4M9QA

Crystal structure of c-terminally truncated arl13b from chlamydomonas rheinhardtii bound to gppnhp
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
196
structure length
195
Chain Sequence
GPRKITIALLGLDNAGKTTLLNSIQGEDRDTTPTFGFNSTTLNEGKYKIEVFDLGGGKNIRGVWKKYLAEVHAIVYVVDAADPGRFEESKMTMAEVLENQFMRDKPICIFANKQDLPTAAPAAEVVKGLGLATCRNSHNVFPCTAKMPAGQDVDHRLRDGLKWLVGTVDREFGRLDPRVQTEAEEVRQEEARKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ARF-like GTPase
publication title Structural insights into the small G-protein Arl13B and implications for Joubert syndrome.
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
total genus 71
structure length 195
sequence length 196
chains with identical sequence B, C
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2013-08-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4m9qA00
1ZINA 5DN6A 3K53A 5EE3A 5KSPA 3ZS8A 3UXMA 2EFGA 4BRWA 4E09A 1W0JD 3SJZA 2GXSA 4ZCIA 2B8WA 1QHSA 3PITA 3Q5EA 2IS2A 1F2UA 1HQCA 3VU9A 2BM0A 4C2TA 1L4UA 1OYYA 1JPNA 1U9IC 1C4OA 2BWJA 2O0HA 3U3JA 1ZBDA 3J81k 4W9MC 3X1ZA 2ZI5A 2ZXUA 4BFXA 2XTMA 5TVKA 3NEJA 1OV4A 5AJZA 2UKDA 1JAHA 1SKQA 1OF1A 2IF0A 2GESA 5JEDA 4Z54A 3K09C 1NVVR 4BFTA 2ZU6A 4I1OA 2Z4SA 4C30A 3BERA 2OXCA 2O8FB 1AS0A 3VR6A 3EPHA 2Q9AA 5JSZB 4G5GA 4N0DA 3QF7A 1VCMA 1WP9A 3WMGA 2YOGA 1W0KD 3QUSA 4G5QA 1N5KA 4LV8B 4UXIA 1XU4A 4BASA 1CIPA 4DIDA 1UAAA 1UKYA 1ZD1A 1G1MA 2FPKA 2O52A 2R62A 4KYIB 1EFUA 4XIGS 1M34E 2AXNA 2NOAA 3GLFE 3K0FA 2JLSA 3KQHA 2PT5A 2JJ1A 5J5CA 1XD2A 1QG4A 1A4RA 5FBWB 2R6FA 3SN6A 2GJAA 1N5JA 3IBGA 2ZRAA 3R8FA 5JLJA 2ZEJA 4AY2A 4YQFA 4MKHA 3FGNA 3OIWA 2EWVA 3EX7C 2REBA 4B2PA 2QA5A 3M4YA 3O8DA 4AIIA 3CPEA 2XOKA 3ZQJA 1TF2A 2JJ2A 4QFMA 4JLDA 2ZE8A 1QDEA 4DSUA 4ACBA 1QBKC 1X1SA 2H7VA 2ZE7A 1GOTA 3BC1A 3GMTA 4OQMA 1S9HA 1XMIA 2VP0A 5CDFA 3CIOA 3WRYC 3K0CA 3R9WA 3QXJA 2WJIA 4LWZA 4YXWA 3U3MA 5CLLA 3GP8A 3B8HA 2O5VA 1VECA 2ORVA 2OUKA 2CL0X 2RAPA 3K1JA 2VP6A 821PA 2EQBA 1P7CA 3CRVA 3I32A 4GOJA 4JL8A 2Q3MA 3RAPR 4D82A 2R2AA 2VLIA 3PUYA 4WXPA 5BN5A 1TQ4A 3IUYA 3GD7A 3RS4A 1UF9A 4JBWA 3X1DA 4HUTA 1OPXA 1U94A 1GRNA 5HKKA 2JDID 1W49A 1HA3A 3B82A 5FOWA 3SJAA 2E87A 1KZGB 1U8AA 3T15A 2WWHA 4ZIRA 4YLGA 2X1VA 5K8TA 1N6HA 2DPXA 2VTKA 1KKLA 5JJKA 3GLFB 3REGA 1Z0JA 3CF6R 1X8KA 4CT4B 2J0SA 2QP3A 2RHMA 3AQ4A 4P3YA 5IHPA 3WBKA 4LC0A 4AI6A 5CYPA 3WBJA 3P32A 3RRMA 3AEZA 2GRJA 3U3OA 1DAKA 2QM8A 1KI6A 1I2MA 1XD8A 1T3HA 1J90A 5DI3B 3AB3A 4B35A 4YMWA 2QQEA 3AVQA 1NF3A 3LY5A 2YC4C 1JR3E 5K8UA 4DCTA 1RIFA 2YWFA 1KI1A 1BIFA 1IN6A 1DS6A 2XXAB 4IVRA 3GLGE 1WBBA 2NO6A 2VPPA 3PUZA 4M9SA 5GVRA 2WWYA 221PA 4EPYA 4C7OA 1LFDB 2QAGA 3FKSA 2P3SA 4FCTA 2VSXA 5P21A 1A1VA 5G53C 1II8A 1GL6A 3B6EA 4BEJA 3SZRA 5JMTA 4A2PA 5AUQA 4Z8YA 1YKSA 1KK3A 3GLHA 4L9SA 1IJEA 3LX5A 3RWMB 1IXZA 2V1XA 4OQFA 1Q22A 4BEBA 4DKXA 3IIMA 2IX3A 3F5FA 3IHWA 3FVQA 4PSKA 3CX6A 3QKUA 4TL6A 3I1FA 1GSIA 1W2GA 3H4MA 4GPTA 1U98A 1KKMA 1XMSA 2GZHA 3W90A 4PO8A 4LK2A 3UPUA 1CRPA 1SZPA 1XFAA 4DJTA 5B30A 4PO1A 2PX0A 2CCKA 3I8SA 5JECA 4QNMA 4U5XA 4WA7A 5EZ5A 1S3SA 3TUJC 2W2XA 4JL6A 1SHZA 2KE5A 4TL7A 1JR3D 3QKRB 2ZTSA 4RY2A 1FTNA 5M04A 1EESA 4PZLA 4PANA 4A0HA 4EDHA 1LS6A 4IFEA 3ECCA 4C0JA 4L4UA 4MGZR 4PPNA 4RZ3A 2IWHA 5IRCD 4KODA 2BBWA 1RRCA 4M53A 3BH0A 5E7IA 4FW9A 4BUJA 1IJFA 3MWLA 2J46A 2OO7A 3A4MA 4MYTA 2ZSDA 2ZAMA 1E4YA 2H92A 3P1JA 4Q00A 4PXAA 4A8JA 1SVSA 3L0PA 4D0NA 1KK2A 1SVWA 1P3JA 4NTZA 2C5LA 4TMKA 2HDNB 3RRZA 4DDUA 3GLGB 2QTHA 1VPLA 1W2HA 1MOZA 2WSSA 1ZUHA 3OIYA 4Q9JA 2WPDA 5FPSA 4B3BA 3N70A 4G5RA 4CEJB 3VKGA 1UBEA 3AF2A 3OZXA 4OQXA 3H2YA 4NCNA 1P2TA 4IDNA 1KOFA 4RVCA 4B48A 2CHGA 3VFDA 4GFDA 1NIPA 1OJLA 1UFQA 3VKWA 2PEYA 5F2EA 4AYXA 4QXAA 5CYOA 2QP9X 4C9BA 1M8PA 1TU4A 4IXMA 4HUQA 4PQYA 2GK6A 3TBKA 4PAQA 5EUQB 3V4FA 3K70C 3CZPA 1R5NA 5E3HA 4Q9HA 2JAQA 2QEQA 4PQFA 1S96A 4QGFA 4OHVA 1OW3B 2QTFA 3PUXA 3VR5A 2GTPA 2A7QA 4V0ME 2GEVA 4Q7LA 4EUNA 1IY0A 4GP6A 5AUPB 4FIDA 1JB1A 4UKDA 2ZRBA 2QP4A 2P5SA 3QG1A 4UJ3A 4NL4H 1D5CA 1M2OB 1T3SA 3QG5A 4NYIQ 3TUIC 3AKEA 3SHWA 3R7WA 3C8UA 5J4LA 1UADA 3SOPA 1Z0FA 1XTIA 1DAMA 3GJ5A 4JVLA 3JVVA 4LBVA 3ZZTA 2IXGA 2WOOA 4HYYA 3KB2A 1G5RA 2XZPA 3OE7A 1VDZA 3B1WA 2ZM5A 5A5GA 1GILA 3PCRB 4KITB 1ZAKA 4TLDA 4M1MA 1IXSB 1SQ5A 2QMUA 2ORIA 2OCBA 2WWIA 3THXB 1QHGA 5CK4A 3JVUA 3EIQA 1P73A 3PQCA 4XVRA 1U8ZA 3G5UA 1I4TD 5EXSA 4JYBA 2QT0A 3WNDA 2OCAA 1WMSA 5L3QA 2P6NA 4BWYA 1W7AA 2VSFA 1W46A 2VYFA 4KLNA 1CLUA 1E79D 2ZRMA 5FBVB 2DHRA 2W6JA 1KI6B 2A5YB 1OHHD 2QENA 3LNCA 2KWIA 3P27A 4EAQA 1XZQA 2BKUA 3LA6A 4KFTA 1XB2A 4MRRA 4U7DA 5CB8A 3K0AB 2OILA 1VG0B 3OIUA 4JVMA 2NTYC 4LPSA 1G8PA 4IDHA 5A0FA 1UM8A 4DT1A 4ZDKA 1BKDR 2D2FA 2ZJ2A 3EZ6A 1P60A 2R6DA 2CXXA 3AF4A 5JJIA 3QPVA 2QM7A 3R9IA 4M9XA 2WJYA 3TMKA 1P9WA 4JLOA 4JLMA 5LB4A 3GJ8A 2ZR0A 4TSFA 3W5IA 1N5IA 3HU2A 2RGAA 3LLMA 3K9GA 5CJ2A 4MUBA 4QKQA 2FSHA 4AC9A 3C15C 4HZUB 2DB3A 1JR6A 1N6IA 1GG2A 1JBKA 3PIRA 4Q47A 5DO9A 4YMTA 4XVQA 4Z8XA 1J8MF 1MO5A 3X1YA 1KNQA 5FI0B 3PV0A 4PC1A 4GBMA 2QE7A 3QQ5A 4Q48A 3GLIE 2P6RA 4PC3A 4Z1MA 3EA5A 4D25A 1E2LA 2LCFA 2QORA 1YZNA 2QY9A 3LBIA 1E2EA 1XTQA 5JS7A 3HPQA 5DLQC 4LZZA 1ZNXA 1RZ3A 4LBWA 2Z0MA 1KK1A 4ZKEA 1BYUA 2QAJA 2WOJA 5FH9A 4PHTA 3K70D 1G8FA 1GP2A 4FMBB 2BOVA 3ZYCA 1CR4A 3KKNA 5A4JA 4B44A 3CRRA 4Q01A 4A15A 5EXPA 2NIPA 4OJKA 1FW6A 1N6PA 3A1VA 1OH6A 4LJ8A 4EJSA 5ELXA 3D31A 2NZ8A 2J7KA 1GDDA 4R2IA 4A8JB 4M22A 1VIAA 3GEIA 2PH1A 2GAOA 4OI4A 2LWIA 4G5SA 2PLRA 1Z0KA 3K70B 1YRAA 3BIFA 3T5DA 1H8EA 2AWOA 2RGCA 2RH5A 3CF2A 3DKVA 4QNRA 1V43A 3RYTC 3UKDA 2XSZA 3KZ1E 3ZZ0A 2WKQA 1NLYA 3BB4A 1S4QA 5DH9A 4C2UA 2B7CA 4QOSA 4NH0A 2VEDA 3NC0C 3CR7A 3TW8B 3Q9LA 4Q4AB 5JCPA 5KHOC 1J2JA 4PHGA 4B75A 2Z6VA 3FMPB 4URUR 3ADDA 3GCGA 2JIZD 4B47A 3BAFA 2XITA 1KO1A 4A92A 3T61A 2O8EA 4BQSA 1ODFA 2YC2C 2J87A 1ZNZA 2CLDX 2CK3D 2WIAA 3QOFA 1NN1A 4PSVA 4K8OA 2FGJA 3L2OB 3AVYA 1LB1B 3W9YA 4XWOA 2CNWD 1XPRA 3GLIB 3DM5A 4A4DA 1G5TA 2F1RA 3OF5A 4WZBE 3IO3A 3OFNA 3V9PA 2QN6A 5DSZA 3U6KA 3R7WB 2HEIA 5CM9C 4FD2A 1G6HA 1G16A 1DAIA 2FEOA 4MH0R 2EFDB 3QPUA 2I1QA 1DG3A 4H1VA 3W6PA 3WXMA 2JLWA 2IYLD 4S35A 1R5OA 3FYHA 4BFVA 5BWMA 4URXR 1E9AA 1I4DD 2GF0A 4Q1FA 5AJYA 2G3YA 2ZRPA 2F7SA 1GIAA 2D4HA 5BN4A 4LYJA 2GCNA 1NRJB 4WBSA 3QVVA 4DZZA 3FPAA 1WXQA 1QHNA 1P9RA 1XDBA 2F9MA 4Q19A 4LHWA 1E2IA 3ASYA 3IILA 4FWIB 3LQRA 3LQQA 1UDXA 3GJ0A 4FMCB 3VNVA 4FMDB 3Q7PA 4M1YA 4NCJA 1NJFA 4KLZA 1W48A 2RGXA 3RVBA 3ZJYA 3GEHA 4M1TA 1TQ6A 2EYQA 1P2SA 3I5YA 2B6HA 3OEHD 4I1VA 3ZVLA 3QKSA 1T3LA 4AURA 1EFRA 2GVZC 2L0XA 4O0MA 2MMCA 4CT5A 4LI0A 2GDJA 4Q5IA 5JHHB 2JLZA 1OE0A 1K5GA 2VHUA 3PENA 3DHWC 5AUOB 1FUKA 4ZDIA 1FMJA 4MA4A 5FOTA 3BB1A 2FPMA 3MGCA 4M21A 3U61B 2ZRKA 4W7SA 3TUZC 1ZCBA 1W1WA 1MKYA 1S8FA 2MMGA 3WP1B 4P4SA 5HR5A 4KFSA 3FTQA 3VR1A 5HE8A 5H8WA 1KDTA 4Q9KA 2HF9A 2JLRA 5G40A 1XPOA 1AJEA 1W44A 4D4MA 1I2DA 4FCWA 1EFHA 1E4VA 1GKUB 2NO0A 1Q1EA 4DLRA 1KYIA 2C98A 2EWWA 2J41A 4IKEA 3ZGXA 3NH9A 1N6KA 4BZQA 3DKPA 1P72A 1UJ2A 2WJGA 3LFUA 4TYQA 2BEJA 4ZKDA 3W5JA 1OXTA 4ZI3A 1E99A 2ZU0C 4DDTA 3ND9A 4TMXA 3AM1A 1NVXQ 2G83A 1SGWA 3FWYA 4QBIA 1EXMA 1GRQA 4PZZA 3RC3A 1Z06A 4UJ5A 1M7GA 3NG1A 3VX3A 2WMOB 1FX0B 1FUUA 1NSTA 5F3WB 2VA8A 4LHXA 3U6BA 2GCOB 2W6ID 3PR1A 3MWJA 2GNOA 1XXHA 2JASA 4DHEA 4TYPA 5C18A 2WAYA 2XEXA 4JLJA 5JFGA 2WVJA 2HYDA 4PHFA 2AK2A 1XCMA 1NKSA 1XCGB 2J5XA 3PVSA 5TMPA 1N6OA 3RS5A 5HTKA 1RRGA 3ZVNA 4LYHA 1VCNA 2C77A 2OBNA 3WNCA 1FFHA 1XEXA 1F2TB 2JLVA 3K9LA 2QSYA 2IF2A 4NCHA 4MQBA 5EP1A 1K5DA 1NIJA 4LJ7A 3IKJA 4DBLC 3QEOA 5FTJA 1Z6XA 3HR7A 4GL2A 2AR7A 2B7BA 1VYTA 4CIDA 1JXOA 1JAIA 1LW7A 1JEEA 2CJWA 4NYJQ 1ZC3A 1IAQA 3TSZA 2F3RA 2J7PD 4BFUA 5GJBA 2C95A 4M1WA 3NBZC 4NP6A 1RFLA 4NBSA 3VX4A 4YMSA 2RHDA 5FI1B 4X8LA 3UMFA 2VRWA 3K9NA 4ON9A 5H68A 1EFTA 2ZYVX 4DB2A 1N6LA 4Q4JB 1OFUX 1Z3IX 4F4IA 4D6PA 1BS1A 3K0SA 2V3CC 5K8LA 4B43A 1RPZA 1LY1A 5KNCA 1P2UA 4JVNA 1Q0UA 1G7SA 4G3XA 3I3SR 2FFAA 2RGNA 1OB5A 2WJVA 2FX3A 1DOAA 3C16C 3Q7QA 4TMZA 2PJRA 2O8BA 2B8TA 4P33A 4ITRC 3MRSA 3W3ZB 1CBUA 1E2FA 4GOXA 3SQWA 1VCIA 2WV9A 2ATXA 3TQFA 2QBYB 4NDZA 1UBFA 4GMDA 1KO7A 3AVPA 1OFTA 4QRHA 1TQDA 1MO4A 4TYNA 3S1AA 2XGJA 2XJ9A 1ZRHA 1NI3A 2OBLA 1O87A 3DL0A 4L5BA 4C0AC 3EZ7A 1P9NA 1CJVC 4QBFA 2R9VA 1Z6YA 3LW8A 1Q57A 2DWOA 3D3QA 1GKIA 4DSNA 3THYB 2OLJA 3QXXA 3UATA 1UBCA 3B1VA 5GADl 4JLBA 1OKKA 3TAHA 3B9PA 4ARZA 1W5SA 4AD8A 3RSOA 4EQ6B 1RW4A 2V1UA 2YOHA 1QZXA 5DYGA 1ZIOA 2QNRA 5EUMA 1MABA 4Y0AA 2BIFA 2HJVA 1CTQA 1XJ0A 4GSYA 4K46A 3MSXA 1WE2A 2F6RA 1G6OA 3BK7A 1VG1A 3HR8A 4UQOA 3SFZA 3SC3A 4RD4A 3H86A 1G17A 2DWPA 2BHRA 2FMXA 4XD7A 2Q21A 5AJXA 3CM0A 2CEAA 4HLQB 2UZ3A 1ONBA 3EIHA 3K0EA 4V03A 3U2QA 2N46A 2OFWA 4I1SA 3EZ2A 2KB0A 4NONA 3RRNA 1AGRA 4E03A 1CXZA 3DMDA 1GFIA 2P2LA 3BFVA 3A36A 3PJRA 2AD1A 3KB1A 2IYYA 3ND8A 3U4QB 4XWKA 4PC7A 1GNPA 1HTWA 3FDIA 5KNBA 1ZMXA 1KI7A 5BW8A 3P4XA 4URWR 5FL7D 2J0UA 1KMHA 4MGKR 2HV8A 1MR3F 5DHFA 1KNXA 3RSLA 3KTAA 1NBMA 3B78A 2J0VA 2A5GA 1CRQA 1K6MA 1V5WA 1IN8A 2V8OA 1E9RA 3KKQA 1TQ2A 1G3QA 1FOEB 1YZQA 3ZD7A 3SYNA 1JPJA 3TJZA 1KY3A 4TTPA 1DELA 4LDJA 5E7JA 4DLWA 5HCIA 4Q4HA 3A1WA 4HLUA 1OXUA 3WMFA 5ANRB 4K81B 3SJCA 3GFPA 4WXRA 4KBFA 2FOLA 1E1QD 3NEYA 2QUZA 4XTCS 2G9NA 5JCZA 4XJXA 4GT1A 1C9KA 2VP2A 5FOVA 2G77B 1IN4A 1NG1A 1XBTA 4EPVA 2UZIR 1WCV1 3PFIA 4TYYA 1N0WA 2FU5C 4G5OA 5E7MA 3L0IB 2IHYA 4ILEA 4A6PA 2VSOA 3TGPA 2H57A 3K0CC 5G3YA 1JECA 1NY5A 5HCNA 3W34A 4Z51A 4LPKA 2ZYWX 4URZR 3KJEA 5J4KA 4YONB 4BRUA 1HUQA 2FN4A 4FMCF 3VR4A 4A0GA 3CPHA 1NLZA 1WA5A 2CL6X 2VF8A 3AKDA 4CEIB 4S2EA 4BLRA 5L3SB 3A1UA 1NMXA 3KUCA 1P62B 2GBLA 4M1KA 3SFVA 1XWIA 1SVOA 2ZJ8A 5EQTA 3BD9A 1KGDA 1W47A 5TV2A 2O8BB 1FNNA 2EFHB 3B1ZA 4B76A 5CIWA 3I8XA 1R10A 5FUVA 1R2QA 2F3TA 1U2RA 4MDFA 2PJZA 4D4JA 1GUAA 4MRPA 4N0EA 5DN6D 4EPRA 2JLYA 2AK3A 1DTSA 2GXQA 3TVDA 3EWSA 2NZJA 3CRQA 4MRNA 5H1YA 4B3XA 1NBME 3O8BA 1NMYA 2BCGY 3TNFA 4C0QC 5KSOA 2GAAA 1XTJA 1E2NA 4RD6A 2OM2A 3LD9A 4JJKA 5L3RA 3C14C 3CX8A 3ICEA 5DE3A 1K8RA 3LX8A 3KXKA 1N5LA 1QHYA 4CF7A 1RKBA 2O8CB 2R8RA 1E2QA 3AVXA 2VHJA 1YR6A 4LHYA 3EIEA 3TK1A 3RRYA 2IXFA 5FUXA 5FTNA 1D2NA 1HYQA 2H16A 4QGGA 5FPHA 1GL9B 2XNDA 3L8ZA 1ZVQA 2NPFA 4LV6A 3T1OA 2IK8A 3BORA 3NDPA 4IFBA 4UXJA 2AD5A 1YR9A 2FJUA 4XWAA 3RABA 5CDFE 2WMNB 4JSYA 2ZJZA 1HT1E 1DPFA 4PZYA 1XD9A 3Q85A 1F3OA 1FP6A 4LOAA 5J4VA 4QG7A 1F2UB 3VU9B 1OIXA 3KKOA 1N6RA 2Z83A 2QAGC 2ZS8A 3RC8A 1JQJC 4DUGA 2PCJA 2W2TA 3AVWA 2ZSEA 4XTRA 3SHFA 1G5PA 4C4PA 1OH7A 3TIFA 4YC7A 4RZ2A 4URYR 4R9UC 4JT2A 3WMEA 1A2KC 2TMKA 1M74A 1Q3TA 1T8TA 3WYAA 3U44A 2W00A 1ZM2A 4UNSA 1YZKA 3QNUA 4B2IA 2JJ1D 4FCVA 1X3SA 5C2JB 2IC5A 1MO6A 4C0SA 3AGQA 2A5JA 5CB6A 2ODBA 5TDHA 5TB5A 1S2MA 5JZVA 1Z29A 1G3RA 3M6AA 4R71A 2HCJB 2G6BA 5L8VA 1YZGA 2XOKD 2JJ2D 4F7WA 1KSJA 4PPGA 1D6JA 3O47A 4JYCA 3KQKA 3PG5A 3K0FB 3AVVA 2ODEA 1XD2B 3N5CA 4H9GA 4GRAA 3W6NA 4YXWD 4DSTA 4JZKA 3SR0A 4RSGA 4B6EA 4Q4HB 4QHTA 4HAXA 5FBLB 4ACAA 3ZH9B 3PEUA 2OCYC 1H65A 5DHAA 2XNSA 4QC2A 3MJHA 4F92B 2VIIA 1TUIA 4A8JC 1GWNA 4R7ZA 1E32A 1XMJA 2MSCB 4BZXA 1MRSA 5TY0A 1F48A 4GP7A 4IOJA 8OHMA 1D9XA 2RGDA 2ZE5A 1Z5ZA 2QQ0A 1WQ1R 1TF7A 2ZUDA 5HKKD 2R6AA 2WSMA 4NPHA 1XEWY 2F9LA 5L3VA 3F0TA 5KDDA 3K8YA 4IOLA 2HLDA 4OK5A 3GJ3A 2ZSBA 3RS3A 2GJ8A 3GLHE 5CLQA 1KI9A 5HE9A 4DLYA 4O3MA 1IXRC 3KX2A 4Q7MB 3HYRA 3EA0A 1II0A 2GJKA 4OJQA 1SVKA 3WY9A 1AKEA 1KO4A 2CE7A 2R65A 3CWQA 5CITA 4LV5B 4NYIR 4M1SA 4LRWA 5G41A 3UWKA 2IL1A 2VP9A 4WZAE 4GMXA 1H8HA 2ZRNA 5IK2A 1UDWA 2ZVQX 1OIWA 1ZCAA 4LYAA 1D2EA 4OL0A 3SU8A 3H0KA 3RWOA 5C4MA 1A7JA 5GJCA 2AN9A 2DFNA 4TLBA 3V4RA 1FMLA 1WDTA 4ZIRB 4JT4A 5D3QA 1AGPA 1U81A 4NHOA 2ZRDA 3QY0A 1SKYE 2G0TA 3UK6A 1AKYA 2PMKA 3IPXA 2F43A 3F8TA 3PEYA 5JWHA 3ASZA 2J0QA 5FBRB 2QPTA 3FKSD 1XNJA 3SS8A 4G01B 1LS1A 1BMFA 4HDQB 1P61B 3VMFA 2YINC 1SVLA 2WKRA 5JRZA 2F55A 4ASUA 3NC1C 4HAUA 4KI0A 2ONJA 4JVSB 4Q03A 1Z6TA 4LJ6A 4OI1A 1CJKC 3P26A 4CEHA 4IW3B 3A58B 521PA 1T0JB 1EWRA 2A5DA 2ZPTX 4PAOA 2IUSA 3CX7A 3W8RA 4C7OB 1L4YA 4LBZA 3HU1A 4DCNA 4DLSA 4MKIA 1I4LD 2QAGB 3AVUA 4FN5A 2ZSFA 5HZHA 3VR3A 1Z28A 1II8B 4P4TA 4FXPA 4BFYA 3QIAA 1KSGA 4MGYR 4BLPA 2XZLA 4U00A 4AYWA 1E9FA 2ORWA 4KVAA 3GLHB 1ZYUA 1E1RA 4IEIA 1SHKA 2C04A 4AWXA 1AZTA 1E9SA 1SXJA 3RS2A 4MGIR 5B57C 2A3RA 4R98A 2CVHA 2EYUA 1UKZA 2C78A 2O8DA 4OI0A 1PUIA 1ZM9A 3A8TA 5FTMA 5C1BA 5AJWA 1COWA 4US0R 2XX3A 1KJWA 5SZIA 3SNHA 1F6BA 2QGZA 1ZW6A 3ZVMA 4PPFA 3LW7A 1HV8A 2IS4A 1ZUNB 2XAUA 2OG2A 4KBGA 1II9A 4H1UA 1UBGA 2D7CA 3GJ4A 4QBGB 1E2HA 5K8IA 3KQNA 1E0AA 1GVNB 1SKYB 4B71A 2WSSD 2WPDD 5D3MA 3JZAA 4KJZA 4ABYA 4NCIA 2WKPA 4QGAA 4EKDA 3MLEA 4QGHA 1CJMA 4PC2A 4QL3A 1JJ7A 5CJPA 4BZPA 3GFOA 1YU9A 3AP3A 1LVGA 1E2JA 4B2LA 2DYKA 3IQXA 3GJXC 2BV3A 4M1OA 4C0HA 2YZ2A 2XB2A 2VHCA 2GZAA 2FWRA 4CRWB 2PMDA 3TR0A 4TQ9A 2FGKA 4RCYA 5JJLA 4EJSC 4HLDA 121PA 2IYRA 2OFOA 4WVFA 4OHWA 1FQKA 2YVUA 5DNYB 2G1JA 2PZEA 4Q1DA 5J40A 2J45A 5SZJA 4AG5A 4AKHA 2FNAA 4RJLA 4HUQB 4Q1CA 3C7KA 1T5IA 1US8A 2FE4A 2A78A 2B21A 4KHZA 2W0SA 2XB4A 621PA 1WB9A 3KUDA 3OAAA 1KIMA 3OE7D 3MWKA 3OEEA 2IYXA 1KZ7B 2A30A 3EC2A 4P0TA 4B32A 3CRMA 4RFSA 5JBQA 2HXYA 4LHZA 2P65A 2YJTD 5J4YA 3LBNA 3TKLA 2WICA 5JI2E 1SXJE 4NCKA 1NVWQ 4HZIA 2ZAOA 3SI7A 2ZSAA 4XH9B 1ZC4A 3T12A 5AR1A 1EX7A 3H1TA 4JIMA 4LJ9A 1X6VA 2OE2A 1ESNA 1W4BA 1W36C 2BEKA 4RKEA 3AUYA 1QHHA 3THWA 1Z83A 2X2FA 2W6JD 4CVNA 3FHCB 3GPLA 3E2IA 1Q20A 2J9RA 2JEOA 3E70C 3THOA 1ZM7A 2FA9A 4B6FA 2V9PA 3NXSA 1HY3A 5FPKA 3ZIAA 1ZD8A 4A2WA 4TZ6A 2F43B 4OK3A 1VG9B 2I1VB 3CZQA 2K5UA 4ERNA 5L3QB 2GXAA 1EFCA 1X8LA 2FFBA 3DOEA 1IM2A 5IF9A 3SYLA 2C99A 2OESA 3O8RA 2X8AA 1VMAA 2DFKB 4EFNA 1Q12A 1QG2A 1G9XA 3CNOA 4TSFD 2JGNA 4Q18A 2ZIAA 2ZS9A 4GZMA 4HAYA 3EASA 3P20A 3I73A 2D2EA 3NVAA 4JL5A 4RZUA 2PCLA 4B73A 4DT1B 2D3WA 4TT3A 4RD0A 4LBYA 3NHAA 5BQ5A 2ECKA 2QT1A 1WF3A 2QE7D 2I4IA 1G8YA 1AN0A 4UNQA 5LBIA 1RRPA 1Z63A 2Q3HA 1Z6AA 5AJVB 2H1LA 2WAXA 2F1JA 2QMHA 1E6CA 2ZR7A 3ZQ6A 1SXJB 4NYMQ 4D0LB 3SYKA 2V7QA 4HB4A 1NVUQ 3U3RA 2ZR9A 4Q02A 3D7MA 3CH4B 4KFUA 1CP2A 1GNQA 1PV4A 1YRBA 1ZU4A 1N0VC 3HWSA 4TQUS 4WOPA 1ELOA 3DVLA 2ERYA 2QTVB 4JSTA 4M0LA 3CPJB 5FUYA 3RHFA 4MYCA 2PZGA 2BM1A 1ZM4A 1TNDA 4N1AA 5F9FA 3KJHA 4B3FX 2JCSA 3SEAA 1SULA 3WHKA 4L15A 3TH5A 1P2VA 1OXXK 4IEEA 5CIQA 1H8ED 4AKEA 3BJIC 2C9CA 4BE7B 2XSZD 2WJJA 4WAUA 1VTKA 3FMFA 2VHQA 1R5BA 1GL7A 4EJSB 1UEJA 1RJ9A 1W0JA 3QBVA 2CMKA 3CNLA 1TPZA 5IT5A 2A2ZA 4TMVA 5EJEA 2PEZA 4W5HA 1FPMA 2Q3FA 4OKSA 4Y0VA 1XTRA 1G64A 3VQTA 3AH8A 3LV8A 1UKEA 3HDTA 1OB2A 1Z07A 3CB4A 2PL3A 1PZNA 3NHBA 2WWFA 4W5JA 1DAGA 2O8FA 4B3CA 1QHXA 1W36D 3SQXA 4BLQA 2XZOA 4EIWA 4E22A 2C2HA 1S9DA 2P0EA 4M8NE 5J4HA 1OSNA 3N2EA 4QBHA 1PVOA 2WHXA 3DEFA 721PA 4Q21A 3CUEF 1SVMA 1U0LA 1TEVA 3OFND 2YWHA 3LVQE 1Z0AA 4NZYA 3SDZA 3UANA 1OH8A 4ZO4A 2ZI9A 3L8YA 2G0NA 1US8B 1OFIA 3HJNA 1DBSA 1MT0A 4O2RA 1VYVA 4IVQA 2E1RA 3CR8A 2O8EB 4NYJR 2HCBA 2HUPA 5DI9A 4ESHA 1W36B 2ZQ5A 1M7HA 1T5LA 5F98A 1Z47A 4ESVA 3PEVA 1W0KA 1KK0A 1TAGA 1OXSC 1TX4B 1KO5A 2LKCA 4D26A 3R9XA 4FWTA 2O0KA 4FI3C 2OCPA 1R8SA 5JWRA 1FP7A 5UKDA 1N6NA 4HLCA 1E2DA 3EWAA 2RGEA 3EAQA 1QHHB 2ZRFA 2HXSA 2KBFA 1BO6A 2ZRHA 1JEDA 2NMVA 1Z2CA 2CL7X 4LJAA 3U5ZB 2F1IA 2AKAB 4I1UA 2CVFA 2ZJ5A 4ZV4A 4PX9A 1U0JA 2ERXA 3T35A 5EP3A 1PUJA 1TUEA 3GEEA 3IIKA 1GKYA 1KAOA 2OZEA 2RKOA 3UMRA 4OQNA 2RGNC 1EFRD 3GJ6A 421PA 2BCJQ 1G41A 1IHUA 2AHOA 2P5TB 1N3BA 3NIBA 3AVTA 2BC9A 3CW2A 3SE0A 1J70A 1E98A 2NO7A 1XXHE 1Q1BA 4M9ZA 3H84A 4HDCA 3CKLA 2N1BA 1ZU5A 4JKIA 3WHLA 4DEXA 4BFSA 2BMFA 3GLFA 4PTLA 2DWQA 1DAHA 2JDIA 2VQSA 2XJ4A 3GFTA 3QKSB 4TL8A 3MG9A 2YYZA 3HU3A 2IW3A 3REFA 3FMIA 1BOFA 1NP6A 1KJYA 3CONA 4A2QA 2ZRIA 4Q7KA 1ANKA 3CBQA 4NE2A 2F1HA 1KMQA 1S3GA 1YZUA 2XXAA 2G1KA 3DZDA 2Z4RA 1AQYA 3PUWA 4IDQA 4KXFB 5FOSA 4C0KA 2GA8A 2RMKA 5BN3A 1KSHA 4P4SB 3EPKA 4V0NA 3I62A 2H5EA 4C0LA 3T34A 2V55B 1J99A 1U9IA 1NMZA 1W4AA 1T6NA 5FPYA 3TQCA 1YZLA 2OT3B 3NBFA 4TN1A 2IYSA 1TU3A 1TL7C 1NLFA 4LHVA 3MAAC 1NJGA 2Q9CA 2JLUA 4QM7A 2ZI6A 3CH5A 2MSDB 4QHSA 1NKTA 2A5FA 3K09A 1U8YA 1Q44A 4V0KA 1E2PA 5JS8A 3AF3A 1R0XA 3DMNA 2GEUA 4KSCA 5JHGB 2YKGA 2IEZA 5C46F 5H70A 5FFMA 1KHTA 1RJ9B 2GWHA 1KDOA 1ZIPA 1FNMA 3IEUA 1F60A 3QI2A 1MRNA 2RCNA 1XXHB 3F3YA 1EG7A 2QMEA 1DVRA 3KDSE 4PC6A 3AV0B 1NVVQ 3QKRA 2NPIA 1W5TA 2BVNA 5DGXA 3RANA 4OHZA 5FR1A 3DPUA 1E9EA 3LLUA 2Y8EA 3A4LA 4GI7A 4M2LA 4EPWA 4J0QA 1XEXB 2ZI4A 3BH7A 3QEJA 4BFZA 4C3ZA 3OESA 1HH4A 4PAMA 2IS1A 2BBTA 3BH6A 1YHNA 4HLUC 3AP1A 1JR3A 3BFXA 3MUFA 1RYHA 2ZREA 1RVDA 3GLGA 1YVDA 3C41J 3IBYA 3L43A 4WW0A 4OHXA 4KSBA 4R2HA 2CJWB 3TW4A 4CEJA 1ZUIA 2W83A 3BFKA 3ZS9A 4QJ3A 3BRWD 3NH6A 4UNRA 2N42A 1L8QA 2GJ9A 2ANBA 2GKSA 2D7DA 4M4SA 1XTSA 4UXHA 1CR1A 1E96A 4BLSA 3R20A 5FUWA 2IA5A 2YNMA 5GJWC 1G3UA 4F4JA 1B0UA 2FG5A 4MDEA 3LAWA 2BMEA 5BYKA 4BGDA 3B1XA 3MCAA 4RZXA 4Q1EA 1T4GA 1KSFX 4FMDF 5IDVA 3T06B 3I61A 2B92A 1NNEA 4UNPA 2OLKA 1HE8B 2AXPA 2QGNA 2YHSA 3KKMA 2J1LA 3BS4A 3NWJA 4P31A 3O8CA 1GNRA 2ZROA 2GZDA 3B60A 1CJTC 4TLCA 2YWGA 4PPQA 4QHYA 3I72A 1J8YF 1ZM3A 2NO9A 4N3NA 4A0FA 4GOKA 3L0SA 2NG1A 3P4YA 2C9OA 4D80A 1Z8FA 5KO2A 5C4GB 1VCOA 1N2CE 3X1XA 1OKKD 3U7FB 2GBLC 6Q21A 3RS7A 1NL3A 1DO2A 2WJHA 4DCVA 1OXVA 3S1AB 1E3MA 4RFVA 4ZI2A 4PFSA 4DCUA 1PJRA 2ZRLA 4LGMA 2GVDC 2GETA 4L16A 2BBSA 3UWOA 3THXA 4AYTA 4P32A 3IQWA 4KVGA 1XEFA 4TTRA 1VIYA 3U7EB 2ZUCA 4XD7D 4L8GA 4V0LA 4ARZB 2V4ZA 5JRJA 2BKEA 5FR2A 1XEWX 5CM8B 4MITA 4OHYA 4Q7JB 1MABB 5E95A 3WNBA 2G88A 2SHKA 4JBYA 1FQJA 2X2EA 4IJMA 3NBXX 2CLCX 3A37A 3MD0A 4B74A 1HQYE 2FF7A 1AQUA 2D62A 1KI4A 4B34A 3BBPA 4LJYA 3K0AA 2OBMA 1G291 2BMDA 1DO0A 1OIVA 1BYIA 1Q3HA 2CLSA 3TAUA 3R8CA 1DAEA 4PQRA 4PSAA 1NBMD 1E2KA 3CO5A 3BWDD 1E79A 1G7CA 1X8JA 1E9CA 2ZUBA 1OHHA 2CE2X 5FOXA 4A1FA 4V0MA 4DIEA 3M1IA 2R6GA 2OFXA 4B3DA 2H8KA 3QE0A 1GTVA 5EP2A 3CF0A 2VO1A 4HZUA 5HPYB 1GZSA 2NQ2C 1XPUA 2DFLA 2J0UB 3T1QA 4KYUA 3MJRA 1ZNYA 1KMHB 1G8HA 3BB3A 2C96A 2QZ4A 3KJIA 3KTAB 3MWYW 1Z22A 4L9WA 1XJQA 5EE5B 4ZDWA 4KAXA 5KPJA 2EFEB 2BJWA 3EPLA 3UMSA 2ZI3A 2FFHA 2WZQA 3PUVA 1VYUA 3X1WA 3QF4A 1R0YA 1JALA 4W5WA 2PT7A 1TF5A 4YMVA 2XTNA 2DY1A 4PHHA 4BPBA 4HAVA 4IXNA 4MUAA 4F38A 1LF5A 3M0EA 2HT6A 4F4CA 4MYUA 4RD2A 1G4AE 1JNYA 4DLTA 1BH2A 3A6PC 2Z43A 3LH5A 2PX3A 1AS3A 4KU4A 3IEVA 1T8UA 3ZZUA 4JKYA 4JMPA 3FOZA 1FTSA 4DEYA 2ZRGA 4QJ4A 1QF9A 3CWZA 4PO9A 5EE1A 4UNNA 1DEKA 4DC9A 4Q1BA 4O2LA 2H17A 2CHQA 4KV9A 3T1TA 2ZANA 4BECA 1DAFA 4ZCMA 4Q9IA 1JQLB 3G82C 1VKJA 3FHOA 4V0OA 2QL6A 1RC8A 2FPLA 5CK5A 4Q4AA 2QPAA 3B5JA 1AM4D 2VH5R 1AZSC 1OFHA 4Q4LA 1W4CA 4DDWA 5KUTA 3W3AA 4TWZA 2IBMA 2VL7A 1L2TA 5TARA 1DARA 1OH5A 2HT1A 1UEIA 1KAGA 2Q9BA 4TYWA 4IOMA 4QJ5A 3U60B 1CJUC 1QRAA 3ETLA 5F9HA 1G7TA 1E2MA 3HP1A 3WYGA 1ZP6A 2GEDA 3QJYA 5JI3E 3EZFA 3TSOA 2PBRA 1G18A 1P4SA 3GLIA 1IONA 1M6NA 1WRBA 4XSGA 3NDBB 1P6XA 2GK7A 3QVUA 5FTLA 1CU1A 5FBQB 2XNDD 3ZD6A 3A1SA 3AUXA 2JIZA 5GJVC 2EW1A 2IWRA 3LDAA 4X8HA 2WTUA 2WWWA 1Z0DA 2CK3A 4DLVA 3MMPA 1MO3A 3B7GA 2CNWA 4II7A 1G8GA 2QPOA 1R4AA 5KTYA 1D8TA 2DCUA 3VHLB 5B2ZA 3FMOB 1IOZA 1KDPA 3QXCA 3ADKA 4DUGD 1GAJA 2GILA 3DOFA 1FL9A 2IHBA 4LX0A 4EPXA 2IYVA 1HURA 1GM5A 1M7BA 4OK6A 1T9HA 1W4RA 3KXLA 2QI9C 4AG6A 2YOFA 3QENA 1XX6A 2BBOA 2V6JA 4TQAA 1IN5A 5EE9A 3IDQA 4XOIA 1CULC 4YMUA 3EPJA 1LF0A 2FEMA 3ZLJA 4IVPA 2VHTA 4AK9A 3QSYA 3IGFA 1CS4C 3U3KA 3SBDA 1JI0A 3LO5A 2KBEA 3MFYA 4HEJA 4HB3A 4JBXA 2XTZA 1Z6GA 3AKYA 5SZKB 2ZYTX 4KCGA 4DXAA 4XSHA 1DE0A 2QU8A 4LCBA 2CCGA 3W6OA 3ADBA 3KXIA 5B64A 3TR5A 3X2SA 1J7KA 4A9AA 1SXJC 3U44B 1XP8A 3Q8XB 3ZVRA 3SJBA 4FINA 3FFAA 1M1YE 4D81A 5KYKA 4RCZA 2X19A 2AFHE 1NN5A 4B33A 4IHQA 1G3IA 1D9ZA 3NKVA 5EXXA 3DM9B 2VP5A 2ZRCA 3EW9A 3IIJA 3DO6A 3OEHA 1O3YA 3C4JA 2ASEA 4D2IA 2Q6TA 3C5HA 3RLFA 4E5UA 1E9DA 1TADA 2VP4A 2IYTA 4F93B 1AS2A 4P4UA 2IS6A 2ATVA 1KI3A 1JJVA 2BJVA 3QF4B 2QRZA 2WM9B 4TMWA 2ZJBA 2E9SA 2J59A 2YV5A 2ZETA 2I3BA 2IUTA 4HB2A 5AWFC 4DSOA 4M9QA 4PR0A 1IBRA 3L0OA 3HYTA 2HLDD 4G0NA 5LD2C 1XZPA 4POAA 5FOUA 3W8NA 3KFXA 4F91B 3VAAA 1KI2A 1ZJ6A 1KO8A 2GHIA 5KSZA 1XMVA 3IHLA 1FX0A 3LXXA 1Y63A 1RE0A 1QVRA 1SVIA 2LKDA 2GF9A 2MSEB 2FSFA 2GCOA 5KNDA 4HI0E 1H8HD 4HDOB 5IK2D 1YE8A 5EXTA 4WIAA 1VG8A 4GDFA 4DLUA 2AKYA 3LBHA 3L82B 4JLAA 4KO8A 3PEWA 2Z5FA 4TLEA 1KJZA 3CNNA 4D4LA 3FE2A 1A5TA 4YDSA 1EWQA 1F2TA 3UG7A 2IUUA 4AKGA 1Q1QA 4Q1AA 4Q9LA 2QG6A 4HATA 5KPDA 2W6IA 1DADA 1Z08A 1R0ZA 1MV5A 3E1SA 2PLFA 2OAQ1 1EX6A 1BMFD 2ZRJA 1UKVY 3KFVA 4ASUD 5EZ6B 1FZQA 3EARA 3RDPA 5FL3A 1LV7A 1OLOA 2KI5A 5KDOA 2VF7A 2C9YA 5JWOA 4TLAA 2HYIC 3VTKA 3CRW1 1E69A 3ICQB 2ANCA 3Q5DA 4DDVA 3TLXA 2CDNA 3QXSA 4HSEA 4JLKA 1Q21A 4D4KA 1OYWA 4US2R 3LXRA 4Q4JA 3EZ9A 4I99A 1ZNWA 3Q3JB 3TRFA 3WYFA 5GVSA 4V02A 1HEIA 5EE0A 1XF9A 3VHXA 2DBYA 3B13B 4DWJA 2IXEA 4US1R 2CBZA 2WBLC 3QXHA 4IDOA 4RD3A 4DLXA 1VHLA 1DG1G 1E1RD 4G1UC 4JS0A 4LYFA 2J7PA 4JJZA 1HT2E 1T0HB 2BMJA 4NMMA 5EP4A 3KJGA 4CEHB 1SXJD 3I4LA 3ZDQA 1Z2AA 3TE6A 1YJ5A 4BLTA 1NY6A 2ONKA 2W2VA 3QBTA 4KFRA 5TXGA 3AGPA 5DIFA 3U7GA 4A36A 5J47A 2DR3A 3B85A 2QBYA 3B9QA 1COWD 4LJ4A 4MRVA 1AA9A 5LDDC 4LSGA 3TVTA 5KSYA 2NO1A 1IQPA 4X8MA 1WBDA 3TSWA 1E0SA 4Z1MD 1TEXA 3AF1A 4OBEA 1CR2A 2P67A 1ZD9A 2RGGA 2FZLA 2R44A 3Q72A 4DB4A 2IYZA 3I5XA 4NYMR 3VKHA 2HJGA 2QRNA 4BFWA 2AL7A 4RD1A 5DYIA 3THYA 1C1YA 4IOKA 4EFLA 2O8DB 3AF0A 2ODWA 2W58A 3AKCA 1NN0A 2REXB 3RNLA 2R6CA 1G20E 2EFCB 2OXRA 1PLKA 1R6BX 1RYFA 4EQ6A 4U02A 3DZ8A 3LRPA 4GNKA 4D0GA 1NN3A 3N2IA 1ESMA 1MH1A 3PXGA 4LY6A 4TTQA 3BOSA 1AIPA 4O25A 2FH5B 3OIVA 2W0MA 5E4FA 1NG9A 2FSIA 1Y3AA 1N0UA 3G0HA 5KU1A 3IO5A 4DLZA 2IYWA 4LJ5A 3BE4A 1X1RA 3CLVA 1E94E 4X8OA 3T1VA 3I92A 2C03A 2QSZA 1QVAA 2PZFA 2ZJOA 4JLPA 5D3MB 3OHMA 4I81A 1XCPA 1E9BA 3AVOA 3K9HA 4NKRA 3VR2A 4JLVA 1U90A 3LWNA 5AK0A 4OYHA 3AP2A 4ZPXA 3WP0A 1TTTA 3QKTA 1G21E 1Z0IA 1CEEA 3D6TB 4RKFA 5LD2B 3HPRA 5LB2A 1S1MA 4CW7A 4WZ6A 2IYQA 2J3EA 1VHTA 1PLJA 1G19A 3FKQA 4OQLA 4HAZA 1EK0A 1D2MA 2FFQA 2GJSA 2NGRA 1U0HC 1YQTA 3U4QA 1CR0A 1QHIA 1RRFA 3RS0A 4HB0A 2OEPA 2REOA 3DDCA 3OAAD 4XVUA 3OEED 1TMKA 3BGWA 5JSZA 1GITA 2JATA 4MKFA 4E07A 1S0UA 3UIEA 3GJ7A 4EPTA 2CCJA 5AUNB 1IY2A 4MKGA 2VBCA 3NTUA 1R7RA 2AX4A 1T91A 4Q66C 5SZHB 3EG5A 3IPYA 1KI8A 3KL4A 4LUCA 5BYJA 2ZE6A 5LPNA 5KOYA 3NBYC 2ZYUX 4CGZA 1G7RA 2EU8A 1E0KA 3ADCA 2RB4A 2D74A 1NSFA 1L7VC 2WIBA 5FL7A 1E0JA 1E2GA 3EC1A 4RFSB 2BDTA 1LTQA 1R8QA 3B2EA 4DCSA 3LVRE 5G3ZA 2ZI7A 4ZDJA 2C8VA 2O0JA 2IT1A 3A1TA 5FTKA 4CDGA 1OT3A 4CYMA 1CF4A 1XTKA 1GRRA 2V54A 1JXMA 2Q0HA 3E5HA 4A0RA 4LC1A 4CZ2A 3KQLA 2QROA 3ZIAD 1KDRA 1IY1A 1Q1ZA 1X86B 2GCPA 4JLNA 3EXAA 3VNUA 4DVGA 2HF8A 2RGBA 2JLQA 2AFIE 1XRJA 1F5NA 3UG6A 3THWB 1B23P 2X77A 2YWEA 4IRUB 2FDCA 2GXUA 4B3GA 4C0BA 2FSGA 2WWGA 1AK2A 3FB4A 3U7HB 2ZJYA 1G3MA 1XJCA 4MYHA 2FZ4A 3WRXC 5HZKA 1E1QA 2FV8A 5JEEA 1N25A 1ETUA 2EVWX 3B1YA 1LNZA 2KJQA 2IEYA 2CHVA 1A82A 1YZTA 4NU0A 1UPTA 2ODNA 1HE1C 3C5CA 4TT3D 4TMTA 3A4NA 2QMOA 1KY2A 1IN7A 4CEIA 2ZS7A 2OSBA 2JA1A 1P5ZB 5B58C 2V6IA 5L3SA 5FPTA 4ZCLA 2KSQA 4OI2A 2OAP1 2UVQA 3ONWA 3FFBA 2H18A 1R0WA 3QPWA 2OV2A 1P75A 4DRZA 3D8BA 2V7QD 4URVR 2DFTA 2AWNA 3T5GA 1S1CA 4HAWA 1YR7A 4EFMA 4GZLA 2OHFA 1A2BA 2ZVPX 2JLXA 1PLLA 1YR8A 1KTVA 2IYUA 2ZJAA 4TZ0A 4A6XA 3JZMA 3V00A 3SBEA 5KDLA 4AKIA 2A9KA 1CKEA 2JJ8A 4YDHB 1EGAA 3KKPA 5DI3A 2D06A 4A82A 2ZITA 2O8CA 5BXQC 4QM6A 5DISB 4I4LA 4IDPA 3KQUA 1U99A 4TL9A 4BLOA 4MRSA 3BXZA 1G4UR 3FHTA 2P6UA 2WWXA 3GQBA
chains in the Genus database with same CATH superfamily
2Z2KA 5I7AA 1WKVA 4YH1A 2BFEB 2O2EA 1WMBA 2OV1A 5A6SB 1WD7A 1RVV1 3G5MA 5DOVA 1BVUA 2DE0X 2EFGA 3R23A 4BRWA 3K31A 3E35A 1CUEA 2E4AA 4MCHA 3SJZA 1T3ZA 2NV0A 1EZ1A 2B8WA 1LSJA 1KF0A 3PITA 1NVDA 1B41A 4NLLA 4P84A 4BBAA 4CBVA 5F1PA 4CKCA 5C37A 5IZCA 3WAGA 4ARCA 3MA0A 4PX2A 1HQCA 4P53A 3THWA 4OVKA 4R2LA 2OHIA 2MSWA 2RHHA 4X5OA 4BO3A 3W2GA 5EAIA 3HXKA 1WCXA 2FVXA 3R77A 2YFYA 3EB9A 2QN2A 1C4OA 2O0HA 3D1LA 3U3JA 2B34A 1AV7A 1DRWA 3DLCA 4NU8X 5AI0A 5F1OA 1A96A 4AUEA 1TW2A 4PYQA 4XPIA 1OT5A 4XQCA 3S5UA 3ZEAA 1OV4A 1V4VA 3FNBA 5AJZA 1JAHA 1SKQA 2HU2A 5T7BA 1TEZA 1U9YA 2QRVB 3ZVKA 3PKZA 5EJ6A 3MUNA 3HKCB 1NVVR 1RBYA 3O8OA 2P2DA 2D59A 5ECGC 1CQPA 2P4QA 3BERA 4HADA 4HNHA 1U7DA 2ZIVB 4I1IA 4JWTA 3U4HA 4EG5A 4C4ZA 1E77A 4R16A 3VR6A 1U5BB 1UPBA 3PHLA 5HWSA 3EPHA 1H3EA 4QWMA 1AGXA 2I4NA 4F1WA 4G5GA 4N0DA 2PZMA 4Z53A 3R2JA 3TG8A 4D9HA 1WP9A 2X3FA 3EJWA 1W0KD 4G5QA 3LM8A 5L6LB 4FYWA 1Y8ZA 4CMJA 1JHUA 5KTSA 4XIGS 1MIOA 1EFUA 2VAWA 2ATCA 4B0OA 5HZMA 2AXNA 2NOAA 4QRDA 5H83A 3GLFE 3DC7A 4EO9A 4TMXA 3HNPA 1E62A 2JJ1A 4H3SA 1A4RA 1PEYA 4YJKA 1J8QA 4QODA 3RC7A 1GG8A 2ZIXA 3SN6A 2QHXA 4YDQA 1T34A 1G0OA 2ZEJA 4FNOA 4YQFA 3R8FA 1KL7A 2QV7A 3HB0A 3A26A 3ASVA 3KU1A 2G1AA 1XCBA 4NC9A 3MELA 4UM9D 4AIIA 3CPEA 2XOKA 3GL9A 4F46A 2HRDA 4D3SA 4MDHA 2ZE8A 1QDEA 2VZ8A 2H7VA 1FRNA 3CGGA 1E7RA 3GMTA 1ISMA 1XMIA 1ZWKA 2XWPA 1NYTA 4FDMA 4P22A 4PTZA 3W1WA 3DVSX 4CDMA 4IIGA 3WRYC 3K0CA 2NU9A 1GGKA 4Z0NA 1DAPA 1PSZA 3QXJA 3NAMA 3WQBA 4RS3A 4QYTA 1A8IA 4OBBA 2O5VA 5C4IA 3VNRA 2XRFA 4BWGA 2ORVA 5J1SB 3NHMA 4JI8B 2IE8A 1DBIA 4RNCA 1O2DA 1EVQA 1Q1NA 4U2DA 1T2NA 2RAPA 2VP6A 4UM9B 3V33A 3QTBA 821PA 4I1YA 3CRVA 1JQAA 2YNMC 4Q3EA 3L1IA 4XD2A 1GARA 1G9TA 4DFDA 1JTEA 3CVUA 4AJNA 2OZVA 4KKVA 5HBGA 5LZ8A 1TQ4A 4FFLA 3GD7A 4M1QA 4R1PA 5G0SA 3D8HA 3CG0A 3X1DA 4OX9Y 1PR0A 2JDID 2VHXA 3IQZA 1GUDA 3BL8A 3WA6A 1ZLYA 4BVGA 1JJIA 4CR8A 1QSGA 1WW2A 1K8YB 4BE9A 3GRYA 4L8WB 1KOGA 5CDUA 1T4CA 3PF9A 5K8TA 2VJYA 3MS7A 5THXA 3HYLA 4QXOA 1XOIA 5TSDA 2WNHA 2DH5A 1JHAA 3KU4A 4DY4A 3REGA 3G7NA 3ROQA 1KJ9A 2QUHA 1FXSA 2V7VA 4Y2PA 2PUHA 1L5SA 2GBFA 1XAIA 4LC0A 4AI6A 2O1EA 2ZJFA 5CYPA 2IGBA 1R6XA 4M7OA 3AEZA 3RRMA 4BVLA 1MEEA 4IJWA 1CE8A 2E37A 2XA1A 4S1NA 1DAKA 1U65A 5DHPA 1XD8A 1XU9A 1T3HA 2YVQA 3EWNA 5I01A 3LUBA 4YMWA 4B35A 1RNLA 5JALA 2B9EA 1T0IA 2YC4C 4DCTA 1ENPA 3GDGA 4KMMA 3RGGA 1DS6A 4DMGA 3OX4A 1XVUA 4M9SA 4M46A 3VUEA 3WAJA 1FSPA 4C04A 4C07A 1OREA 4UQLA 1IY9A 2QX8A 4QUHA 2X3YA 3WS7A 4UU1A 4CLRA 1CCWA 5G53C 1YVRA 1CQZA 1JDJA 1II8A 1Q17A 3EDQA 3KVRA 3O38A 5DXFA 4BEJA 4A2PA 5AW8A 2Y1LA 1VPEA 4NMLA 5K3OA 3KVVA 3GLHA 1IJEA 2Y0BA 3LX5A 4JBIA 1CZUA 4BEBA 3M89A 3QEKA 1NYLA 4DKXA 2IX3A 2RCYA 1A9PA 3LYUA 4J03A 1JDZA 1U1CA 3VYTB 2Q4BA 4GSKA 4C7KA 2DJIA 5K03A 3JQGA 2EQAA 1LSOA 1MPXA 3U4MA 3LHSA 1KKMA 5IPFA 2BN4A 3ISVA 3OURA 2WTEA 4PZPA 4ZOQI 4LDPA 1U5AA 3SZOA 1XFAA 2C07A 4PO1A 4KE9A 1ZUNA 4LTDA 4U5XA 1Q19A 1FU4A 4UAGA 3BWYA 3DTVA 3G0GA 3DB1A 1KEVA 1SU7A 1D7AA 3KQSA 2XMQA 1H0HA 2BFDB 1SHZA 3CEJA 2NLOA 1JR3D 1UXGA 2VPQA 2ZTSA 3BRCA 3IXMA 4PX5A 5AM0A 4ZC8A 5M04A 1PVVA 4PZLA 4DJEC 4EDHA 1CZOA 1L5YA 2W9XA 5DNAA 4L4UA 3D8TA 3RREA 3PPVA 4RZ3A 1G2IA 4XPZA 1DWPA 2BBWA 4NK4A 2DU8A 3LRTA 3T94A 5JUWA 4WXMA 1WWKA 4KLCA 2IPAB 4QGSA 4HEQA 4WADA 5M2QA 3ZY4A 1SVSA 3L0PA 4LECA 1KK2A 9ATCA 4DUYB 5E6UB 3QEMB 2VQDA 3FHLA 3G9TA 3VGPA 1WHSB 4A2CA 1FYVA 2HDNB 3OMXA 3RRZA 4GI3A 5KYYA 1ZUHA 1H4SA 3L6CA 3OP4A 4CEJB 2KHZA 3BYZA 1UPUA 2PRZA 3AEKA 3RD5A 2P9YA 4RVCA 5DBGA 4DQLA 2CHGA 3EQZA 1OJLA 1A8HA 2JFWA 4JLSA 1FA9A 4RSHA 3VKWA 1Q14A 2PEYA 5F2EA 4OA5A 5F77A 1AUPA 4DNFA 3KSZO 1A9QA 1TU4A 1GDHA 2CL5A 2FZCA 4IXMA 1MNAA 4HUQA 4PQYA 1AUOA 5EUQB 3OZIA 1EK2A 2IH4A 1ZZGA 5EC8A 3K70C 2W2NA 1I6LA 4UCQA 1Z2NX 3OQIB 5E3HA 4Q9HA 2FRDA 1N4DA 2JAQA 3JQ7B 3TMYA 4EFKA 4QGFA 4TV9B 5I7RA 2AE2A 4AQYB 4OHVA 2YW9A 2PUWA 3P2IA 2MSLA 2FWIA 2FN7A 2QG9A 2AFRA 4NOKA 4IEFB 4V0ME 4E31A 2QLBA 5BO5A 4RTPA 2X8WA 4UFPA 3T3GA 2FPGB 2AR9A 4WN9A 5JDCC 2AMFA 4IIHA 4MV3A 2PV7A 4IJVA 3OQBA 3O31A 3GA0A 3HWWA 1N2GA 2FZGA 4X00A 4A23A 5KIAA 3AFHA 2JFYA 3QG5A 3AKEA 4J0FA 3SHWA 1MHTA 4FFRA 2QN3A 2I2FA 3PPXA 4N0MA 2WFMA 1ZRNA 1FSSA 4NOMA 4LBVA 2DECA 4XQEA 4ISCA 3QU7A 4J16C 2BFOA 1H66A 2WOOA 1G5RA 1G8MA 2XZPA 3CMCO 3T3PB 4GE3A 2ZM5A 2FK7A 1G1AA 1IXSB 2HBQA 2QMUA 1INLA 1PSDA 2W2PA 4OJYA 2XB6A 3AOEA 5GOTA 4WCFB 1L7RA 1TRKA 4XVRA 4QXPA 2JFGA 4BX3A 2HLPA 1WX1A 2Q6IA 3LQ2A 4FM9A 1L1EA 1ZNQO 3EDRA 1I4TD 3G5UA 1V5EA 1V7PC 4XJTA 1WMSA 1ULTA 2P6NA 1W7AA 3A9WA 2VYFA 2RJOA 4EL0A 1B16A 5LZ9A 1VJ1A 2I3GA 3JWJA 1CLUA 1E79D 3HJUA 5DX8A 1OI2A 3UHOA 3VPDA 2W6JA 4NSNA 3L5OA 4Q6WA 2KWIA 4HN4B 4WGGA 1XZQA 4PGAA 1EXVA 1PT7A 2WSIA 2XUGA 3IDSA 4KUHA 2FQXA 3IAFA 4U7DA 4Q4DA 5CB8A 4JLWA 2VJQA 3X1MA 1VG0B 3T3IA 4JVMA 1ZHOA 2NTYC 3DLBA 4IDHA 3HUTA 4I46A 4HGRA 3AUSA 4DT1A 4ZDKA 1BKDR 2ZJ2A 1M6VB 1F2DA 3MJEA 3Q6MA 4QECA 4QLAA 3AF4A 4EMSA 3ORQA 3V7NA 2C5AA 5CEJA 1ZJ4A 1E1LA 5ER6A 2HCRA 3R9IA 2UXCB 4KB5A 1KETA 4IS2A 2PKWA 4EARA 2HA6A 4R9SA 1JFFA 1C9YA 3FRIA 1GUFA 4UTOA 4JLOA 1L5RA 3W5IA 3VJLA 1FUYB 4DNOA 4ID3A 3SHOA 1N5IA 5CTJA 4DMFA 4F4HA 2EGGA 1B73A 2ET6A 1W581 2R84A 3IUSA 1IYZA 1SCBA 2GN6A 4AC9A 1TJ3A 3C15C 4BE4A 4QKQA 1JR6A 2V7BA 1GG2A 3GG2A 3LDHA 5I4CA 3UN1A 4RY8A 5IAEA 4LDQA 5LP6F 1F9AA 3FDJA 1ZK1A 4D96A 3PIRA 4UFOA 1WUTA 5DO9A 3FTCA 1HTTA 5EN4A 3D7KA 1OWLA 3E9NA 2YRFA 5ALLA 5AK4A 4F6RA 1NVEA 1KNQA 4MP6A 3JYOA 2YZGA 4J43A 3E2PA 2E4XA 4GBMA 5AKLA 3HSSA 4RTSA 1M1UA 3AEUA 3EA5A 4CTJA 3OQNA 2EDCA 4MS4A 2QORA 4WBNF 1WOYA 2V6GA 1BQ3A 1VPTA 2HK7A 3FVRA 3F6BX 1ND6A 2IYFA 2JFZA 3LYHA 3P0HA 1TEHA 3OMWA 3PRYA 3HKDA 2B4QA 3DDSA 3LWDA 4EKNB 1Z35A 4B4DA 4PHTA 3RAFC 4P7JA 3UB2A 1GP2A 4F3RA 4DCOA 1GT6A 1GPBA 5JY1A 5A4JA 3ZHYA 2DQ4A 3CRRA 2WEKA 1QMPA 2X9GA 4I66A 5EXPA 1WMEA 4AZTA 4J1SA 1LUAA 3TN7A 4EGAA 4EKGA 5ELXA 4KWCA 1YK0A 3C48A 4M22A 4JI3B 4HMPA 1VIAA 1E5TA 1W8IA 3UW1A 4OI4A 4BNIA 1HQDA 1I24A 3TIXB 2VSYA 3W3AD 4COKA 4FZVA 3DVAA 3MLAA 3T5DA 2AWOA 1M76A 3U81A 1JEQB 2FSSA 2RH5A 3DKVA 1V43A 2Q6LA 3JAKA 4N5MA 5B6PA 3T54A 2MU1A 2WKQA 1N1EA 5EIOA 4OGWA 1H05A 3MRVA 2P35A 1YDHA 1EFVA 3ECSA 4CNBA 4QOSA 1AKQA 1RLTA 1IG0A 2C7GA 3Q9LA 4F9FA 3JPWA 1O94C 3HVJA 3N8NA 2BUAA 3HXQA 4RANA 4GR9A 3MW8A 3N2NA 4H6WA 1B0AA 2D1YA 3ESXA 4L8LA 1P0PA 1CUCA 1SG9A 2CLLB 3GCGA 4HH0A 1F0KA 2OZLB 2XITA 4KPUA 3T3EA 1VJRA 4K9DA 1QCYA 2J87A 3VDRA 1U4SA 1ZNZA 2UZ1A 4O4HF 3BK2A 1QV9A 1A72A 1PQUA 2FGJA 3L2OB 3AVYA 4XWOA 1Y6RA 3E3LA 1XPRA 3DM5A 2FI1A 3OF5A 4WZBE 3Q87B 3ORRA 4ZVSA 3ENZA 3UXHA 4IHKA 4MJ3A 2C57A 1L4EA 4MB0A 4EHAA 4PFJA 4UC0A 4DPKA 2MOKA 1U7OA 4TKUA 3ZU4A 3L84A 4MH0R 1JUDA 4J0KA 5HQ3B 1JILA 3HZZA 3QPUA 1DG3A 3ILYA 4S35A 1WVGA 3LUKA 2DZDA 2E4WA 1Z5UA 2OR3A 4R1LA 4FVTA 5KTPA 4GBJA 3NHJA 2C8LA 2GF0A 3CBGA 1SU4A 1Z8NA 3Q0EA 2F7SA 1GIAA 2D4HA 2R4UA 1J22A 2PL1A 4ZK2A 2ZIEA 2XH8A 1UBTS 3QVVA 5HILA 5EG5A 3EK2A 1WXQA 1XAHA 1MV8A 2F9MA 2HF2A 4Q19A 1FDTA 4RBNA 3BD6A 4XKJA 1NQVA 4FWIB 3LQQA 1UDXA 3GJ0A 3COVA 1EM8A 1I80A 1AKTA 1GU1A 1SOUA 2AC7A 1GAWA 4FMCB 4KE6A 2I91A 1BDIA 1W48A 4K05A 5E4YA 3GEHA 1MB4A 2I6XA 1ILWA 2BEWA 3G49A 3JVDA 4PCLA 5A0VA 1MHPA 4KRXA 4EUSA 1G66A 2WHPA 4FQ7A 1RAGA 1Z7WA 2GPSA 4K9SA 3OEHD 1V2GA 3LHKA 5EJ4A 2YYSA 3GIDA 4I1VA 3QKSA 1FZTA 3BWBA 3WL6A 5CVJA 2GVZC 5JH7F 3CZAA 4HBZA 4Y7DA 2UYHA 3DTYA 3IP1A 5DMXA 1K5GA 1FLDA 4RNDB 1IBKB 1N2IA 3DHWC 4ZGWA 1OZGA 1X9GA 2WG2A 4ZJPA 3BB1A 3U61B 2Y1OA 2DEUA 2FZWA 4W7SA 2Q3JA 2VUHB 1X0VA 2XCOA 2XCTB 1S8FA 3USZA 4EABA 5HR5A 4P4SA 5J2TB 4X65B 3C7AA 2VT3A 5LUAA 5LNK1 3VR1A 2OD2A 4YRTA 4DMMA 5DVZA 3TNJA 1RWKA 2HF9A 3U19A 3WTCA 4BYGA 2PKEA 1WAMA 1TU0A 3HJRA 5HRCA 1JG1A 4WBXC 3PF8A 1EFHA 1D5WA 3DFZA 3SX2A 2NO0A 3A70A 4LXGA 4XUDA 1YT5A 5IEBA 3TZHA 2J41A 3CVOA 2VWQA 2FR8A 4INJA 1N6KA 4E15A 5IDYA 1YRQA 4ALKA 4DWJA 4YCMA 5A9SB 4TYQA 5EJMA 4D56A 1OXTA 3PI6A 4R2KA 5M34A 3WNQA 3BIWA 3EOBI 3L7IA 1RXCA 3FWYA 4O59O 2UYOA 1QJCA 4JOSA 5INTA 3IC5A 2A0UA 1HDZA 3FPSA 2XOXA 3VX3A 3ZNOA 1SUIA 3DEKA 5BUCA 3DHYA 5C7LO 4X24A 3R9KA 4IZ6A 5FWYA 2IKQA 2W6ID 3PR1A 4L28A 2A84A 4YRNA 1ES9A 2VRBA 1SBIA 4FYHA 4DQXA 1SCNE 2WAYA 4H7FA 2V7EA 5HBRA 4GW3A 5JVDA 1NPYA 4QWWA 3I9V6 3WWEA 2HYDA 1R8XA 1LX7A 1O96A 1XCMA 2R6ZA 3PVSA 2WU0A 2IPLA 3FSRA 4QDZA 1QRTA 4L0DA 1E4OA 2WYUA 2ID7A 1MCZA 2C77A 2OBNA 5F52A 5AKHA 4Z7QB 1S4MA 4RDIA 2FUG1 5HF5A 4Z5XA 3K9LA 5BMVA 4B3RB 1XQ6A 4NCHA 2GPWA 4R54A 3DKKA 3A3OA 3WO1A 3IKJA 4C5BA 1YULA 2BMAA 4FFOA 3HO6A 4BVBA 4BX0A 2YIVX 2L18A 2QRLA 5FTJA 3HR7A 4YRRA 2XB9A 3MMXA 4KO3S 4ZT6A 1IOWA 2JCGA 4YUWA 1C4KA 1QH9A 4O6VA 2CJWA 3TLAA 1N2OA 1HFJA 3FPHA 3S8MA 3GU3A 2F3RA 3EYWA 1XF1A 2VRNA 2J7PD 4BIMA 4C4AA 1Y6FA 5GJBA 1QF7A 2X9VA 1B4DA 1F5SA 3LPAA 3VC1A 9LDBA 4YMSA 5FI1B 1YJXA 2R4QA 2B61A 3R0VA 2A9OA 1RCUA 3HXOA 3TTTA 2JFXA 3NJ8A 4Q4JB 4K9PA 4MUKA 5F7JA 1GQRA 4BUZA 1C8VB 1GN9A 4F4IA 5J2UF 1VSBA 4D6PA 2PKCA 1BS1A 1NM5C 4G5XA 1T9AA 4LNUA 3TOXA 4B43A 1P2UA 2RI6A 4LMAA 4G1EB 2V9ZA 3JQDA 5D7NA 3E2MA 4UBNA 2RGNA 4AZ3A 1QIEA 2FX3A 1DOAA 5BYAA 4CCYB 2PSDA 5BSUA 1MIHA 1NNUA 4NE7A 5IAKA 2PBFA 1CBUA 3T0IA 4XFDA 1WEKA 2PLAA 2W98A 3SQWA 2VDLB 4WH0A 3CR3C 3ZKWB 2ATXA 3VU0A 1JKMA 3D6FA 4JFAA 4UHDA 4CHGA 1KBOA 1T15A 4QU5A 2WU4A 2PGXA 5CXQA 2QQ5A 1QYCA 2XV1A 1OFTA 3AVPA 4L27A 1MB2A 4TYNA 1PYGA 3AHIA 3T1HB 1UANA 3C6BA 1NI3A 3DZIA 4EEKA 3OCJA 1E6MA 1O03A 1J0CA 1CJVC 1J09A 3MCVA 3ER6A 4KGVA 4QBFA 3SR3A 3LW8A 1QWSA 2DWOA 4DGQA 4LFCB 1JQBA 4EGSA 3PHBE 3MCUA 2OLJA 1JSLA 1TYEB 3QVOA 3TQRA 1PHRA 5GADl 4PWYA 1OKKA 2C5GA 1ZO8A 3N75A 1PGJA 1R6DA 2WUEA 4LRXA 4MVJF 4R01A 3RSOA 4AD8A 3O0TA 4E46A 4UEKA 2QNRA 2V96A 4RV9A 3UMJA 3F74A 5IYZF 4AJ4A 2BIFA 3C1UA 3OF2A 5EJ5A 1PK9A 3D8RA 3L4BC 4FBGA 2F6RA 3BF8A 2FPPA 4KR3A 1G6OA 2C5BA 4RPGA 4R3WA 3IEKA 4L57A 4V1CB 4RD4A 1DMRA 1OFUA 5KWEA 1J2EA 3GUUA 1G17A 2DWPA 2BEUA 2DKFA 2FMXA 1TXGA 3GLSA 2VS1A 4XD7A 3CM0A 4DV3B 4EYEA 1ONBA 1O95D 3K0EA 4BNYA 1M8JA 1W59A 3V4VB 4MYDA 1AKMA 2QRHA 3OQMA 3QHQA 4J3NA 3UJ3X 2Y2UA 3D6MA 1MORA 2GM9A 1EBBA 3UM9A 3MMNA 3PJRA 3RE1A 4P4NA 2C2XA 2P1RA 4R84A 1YZ3A 2BEVB 2Q1YA 3T9CA 2AOUA 1XZEA 3ND8A 2AN1A 4RA6B 4XWKA 1SWWA 2CWWA 2LP4Y 2XXBA 1EUZA 3BREA 1D1PA 2HY7A 5KNBA 2VJKA 5ADUS 1KI7A 3AY3A 1B8PA 4BVKA 4JEUA 3VVLA 2ZQYA 3MINB 1JYSA 4MWOA 4N7JA 3R1IA 3WGUA 3O2NA 2HV8A 1EJ0A 1SOVA 4IP0A 3LDFA 3UXEA 3RSLA 3KTAA 2UU9B 3K15A 3CLSD 2J0VA 3KD3A 3OZUA 4K87A 2OGUA 5J23A 2O59A 1TGVA 1HDGO 1QORA 2AR0A 3KKQA 1OFVA 2IY8A 2A88A 2RK6A 2NACA 1Y1SA 2PWPA 5EWLA 3V7FA 3AXTA 3H87A 4CHTA 4K6MA 3MFQA 1JPJA 3TJZA 3ZWXA 3L18A 5BWBA 3UQYS 1G2OA 1VPVA 2VH2A 4W9NC 4GLJA 5HCIA 1FNDA 1T24A 2YJNA 4Q4HA 5K0GA 1JDVA 3P2KA 2DAPA 4WV3A 1MOSA 2JIQA 2GFIA 2AC2A 3IKMB 8ADHA 4KBFA 1E1QD 1A76A 1EBFA 3MERA 1EE9A 5BSKA 2QUZA 4XTCS 3INYA 3UH1A 3BCSA 4GGMX 4GT1A 1YFJA 3KV3O 4RLHA 1ODJA 5FOQA 4I9NA 2A9VA 4HDAA 4IXDA 3LCUA 4P3KA 2IYEA 4H3HB 3E1GA 4L6AA 1ORDA 2ZIGA 4XXHA 1F8FA 1FRZA 2QTWB 5CVDA 4C2AA 5HXAA 4YT5A 3LTEA 4E08A 4JQOA 3HFRA 2B3TA 3CUUA 4YJ3B 1N0WA 5KBYA 2HGZA 2V03A 2W37A 3M6UA 5TLSA 1T3TA 5E7MA 2HQ1A 2WYIA 4MQUA 1HG0A 5H9VA 4CT0A 4ILEA 3UK0A 4LNHA 3U48A 5IARA 5IKOA 3TGPA 3JQCA 3K32A 2FLVA 3I2IA 1GD1O 2B4YA 5G3YA 4PYOA 1JECA 4XYEA 2YXPX 4LPKA 1FYXA 3NETA 4URZR 2XE6A 1ZOSA 1YFKA 4YONB 3U4AA 3V8MA 5BV7A 3V55A 2IZ5A 2CL6X 4OXYA 2AEEA 1A9XB 1F8XA 4MA0A 5L3SB 3A1UA 3KUCA 3P5BA 1L5GB 2GBLA 3RCBA 1YAJA 1IBSA 3GBSA 4W7HA 1AGNA 1JKJB 3D2CA 4OD0A 3WKCA 1SQFA 1CNEA 2QJFA 2I55A 2WLSA 2W4MA 1ZH0A 2XT9A 2YFHA 3ZXIA 2Y67A 3B1ZA 3E9YA 3Q3HA 3HY6A 1KIAA 3I8XA 5CIWA 1RE1A 3MTJA 3UF0A 4QVKA 3K6JA 1R2QA 2F3TA 4ISBA 5FUVA 3VR5H 3T7IA 1QH1B 5IAOA 3MQ4A 2NXEA 2DXIA 4K0KB 2QJOA 3JW8A 4QAJA 3R7NA 5LWHA 3TLZA 1LDGA 4N0EA 4D6XA 3M6LA 4EPRA 1Y1PA 2V97A 4MJXA 1BJTA 1ICEA 1OWOA 4TTTS 2XKBA 4X84A 2NZJA 3WK6A 4MRNA 4PZ9A 4WHMA 3I28A 5H1YA 5IMBA 3TEMA 3TNFA 3DDOA 4C7VA 3GARA 2PUCA 4MW9A 1R0LA 4I55A 3OX1A 1PTKA 2G67A 3ACDA 3CGWA 3JALA 3JQ8A 4HDRA 3KSMA 4HEA1 4MXDA 1Q7GA 5DT9A 1J1UA 3DB2A 2PQ6A 1N5LA 1QHYA 3Q3EA 3EZLA 3FWKA 2AI1A 1E2QA 3AVXA 1QS0A 3ONNA 3RRYA 4UZFA 1MOPA 3TK1A 1UMDB 1XRLA 3BXOA 1P5RA 3C3BA 4WKOA 1HYQA 2H16A 2IXDA 4DG9A 1YI8A 5FPHA 5KVAA 2LXNA 1UDCA 2ZVDA 1PW7A 1OQAA 4QVIA 4UXJA 3M33A 4FDLA 3O4RA 1YR9A 3RABA 4XWAA 2YIDA 1V6AA 3I6YA 2M6RA 4IIEA 4LY0A 4CKCB 1F3OA 3OU6A 4Y1GA 1Z13A 1UUFA 2VZLA 4PCUA 2O06A 1Y3HA 2LUOA 4MLZA 3ENWA 3REQA 2C42A 4LWQA 1EDOA 3VR6D 1Q92A 3M34A 2XUJA 2OY0A 4DUGA 4IJQA 1VA4A 2YZ7A 2ZSEA 4L6CA 4C4PA 1YMQA 4KR9A 2AZTA 4DTIA 4EO7A 3TIFA 5JAOA 4Z4EA 4YC7A 1IWBB 1DNPA 3AEQA 4RZ2A 1S8AA 2JZOA 4JT2A 2PVSA 3WMEA 1GR1A 5IAAA 4XSVA 1SD1A 4XPIB 3L1JA 1VHJA 4G9BA 4U2CA 1D09A 1ZM2A 2J07A 3FUUA 1VE6A 4K1LA 5JAPA 1VMDA 2JJ1D 3A6GA 2VATA 3CLUC 3O8OB 4FYVA 4B2IA 2BYTA 1R64A 5C2JB 2FPWA 5EHXA 3LYLA 1ZDMA 2C2KA 2NYVA 2YFQA 4E2FA 5JNSA 5TDHA 3RRBA 5FWNA 1TM4E 2MINA 1S2MA 1NA5A 2QK4A 3LGSA 5JZVA 2PWAA 3SK0A 5BP7A 2HCJB 2GD1O 1P4HA 2ZB2A 1F38A 2J30A 2XOKD 3C6XA 3RYFA 3WKDA 1MIOB 1N8KA 2ZPAA 3II6X 4DCPA 3MIZA 1KSJA 1RZRA 4FMPA 4LXQA 4PPGA 4HY3A 1MVLA 2FW9A 4FSXA 2H1CA 3A1CA 1OLUA 3PG5A 5JARA 3KQKA 5JNWA 1AGYA 2CT8A 1JDSA 3LZCA 3N5CA 4EDFA 1OXBB 1YA6A 2OUIA 1J9GA 2ZIXB 5AKIA 3MXTA 1HE2A 2E7ZA 4B6EA 4O2AF 4L3VA 2CFSA 2XUIA 1MA3A 1GZDA 1PL0A 1NW8A 4K3UA 4ACAA 2VTBB 4N3AA 3PEUA 3ZK8A 3RV4A 1H65A 2LTAA 4G0PA 5DHAA 5B36A 2JGFA 3RVSA 5LZ4A 3V6MA 4OLAA 1C1HA 1GYQA 1CETA 2DWUA 2QVCA 4YRCA 2MSCB 4DR3B 2I65A 8OHMA 5TY0A 3LJKA 4IOJA 2YTZA 2RGDA 2ZE5A 2ECQA 1Z5ZA 3QITA 4IAOA 1C0PA 2QQ0A 3QVSA 4UFNA 1UJNA 3GT3A 2NU9B 1K6JA 3MVEA 4EBFA 2QJWA 2ZUDA 3D2BA 3FPEA 2IBTA 1VZ3A 2WM3A 1R12A 3UT0A 2F9LA 3ICOA 4YDRA 3EGOA 3K8YA 3COYA 3FSEA 3KP1A 5JATA 4OK5A 5AXCA 5AM2A 2HCFA 1O9BA 4YO8A 3GJ3A 3T95A 4ND4A 3RS3A 4NZOA 5CLQA 4EHLA 1IXRC 2C84A 1L6IA 1UK6A 1MUUA 2C2BA 2RHBA 3IOCA 3A7DA 1KZ9A 5CLFA 1II0A 3SKYA 3TBHA 1KO4A 2CE7A 2R65A 4B31A 4F8JA 3N0TA 4ZMBA 4IKOA 2J31A 1LBQA 4R6XA 1LW6E 5AOVA 4GPAA 3UWKA 1Z7YA 4AROA 3S8EA 5GV8A 1A4IA 1NHWA 5IK2A 1UDWA 2IDMA 2ZVQX 4GLOA 1OIWA 2BGLA 1DBPA 2PMWB 1MEOA 4LDRA 5FEMA 5E4TA 4J4HA 3ENKA 4N9WA 1QFXA 5CX1A 5GJCA 2DFNA 2W6CX 4TLBA 5D84A 3V4RA 1U5CA 5AW7A 3QU4A 1T4CB 5ALPA 3N6VA 4TS9A 3PDHA 1P7YA 2ID4A 4DA8A 4NHOA 2ZRDA 3RVOA 1AKYA 5DNWA 5DSXA 3F8TA 4PR3A 4ZZ1A 2J0QA 4AMVA 1TDJA 2XDQB 5FBRB 3QYFA 5JDIC 3HB5X 3SS8A 3LX4A 4X92A 4G01B 1LS1A 3SC2A 2X6RA 3ZHZA 1P61B 1CE8B 3I1YA 3LFHA 2YINC 5FORA 3QU5A 5EMKA 5JRZA 3ZG6A 2F55A 4ASUA 2HWUA 4KI0A 1DIRA 3TLJA 1I3OA 3QYJA 4C1NA 3HNOA 2WD7A 4JVSB 1Z6TA 3GI1A 3DDZX 4H31A 2BSAA 2LV8A 3OQVA 4E1AA 5AW3A 1AK9A 5LNK6 521PA 1EWRA 2A5DA 2FQQA 2I2CA 2JB9A 2ETXA 3IPAA 4XB2A 4DVJA 2PSSA 2HW8A 2H5IA 1MP0A 2CJXA 4MKIA 4CLRB 3VM6A 3KLOA 5IKEA 1Z28A 1II8B 1TZCA 4G65A 1WV1A 4MGYR 1Z38A 1JT9A 3UUEA 2XZLA 3TLMA 5E1OA 2ORWA 2VAMA 3HS3A 4KVAA 5IM5A 3GLHB 3PWKA 2QLLA 1XVVA 1ZYUA 1E1RA 2HTFA 2PZBA 3DTVD 4WACA 2CMDA 5K3AA 4J1TA 3LT5A 1R0SA 1A71A 2JBHA 1P1CA 2C04A 2W6OA 1AZTA 3IJPA 1DHRA 4AWXA 4CU2A 1MVOA 2OC4A 5I9NA 2P2SA 3CNEA 2Q7XA 1Q0SA 4G0XA 1UKZA 4RY9A 4KRGA 4OI0A 5JD4A 1PUIA 2AN3A 3GCWA 5FTMA 5AJWA 1COWA 2DGDA 3N87A 2XX3A 1K5HA 4NH4A 3EVZA 4JDPA 4QYXA 3UCEA 1YBVA 1XL1A 2Q5QA 1ZUNB 5EHZA 1ZSNA 2XAUA 4KBGA 1WSDA 1ZI9A 1II9A 4IH4A 4Z2AA 2HNBA 2G6TA 3G17A 1E2HA 5HJ2A 1R6VA 1CVLA 3QXGA 1FYDA 1FFCA 1GVNB 1YS7A 1SKYB 3COWA 5TJ9A 3OZWA 3CW8X 3R7BA 3TSAA 3NFYA 5C32A 2YH2A 2EWMA 3KUUA 1WKBA 4LQDA 4XI9A 1IBMB 3FAKA 1JTFA 4DRYA 1RM3A 2X9LA 2WKPA 2FUG6 4MV4A 3BZWA 3AFNA 3QMWA 3R7SA 4PC2A 3EW7A 1DDIA 5CJPA 2TRSB 3WOHA 1C3LA 4HQRA 2XQFA 2QU7A 3ZLUA 3T3NA 3LWZA 4BNLA 1YU9A 1RABA 4RVUA 4X1OA 4CIXA 4B2LA 4ZANA 3IQXA 3K0KA 1H22A 1HTBA 4DN6A 2XB2A 1YUMA 2VHCA 2GZAA 3VNQA 3CUSA 3KSBC 1RZVA 5KYYB 2WTBA 1ZD5A 2VWHA 4A27A 4XIIA 3TR0A 3QUCA 4WK2B 1TM5E 3AEKB 1NUAA 2OP1A 3GN1A 4ALJA 5JJLA 1E59A 4WNIA 3W0LB 4HLDA 3MTDA 3EN0A 1IVNA 4OHWA 1P9LA 1Z36A 1FQKA 4ND1A 3H17A 4U7FA 1GPWB 4LGYA 4LZWA 3CINA 5DNYB 2VVTA 4Q1DA 4KIUA 4M6WA 1X94A 4RJLA 3ZV5A 4HUQB 3H5RA 3ELDA 4OLBA 1ZHFA 4YCBA 1OAOA 3HYCA 1WUYA 2A78A 1FU8A 1F8YA 2HA2A 1NI4B 3B70A 4F86A 2QXTA 621PA 5ITSA 1EFPA 3KUDA 3DR3A 1L5OA 2NTNA 2QN7A 1M83A 1PK8A 3FETA 4X45A 1ARZA 2ZATA 3EC2A 3GRZA 3EGWA 4B32A 3CRMA 4ETMA 3IMEA 2IE0A 3G2OA 3O3NB 4KWTA 5CNKA 3M7IA 5JC1A 2P65A 1UIMA 4IX1A 2D54A 2VDQB 4I3HA 5A2QA 3EZYA 2O14A 3ZDZB 1FY2A 1SXJE 1NVWQ 1NQTA 4GYWA 4NCKA 3SI7A 2R7NA 2XMZA 2ZSAA 3RIYA 1UWKA 2VCHA 3H1TA 3IP3A 3SLRA 3ZPXA 5E38A 4ZT2A 4MWGA 2IHKA 1H93A 3M2PA 1X6VA 3PFGA 4LJ9A 1S01A 3A3YA 1W4BA 5ALZA 1ZCJA 2BEKA 1IWOA 2OORC 3FNEA 4RKEA 1T1SA 5F3RA 4PHCA 1TO6A 4L8FA 3S2EA 1REQA 3PQ6A 4PINA 3NI2A 2X2FA 2C7BA 2W6JD 3FHCB 4CVNA 4DCCA 3GPLA 3CLRC 3K3PA 3I2KA 4LZLA 3W2FA 1HBJA 4RGQA 5ESWA 3OOYA 2A57A 3H7IA 3NXSA 4JXKA 5IBPA 2BFBB 1ZD8A 4HAZA 4A2WA 1I1OA 1RQGA 2F43B 8ATCA 4TZ6A 3VYUB 2P30A 5F51A 1UZLA 1X1AA 4UUBA 4ERNA 1EFCA 2ZSIA 3VKUA 3HV2A 1JXAA 3KKZA 1IM2A 2OESA 3H16A 1FFYA 4H17A 4BMNA 4UM5A 1VMAA 1IHYA 1BRTA 1U3UA 2V5UA 2QL9A 2WE7A 4MQ5A 3SBOA 2ODAA 3CTMA 3KEMA 3EEQA 5H7XA 3U37A 2Q4TA 4F71A 1RWWA 4H6VA 4EOGA 2D2EA 4MKXA 3HP7A 3K6KA 4QUBA 3NVAA 2HGSA 4MAAA 4QOIA 4DT1B 2Q7OE 2GEFA 1QG6A 2I6UA 2CLFB 1O89A 3PHJA 4YUVA 4CG1A 4PLWA 3ZWKA 5I3ZA 1WXHA 4MVCA 4DANA 2FW7A 3IAAA 1ODKA 1JFFB 1WXGA 1ZCFA 3DTTA 4COOA 4UNQA 2Y0CA 4L0CA 1RRPA 1SC9A 2ALJA 3DEIA 5LBIA 3HDGA 1VSQA 2H1LA 3QNWA 3ZV7A 2WAXA 2JG3A 4GRIA 4TKLA 2F2TA 2ZR7A 1IVYA 2BZ1A 5GPBA 2AS0A 3U3RA 2O2CA 4I4NA 3D7MA 2XIQA 2BFNA 3CH4B 3NKFA 4BNWA 3TXXA 3LUFA 3I1JA 2AG5A 5JSQA 4FFWA 1NQAO 1NVMB 3L9XA 1UMBA 2OC9A 4N5NA 5H3LA 4F6RB 4LF6B 4MWEA 3AG6A 1P31A 5D3QA 3EWIA 1XNGA 2ERYA 4G85A 3CPJB 3U9TA 3UMMA 3AEUB 2WPNA 4MS4B 1YE3A 3F1LA 1SC4A 1ZM4A 5FB3A 3BGDA 1YNSA 5MGNA 2VK1A 3U09A 1GTL1 1EVIA 4RLQA 3HKDB 3F9CA 4BBPA 4H7PA 3MT8A 2BW0A 4C4OA 4RHXA 1SULA 3UQZA 1MBZA 4L15A 2XY4A 3ICCA 4IEEA 5CIQA 2BE9A 2C9CA 3ESCA 4W8HA 3IT0A 4P7FA 2XOEA 4BJ1A 4OXRA 2H85A 1V5GA 4RJJA 3AJ9A