMLA 5TS2A 5KOHB 1KDYA 3VXKA 3HYTA 3OEED 5CT4A 2OLJA 2CMDA 3T5CA 4CI9A 1N5LA 5A9RA 2FXIA 4BU0A 3TEFA 1JIXA 4ID3A 2CXPA 4ALNA 2DQZA 1FE8A 2XAAA 2R00A 3ESXA 4AJIA 4XLLA 4FYXA 5JE8A 1XV5A 1UC5B 3NHRA 1DJOA 4K05A 1UZMA 3BB4A 3ZYZA 2EZTA 3GUZA 5JSZA 4NJMA 4XJXA 2AZXA 2GBLC 1Q6YA 2KI5A 5KKAA 4B4KA 1WB6A 5K0TA 2Z6QA 1MG5A 1XCGB 1TPZA 3NANA 3U3MA 1U04A 3DT9A 2VDNB 4RF4A 4FB4A 4XWWA 3EEOA 3LC1O 1U9IA 3CSSA 3AJ9A 4GD3Q 5AIBA 4K9SA 1JRLA 5L3RA 1M2NA 3KPVA 3RRFA 3W9YA 5BY2A 1VIVA 4MR8A 1KP9A 2HL6A 3BD6A 4PPGA 4C7MA 1UKBA 1WEHA 3C6QA 2CHFA 3BJMA 3JWIA 3W3AH 2D2XA 4AZTA 1E6EA 1E4OA 1ULSA 4UAVA 3U56A 4KR6A 2VZ9A 5L3QB 2PMKA 5CT8A 1RHKA 3U5TA 5TPZA 4Z3OA 3I05A 3TSZA 4TLAA 5AHWA 4C6RA 1XVIA 1VI5A 4AN4A 2PBZA 4YPVA 3QYFA 1O8BA 2BT4A 2FJPA 4DMRA 4DV7B 1JIUA 4MP6A 3U1VA 3DWFA 4Z3KA 4X93A 2FH5B 3VU9A 4F5EA 2C1EA 3OUZA 5FOTA 3NP7A 4JMPA 1T8YA 2AI3A 4ILEA 1D6SA 4YHBA 1TC1A 3B7PA 2NU6A 3F0TA 3U7IA 3V8EA 2O1WA 2KJQA 5KVVA 3ZXSA 4UC0A 3LW7A 1RACA 3LX5A 4UOEA 1FFDA 2GHTA 4DW8A 1F6BA 1J33A 3I83A 1H1TA 2J9YB 2ZB7A 3H18A 3MJFA 2EATA 1C9JA 2BFBA 2P90A 1XOIA 1TD1A 2OCLA 1LLCA 1MJGA 3NASA 2QSYA 2VBGA 3WNZA 3A2NA 1M1YA 1DTWB 3KZMA 2ZB4A 4QOSA 4UW9A 1GLGA 3TQTA 1F1BA 2B94A 2O23A 3LKBA 2DR3A 4HQ0A 4NE2A 4B85A 5ILGA 2YZNA 5FJIA 3X1MA 5CB4F 1ZN7A 4V2IA 4CIWA 4D43A 3BIOA 1BJKA 1MG0A 4ENRA 3HWX1 4LK3A 3LGXA 4OOFA 3WNDA 3SVZA 1TM2A 3VGPA 4ZU3A 5I3ZA 3CNOA 4G37A 1N9ZA 4D80A 3TBKA 5C31A 2LKDA 4GP9A 4DQ0A 1H69A 1IZ7A 1T3TA 4U8GA 2PKWA 1R8SA 3IDZA 1KFCB 3M4NA 3MLEA 3V46A 4ZIRA 1QRTA 3RYFB 3WIVA 2XF2A 3NS7A 3P2MA 5ICMA 4JITA 5K01A 3R8CA 3EVEA 4AZ0A 3U3ZA 1HZZA 1N5MA 2G4LA 2NADA 3I73A 3AEQB 3UC5A 1XZQA 2L2QA 1PJTA 4W5WA 2QNBA 2P2CA 1NLMA 2OBMA 3D8HA 5IXSA 1Q84A 4DR2B 4NHEA 2H3HA 3WZLA 3IEIA 4D46A 5KMGA 3JWEA 4UDYX 1RYBA 4TTAA 2XQIA 3I0MA 3GH3A 5EKUA 2OFOA 3WLRA 1T0JB 2R751 2ENUA 3AP1A 2O6LA 5LN1A 4ZVNA 3GXOA 2OVBA 5ITSA 4UNNA 1YKGA 3LT5A 3LPLA 3PQDA 3DDCA 4R9NA 1XRJA 5EQDA 4UM9D 5CXUA 2HU7A 2WPDD 4OHZA 4DABA 1UXIA 4BNYA 3HDYA 1CQWA 1RJDA 3C6BA 4C5BA 4KFUA 2CE7A 4JP5A 1PGQA 5EUMA 1V3VA 2ZQZA 4QD3A 3R9XA 3LY5A 2AOVA 3L7IA 1PLLA 2V7EA 4UXHA 4HB2A 3U4CA 2W6NA 5FT9A 3O9VA 2CFSA 1QZXA 2O2HA 3QXCA 2VSXA 4L3VA 2CJYA 5JQGA 2ANCA 5KWVA 2B3DA 1NN5A 1NN3A 2QW1A 3OP1A 1E9EA 4XCQA 4BV9A 1RHUA 4QG3A 3AOEA 3DOJA 3T5BA 2HQOA 2WG2A 4LHVA 3SC4A 1Z33A 2HFJA 3D6JA 1OFTA 3ZE6A 5B2ZA 1MF7A 1X77A 2ASVA 3CH6A 1KS9A 4ZYLA 3PRJA 4XGRA 4EJSC 4M7WA 5CA0A 3BCHA 4LBYA 4MI9A 1CY2A 3Q8WA 1Z0ZA 3DSRA 5BQXA 5AYVA 1CVRA 1IY9A 2Y4NA 4Z3DA 3K2EA 3D7SA 1OXVA 2WTUA 1J09A 2OZLB 4ETWA 3K8YA 2E7ZA 4NNOA 4HJXA 3RHSA 4R3UC 3WDKA 5J4VA 1HDOA 1JIQA 1OY1A 5AK4A 1EJBA 1M72A 1N5DA 1NSFA 1S2MA 1WCXA 2EFCB 2QT9A 2YJ6A 4QRHA 5SYAA 4DNPA 4F3NA 2V7GA 4GP6A 5EWJA 5HE8A 2MOKA 2IZ6A 3OAAD 4HTFB 3OCWA 1J0BA 4PICA 1ZKMA 3ESAA 2AKAB 3AZPA 3COZA 1U7DA 3IIIA 3T3GA 4TWBA 5AUOB 5BN4A 4RH1A 1TU0A 4B35A 4BO2A 4RIEA 3JYHA 2OXEA 4KIFA 1AG9A 3HE3A 2A0KA 1OB5A 3KJIA 3WYAA 2VPPA 2ZPAA 2UZAA 5LNK1 2PGAA 4BNIA 5AVRA 3J81k 2VLIA 4NH0A 1GL7A 2DQKA 3D3KA 4HNVA 1F06A 4XJVA 2VF8A 2AIRA 1YQQA 2I7DA 1BROA 2QTAA 3AC0A 3CLSC 2FSFA 3NWPA 4E1VA 5JZSA 5KB3A 1AJEA 1J2UA 2OZKA 3ETCA 5IYZA 1XAGA 3HXMA 3V5NA 2XDWA 6REQA 2CDNA 2FLWA 3ZQUA