4M9QA

Crystal structure of c-terminally truncated arl13b from chlamydomonas rheinhardtii bound to gppnhp
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
196
structure length
195
Chain Sequence
b'GPRKITIALLGLDNAGKTTLLNSIQGEDRDTTPTFGFNSTTLNEGKYKIEVFDLGGGKNIRGVWKKYLAEVHAIVYVVDAADPGRFEESKMTMAEVLENQFMRDKPICIFANKQDLPTAAPAAEVVKGLGLATCRNSHNVFPCTAKMPAGQDVDHRLRDGLKWLVGTVDREFGRLDPRVQTEAEEVRQEEARKKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ARF-like GTPase
publication title Structural insights into the small G-protein Arl13B and implications for Joubert syndrome.
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Hydrolase
total genus 71
structure length 195
sequence length 196
chains with identical sequence B, C
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2013-08-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4m9qA00
4WOPA 4DLYA 1H8HD 1T91A 2V6IA 1QHGA 2E9SA 1W44A 4JLNA 1W2GA 3U61B 4XSGA 1KI6A 2OHFA 2BBTA 1TMKA 2PCLA 3BJIC 4TLBA 4OBEA 4LHVA 1E2HA 3EIQA 3ZVNA 4UNQA 1OV4A 4L5BA 2PJZA 4P33A 4E09A 4K46A 2ANCA 4JLKA 4HUQB 4LJYA 1S3GA 2C98A 5KSZA 2WHXA 1SZPA 4DSOA 3QXXA 3K70D 4YXWD 2J0QA 3FMPB 4LJ7A 1MH1A 3AVPA 3IHWA 3HJNA 2IBMA 1F48A 1P3JA 2CXXA 3EX7C 1XWIA 4L15A 3K0CC 5KU1A 4AYTA 4URWR 3SJAA 4M8NE 5JBQA 3AV0B 2J7PA 4TN1A 1ZNWA 4JVLA 3GEEA 3UMFA 4Q1CA 2QNRA 1E3MA 1X1RA 2A5YB 3QEOA 1NL3A 2CJWB 1E98A 1OSNA 1YZNA 1ZU5A 5FPYA 4GDFA 4KXFB 2XZPA 4TL9A 3B2EA 4EKDA 5GJBA 1CS4C 4DIDA 3ZZUA 1MO6A 3J81k 2JLXA 2GXUA 1A2BA 1XEXA 2G3YA 1YR7A 4AYXA 1VG9B 2RH5A 3SI7A 3NC1C 5EE1A 4IVPA 3W8NA 1FTSA 2IYZA 4KLZA 1OIVA 3Q3JB 3EG5A 4F4JA 2JLWA 1GRRA 1FX0B 4D4MA 1J8YF 1XXHE 2FSIA 4XSHA 4M0LA 4Q66C 3WMFA 4TLAA 4LGMA 1VYUA 2O8DA 3HDTA 2ATVA 2FPLA 1DEKA 3SR0A 4Q01A 1G6HA 1YRAA 4PC2A 3TJZA 2DFLA 4M2LA 4BQSA 1G19A 5FI1B 3VFDA 3B60A 1FFHA 5J40A 1UBEA 3TAHA 5CM9C 1FNNA 2J9RA 1RRPA 5JHGB 2JIZA 1AA9A 5GVSA 1N5KA 1NF3A 2QZ4A 4QBFA 5FOTA 1TNDA 2DWOA 3NEYA 3RRNA 8OHMA 2W6JD 5LPNA 4WAUA 3PCRB 4RY2A 1OW3B 4KFUA 3RNLA 5L3QB 3ADCA 4MGZR 2ZI3A 4HB4A 2VL7A 3F0TA 2G6BA 1E2LA 2ZRIA 2WIBA 2YHSA 4NCNA 1VYVA 1UJ2A 3EZFA 3I92A 5HE9A 2E1RA 5B30A 1X8LA 2IYLD 4OHZA 3IEUA 1XEFA 4Q1AA 4U5XA 5BYJA 2Y8EA 4JLDA 3DVLA 3MWJA 4B3CA 1KO5A 4RZ3A 3MRSA 5TARA 3EZ9A 3REGA 1Z0KA 4M1OA 3THWB 1GTVA 4PZYA 5CDFA 3ZIAA 2ZS8A 2C95A 1K5DA 4XJXA 5FPKA 1OH8A 1NIJA 1AZSC 1M7BA 3I3SR 2IYXA 1SVWA 3RDPA 4PPFA 2AWNA 2D2FA 4MKHA 2ZITA 4NMMA 1BOFA 3P26A 4DDWA 5HZKA 221PA 1CR4A 1E9SA 2YYZA 4QRHA 4DSTA 1L7VC 1GDDA 2BMDA 2DHRA 3FTQA 4A0FA 1P75A 1KGDA 4NONA 2VHTA 3VX4A 2GXAA 2QRNA 4IJMA 1R0WA 2PH1A 4ZKDA 1NNEA 2O0JA 4O0MA 4YMWA 1XEWX 4M9QA 1TEVA 4HB0A 1CU1A 5AWFC 1IBRA 5K8IA 2XGJA 1J2JA 3NTUA 4Q1DA 1GNRA 4DLUA 3IBYA 2CK3A 3NWJA 3P20A 1Z8FA 2VA8A 3SDZA 2QM7A 3KJIA 3RS7A 1V5WA 5SZHB 2VRWA 4G5QA 1KAOA 2IF0A 1A1VA 1P6XA 4KBGA 2YV5A 1XMIA 1XPUA 1PUJA 2WJVA 4V02A 3MJHA 1YQTA 5JJIA 4AC9A 3K9LA 5DLQC 1P2TA 1YR6A 2G83A 2WIAA 2ZE6A 1QG4A 2BBOA 1EWRA 2ZRFA 1UM8A 5FL3A 2IYUA 1O3YA 3KQLA 2HYIC 2GK7A 3NDBB 3DO6A 2H8KA 1DELA 2WZQA 5EZ5A 5F3WB 5J4VA 4BE7B 1LY1A 1OF1A 1R0XA 3KUCA 1RKBA 3Q7QA 2Q6TA 1S4QA 2O8DB 2WBLC 5EP4A 3TKLA 2EQBA 4CRWB 2EYUA 4R71A 1E0AA 4TZ0A 4YMSA 2WWYA 3IPYA 4JLMA 4OI4A 2R44A 1P9WA 1TL7C 1A5TA 1T9HA 2UZ3A 3HWSA 3MWKA 2XNDA 1KNXA 4NPHA 2XJ9A 4HAZA 1U8AA 2OT3B 2ZQ5A 3QENA 3AVVA 4ZDWA 4MKIA 3TW8B 2IEYA 1GL7A 1NVVQ 2HXSA 2JLQA 1UF9A 4TMZA 3W6PA 3KFXA 5HTKA 3D3QA 1N5IA 3ECCA 1XXHA 4Q4AA 1N0VC 5FPHA 4BLSA 3L0SA 4C7OA 3TVDA 4PO1A 4S2EA 3DL0A 1P2UA 4G1UC 4RFSA 2QE7A 2GRJA 3EW9A 4MKGA 2O8FA 3EA0A 2ASEA 1XBTA 1OFUX 4R7ZA 1NRJB 3C15C 4TYQA 2AK2A 3UWOA 3MFYA 1VCMA 4PC1A 1N0WA 3QQ5A 2K5UA 3TSZA 2P6NA 2XTZA 1YKSA 1JEDA 2YJTD 2EWVA 2ZTSA 4AKHA 5DI9A 2O52A 1KI2A 2HEIA 3VKHA 4V0LA 4C3ZA 2J1LA 4UXJA 1TADA 2ZYUX 1I4DD 3GLFB 3K53A 1G3UA 2F1HA 5FTKA 421PA 5AJZA 4A15A 4HYYA 1M34E 2ERYA 3OHMA 1E2FA 1VDZA 1ZD9A 3CRMA 4DCTA 2QSYA 4NYMQ 4FW9A 4V0MA 1CJUC 1JALA 1HE1C 5G3YA 2CLSA 2JCSA 5JFGA 4KHZA 4QGHA 1YZQA 2NO6A 3WNCA 5KPDA 1Z6TA 3SZRA 3CX6A 4OHXA 1WXQA 2FH5B 2ZE7A 4DDTA 1YZUA 4ZIRA 1G8HA 1W4RA 1JQJC 1XJ0A 4EPRA 4LBWA 3GJ5A 1CBUA 1FP6A 2ATXA 3OEHA 4LOAA 3FHTA 4JYCA 1TAGA 1SHKA 1IY0A 3EPLA 1E6CA 3QF4A 3CX8A 4EPTA 1PLJA 1KDOA 3VNUA 3ND8A 3GPLA 2PBRA 4PHHA 2Q3HA 3TSOA 4TSFA 2ZRMA 4G5GA 4JLJA 1BS1A 2O8CA 4JL5A 1W48A 1SQ5A 2HDNB 1U9IC 2BBWA 4URUR 2VSXA 3PXGA 4CF7A 4NYJR 4X8HA 1KO7A 1FMLA 1ZIOA 2AR7A 2JJ8A 3K1JA 2V7QD 2WAYA 3EWSA 1Z06A 4GMDA 2VP4A 4XOIA 3U3KA 3BWDD 1W0JA 4QNRA 3QKTA 2A5GA 3OIVA 1U99A 2QMEA 5L3SA 721PA 2IC5A 2GESA 1Q57A 3K0SA 4KI0A 2R9VA 3LFUA 2PCJA 1HT2E 3I4LA 3TSWA 2G9NA 3AVXA 4PR0A 5AUPB 2CNWA 4ACBA 1NVWQ 5B64A 3R9XA 2C04A 3KXKA 3QG1A 821PA 4CGZA 1N5JA 1KSJA 1S2MA 2OESA 3GLHA 4YMUA 4TMTA 4Q18A 3BXZA 1DAMA 1XXHB 4Q4AB 5CIWA 1VG0B 5F9FA 1G41A 1Z0JA 1NP6A 2IEZA 2NZ8A 4FCTA 4C0HA 2WKQA 4RFSB 3QKRB 3QPWA 4CYMA 1VHTA 3Q72A 4EIWA 2O8FB 3WP1B 4M9SA 2FFHA 4MYCA 4B34A 1TF2A 2BBSA 1PLKA 4WBSA 3CWQA 2JJ2D 4ITRC 1G6OA 2VP9A 2EFGA 4ESHA 1UAAA 4JBYA 4D0GA 3AH8A 2CE7A 4H9GA 5FUWA 4IW3B 5DN6D 621PA 4DLXA 4WW0A 4TMVA 2AXNA 4XVQA 2ZR7A 1QHNA 2ZI9A 1I2MA 2Z43A 3TAUA 5EXSA 3ZZTA 2H7VA 1YZTA 3QVUA 4JL8A 3EIHA 2WPDD 2PEYA 5JWHA 4DCSA 5FI0B 3AP2A 1GOTA 4KVGA 2MMGA 4LJ5A 3OIYA 4Q21A 4QC2A 4AG6A 2OILA 1G5PA 4F4IA 3LBNA 1CR2A 1E2MA 4HLQB 1T8TA 1CRQA 2VEDA 4C30A 4Y0VA 4YC7A 4Q9JA 1R5NA 5IRCD 4AY2A 1IXRC 1OXUA 4C0JA 2OAP1 3RABA 1E9EA 4B74A 2DB3A 1P9NA 3B13B 3K0FA 4X8MA 3I73A 1JI0A 4M9XA 2BV3A 2F9LA 3EXAA 2I4IA 4A8JC 4BWYA 3HYTA 5F2EA 3A4LA 4NYIR 4W9MC 1PUIA 4GZLA 4PXAA 3GJ0A 4LYFA 1VCOA 1U0LA 1Z0AA 3CBQA 3W5IA 2FN4A 3WY9A 5KYKA 3SQWA 2B6HA 3FE2A 4KVAA 2OEPA 2HLDA 1F2UA 4NHOA 3FFBA 2P3SA 1UKZA 1UDXA 2YWGA 2P0EA 1MRSA 4RJLA 4KLNA 3TK1A 2YZ2A 4BEBA 4NYJQ 3E70C 3PV0A 2BHRA 3TQCA 1D5CA 4QKQA 2O8CB 3QBTA 2ZRKA 1GM5A 3T1OA 2JLVA 3PEWA 2DWPA 2VF8A 1WCV1 2PX3A 2DR3A 1T4GA 2REOA 4HAVA 4BLOA 1KNQA 3UK6A 1S9HA 1RYHA 4W5JA 4PZZA 1MO5A 2FWRA 1I4TD 1ZAKA 4DCVA 1OFIA 3IO3A 4LUCA 5L3SB 2R6DA 3V4FA 3U44A 3LW7A 1ZNYA 4ZCMA 2ZJAA 4F38A 4QL3A 2AD1A 3OAAD 5CYPA 2OAQ1 3BFKA 3B78A 1RC8A 3AUXA 1XDBA 3A8TA 1W46A 2P2LA 4PSAA 2JA1A 2JJ1D 2J7KA 3RWMB 1G3RA 1KK0A 2B8TA 5FUYA 4M1YA 4OQNA 3LD9A 1ZM9A 2GDJA 2G77B 4IDNA 4IDQA 3TH5A 2B21A 4NBSA 3TGPA 2CDNA 3EASA 4KSCA 3T15A 2IF2A 1KMQA 1NLFA 3OIUA 4ZI3A 4AKGA 4DCNA 5JJLA 2ZRGA 3GLGE 3PEUA 2MSCB 1G20E 1DE0A 3RS4A 2G1KA 2X77A 1IN4A 3B1XA 4AURA 3DMDA 4DLZA 4HAWA 2ODWA 5FBWB 1NY5A 2B7BA 5KOYA 2G88A 1X1SA 1MO3A 2C03A 1ODFA 2GXSA 4LJAA 1OIXA 1X3SA 3H84A 3BH0A 5EP2A 1OE0A 2ZSDA 2ZM5A 1TF5A 3HU1A 1G4AE 3K9NA 2DWQA 5FBLB 3CZPA 4IDHA 3ZQ6A 3IQXA 4FCWA 3FDIA 1S1CA 4PX9A 2FA9A 2CE2X 2FE4A 2I1QA 4Q03A 4DZZA 3HU3A 2D7CA 1KZGB 1MV5A 2GF0A 4TQ9A 4JLBA 4BLTA 4DXAA 1Y3AA 2OXCA 2W2VA 1XRJA 4JBWA 5IDVA 1E79D 2XITA 4JLVA 1GKUB 1NY6A 1M7GA 4K8OA 5FBQB 5KPJA 4WXRA 3R8FA 4PAOA 1P60A 3FB4A 4MRRA 3Q8XB 2EFDB 4TT3D 4BFSA 4NYIQ 1E9CA 1DAHA 3T06B 1FUUA 4J0QA 5DE3A 1SKQA 3KB2A 3O8DA 4YMTA 4ZI2A 1XTIA 4C4PA 5AUNB 4P4SA 2WTUA 5FTMA 3SJCA 2A78A 3EC2A 5E7MA 3NG1A 2BEJA 3GMTA 2WSSD 4LYJA 4TMWA 3U3RA 2F9MA 1CXZA 4QJ4A 5HZHA 5GADl 4TYPA 2CHQA 4E03A 3B85A 2QI9C 3NVAA 2R6AA 1F2UB 2QTHA 3EZ2A 2H5EA 2KI5A 3KZ1E 1ETUA 3PEYA 1Q1ZA 2ZRPA 3MUFA 4LYHA 4HZUA 4X8OA 2KE5A 1KZ7B 1VCNA 4IOKA 1F60A 4LBVA 5CB8A 1GKIA 4GSYA 4Q9IA 1G8PA 3KB1A 3LDAA 4LV5B 4YLGA 1G17A 3E5HA 1IY2A 2QTFA 1KDPA 4AWXA 1VG1A 3AKCA 3SHFA 2G1JA 3A4NA 5DISB 2GEUA 5JCZA 2GCPA 4HB3A 1KO1A 2RMKA 4L4UA 3NDPA 2ZI6A 3SNHA 3U44B 2Q0HA 3C5CA 2DFTA 4TMKA 1ZD1A 1XD8A 3G5UA 3R7WA 5CB6A 1DVRA 2NMVA 1KK3A 1JJ7A 1N6RA 3FMFA 4AYWA 5EE5B 3THXB 1GKYA 5BN3A 2ORWA 4IFBA 5EXTA 3CKLA 2EWWA 1GNPA 3JVUA 4PO8A 2IS1A 1G18A 2B92A 3TNFA 4B73A 4BFWA 3UG6A 3VR2A 3BS4A 1Z0DA 4NL4H 1XTRA 4NCKA 1CKEA 4LV6A 3VU9A 2WJJA 4JVSB 5FOWA 4E07A 1E96A 2QQ0A 2REXB 4CEIA 5KDLA 1QVAA 5CDFE 5JS7A 1TU3A 1XD9A 5KSYA 1RVDA 2QQEA 1ESNA 1XCMA 3A1SA 3DEFA 1ZVQA 3AKDA 1KMHA 2OBNA 2ZROA 3F8TA 3I1FA 3LXRA 3N2IA 1XPOA 2NPIA 1S1MA 4Q1FA 3X1YA 3ZD6A 3LVRE 1XNJA 2AWOA 3BERA 4MKFA 4OJQA 4AK9A 4LJ9A 2Z4SA 1EFRD 3CZQA 3A36A 4PQFA 2X2FA 1XZQA 2IL1A 1UBGA 3CRQA 1LV7A 3IBGA 4XWKA 4NKRA 4F7WA 1RIFA 1Z6GA 4XVUA 3NBXX 2GVDC 4P4UA 4Q00A 4QG7A 1CTQA 1CRPA 4TLDA 4RKFA 3VR3A 2ZANA 4BLRA 3WHLA 3TR0A 1FL9A 3QVVA 1D9ZA 1RE0A 2FSFA 3NEJA 3OEED 4LPKA 3U4QA 1G291 2C8VA 3QBVA 3AF4A 4LJ4A 5DYGA 4A0RA 4A8JB 1NMXA 3WYFA 1SULA 2HYDA 2QA5A 3I72A 1H65A 4P31A 4NTZA 3AKYA 2ONJA 2H16A 1EFCA 1G7RA 2YNMA 5FTJA 2XOKA 5JEEA 3HPRA 2REBA 3C7KA 1G5RA 2PMDA 3VR4A 1HEIA 2ZUBA 2FDCA 3SBEA 1IQPA 1JR6A 3PUVA 2PZEA 4FMCB 4LWZA 2ODEA 2XEXA 2NIPA 1ZJ6A 4EFNA 1IM2A 1E1QD 1A2KC 2QP4A 4JMPA 2IUUA 3TQFA 1KIMA 1MABA 3MD0A 2WKRA 2FEOA 4JT2A 4HDQB 2W6ID 4HZUB 1BH2A 4ZV4A 1OKKA 2FNAA 1B0UA 3KJHA 3RAPR 2XSZD 1R8QA 1ZW6A 5EXXA 1FW6A 3ASZA 2HJVA 3LQQA 5FOVA 3E2IA 4TTRA 1YRBA 2QGZA 3A1UA 5D3QA 3GJXC 2YVUA 2C2HA 2VP5A 3WYAA 1AK2A 4L8GA 4QJ5A 3B8HA 1U2RA 2GBLC 1T3SA 3CNOA 4OQXA 3EPKA 4BFZA 2O0HA 4GPTA 5CYOA 5SZKB 5AJYA 3QIAA 3QXCA 2RAPA 1RZ3A 1OB2A 4BEJA 1WE2A 1KO8A 4JJZA 4LX0A 2ANBA 3OFNA 4EPWA 1S9DA 2TMKA 2UVQA 2F1IA 4BUJA 4DLWA 4ZDKA 3SS8A 2QEQA 3CH5A 2GAAA 4U02A 3JZAA 4IVRA 3MMPA 4BZPA 1W47A 2GCOA 1BMFA 1XB2A 3U7HB 1DAKA 2GEDA 3L2OB 2ZVQX 1D8TA 1YHNA 3NKVA 4QJ3A 5SZJA 3DOEA 3AVWA 3MGCA 1E32A 3ZYCA 3EWAA 4CT5A 1Q44A 2QT0A 2OLKA 1KMHB 5C18A 4H1VA 1NVVR 1FMJA 1Z6XA 2B8WA 2C9YA 2FMXA 4R2IA 3V9PA 1YR8A 1S3SA 3QEJA 4E5UA 3DMNA 3SYLA 4ABYA 2QBYB 2XXAA 1FQKA 5FL7D 4EFLA 1KJYA 3DOFA 5HKKD 1ZCAA 2QTVB 4BECA 4B3GA 4V0ME 2GK6A 3T1TA 2GZAA 4KYIB 3AP3A 1ZC3A 2IW3A 1JR3A 1XZPA 3CPHA 4LJ6A 5DYIA 3TIFA 3I8SA 2X2EA 4HLCA 1E0SA 4IVQA 1JECA 4CEJB 5CJ2A 2WOJA 2IHBA 3LRPA 2WJIA 5FBVB 1DAFA 1R5BA 3LY5A 4M1WA 3GLGB 3U4QB 5G3ZA 3RS2A 1OHHA 3KKOA 3LAWA 1ZNZA 2IA5A 4Q9HA 1GVNB 2IYYA 3CF6R 3U5ZB 2VHUA 4D4KA 3EZ7A 1E2GA 1VTKA 4A2PA 1KI6B 1W4CA 2WICA 1FUKA 2BC9A 2RGEA 1T0JB 4DUGD 3HR8A 3W34A 1Z2CA 4B43A 5JI2E 3WYGA 4JKIA 4HATA 1II9A 1I2DA 3EIEA 2PMKA 4TLCA 2ZETA 3TBKA 3GJ7A 1H8EA 2CHVA 3B1YA 3HPQA 5EE9A 4LHWA 5ELXA 5KUTA 4D4JA 3IIJA 4IEIA 3FVQA 3QY0A 1DAGA 5DGXA 2V7QA 1NKTA 2Z5FA 1NJFA 3M4YA 4FXPA 2RGXA 4G0NA 1SHZA 4NYMR 3VR1A 2HCJB 1CJMA 2ZJZA 3VKGA 1MABB 3LO5A 3SYNA 2V1UA 1GNQA 4HI0E 4BFTA 3BK7A 3I62A 3QKUA 4GOJA 1BKDR 4QGGA 2R65A 4QM6A 4FIDA 3Q5DA 3LQRA 3GJ8A 4KYUA 4D26A 4EQ6A 4PPGA 2GBLA 3GP8A 4P32A 3EPJA 5IHPA 1FQJA 4RD3A 3VQTA 2ZJBA 4L16A 4Z51A 3A6PC 2VHQA 2VBCA 2J0VA 3KJGA 1SKYE 1XEXB 3AQ4A 5HCIA 2IUSA 1P73A 3SOPA 2JDID 4B6EA 3KXLA 3AVQA 1F3OA 1TQDA 3H86A 1JXMA 5F9HA 3SE0A 4DC9A 2CCJA 3GLHE 3H4MA 3HYRA 2GJKA 3QPVA 5TVKA 2BDTA 4Q7MB 4FI3C 3CX7A 5KNBA 1F6BA 3CWZA 3JVVA 4DSNA 1JNYA 2YWEA 2P67A 4UJ5A 5FPSA 2QUZA 3L82B 1GITA 2LKDA 5BN4A 1E4YA 2BMEA 4HEJA 3ZGXA 3TE6A 2YOHA 2IYVA 5C2JB 4M21A 2R8RA 2A3RA 1W7AA 1HT1E 2WV9A 2NGRA 2BKEA 3A1TA 1P4SA 1XEWY 2SHKA 3O47A 4JVMA 4N0EA 4B3XA 5LB4A 1EXMA 2VHCA 2IHYA 1GL9B 1P61B 1EX6A 2WPDA 4LV8B 3T1QA 2GF9A 5HR5A 1M1YE 3Q85A 4Z1MA 4Q47A 4GBMA 2J7PD 1JEEA 2BCGY 5JLJA 2XXAB 2CMKA 1M74A 4N0DA 1FPMA 2MSDB 4IOJA 1U8ZA 3WMGA 2ZAOA 4F4CA 4MQBA 1ZYUA 3NHBA 1Q3TA 4R9UC 4FINA 3UANA 4PPNA 3I5XA 2QGNA 4RZUA 1G9XA 4Q4JA 4DCUA 5EJEA 4ZDJA 3PG5A 2IS6A 1ZUIA 4WVFA 5JSZA 4KODA 4R98A 3LH5A 5LBIA 5KSPA 1AS2A 4UNRA 5UKDA 2CBZA 2AD5A 2GCNA 5J5CA 3FGNA 4CZ2A 3K9HA 3GJ6A 4AIIA 1E2IA 3QPUA 1N6KA 3NBYC 2IXGA 3SU8A 3FKQA 1XU4A 4DLTA 2F55A 3PUWA 2OBLA 3N2EA 4YDSA 2QAGA 2FV8A 4URVR 1PLLA 4IDOA 4RZ2A 4B47A 4DLVA 4NCIA 1A4RA 2NTYC 1BYUA 4Q5IA 1RYFA 4DLSA 1D2EA 3WBKA 2OCPA 2GJSA 4OHYA 4LCBA 1A82A 2Q9AA 5AR1A 3R9IA 2QPOA 1ZM2A 1UEJA 2WJGA 5H1YA 5TV2A 1NI3A 4IXMA 4I1VA 2OZEA 2X8AA 3AVUA 1DS6A 4B6FA 2ZS9A 2AKYA 4IKEA 1IN8A 2DFKB 1N6OA 2UZIR 3EPHA 2O8EA 4P4TA 1DADA 1KYIA 3CUEF 2N1BA 1Z3IX 2D74A 1Y63A 2ZJOA 3GJ3A 4BFUA 2OCYC 3LLMA 2BMFA 3HU2A 1UBFA 5AJVB 4PFSA 4EJSA 2FG5A 3KFVA 3P32A 1IJFA 1E2JA 1XMJA 1KI3A 2CL7X 2WVJA 3ZIAD 1NMYA 1U8YA 1IN6A 4PSVA 1NBMA 1GAJA 1HH4A 2J45A 2BOVA 2Z6VA 4NU0A 1EG7A 3FKSA 2BMJA 1QZXA 4C0LA 4TQUS 4O25A 4OHWA 1G1MA 2EFCB 5DO9A 3TUIC 1NLYA 4Q1EA 1CR0A 1ZD8A 2ODNA 4L9WA 3U7GA 4KJZA 4LPSA 4CVNA 2XB2A 3R9WA 2F1RA 3NIBA 3MLEA 4B76A 1CJKC 1J90A 1R2QA 2Q21A 1YE8A 2WSMA 2X1VA 4FN5A 4RCYA 2ZRDA 2J46A 2WMNB 3M1IA 5AJXA 3WP0A 2NQ2C 5L3VA 4FMDF 5JRJA 2R62A 3SC3A 4O3MA 2Z0MA 4JZKA 1KSGA 4LC0A 3TUZC 4NZYA 2CK3D 5DI3A 3ZQJA 1U0JA 5B58C 2FZLA 4C7OB 1Q3HA 1A7JA 1G16A 1CIPA 3M6AA 1OXVA 1NLZA 1HYQA 1U81A 2J41A 2NZJA 2P5SA 1XJCA 3BB4A 3DM9B 4OJKA 4AD8A 1NJGA 2AK3A 1E2EA 2O5VA 2GJ9A 2YWHA 4HDCA 4TT3A 1W0KA 2OSBA 2F3RA 2FGJA 1E9AA 1F5NA 1UEIA 2C9OA 3WNBA 4ARZA 4TYNA 1WMSA 3PUXA 5BWMA 5CM8B 4C0QC 1DBSA 2NO1A 3EA5A 5JSZB 3T5GA 1M8PA 4UXHA 2GHIA 2R6FA 4BFVA 1ZUNB 4UNSA 4M1TA 5IK2A 4B33A 3R20A 3RHFA 1AGRA 1LF0A 1E9RA 3EC1A 3KTAA 1N6LA 1COWA 2C9CA 1DG1G 4TMXA 4QGFA 2GETA 5FR2A 4DBLC 1X8JA 4XD7A 1Z08A 4GP7A 4A4DA 1OXSC 2BJWA 3BGWA 4LYAA 4XWOA 3RRMA 2IYQA 3OIWA 2D3WA 4YQFA 2HT6A 3EAQA 2GKSA 1IN5A 2OCAA 2MMCA 2VTKA 1Z47A 2QMOA 1EX7A 3UKDA 1T0HB 1UKEA 1XPRA 5TY0A 1P72A 3GQBA 3NH6A 1DARA 4B2PA 1OFHA 2W00A 4JBXA 3VAAA 3ZZ0A 2V6JA 4ZIRB 3QXSA 2A9KA 1YU9A 2QROA 2CCGA 3VNVA 3F3YA 1VMAA 2VSFA 4Q7JB 3BOSA 1LFDB 1ZCBA 2ZAMA 2QE7D 3QF4B 4MA4A 4Z8XA 4DDUA 2ZSFA 3RWOA 4QBIA 4HZIA 1KTVA 2O8EB 1RW4A 4N1AA 4B2LA 2JLZA 3FMOB 3PUZA 3THYA 3KQKA 3OESA 4V0OA 2AXPA 3K0AA 5TXGA 1ZRHA 4EJSB 1W49A 3SFVA 1SXJA 4KITB 2VP6A 1DO0A 3UMRA 2QM8A 2IS2A 4W7SA 4LHXA 4RD6A 3ETLA 1TX4B 1E0JA 1XCGB 1YJ5A 2WM9B 1JB1A 2IYRA 4MRVA 4AKEA 1WDTA 2VP0A 3UIEA 4MDFA 1PJRA 4GI7A 5DSZA 2LCFA 3NXSA 5LB2A 4GT1A 1OH6A 4GP6A 3W8RA 3K8YA 3ZVMA 4UXIA 4EPVA 4C2UA 1E99A 2QP9X 2PJRA 4LHZA 5KHOC 1SKYB 2FFAA 1GIAA 3ONWA 4JLPA 1N6IA 3W3ZB 4TZ6A 3QE0A 4I4LA 3GLHB 3ICQB 3UMSA 1D6JA 1RFLA 4ESVA 4A1FA 4YONB 1X6VA 5DI3B 3ADDA 3FMIA 3O8BA 2OUKA 4TL8A 3OEHD 2RGAA 3FHOA 4Z8YA 5HPYB 2O8BA 4OI2A 4RSGA 5BXQC 1N25A 2ZJ5A 1M6NA 3B6EA 1YZLA 1H8HA 4Q7KA 5CK5A 3SFZA 6Q21A 4QGAA 3QOFA 3BAFA 2NO0A 5GJVC 2GAOA 3CB4A 4D80A 3AF1A 4TSFD 5DIFA 4WZBE 2V54A 2YOFA 5J4HA 3SN6A 2H17A 2C96A 3KX2A 1ONBA 2VPPA 5FPTA 3D31A 4O2LA 5AK0A 1P7CA 1Q1BA 3BB1A 3CPJB 3BC1A 4LSGA 3O8RA 4CEHA 1N6PA 4XIGS 4YXWA 4FWIB 1F2TA 3A1VA 4GOKA 5JECA 3O8CA 2JLUA 1FZQA 1KO4A 2OLJA 3DDCA 1ZBDA 3L0IB 4DVGA 2OCBA 1W0JD 3CF2A 1CULC 4QHTA 1U98A 1ANKA 3AEZA 4B44A 4HDOB 3NC0C 3BE4A 5K8LA 1BIFA 2FSHA 3A1WA 3L8ZA 4G3XA 2KSQA 1IY1A 2XSZA 2IXFA 1ZMXA 2CNWD 1QG2A 2QU8A 1XF9A 1S0UA 1NG1A 2H1LA 3U60B 4IDPA 2FZ4A 3K0FB 4YDHB 3Q7PA 1PV4A 4I1UA 3RVBA 2GZDA 2R6CA 4ZKEA 2G0TA 2ZYVX 5LDDC 5TMPA 4KCGA 4AI6A 1CR1A 4M9ZA 1II8A 5M04A 3WXMA 3R8CA 2WAXA 1DPFA 3K09A 3P4YA 1KY3A 3QI2A 1UADA 4MH0R 4JL6A 4Q48A 1DOAA 4KFTA 1LNZA 4HUQA 2XTMA 2W0MA 3CNLA 3AF0A 4FCVA 4B2IA 4LZZA 5H68A 4OHVA 4Q4HA 1V43A 3CF0A 2W6JA 4MYUA 3U7FB 2KBEA 2FPKA 1US8A 4A2QA 2WWWA 3BD9A 2V1XA 1X86B 3OE7D 3X1ZA 5JRZA 5E95A 3AM1A 1T3LA 2XZLA 3AKEA 4URXR 4CW7A 1AKYA 4OQFA 1ZU4A 1PZNA 4B71A 2GJAA 2ZR9A 2ZJ2A 2J87A 2CJWA 4IOMA 1WRBA 4RD4A 2RGCA 1YR9A 1SVSA 1TU4A 2RGNA 4LI0A 1Q1EA 5G53C 4MDEA 2Z4RA 4EAQA 1MT0A 2JEOA 1C9KA 1TQ4A 3PIRA 1JR3E 1W36B 3DPUA 5E7IA 1NN5A 1W2HA 3TLXA 4F91B 4BPBA 2KB0A 1T3HA 3ASYA 1FX0A 4HSEA 4GOXA 5FOUA 3UG7A 2ERXA 2O8BB 3C5HA 2BCJQ 2QORA 3WRYC 3H1TA 4B75A 1SGWA 3EARA 4I99A 2HLDD 4V0NA 1XX6A 2PX0A 2QMHA 3CW2A 2ORVA 1JPNA 2KBFA 4QOSA 3K0EA 4BLQA 3IGFA 2ZSEA 3KKQA 3VTKA 4EFMA 1LVGA 4II7A 1ZP6A 3X1DA 4KSBA 1E9BA 5EE3A 3U3OA 4NCHA 4CEHB 3KXIA 1LS6A 1CJVC 4CDGA 4JYBA 3K70B 2RKOA 2UKDA 3LBIA 1QHXA 4JVNA 2XX3A 2IT1A 4NCJA 2CVFA 1MO4A 1L4YA 2C78A 2DPXA 5JWOA 1ELOA 2PEZA 2QPAA 1WBBA 4IFEA 3GEIA 4Q7LA 3U3MA 1OXTA 1U0HC 4DRZA 1FNMA 4Y0AA 2VIIA 4A6XA 3FPAA 4GFDA 1C1YA 4LJ8A 2HF9A 2PT5A 2ZI4A 5FFMA 3C14C 4EUNA 1Z63A 3GFOA 1AIPA 2GVZC 4C0SA 3U3JA 4DSUA 2RB4A 1E2KA 1QDEA 5G40A 4XVRA 2RHDA 4PHTA 3AVOA 1M7HA 1OFTA 2EFHB 2F43A 3DKVA 3A37A 2NO7A 4NE2A 4MRSA 1GUAA 4ASUD 2QG6A 2V3CC 3NBFA 4ZO4A 4M4SA 2B7CA 4P4SB 4Q1BA 5B57C 5EQTA 3VMFA 2JASA 5H8WA 3T1VA 3LX5A 5JWRA 3RRYA 5LD2B 2C5LA 3AB3A 2XZOA 1NKSA 3ZVRA 1II8B 1Q12A 4DB4A 1GG2A 5C4MA 2ZUDA 2IWRA 1KK1A 1SVOA 1DTSA 1R0ZA 1T8UA 2BJVA 1VPLA 1AQUA 3T12A 3W5JA 2NOAA 3CO5A 4Q19A 1SVKA 3QF7A 2BVNA 2XB4A 1I4LD 4A0HA 2RGDA 5JMTA 5BQ5A 1YZGA 1WF3A 3MJRA 1Z6YA 3D6TB 4DIEA 3HR7A 5BW8A 5P21A 3IILA 2WJYA 4Q4HB 3BRWD 5CK4A 4HUTA 3DZDA 1NVXQ 4A36A 2AL7A 3AVYA 2PLRA 5E4FA 2A7QA 5EE0A 1R4AA 121PA 1Z2AA 3B5JA 1FOEB 1US8B 2ZXUA 4RCZA 4DDVA 3BORA 2QAJA 3AUYA 1RPZA 3H0KA 1OJLA 2NPFA 3R7WB 3S1AA 1VG8A 3VR5A 3SJBA 1AJEA 1LS1A 3I32A 1CF4A 2VF7A 5FUXA 2Z83A 4ZDIA 3AF2A 3LW8A 3CRRA 1QHIA 1W4AA 2DFNA 4RD0A 4BZQA 1XTJA 4GRAA 1N5LA 1YVDA 3HP1A 2WKPA 5AJWA 3FOZA 4DJTA 4L9SA 2ZR0A 1AGPA 3VU9B 4HLUA 1E2QA 4AKIA 2WWXA 4CEIB 1KJWA 2R6GA 1N6NA 1XTKA 1NSFA 2GTPA 1HQCA 2ZUCA 3GJ4A 2NG1A 4URYR 1PVOA 5CLQA 1TEXA 2Q9CA 1KDRA 3CRW1 2WWGA 4PAMA 1EFUA 5BN5A 4C9BA 5IF9A 2J0UA 3SJZA 2AHOA 1HA3A 1U90A 4US0R 1KSFX 3QJYA 5FR1A 1HURA 2W2TA 4LC1A 4QNMA 4URZR 3W6OA 2C77A 5ANRB 2AFHE 3VX3A 2FFBA 4R2HA 1MKYA 4W5WA 1JBKA 2AFIE 1G64A 4ZCLA 4JLOA 2FX3A 3ZJYA 5K8TA 1L2TA 1G5TA 5J4YA 5A0FA 3B1VA 4CIDA 5GJWC 2JLYA 3IHLA 1IONA 4OI1A 1G8YA 3T5DA 1TQ2A 2BM1A 2WMOB 1M2OB 2D2EA 5FOXA 4XWAA 1K8RA 2H92A 4GMXA 3IIMA 2BIFA 3WHKA 3CPEA 5C1BA 1KI9A 4DB2A 1BO6A 1L8QA 2F43B 1XMVA 2RCNA 1SVIA 1NVUQ 2OG2A 4B32A 5JCPA 5D3MA 2IK8A 1DO2A 1E2DA 1KY2A 3WBJA 4I81A 2OBMA 2W0SA 4FMBB 3MAAC 2W83A 2YINC 1UBCA 3MSXA 4TLEA 1UKYA 1NBME 3GLFA 5KDOA 2QAGC 1G8GA 1VKJA 3BFVA 4MYTA 3KJEA 2QSZA 1Z0IA 3UXMA 4ILEA 1KI4A 2V4ZA 3ZD7A 5JI3E 1E1RD 1EESA 1J8MF 2A5FA 4G5RA 3K0CA 2J59A 4TYYA 4P3YA 2HXYA 4UQOA 2D4HA 5B2ZA 3VHXA 2HT1A 2A5DA 3X1XA 1DAEA 1DAIA 1G7TA 1Z28A 3C41J 4NP6A 2QY9A 4IRUB 4B3DA 5KTYA 2GILA 4LDJA 2RGBA 4MGKR 1GP2A 4F93B 3G0HA 4HAYA 2ZRHA 3T34A 2I1VB 3BIFA 2D7DA 3PR1A 4I1OA 3RC3A 1UDWA 1Z22A 2F3TA 4JIMA 3CR8A 3QKSA 3PQCA 3S1AB 4B35A 1E4VA 1G8FA 2IXEA 1HUQA 4BGDA 4D4LA 2FEMA 3KKNA 1CLUA 4LBYA 1QBKC 1O87A 4EJSC 3KQNA 4D0LB 3PFIA 2IUTA 1J99A 3CR7A 2D62A 3L8YA 4OKSA 2QT1A 2JJ2A 5L3RA 1KOFA 2XOKD 2L0XA 4WZAE 2JLSA 2GCOB 1VHLA 1ZUHA 4O2RA 1CJTC 3PVSA 5DN6A 2H18A 5AUOB 3U7EB 4M1MA 4A0GA 2CEAA 4F92B 1WB9A 4GNKA 2ZPTX 3VR6A 3C16C 2GA8A 1CEEA 5L8VA 5J4KA 3IDQA 1E2NA 1T6NA 1GSIA 3Q5EA 2ZREA 1J7KA 4KU4A 1KAGA 3B82A 2J0UB 2WWFA 5JHHB 3QSYA 4OK5A 3DHWC 1XD2A 3T35A 3UWKA 2FPMA 1OKKD 1J70A 3LNCA 4JS0A 3BFXA 3LWNA 2FF7A 1QF9A 3ZS9A 1KJZA 1KI1A 1WBDA 1TPZA 1NG9A 1RRCA 1TTTA 2OFOA 5CIQA 2GJ8A 4LBZA 1KK2A 4Q02A 4QFMA 1P2VA 3UATA 4S35A 1R6BX 3CIOA 2Q3FA 3G82C 4DWJA 2H57A 3RSOA 1EFHA 4PQYA 2PLFA 1ESMA 2D06A 2QENA 3RS5A 3FHCB 1QHYA 5TDHA 1LTQA 3IUYA 3CLVA 4UKDA 3P1JA 1NSTA 5K8UA 5HE8A 5FH9A 3QKRA 1CP2A 3OFND 2AKAB 2FJUA 1OT3A 1KKLA 3FYHA 2DYKA 3VKWA 4M22A 2ZSAA 2W2XA 5JZVA 4JKYA 1P5ZB 5D3MB 5H70A 4US2R 1BMFD 1JAIA 1NMZA 2Q3MA 4V0KA 2J0SA 1UKVY 2JIZD 3QG5A 1SXJE 4QBHA 5JJKA 3GLIE 2RHMA 3CNNA 1N0UA 1R10A 5GJCA 4TL7A 2QPTA 2P6UA 1R8SA 3NBZC 3GFTA 4OYHA 3RRZA 1KSHA 2YWFA 2G0NA 2P5TB 4D25A 4LRWA 2ZIAA 2ORIA 3OAAA 4EQ6B 4HAUA 5JS8A 1G3QA 1X8KA 1OIWA 2V8OA 2XAUA 3K9GA 4BFYA 3NH9A 5IT5A 3CONA 3OF5A 3TRFA 2JJ1A 1NN0A 4PHFA 521PA 2OFWA 2J3EA 1JR3D 2HJGA 4DT1A 2YKGA 4PQRA 2HV8A 3ZH9B 3I5YA 3ZS8A 2QN6A 2VYFA 3CM0A 3RS3A 3KL4A 4ACAA 3QKSB 1XFAA 2FOLA 3RC8A 1EK0A 1Z83A 1OHHD 4Q4LA 4FD2A 4A82A 2ZRAA 4NDZA 3TW4A 3GD7A 4NH0A 3LXXA 1XMSA 4G5OA 4TTPA 1SXJC 3L0OA 3D8BA 1LW7A 5J4LA 2YOGA 1Q21A 1G7SA 4G5SA 5DH9A 2EFEB 3T61A 4D82A 1LF5A 4GL2A 1JPJA 1H8ED 4X8LA 2ZYWX 2FSGA 1HTWA 1ZNXA 2A5JA 1UFQA 2F7SA 3D7MA 3I8XA 4IEEA 3ZLJA 1D9XA 2EW1A 4PAQA 3C8UA 3P27A 4CT4B 3TR5A 4POAA 4TTQA 1OH5A 2ODBA 1EGAA 5FBRB 3IIKA 1XD2B 4MGIR 1E79A 1AKEA 3L43A 1Z6AA 4JT4A 4K81B 4Z54A 3BH7A 4TL6A 3MWLA 3U6KA 4JLAA 1RJ9A 4JJKA 5DNYB 1W36C 2VP2A 4D0NA 2VSOA 4HB2A 4ERNA 3ND9A 4B48A 4C2TA 4Q4JB 2ZRBA 1II0A 1MR3F 2RGGA 2IYSA 4BZXA 1KKMA 4OL0A 4A92A 1P9RA 1E9FA 1NN1A 2WSSA 2PZGA 4QHSA 3IQWA 1N3BA 1OB5A 4QBGB 4HAXA 1IOZA 4FMDB 2BKUA 2ONKA 1S8FA 3LBHA 3PEVA 3WRXC 3M0EA 4U00A 2V9PA 1W5TA 2AX4A 3BH6A 4ZCIA 2XTNA 3N5CA 4US1R 1ZC4A 5DHAA 5CITA 3K70C 1HE8B 4XTRA 1QVRA 3TUJC 5E3HA 2QAGB 4MGYR 1MRNA 2XNDD 4DLRA 4EPYA 4YMVA 3ADBA 2ZYTX 1Q22A 3RSLA 5E7JA 2W58A 2GNOA 4MUAA 2YC4C 1TUIA 1GWNA 1YZKA 1UPTA 4XTCS 4D2IA 5AUQA 3V4RA 3KKPA 1QHHA 4DEXA 2NO9A 5C4GB 3RYTC 3OE7A 3ZVLA 2WWIA 5G41A 4Z1MD 4A6PA 4UNPA 2FGKA 2CHGA 2GXQA 3V00A 3W6NA 4PTLA 4RZXA 2N46A 3AVTA 1OYWA 3SBDA 3LLUA 3GCGA 3QXJA 4WIAA 3ZDQA 3PUYA 3IO5A 4D6PA 3BB3A 4RKEA 1ZM3A 4DHEA 1BYIA 2X19A 4QHYA 1IXZA 2F6RA 2WOOA 2FFQA 1GRNA 5LD2C 4AG5A 5HCNA 1G3MA 4DT1B 3RANA 2AN9A 4KO8A 1IXSB 1XCPA 1KHTA 2CVHA 2OXRA 3QUSA 1E2PA 4C0KA 3GLIA 4DEYA 3U2QA 1EWQA 1G3IA 3K09C 2GEVA 1VCIA 4JSYA 1U9IA 2VO1A 4KFSA 2R2AA 4ON9A 1P62B 3W90A 2GWHA 4BRUA 1E9DA 2ZJYA 5FOSA 2ZSBA 5TB5A 4D81A 3JZMA 2EVWX 4M53A 1AS3A 1OPXA 1EFRA 5A5GA 3KUDA 3OZXA 5EXPA 1U94A 1Z07A 1P2SA 2BEKA 1Z5ZA 2ZE8A 3WNDA 2QL6A 4RD2A 2EYQA 3VHLB 4MUBA 3C4JA 3DM5A 4KFRA 3SEAA 2DY1A 4PPQA 4TWZA 4PZLA 1E69A 3X1WA 2QP3A 3FWYA 2PZFA 2A2ZA 1QRAA 3B9PA 4LK2A 3ICEA 1NN3A 3OEEA 1JJVA 4OQLA 2ZVPX 3KKMA 1KI8A 2RGNC 3P4XA 5EUMA 5KNCA 2IWHA 3THXA 3MWYW 2E87A 1EFTA 2JAQA 3E1SA 5GVRA 1VIYA 2JLRA 1RJ9B 3GFPA 2HUPA 1XP8A 2OM2A 2VLIA 4EDHA 2DBYA 3MCAA 5KNDA 3RLFA 1NIPA 3WMEA 2KJQA 4ASUA 3B7GA 3B9QA 4UJ3A 4ARZB 4BRWA 1OLOA 3PENA 2EU8A 2Q9BA 2I3BA 4OK6A 1L4UA 4QXAA 1G4UR 1E94E 1N6HA 2ZJ8A 1Q0UA 3DZ8A 3LX8A 2C99A 3X2SA 4LHYA 3QNUA 4RD1A 1E1QA 1NBMD 4MYHA 2J5XA 1OXXK 2O0KA 5JEDA 3FKSD 2DCUA 1AN0A 1AS0A 3KTAB 1RRGA 4GZMA 4RVCA 2W6IA 2CLCX 2GZHA 1ZIPA 5A4JA 1HV8A 2IX3A 4PC6A 4PHGA 1IAQA 2QMUA 1Q20A 3W9YA 2F1JA 4XH9B 2ZE5A 2N42A 3B1ZA 4FWTA 1ZM7A 4UNNA 1GZSA 4I1SA 3AP1A 3FFAA 3KQUA 3UPUA 3QXHA 2JATA 1Z0FA 1ZM4A 1QHHB 2CLDX 1WA5A 1QHSA 2V55B 3GEHA 4Q9LA 5EP1A 1HY3A 4E22A 4B3BA 5FUVA 3A4MA 2HF8A 4BASA 3AGQA 3AF3A 3TVTA 3U6BA 1LB1B 2KWIA 3W3AA 4JSTA 1AQYA 1T5LA 2VHJA 4A8JA 1T5IA 4U7DA 2A30A 4WZ6A 2ZU6A 3DKPA 4EPXA 3MG9A 5BYKA 1IHUA 2VH5R 1E0KA 3Q9LA 1GFIA 1W0KD 4OI0A 4BFXA 1IN7A 3THYB 5EZ6B 5KO2A 3SQXA 3EZ6A 3K0AB 5EP3A 5C46F 5CLLA 1G21E 4RFVA 4OK3A 1SXJB 1TQ6A 4WXPA 1AZTA 3A58B 1JXOA 1VECA 2YC2C 3GLIB 1XTQA 3BBPA 3KQHA 1OH7A 1JAHA 5IK2D 3THOA 1SVMA 2LKCA 1DG3A 1S96A 3TMKA 1GRQA 2ZRNA 3H2YA 4LY6A 5CJPA 4DKXA 1Z29A 1COWD 3CRVA 3LV8A 3LA6A 4MITA 3LVQE 3L0PA 3ADKA 1FTNA 4XD7D 4HLDA 2OV2A 4W5HA 4ZPXA 2OFXA 2XNSA 2ZEJA 1W1WA 5FL7A 3I61A 3N70A 2QRZA 5HKKA 5FTLA 2ZU0C 4N3NA 5KDDA 1ZINA 2BWJA 1XTSA 3KDSE 2ZRLA 4MRNA 4M1SA 1AM4D 2ECKA 4BLPA 4Q9KA 2ZI5A 5F98A 5DHFA 1IJEA 2JGNA 4KV9A 2XJ4A 5SZIA 3AGPA 3CH4B 2PL3A 1JQLB 1VYTA 5EUQB 2MSEB 1K6MA 3IKJA 2WJHA 4KBFA 4A2WA 2CCKA 1RRFA 3PITA 4QM7A 4PSKA 3F5FA 4DUGA 2P65A 4HLUC 3PJRA 1GILA 1K5GA 3SYKA 4M1KA 4C0AC 5KSOA 2P6RA 1G7CA 2IYWA 4PC7A 1MOZA 4P0TA 1WP9A 1HQYE 1GL6A 1KDTA 4A9AA 1SXJD 5J47A 2FU5C 4PO9A 4C0BA 4V03A 1OYYA 4MRPA 2BM0A 5FTNA 4PC3A 1F2TB 4IHQA 2PT7A 3IPXA 1R0YA 1D2NA 3IEVA 3NHAA 5L3QA 3GLFE 2ZRCA 1B23P 4IXNA 2CL0X 3RS0A 4OQMA 1E1RA 2ZS7A 4WA7A 1C4OA 1R5OA 1TF7A 2IS4A 2IYTA 2QBYA 3SHWA 2CL6X 1FP7A 4G01B 1W5SA 4KAXA 4TQAA 2ZRJA 4FMCF 1WQ1R 1KI7A 1TUEA 1R7RA 2WWHA 3REFA 2LWIA 2OO7A 2ZI7A 1Q1QA 4B3FX 4IOLA 2JDIA 1W36D 1VIAA 3THWA 2VQSA 2HCBA 4CEJA 1W4BA 4TYWA 4H1UA 1D2MA 1N2CE 1SVLA 4PANA 3GLGA 3B1WA 2OE2A 1XJQA
chains in the Genus database with same CATH superfamily
5AHWA 3L04A 5LXTF 1I3NA 1T91A 1QLHA 3AMVA 2E9SA 4ZHQB 2BYTA 1KI6A 4XZ3A 6CHYA 1ISGA 2BMAA 4EYQA 3BJIC 3GO4A 3N7TA 4ZICA 3QU7A 1W0CA 1CHDA 1E2HA 3HRHA 3PGLA 4LHVA 2HRCA 3F96A 1GQSA 1OV4A 2VDUE 1ZL2A 2PJZA 4KRYA 1MG0A 3HMKA 4PLZA 5AXAA 2KX7A 5I9LA 4AU1A 2ANCA 4JLKA 4NNJA 2WMDA 2EATA 4FBMA 3SMQA 3N07A 4E5MA 1L5HA 5DX0A 3M82A 2OQIA 1Q7CA 3QXXA 4Y2JA 4FHFA 4YXWD 5JNTA 1FY2A 3JQGB 3LVBA 3VH4A 3MRTA 3HJNA 1F48A 4RVGA 2CXXA 3EX7C 1XWIA 1E1KA 3HKDB 3K0CC 1FTGA 4URWR 3SJAA 4M8NE 2WD7B 4JB3A 3V33A 3UMFA 2UZAA 4Q1CA 1NV9A 4BKUA 4LZPA 2G5CA 1BD3A 1E98A 4KPUB 1QV6A 1W5FA 3TLAA 4TL9A 1XAJA 3DBVO 4RWZA 3B2EA 4YA6A 5CXXA 4D9MA 4DIDA 1MO6A 1T9KA 3NAGA 4IIEA 3SI7A 1QB7A 1LH0A 4R1PA 5JSYA 2QSJA 3PWZA 1FTSA 1C1DB 2IYZA 3CT6A 1ORWA 1TEHA 3D5QA 4I4TF 4LNAA 2I5PO 1IWOA 2NU6A 4MRAA 3L6UA 3U26A 1J8YF 1MENA 4Y30A 4C7KA 4Q66C 1UPUA 1I2AA 4MQLA 4GQAA 4TLAA 2O8DA 4NC9A 2VSYA 2FPLA 1RKVA 4ER3A 4Q01A 2CDRA 3KUUA 3C3KA 4FB4A 3TJZA 3JYHA 3PFKA 1QP8A 4M2LA 5HJ5A 2EF1A 2MR5A 2XYRA 3B60A 1LTKA 4NIMA 4BV2A 5B3KA 4ZD6A 5E9QA 3VJRA 1FCJA 4QUJA 1EE2A 2QV0A 3V6LA 4D8WA 1RWKA 2JIZA 2BHLA 3JZFA 3CVJA 3VBEA 3MJDA 4I3FA 1P7ZA 8OHMA 5AKEA 1A0OA 5IDVA 1ABFA 4JDPA 4RY2A 1F8FA 1OW3B 3P2JA 3CUTA 4ID9A 2X9GA 3IEMA 4WBNB 1ADFA 4H6XA 4V1CB 3S0JA 3V55A 4IO1A 5HMMA 2RHGB 3PHCA 1PD1A 1AVTA 2ZI3A 4JT8A 4FGUA 4TV8B 1E2LA 2C9MA 3FDZB 4MI1A 2WB4A 4GQBA 1LRLA 1O08A 1AQ6A 1OV6A 3FWPA 3LY9A 3M1AA 2RSLA 3MRVA 2K87A 4NCNA 4JUCA 4F71A 1T2UA 3I92A 2PUCA 2E1RA 2O3QA 3AFNA 5A4MS 1X8LA 2IYLD 1SUPA 3IEUA 1AC5A 1XEFA 4IIJB 4Q1AA 2GARA 1CUSA 5KVAA 3L7IA 1V45E 4D6XA 3WGTA 5AH0A 3DXYA 5F76A 3BICA 3IVCA 2RGWA 2EARA 3MRSA 2O50A 5B4VA 3GYGA 3OOJA 3THWB 2VTBA 1QVWA 2EJCA 3ZR4B 5JSQA 1Z5GA 2DM6A 3DJYA 3DD5A 1SO8A 4DMRA 2IBTA 1SEPA 4GICA 1MUUA 1QG6A 1SVWA 2J6BA 2AWNA 2D2FA 4RVOA 2ZITA 4KPEC 3I1YA 1GYQA 3QFFA 3IBTA 4YHBA 2OM6A 1LD3A 4IF4A 5HZKA 5IM4F 4L4RA 3MQ2A 4QRHA 2GFHA 1QYIA 1L7VC 3EEQA 3L06A 5FWXB 4NHEA 3ZWKA 1GDDA 3CU5A 1GN8A 1T0UA 2VBGA 1S7CA 2QLLA 2WIGA 2YHIB 3GRFA 3H3FA 4G0OA 1WX1A 1CSEE 4XGNA 2J48A 4XM2A 4RJIA 2RCYA 3GV0A 3BILA 4EG6A 1KQPA 3THSA 3VX4A 3OLXA 2GXAA 3S70A 1ID8A 4XI9A 2AQHA 4D3ZA 1I7DA 2C7PA 1P1HA 2FUKA 4XJTA 4JK3A 5AI9A 2LW7A 3T41A 4QULA 4X1KB 4B84A 2VPZA 3SICE 2AE1A 2D2VA 3FY4A 4M9QA 4RK4A 1TEVA 1CU1A 2ODTX 3AONB 4TQGA 3VR3D 4UUOA 2D1QA 2P2ZA 4N5LA 1CNEA 1GNRA 1L5MA 2R3SA 1A9ZA 3CW9A 3H9GA 1H69A 1R8XA 4M36A 2GBGA 3P20A 4OUDA 3SDZA 2Y92A 3K2IA 3OQHA 3KJIA 2WHYA 1V5WA 2BM8A 3KPVA 4R2JA 2VRWA 5BNTA 1TCVA 2MJLA 3AUFA 3QUTA 2IF0A 1YWGO 2ZIGA 3LPDA 1QNLA 3LUPA 1L3IA 4KBGA 3IMCA 3TZBA 5A9SB 2CXPA 5ERYA 3KWFA 2WSYB 1FLDA 2WJVA 2QXYA 3PRYA 5IWCA 4YCNA 2PKWA 6NULA 1GLGA 4CLHA 4AC9A 5M29A 3OJLA 5GM2A 2VJPA 3N1UA 1EFLA 1YR6A 3PNBA 1P17A 1RR6A 1EWRA 1UM8A 4GX5A 1SQSA 2JGMA 3KQLA 1HYHA 2G9UA 5HKBA 1WCXA 1DELA 2WZQA 4ML3A 4UW9A 2FPPA 5J4VA 1ZOLA 5AKGA 1OF1A 4Z0HO 3L0DA 4W1QA 3TLEA 5CFRA 3IPAA 2FWBA 1W6RA 2JG3A 4QYWA 2XZDA 2DECA 4QFBA 5DHPA 2IDZA 2TRSB 4R71A 4YMSA 4NCXA 5E2AA 4NQRA 3ZU4A 2WWYA 3CR3C 3TEJA 2PL9A 5HZMA 1A5TA 2CD9A 4PN7A 3P7MA 1T9HA 2UZ3A 4OSEA 1KNXA 3QVJA 1X15A 2WJAA 3MTIA 3PNPA 4HAZA 4RESA 2O1EA 3RK0A 1TA9A 1U8AA 3E1GA 1XXLA 3QENA 2R85A 2H29A 3M70A 4FR0A 4ZDWA 3ZLBA 4ESEA 1SG6A 2GUGA 2HBZA 1F5SA 4O4HF 5T7BA 1I80A 4TMZA 2YXLA 1GD1O 2JFQA 1ORTA 3BL5A 3KFXA 3LCMA 5ETJA 5SICE 1TJ5A 1O8BA 4F45A 2BFDB 3KVVA 2B8JA 5B1HA 3A6LA 2AMJA 3MWEA 4E2FA 1JW9B 5FPHA 4BLSA 1BEEA 3VR5D 4WSOA 1YA8A 3TVDA 2XVAA 2QD1A 3QX8A 4CUJA 1KU6A 2WU4A 4FWBA 4II2A 5ES3A 1VIDA 3FVTA 2XQFA 1FRVA 1R0SA 4E08A 3IIIA 4NBUA 3C15C 3UOWA 3UWOA 4JR2A 2V58A 1N0WA 4PC1A 3CUYA 4DMKA 2L82A 4ZT3A 4ZJZA 2K5UA 3TSZA 2ODQA 1YKSA 2H51A 4RTNA 5LDGA 3VC7A 2EWVA 4NOMA 1MPTA 4FONA 2O52A 1KI2A 2HEIA 3IQIX 5AHOA 4ZPJA 5CA1A 1G9TA 1O1YA 3FMGA 3GCWA 4UXJA 1SN7A 1XZIA 2HWUA 4NOJA 5IHXA 1I4DD 3A3OA 3OMXA 4LJKA 4ARIA 1FJ2A 2IEDA 4HVTA 1L7BA 5TPWA 3IRVA 4YGYA 3DP7A 1KYYA 5IG2A 2QN3A 1AY0A 5AJZA 3S40A 4C01A 4ZAGA 3NP9A 4A15A 2H1FA 4DV5B 1R15A 1M3SA 4QDZA 1E2FA 4NZPA 1B0PA 1T8YA 1WBJB 1YO6A 1Y9AA 2IOFK 2RHWA 2R5NA 2VPIA 3KU4A 3CRMA 2B0JA 4DCTA 2ZFUA 1I0LA 1KAEA 1THZA 5G3YA 4C22A 1J2UA 2J4FA 1YS4A 3DDHA 3CZ9A 5TPWB 3OJOA 3BL6A 3JARA 2EBWA 2EGGA 3HN6A 1NX9A 1PL0A 1Z6TA 4FYVA 4HFNA 2YYSA 4PNEA 3CX6A 4DMFA 4AN4A 1V3VA 3PB3A 5EZYB 5GIPE 2ZE7A 2WUFA 3Q1LA 3ZV7A 3O0TA 1LTHR 1RMTA 4X7BA 1XJ0A 3T95A 4EPRA 1Y7IA 1CBUA 2VYVD 2ATXA 3GJ5A 3OQNA 3FJ1A 3OEHA 5C3UA 4EHNA 1FFAA 3DVSX 4HX2A 4PTYA 3SX4A 5ALXA 3QF4A 2GZ1A 3W1VA 4Z6KA 3C3JA 2DJ5A 1T34A 2PBRA 4PHHA 3RQSA 1JWBB 2BLLA 3ZN2A 3PUIA 3PQ7A 3NJ8A 2AR9A 3I42A 4HDSB 4IV0A 4KIFA 1A69A 4TSFA 2AA3A 1NGSA 1C30A 4JLJA 4YUZA 2QZJA 1W34A 1BS1A 2P5YA 2XUHA 3AC0A 4BKOA 2O8CA 5FX2A 2AOXA 1U9IC 1UH5A 1BU8A 2D2XA 1DU4A 3EOBI 3KV3O 4URUR 2AI1A 5EWJB 4CF7A 5IF3A 3DMPA 4OHRA 2AR7A 5IABA 2C0CA 4MA5A 3B2QA 4UBLA 4LWOA 1DBVO 4F4DA 1Y4UA 5TPZD 3QLVC 2R47A 4GMDA 2VP4A 1TCCA 3S27A 2ZPAA 2GOYA 4JQSA 2B6NA 1D3AA 3JD0A 3P9XA 1JH8A 3QKTA 4N3GA 4QNRA 4CLXA 4PLVA 4BP1A 2ZWPA 3RC9A 4BVGA 5L3SA 2GESA 1YDHA 5IXYA 3S8EA 4KI0A 2C7OA 4AZWA 1XZGA 2D0OB 2YWJA 2P9ZA 1HT2E 5ADHA 2O19A 1QMGA 2YYYA 1U3TA 1YJQA 4GC5A 3Q8MA 5IN4A 1EZ1A 1EMDA 5G4KA 2M2IA 4PLFA 2G9NA 2OO3A 2CNWA 5B64A 5J63A 3R9XA 1V4NA 1PJCA 3ZIUA 821PA 4DR7B 4MUYA 1JKMA 2WFLB 4Q3BA 2A4MA 4IPTA 2OXEA 3KNZA 2R1TA 1TMGE 3DT8A 4J0KA 4KHPB 3QYJA 4G24A 4TMTA 4YMUA 5JD3A 4IUCS 4EG8A 2ZAYA 4ZCSA 1XXHB 4Y7DA 3CUWA 4RK0A 3O82A 2NM0A 5DWVA 3PD0A 1A98A 3O4FA 1ZONA 1W35A 1R50A 3H1BA 5I9NA 4OHFA 1NUSA 1D1PA 3EGDB 2QY6A 3GEDA 1EFVB 3QPWA 5KCZA 1E60A 3Q72A 3I5MA 1SXIA 1KVQA 3WP1B 2FFHA 1LC3A 4J4BA 4MYCA 3C3MA 2ILTA 1NXQA 4CF3A 2EFGA 2MYUA 5LZ2A 1VL5A 3V9PA 2RHOA 3D8HA 3AH8A 3LDGA 5FUWA 3HCWA 2CKDA 3IE2A 4MULA 2BISA 5LA6A 4DLXA 1L5NA 2AXNA 4WBXC 1HNZB 3IMKA 4LGYA 1JLMA 1QHNA 2EJUA 2E21A 1BD4A 5EKSA 4BNTA 4UNIA 1BWRA 4YEDA 4TS3A 1NVEA 1FP4A 2PUVA 3CV3A 3F67A 3FLBA 3PQ2A 3PFWO 3QVUA 1OAAA 3ZZTA 1XI2A 4HK4A 4WLUA 5JZ9A 5DNVA 1QR2A 2WIJA 3P9KA 5AKJA 5FI0B 5GMOA 4DCSA 3AP2A 4KVGA 4ZA2A 5EUCA 5EY5B 1T25A 3ZTYA 3RRJA 4ALJA 4FI3F 5B36A 1CR2A 3BYZA 4HLQB 4N01A 4C30A 3EVTA 4Y0VA 5LFAA 3I45A 2AF4C 4JBGA 2DLCX 4B1FA 5AVXA 1VL2A 4KDCA 1GPMA 5IRCD 1YGYA 4ZANA 1OXUA 5HKLA 2DZDA 2AZTA 2OAP1 2XQGA 3K9WA 3RABA 1U6JA 3ZHTA 5KVCA 2DB3A 3OLQA 1WQ4A 4MA0A 3B13B 4X8MA 4Y98A 4LF6B 4M9XA 2O54A 2HU5A 4I5IA 1TVCA 3EXAA 1EZ4A 1TXGA 2IZ7A 4Z4CA 4BWYA 4F6LA 2R8YA 2WR8A 4O4IB 3A4LA 5TQ2A 5PNTA 3FTNA 4BMVA 4RU1A 4I1IA 3EMBA 3SC6A 3SLGA 4LEIA 4E32A 2R4TA 2UXBB 3GJ0A 2BZSA 3C8MA 3I09A 3OQIB 4L76A 2FN4A 3WY9A 5KYKA 2QTTA 2ACWA 2X7HA 4KVAA 3TKLA 1GU0A 2OEPA 1F2UA 4NHOA 1NVMB 2P3SA 1M2HA 2YWGA 3C6BA 3LLVA 3NGLA 4H0CA 4YJ2F 3BAZA 5F64A 3J7AC 3E82A 2YZ2A 3AU8A 4BNHA 3GLKA 4L8WB 1UK7A 4NYJQ 4KW7A 1ZIYA 2BHRA 3AOEA 1D0IA 3GVCA 3PFNA 3CLKA 4QKQA 1JIVA 3I76A 3O4RA 4OJMX 2Q5EA 2AMFA 3QBTA 1XK7A 3T7RA 1GM5A 1R12A 3PEWA 1MP0A 2DWPA 2OPHA 4RQAA 1FFDA 4KLRA 2JBHA 3GT7A 2REOA 4H17A 5CT9A 1JU4A 4EF6A 4BLOA 4YAGA 3KTDA 1VXOA 4F85A 3E35A 4OYLA 1RYHA 3QWAA 3EQ6A 5JZMA 1W29A 1MO5A 5HIAA 2DSTA 2R1UA 3GWGA 2Z8YM 2VQ3A 4AJ4A 4FHGA 2XECA 5JXHA 2FZEA 1CY2A 4FHCA 3K6SB 2R8PA 1F8GA 4DABA 4HEQA 2VK2A 4ZCMA 1Z4IA 3ZXSA 4F38A 4QL3A 4HY3A 1PHPA 4NABA 1N7JA 5JVDB 2VRCD 4MR9A 3RRFA 3BFKA 2PQ6A 4ZYXA 2YS7A 5C52B 1NQAO 1GUZA 4DRXA 1W46A 1B8VA 3FLMA 2XT0A 1H6AA 5CCEA 3WQSB 3OG9A 1QGYA 3RYIB 2J7KA 2WV7A 1KK0A 2B8TA 1YQUA 3A31A 3C8ZA 4M1YA 3LD9A 1ZM9A 4P4LA 3QY9A 5FWDA 2PH7A 3WK9A 3DV0A 3WG9A 3OT5A 3G79A 1KE2A 2B21A 1NBIA 5JAUA 2UU9B 3M8KA 4NEHB 2EP5A 3T15A 5LYJF 1U0OC 4ZI3A 1PT5A 3OIUA 3S29A 1QH8A 3R3VA 1F0KA 4XVHA 3GLGE 4ZVSA 1WXHA 3PEUA 4MQ6A 2HRQA 1U3FA 2VDJA 1M10A 4M6WB 1DE0A 2CC2A 1CDDA 4WH0A 2G1KA 4OH7A 2OQVA 4Y67A 3JD1A 4PIVA 5J2TA 2OV3A 4N7RA 2Y0BA 5F73A 3N8KA 4DLZA 4HDRA 2GEFA 3VPDA 2H4XA 2GD0A 3ZNPA 2ZZMA 1VE3A 2B7BA 5EWMB 4NBRA 3NYRA 2FKNA 2OHIA 2WU0A 3AEUA 1KYQA 2C03A 4I55F 1ODFA 1E3SA 1U2GC 3IBSA 2FW0A 2M1XA 3ET5A 1X3SA 5DT9A 3UYKA 2XXBA 1XPOA 1J0EA 1H9BA 3BGIA 5E1MA 5IP5A 5I7OA 1L1EA 4GI5A 1G4AE 4RHYA 5AVWA 1EUQA 3ZDFA 1WOYA 2Q1XA 2QD3A 2QTAA 3RSHA 3V8RA 1ID1A 1J8FA 1R9MA 3IQXA 3ZZMA 4DPLA 1S1CA 1MB9A 4YUWA 2I1QA 5AIBA 5K7SA 2GF0A 3VDXA 4F2PA 3EDMA 5T6BA 4YT4A 2VAVA 3ABOB 1Y3AA 2D59A 2M1ZA 2OXCA 2W2VA 2WP8J 3N0TA 4I8XA 4JBWA 4D79A 4CIYA 1U2QA 3Q0EA 1SBCA 5KQSA 3K9QO 5J59A 2YVLA 3LCVB 4WXRA 1BMDA 1YONA 1Q14A 4PAOA 5IUKC 3UCFA 4MS4B 3T06B 3WGJA 5EL0A 1HLGA 4C7MA 4D3SA 1IY9A 4DNPA 4DQXA 5FV4A 3NJRA 4IDGA 2QNIA 4YMTA 1M73E 1CIJA 1Y8AA 4ARVA 2BFBA 2CUTA 4F4HA 1GUBA 3HWRA 3TNDA 5BW4A 2WTUA 4RJJA 1XAIA 4HH0A 2ZXFA 2BEJA 4TMWA 3U3RA 2F9MA 3Q8LA 1X13A 3M6MD 1Y34E 1DI0A 5EIXA 5JXGA 5JTTA 1LXCA 3NVAA 5JT1A 3OO0A 4ER7A 3P2EA 3EZ2A 4YI3A 2F90A 1DDOA 3D6JA 4EG3A 5B5SA 1Z2OX 4JAVC 3TRKA 4RQBA 4AY5A 3NO4A 1KFEB 4HZUA 4X8OA 4LBVA 1VCNA 1HEUA 4MUHA 3SIXA 3WLMA 5JNVA 1DIGA 5KJCA 3J81A 4LXTA 4RGQA 4XGQA 2P9QA 4LV5B 4R8RA 4YLGA 3OM9A 1MX9A 3IALA 3I6BA 3AL2A 3OIDA 3DFMA 4GM0A 3GPIA 1EUDA 3AI7A 4HDKA 4S24A 3LP6A 1ZCJA 2QJFA 5H59A 4BX8A 2WD9A 5JMOA 2EJBA 2ZIUB 3AKCA 1IVNA 2G1JA 4C89A 3S81A 2PU7A 2GEUA 5HFJA 3HJFA 2ZYIA 1RRMA 2WKWA 3NYIA 4HB3A 1KO1A 1KQ3A 3SWWA 3TOVA 2NP7A 2DX7A 3NDPA 1BGWA 1G2OA 3MGBA 3PQFA 4YJKA 1USGA 1ZD1A 3G5UA 1DKUA 4CR7A 4AYWA 4B8WA 5EE5B 4BNDB 1GKYA 3CVVA 2OMEA 3FUWA 1AUVA 5CYGA 1MHPA 1PR4A 3GHYA 2EC5A 1QO0D 2EWWA 1GNPA 3HVUA 4M99A 1TJPB 4YS6A 3RVDA 5BSGA 2A1TR 4G86A 1AHPA 3FPGA 4M0FA 1E18A 4PO8A 2D5AA 5THQA 2B69A 3CLUD 3MWDA 3W0LB 4DG8A 1KEEA 1GHTA 4EGSA 4OOFA 1CUIA 2QD4A 3BS4A 3AIKA 3JATA 1UIMA 1XTRA 4H7FA 1T9BA 3E81A 4MPTA 4MYSA 1NF2A 4LV6A 1AO3A 5F5XA 3VU9A 3UB4A 4A26A 2LBPA 5KDLA 1ZXLA 2C7BA 5B3JC 2QQEA 5JW6A 3G9TA 2EHDA 4GOMD 4RTKA 1NVFA 3KOOA 3C39A 1ZVQA 3AKDA 3JWHA 1KMHA 2ZROA 3N2IA 3I1FA 3BD6A 1WULS 1S1MA 3WJ2A 4GGPA 1DCKA 1QO9A 2QM0A 3Q6MA 2WF8A 4WXHA 3RFVA 4LJ9A 4AK9A 1MX1A 2VXOA 5ITSA 1R74A 3JYOA 4PQFA 2H3EA 1N4AA 4DGQA 1XZQA 1UBGA 4PS0A 3CRQA 2A94A 2SCUB 1XWWA 3LE8A 1KJ8A 4WQMA 2CVZA 2OOKA 1YULA 2W2KB 2QTVA 2YIVX 1NXSA 4B83A 2QHXA 3GDOA 3WB9A 5KKNB 1ZSNA 4QG7A 1CRPA 1KY4A 4TLDA 2H1VA 3VR3A 2VUSA 2ZBVA 5JDCC 5BNFA 5IULC 1CRZA 2YWRA 3CFYA 3TR0A 4D41A 3SLRA 1Q15A 2XWSA 4MP3A 3GJYA 4LPKA 1G20A 1G291 3OOSA 3QBVA 4B2YA 1BMQA 3H5IA 1LK5A 2W42A 1AUQA 4KN8A 1TM2A 4QOJA 3F6EX 1RYMA 1H65A 2EOAA 1PBNA 2CDAA 3I72A 4Y2XA 3SEZA 4B6RA 4MW0A 4Y6QA 3TD9A 2QB5A 2CXTA 3C3CA 2ADOA 3DBRB 4E4RA 4M1QA 1WNTA 2RAUA 3DR3A 5KNDD 4BMCA 4P92A 4EO9A 2D1FA 4CV2A 1G5RA 2PMDA 4FNGA 3H19A 4O5AA 3GGGA 1KAHA 4Q15A 4L8LA 3R76A 3NGXA 3VYWA 4D4GA 1J2EA 1MG5A 1BCRA 1ZJ6A 3GB9A 4EFNA 2IUUA 2PLWA 4B3TB 1JYEA 5DGTA 4IMRA 3I9JA 2FMHA 2QR2A 3MD0A 4JT2A 3MCWA 4DXDA 1XZFA 1SU6A 3VYVA 4DYVA 5DCWA 3RKUA 4EL0A 3RVOA 2BUBA 1ADJA 3NHJA 1B0UA 2R7KA 1A5SB 2XT6A 4LDAA 3ROXA 3DTNA 4IICA 2P3LA 3F5DA 4W99A 1ZW6A 5EXXA 3G8BA 5IM4A 3ASZA 3QLUA 3KYJB 3LCCA 3WJ1A 3E2IA 1GEGA 1USWA 3DEIA 4GO1A 3UY4A 1VHWA 1I1QB 2VP3A 3Q0TA 1GFWA 3KHSA 4INPA 1UKBA 2X9VA 4J1TC 3L7AA 4IJUA 5HX7A 5AD1A 2EERA 4MHOA 4QJ5A 3MILA 4HXFB 2DUMA 1U2RA 1U0TA 1T3SA 2PFKA 2BE7A 3EVBA 4J1SA 3RREA 4DCOA 5I5EA 5SZKB 3QXCA 4BV9A 1XV5A 3QKWA 1U9ZA 1WE2A 3U19A 4JJZA 1G5HA 2ANBA 3PC7A 4QBKA 1S9DA 4EMUA 1MB2A 4BUJA 4DLWA 4ZDKA 4C87A 1T9GR 3EPPA 3GRAA 2GAAA 2WU3A 4U02A 4IVRA 2X5JO 3MMPA 3WRYA 2Z2JA 1HQDA 3BGSA 3UFXA 4EHJA 2GCOA 4J3JA 3F7MA 5LZ5A 1I01A 3U7HB 3F7OA 1D8TA 1Y8CA 3K5HA 4J2TA 3Q5GA 4PYQA 3CH6A 5SZJA 5T3YA 3STTA 3T54A 2CJYA 4YUVA 4YJHA 3RIHA 3ENKA 3NS7A 1ZNQO 2B7LA 5HJ7A 2PKYX 2JF0A 3UQYS 3I23A 5DNDA 4W1RA 3NVKI 1PU2A 1T9ZA 2PD3A 5DF1A 2DHEA 1G1AA 2IDJA 3A6FA 1NVVR 3L7NA 1FMJA 1Z6XA 3RT9A 5AVVA 1NBHA 3BIOA 4IX9A 4NFYA 2B8WA 2H4YA 3E5RA 2IZ1A 2HK9A 1GCUA 2HFJA 4KAJA 2W8BB 3QEJA 5EFZA 4OF4A 3R7LA 3T3GA 4E5UA 5JU6A 1XF1A 4FFBA 2HSWA 2HUNA 4W1SA 3SYLA 3TW6A 1Z5OA 5CPBA 1C7RA 1RWBA 5FL7D 4EFLA 3DE4X 3FTPA 1OCEA 4BN0A 1V2HE 4A2CA 5AVTA 3DNFA 4UZEA 5F3RA 4BECA 3U7RA 3IL2A 3ZE6A 3T1TA 3TTYA 4G5HA 2FDXA 3HADA 1LKZA 2XCRB 2C4HA 1R6XA 2EIHA 3LWDA 2CLEB 2FEXA 2ZWOA 4PYNA 1IH8A 5JCOA 5DYIA 2PBLA 3TIFA 2AOTA 2IOYA 4ZI7B 4DIUA 1E0SA 4IVQA 3ANXA 4QQRA 5CJ2A 4CEJB 3E2MA 4AM8A 3C6ZA 3RVLA 2W6PA 1MAAA 3GJRA 1KZHA 3RIGA 2IH2A 3KPYA 4MW2A 1QAQA 3IJPA 3W6ZA 3U4QB 2FE1A 2BDEA 3LAWA 4ZEMA 3HCAA 3VDRA 1BA3A 4D4KA 2A1UB 4DA8A 4J7XA 1XRQA 4A2PA 5IUJC 2QZ9A 1BQ3A 5FNVF 4B43A 4TTAA 3S2ZA 2TS1A 1NP7A 1TK9A 4C4OA 5LMUB 3EXFB 1PJ2A 3AZOA 5EKTA 3GJ7A 1Y6QA 3B1YA 3LBAA 3HPQA 3P5BA 4ZV7A 5ELXA 4YV0A 1VRWA 3OECA 5FJJA 1R9JA 5B7NA 4FXPA 5I48A 1Z4QA 2RGXA 2EKQA 3VR1A 4ZRMA 3C87A 3JQ7A 3LO5A 1GNQA 4HI0E 3G1TA 1SVNA 1T1GA 3BK7A 3HYNA 4W8OA 2FEAA 4GOJA 1BKDR 2BEVA 4O63O 5A2QA 1Y5RA 4RMIA 3GMSA 2R1VA 1RM5A 2YWCA 4S0XA 4E5NA 3IVGA 2AYZA 5HTOA 3GP8A 2Y0DA 3FG9A 4K87A 3E3MA 4BB9A 4OP1A 2VDMB 4IJQA 5H9VA 5IHPA 3A6PC 4P3PA 4JUFA 1HPLA 2VBCA 1YS6A 5B4UA 1SKYE 1XEXB 3OP4A 2TYSB 4B8YA 4UHHA 5LQSA 2AZXA 1N1GA 1KQNA 3ODPA 2XVMA 3JALB 2G5PA 1DX6A 3GGSA 2ZB3A 3GLHE 2A67A 3HYRA 4EHKA 1V6CA 2FMIA 4JP1A 3MGGA 2C1XA 3L79A 5FWYA 1YQ9A 3BVPA 4K9QA 3QYFA 2NU8A 1SRQA 4N4AA 4FI3C 1MEOA 3RPEA 5KNBA 4A10A 3STUA 3JAWB 5DSTA 4JY7A 1L4BA 1JRLA 4MUIA 2YWEA 1Q7GA 3BCRA 4UJ5A 5FPSA 5CB4F 3L82B 2O8EB 1WB4A 5IDWA 5BN4A 3TE6A 2FWJA 2WILA 3KVYA 1NJ2A 1ZI8A 2IOQA 4PZCA 1KJIA 1JLKA 4O6VA 3RC7A 5C2JB 3W8DA 1PG2A 1RZRA 2WV9A 3GUUA 2O3TA 2P7IA 1CC1S 4DQUA 2MDTA 1XEAA 3HG7A 1P4SA 1K4MA 3GUZA 1GSOA 4JVMA 4N0EA 3X1MA 2PX5A 2XMBA 5IFLA 2IHYA 2CHEA 3L1VA 2AOWA 1F51E 4LGCA 1GG9A 2P79A 3GAMA 4LV8B 3T1QA 1M1YE 4BNMA 3Q85A 3EA4A 4M86A 4NESA 4KOEC 3R8XA 4BIMA 4E5DA 1UJ4A 3AK4A 5JLAA 3OM1A 3DZHA 2NUAA 2PYDA 3U7IA 3EIXA 5DVZA 3UH0A 4YJGA 3AI1A 4EG5A 4OHKA 4RVSA 4XPZA 1MVLA 2QL5A 3KB6A 4QASA 5DYTA 4F4CA 4QATA 1ZYUA 3E23A 2Y66A 1Q3TA 3Q8WA 4GEKA 4YRDA 3OZEA 7REQB 2QGNA 4RZUA 4CIXA 5IU6A 2MU1A 4Q4JA 3BRSA 4G5FA 2V7TA 3QH4A 1Z37A 2H5IA 3PG5A 3C0KA 4ZDJA 4MLCA 2B4QA 4WVFA 1DINA 3T4UA 2XRYA 2PUJA 3LH5A 4R98A 5LBUA 2K7FA 5DM2A 1AS2A 1XE3A 4GPZA 1CUDA 1A95A 1J23A 3BF7A 3RFXA 1H66A 3MT9A 3FGNA 4XCXA 3K9HA 4BCDA 1GGJA 1H2BA 4D5GA 3DNPA 1E9VA 1LJ8A 1ZO8A 4S0ZA 3HB7A 2IXGA 3DQPA 3EF3A 1T29A 2WHPA 3LUAA 4NBKA 4DWWA 1JQKA 5C7IO 3ND6A 4OG2A 1JFTA 4ZGGA 1YF3A 3N2EA 5AQ1A 2YMLA 2WFAA 1AKVA 2AFHA 1YVUA 2CLOB 2QAGA 2WT4A 2G63A 3FNQA 2AFIA 1XT6A 1YTUA 7AT1A 4FHZA 3N39C 4BB6A 4PLCA 1C7ZA 2I6XA 1ZR2A 3FPKA 1H22A 3K73O 3COZA 2CN1A 4G67A 4Q5IA 2ZUSA 1L3CA 2BONA 2F2TA 1GTZA 2FZWA 3FMVA 4BLVA 4KWIA 2FQWA 4R2WA 1A88A 4TMYA 4ETIA 1L7MA 1ZM2A 5TV2A 3F5QA 5MFPA 3NHLA 4CFSA 4KR2A 3EISA 5M7EA 3CLTC 3M1YA 1NBOA 2G9ZA 2J3QA 1DS6A 2R68A 3FZYA 4CKEA 4LTNA 1NT2A 3SSAA 2PRZA 1ZSYA 2I6UA 1QQAA 1YB6A 4TWBA 1YOBA 1NONA 1XO1A 2UZIR 3EPHA 3ZBTA 1Y5NA 4LY3A 2IH4A 1OTXA 1KYIA 2CUNA 3MCZA 2N1BA 1Z3IX 2XPCA 4GBJA 1JEAA 3H87A 4O33A 1KARA 4QPCA 4DWOA 4LMPA 1MORA 1S4MA 2B5VA 2JFPA 3HR4A 3OU7A 3ZXIA 2QVCA 1UPAA 3GT4A 1IJFA 1E2JA 5F78A 1KI3A 2WVJA 2IDKA 3ZIAD 1NMYA 2X58A 1UAYA 3HJBA 5AKYA 3RLIA 4OHMA 3AB8A 4RDCA 5JBNA 4V3BA 1HH4A 2J45A 4ZVRA 1EG7A 2FZ5A 5CXSA 5BURA 1QZXA 1K7YA 3HE3A 4C0LA 1IBKB 3N2KB 3HY4A 4TQUS 4IAOA 2LR0A 2P4HX 4IGAA 5AW7A 1U7DA 5EEHA 1VIMA 2F1KA 4NMWA 5DO9A 5JROA 1CR0A 2O2ZA 3FBTA 1ZD8A 2IE0A 2ODNA 4L9WA 1ZH6A 4KJZA 1SB8A 1L6RA 3N74A 5CTJA 3DCIA 3GD5A 1YGPA 2HV9A 2JFVA 2QDXA 4HWKA 4LJRA 3R9WA 1GQ2A 3MLEA 3NM5A 4CMIA 1JU9A 2XNCA 4GX1A 1R2QA 2Q21A 3OC0A 4KVZA 4PCUA 4DLPA 3HBFA 3A3YA 2ZRDA 2J46A 4JWKA 3UFBA 4X45A 4WKCA 3DXZA 4NVRA 3WP0A 2NQ2C 3W9UA 4WKNA 2RG1A 4C7XA 5LM3A 1MIOA 2R62A 3GA0A 1H3NA 3T1NA 4YJ2A 4ZTUB 2AXQA 2XKJE 4D43A 1FNCA 2DH5A 4UTPA 2GAJA 2OMKA 4UM9B 5BORA 1WHTB 2Z0MA 4QDUA 1M33A 2Z09A 4LTMA 1CJBA 1NZFA 3TUZC 2HQBA 3ZK8A 1KKUA 2CK3D 5DI3A 5H82A 5KYWA 4C7OB 3HLKA 1A7JA 4NLLA 3HDQA 3NPMA 1OXVA 1NLZA 2ZKLA 4NECA 4QQKA 2NZJA 3E48A 1XSEA 2CT8A 1E7SA 1TZBA 2HNBA 4KE7A 2GQ0A 4DEVA 2OC4A 3UJBA 4K5QA 4UNRA 4UQLA 4L2IB 2P27A 5HFAA 1QYCA 4CQMB 4JP5A 2YWDA 4HDCA 1B73A 1W0KA 2F3RA 2IZ6A 2N0SA 2OSBA 3DAGA 1XA0A 4GKAA 4KO3S 1KYXA 4MJ3A 4MUXA 4S1NA 3RYFB 1E9AA 1NRIA 4UARA 3BGDA 5CDYA 5JWHA 1MC5A 4J0DA 5F4BA 3QEMA 3ZBPA 1UBMS 1D4ZA 1N5MA 2FHSA 2VWQA 3HDVA 4HMPA 4JVOA 5IZCA 3U56A 3EA5A 2HU8A 4DFDA 5KOJB 3OQ6A 5I6DA 1QIJA 5JFTA 3VR6D 4A8TA 4CFYA 2AOVA 4HQLA 4B33A 4PLPA 5T5QA 3RFFA 5A5DA 3TXXA 2BGWA 4IHAA 4RENA 2EHJA 3KTAA 1N6LA 1ZK0A 4PCLA 2GETA 4CJXA 4FEAA 4XD7A 2I2XB 5A6SB 4DBLC 4DJEC 1IUOA 1SJ9A 2H1IA 4JI4B 2GBCA 4M54A 3O93A 5CAEA 3DW1X 2GFQA 3UB3A 3DE0X 4P3NA 4LDNA 4YRSA 2WG2A 5FLEX 4KIGA 1AX9A 3NTOA 2R96A 3OIWA 2D3WA 4WLNA 1P8JA 2GKSA 1IN5A 1V1JA 1ZCZA 1WXIA 1XOIA 1Z47A 2MMCA 3E5NA 3W8FA 5EIEA 5L51A 3RR2A 3GJQA 5A0VA 1R6UA 2V7PA 2IJGX 3NH6A 4B2PA 2Q8QA 1J8DA 4X7RA 1OFHA 4JBXA 1VLLA 2PANA 5BW5A 1RCFA 2V6JA 5EI5A 4ZIRB 4C6RA 3GLRA 3KAQA 4FYJA 4NAVA 4CE6A 4G84A 1TVMA 1BE0A 3VNVA 1H6CA 4RTMA 1VMAA 1Z88A 4G0XA 4M0MA 3E03A 1T1SA 2DUJA 2P9BA 1I5EA 5K2OA 1LFDB 2ZAMA 1N75A 3DDZX 1QP4A 2VCYA 1A71A 2CXUA 4CV1A 5JS1A 4N1AA 1NW5A 1WUJS 3C74A 2PRSA 2G8LA 3JYPA 5P8WA 2QF7A 3MCTA 4LFCB 5JY6A 4DUYB 2YVKA 3R0XA 3OESA 3S2FA 4PG8A 5I9MA 2VLBA 1Y7HA 3I2IA 3SFVA 1N2JA 3RVJA 2VP6A 5EIBD 2HHLA 3IUJA 4MW7A 2IS2A 4RORA 4C1BA 1C29B 3MLAA 2Q4EA 2O7QA 1W8IA 2ONYA 1TJYA 4RD6A 6GPBA 3BJMA 3C6QA 3FSRA 2BMWA 4YIHA 3MQFA 1U2TA 2DBZA 4OMDA 1JB1A 4MQUA 3UIEA 4MDFA 3AWIA 4ZVVA 4EGJA 5DSZA 4GI7A 2WFMA 4ENSA 3NXSA 3PKZA 4UM5A 3MBOA 6LDHA 4GT1A 4G1EB 4KMOA 3CMCO 2RIPA 1V16A 3H8SA 5K0GA 1LLDA 2Y0CA 3TL3A 4C2UA 2FPGB 2WP0A 4JP2A 2QP9X 3PNLA 4QYTA 2PJRA 3EF0A 4LHZA 5JQGB 4MR7B 2EL9A 2GAFA 2OV1A 4TZ6A 3TB4A 5H9WA 2QZZA 2MINA 3F49S 2Y1XA 4UMFA 4DMHA 2ZXEA 4MZXA 3MJFA 4YP7A 1D6JA 3VZBA 3DLCA 3QHPA 4F12A 4A1FA 4YONB 1RCUA 1X6VA 2VDQB 3EDRA 3LHSA 2NW6A 1CUGA 2OUKA 4BU1A 5A2GA 5FOQA 2RGAA 1FQWA 2D1SA 3BBLA 3KKLA 4Z8YA 3SKVA 1C3VA 3TQIA 2O8BA 1N25A 5CK5A 3D0OA 1H8HA 3M89A 4FUTA 4HRVA 6Q21A 5JAIA 2B4YA 1J20A 2I2DA 2A8YA