4M9QA

Crystal structure of c-terminally truncated arl13b from chlamydomonas rheinhardtii bound to gppnhp
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
196
structure length
195
Chain Sequence
GPRKITIALLGLDNAGKTTLLNSIQGEDRDTTPTFGFNSTTLNEGKYKIEVFDLGGGKNIRGVWKKYLAEVHAIVYVVDAADPGRFEESKMTMAEVLENQFMRDKPICIFANKQDLPTAAPAAEVVKGLGLATCRNSHNVFPCTAKMPAGQDVDHRLRDGLKWLVGTVDREFGRLDPRVQTEAEEVRQEEARKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ARF-like GTPase
publication title Structural insights into the small G-protein Arl13B and implications for Joubert syndrome.
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Hydrolase
total genus 71
structure length 195
sequence length 196
chains with identical sequence B, C
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2013-08-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4m9qA00
2JLQA 2O0JA 3LVQE 3T35A 4TL7A 2NQ2C 2BM1A 1W4RA 2BOVA 2OV2A 3PG5A 4JLKA 5DYIA 5JZVA 1D8TA 4JLOA 5LDDC 2G88A 4DLYA 4MYTA 3WMGA 4OHVA 2Q9CA 3SJCA 3ECCA 3C5CA 4RD4A 2FX3A 1U9IA 4D25A 1JI0A 2GZHA 2H18A 4C0LA 3IO3A 4V0MA 3S1AA 3H1TA 5KTYA 3THYB 2ZQ5A 2B8WA 2CEAA 4YMSA 4I1SA 2AK3A 1VYVA 3QUSA 4JVNA 4NDZA 1X86B 3EZ2A 4MUAA 3M1IA 3B78A 4Z51A 1EFTA 2AFIE 3HYTA 3ZVNA 3H86A 2F1HA 5P21A 2IXGA 4D4LA 1A2BA 2BIFA 3OEEA 4O2RA 1NKTA 2JJ1A 2WWWA 4TTRA 2G0TA 2QQ0A 4KSBA 1OE0A 3GFPA 2CE2X 2AXNA 4BLRA 1FMJA 4GI7A 4UXIA 2N46A 3U4QB 1QHGA 1MRSA 4OBEA 5J4VA 1DE0A 1T0JB 1UEIA 2BMJA 2A5YB 4TQ9A 1JQLB 1W0KA 2IW3A 3VU9A 2PJRA 4AG6A 5CK5A 3ZIAA 1UM8A 1Q1ZA 3DKVA 1W44A 5FBLB 1OIVA 2DY1A 2PZEA 3K8YA 3C15C 1ZC4A 4LGMA 1E9BA 2ORIA 1XMVA 3Q7QA 2WTUA 1T3LA 1W4BA 1GKIA 3U3KA 2CHVA 5FL7D 3CNNA 2JDID 1CEEA 4DKXA 1X1RA 3G82C 4Z8YA 3AF3A 2GNOA 3EWSA 4MRPA 4W5WA 2VF8A 4KLZA 4TZ0A 1UAAA 2E1RA 1XD2B 3X1DA 2QQEA 1N0WA 4Z54A 3FVQA 4ZKEA 1GVNB 2O8EB 1QVAA 4B2PA 1GRQA 1S2MA 3NIBA 2VHUA 4TQAA 2J0VA 1ELOA 1NVXQ 4TYNA 1CKEA 4CF7A 3R9XA 1GFIA 4B3CA 3SQXA 4LV5B 1G18A 4IVPA 5DI9A 1NBME 4DLUA 5A0FA 3ZS9A 1F3OA 3GJ5A 1KSGA 4B76A 2OZEA 1HY3A 4M53A 2V7QD 5FPTA 5JWHA 3LX5A 2XTZA 4P0TA 4BEJA 5FI0B 1KKLA 2XB2A 2RGGA 4X8LA 1GSIA 4S2EA 3T1VA 3IIJA 2VP2A 2FGKA 2ZJBA 2PMKA 1GG2A 3TUIC 2GCOB 3BE4A 5C4GB 1PLKA 1XTIA 4Q19A 3NBYC 1GNQA 2ONJA 4PC3A 3SBDA 1E2JA 3BFXA 3GJ0A 2QA5A 3KKQA 2OAQ1 4IDQA 2LKDA 2GEVA 1KKMA 4DRZA 1KDRA 3LO5A 4GPTA 2ZRMA 4JIMA 4MRSA 1CBUA 1CJKC 2OLKA 3C7KA 3ZDQA 4C30A 2EYQA 1KK1A 3K70D 3A1TA 3KQKA 3QBTA 2W6ID 5KSPA 2C96A 2G3YA 2R6AA 4YXWD 4WZAE 3OFNA 4V0LA 4ITRC 5FOSA 4DB2A 3T34A 2H92A 4A1FA 2GK6A 1K5GA 1E2LA 3I5XA 5LD2B 1BYIA 2G1KA 1GRRA 1DELA 1U8ZA 1E2KA 1QBKC 2DWPA 1KI2A 3GCGA 3SN6A 1M1YE 2VP5A 3I8XA 4P32A 4JYCA 5FUWA 1RRFA 2GCPA 5FL7A 2A5FA 3TSZA 3NC0C 1LNZA 2WJYA 1DG3A 4MKHA 5B58C 3KTAB 4PSAA 1DS6A 3BC1A 3RRNA 4JLAA 4R98A 3AVQA 5CM9C 3SYLA 4NH0A 1EESA 1W46A 4D6PA 1M74A 1IJFA 1EG7A 1GZSA 2QZ4A 4PFSA 1AKYA 1VMAA 1E9EA 4TT3D 4HLCA 5HKKD 2Z43A 1A7JA 3H0KA 2C8VA 2HDNB 1KO8A 4TMTA 2EWVA 3KQUA 1G3MA 1G64A 3FFAA 1OF1A 3IKJA 4G01B 3U7HB 1E9CA 2ZI6A 1OJLA 1D9ZA 1G5RA 1S8FA 2IYTA 4FINA 4ASUA 3P4XA 5BN5A 4IVQA 1NL3A 4RKEA 3IGFA 4M4SA 4M22A 4E5UA 3VR1A 2PLFA 4GZMA 3GLFB 2CVFA 1LTQA 3K0FB 4HLUA 3KX2A 3IBYA 2YV5A 1NJFA 4YC7A 1S3SA 1W47A 1VYUA 3BFVA 3KKPA 1ZM3A 4CEHA 3EPKA 2YC4C 4KSCA 2JJ2D 1ZM4A 4A6XA 3KQLA 4LPKA 4LC0A 2WWYA 1ZD8A 3GD7A 4TMVA 5D3QA 4DLRA 2D7CA 1KK3A 1R2QA 1XJCA 2ZE6A 2WZQA 1VHTA 4G0NA 2VEDA 1COWA 2BC9A 1Q0UA 3EZ7A 2QI9C 4A2QA 2H17A 2ORWA 3AB3A 2O52A 3UXMA 3K9HA 4HYYA 2YOFA 3DHWC 4PZLA 3SQWA 2QT0A 1XTJA 3DOFA 4ESVA 3UPUA 1W36C 2P6UA 4PHFA 1VYTA 5KPDA 3ASZA 3ICEA 1FFHA 4JSTA 2BVNA 4JJZA 4PQYA 1NSTA 2QP9X 4DSTA 2IS1A 1XBTA 2KI5A 1Q21A 1CLUA 4HLQB 5SZIA 1KSJA 1UKEA 1VG1A 2HV8A 2HCJB 4NBSA 3TVTA 1EWQA 1FNNA 3QKTA 4Q02A 3TKLA 1FX0A 2O8FA 1E69A 1E2IA 3WHKA 3U6KA 1FP6A 1XTQA 4YMWA 2IK8A 2O0KA 3QNUA 4OQLA 3A4NA 2IYWA 3PUVA 3QG5A 4M1KA 4OI2A 4LJ5A 2ZR9A 5HKKA 5LPNA 3AQ4A 3KFVA 1KK0A 2A9KA 4LHVA 2ECKA 4B35A 1AS3A 3FMOB 4HAYA 4XVUA 1XPRA 2XZLA 4BLQA 5FBQB 2YINC 1DTSA 3GEEA 1YJ5A 1S1MA 3TVDA 1JAIA 4R2HA 4URVR 2CJWB 2UZ3A 3U44A 3AKEA 3PUZA 2YWHA 1NMZA 1OH6A 1QHIA 3QPWA 2F1RA 3GLGA 1IN6A 1LS1A 3KJGA 4E03A 1H8ED 1IXZA 5JS8A 4V0OA 3TMKA 1NG1A 2HLDD 4KHZA 3EWAA 5EE5B 5J40A 1IHUA 1KSFX 3AKCA 4EFNA 3U3JA 2IYRA 2ERYA 1T3HA 3QPUA 2YKGA 1XB2A 3AVTA 1P5ZB 1ZNYA 3C8UA 5GVRA 2QRZA 1QDEA 5DSZA 4KVAA 1QVRA 1YZNA 3TSOA 3VR6A 4Q03A 4QXAA 5FH9A 2W0MA 3TNFA 2E87A 2ZJZA 2RGEA 2W83A 1PJRA 4DB4A 1WA5A 1AS0A 4J0QA 3GJ3A 4DCSA 1OT3A 2J7KA 5KHOC 1EX6A 1AM4D 1CTQA 3BFKA 3KL4A 4LJ9A 1A82A 621PA 3KQNA 1NNEA 1U98A 2QG6A 3EG5A 4ZIRA 2DFLA 2VHJA 4Q21A 1MO4A 4KLNA 3W9YA 2IYQA 1JXOA 3FHCB 3VAAA 4Z1MA 2NTYC 5JHHB 1KO5A 2G1JA 4B3GA 2XZPA 3C16C 4LUCA 2NZJA 2PBRA 4M9SA 5DI3A 2QUZA 1TQ6A 1G5TA 1Z47A 4GFDA 4JMPA 3ZVRA 1ZU4A 2PJZA 3T12A 5KDOA 3TUZC 3GJ6A 3LLMA 1U0JA 1P75A 3B85A 2W2VA 1EFUA 1VCIA 4OQMA 2UVQA 2H8KA 3E2IA 1OIXA 3QKRB 4FIDA 4H1UA 4NYJQ 4CT5A 5AUOB 1XTRA 2VO1A 4JZKA 1VCMA 2B7BA 2VSOA 1KDPA 3U7EB 3CW2A 3T61A 4BZQA 2WWIA 1HEIA 1X8KA 4D4JA 4IDPA 4NONA 4XWOA 3EC1A 2GJKA 5E7MA 3R7WA 5FPSA 5F98A 1US8A 5JJIA 2ZR0A 1ZIPA 4XIGS 3NEJA 3VHXA 4F4CA 1AKEA 1G3QA 2CCKA 1SGWA 1SVSA 2ZRGA 4KYIB 2HYIC 2NZ8A 2Z6VA 1KMHA 1N6NA 3NVAA 5ELXA 4L9WA 1T5LA 4AKHA 2AK2A 3M6AA 4RZUA 1CRQA 2Z5FA 1OXXK 3IEVA 1Q12A 2BCGY 4CDGA 4LBVA 2G6BA 2FFAA 4KFUA 3TAHA 2FSGA 3B1XA 5JWRA 1WBDA 1NP6A 5F3WB 3IPXA 1UF9A 2J0UA 1VG9B 1UFQA 3TAUA 4BFZA 3D6TB 3FHTA 1UDXA 1QF9A 3FTQA 1XMIA 1AK2A 1O3YA 4YDHB 1PVOA 1I2DA 2OUKA 4BLOA 5L3SB 2FPKA 1YZQA 4Q7KA 1OV4A 1CJMA 4HSEA 2ZRDA 4LK2A 2D62A 3WNCA 5KU1A 1MO3A 1OFTA 5SZKB 1W2GA 1KI6B 1J8MF 4BPBA 3T15A 1VHLA 2XOKD 3FMFA 3Q5EA 1KNXA 3TK1A 3VMFA 4DHEA 2CLCX 3JZAA 3PV0A 4IJMA 5JI2E 3QF7A 3SS8A 2A5JA 1SZPA 2R6GA 1Q1BA 4NTZA 3EIHA 4A0RA 4G5QA 4UNRA 1K6MA 2FE4A 2IYLD 3HYRA 4DCTA 2OXRA 4L4UA 4US1R 3ZVMA 4A4DA 5L3QA 1G8FA 4UJ5A 1XRJA 2ZM5A 1KZGB 2ZIAA 4JBYA 3TQFA 4Q01A 3ADKA 3K0CA 3AM1A 1R4AA 5HR5A 4HLDA 3QVUA 4LX0A 3A6PC 4RD2A 4Q1DA 1X3SA 1OXVA 2IUTA 4D0NA 3JVUA 4ESHA 1GITA 2W00A 3B9QA 2YOGA 2J0SA 5TV2A 2JLRA 2ZRJA 2HJVA 5BWMA 3AVUA 4K81B 3W34A 2GAAA 1AIPA 1TF5A 1KTVA 2QP4A 3DVLA 5AR1A 4ILEA 4M8NE 4DJTA 4EFLA 1NF3A 2H7VA 4Q1CA 4DDUA 2PX3A 2QORA 1BS1A 1YZUA 2CL0X 2YVUA 4PO9A 1G8YA 3W90A 3OIVA 2OXCA 1XZPA 4RCYA 4BRWA 1QRAA 1W7AA 3L0PA 2LWIA 4Y0VA 2C9YA 2G83A 2QY9A 2V55B 1DARA 1XTKA 1LB1B 3WP0A 1PLLA 3N5CA 3B7GA 1KJZA 4KXFB 3ZS8A 4U7DA 4LSGA 3THWB 3MG9A 4OKSA 4DC9A 3I1FA 4U02A 1N0VC 1BO6A 2J59A 4NHOA 1NBMA 3SBEA 3CF0A 4EJSB 4FW9A 1V43A 1G7RA 2W2TA 1Z6TA 4ZDJA 1M7BA 2A7QA 3RC3A 1NN0A 5LD2C 2QGZA 1FNMA 1YE8A 4KJZA 1DBSA 1II8B 4N1AA 3UMFA 2FG5A 3QSYA 4ZV4A 2Q6TA 4URUR 3R20A 4BFTA 1M2OB 1XEWX 1ZMXA 2XOKA 5GJVC 5IK2D 1L4UA 1P73A 4IDOA 2MSDB 4JLNA 4GDFA 4DZZA 1KJYA 4BFWA 2D2FA 2FNAA 2GJAA 5FPHA 3MJHA 1SKQA 3THXA 1VIYA 4BGDA 1KO4A 1OHHD 2DHRA 2REBA 4HB4A 4Q4AA 5JEDA 5KO2A 1D6JA 2QPAA 4RFSA 4UXJA 1R10A 2VRWA 3QQ5A 3TR5A 1OKKD 2D3WA 3I8SA 2W58A 1A2KC 4IW3B 2XXAB 1T91A 3R8FA 1R5NA 1E0AA 4KFRA 4Q9IA 2FEOA 3X1ZA 3A4LA 4HEJA 1JQJC 5KUTA 3WY9A 3PEWA 4OI0A 1YZTA 4OYHA 1DO2A 4PSKA 2ATXA 1R8SA 3B6EA 4M9XA 2OT3B 3GJXC 4F38A 4MGZR 3ETLA 5AJZA 1R7RA 3REFA 3SFVA 3BERA 5DIFA 3SNHA 1P3JA 1SKYE 1OXUA 1VTKA 1S1CA 4YMUA 3UG6A 2I1QA 4O2LA 3VQTA 1J70A 3NC1C 2O8DA 5DE3A 1XCGB 3H2YA 5L3RA 1P2TA 3OF5A 3CR7A 4NCJA 5E3HA 4DUGD 3DPUA 3TUJC 1VG0B 2XEXA 3F0TA 3D31A 4G5OA 1R0ZA 2EQBA 3OEHD 4N3NA 2X19A 2R9VA 1GILA 5DYGA 3SJZA 4QHTA 2VTKA 1DEKA 3VX4A 4EQ6B 2WICA 2MMGA 3RABA 3CZQA 4LDJA 3AF2A 4IFEA 4D81A 1MT0A 3CRVA 3FMIA 4AIIA 2Z83A 1WB9A 2QBYA 1HT2E 4A6PA 2QBYB 1DAFA 3CH4B 1SVMA 3HDTA 1PZNA 4KBGA 2R6DA 1EGAA 1WE2A 2F6RA 4CEIB 3HWSA 2QTHA 5EP1A 2XGJA 5E7IA 2CCGA 5SZJA 2ZJOA 3E1SA 3LW8A 4UKDA 1CRPA 5AUPB 5B64A 3U7GA 4TZ6A 2WAYA 4CEJB 1A1VA 2RGCA 4AYWA 4FI3C 3KB2A 5A5GA 3GLIB 2JLVA 4BLTA 4HAWA 4LWZA 1TL7C 4JLJA 3QF4A 2GDJA 4ACAA 4Q4JA 4EAQA 5EP4A 2WKQA 1OFUX 3RS0A 2JIZD 2QGNA 1XD8A 1OPXA 1KIMA 2SHKA 1FTSA 1XEXA 4ABYA 3TR0A 2XNDA 4R7ZA 1AS2A 1E1QD 4QM6A 1R0YA 1XX6A 5EXXA 2ZAOA 3SYNA 4C7OA 3FB4A 4MH0R 2EYUA 5EJEA 2D2EA 2V6JA 2WSSD 4IDHA 4JBXA 4DDTA 1KI4A 3I32A 1IOZA 1NG9A 4WAUA 5ANRB 3EA5A 1FQKA 2F1JA 3IDQA 3M0EA 5EXPA 3ZH9B 2CNWA 4PAMA 2ZRBA 4JYBA 4TTPA 1CIPA 1WBBA 1SHKA 1AJEA 3TW8B 2BKUA 2J5XA 1SVOA 3KFXA 5JBQA 1HUQA 2F3RA 1X1SA 3PIRA 2W6JA 4HI0E 3NEYA 3AV0B 2QTVB 2HT1A 1GL7A 4A36A 3GPLA 3T1TA 1H8HA 1B0UA 5FPYA 4A2WA 3Q3JB 1P2UA 3QG1A 3SR0A 2IEYA 1IJEA 3K9LA 5JS7A 3U60B 1HE1C 1RYFA 2KBFA 2GK7A 4DSNA 2GVDC 3CH5A 3JVVA 4QM7A 3GFOA 3K0EA 1G3RA 3LA6A 1D5CA 2PEZA 3THYA 3BB4A 4AI6A 4G5SA 3B1ZA 1JR6A 4AKIA 3L8ZA 1CXZA 2ZROA 4JL5A 4PSVA 1GTVA 5FOXA 3Q5DA 3P4YA 5JECA 1V5WA 4TSFD 1M7HA 4PTLA 1ZNWA 2D4HA 2ZJYA 1S9HA 2ZANA 2J41A 4LHWA 3MWKA 3PITA 2F43B 5G3ZA 3U7FB 3U4QA 4MGKR 2A5GA 2C03A 2WJJA 3FHOA 1HA3A 4HDQB 2EW1A 2C77A 1E1RA 4QBFA 4V02A 4M0LA 1Z29A 2PX0A 2QP3A 1Q22A 3C4JA 4B48A 4HAUA 3NDPA 1KI9A 4EUNA 2P5TB 3WHLA 5BXQC 1YZGA 2C99A 3SOPA 2YHSA 5J4LA 2P6RA 1E1QA 3KJEA 5FTJA 1YR9A 4LYFA 521PA 3O8RA 1YQTA 3MWJA 6Q21A 2ZJ8A 3X1YA 4BECA 1C4OA 3CRW1 4AYTA 3NH9A 3P1JA 2BBWA 3UMRA 2CLDX 1UEJA 1Y3AA 1IN7A 2GXUA 3MWYW 1XD2A 3AVOA 3EAQA 1S0UA 2JAQA 2O8EA 3BH7A 4PZYA 2IHYA 2R44A 4W7SA 2C78A 4C0SA 1Z28A 4D4KA 1JNYA 4LZZA 5H8WA 3BD9A 3MD0A 2P0EA 4L9SA 1N6RA 2QTFA 4TLDA 1Z5ZA 2PZGA 1ZM2A 3AVYA 1IY2A 121PA 2VPPA 1WRBA 3ZLJA 4CGZA 2DCUA 3HP1A 4KFTA 5EUQB 5G3YA 5FR1A 2JCSA 2NIPA 4BQSA 2RKOA 4MDEA 1NIJA 1KYIA 4EFMA 2RGNC 2WJVA 4JS0A 3W5IA 2GVZC 4O0MA 2Q9BA 3MSXA 4WBSA 3VR3A 2KWIA 3VR5A 4B3DA 2GCOA 2A2ZA 3QIAA 2BJVA 3MRSA 1G16A 5KNCA 4ZKDA 2BMDA 4TSFA 3DEFA 1NY5A 2IS2A 2FSFA 4QJ4A 1QG2A 2GXQA 1P6XA 4F4JA 1R5OA 3A1SA 4XSGA 1F2UB 1XCPA 4QKQA 1G3UA 2G77B 1XJ0A 1XDBA 1Z8FA 2ANBA 1EK0A 1NN3A 3QBVA 4DCVA 1E32A 2I4IA 3B1WA 2P2LA 3BXZA 2Q9AA 1E2DA 5DN6D 1GNRA 1GDDA 2B21A 2VP4A 4L5BA 2DFNA 4LBZA 4ZCIA 4QBIA 1OH5A 1KK2A 1LW7A 3B1VA 4TN1A 1HTWA 2FZLA 1D2NA 4F91B 5JI3E 2FJUA 2ZI5A 1ZW6A 2JDIA 1S96A 2LCFA 3KTAA 3I92A 5J47A 2BEKA 3UG7A 1IONA 1XD9A 4CRWB 3T06B 4LYAA 2CXXA 3KQHA 4PHHA 1M6NA 1I4TD 1KGDA 4LYHA 4Q4HB 1MO5A 3KUCA 1WMSA 1N2CE 2EU8A 2Z4RA 2ZEJA 3FWYA 4DCNA 2GA8A 3NKVA 1A4RA 4BUJA 3WRXC 2OLJA 4URWR 2DPXA 2ZI3A 4EJSC 4NYIQ 4C3ZA 3MUFA 5B2ZA 5GADl 1Q57A 2PT5A 4HAXA 4U5XA 1R5BA 1NLFA 2V7QA 1E0SA 3TGPA 4LHXA 1JEDA 4GNKA 2ZS7A 2VH5R 1JALA 4TMWA 3ADCA 3GLFA 4BEBA 4X8HA 3BIFA 2A3RA 2J1LA 3RSLA 4N0DA 3K0FA 2OAP1 3RRMA 2IS6A 5D3MB 1GWNA 2IBMA 4W5HA 1E2MA 3FYHA 1CR4A 2REXB 1UPTA 2GETA 2B8TA 3MWLA 4FN5A 1DAIA 4PPGA 3SEAA 3WMFA 4DWJA 5JLJA 4IEIA 5TY0A 2QRNA 3AVVA 3A36A 4QOSA 2X77A 3GQBA 4PC6A 1KAOA 1KDTA 2WVJA 3NHBA 1BYUA 1QHYA 2BDTA 2ZRLA 2HJGA 4KO8A 4M1TA 3TLXA 2BMEA 4DIDA 3GLIE 4HZIA 4JKYA 2W6IA 4KAXA 2HXYA 4Q18A 5FUXA 1T8UA 5GVSA 4YXWA 4NZYA 1L8QA 4YMVA 4MDFA 1DO0A 4LRWA 3LNCA 2ZSDA 5JCPA 1OFIA 4RD1A 3DMDA 4M1YA 4JL8A 2YNMA 1BKDR 1ZBDA 3DL0A 5LB4A 4P31A 4DDWA 1FPMA 4MRNA 1G8GA 3I4LA 3KZ1E 3ICQB 4PANA 3VKHA 4PC2A 1MABB 4EPTA 3CPJB 1XJQA 1YU9A 5EP2A 5BYKA 4C2UA 3QJYA 3RWMB 2X8AA 3FFBA 4FD2A 4LC1A 4P4TA 3T5DA 4OHYA 3WYFA 4IXMA 1Z6GA 2GEUA 1IXRC 2DR3A 2QM7A 1YR7A 4P33A 1TU3A 5JCZA 3LLUA 1G41A 1ZM9A 2FSHA 3CBQA 4DBLC 4TT3A 4F7WA 1CR1A 1W5SA 2ZSBA 1YHNA 2ZI7A 4X8MA 2GILA 3RANA 1ZNXA 3DKPA 4URXR 2D74A 5AUQA 5DLQC 2B6HA 2JA1A 3FKQA 2WM9B 1II0A 3CM0A 3LRPA 1P61B 2AX4A 2CJWA 3RAPR 4IOLA 4C4PA 1TQ4A 1U8AA 2P3SA 4QNMA 2FWRA 4WXPA 1G8PA 3CR8A 5L8VA 3AKDA 4JBWA 1XEWY 3G0HA 3BWDD 4I1OA 3AEZA 3LQRA 3L82B 4A2PA 4AK9A 2H57A 1J7KA 2WJHA 5H70A 4ZCMA 4QG7A 1RKBA 5FL3A 3KKMA 2PT7A 3HU3A 4AKEA 1JB1A 2CDNA 2JLSA 2EFGA 4RKFA 4URYR 1LY1A 2WPDD 5G53C 2QMUA 1ZD1A 2JJ2A 4CW7A 1WCV1 4OL0A 3A1VA 1XWIA 3QE0A 2KE5A 4BE7B 3PEVA 4ZCLA 1ZINA 2DFTA 1NVWQ 1ODFA 2MMCA 3W6NA 3QI2A 2RGXA 3N2EA 2RGBA 2KJQA 4L8GA 1GKYA 3VR2A 5FBVB 4O25A 1MO6A 1Q3TA 3U5ZB 2OBLA 3VR4A 2L0XA 1S3GA 1ZVQA 4RD0A 2YWEA 4LOAA 1SXJC 2VF7A 5TB5A 3ZZ0A 5IDVA 4AWXA 2OCPA 3LWNA 5E4FA 4F4IA 2ZETA 1Q20A 5DO9A 3SZRA 4C0AC 1YZKA 1JR3D 5J4KA 5JSZB 3LD9A 5KNBA 1XP8A 3QXSA 2WIBA 2IXFA 4HDOB 3V4RA 1G6HA 2AFHE 5L3VA 3CO5A 3W8RA 2GBLC 1E99A 2FMXA 5HE8A 2IS4A 1SHZA 2I3BA 1AGPA 1X8JA 2FSIA 3IBGA 3QKRA 2V54A 5CK4A 2EFHB 1XU4A 4IEEA 2IHBA 1KY3A 3A4MA 2ZAMA 3TH5A 4NYIR 3I3SR 4D80A 3W6OA 4KFSA 3K09C 1P62B 2YWFA 3IUYA 4LBYA 4RJLA 2QMEA 1ZNZA 1RRPA 2X2FA 3CWQA 1WF3A 3C5HA 5EUMA 4FCVA 4GMXA 5CLLA 4A9AA 4US2R 1NMYA 3CLVA 1BOFA 3TRFA 1TEXA 1MV5A 1U0LA 2AHOA 3THOA 5LBIA 1H8EA 3Q9LA 3AVXA 1YRBA 2IF0A 3CNLA 3E70C 4ZDKA 2BBTA 2HLDA 4QGAA 1E2PA 3L8YA 4ZPXA 4TYYA 4QJ3A 2O0HA 2ODEA 3RS3A 3EPHA 2GCNA 4Q7MB 3BJIC 1N6KA 2ZREA 3NBFA 3R9WA 3NDBB 2F3TA 3BBPA 4FXPA 2QU8A 2WWFA 3I61A 4OJKA 2O5VA 1LFDB 1AZTA 1OYYA 4OI1A 1QHHB 5CITA 5L3SA 1IM2A 1FQJA 4X8OA 3UIEA 1NMXA 1U8YA 1P72A 3HPRA 4JKIA 3EW9A 2FFHA 2RHDA 2VQSA 4Q7LA 4B3FX 3ZD6A 5AJVB 1OW3B 3SJAA 1KI6A 2HT6A 4IOMA 2ZRAA 3MLEA 5KOYA 1Z6XA 2RGNA 3NH6A 3NBZC 4QC2A 3U61B 1Z2CA 4Q48A 5KSZA 1JXMA 1K8RA 3Q8XB 1I4DD 1OXSC 3ZQJA 2ANCA 3QKUA 1KO7A 5TDHA 5K8IA 2ODWA 1YKSA 2WAXA 3CPHA 3GEHA 4HB2A 5EXSA 5EXTA 2QL6A 5FTKA 4ARZB 4Z8XA 3L43A 1JR3A 3QEOA 2KSQA 2ZRIA 5FPKA 1R8QA 1ZUNB 2CCJA 4W5JA 4QBGB 1HV8A 2CL7X 2XNSA 4I1UA 1UKVY 2Q21A 1OH7A 2CK3D 3W3AA 1LF0A 4BWYA 4AC9A 3GFTA 3UANA 2RHMA 4MITA 1JPJA 2PZFA 3OE7D 1DPFA 1E9AA 3CIOA 2ASEA 3RSOA 4V0KA 4EPVA 4LJYA 3ND8A 3UMSA 4DT1B 4AD8A 3LXRA 1SVKA 4MGIR 5F2EA 2C04A 1R6BX 3O8DA 1KHTA 3QXXA 4LBWA 3CKLA 1TU4A 3DO6A 2IYVA 1N6OA 2J7PD 5HTKA 3ZQ6A 2UZIR 1OYWA 3EXAA 2AWOA 5KYKA 4OK6A 2C95A 5JMTA 2AN9A 5FR2A 1NLZA 4R9UC 3GLFE 3KXIA 2R62A 4B2IA 3QOFA 5EQTA 5UKDA 3W8NA 4YMTA 4TMZA 5EZ5A 4M9QA 2JLYA 2NO0A 3UWOA 3AP2A 2WMNB 4GT1A 2ZRNA 3RS2A 1TF7A 1G7TA 4MUBA 3THWA 3AP1A 1GL6A 3RHFA 1JJVA 3P32A 1NVVQ 2JLWA 3AVWA 1KDOA 2XTMA 3B60A 4EJSA 4GL2A 1JBKA 3ZZUA 3NXSA 3ZD7A 3LBIA 3LDAA 4UJ3A 2NPFA 3SYKA 3PR1A 1W0JD 4TL9A 2FPMA 1GOTA 1II8A 1ZRHA 2GWHA 3GLHB 2GRJA 2HXSA 3T1OA 2ODBA 2I1VB 4OHXA 1IN8A 4FCWA 2BMFA 421PA 3K9NA 4LHZA 2QE7D 1P60A 2IUSA 1XF9A 2GESA 4JLBA 5CJPA 2ZJ2A 4MQBA 4LV8B 1S9DA 2ZVPX 3I72A 5CDFE 3N70A 2WBLC 4TYWA 2WSMA 4I4LA 1HYQA 2C5LA 3LW7A 2OCYC 1ZUHA 4FWIB 4NYJR 3ADBA 4NCIA 4WW0A 2YWGA 2CK3A 5BN3A 1FTNA 1EWRA 1N3BA 1W1WA 2IA5A 2WWGA 4MRVA 4XTCS 2XXAA 3B82A 4DSOA 2R8RA 4NCNA 3PEYA 1XPOA 1ANKA 1MOZA 1RW4A 2OFXA 1RRGA 4RVCA 2D7DA 5GJBA 5HPYB 3RVBA 3LAWA 3NHAA 1SXJD 3B2EA 5EE1A 2GF9A 4TLAA 3R9IA 4A8JB 4GMDA 4IRUB 3BB3A 1N5IA 1HURA 1FP7A 4Q47A 1G3IA 3W5JA 4HDCA 3TIFA 2ZTSA 3EPJA 1E9FA 1D9XA 2DB3A 1E2GA 2D06A 2OCAA 4JLVA 4NMMA 1W4CA 2HF8A 3BORA 3FKSD 4MYUA 2ZVQX 1Z6AA 2LKCA 4QHYA 1F5NA 3L2OB 5AK0A 4DLTA 4P4SB 4Q4LA 1EFHA 2QEQA 3H4MA 2C9OA 1E2QA 2VIIA 4YONB 2FF7A 1OIWA 1P2SA 4EQ6A 1OXTA 3AF4A 2QSZA 2VHCA 2V9PA 2JLXA 2QAGB 2VA8A 1OSNA 1Y63A 2NOAA 4E22A 1KJWA 3L0SA 1E2FA 1W0JA 4HATA 4AURA 4DIEA 1OFHA 2W2XA 5CYOA 5KDLA 4IKEA 3IEUA 3SHFA 2ZSFA 1RE0A 3VNUA 1YRAA 2FZ4A 2N1BA 4CEIA 5H68A 5KDDA 5E7JA 5IK2A 3K1JA 3SC3A 1CJVC 1PUIA 3LVRE 3NG1A 3BK7A 2WV9A 5G40A 3JZMA 1QZXA 3K0AB 4RY2A 1ZC3A 4GRAA 4MRRA 4KVGA 4QGGA 1Z63A 1E6CA 4RZ2A 2P6NA 4CEJA 1F2TB 1OHHA 3CF2A 1JEEA 2AD5A 2A30A 3GLIA 3OIUA 1KOFA 1Z08A 1OKKA 4WXRA 3B8HA 5JHGB 3ADDA 1YR8A 4P4UA 2JJ8A 5C18A 4BFSA 2PCLA 1VKJA 1E79D 2HCBA 1XCMA 2IWHA 3RLFA 2CL6X 2JLZA 3OEED 2C9CA 4M21A 2FH5B 1XMJA 1GUAA 1UDWA 4K8OA 4ON9A 2IUUA 1SXJB 3V4FA 3OHMA 3ZYCA 3HR8A 5DGXA 1DADA 1FL9A 4IOKA 1RC8A 4EPXA 1BIFA 3IHWA 1W0KD 2IYYA 4C0KA 4EPRA 4R71A 1BMFD 3V00A 1DAGA 3ZIAD 1N6HA 1O87A 4HUTA 3A1WA 2VSXA 3K53A 4JSYA 4LY6A 5CB8A 3WNBA 5C4MA 2GBLA 3IQXA 2QROA 1CU1A 3CONA 3G5UA 1E2NA 4DUGA 2P67A 2WJGA 3BS4A 3SU8A 4B34A 1XMSA 5LB2A 4CYMA 2O8CB 2CLSA 1XXHA 2REOA 2DBYA 1XXHB 1TTTA 2RH5A 3OEHA 3I73A 4D4MA 2ZRFA 3K09A 5EE9A 4HAZA 3QEJA 1E0KA 2FFBA 5DNYB 4PZZA 3CF6R 3IHLA 4I1VA 2GHIA 3B9PA 5KPJA 1RJ9B 4EIWA 5SZHB 1AA9A 1ZYUA 2V1XA 1AZSC 3IPYA 2NO6A 1MRNA 2PH1A 4DCUA 4DLWA 1D2EA 3GMTA 3VFDA 1NN5A 4B6EA 5CJ2A 2NO7A 2QPOA 1KI3A 3EZFA 1JR3E 2IX3A 2Z4SA 4M1WA 1IBRA 1TX4B 1GM5A 1GAJA 1IN4A 2F43A 1HQCA 3P27A 4PO8A 2V4ZA 4G1UC 3S1AB 2R2AA 1ZM7A 2ERXA 4KV9A 1TADA 3HJNA 2GZDA 3BOSA 1U0HC 1E98A 3D3QA 4EPWA 1W2HA 1CJUC 1RZ3A 1E79A 2JIZA 1T4GA 1NSFA 3CX6A 2ZITA 3D8BA 3LV8A 4GSYA 4C0BA 3MAAC 4FMDF 1E4YA 1N0UA 2GKSA 3FGNA 2ZR7A 1J99A 4LYJA 3WRYC 4B44A 3OIYA 1G7SA 1CJTC 3CNOA 1G291 4NCHA 4JT4A 4IVRA 1E3MA 5F9FA 4XOIA 1L7VC 3DMNA 3L0IB 2WSSA 3VU9B 1T0HB 3OFND 1BMFA 3ASYA 2ZUBA 3GEIA 4PR0A 3U6BA 2GXSA 2A78A 1R0XA 5BYJA 4BASA 4PX9A 3PXGA 2WHXA 4RD6A 1FZQA 3D7MA 4XSHA 4FMCF 1HH4A 1JPNA 2BHRA 4QJ5A 3UK6A 4BZPA 4B3XA 4QGFA 2ZYWX 5FUYA 1RIFA 2ZUCA 5FBRB 3R8CA 4PO1A 1Z0JA 1SQ5A 1ZIOA 2OG2A 1G4UR 2WOJA 3LBHA 4JJKA 4YLGA 2J0QA 5DH9A 3WNDA 1SVLA 4MA4A 4BFUA 2JASA 2IL1A 2QMHA 3AUXA 4C9BA 3WMEA 5F9HA 1JJ7A 1KI8A 2MSCB 1ETUA 4Q1EA 4Q9HA 4FMDB 3RS5A 3GLHE 5HZHA 3RYTC 3CB4A 3FOZA 4C0JA 2H5EA 1N6PA 4OQFA 1IY1A 3PUYA 2VBCA 4ZDIA 3DM5A 2B92A 1ZD9A 2QNRA 1KZ7B 4KYUA 2NGRA 3IO5A 1TAGA 4MKIA 1VECA 4BRUA 4MKFA 4Y0AA 5JEEA 2RGDA 4ASUD 4RZ3A 3A1UA 4S35A 1F2UA 2Y8EA 3DZ8A 3T5GA 2AD1A 1E9DA 2OESA 4BZXA 4TWZA 1KSHA 4QBHA 4QRHA 4B2LA 3HR7A 1BH2A 3AF1A 4FMCB 5JRJA 3UWKA 1MR3F 4TTQA 4Q1FA 5EE3A 3X1XA 5K8UA 1XZQA 2GJSA 5FOUA 4FWTA 1G20E 2PL3A 4DLSA 3A37A 3A8TA 4TL8A 4ACBA 5M04A 2P65A 3QENA 4PQRA 2IWRA 3W6PA 2GZAA 2F55A 4E09A 1EXMA 3GJ7A 4MGYR 4GP7A 4OJQA 3SI7A 3K0CC 4F93B 1FMLA 3NWJA 1SVWA 1COWD 2F9MA 3MGCA 4ZDWA 2YOHA 2BEJA 2PCJA 5BW8A 5IHPA 3LBNA 1Z0KA 2FEMA 2WIAA 5IT5A 2EFDB 4YQFA 1NVUQ 4XTRA 4Q4HA 2IXEA 5J5CA 4B3BA 4M1OA 1CP2A 1GNPA 1XFAA 2B7CA 3CUEF 1NIPA 2ORVA 1AQYA 2GTPA 4QNRA 1G7CA 3AH8A 1GL9B 2ZS9A 4M9ZA 4Q9JA 2CHGA 3BH0A 1IAQA 1OB2A 1WQ1R 2RGAA 3KB1A 4KODA 1VPLA 4PAOA 4F92B 4E07A 1Z06A 1CR2A 1DAEA 3TJZA 2ZRHA 2PMDA 2E9SA 3LQQA 1A5TA 3DZDA 4PXAA 3U2QA 5EZ6B 3ONWA 2JLUA 2BV3A 2J9RA 3DM9B 1IXSB 2XSZD 4JLPA 3UKDA 2ZJ5A 1VCNA 2Q3MA 5D3MA 3SFZA 2HEIA 4BFXA 4DVGA 4Q1AA 1NKSA 5AJXA 4OHWA 4B71A 1CS4C 1N6LA 3NTUA 3X2SA 2XAUA 2BBSA 1P9RA 3LH5A 4JVLA 1T3SA 1ZUIA 2KB0A 3EIEA 5KNDA 5CYPA 3KJIA 4NYMQ 3RC8A 4HAVA 1NLYA 4PHTA 4XWKA 1U81A 5TXGA 3CZPA 3EARA 4JL6A 5CIQA 3PVSA 3P20A 3ND9A 1FUKA 4NL4H 4ZO4A 2Q3FA 5CIWA 2VP9A 1E94E 1KO1A 4WZBE 1LV7A 2CBZA 1CR0A 2W0SA 5DN6A 5J4HA 1P7CA 2NPIA 1U99A 4IDNA 4LV6A 1PLJA 4KU4A 4CEHB 4G3XA 2Q0HA 2YYZA 4D0GA 3EPLA 2QSYA 4A8JC 4DEXA 3BAFA 3I5YA 3I62A 1SXJE 3QXCA 1FOEB 3DOEA 1MABA 2V6IA 2XTNA 3SJBA 4OI4A 2EFCB 1LS6A 2YC2C 3BRWD 4G5GA 5CDFA 3K70B 3BH6A 3PEUA 4UNPA 2OBMA 4GOXA 3MFYA 2IYZA 3OIWA 2ATVA 3LFUA 4UNSA 2WOOA 1P9NA 2ZI9A 4M1SA 3VX3A 1VDZA 1EFRD 1UKYA 3KUDA 4LJ6A 4XVQA 4B73A 2JGNA 2EVWX 4Z1MD 1VIAA 3PUXA 4NPHA 3RWOA 1F48A 2FFQA 4TL6A 2QAGC 1XXHE 3VKWA 1Z83A 1UKZA 1UJ2A 3PCRB 4TQUS 3EA0A 3BB1A 4TLEA 2EFEB 2JEOA 1B23P 1FX0B 2IYSA 3K9GA 2O8FB 1QHXA 3CWZA 2VHTA 3RNLA 3AGQA 5HCNA 4B43A 1ZU5A 2XSZA 2FOLA 1KMQA 3Q85A 3CX8A 1ZCAA 1Q1EA 1G1MA 1VCOA 2PEYA 3T1QA 1WXQA 4B33A 3U44B 4PPQA 1E4VA 3LY5A 3HU2A 4DXAA 5K8LA 1ZJ6A 2ZUDA 5CLQA 2FA9A 4D82A 1TQDA 1N5LA 1R0WA 3GLGB 2VHQA 4QL3A 2X2EA 5IRCD 1UBEA 4V0ME 1SKYB 1TUEA 1UADA 5C1BA 4I99A 1WDTA 3OZXA 1OLOA 4IOJA 2K5UA 4B75A 3KXLA 5B30A 1KNQA 1UBGA 2ONKA 3RRZA 3KJHA 1UBFA 5TMPA 1W48A 4WVFA 4AY2A 3TBKA 1TQ2A 821PA 1LVGA 5JRZA 4BFYA 2UKDA 3QXJA 3WYGA 4JVSB 4PAQA 4LPSA 1J90A 5HCIA 8OHMA 4NE2A 4RZXA 5JSZA 5G41A 721PA 4H9GA 3REGA 3FPAA 1U94A 3X1WA 2WJIA 3KKNA 5H1YA 4AYXA 5J4YA 2HYDA 5FUVA 3ZGXA 2BCJQ 2J45A 4ZIRB 2GXAA 4P3YA 4ZI3A 3AP3A 1N5JA 3F8TA 5BN4A 4EDHA 1EFRA 1DAMA 1F6BA 4M1MA 1XEFA 1Q44A 2OSBA 5DHFA 4A82A 2XZOA 4UNNA 2VP6A 1HQYE 1EX7A 1AGRA 2WWHA 4FMBB 1OH8A 5DI3B 2WWXA 4B47A 3WBKA 5JJKA 2XX3A 1E9RA 3WYAA 1LF5A 4GOJA 4XJXA 1Z22A 2ZSEA 4US0R 4UQOA 2IYXA 3KKOA 3N2IA 3PFIA 3CRQA 4IXNA 3IIMA 3O47A 4LI0A 3AUYA 1U2RA 2ZYUX 3QKSA 2GJ8A 3QKSB 3C14C 5EP3A 4L15A 2AR7A 5AJWA 4NYMR 4A0FA 3R7WB 1G5PA 4KBFA 4OHZA 2XJ9A 1DAKA 1US8B 2WPDA 2OM2A 4I81A 4JT2A 4XD7D 1U9IC 4LJ7A 1RVDA 4W9MC 1OB5A 2ZU0C 4TLCA 3EIQA 2ZRPA 5FTMA 4AG5A 5IF9A 1KI1A 1QHHA 4DLXA 1E0JA 4OK5A 3CRRA 1XNJA 2OE2A 4LJ8A 4OQXA 3Q7PA 5C2JB 3TE6A 3UATA 1KMHB 4C2TA 2TMKA 1II9A 2GAOA 1TF2A 3EC2A 2P5SA 1PV4A 2YJTD 4XH9B 3C41J 4II7A 3EX7C 2NG1A 1Q1QA 3F5FA 3QVVA 4D2IA 4WIAA 1TUIA 3AGPA 2QMOA 3WXMA 2G0NA 2J0UB 3FDIA 4URZR 1HE8B 1P4SA 4ARZA 2F1IA 1IN5A 1E2EA 1NBMD 2EWWA 4CZ2A 1Z6YA 1YVDA 4TMXA 5JFGA 2WKRA 3GJ8A 4IHQA 1D2MA 1W5TA 2RB4A 1P9WA 3K0SA 4DEYA 4MYHA 2NO9A 1T8TA 3AVPA 1KAGA 3H84A 2ZS8A 3IQWA 5FOVA 1Z0DA 2OCBA 3SHWA 1NN1A 4JVMA 2AKYA 3AF0A 1N6IA 2DYKA 3QXHA 4DT1A 1WP9A 1DVRA 1Z0IA 1IQPA 4RCZA 1J2JA 3ZJYA 3J81k 2BM0A 1ONBA 4DLVA 4UNQA 3RRYA 1G9XA 2RMKA 3OAAD 2OHFA 1X8LA 2IEZA 1G6OA 1J8YF 4Q5IA 2H16A 2OFWA 5L3QB 3B5JA 4H1VA 1G4AE 2ZI4A 3MCAA 3QPVA 4V03A 3LXXA 2BJWA 3U3OA 1G21E 3E5HA 2XITA 1DG1G 2BBOA 4C0HA 2Q3HA 4GP6A 4QFMA 1Z07A 1E96A 3B13B 4GZLA 4NP6A 2QT1A 4A0HA 1AQUA 4NKRA 1W36D 4GOKA 2J87A 2IT1A 4B74A 1MKYA 5JJLA 3PQCA 4XVRA 2VYFA 2C98A 4XD7A 2FV8A 3SDZA 4L16A 2HUPA 5DISB 1U90A 3L0OA 3A58B 221PA 2QM8A 2AXPA 4Q1BA 1I4LD 4TLBA 4EKDA 4WOPA 2FU5C 1QHNA 4OQNA 2R65A 2IF2A 2QPTA 4PQFA 1L4YA 2JATA 2DFKB 2BKEA 3GLHA 2GF0A 3EZ6A 2VP0A 3EZ9A 1FUUA 4A0GA 4RFVA 4HB3A 2OEPA 2QENA 4ERNA 1Z3IX 2BWJA 1Z0FA 2ODNA 1Z2AA 2IC5A 2H1LA 3P26A 2ZXUA 5A4JA 1QHSA 1T5IA 2NMVA 5FOTA 1IY0A 2FN4A 2CHQA 3VTKA 4N0EA 3TW4A 3PJRA 1QG4A 4A15A 1JAHA 1ZCBA 1GIAA 3SE0A 1E2HA 2VL7A 3M4YA 4DDVA 3KXKA 2KBEA 2ZE5A 2FPLA 5CM8B 1DAHA 1TEVA 1N25A 1T9HA 3Q72A 4Q00A 2CE7A 3OE7A 2ZJAA 4HUQA 4HUQB 1PUJA 4QHSA 4NCKA 2MSEB 4LCBA 1H65A 2GJ9A 3AKYA 5HE9A 1K5DA 2C2HA 2OFOA 2RCNA 3OAAA 1ESNA 1YR6A 3THXB 5FOWA 4A8JA 2ZE8A 2J3EA 4PPFA 1C9KA 2J7PA 4Q4AB 3FE2A 2F7SA 4RFSB 1NI3A 5TARA 5TVKA 4U00A 4YDSA 3PUWA 5FI1B 5KSYA 2O8BA 4RSGA 4B32A 2O8BB 3MJRA 1M8PA 2WMOB 3NBXX 4GBMA 4UXHA 2V8OA 4POAA 2J46A 2R6FA 1TNDA 1ZP6A 1W4AA 4JLDA 4LJ4A 1E9SA 4HB0A 4OK3A 4TYPA 3W3ZB 1RRCA 4AKGA 1TMKA 3IIKA 4PC7A 2FDCA 2XNDD 4P4SA 1SULA 4CVNA 3PENA 3O8BA 1W36B 2OO7A 4CIDA 3VNVA 2ZRCA 3QY0A 3VHLB 4BFVA 3HU1A 3IILA 1NJGA 1RFLA 3V9PA 5B57C 3GLGE 3EASA 2AWNA 4LHYA 3WP1B 4D26A 4HLUC 2QAGA 3CRMA 2V1UA 1ESMA 2OILA 3GJ4A 4HZUA 4HZUB 4IFBA 2HF9A 4V0NA 4ZI2A 2CNWD 4C0QC 5CB6A 1T6NA 2O8DB 3RS7A 4KI0A 5K8TA 4B6FA 4PHGA 2W6JD 2ZPTX 2XB4A 2XJ4A 1G17A 1CF4A 2QE7A 3BGWA 4WA7A 3TQCA 3K70C 3MMPA 5AWFC 1H8HD 1S4QA 1JECA 5GJWC 3B1YA 3K0AA 4FCTA 1G8HA 1UBCA 1F60A 2QAJA 4Q7JB 3CX7A 4DLZA 1TPZA 3HPQA 4D0LB 1F2TA 4MKGA 2AL7A 2X1VA 5GJCA 4KCGA 2QN6A 4WZ6A 1P2VA 5FFMA 2ZE7A 2PLRA 2GEDA 1EFCA 5FTNA 1Q3HA 2OBNA 3U3MA 1NRJB 5AUNB 2AKAB 2ZU6A 3ZZTA 3RS4A 1YZLA 2ZYTX 5FBWB 1Z0AA 2WKPA 5AJYA 5HZKA 4Q9KA 3ZVLA 1W49A 5BQ5A 1DOAA 4MYCA 1FW6A 2IYUA 2JJ1D 4NU0A 4PC1A 1GRNA 1L2TA 2A5DA 1SXJA 2V3CC 1G19A 4BLSA 3DDCA 2DWQA 1E1RD 4BLPA 4K46A 3KDSE 1C1YA 3TSWA 1GKUB 4A92A 1RYHA 2F9LA 3QF4B 2Z0MA 1MH1A 4LJAA 2VLIA 4XWAA 5EE0A 3U3RA 4Q4JB 4DSUA 1M34E 2ZSAA 4TYQA 1AN0A 1NY6A 3FKSA 3GP8A 5E95A 1N5KA 2ZYVX 1X6VA 1NVVR 1KY2A 1KI7A 1SVIA 1XEXB 4R2IA 5DHAA 4O3MA 2RAPA 4QGHA 4Q9LA 4C7OB 2O8CA 1I2MA 3FMPB 4EPYA 1VG8A 2VSFA 1CULC 3F3YA 1HT1E 5FTLA 3VKGA 3OESA 2FGJA 1GP2A 2YZ2A 2R6CA 1XTSA 4JLMA 1M7GA 4Q66C 1RPZA 2CMKA 3CPEA 2DWOA 5KSOA 2CVHA 3O8CA 1RJ9A 4G5RA 4RD3A 1XPUA 3RDPA 4PPNA 5C46F 4TMKA 2G9NA 2N42A 5JWOA 4KITB 3WBJA 1ZAKA 2ZRKA 4M2LA 4CT4B 3LX8A 2NO1A
chains in the Genus database with same CATH superfamily
5F1OA 1RCUA 1Q0ZA 1NZFA 3WO1A 5I4CA 1NV8A 1C3JA 1RAHA 4TL7A 2W37A 1L5OA 5HRCA 1DIHA 3LWDA 2BOVA 1KYYA 3Q9UA 1ZSNA 4DADA 1KVSA 1JU3A 5JATA 1GYQA 4DLYA 4EI7A 4QT0A 3VSCA 3OLQA 2DBRA 2Q9CA 3QLTA 5KNCH 1H9BA 1M2GA 5BRAA 1X77A 1X92A 5I7AA 3HL4A 5T6BA 1KQGA 4OREX 2HA5A 2B2XA 1JI0A 1QZTA 3IO3A 3W8FA 2Z09A 3H1TA 5KTYA 5FNVF 3VR3D 2PBFA 5LPNA 3THYB 4YMSA 1WSAA 3NJ8A 4BX0A 2PKQP 5AOBA 3T5CA 2AK3A 5CG1A 1FBNA 2DE0X 2GMWA 3LF2A 1DEOA 2P6OA 5IEJA 1WV0A 2OHVA 4RIIA 5K03A 1Z4OA 4B7ZA 4XYLA 4TKUB 2Y4OA 5J2TA 2IXGA 3OKFA 1IATA 3SMQA 3U4CA 1A2BA 1KAEA 2BIFA 3HBLA 3Q2OA 4RV5A 1NKTA 2JJ1A 2WWWA 4TTRA 1NUTA 5K4HA 2ZYGA 2O2IA 4GLJA 2PUDA 4ECAA 2YBDA 3GFPA 4EMUA 2AXNA 4P98A 4BLRA 3DQPA 4GI7A 1X13A 4UXIA 3U4QB 4QPDA 1QZZA 1AURA 2RBKA 1E2UA 1H1TA 2C2BA 1UEIA 2H51A 3MS2A 4TQ9A 4PBTA 2PJRA 2IW3A 3D7KA 1OMOA 1U9JA 3LY9A 4NBKA 4R3UC 2O5EA 1QH0A 2B2NA 4NPAA 2QT9A 3DZJA 1Z2OX 2C8KA 3OZIA 4N03A 4RXUA 4MS4A 3BE8A 3QOYA 2R8XA 1SHUX 3U9SA 2DY1A 4R8KA 3HEAA 4JOBA 1PK9A 2Z30A 4CIXA 3ZDYB 5IJ9A 4EHKA 4LGMA 2O7QA 5BWBA 2ORIA 3K30A 2Z8ZA 1XMVA 1LK7A 2ZAYA 4QLOA 1Q91A 3EGXB 3HDYA 2PR2A 2JDID 5E4YA 3RI3A 4L3OA 1JWBB 1NP7A 2SCUB 3NWBA 5HBRA 1TYAE 3G82C 2ECOA 1E77A 4Z8YA 5FORA 4DWOA 1VZ3A 5FNVB 4CLOA 3SXUB 1WXGA 3AUAA 3GK3A 1GDHA 3AR5A 3ZWKA 5K0LA 1M8FA 1QQTA 1T5SA 2VF8A 3CE6A 4KLZA 3T4UA 2AFHB 3ZU4A 1UAAA 3ZZ0A 1CS0B 2E1RA 5G0VA 3UGJA 2ZDGA 1OREA 2QRQA 1LWNA 1WX1A 3X1DA 2GCEA 2XT0A 4NBWA 2O1XA 4MYSA 4EFKA 1A8IA 2O8EB 1QPZA 3DHYA 1DCFA 5AHWA 1FJGB 4G25A 4EHLA 3BXHA 1HNWB 3K94A 4B6JA 3DMHA 1F0PA 4Q39A 2BISA 2FJ0A 5DP2A 1CKEA 1YD7A 3JQRA 1GFIA 4XR4A 2QNBA 3E2MA 5FA5A 3R9XA 3SQXA 3GR6A 3LPMA 3IR7A 1NBME 4DLUA 4B76A 3ZS9A 4JKOA 1KSGA 3B3AA 4WASA 5LDHA 1J8FA 4RA9B 4JDPA 4RIGA 2D7JA 3NCHA 1ZHOA 4KQFA 1F9AA 4P0TA 1J1UA 1IRXA 2VOEA 1FX1A 1KKLA 1RI2A 1TCBA 2HIAA 1CZNA 2A9QA 2G70A 3E9MA 3GVHA 3KV1A 3OMLA 3OUTA 4S2EA 3T1VA 3IIJA 1PWHA 2VP2A 4CMCA 4DS3A 2ZB7A 2ZJBA 1SEVA 3TUIC 1AZLA 2W2LA 4Q6BA 5C4GB 2WY2D 2H2WA 4D44A 1NTRA 2HHLA 1VJ1A 2IITA 5ALDA 4ZREA 4U7TB 2C3MA 2RE8A 3KKQA 2QA5A 2OAQ1 3OM0A 2YQZA 3U7QA 4R1LA 2CB0A 4FSHA 2GEVA 4RZIA 4Y2XA 4CM3A 4R1MA 1T2UA 3DFKA 3LO5A 4RHEA 1Y3FE 2ZRMA 1MGOA 1CBUA 1CJKC 1Y6ZA 2OLKA 5E8JA 3U17A 3T1YB 2EYQA 1KK1A 2RHBA 5JOQA 3IJEB 4D0RA 4OSEA 1RQRA 3A1TA 2XKJE 2G3YA 4RHUA 4DEVA 4YXWD 4AO7A 2J4DA 3NWEA 1IPFA 3B2QA 4N8EA 4WGFA 3QOWA 5ICFA 2H92A 3U31A 2I91A 1G5HA 2OCXA 5J1TB 1INLA 2A4KA 5AM2A 1E2LA 2XBUA 5LD2B 1BYIA 4Z9YA 3FA2A 5EPEA 1U3GA 2H5IA 1QORA 1U8ZA 3LT0A 4UNIA 5HNKA 2O0LA 1KI2A 3SN6A 4J0KA 3ZDZB 4ZI7B 4XCQA 1GG5A 2GN8A 5FUWA 2JA2A 1GQ2A 1EFVA 1QK3A 3NC0C 1LNZA 1DG3A 1USKA 1SCUA 2W2OA 1K89A 4PSAA 2NUTB 1T4BA 4OFXA 1DS6A 1DJNA 3BC1A 3RRNA 3ZEIA 4WKCA 4BX3A 5CT5A 2P75A 3AVQA 1EESA 4NH0A 1T5TA 3IERA 2GBGA 5F77A 2O9JA 4ER7A 5TF4A 3RYFA 3VH1A 2QZ4A 4WINA 3T54A 1AKYA 3PD1A 1YGPA 4K1XA 3E8XA 2FR1A 1G21A 1ZN7A 5DVZA 4DAEA 3F6PA 3B48A 1A7JA 3E05A 1O0CA 1F6DA 3H0KA 4LNHA 4ZO6A 3W5BA 4TMTA 4F71A 1SPXA 3DSRA 2QR3A 4X92A 4DA0A 3FOCA 4DY4A 1IY9A 2M32A 3L1KA 4BN5A 1N5RA 4G01B 2HPVA 1YDMA 3HVHA 4WBNF 3U7HB 1Q6YA 3RG8A 1V8PA 1D9ZA 4AG3A 1Y89A 3MTAA 3WQQA 4JV5B 3O1HB 3DV0A 1YS1X 4ASUA 5HJEA 3JV7A 2GD6A 5JD3A 5JVDA 1NL3A 4RKEA 3AI2A 1FFSA 1S2OA 4I4TB 1ZK1A 5DLDA 2YH2A 1A9RA 2H4FA 4GZMA 4MO2A 3V8BA 4CN8A 3GLFB 1UJNA 3SX0A 2PKWA 4IZHA 1CY8A 1OVGA 1UP6A 3BPSA 3KX2A 4FFRA 1ZH6A 4IDFA 4L5IA 4YJHB 1U3UA 3KQHA 3NWPA 2ENUA 4NFHA 4F85A 1ZM3A 1G66A 1P4HA 3BX1A 2YC4C 3NBAA 4KSCA 1EXNA 2VKQA 3FFTA 3HJUA 4HN2A 2C0CA 4JR0A 4MWDA 3ZNNA 3QE2A 4A6XA 1PNRA 1VGQA 3GD7A 1KFEB 5T7BA 4PICA 2P3LA 1XQWA 3E81A 4YPFA 2YTZA 1KK3A 3J81A 5EJ8A 1P7ZA 1VKOA 3NIWA 1GQFA 2R8PA 1VHTA 3C7CB 3ILHA 5JCXA 4J16C 4CNBA 4F8YA 3EZ7A 1ZQ9A 5HWSA 1YI8A 2H17A 4MW7A 1IZZA 2YOFA 4KAFA 1NOKA 1QOPB 1QHFA 5EKXA 2HXGA 3A1NA 4QUAA 4MVJE 4RABA 1YE3A 4ESVA 3U7IA 3UPUA 1LX6A 1B1CA 3MC1A 3QE9Y 3I39X 2L82A 4PHFA 1WNFA 3EC7A 2UZ4A 4ZK6A 3Q7RA 2I6GA 1G5IA 1PQ4A 2I4MA 2BVNA 4FOLA 5IASA 3PC6A 3RWBA 2IS1A 1GO2A 4DIMA 2KI5A 2PXHA 1UFOA 2X14A 2QZJA 5SZIA 5FHQA 5C3MA 3TIIA 2VF4X 4ANFA 2HQOA 5K6AA 1VG1A 3VYTB 2HCJB 4NBSA 5EFZA 4OY3A 1JF8A 5DOVA 2VYNA 3WWZA 4K7JA 3RO7A 2FXVA 4FYPA 3N59A 3ZHCA 3KYBA 1TD1A 4HY3A 3H3FA 4YMWA 4EB6A 2Q5FA 3VC2A 1G2OA 2FZKA 2F3QA 3A4NA 5KJ1A 3V9AA 1MAWA 1XMOB 3VOBA 1WPGA 2PV7A 4LJ5A 1U6KA 2Z08A 3CW9A 3AX6A 4BQQA 3KL2A 2A59A 4MIYA 2VYVA 2OA0A 3G68A 3FMOB 4XVUA 1Y33E 1XPRA 3OECA 3RSGA 2EJVA 1IMJA 4BLQA 1GT91 2ZSUA 3L9WA 4P82A 2TECE 5FBQB 3QUCA 3ORQA 3GEEA 4TWAA 1YJ5A 4Q37A 3DLBA 2UZ3A 2YICA 5NLLA 5IYZB 3OQVA 2YWHA 2YW9A 4HXEB 5MDHA 1QHIA 1JH8A 2Y6VA 3HCOA 3VMMA 3EH1A 3AO0B 3GUZA 1CY4A 3VVBA 3WGHA 4Z0PA 3PQFA 3C8DA 1QS0A 4V0OA 5AIAA 3BMNA 4J4BA 4D8XA 5K8CA 1FDUA 3E9NA 3EWAA 4UOZA 2PNFA 1PBNA 3MQ4A 3AKCA 2J9FB 3DP9A 1PGOA 5C1OA 2QD1A 1T3HA 3P9QA 3QPUA 4JJIA 4O4IA 1P5ZB 3IPRA 4XUGB 3MLAA 3FSGA 3V8EA 3P9ZA 4K26A 5IN5A 1BOOA 4L4ZA 5DSZA 4ZN6A 1Y5LA 4YQYA 2FQQA 4Q03A 3U81A 1Z4KA 2W0MA 3TNFA 1GV0A 1T36A 3MW8A 1WABA 3KOWA 1MXHA 1NQOA 2PSSA 1AS0A 3UCXA 1I13A 5K8JB 2ZIWB 1N36B 3GJ3A 1V1RB 2XMDA 4DCSA 2QD4A 3NOVA 1ZD5A 3KQNA 3BZWA 1PN3A 3K15A 3EG5A 2QJOA 5E3JA 2X2OA 1FUYB 3TIGA 3MA0A 1IC6A 4OIMA 2DWCA 1EQAA 3BWXA 3A9CA 1U3WA 3ABZA 1WSDA 3TTUA 1Z2NX 2IYQA 3VAAA 1IXKA 3DBRB 3GVXA 1NBEA 3EB9A 4BNNA 2G1JA 2P69A 2X58A 2XZPA 3GLRA 4QELA 3RARA 5BUZA 2PUWA 2IH4A 1VBNA 1G8SA 4H15A 1SK8A 1Z47A 2IZ1A 4JMPA 1CETA 1XZ8A 1UXGA 2CB9A 2NADA 2PJZA 3NHKA 5LZ7A 1VSVA 1VHDA 3TUZC 2H3HA 1D09A 3ZE1B 1Y48E 1H5NA 3B85A 2W2VA 1HKUA 4Y2YA 3W8EA 1VCIA 3O94A 4H1UA 5DHUA 2JJQA 4FIDA 5AUOB 2QLTA 3AJEA 4HH4A 1VCMA 2B7BA 2VHWA 7YASA 3IVXA 1L1FA 4EI9A 1AQJA 5LMNB 1U3CA 5AH0A 3OH8A 4YJ3F 3KPYA 1L7XA 4YR7A 1K6JA 2ID4A 4IDPA 3EC1A 5EJ5A 5LQJA 1XQVA 2NZVG 3FGOA 3S55A 3R7WA 2AHRA 2PMCA 1RZVA 3ZCSA 2G4VA 2RK4A 4D5EA 3E15A 2BSXA 5K2OA 5JJIA 4EAAA 4JOCA 1VL2A 3B1FA 3LCVB 1U3TA 3ROPA 1AKEA 4A0QA 4E21A 2ZRGA 3K5PA 1P2GA 4KYIB 4KWHA 4CIYA 3AEXA 3EQZA 1THZA 1KQPA 1M2FA 1E1LA 2V45A 3R7LA 4AKHA 2Z5FA 5EI5A 4DANA 4UOQA 3ZTTA 4K0RA 2HK8A 4KN9S 2N0SA 1NJ1A 2YIJA 4BB9A 1DJPA 1QV9A 2D1TA 2FWMX 2JK0A 4W1PA 3TAHA 4EG5A 3B1XA 1HGXA 1WXDA 5HIJA 1UF9A 2JFNA 2J0UA 3MGKA 1FU8A 5C5CA 2XIQA 1EM8A 2H07A 3D6TB 1Z3CA 4LYEA 4QSHA 4AECA 1QF9A 1P4AA 3FTQA 1XMIA 4PXYA 1KDYA 3T0FA 3UMJA 1JNXX 1NHGA 1QMGA 2FPKA 5GM2A 4N5IX 1RQ2A 2J3DA 1OZHA 1I2AA 2A84A 3O3OB 4CUKA 4BU1A 4LK2A 1D4ZA 1KJ8A 2D62A 1UJ6A 5G4KB 3LGXA 4CR7A 2Q0SA 2B8JA 4FWBA 2BH9A 1KI6B 2FHSA 2GBIA 1JQEA 1T0UA 2OV6A 2QTGA 2RI0A 3BEOA 4KXLA 4YHBA 2QV0A 2C20A 4LQLA 4L27A 3T15A 3HKEB 5AW1A 1NYLA 2XOKD 2O2YA 4EKYA 1EEHA 3H11B 3TK1A 3RUPA 3WB9A 3RGWS 1XMQB 4DG9A 2WYUA 5E6UA 4NATA 3QF7A 3N76A 3IA7A 4UNRA 4G5QA 2P91A 3PXCX 3QEKA 2FX5A 3K16A 2LRHA 3G0CA 4HEHA 4B46A 3PNQA 3ZVMA 4A4DA 1XVVA 2I2FA 5L3QA 3D9QX 4AXBA 4BMSA 4H7PA 4WNCA 3CRZA 4J4TA 4N8SA 3I6IA 1L7QA 2PBLA 4PYJA 2SKDA 1IHXA 3ADKA 4C4SA 4JFAA 2AOXA 4B6SA 4B6RA 3LUDA 1R4AA 2A1UB 3A6GA 2WZDA 4RD2A 4Q1DA 4XD2A 4Y18A 4C4OA 1ZPDA 2IUTA 2RGYA 5D1HA 4DSZA 4YAGA 1LFAA 1GZ3A 4ESHA 1CUBA 1GITA 1I14A 1TA4A 2W00A 2YV3A 4IDCA 3WNQA 1TK3A 2YOGA 3COVA 1N7HA 3NOOA 4M0CA 3SF0A 2J0SA 3E5NA 4FOSA 2P3QA 4EM6A 1NBOA 2HJVA 3HABA 2CNKA 4BJ5A 5B1HA 3AVUA 2YJ4A 4G0MA 5AR1A 1MC8A 1KTVA 3CLRD 3OG9A 3AINA 1OX6A 1LBTA 2QORA 3UT5B 4U5QA 3F9IA 3IDOA 3WSTA 5JTUA 3KT8A 2OXCA 2WFZA 2ZWAA 4G36A 4JX9A 2Q3JA 1X1AA 4B85A 2OCGA 1QRAA 3FRJA 2LWIA 4Y0VA 2G83A 3DE1X 2R5NA 3I01A 5BUCA 2ADOA 2C5BA 3WP0A 5JC8A 3BDVA 2GPYA 1KJZA 4KQXA 1LJLA 4KXFB 3KT3A 3THWB 2O3UA 2NUPB 3L8GA 3STWA 4X24A 4PLCA 1J0CA 4NHOA 3PYMA 1NBMA 5CM2Z 1U0TA 1GAXA 2C1EA 4EJSB 1TLFA 2SKEA 1V43A 3OTOB 3TTWA 1M73E 2VK8A 1M7BA 5EWLB 1SAYA 3ZH2A 1JEAA 1W96A 3RC3A 4BP8A 3ELWA 4XOUA 4PLTA 1V11A 3HNOA 1NT4A 3QSYA 1CB7A 2HHJA 3C7AA 4JP8A 2Q6TA 3EYAA 4M6WB 4Z53A 2I03A 1V8OA 1FS6A 3UC5A 2BRUA 2ES4A 4OVKA 3N58A 2OUIA 2IXBA 1Y3CE 1U5CA 3ITNA 2MSDB 2D0DA 3D6HA 4BFWA 1PKEA 4NESA 5ADHA 5FPHA 4U7GA 1C8KA 2C3OA 1KO4A 2OM6A 3SR3A 2DHRA 5B1EA 2ABWA 1IRIA 5JNVA 4Q4AA 5KO2A 1R6UA 3UFXB 1VMDA 3MWGA 3T95A 4ZCSA 4UXJA 1R10A 2VRWA 4WKGA 4OFWA 1TEHA 5A6SB 3TR5A 5CDTA 3FFWA 3TB4A 4IDGA 4NJOA 5IH3A 1J2YA 1EUYA 1U5BA 1U2SA 1KS9A 3VJMA 3X1ZA 1KMCA 4DM3A 1C1HA 1E3WB 2IKSA 3O0TA 4JAVC 4ZPJA 1YZTA 4H6XA 3QUTA 3QXGA 3S2EA 4BLWA 3ERCA 1SUEA 4PSKA 1T9DA 1TT5A 1MX9A 1MB9A 2ATXA 2WLSA 4FIZA 4JGIA 3NHPA 1KFKB 2Q6VA 1R8JA 1Y3BE 5JS2A 2BTOA 3D4OA 3S8YA 1A5BB 3REFA 3SFVA 1SM4A 4BO9A 5JCZA 2I7XA 1A9PA 3IXLA 5NULA 4Q12A 5CDYA 3B8EA 3EDRA 1OXUA 3LYLA 3LPNA 3NASA 4J1TA 1EDOA 4YMUA 4RTNA 1SZJG 4OOEA 4KRFA 2Y99A 4KDRA 3VQTA 3NC1C 4E2XA 4TTJA 4FZVA 1P2TA 2ZAIA 1T5BA 1M2VB 3ESQA 5FA6A 1V47A 4P80A 5E3HA 2WUVA 4FD3A 3TCKA 1WR8A 2Q4TA 3DPUA 4DUGD 1B7GO 1JEYA 1ZMRA 2RC5A 4KQIA 5REQA 2FG6C 3L79A 3UQZA 1NE7A 5BOVA 4KQWA 1R0ZA 2EQBA 4Y8VA 3PXXA 3O4HA 4EZEA 3SJZA 2CJFA 4QHTA 2VTKA 1DEKA 1EK1A 2CSUA 4IIEA 4J0CA 3RABA 3SBOA 3IDZA 1KRWA 1CT9A 2Z98A 3RT9A 4CMIB 1MT0A 3FMIA 3IS3A 2GLXA 3QA9A 2FWPA 4N8DA 3R0ZA 4S05A 1T8YA 2JH8A 1UPAA 3Q8WA 1T5HX 1QVWA 1SVMA 4GPAA 3HDTA 1R0KA 1GYRA 4FHCA 1TZBA 3LGAA 2F6RA 1SUIA 4PN7A 4L5AA 3T41A 3IUQA 2CCGA 4O1MA 3PHHA 1V7QA 5D86A 4HMPA 4UKDA 3ZCRA 3DAOA 3E22B 3CFYA 2NU9A 4ZAWA 2A58A 1OGYA 3I1JA 2Q27A 3PX2A 4TZ6A 1D7OA 3I2GA 2E3JA 2WAYA 3CKYA 3WV5A 3G2JA 4OH7A 2CV1A 1A1VA 1TYBE 1P1FA 2F62A 4U7JA 2OZVA 3GLIB 2E5LB 4C3OB 3GFGA 4BLTA 3TS1A 1E8NA 1TL7C 1V6AA 3LI2A 3QF4A 2Y05A 4IDEA 4QTXA 4ACAA 4Z4QA 4A03A 4C08A 5EP4A 2B4TO 2I33A 2IU3A 4MVJA 3P5SA 5TQJA 3OJEA 3GPCA 4R9RA 1XD8A 4RGQA 1HSZA 2ZTVA 4MTLA 2GX6A 4E4RA 1JFFA 3QX9A 1NF2A 1XEXA 1MIOA 1K3FA 1EA7A 3OT1B 4R8VA 4ABYA 1O95D 4DB4A 2BFOA 4R3NA 4JQZA 4JUIA 1T8WA 2NQ8A 1R0YA 1RWQA 4LNUA 5KMGA 3TD9A 2CW5A 3BHMA 1HQKA 2ZAOA 1YB2A 3DAPA 3N8HA 5LVAA 3KALA 1SOAA 2EYUA 2H4HA 5KKNB 5LMCA 4Q1VA 2WSSD 3V8RA 2WIJA 3MBOA 3DEZA 2NVUB 1Y8ZA 4PGFA 3T4XA 4G86A 4UFNA 1HDEA 2BHTA 1MVLA 5E38A 1FQKA 5EXPA 1C3XA 2IYAA 3ZH9B 1SRRA 4BZWA 3WK7A 1B73A 2C57A 3Q7EA 3HXLA 4AF6A 1MNQA 3DDNA 2BKUA 2J5XA 1EGMB 1MJGA 1WUTA 3R7DA 4GUAA 1X1SA 3L4BC 1RAAA 4FYMA 4B7AA 4WCFB 5LQRA 1M5RA 4N4AA 4CIAA 2IVZA 1T5DX 3SR0A 3MT9A 2IEYA 1IJEA 2W6NA 3FCCA 3JD1A 4U7HA 3TVYA 4KWTA 3QTTA 4AJOA 3IVRA 3Q7SA 4Y0NA 1JLKA 1HLPA 3WMRA 3VYRB 3GFOA 4QM7A 5A0VA 1R0CA 3L05A 2V7EA 3RTCA 1UP4A 1KU0A 2IODA 3C87A 3S7TA 2ESRA 5AVXA 3THYA 4EJFA 4CU2A 4O4HB 3U4IA 4UDYX 4ED9A 1U2GA 3OFSA 3VR5D 2NU8B 3B1ZA 4AKIA 5ALGA 2G28A 4LN1A 5EHGA 1CXZA 4DCPA 2ZROA 2HPAA 4JL5A 1YIDA 1GTVA 2D5LA 3RC9A 1N2XA 4TKUA 5COAA 2MSWA 4F97A 4YRTA 5I9IA 6REQA 3G2HA 3DMTC 3N5KA 1C7IA 1YT5A 3D8UA 3BWYA 5JNWA 5ALEA 2D1FA 1MZPA 4EHAA 3DEIA 1JBEA 1O0SA 2ZANA 5K3BA 3GNTA 3KZXA 3U7FB 2NT4A 4KXVA 1QGYA 3ACDA 4MGKR 2C03A 3U4QA 4Z4FA 1JHDA 2QDXA 3B9BA 1R64A 1GTG1 4RDCA 3DH0A 4M0LA 5IFLA 1Q22A 5I8PA 3C4JA 4JI5B 1KDZA 3KG2A 3DE6X 2VHZA 2PY6A 5CA0F 5KKCA 2P5TB 3WHLA 1U9YA 2EKDA 4KIFA 4WCDA 4UPEA 1MENA 5DIZA 1F0NA 2G1UA 3EGXA 5J4LA 2P6RA 3TPFA 1E1QA 1P0MA 4AJPA 3GZJA 2SCUA 4QVGA 3P2IA 5KREA 521PA 4DMUB 1GGMA 4PFJA 4HNTA 5HUQA 1PDOA 5FNVA 5AW8A 3SXUA 1S5PA 1WXIA 3BGVA 3DULA 4EENA 5J2UF 3NJ4A 3LF1A 1C4OA 1GFZA 1GPKA 2BBWA 2HWWA 2AFHA 4L0DA 1C5KA 1Y3AA 4HVTA 4YMGA 1CS0A 2DHQA 3HQ4O 4BWGA 4DIUA 3EAQA 1F4PA 4Q4CA 5J9FA 1XYGA 4PNZA 4R2WA 2O8EA 2IHYA 2IQ5A 4PZDA 1N2ZA 5LFAA 2CMGA 3PJEA 4CL2A 4CM9A 3GFBA 5E6RB 4RW0A 3BD9A 3MD0A 2P0EA 4PLZA 3WHPA 1NMQA 2NUAB 3AVYA 1IY2A 3U13A 3CVOA 5H80A 2IZ0A 3GRFA 4CGZA 3V2IA 4JLSA 3HP1A 4YAFA 3D6FA 3T52A 5FR1A 2JCSA 2NIPA 4ZYVA 3T0GA 3RVOA 5J5VA 3W4JA 4ZQFA 1PCXA 1R3DA 3GGCA 5ER9A 4IBOA 4O33A 1PHRA 3G3EA 1QLWA 2GVZC 3BWBA 3AI1A 2G0AA 3MSXA 4O0MA 3AUKA 3H9GA 4Q4DA 3UKJA 4JI8B 5K1ZA 1X70A 1KZ4A 5M34A 3AR9A 3OETA 5DM70 2EOAA 2A2ZA 3ZJVA 1Y5NA 5LZ2A 2ZTMA 4RIFA 5EIFA 4EMTA 4ZKDA 4BATA 4HX2A 5KNDD 2WJAA 3DEFA 2JFZA 1UQUA 3OTGA 4BQNA 1VQ1A 4J94A 1QG2A 1NW6A 2DUWA 4QJ4A 4RPLA 4ZMRA 4WEQA 1NUSA 1SO8A 1XZBA 3K2QA 4O2AB 2E4AA 5DTEA 4QKQA 5C8DA 1XJ0A 3B38A 5ALKA 1QANA 1EIZA 1XDBA 2C5EA 4LTDA 3AFNA 1NN3A 1M8GA 2ZBUA 3R6LA 3WBBA 2ZJ0A 1E32A 1H93A 2I4IA 3B1WA 3LC2O 4NFYA 3BXZA 2Q9AA 4P7KA 1DT5A 4S2UA 5LBUA 3NAZA 3RKRA 1GDDA 4BVEA 2QZSA 1IPHA 2UYYA 4FYWA 3TZBA 2DFNA 4IINA 3UTDA 1FDOA 1X1BA 2E82A 5LZ8A 1KK2A 3B1VA 3O7MA 4YRNA 4MPPA 4BLVA 5A02A 3GHHA 3V6MA 1NURA 4ZI7A 4B6GA 3O91A 3ICPA 2HQRA 5ALFA 1ZW6A 4OGLA 1S96A 2QIPA 1BRTA 4UTNA 2V7PA 3N39C 4FNMA 4UEOA 2NUTA 3UG7A 1RLTA 1PGQA 2YFKA 1XD9A 4P5PA 1LDEA 4AJ2A 4CRWB 3L6RA 4OQYA 2CXXA 2Q07A 2CLHB 3N28A 3R77A 4DR4B 1MO5A 4RMIA 3DAFA 3MNFA 4ZOAA 3JYNA 4ZQCB 2CVZA 3WYNA 5L40A 1SC3A 4X45A 2HNKA 3RV3A 2Z58A 4EB8A 3NKVA 4IIBA 3HACA 3SVTA 1BZYA 4F9EA 4HLNA 5CHYA 4QATA 3WJ1A 4DQVA 5A4FS 2QN2A 4AQ7A 4X1KB 4NYIQ 3GA5A 2GT1A 1VHWA 2MR5A 3CZMA 5MN4A 3WTCA 1I4WA 2FTKE 4DDMA 2PT5A 2HSGA 3GIDA 4QD3A 4IY1A 1IIBA 4ZEXA 1M83A 2FOXA 4B3HA 3ISJA 1VRWA 1ZVKA 4I4TA 5IU6A 4TPKA 3NJRA 4ARIA 3O2SB 4KDEA 1EDBA 3ADCA 3GLFA 4BEBA 3AETB 2A3RA 3IX7A 4X44A 4IJ6A 3RAGA 2WHEA 5ELMA 3RRMA 1STOA 5D3MB 4YJHA 3CJTA 2TRSB 5IAOA 3DS8A 3AFGA 3M83A 2X41A 4K5QA 1Y4SA 3DLCA 3IUMA 1EVLA 4H3SA 1PD1A 2HF2A 4Y9SA 5FIUA 2J08A 4DWJA 4B3RB 3AVVA 5TY0A 2R86A 1G0NA 1JZTA 1V3QE 2VTEA 3IB6A 1KJJA 4QOSA 3VOSA 1KAOA 1KDTA 2QQGA 2PR7A 2AR0A 3NHBA 5DJ5A 1QHYA 2EBFX 1Q0HA 3A10A 2YMPA 4R8MA 3RIEA 3WIEA 3KOOA 4KO8A 3TLXA 1LC3A 4DIDA 3GLIE 2ZCVA 2XWJI 4JKYA 6YASA 1GPBA 3T9BA 4Q18A 3DZIA 2AW5A 1T8UA 1HZZC 2BUBA 5D3ZA 5TGTA 2BLNA 3SYRA 4F5DA 5INTA 1IBMB 3BJRA 5ECYA 5KNBH 2FPWA 3LNCA 4RQBA 3LC7O 2V8BA 1AXGA 4RGVA 3DMDA 3CUTA 4A0SA 1C7EA 1M6WA 6GPBA 2XRZA 3WX0A 3LXUX 1J23A 2WB4A 4X61A 1Y1KE 2EKBA 1GU7A 2JZNA 3HRHA 5FA8A 1WBBA 3HBMA 3ICQB 3VKHA 1E1NA 4XLLA 4EA8A 1VCHA 5IABA 2RJNA 2NUBA 1YU9A 3OJWA 3O8RA 5BYKA 4MULA 3ZIUA 1GQOA 3QJYA 5F4BA 4F8EA 5BT8A 3DFIA 1H2AS 2EZ4A 5KAMA 1EGQA 4XFJA 4P4TA 3T5DA 4OHYA 3WYFA 5DN9A 1NULA 4YWJA 1D04A 3VNBA 4DFDA 5I8ZA 2DY0A 2QM7A 4R1SA 3RU2A 1LI4A 4E5DA 5CCDA 1ECPA 5JAIA 2XKKA 1G41A 1PEKE 2XB9A 3CBQA 4DBLC 1TC2A 4FLFA 1CR1A 2VQDA 1W5SA 2VXYA 1YHNA 1BQEA 3LNTA 2GN9A 3RANA 1HFEL 3K5HA 3VZCA 4AMVA 4URXR 5CDHA 4G65A 1OBOA 1E20A 5BUQA 3FKQA 2WM9B 3LUJA 3L7YA 4BJ3A 5IYZA 3EE6A 1TQ4A 1U8AA 3MTGA 3V5NA 2FFJA 1N5MA 4MP8A 2FWRA 3TE7A 3OPNA 1A7UA 1YAJA 2GPTA 3NAGA 4LQCA 1ZS9A 1XEWY 4DJJA 3LQRA 1I36A 1G59A 4XGRA 4JUFA 1DIGA 2WJHA 1OAOC 3Q15C 2J9FA 1CIJA 3R3VA 4KQHA 2IEDA 4NRDA 3GFSA 1VKHA 3M89A 2VJLA 5FL3A 3HU3A 5H9VA 1JB1A 3A6KA 4AO8A 2H48A 4H27A 2GCGA 2EFGA 4EW1A 1EMDA 4JC5A 1DOHA 5JY1A 4OJTA 2WPDD 3JQPA 4WFJA 2X0DA 2JJ2A 2W48A 5GGXA 3FUUA 1Y81A 3ESXA 2WEKA 3WVNA 2VUHB 2KE5A 4YRAA 1YO6A 4ZCLA 2OMEA 1L5YA 4HAIA 3DDWA 1ODFA 1B76A 4UUNA 2FN7A 1RJWA 2HMYB 4L8GA 1DBRA 4PCUA 5A05A 3L9XA 1AKWA 1UC9A 1T6BY 2XD9A 1RKVA 3OCVA 4I2VA 4YP0A 1GNSA 4CCSA 1L4MA 5H59A 2ZYHA 1C7ZA 1MO6A 5B6JA 2A0XA 5IAAA 3F2VA 3U5ZB 3QUAA 4J0DA 1ZK2A 1NF9A 4QJIA 3OPMA 3VDNB 4RD0A 3QM1A 2Q5CA 4NZPA 1A98A 2AC4A 3ZXSA 1M0EA 1S7CA 4LOAA 4G8JA 1E89A 1T3ZA 2DH5A 2V7WA 1XCOA 3IAEA 5COBA 2P9TA 1W2WB 4AS2A 4F4IA 1EB9A 2HY7A 3B89A 3EZNA 1BEEA 2F48A 3DBRA 3M7IA 3OZUA 1EWVA 4DARA 3CYFA 5BSTA 1HNZB 3LD9A 1PBTA 5IXJA 5KNBA 2Z4TA 3QXSA 3ONNA 4J0HA 4FZRA 1WXFA 4JUAA 3WLJA 2FMXA 4GEKA 1YZHA 4FFOA 4R1OA 1KTIA 2FSIA 3IBGA 2C7VA 2V54A 2W6MA 2X0JA 3AI7A 3TPCA 2G09A 2H1IA 3A3KA 2AV6A 1P8JA 3KPUA 4IEEA 4DM4A 1M10A 2F1OA 2H00A 1K8QA 2K4MA 3H7IA 3TH5A 1NT2A 3RC2A 4EARA 3W6OA 3UA3A 3EBPA 4HMOA 2FUG1 3K09C 3KJFA 1G1AA 2YWFA 3DBHB 4QDTA 1PVVA 4RZQA 2RBGA 4W5TA 3VUFA 2GARA 3EDYA 2C7BA 2F2TA 1LUAA 4FCVA 4HPXB 1P0IA 4D3XA 1NMYA 1QP0A 4LDNA 2WF6A 3OQJA 1TEXA 5KU7A 5EJIA 2I2AA 1I3MA 5LBIA 2G76A 3Q9LA 1J21A 3AVXA 3E70C 2FRVA 1MV8A 4MI9A 4NY1A 1E2PA 1U9ZA 1ND6A 3U7RA 3N3AC 1XOIA 4ALJA 5GIPE 1ZJZA 2Q3CA 1IVSA 4E15A 4L7QA 1N2BA 3EPHA 1N9KA 3BJIC 5CLJA 2ZREA 3F1KA 3NBFA 4XA8A 4ZCRA 3OZBA 2YFQA 4JQOA 4DZTA 3B20A 4KX5A 3DHEA 2AYZA 2QU8A 4FXPA 3NDBB 2O5VA 1NZJA 2D0IA 2E55A 2JFFA 3BK1A 1VKRA 4OI1A 5CEJA 4YECA 4K0KB 5TE9A 1IM2A 1UWVA 5CH5A 4RBNA 3QVOA 3TMYA 1BN7A 4MAFA 4MUXA 1VMIA 1P72A 1RI1A 3M6LA 4JKIA 4OBXA 5YASA 1E62A 4GKVA 4U2CA 1TM3E 4Q7LA 5G4KA 1YMUA 4B3FX 3G0DA 1OW3B 3SJAA 1KI6A 4YFVA 3WV4A 2PYIA 2RGNA 3NH6A 4XX0A 4MARA 4NFLA 3RAFC 3U61B 3HKEA 3CLUD 1JXMA 3X2FA 3ZCXA 5ALHA 3C3JA 3SSAA 2YZKA 4ZARA 1SUAA 3ZQJA 3W2GA 5K3EA 3UPTA 5TB5A 1FRFS 3KT0A 4HB2A 3GEHA 1L7RA 5EXSA 4KE9A 2XT9A 1YRQA 5A06A 5C7LO 5JNSA 2XNCA 1DKQA 4M1EA 2D2VA 2CCJA 4TVOA 2IELA 4FLEA 4ZC1A 1QQ5A 4AICA 5HW0A 2V5UA 4OU4A 4QBGB 3TIXB 3BG5A 3CIFA 3OCCA 3WK4A 1DP4A 1LF0A 5FNZA 4GPD1 3Q7IA 1WDMA 1RYDA 3OE7D 1DPFA 1D6SA 4UCWA 3RE1A 3RSOA 4BVLA 5LLDA 2A1UA 4XRGA 3I42A 4Z3DA 1D6NA 3OEYA 2M1XA 3L02A 1P1HA 4G5YA 4MGIR 5F2EA 5TT1A 1E5TA 4ZU1X 1DMRA 2ZIFA 4UAUA 2WINI 2Z2YA 2BGWA 3O8DA 4EYSA 4Y6LA 3QEMB 4D4GA 5IS2A 3WFJA 3EAGA 2JI4A 2NP6A 2ZB3A 3I1YA 1KPIA 3Q40A 4K05A 3NVKI 1TM4E 2X1LA 1KQFA 1OYWA 5AVTA 4A2CA 3U0BA 1RWXA 2AWOA 3UT5A 4L6IA 3RRJA 3L18A 2AN9A 1OCEA 2V4MA 1RM0A 3CF4A 5EWMB 2LCQA 3I2IA 5EQTA 1Z37A 4MI1A 3UC9A 1E3JA 4YJ2B 2NO0A 4A8PA 4I3HA 3AP2A 5KYTA 4RK0A 4GT1A 3JYHA 2ZRNA 4BMDA 3ENNA 5BWNA 3RS2A 4I1RA 3K6SB 4RX1A 3DOJA 3THWA 4J1NA 3AP1A 3EY4A 4UZFA 1GL6A 2NUPA 3P32A 3IP9A 2K7FA 3PB3A 4AF7A 4XYMA 3WRXA 3QE4A 4EYQA 1GR1A 2XTMA 2VKTA 4EJSA 4GL2A 2OKGA 5CXSA 3ZZUA 1DX6A 3LBIA 4P2GA 5EWLA 4HQOA 4RY8A 4OB6A 1EFKA 3SYKA 4TL9A 4WKOA 3EGVA 1J56A 2FPMA 1ZRHA 3TWOA 3M5PA 3GLHB 4H4CA 3K1AB 4FHGA 4M6WA 1JW9B 1NBAA 5T4EA 4OGFA 2C7QA 3UAGA 1C0PA 4EABA 1LSSA 3MRTA 4QO7A 1EWYA 1P60A 1U4NA 3DBLB 3I58A 3NM4A 4L75A 4LY0A 3RBVA 1WNTA 4QDJA 1SQGA 2ZDQA 4OGGA 1E1KA 1L9XA 5EHIA 1RLMA 3IE0A 6REQB 4ZAZA 2GB4A 4CR6A 4RDHA 4TYWA 4DLKA 4QDZA 2C5LA 3UN1A 4IJWA 1ZUHA 2O2CA 1B0PA 3L7IA 5AI6A 3UFXA 4JJ8A 2P7IA 1Y8QA 3WK8A 4MRMB 1O94A 2AMYA 4M0MA 5A6SA 1TMGE 2B35A 2IA5A 2FWJA 2YHBA 3KLOA 4XTCS 2JFVA 3BCHA 4AZ3B 5HX7A 1JLRA 1JQ5A 2YYSA 1E3WA 2GRAA 2BEVB 2OFXA 2G71A