4M9QA

Crystal structure of c-terminally truncated arl13b from chlamydomonas rheinhardtii bound to gppnhp
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
196
structure length
195
Chain Sequence
GPRKITIALLGLDNAGKTTLLNSIQGEDRDTTPTFGFNSTTLNEGKYKIEVFDLGGGKNIRGVWKKYLAEVHAIVYVVDAADPGRFEESKMTMAEVLENQFMRDKPICIFANKQDLPTAAPAAEVVKGLGLATCRNSHNVFPCTAKMPAGQDVDHRLRDGLKWLVGTVDREFGRLDPRVQTEAEEVRQEEARKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the small G-protein Arl13B and implications for Joubert syndrome.
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Hydrolase
molecule keywords ARF-like GTPase
total genus 71
structure length 195
sequence length 196
chains with identical sequence B, C
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2013-08-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4m9qA00
4DIDA 4JLDA 4AI6A 2WOOA 1PZNA 4M1MA 2ZYWX 2AR7A 2PCLA 3MLEA 4LCBA 2IYUA 3CX6A 1J2JA 3IILA 1ESNA 1CTQA 1LF0A 3RRYA 1YZNA 1M2OB 4ZCIA 1KI8A 2SHKA 2PZEA 2ZRPA 3K70C 3DZDA 1NSFA 5H68A 1NN5A 2EYUA 4RKFA 4NDZA 2GCPA 4DB4A 1WDTA 3CH4B 3FMPB 1LVGA 3T1VA 3E5HA 1HV8A 3Q72A 4V0MA 4IOJA 3PENA 3PUWA 4HDQB 3T5GA 4BEJA 4A92A 4JSYA 4EPXA 2CLCX 1M7BA 1T5IA 4U02A 2CCKA 2ODBA 4KLNA 3AKEA 3SBDA 4JL5A 4DT1A 4R71A 3G82C 2HF8A 3L2OB 1GUAA 2XTNA 5IT5A 1T91A 3RSLA 4HB2A 1NL3A 3NC1C 2Z0MA 4XWAA 2BMJA 2RGNC 3X1YA 1W0JA 3X1ZA 4ZI2A 1E2HA 2IYLD 4A4DA 4LOAA 3QXJA 1XTJA 3QKSB 3W34A 4F93B 5AUOB 2PX0A 1N5KA 2YC2C 3GJXC 3PEUA 3O8CA 2WWGA 4TQ9A 3GEIA 4DEXA 3K0SA 3BOSA 1DAEA 5EP3A 1Z6YA 2V54A 4BRUA 1VTKA 1MR3F 2QMEA 5HCIA 3H2YA 1II8B 1RKBA 3ZVLA 2Z6VA 4ZKDA 2QP9X 2AN9A 1GRRA 2OUKA 4FCWA 1D6JA 1D2NA 4C0HA 4RY2A 2BV3A 4TN1A 1OJLA 2ZUCA 3U44B 3GLIB 4JLPA 2FFAA 1VYVA 3NVAA 4H1UA 1YRBA 4PC6A 4M9SA 5HTKA 2QU8A 1J7KA 1X86B 4M1YA 1Z29A 1X3SA 3RS0A 1HA3A 3QVVA 5C18A 5KUTA 3CUEF 4YONB 1CJMA 2GF9A 1G19A 4ZI3A 2JATA 5TDHA 4D2IA 3LVRE 2PCJA 4B74A 1KI9A 3I5XA 1TADA 1T9HA 3I92A 3W6PA 4DSNA 3DVLA 1LY1A 3X1WA 1UDXA 3OESA 1TQ2A 3MGCA 4PC2A 3SE0A 1GOTA 4Q7MB 5FTJA 4FCTA 3WXMA 1WBDA 1K6MA 1CIPA 4PSKA 4DRZA 1D9XA 1VDZA 3QKRB 1Q1BA 3TAUA 1R0WA 1R0YA 4B47A 4FIDA 2VEDA 5DNYB 2DWPA 4FMDF 4EPWA 3I4LA 4JLAA 1W2GA 4G5GA 2G88A 2QPAA 1XZPA 4FMCF 4QNRA 3KJIA 4IOLA 4RVCA 1SVKA 3EZFA 2RGDA 2IA5A 5BN4A 2ECKA 2C96A 1G7TA 3R7WB 1TF5A 2ZRMA 1KI1A 3U44A 1KJYA 1E79A 1NBME 2DY1A 4P4SA 4XWKA 1JNYA 1GFIA 2XTZA 1TF7A 3FKQA 3OAAA 5CK5A 2EFCB 1NIPA 3I8SA 2WV9A 1P9NA 5E95A 5FUXA 3JZAA 3T15A 4B75A 4E09A 2IF2A 1WE2A 3HU3A 2V1XA 2H7VA 1XPOA 4MRSA 3SOPA 3H0KA 3LLUA 3A6PC 1XFAA 2ZPTX 1FUUA 3GCGA 3SI7A 4TMVA 4M8NE 3SYNA 3O8BA 5JJKA 2QMHA 3OF5A 2HJGA 4HAWA 3DO6A 3UG6A 4Q00A 1BS1A 3K1JA 5KDDA 4KBGA 3M6AA 1HEIA 5A5GA 2WICA 4OI4A 3BS4A 3AP3A 1OB5A 2O8CB 2FNAA 3ND8A 4LY6A 4BZPA 4D80A 4DVGA 2F6RA 4JLBA 5CYPA 2VH5R 1N5JA 1GITA 2X1VA 2ZYTX 3ZH9B 5FBLB 1PV4A 4D26A 2V6JA 3B1XA 3VFDA 2OILA 3THWA 3LBIA 3GEHA 3DM5A 4NYIR 1FUKA 3EC1A 2JLYA 1FX0B 4M2LA 4QL3A 3RS4A 3T12A 2ANCA 2I4IA 1XEWX 1E3MA 5IDVA 2EWWA 3IBYA 1ESMA 5EUQB 1P73A 5HPYB 2C9OA 3C41J 1L4YA 2R62A 2O8EA 4Q01A 4DUGD 4MRVA 1AK2A 4TL7A 3U7FB 3AVPA 1NN0A 2W83A 4LYFA 2JASA 2WPDA 3IIKA 3NHAA 4PPNA 3ZZUA 2Q0HA 4B3XA 3I62A 1ZM4A 2O0HA 2RHDA 3TAHA 1OE0A 4I1OA 4BEBA 5JLJA 5L8VA 2E87A 4IDHA 3CPJB 4DZZA 1XJ0A 4L4UA 4GMDA 2I1VB 5B64A 3FVQA 4JLOA 1R10A 3I8XA 3LWNA 2C9CA 3OFNA 1RIFA 2YOHA 1AZSC 4Q02A 4FWIB 4YDSA 4C2UA 2E1RA 2FFQA 3HU2A 1X8LA 1HTWA 1P2TA 1DS6A 2BJVA 1G20E 2WHXA 3BB3A 4DBLC 2BMDA 4PC3A 4LJ6A 4DLSA 4EJSA 5KTYA 2BMFA 5CLLA 3DKVA 4OKSA 1CRPA 2IYQA 1U0LA 3K0AB 4JLVA 1R5NA 3AGPA 1SKQA 2R2AA 5CIWA 2GJAA 1HYQA 1N6NA 2V55B 3IPYA 3WMFA 5FPTA 3A1TA 4Q7KA 1IN7A 2DFKB 3QKTA 2P3SA 4EQ6A 3SQWA 1IONA 1JPNA 4KODA 1E0JA 1T3LA 4G5RA 2FFHA 5FUVA 1XF9A 5EE0A 3WP1B 2YZ2A 1WRBA 3BH7A 2WAYA 3NIBA 2OV2A 5GJVC 2WAXA 2WJIA 3NHBA 5SZHB 2ZSAA 4A8JC 2DHRA 3BK7A 2VTKA 3FFAA 3LX8A 3TW8B 5KSOA 4Q7LA 2OCBA 2EFGA 2IL1A 5ANRB 2W00A 1Z0FA 3BAFA 4JYCA 5AJXA 1XZQA 2ZRLA 3QENA 4G5QA 1FNNA 1R8SA 3MUFA 3SYLA 3UIEA 3V9PA 1CJVC 1YR7A 2OM2A 5IHPA 5IF9A 3TQFA 5FTKA 3CLVA 3CONA 4DUGA 3D6TB 4JJKA 1CR1A 3EC2A 4D6PA 4D4LA 3QKSA 1DO0A 1E4VA 5EP2A 2ZJ5A 1KK0A 2FEMA 4AYWA 1OH5A 2YYZA 4B43A 1YJ5A 1HE8B 2NO9A 4TYWA 2O8CA 3CW2A 2ZRBA 3KQKA 2GAAA 4Q9JA 5AR1A 2F9LA 4K8OA 4EPTA 1FTSA 1P3JA 2FPLA 3I1FA 2W6JD 3TR5A 4D4MA 1G7CA 4B73A 3LFUA 3EPHA 2A78A 4C0BA 2JLXA 2JJ8A 2IYSA 2WSSA 2OZEA 4WOPA 1ELOA 2ZTSA 2WWHA 3UXMA 4TZ6A 1ZYUA 4TT3A 3C7KA 1KO5A 2ZS8A 4PAMA 3FOZA 4A2PA 4CEIB 1QRAA 1US8A 1JQJC 4KCGA 5GJCA 2ZEJA 1JR6A 4PPQA 3X1XA 2DB3A 1NVVQ 2JLWA 1U0JA 1YZUA 4AWXA 2Q3FA 2WOJA 3ZJYA 1W4BA 4F92B 4PC7A 1CJUC 3OHMA 3SJCA 1S3SA 1PLKA 2FPMA 3GLFA 2JJ1A 4OQFA 2LWIA 3FMIA 4O25A 2G1JA 2O0KA 2C98A 5CB6A 1S1MA 1J99A 1DG1G 2AWNA 5BN3A 3R9WA 3AP2A 1ZNYA 1B23P 1G8HA 1SVMA 4CVNA 1VG1A 2W2VA 4O2RA 1NJGA 2GTPA 1BMFD 2MSEB 2W58A 1N0UA 1KI4A 2I3BA 4Q48A 3ZGXA 3U61B 1OIXA 2BBWA 4ZIRA 1N25A 1KMHA 1V43A 3IEUA 3GQBA 1OH7A 1FZQA 2OCAA 1G3RA 1TTTA 3C8UA 5DIFA 1KI6B 3K9NA 1WB9A 4P0TA 2DWOA 1E2IA 4BPBA 3B7GA 3B1WA 4TMXA 2JA1A 4UNRA 1W0KA 5DO9A 1NI3A 1ZD8A 4GZMA 3VMFA 5C2JB 2QGZA 2GRJA 2FSIA 5JRZA 1I4TD 1RYHA 3AVYA 3K9GA 2NO0A 2YKGA 2QP4A 3AM1A 2XXAA 2D74A 3HDTA 4NYIQ 1Q12A 1NP6A 1UDWA 5JRJA 4UQOA 3EAQA 1MT0A 1G8GA 4V02A 3K0AA 4Q7JB 2CE7A 2GCNA 3A8TA 5FL3A 1KDPA 3TMKA 3H86A 3QXCA 5E7JA 2XZOA 1G7RA 1NJFA 3H1TA 1ZU4A 2J87A 4C0LA 2BBSA 1OXTA 2B7CA 2ZRNA 3A58B 2P0EA 4ASUA 3GLFE 1U2RA 1RRGA 2GA8A 1MV5A 2C04A 4AYTA 3BC1A 3PR1A 5JSZA 2C5LA 1K5GA 1KDRA 4NYMR 2N46A 1OXVA 2FEOA 1I4LD 4Y0AA 3LNCA 1E9AA 2IC5A 2OSBA 2QA5A 3MWKA 3O8DA 4W9MC 1P2VA 2FOLA 5FL7D 3QPVA 4A6XA 1TEVA 2OCPA 721PA 3VHLB 3ONWA 5EXSA 2UZIR 1KI6A 1A7JA 4LHZA 2ZRKA 3S1AB 4TSFD 5BWMA 4M53A 5AK0A 4DHEA 4Q1DA 2QE7D 4A15A 1BH2A 4Q1AA 3SJAA 4US2R 2NGRA 2D62A 1F60A 2CMKA 4G3XA 1E1RD 3AUXA 3LX5A 2ZQ5A 4GSYA 2GJSA 3WYFA 1VCOA 4KSCA 4M1WA 3J81k 4B71A 2B8TA 2ZJOA 1KI7A 1W5SA 2ZS7A 4PTLA 3SNHA 1DE0A 4DCSA 3GLGA 5KDLA 2OESA 1G21E 3IO3A 1AA9A 4LUCA 5DI3A 3E70C 1Z06A 3W8RA 2XNSA 1A2KC 3IKJA 1Z0JA 1IXRC 2P5TB 3CRRA 2HCBA 4YXWA 2VP6A 4PHHA 2IUUA 2DPXA 2P65A 5J4LA 4QKQA 4N1AA 4KSBA 1AKEA 1RC8A 4JIMA 4ERNA 4LJYA 1PJRA 3QF7A 1E2LA 1CF4A 4JKIA 2AXNA 3K9LA 4IVRA 1Z0KA 1C1YA 5E7IA 1MO5A 1Q3HA 4PHFA 2OFOA 4R7ZA 1TNDA 5CIQA 5FBRB 1R4AA 3TIFA 4OK5A 4P4UA 4BFZA 1E2GA 3UKDA 1UKEA 1Z0IA 2PEYA 4DDWA 4IVQA 4Q1FA 4DWJA 1FTNA 1Z07A 3H4MA 4IXNA 1HT2E 4TQUS 3Q7PA 5DH9A 4AURA 4Q19A 2WTUA 4D4KA 2R6AA 3A4LA 5L3QA 5JS7A 4HLUC 5LD2B 1ZNWA 2JLRA 3GLHB 2QG6A 4NP6A 4RFVA 3T61A 2FSHA 2QGNA 4PAOA 1NVUQ 2W0MA 3DZ8A 3IEVA 4BLSA 1XDBA 2GBLC 4LYAA 1OFHA 3AF3A 4BASA 2IYWA 1E2DA 3KKMA 2Q21A 1IJEA 2EW1A 1JB1A 4HB3A 1I2MA 1VHLA 1QHYA 2CEAA 3GD7A 3QBTA 2CNWA 1A2BA 4NCNA 3LAWA 1N5LA 4PO8A 4EQ6B 2XB2A 3PEWA 1H8HD 2YWFA 2QE7A 4V0KA 3U4QB 2RMKA 2ORVA 5JMTA 4WXRA 2DCUA 4K81B 1E2EA 3T5DA 2WKQA 3AVTA 2BMEA 3N2IA 2C9YA 1UBCA 4XTCS 3K0EA 4QGAA 2JDID 1GP2A 4A1FA 2JLSA 2OE2A 2QM8A 1P62B 5CJ2A 1S9HA 3Q7QA 5FI0B 4YMWA 4GMXA 2HUPA 2NO6A 5DE3A 2GESA 4K46A 4BLOA 4QGGA 2G3YA 4WA7A 2IK8A 3AEZA 2QTVB 2ZM5A 1CR4A 4NH0A 4TMZA 1P2UA 1Z47A 2ATVA 2MSCB 1N6LA 1BYUA 5EXTA 3EPKA 4YXWD 3QVUA 2ODNA 2D7CA 2OXRA 1N6HA 2DYKA 3GJ5A 5AWFC 4A0GA 4KI0A 3A36A 4BFYA 4DLXA 3GJ6A 1ZW6A 2CXXA 2O5VA 1U99A 4GT1A 2GZAA 5IK2D 1W44A 2JDIA 4TMWA 5A4JA 2P6NA 1WQ1R 1U98A 2KB0A 3Q8XB 5E7MA 3PEYA 3WMGA 1HY3A 5EE9A 1VYUA 4X8MA 1HUQA 3MWYW 3VR4A 4CF7A 1P61B 4V03A 1OXSC 3L8ZA 3P26A 2JGNA 5FPKA 4DKXA 1G18A 1FX0A 1TQ4A 4NE2A 3IQWA 3IIMA 1K5DA 2GXQA 4HB4A 1CLUA 1CP2A 3AUYA 3ZVRA 4D82A 4A0FA 5JEEA 4P3YA 3ZZTA 2VLIA 2ZAOA 1E2QA 1NIJA 2VHTA 5TV2A 4DLYA 1S2MA 4MKHA 4V0LA 2BKUA 3KQUA 1JJVA 1LFDB 5KOYA 2CLDX 4RD0A 2ZE6A 1OV4A 1EFRD 1OF1A 4TWZA 4BE7B 2IUTA 1DEKA 4X8LA 4Y0VA 4DCTA 1J90A 2V7QA 1G8PA 3P20A 3T35A 1BKDR 1XMVA 1U0HC 2F1IA 3L0IB 4C0SA 4DCNA 2VP4A 4DDVA 1JALA 1T8UA 5J47A 4MKGA 2C03A 1KTVA 5FR1A 2KJQA 1WF3A 3W5IA 4LZZA 1QVRA 2VF8A 3PFIA 2O0JA 3IDQA 1Q57A 2Z83A 4B3FX 1OFUX 5KO2A 1ONBA 3IGFA 4LV5B 4PQFA 1EWRA 1IXSB 5LD2C 5EQTA 1EGAA 4FMBB 3QSYA 2QRZA 3U3JA 4LJ8A 4RD4A 2AK3A 3B13B 4AG6A 1SXJB 4JLNA 1ZM9A 4BLQA 1E69A 2F1HA 2ZS9A 5JSZB 4R2IA 5KSZA 5JWHA 1UF9A 1QF9A 1M8PA 3CRVA 3KXLA 3SN6A 2LKDA 2ZI3A 3LRPA 3DEFA 3L82B 1F2TB 3SR0A 3RS3A 2D7DA 1E0KA 4EPVA 1OB2A 3SJBA 2F1RA 4DDUA 3HYTA 3WYAA 1KYIA 4V0OA 5KPJA 5TXGA 3AKYA 4UKDA 4PZYA 3EARA 1XTKA 2W2XA 2OBNA 3MJHA 3ECCA 2AFIE 1CXZA 2DWQA 2HDNB 3QPWA 1QDEA 1ZUHA 1ZC3A 4QXAA 2GHIA 1N6IA 2YOGA 4HUQA 2NQ2C 3C5HA 1E2PA 4B76A 2ZUDA 3RWMB 3KJHA 1N3BA 1ZD9A 2ZYUX 4JZKA 1G6HA 4B6FA 3BRWD 2AXPA 4L9WA 4MITA 1FPMA 2QEQA 4MGYR 3IQXA 3K9HA 2X2EA 3AGQA 4LDJA 1KAOA 1XJCA 1OW3B 2ZE8A 2GZDA 5J40A 1R0XA 3ICQB 2QSZA 2ZI7A 3T06B 4OJKA 5AJWA 3NBFA 1R6BX 3UMRA 4YQFA 1XD9A 4LRWA 1VPLA 1XTQA 5JCZA 2VP2A 5J4KA 1TMKA 4NYMQ 3B1ZA 2GKSA 5P21A 4CEJA 2K5UA 3KKQA 1IN6A 2H17A 3ZLJA 1D5CA 3HP1A 3VKWA 3TSOA 1Z22A 2HJVA 4LSGA 4ZDWA 4OHZA 4AC9A 2QQEA 4PHGA 4QRHA 3QXSA 3PUZA 3THXA 2QQ0A 4F91B 3DM9B 3MWJA 4XWOA 3ASYA 1XB2A 1FQKA 1W0KD 2OLJA 1AS0A 4TMKA 2QUZA 1W0JD 4IKEA 3W6NA 1E9EA 4CEJB 4YMUA 4QHYA 2IW3A 1DAIA 2BM0A 4I99A 4MKFA 1W5TA 1YE8A 1WMSA 1OXUA 3R8CA 1NVXQ 1IHUA 1HH4A 2ZI9A 2RGBA 2IXEA 2A5FA 1RRCA 4IHQA 2CL7X 5TVKA 3KQNA 3RANA 1VYTA 4ZIRB 2CL6X 1UKZA 2ZSBA 2JJ2A 3AVOA 3TK1A 2B7BA 2H16A 1US8B 2V4ZA 3RHFA 121PA 4LHWA 1XEXB 3KFXA 1SHKA 2QI9C 4OL0A 4J0QA 3VTKA 2MMGA 3THWB 4P32A 2J7KA 2Q6TA 4GOKA 1XP8A 3W9YA 5TARA 2WPDD 1MO6A 4MYCA 2NZ8A 2J1LA 3LH5A 2D3WA 3ZS9A 2AX4A 3QBVA 4LK2A 2ERYA 3K09A 1XXHB 3EIEA 5HZKA 2W6JA 3QI2A 4GP7A 3TLXA 1F48A 1Z63A 3U3RA 1VHTA 3K70D 1A1VA 4P4TA 1KO1A 5CM8B 5BYKA 1Q0UA 4PO1A 3GFPA 4QOSA 3GFTA 1E0SA 1SXJC 4KU4A 2BCJQ 2HF9A 2P67A 2PH1A 4QBIA 3VQTA 3F8TA 4C9BA 4JT4A 3CO5A 2NOAA 4BFTA 3KL4A 2CL0X 3VNUA 5FTMA 5F3WB 1TEXA 3VAAA 1XXHA 4ARZB 3SHWA 2J0UB 1CRQA 3FMFA 4FCVA 2ZREA 2NPFA 3ZYCA 2J3EA 4WIAA 1ZUIA 3FGNA 2EYQA 3OEED 5DSZA 3EXAA 2ATXA 3VR5A 821PA 1FQJA 4I1SA 1EWQA 2ZI6A 1BMFA 1NF3A 4I1UA 5DISB 5G40A 2BDTA 1OT3A 4MGKR 3AB3A 2REBA 4C3ZA 5C46F 1F2UB 3MG9A 2R6CA 4OHXA 4QG7A 4TMTA 4URWR 1JEEA 4EFLA 2ZSDA 2P6RA 3PVSA 1KHTA 1BO6A 5DN6D 1AGRA 4Q18A 4DSUA 2D2EA 5DI3B 2F3RA 3MAAC 4JSTA 5KSYA 1QHNA 4TYYA 1UJ2A 4LWZA 5JBQA 2GEUA 2REXB 1F6BA 4A8JA 4GRAA 5EE1A 4C2TA 4XD7D 5DN6A 4CZ2A 4GBMA 4ESHA 4DLWA 1KIMA 2J59A 2XAUA 4B33A 1KNQA 3SFZA 3WNDA 1G8FA 4TLDA 1YQTA 3QKUA 4XIGS 3IO5A 4IFEA 5DGXA 3THYA 1Z0DA 4KFUA 2XITA 3EZ6A 4Z54A 1B0UA 1JPJA 2PX3A 4KFSA 4RJLA 1SQ5A 3IHLA 3RNLA 3HPQA 2JCSA 1FFHA 2QL6A 5IK2A 2ZI5A 3THOA 2GZHA 1X8KA 3CF6R 4PPFA 1IY2A 2QAGA 4G5SA 4YLGA 4Q47A 4PZZA 2LKCA 3B6EA 1AKYA 5BXQC 1ZC4A 5FOXA 3ADBA 1C4OA 2NIPA 4OYHA 2PJZA 5BW8A 1DAGA 2XB4A 4LJAA 1N6RA 3NH6A 2BWJA 3FPAA 4OK3A 3KQLA 1P4SA 4G0NA 3TGPA 4AKIA 4M9QA 3BERA 3TUIC 5LPNA 2CDNA 3G5UA 1QHHB 1ZBDA 3BORA 1KKLA 3HR7A 4Q4HB 5LB4A 1P60A 4QJ4A 4DC9A 4DCVA 2QBYB 2R6FA 1YU9A 4OJQA 4RZ2A 5AUNB 4BLPA 3BFVA 2OG2A 3RLFA 5KHOC 1R2QA 5EXXA 3M1IA 1JXOA 2ONJA 5CDFE 3LQQA 2GEDA 5JWRA 2X77A 1Y63A 3FHCB 3U4QA 2VHCA 3BGWA 5DHAA 2HYIC 1T6NA 1XPUA 2JJ2D 1YZGA 2VHJA 1KO7A 3QEOA 2PLFA 5C4MA 4WW0A 3MMPA 2BM1A 3IBGA 4LC0A 4PSVA 3EZ2A 3CZQA 1G3QA 5CM9C 5CYOA 2MSDB 3GLFB 4GDFA 1KMHB 1N6KA 1EK0A 1RRPA 2GAOA 3GP8A 1TUIA 1IJFA 1N0WA 4UJ5A 3MD0A 4D81A 4U7DA 1XXHE 2RHMA 1UKYA 2YVUA 1Q3TA 1SVIA 2C2HA 2Z4SA 4IEIA 1OHHD 4JT2A 4UNPA 3WNBA 1AS2A 2GJKA 4DIEA 5SZJA 2HXSA 1EX6A 1NY6A 4HAYA 1ZVQA 2GJ8A 2ODEA 3GJ0A 5JHGB 2RKOA 4NYJQ 2YHSA 2IT1A 3QXHA 2WZQA 1KDOA 1E9CA 1FP6A 2PZGA 1E2NA 2IUSA 4Q4AA 1DBSA 2AD1A 1E9DA 3P4XA 1XNJA 2GNOA 4O0MA 4A82A 1VCNA 3ND9A 4IDOA 1T3HA 3VKGA 1GNRA 2OEPA 3WRXC 3EX7C 4A2QA 5L3RA 3KUCA 1GILA 4Q03A 4JBYA 5EE5B 4JVLA 1SKYE 1N0VC 5KNCA 4QJ5A 3A1WA 1OKKD 3NTUA 1SGWA 4LHXA 3MCAA 5EP1A 4C4PA 3SHFA 1JQLB 2F43B 4EFMA 5EP4A 3MJRA 1U9IA 1VMAA 4M9XA 1G3IA 4WZAE 1T0JB 2DR3A 1YKSA 1ZIOA 2H92A 5AJZA 1ZJ6A 4QM7A 2VHQA 2WVJA 4O2LA 3SFVA 1NY5A 5GVSA 2E9SA 4UXIA 1OSNA 3VR3A 3QG5A 1RYFA 1GKIA 2WKPA 3I3SR 5DYGA 3VU9B 1R5OA 1U8ZA 2F9MA 2HYDA 4HAXA 1BIFA 2FJUA 3LO5A 4NPHA 4KVGA 4PFSA 4JBXA 2VHUA 2GCOB 1W2HA 1AM4D 3KB1A 3OFND 1COWA 5B58C 3B60A 3ZQ6A 3DOFA 4R2HA 4HUTA 1Q21A 1A5TA 4NL4H 3SEAA 3RRMA 4X8HA 5B57C 4TT3D 3B78A 5IRCD 4HEJA 4F7WA 1II9A 2ZYVX 1KJWA 2WJJA 1YZLA 3AVWA 3GJ3A 1JEDA 1M7GA 1RVDA 4HAUA 2J0VA 2FF7A 1NLFA 1P2SA 2PMKA 3ADKA 3KFVA 5FOUA 4OBEA 4MGZR 4RKEA 4GFDA 2VF7A 4IW3B 3OE7A 1IBRA 3P4YA 4OQMA 1GAJA 1U90A 2VPPA 2QPTA 1DPFA 2NPIA 4S2EA 3W3AA 5GJWC 5EE3A 3R9XA 3LV8A 1SKYB 1TAGA 3LVQE 2F7SA 1M1YE 4Q1EA 2ZSFA 3HU1A 3FWYA 3ZVMA 3EASA 4IOKA 2O8BA 1F2UA 3LXRA 2QNRA 2IYVA 1DELA 4IXMA 4MYHA 3NEJA 4EIWA 1SVOA 1GRQA 2CHQA 4ZCMA 1CEEA 2OT3B 4RD6A 2FV8A 4TQAA 4FW9A 4CT4B 1GL6A 4BECA 3EG5A 2F55A 1II8A 1U94A 3B1YA 2XJ4A 3U7EB 3UK6A 3GFOA 5KDOA 4GZLA 1GKYA 4A6PA 3BB4A 2ZR0A 3QUSA 2WJGA 3M4YA 4FN5A 2J5XA 1G4UR 4TTQA 2IS2A 3CR7A 4A9AA 4MRPA 4JVSB 4WZBE 4N3NA 2IWRA 2NO7A 5GJBA 1KSJA 2H8KA 4X8OA 3GLHA 3SU8A 2BCGY 1NMXA 5SZIA 2P5SA 2OBLA 2GILA 4F4IA 1GZSA 2H57A 2Q3MA 3R7WA 4URVR 2IEZA 1Q20A 1ZP6A 1GTVA 3FFBA 4NTZA 3B9QA 4BZXA 1E98A 4LHYA 2BEKA 1KJZA 2FH5B 2WIAA 2XSZA 3NBYC 3HR8A 1TU3A 5D3MB 2Q9AA 3A4NA 4B6EA 1QVAA 3PUXA 2AK2A 4HAZA 4JL8A 4TLBA 1SVSA 5FOTA 5BYJA 2IHBA 5DI9A 4URUR 5JZVA 1LF5A 4URZR 5TY0A 4M22A 1G5RA 4PANA 4M1SA 4LBVA 5K8LA 2BC9A 2ASEA 2V3CC 3N2EA 1IQPA 3BBPA 4MYTA 4GPTA 3RS7A 1D2MA 1TPZA 2EFEB 1GNQA 2ERXA 4H9GA 2GVZC 2NO1A 2WJYA 3CB4A 3KXIA 3QY0A 3IPXA 4JMPA 4P31A 4QGFA 4KAXA 1OFIA 4OK6A 3AVXA 3WBJA 2B21A 1DAHA 4ZPXA 3IIJA 5JS8A 4E5UA 4Q5IA 5G41A 1QBKC 1W46A 4B3CA 5G3ZA 4CW7A 3GPLA 1T4GA 2QSYA 2BHRA 4LX0A 2PL3A 3KX2A 1RW4A 1KDTA 2IYZA 4ESVA 4BFXA 2J46A 4DXAA 3SS8A 1U8YA 1G4AE 2R8RA 2VL7A 1SZPA 2UKDA 3CF2A 3N70A 3BB1A 2QRNA 3B5JA 4U5XA 3GLIA 1CBUA 1WA5A 1WXQA 4B44A 3Q5DA 2EQBA 1YVDA 3FDIA 4LV6A 3U3KA 2ZJ2A 1L8QA 5JHHB 4YC7A 1W4RA 1G16A 1W7AA 4Q4LA 1CULC 4ZKEA 1P9RA 3WY9A 5JCPA 2PT5A 2ZRCA 5EZ6B 1LV7A 4XVUA 2VIIA 1MO3A 4JVMA 1GWNA 2OHFA 2G9NA 3RS2A 3TH5A 4P4SB 3CKLA 4FMDB 4BFVA 2GXUA 1KO4A 3L0PA 2D4HA 1GIAA 1KY3A 4QHTA 1EG7A 2Z5FA 3QE0A 1WCV1 3GLIE 3AP1A 3CWZA 2XJ9A 4OHWA 4MKIA 5KSPA 4GL2A 5M04A 4KV9A 1IXZA 4M4SA 5DLQC 1PLLA 2IS1A 2ZRJA 3BD9A 4LHVA 4UNSA 1UADA 3F5FA 2GJ9A 5LBIA 3SJZA 1XD2A 2DFNA 1Q1QA 2W0SA 1M34E 4DCUA 2ZETA 2YWGA 4UJ3A 2ZI4A 3TE6A 2VYFA 4L15A 4BLRA 1J8YF 4RD1A 1HURA 3U5ZB 2GF0A 4AG5A 1DAMA 2WM9B 4PR0A 2N42A 3GJ7A 4UXJA 3ZD6A 3SDZA 2J0UA 3LW8A 2BKEA 4IJMA 5C1BA 2RGCA 2BJWA 3EPJA 5AUPB 1OLOA 4NCKA 1SXJD 2VBCA 2XZLA 4YMTA 1QG4A 1Q44A 4GP6A 3DMNA 4TLAA 4C0JA 4ON9A 5HKKA 3EIQA 2O8DA 1E9BA 2ONKA 2WJVA 3AF1A 2IYRA 1T5LA 5J5CA 1LS6A 5FL7A 4NHOA 2J45A 2YINC 1SXJA 1GSIA 1ZCAA 3AF2A 4ZV4A 1DARA 1T3SA 4KYUA 4MDEA 4TZ0A 2RAPA 3U6BA 2AWOA 5CB8A 2V6IA 4QBFA 3TKLA 4LYHA 4FXPA 5FFMA 5FBQB 1E1QD 2EWVA 1OHHA 2CK3A 3LW7A 3V4FA 2IX3A 1N5IA 2PBRA 3I32A 3BE4A 5F2EA 1EFUA 3TR0A 2QMUA 1CS4C 1TF2A 3P32A 1ZNZA 4PPGA 3F0TA 3QKRA 4WAUA 1MABB 2BBTA 2ZJZA 1MOZA 4WZ6A 2B8WA 5AJYA 5FI1B 1ETUA 1S96A 3C14C 4URYR 3KUDA 1G5PA 1JJ7A 1Q1ZA 2RGNA 2XTMA 4RFSB 3ADCA 3D7MA 2IXFA 5F98A 3NG1A 5JJLA 1E9RA 1E94E 3FHOA 4BGDA 1MRSA 1XMIA 4B35A 4XTRA 3EA0A 4E03A 1GM5A 3LBNA 1EXMA 3KDSE 4CGZA 3KKPA 2ZANA 4DSTA 1OXXK 1NVVR 2V7QD 3CH5A 5LDDC 3WNCA 3QF4A 3B8HA 3P27A 4LC1A 4A8JB 4D25A 2ZAMA 1Z0AA 2ZE5A 3OEHA 4LV8B 3OEEA 2ZRHA 1FNMA 1H8ED 1E0AA 1ZM7A 4HUQB 3QQ5A 3ETLA 1W4CA 2QMOA 3JZMA 4TTRA 5DHFA 3EZ9A 5F9FA 1SVWA 1Z8FA 2FFBA 4JLJA 2Z43A 2IHYA 1X1SA 2WWXA 1PVOA 2FE4A 4R9UC 2WSMA 3TRFA 4HLCA 4A0HA 1VCIA 3NBZC 1MH1A 4Q4HA 4ACBA 4QGHA 2I1QA 3ICEA 4M9ZA 2ZJYA 1N2CE 4NKRA 1D9ZA 5KPDA 1E1RA 2QAGC 4B48A 1GL9B 4F4CA 2EFDB 1XJQA 3LDAA 3Q3JB 4UNNA 4B2IA 3QJYA 3MRSA 1LS1A 2WMNB 3ZDQA 3MSXA 5L3VA 2QROA 4XD7A 4M1KA 1JR3E 1YR6A 4D0NA 1E99A 4IVPA 3CX8A 2FPKA 2UVQA 3RC8A 2WWYA 1NKTA 5HE9A 3REGA 4UXHA 3PXGA 4C30A 2J0SA 4P33A 4NU0A 5BQ5A 4AKEA 1BOFA 1HE1C 4MRRA 3HWSA 1W1WA 1KMQA 1KSFX 2FA9A 4JKYA 1C9KA 2WMOB 3RDPA 2GETA 2PT7A 1U81A 2J9RA 4OQXA 8OHMA 3ASZA 3D3QA 2NMVA 2NZJA 4QC2A 4TL6A 1YZQA 1IY0A 3C16C 3WRYC 1KK3A 3OAAD 4DLTA 2LCFA 4NONA 1ZMXA 2A5YB 2WWWA 3U3MA 1ZD1A 1S9DA 3EWAA 4B34A 5K8TA 1E9SA 3WP0A 1XEXA 2F43A 3OE7D 2V8OA 4DJTA 4RZXA 3EPLA 3PJRA 2ZR9A 3M0EA 2R6GA 4RD3A 1G6OA 1Z08A 4LPSA 3K8YA 5BN5A 1T8TA 2P6UA 2XNDD 4KYIB 1NN1A 1J70A 2NTYC 2ZUBA 3CZPA 3MFYA 1PUIA 4KFTA 3ZD7A 4PX9A 1Q1EA 2KBFA 3V00A 4HDCA 1AZTA 2TMKA 4KO8A 3VU9A 3NXSA 1VECA 4BRWA 1H65A 4XH9B 3U60B 3OEHD 1G9XA 1EFTA 3B9PA 4ACAA 4L9SA 2FU5C 3RYTC 3TNFA 4XSGA 3K70B 1FOEB 2D06A 3KKOA 2VQSA 2FGKA 3TUZC 3RSOA 4D4JA 3TSWA 4KITB 3CM0A 1NN3A 3DDCA 2VSXA 1LW7A 2CVFA 2G6BA 1Z5ZA 3CR8A 5FOWA 5CDFA 3RWOA 5EJEA 4TSFA 4QM6A 3R20A 2ZJBA 2QTFA 3KJGA 2IYTA 2FG5A 2XNDA 2X19A 3ZVNA 4AY2A 4BUJA 1G5TA 2ZITA 3KZ1E 4CT5A 3ZQJA 1NBMA 3BH6A 2YJTD 4POAA 5HCNA 1JAIA 1LTQA 3O47A 3BFKA 2O8DB 4CEHA 521PA 2AD5A 4JS0A 3CPEA 3K53A 3A1VA 1AN0A 3QXXA 2ZJAA 3K0FA 3CRQA 5C4GB 4A36A 1PUJA 2HT1A 2ZE7A 3PUVA 3THYB 4LBWA 3RRZA 1E9FA 2IWHA 3UANA 4D0LB 1NMZA 1S0UA 2OO7A 2QT0A 4ILEA 1ODFA 4O3MA 1NG9A 4BFWA 4EAQA 2WKRA 3AF4A 4UNQA 2ZRFA 4KLZA 4BFSA 1KK1A 2XSZD 3BFXA 1G41A 1NLYA 2Q3HA 2ORIA 3LD9A 1W36C 4DEYA 3EZ7A 4U00A 2FN4A 2PJRA 2WWIA 2O8BB 3VHXA 2ZU0C 1ZRHA 3JVUA 3W8NA 1I4DD 5HKKD 5FH9A 1SXJE 1UFQA 2G1KA 2QAGB 4A2WA 2GXAA 2CHGA 1ZINA 4DSOA 2EFHB 2OLKA 5FBWB 3BXZA 1CR0A 4JLMA 2JLUA 2ORWA 2PLRA 1OH6A 1P72A 1UKVY 4IDPA 2RGAA 5F9HA 2G0NA 2QBYA 1Z2AA 3SYKA 4AIIA 4TTPA 1AIPA 1P7CA 3PQCA 4IDQA 4NMMA 3TBKA 3CIOA 4Q1BA 1KSHA 4Z1MA 3W3ZB 4MDFA 2A5DA 4QNMA 4RCYA 1E2KA 1YZKA 4JLKA 4OQNA 1IN8A 2AL7A 3P1JA 4Z8XA 5H1YA 1Q22A 3IUYA 4OI1A 2RGGA 4F38A 4MUAA 4AYXA 2JLQA 3CNOA 2N1BA 4XVQA 2BBOA 3N5CA 3GLGB 2CNWD 2BOVA 1KI3A 2FWRA 3QIAA 3FKSD 4MA4A 4EJSC 1E96A 1JBKA 3AVUA 5KNBA 1E32A 421PA 4HLDA 1KZ7B 5FR2A 4C0QC 4YMVA 2GXSA 1FMJA 4XJXA 4Z1MD 1W48A 2AHOA 4TLCA 3W90A 5L3QB 4WXPA 4LJ5A 1P6XA 1XRJA 2XXAB 3THXB 5FBVB 1GNPA 2Q9BA 3T1OA 3GEEA 4RZ3A 3KTAB 4M0LA 2P2LA 4MUBA 4HLQB 2ZSEA 5SZKB 4PSAA 3TQCA 1XD8A 4TL8A 5B2ZA 1KAGA 3FTQA 1OYWA 1AQUA 3A1UA 2XEXA 4C7OB 1RE0A 4KHZA 4Q21A 2WJHA 2WSSD 3CRMA 1W47A 3OIWA 5JWOA 5CJPA 5KNDA 1WBBA 1VKJA 3I72A 1IAQA 4GOJA 4R98A 5L3SB 2QP3A 3Q85A 1R0ZA 2X2FA 3BH0A 3RVBA 2B6HA 4MQBA 3D8BA 4DLRA 1E2FA 1OYYA 2A7QA 2J7PA 2V9PA 2EVWX 2YOFA 4TLEA 4L8GA 3T1TA 3T34A 2JJ1D 3TJZA 4B3DA 3S1AA 3I5YA 1OH8A 2YWHA 5JI3E 1L4UA 2GK7A 621PA 5L3SA 4Q4AB 3K0CA 4OI0A 3RS5A 4M1OA 3OIUA 1EX7A 1PLJA 4I4LA 5JJIA 1Z83A 2HT6A 1XWIA 2AFHE 1ZCBA 2BVNA 4LI0A 3CNLA 5CITA 2FSGA 3GJ8A 2ZVPX 4YMSA 4HZIA 4G01B 2A3RA 1TQ6A 4PHTA 3ZIAA 4CEIA 1IOZA 2RH5A 2O8FB 2IF0A 1G8YA 3TVTA 1Z6AA 4ZDIA 4EPYA 1NMYA 1MKYA 4C0AC 4B2LA 2HXYA 3H84A 4Q1CA 5UKDA 5JEDA 1RFLA 4D0GA 1XTRA 4A0RA 2ZRAA 1GKUB 3R9IA 1YHNA 4JBWA 1ZAKA 2G77B 1E4YA 1O87A 2IYYA 2JIZD 3DMDA 4Q9HA 4W5WA 1AGPA 1UPTA 3I73A 3NDBB 3EWSA 1KK2A 4WBSA 2DBYA 1ZUNB 1XD2B 1DTSA 1CR2A 2H5EA 1IY1A 4CRWB 3LA6A 4OI2A 2CE2X 4QBGB 3FKSA 4FINA 1GVNB 2QM7A 2QY9A 3L43A 2R6DA 2ZRIA 2IS6A 1N6PA 4BWYA 2KI5A 2F3TA 1Z6GA 2ZIAA 3PG5A 3Q9LA 1FL9A 4QJ3A 3O8RA 2J0QA 3VNVA 3GLHE 2XZPA 4AD8A 5JFGA 4HDOB 2Y8EA 1NNEA 1XTSA 2XOKA 1G291 2VRWA 3SZRA 2V1UA 3C4JA 2W6ID 1QHSA 1W49A 3UWOA 3V4RA 4BFUA 1XMSA 1L7VC 1VG0B 2JLVA 3B82A 4L16A 1QHIA 3A4MA 2W2TA 4PAQA 4MH0R 1TUEA 3AKCA 5EXPA 5HZHA 2O8EB 1UEJA 2H18A 3U7GA 1D2EA 3CX7A 1DO2A 4CEHB 1SHZA 1X1RA 1UBEA 4NZYA 1M6NA 3TUJC 3TVDA 2ZXUA 2A30A 2C78A 3U2QA 4B3GA 1R7RA 1W36D 3DHWC 4HAVA 4EJSB 1X8JA 2VSOA 221PA 1A4RA 1R8QA 3RABA 1E1QA 2ODWA 3AH8A 4Q9IA 4US1R 4V0ME 2CLSA 2IBMA 2ZRDA 1KGDA 3SQXA 2GDJA 1CU1A 2JEOA 1ZM2A 4DLVA 1QZXA 1I2DA 1TU4A 2KE5A 3T1QA 2FX3A 3D31A 2ZRGA 3FB4A 2CJWA 3WMEA 1D8TA 3GJ4A 3CPHA 3PCRB 3BWDD 4QBHA 3B2EA 5AJVB 4F4JA 1OPXA 1W36B 2JAQA 4H1VA 5J4YA 2ZJ8A 2IXGA 1DVRA 1NSTA 3UWKA 3NC0C 1VG8A 1NVWQ 4NCJA 4C0KA 3UPUA 2YNMA 1O3YA 2CJWB 3B85A 1F3OA 4OHVA 1G1MA 4HLUA 2FSFA 3QF4B 1GL7A 1EFHA 4EPRA 1V5WA 2C77A 4JYBA 4B3BA 4M1TA 2YV5A 4GNKA 4WVFA 2MMCA 4EKDA 2RCNA 3U6KA 1G3MA 2HLDD 3C5CA 1TQDA 3UATA 1IM2A 2Z4RA 3AV0B 1XTIA 1JXMA 1OKKA 2ANBA 2DFLA 2HEIA 3NH9A 4XOIA 5AUQA 1XU4A 1K8RA 4EFNA 2PZFA 1Z28A 3B1VA 1Y3AA 1G3UA 1AS3A 1F2TA 1E6CA 2HV8A 3EA5A 1M7HA 3U7HB 1A82A 4AKHA 1RZ3A 4HATA 3C15C 5G3YA 2KBEA 3W6OA 3E1SA 4PC1A 4S35A 5J4VA 1U9IC 4BQSA 1GG2A 1L2TA 1RJ9B 2XOKD 3LXXA 5G53C 1KO8A 2CBZA 1KNXA 1G7SA 1EESA 2ZR7A 3MWLA 4PXAA 3R8FA 1UEIA 3KQHA 2CCJA 3L0SA 1YRAA 1XEWY 4HZUA 2XX3A 3DKPA 2OFWA 3QPUA 2QT1A 4Q4JA 4TYQA 1P9WA 1XMJA 4CDGA 3QEJA 4IDNA 1HQCA 1NKSA 2QENA 1II0A 1XBTA 5TB5A 2G83A 4IFBA 2F1JA 1HQYE 3RRNA 3KJEA 4TL9A 3RAPR 1P75A 4CIDA 2D2FA 1G17A 1OIVA 1VIYA 2GK6A 5E3HA 1XPRA 3OZXA 1KY2A 3SC3A 3JVVA 3BIFA 1T0HB 3ZS8A 3KTAA 1KZGB 4Q9KA 4BZQA 4MRNA 4NCIA 4XSHA 2Q9CA 5CK4A 2XGJA 4ZCLA 4IEEA 3ADDA 1NBMD 2VP0A 4PQYA 3TW4A 2WBLC 2YWEA 1YR9A 1YR8A 1S1CA 2VP5A 5B30A 2GWHA 4URXR 3A1SA 3PITA 1CJKC 3Q5EA 4LYJA 4AK9A 1IN4A 1WP9A 1DG3A 3ZIAD 4B2PA 1KSGA 1E79D 2A5GA 2CCGA 1UM8A 1X6VA 1GDDA 3DPUA 3UMFA 4ZDKA 1FMLA 2GCOA 4KFRA 1COWD 2VSFA 1JR3A 4I1VA 4L5BA 4AKGA 1SVLA 1YZTA 2EU8A 1KKMA 1AQYA 2QZ4A 3KKNA 1VG9B 2HLDA 1QHGA 2R44A 5DYIA 1N6OA 3OIVA 2QORA 4E22A 4PQRA 4GOXA 2UZ3A 4W7SA 4Q9LA 5FPHA 3U3OA 3VR1A 3VX3A 4YDHB 4DDTA 4DB2A 1HT1E 1QG2A 2QN6A 1MO4A 2IS4A 1ANKA 3REFA 4QHSA 3X1DA 4TYNA 2O8FA 2A2ZA 1JAHA 2AKAB 1Z2CA 4HYYA 4KBFA 5JECA 1EFRA 1F5NA 5GVRA 1NRJB 3AQ4A 3E2IA 4G5OA 2OBMA 5E4FA 3DOEA 4HI0E 4ABYA 5JI2E 1P5ZB 3G0HA 2R65A 4ARZA 5GADl 3FE2A 1BYIA 2RGXA 4IOMA 2J41A 5EUMA 4OHYA 4TYPA 4LJ4A 1XX6A 1DOAA 1TX4B 2AKYA 4ASUD 4GI7A 3KB2A 2KWIA 3A37A 3CF0A 3LQRA 3QOFA 1GRNA 2B92A 5LB2A 1KI2A 3X2SA 1LNZA 4RFSA 5HE8A 1DAKA 2QAJA 4RSGA 2ZROA 4NCHA 4V0NA 2OFXA 1UBGA 1U8AA 4N0DA 1MABA 2KSQA 4LGMA 1JECA 1RJ9A 1ZNXA 2PEZA 4LBZA 4DLUA 3ZZ0A 1W4AA 5KYKA 4MGIR 2VO1A 1S3GA 5HR5A 1VCMA 4RD2A 3CWQA 4LPKA 1Z3IX 4HZUB 4KXFB 1FW6A 3VKHA 1J8MF 2DFTA 3CNNA 2IEYA 3WBKA 5FOVA 2REOA 3LLMA 3W5JA 3NKVA 1Z6TA 3FMOB 1QHHA 1OFTA 4M21A 4CYMA 4JJZA 2CVHA 1JI0A 3PV0A 5D3MA 5FPYA 3WHKA 1JR3D 2JLZA 4US0R 1S4QA 1G64A 5A0FA 3CRW1 4IRUB 1SULA 4NYJR 1XCGB 2OXCA 4HB0A 2GEVA 3HPRA 1S8FA 3BJIC 6Q21A 4ZDJA 4I81A 3FHTA 1FP7A 3WYGA 3AVVA 2CHVA 4JVNA 4E07A 1UBFA 2GVDC 2O52A 2C95A 4EUNA 1OIWA 4LBYA 2FGJA 4OQLA 2FZ4A 2VA8A 4PZLA 3NDPA 4RZUA 1ZIPA 4W5JA 5FOSA 2FDCA 4RCZA 4W5HA 1RPZA 5H70A 2FMXA 2IYXA 2W6IA 3HJNA 3EW9A 4ITRC 4ZO4A 4XVRA 5ELXA 2H1LA 2QTHA 5K8UA 1Z6XA 2L0XA 3NWJA 4G1UC 3NEYA 4C7OA 3GLGE 1AJEA 1VIAA 2VP9A 1E2MA 3VR6A 3LY5A 2C99A 1RRFA 1XCPA 2GBLA 2OAP1 3PEVA 3HYRA 4EDHA 3UG7A 1KOFA 5CLQA 1E2JA 1ZM3A 1UAAA 2WWFA 3NBXX 5FUYA 4FMCB 1NLZA 3SBEA 2HCJB 2NG1A 2YC4C 2RGEA 3PUYA 3L8YA 4B32A 1XCMA 4BLTA 2FZLA 2JIZA 2RB4A 5H8WA 1H8EA 2ZU6A 2G0TA 4JL6A 3CBQA 1LB1B 1CJTC 3WHLA 1MRNA 4Z8YA 4HSEA 1EFCA 2A9KA 3AVQA 3KXKA 2J7PD 3IHWA 1XEFA 4QFMA 5EZ5A 3TSZA 4KJZA 4LJ9A 2OCYC 3F3YA 3L0OA 3I61A 3VX4A 5FTLA 3DL0A 3RC3A 3EIHA 2PMDA 1IN5A 3OIYA 3PIRA 3QG1A 1H8HA 2WIBA 3GMTA 3UMSA 5KU1A 5FUWA 4KVAA 1NG1A 1CKEA 1TL7C 2ZVQX 4PO9A 1DAFA 4NBSA 2OAQ1 3VR2A 5TMPA 1M74A 1R5BA 3QNUA 5D3QA 4Q66C 2BEJA 3FYHA 4FD2A 4FI3C 2X8AA 4Q4JB 4Z51A 2A5JA 4DT1B 3AF0A 1QHXA 4MYUA 4DLZA 5J4HA 5K8IA 3K0CC 3K09C 1ZU5A 2QPOA 4II7A 4LJ7A 3AKDA 4FWTA 1DADA 5FPSA 2CK3D 2C8VA 5FTNA 3LBHA 4N0EA 2R9VA 3K0FB 2BIFA
chains in the Genus database with same CATH superfamily
4DIDA 4OP2A 4NNOA 5JCXA 1Z5PA 3PHCA 1L7MA 3G2MA 2ZYWX 1I6MA 3MLEA 1IUKA 1YO6A 3BJZA 1TECE 4LCBA 2VJLA 4YFVA 3PUHA 4AJIA 3ZHUA 1KDZA 3ZU6A 2E6KA 1ESNA 1CTQA 1LF0A 4WY8A 2QYSA 1KYTA 1NP3A 2IZZA 2NT3A 3CS3A 1CEXA 3OCUA 1A2OA 3EDCA 1H9BA 2ZRPA 3SS9X 4DNXA 1OR8A 3UFBA 3T41A 4COOA 2CLMB 3DBRA 1UAGA 3GFQA 1EP1B 4NDZA 2M9MA 1IG3A 4Q3AA 4IUCS 1VLLA 2Q49A 5JSQA 2C2OA 3FSEA 4MW5A 4DB4A 1WDTA 3H1AA 1SBCA 3C2QA 2ZUVA 3FMPB 5AH0A 5HCUA 3IDZA 2WIGA 1U0EA 3HY4A 5EHNA 1QCYA 5F7JA 1OTXA 4V0MA 3PENA 2X0NA 3L40A 3F4BA 4HRVA 4JSYA 4CIBA 2R97A 4U2EA 4YRBA 1S89A 2CDRA 1IFXA 4X84A 1T5IA 1VGRA 2ODBA 1W6RA 3CKYA 3GVIA 3AKEA 2C5FA 1PJCA 1DIGA 3H3XA 3N59A 4JL5A 1NU6A 4FYVA 4KWTA 4OFZA 4TV8A 4N76A 2HF8A 2I8LA 2QZSA 3L2OB 4YI3A 4B31A 5IT5A 4WKBA 4M76B 4NEGA 3PQDA 3IP7A 1W30A 3VR3D 4BVEA 5EJ7A 2YL2A 1O97D 5HJEA 3EJ6A 1W8IA 3L6DA 4XR9A 4B7AA 4EGFA 1MW8X 2DX7A 1E2HA 3I9KA 2YWCA 4LOAA 5M34A 1L4GA 3P0JA 2NP7A 1XHLA 1WP4A 1K2VN 2M98A 1EXNA 2HRZA 2W8BB 3KOYA 3TTVA 3W34A 1IHOA 3GJXC 2C7QA 1NXWA 3K16A 3OQIB 1V9LA 3OQJA 1C7QA 4OH1A 2WWGA 2PUDA 3ZJVA 3ROTA 3GEIA 3KT8A 4FOPA 1YB7A 1AZWA 3AJ9A 4F5EA 4OFWA 1PNQA 3QFCA 3VDNB 1MR3F 1A69A 1A50B 1KP9A 2IZ7A 5AW4A 1L5ZA 1RKBA 5KOIA 4RK5A 5DHSA 2Z6VA 3E18A 2AN9A 3IP5A 4PZPA 3T9EA 1XZLA 3A6HA 1AU9A 2CXHA 4QELA 5HUQA 1YFJA 3W77A 4TN1A 5A6SB 1UC4B 3ZWQA 1E7YA 5JVDA 2KQUA 5ILOA 3ZXSA 2ZZKA 2BE9A 1UC9A 5BWNA 1SD1A 5F1YA 3QMPA 1U7WA 2VWPA 4B6RA 1OGYA 5K3BA 2W6ZA 3A6LA 5C8DA 3G02A 1OV6A 1HA3A 5IKEA 1ZCZA 1W52X 1Z38A 2VR1A 3ANNA 3CUEF 5IYZF 4BE9A 5KUTA 1WLSA 2H4FA 3UOGA 4AX8A 2AYXA 4PN7A 2BFBB 5TDHA 1IMJA 2EBHX 1U7TA 3IIIA 4J1SA 3KZKA 4I6JA 1YNSA 5EMLA 4FFDA 5HTOA 3LLCA 3NVKI 1VZ3A 4JEHA 2JFBA 3LLVA 3QGMA 1A9ZA 3LUGA 4R40A 1HI9A 1T36A 3DFMA 4HDKB 3OPXA 3SZMA 2KX7A 4EFDA 4WFJA 4DS3A 4X61A 3ZWVA 1Z7YA 1ZH0A 1BHJA 1ZH8A 3MGCA 5GQSA 1GOTA 1FP4A 1M66A 1T10A 1KVTA 1YD7A 4Q7MB 1WBDA 1K6MA 3UQYS 3Q3IA 1L5NA 4D3FA 4CM7A 4BXOB 5F4BA 3TAUA 1T13A 2ZYAA 3DE6X 2NYRA 4D8TA 1H1LB 3OOWA 3ZH2A 4EPWA 2WZCA 1TM4E 3OD1A 3DWEX 1HE5A 1O95A 4ZZ2A 1ZO8A 1F06A 2VHZA 1TXGA 4FT2A 4XJTA 3HHEA 4B6PA 2YS7A 3JYLA 1LLUA 5HZMA 4J0EA 2IA5A 3LPMA 4NWIA 1IHPA 4ZZIA 5K0EA 4Z4HA 5E1MA 2V9ZA 3R7WB 3QVSA 1L7QA 1TF5A 4QFDA 1JIVA 1KI1A 3U44A 2DY1A 4P4SA 1W8DA 2E4VA 2BI7A 4IKOA 4GIBA 4O1IA 3FKQA 2P35A 1XQWA 2Q5FA 3G2JA 3OAAA 2O23A 3I8SA 3DCYA 3H9JA 2IZ6A 3DE0X 1P9NA 1PR5A 4P1ZA 4PTZA 3LP8A 4XPIA 5EKDA 5FUXA 3JZAA 4AECA 4B75A 3SWWA 5THKA 1Q7GA 1JJIA 4F60A 5EZYB 5LP6C 2F2TA 3HU3A 1YJXA 3FBTA 3I52A 4E2YA 4BBZA 4C4XA 2JJYA 3FZYA 2CYAA 3V8NA 3A6PC 2FXVA 2BGIA 3SYNA 3KEOA 4Y6PA 4YJHB 4DJEC 5CCBA 3BXEA 4UUBA 1NURA 4JBHA 1ZOOA 3SF8B 5A4FS 2DEUA 2HJGA 4HAWA 4R1LA 3DO6A 3RBAA 2JD1A 2WP0A 1AUQA 4HNVA 3AXTA 5KDDA 3N76A 5HQ3A 2CZCA 3LK7A 1HEIA 2Q46A 4K40A 5A5GA 1AKQA 3TCNA 5IDXA 2O48X 2QV7A 4MGHA 1OAOA 3GVXA 5IBPA 4D80A 4AP6A 4REQB 5CYPA 2QJRA 3MJEA 1OY1A 2E4UA 5CVDA 1V26A 2HLPA 4A6DA 5CB4A 3B1XA 4ZCPA 3THWA 3LBIA 3GEHA 3BWYA 4N48A 2FW9A 4GI3A 4YV7A 1SU8A 3MPUA 3RIYA 4JEMA 3M81A 2I3GA 1IY8A 1UFKA 3K0HA 3OQBA 1Y3FE 2EWWA 3AM3A 4WOBA 1FS4A 2O0MA 3JALB 1P73A 3K0BA 2PAFA 4E5YA 3OQOA 3O9MA 3C41J 1GUFA 2I33A 3QV1A 4OYYA 4P35A 4YQEA 4ZMRA 5A9SA 3IUMA 2CKMA 2JKYA 3KZCA 2GH1A 3NZEA 4YNBA 3P9PA 5I9SA 3C8HA 3U7FB 2J30A 2DH6A 1QRRA 1P18A 3KYIB 2F00A 3ZWKA 3TTWA 1U1EA 4LYFA 1UKCA 2WPDA 3IIKA 3NHAA 4MR8B 4TM8A 1Q2UA 4YJGA 3ZZUA 2RHDA 2ON6A 1QPBA 3TAHA 1OE0A 2C9BA 3BXHA 4J7UA 4BEBA 2IU0A 4QSHA 1D0VA 1A4UA 4D7AA 4HKTA 3C70A 4JJFA 4Z4EA 1PZFA 2VDRB 3JQ7B 2GSWA 2VJOA 3UW1A 3MJ4A 4LQDA 4GMDA 2I1VB 1HKUA 3RKRA 4LAFA 3SX0A 3CJRA 5EESA 1JFRA 4MLCA 4ZHQA 3ZDXB 3JV7A 1R10A 2RKWA 3I8XA 3PHGA 4LDAA 1WMBA 2C31A 1T0IA 1WLYA 2Z30A 1WOYA 4FPXA 4MQ6A 1UJNA 2I67A 2B5WA 1U2DA 1AZSC 3KG2A 4FWIB 4WKCA 2AQKA 4LZOA 1DQZA 4X65B 3WWCA 3L77A 4BJ3A 2ES4A 1ZIYA 2EP7A 1G20E 4O2BB 4TTSA 2WHXA 3G85A 4CKCB 3BB3A 4NE7A 4PC3A 4G8DA 2RI0A 3CMCO 5CW1A 1GFZA 2YFQA 2MYTA 4HN2A 2BMFA 2GVNA 2I9PA 4PSDA 5F73A 3RSQA 3REQA 2ZIGA 2WJZB 1PK8A 4JLVA 1R5NA 3WMFA 1HYQA 3DT8A 1KC1A 1PL0A 3ZEAA 1YS6A 2I6FA 7REQB 1Z6QA 4AMBA 5JV5A 2H5JA 4F2HA 1L4BA 2G4VA 4W99A 3ZJTA 1ISPA 2PTGA 2Q8QA 1VMDA 1M2JA 1I6KA 1VPEA 2LR0A 2W93A 2X0RA 1QXSA 2ZWAA 3FCUB 3QKTA 4G23A 2O7NA 3E7DA 4EQ6A 5BYBA 2B3TA 3HCRA 1EDEA 4AKTA 5K4HA 2HNAA 1E0JA 4IS3A 3ZY4A 4G5RA 2YHBA 2FFHA 1ZVMA 3T4EA 3WP1B 3QV2A 1WRBA 3BH7A 2WAYA 4A1OA 1Z56C 3EDMA 3I1YA 4FFSA 5SZHB 5DTEA 2Q4TA 4A8JC 1VGQA 2AFRA 2GO7A 4U2DA 1UCFA 2GNAA 1XNHA 3I34X 3OCJA 4P9NA 4JYCA 3BAFA 1BVRA 4GG1A 1EHCA 4DL9A 3SYLA 3MUFA 4XX0B 1N7GA 4Q3KA 3N0TA 1SPXA 2JRCA 3EZLA 4IIBA 2D1YA 4Q9DA 2FHPA 3LF2A 4YAEA 4ZAGA 3TQFA 4Z4FA 3CONA 3K20A 5TNXA 2IPLA 1O5IA 5F33A 1CR1A 1F38A 3F47A 3IJ5A 4HH1A 3DDOA 4BCCA 3N1UA 1E4VA 3MTJA 3PWZA 4ITVA 4JA0A 1PV1A 1KK0A 2ZSHA 4AYWA 1OH5A 2YYZA 4BAGA 4OQEA 2VDKB 1BE8A 3E8MA 5ER6A 5IC4A 4G41A 3KQKA 3Q12A 1H93A 3I42A 4YRLA 1HSZA 1U7PA 2ZQZA 3BJMA 4UAUA 1FFXA 2FPLA 3LIIA 3D5EA 5DSXA 2XUGA 2J9ZB 3LFUA 2FOIA 2WSBA 2OGUA 3PGXA 4C0BA 4ZJZA 2WSSA 4FK8A 2QSUA 3RSCA 1T5TA 5DTQA 1LX6A 1MJGM 4TT3A 1WAMA 5KVVA 1KO5A 2ZS8A 3FOZA 4A2PA 3RYCA 1QRAA 3LWBA 3U9TA 1JQJC 1Y8RB 3D4NA 2YDYA 4KN9S 4R05A 2DB3A 1YS1X 4ARAA 4AWXA 1N9ZA 2I1LA 2Q3FA 3ZXYA 3PFFA 4PC7A 1GYPA 3ADPA 1S3SA 2ZB2A 1X7ZA 2FPMA 2GAFA 2X5KO 4BTVA 3EEOA 2G9ZA 4FFPA 5K3EA 5JOQA 1OAKA 4CFYA 4P22A 4LY0A 1P7ZA 1R9MA 2C98A 5TT0A 4DIBA 3E3LA 5CB6A 3LUHA 3K6SB 2H2HA 3ESBA 3O9VA 4YP9A 1MAAA 4YX9A 5AICA 1G8HA 1SVMA 4GLOA 4H3HB 1VG1A 2P68A 1U2TA 1IHYA 3O1HB 1NJGA 1BMFD 3GELA 3ZWCA 3PTAA 4ZHSA 5BVGB 3ZWDA 4HVCA 4KGVA 5EINA 4UEJA 3O4HA 3IEUA 4REOA 1HRDA 1YCDA 3GQBA 3KNZA 4YO7A 3SE7A 2XA1A 1FZQA 1IM8A 1DJLA 1SFRA 1ZUWA 2XT0A 1NZJA 1F1JA 3JYNA 5FEMA 1RSZA 1L4LA 5KREA 5LQAA 5COAA 2DWOA 4BP3A 2W2LA 5EOVA 5A5VA 2J5RA 5CCDA 1OXKB 5JCOA 2NU9B 1ST2A 5L4LA 4GZMA 3HGTA 3CEPB 3JCZA 3P9QA 3W2GA 1LSJA 3OU7A 3VISA 3MS2A 3FSJX 2FDRA 3RB8A 3AVYA 3K9GA 3WLPA 2HFJA 5BR7A 5ALHA 2XH8A 4YREA 4L0DA 2XXAA 1OFVA 2D74A 1W9MA 3FGPA 1GRCA 5JRJA 3EAQA 5C5DA 1G8GA 2XWPA 2ZAIA 1ZGBA 3K0AA 4G97A 4WOJA 2GCNA 4TV8F 2PBZA 3TMKA 3J80A 1WZIA 1ISJA 3H86A 3INRA 1WULS 3SR3A 3R9KA 3T5BA 3ZWAA 4BYMA 5B55A 1BX3A 1E3JA 1YMUA 1EAMA 1BXRB 2ZRNA 3RVLA 1UK9A 4BO7A 5HQTA 4RJ2A 2AMJA 1LZKA 3LWDA 5GZ1A 1AF7A 2C04A 2HU7A 1BW9B 2VF4X 3MMZA 3PR1A 4YXFA 1KDRA 2EIXA 3ZGZA 1OXVA 4IGFA 5FNZA 4BIMA 4Y0AA 3BF8A 4R2XA 3L49A 3MWKA 4JFRA 4QODA 4MVJH 1DKRA 1ZH4A 4EH1A 3WFJA 3BCRA 2FOLA 3KSZO 3QPVA 2W4IA 4W9MC 2J0QA 1M2GA 3UO8B 4KQXA 5DBHX 1W4LA 2P2CA 3VHLB 2JFZA 1UP7A 3T9DA 3B8EA 4RIGA 3GFRA 3IR5A 1NXXA 2FW1A 4Q1AA 2PUFA 1A3CA 2QRHA 2NGRA 1N8SA 2D62A 2OMEA 1E1RD 1M1UA 2IH4A 5KNLA 3LX5A 2ZQ5A 4Q7EA 3SQNA 5KU7A 5C1IA 3M3PA 3DTVD 1K3TA 2ZZMA 1JIKA 4M1WA 1J97A 4H1HA 3RHTA 1K4MA 4PYJA 1KI7A 4HGNA 5FLEX 3H2KA 3SNHA 1HLFA 3C7TA 3G0BA 3UF0A 3HBNA 2OESA 2Q45A 4BWFB 4GQAA 4LUCA 5LL6P 4I36A 4Z99A 3ETDA 5DI3A 4UEOA 1A2KC 3KDAA 4KAFA 4RK7A 1EHIA 3BGDA 3CRRA 4RHYA 4YXWA 3CUWA 3ROMA 4H6XA 1OZ0A 3ROQA 1L0BA 2QTCA 2VNKA 3OKAA 1T35A 3F98A 3FB1A 3ZWPA 1AGXA 1CCWA 4YJGB 4PRYA 2Q0SA 3PI7A 1E2LA 2AE1A 2VUIB 3SZGA 1CF4A 5IWAB 4PYIA 4IAOA 7AT1A 4IVRA 1Z6PA 5CNKA 3ZNNA 1GV1A 3E8XA 1S6YA 3PJEA 4JXJA 1L5OA 1HXHA 4QUKA 4F3CA 1Q14A 2H4XA 2R87A 4JNKA 5JD6A 4CCSA 4C7XA 3VSCA 4JD5A 3K30A 4OK5A 2XQVA 4BFZA 1N57A 4Q34A 4J91A 4N54A 4ZT2A 2IXAA 4RACA 5AKYA 3TMYA 1MJFA 4DWJA 1FTNA 1YC2A 1VLMA 1Z07A 2JFHA 3C4VA 3H4MA 3JD4A 3VH4A 1VIMA 2VUSA 3Q7PA 1F8YA 2HMTA 3H6GA 3HNPA 4I4CA 3T54A 1YMVA 4GAEA 4FWBA 3VHQA 3M2TA 1UP4A 5ELMA 4CF4A 5L3QA 4FHFA 5FBZA 1U11A 2F8MA 2YIJA 5J2UF 1D5WA 1DWQA 3T61A 4LDNA 2H6EA 5K51A 1L5QA 2FSHA 3HO8A 3R40A 5FPQA 2W0MA 3DZ8A 2JFVA 4B4WA 2CT8A 4MS4B 1W88A 3RG8A 2GBLC 2QRKA 3I2JA 2EGHA 3AF3A 1E2DA 1Z4KA 2O2DA 4K03A 2HCRA 1TYAE 2EW1A 1H0KA 4QOJA 4IM7A 4X62B 1JB1A 3ODPA 4UUOA 2O1EA 3FBWA 3OFSA 5I4KA 1TMYA 1U1DA 4GDMA 4N5MA 3CURA 3HKCB 5AM3A 3IBSA 1YQUA 2G67A 5CGQB 1N5LA 4CQMD 1X1BA 2VDUE 4K9PA 4XSVA 3OF2A 1C1HA 3IULA 3UGKA 4BFCA 1H8HD 5J2TA 3U4QB 2GM4A 3O8LA 2QN7A 2DCUA 2WF9A 2X4GA 4LN1A 2IZOA 3A1EA 1TK9A 1K0FA 3F4LA 2PRSA 3AVTA 5SYMA 2HCFA 2C9YA 3ODGA 1LPBB 4CHGA 1U1FA 1UBCA 3QU2A 4XTCS 4CLOB 1XTBA 3K0EA 4RA6A 2X40A 5JQGB 4C4OA 2W8ZA 3E0XA 2XHZA 3VC2A 3MF4A 5TQJA 1I4EB 1VBMA 2GN6A 3E4CA 3THSA 5BPFA 1BW9A 5ALUA 3UCXA 4UREA 2JFOA 3DHEA 4X41A 1P62B 4Z4QA 3GFFA 1A5AB 1GL3A 3Q7QA 5FI0B 4C3OB 4D98A 2FMTA 3GP3A 4ARBA 2ZYDA 5DE3A 2IODA 4F84A 4YRGA 1CNEA 2BLNA 2GESA 2V7BA 4NCXA 2BY4A 3MQFA 4BLOA 4QGGA 3B6IA 1QAMA 2EKZA 4WA7A 3DV2A 3PJDA 2B25A 3TQOA 3KEQA 4NH0A 1P2UA 4XPZA 4JIGA 2AFHA 2ATVA 5CU7A 1BVUA 5EXTA 1JS1X 1OZGA 1GPKA 1U6JA 4ZYLA 4A0QA 2Q5IA 2D7CA 5C8ZA 4E70A 2EXXA 3T7JA 1WEHA 2DHEA 3F7OA 3H4TA 3CEJA 1UJ5A 3LY8A 4KI0A 4DLXA 5CHEA 2A3NA 1AKNA 2OP0A 3KSRA 1O95D 1U99A 3B3JA 4BMXA 4GT1A 1P7PA 1ZDMA 2XV1A 2AUMA 1XDDA 2JDIA 3PD7A 4TMWA 5D7BA 4Y98A 3I2GA 4GEGA 1T2UA 3N07A 4TX1A 3HBJA 1U98A 2EKBA 5E7MA 2CDBA 4QTXA 1CJCA 3MWDB 1HLPA 5BNZA 3Q8MA 1EX9A 3MWYW 4MWCA 2C7GA 1NLUA 2PG3A 1DZIA 4MS1A 3L8MA 4V03A 4ZVRA 4OFBA 3LK6A 1P5FA 4CF7A 2C7BA 1IEXA 3TGLA 2Q2WA 2YFKA 4YHHB 3NORA 4NE2A 3WIBA 5K09A 4YUAA 1RHKA 1NVMB 5C81A 3ZVRA 1T3GA 3AUYA 3BXFA 4IV5A 4BO3A 4P3YA 4MEAA 3KKEA 4RH3A 1Z36A 2E85A 1MC1A 1R00A 4OXQA 4YAWA 4EF6A 5KTPA 1PK7A 1KS2A 3E5RA 1AQNA 5TV2A 4DLYA 5HUJA 1S2MA 4MKHA 2BKUA 3AXSA 1NQTA 2QD2A 2A86A 1U5BB 4ZVSA 3ZWYA 1O08A 2CLDX 3KJZA 4HVAA 5EQJB 5A3RA 1IBKB 1OLSA 4PWYA 4BE7B 3HY3A 3JRXA 3K4PA 3N86A 1DEKA 4JR1A 3R9IA 5JPIA 3H2IA 3RKUA 1G8PA 2IIBA 5C8XA 2OCDA 1YFLA 3NIFB 2F1IA 1VP9A 2QI9F 5F1OA 3TLEA 2VP4A 4HFNA 1D2GA 4UBMA 1GGFA 1JKIA 1JDTA 1A72A 5FWYB 3ZTWA 4DA8A 4DDVA 3NPAA 1PVDA 1RHJA 3FTCA 1KTVA 4NMWA 1W5FA 2ECQA 2P4EA 2EDCA 3KSUA 4LZZA 4ZODA 1LRJA 2VF8A 3FR7A 3PFIA 2O0JA 5DDIP 1Q57A 2Z83A 1V16A 3DTVB 3EQ6A 2CVPA 3RUDA 3T3HA 2P11A 4H35A 4B3FX 1PR6A 2HK6A 4X0EA 4CKBB 5K6AA 3O21A 1ZOIA 4M7WA 1ONBA 3L4BA 1TM5E 4LV5B 2GA9A 3CB2A 4F8YA 3H6KA 5LMUB 3KWFA 3T3MB 1EGAA 1FE8A 2BHLA 1UKBA 1S7GA 1D7AA 3TZBA 1ZM9A 4BLQA 1E69A 1Q83A 2ETXA 3HCNA 2QL9A 3MELA 3OT4A 1Q6ZA 2O8VA 2ZS9A 4QYWA 5JWHA 1H9AA 2Q3JA 3WYDA 3MBOA 4Z7OB 1PHRA 1QF9A 4B8ZA 4EJ0A 5EG5A 2DY0A 3SN6A 2HMYB 1S2DA 2QYHA 5LQRA 3A25A 4YRQA 1ID1A 2QAIA 2UUOA 3LRPA 3QE2A 4B3RB 4KXWA 4YR9A 5L4SA 1H2FA 1CF2O 1B14A 1MT3A 3H13A 3RS3A 1E0KA 1QIGA 2O5CA 5F5XA 1OB2A 4DCGA 1FJXA 4PF1A 1LPSA 2IVZA 3WYAA 2CB9A 4DDUA 2XGGA 3GNLA 5E7QA 5KPJA 4CNQA 1IZZA 2YHIA 2Z8XA 3PLNA 1IOWA 1XYYA 1SXGA 3QK7A 2QQFA 1RXWA 4GKJB 1XTKA 2W2XA 4CTNA 1LJUA 5DX0A 3O8CA 3MJHA 2P90A 4HNSA 1LDYA 5JIBA 1X15A 3ECCA 2AFIE 2DWQA 3LG2A 3QPWA 4ZVNA 4W63A 1RZRA 1ZC3A 1YJCA 1JWLA 3JASA 1U2PA 1ZJZA 3C5HA 3WLKX 1CUIA 1WSAA 4PG6A 3KZMA 4JT9A 1QPGA 2ZYUX 4TTIA 1G6HA 1SVNA 1SWWA 3BRWD 1J22A 3TGWA 5JD5A 4AMYA 4MITA 1KU6A 4MGYR 1ZK4A 2R8EA 3SVZA 3IQXA 5CBKA 4LDJA 1O5TA 1KAOA 3AU8A 1OW3B 1M6VA 2HRDA 4R7GA 1JDSA 3AHIA 4OJKA 3TJMA 3Q4GA 4WWHA 3UMRA 4YQFA 2AI2A 1OVMA 1QJ4A 3DOIA 1M75A 3B2QA 2IITA 2J9FA 2HA3A 5I4IA 4OF4A 2WLTA 4IIXA 1Q11A 4GPAA 5EJAA 4XWTA 3IPLA 4M86A 5LLTA 2H7YA 1WUHS 1VIDA 2GFIA 3HJUA 3RTCA 2WFLA 2P4SA 2PX8A 4JU8A 3IQDB 4LW8A 1KDVA 5EJ5A 4QXOA 3ZLJA 1D5CA 3P52A 3HP1A 1TC2A 2FRVA 5ECGC 4NECA 1X7YA 1Z45A 4I55A 1HYGA 1P4RA 1BQ4A 1WY5A 4F91B 3MWJA 5JNVA 3UV6A 2ZWPA 2OLJA 4UTVA 4S04A 1W0JD 5HM6A 3V7WA 2ZTLA 2DHQA 3EGWA 4FKZA 1JHAA 3ZU5A 3ICOA 2Q62A 2IW3A 1D0IA 4QHYA 1I7QB 4WZZA 2C3OA 2NUPB 4TKVA 1XKQA 2BFMA 4NBNA 2HADA 5DHUA 1KDYA 4OOEA 4FYJA 2IXEA 2Z5LA 3HNRA 2CXNA 3EXFA 2GN1A 5BV1A 3AY0A 2CGEA 5CXUA 2WM2A 5D6OA 1SCUA 1ZCJA 5KKAA 1UKZA 1H94A 2ZP1A 4BNIA 2JJ2A 4FYKA 1LPPA 4PLGA 2OZLB 1SPBS 3AVOA 5G0VA 3WMWA 3DT9A 1B6SA 2IIPA 5IPFA 1ODIA 1VRWA 2PS1A 4KDEA 4CL8A 4HVLA 1QC5A 3BE5A 5A3QA 4EW3A 2MMGA 3AIIA 2JK0A 1NBIA 2ODQA 1SR8A 2J7KA 1Y37A 4P32A 3F96A 4QEKA 2ZRQA 3OSUA 3SHTA 4O29A 3W9YA 5TARA 2G1PA 3OQHA 4V0RA 3TIGA 5EIFA 2D3WA 3U4DA 3EULA 4DLBA 1QFXA 2BZ1A 3FNGA 4L4ZA 2PKXA 1E62A 4QO8A 3HA5A 1R9JA 3A06A 4R83A 3S70A 2O7SA 3LPCA 4AY5A 4EYGA 1QFMA 1RT9A 3ISJA 4P84A 2ECOA 4DYHA 3EGXA 2VNHA 1KQNA 3TR6A 5AOBA 4MYDA 3DDZX 4UEQA 2PH1A 3GA7A 1OCEA 4GYJA 4JT4A 3CO5A 3EB9A 5LXTA 3GMIA 5C80A 1Z3CA 5ITZB 5HS4A 1TEXA 3I0MA 4K9LA 1L7RA 2IUEA 3P9XA 2R7MA 3EEQA 3GRZA 5AVWA 5C8YB 2NU6A 1T3ZA 2ZREA 3PFCA 1AUXA 2O0LA 4HL6A 1MH9A 3OEED 3ZZMA 3AF6A 4ETMA 3VR5A 1F0KA 2Q5CA 3GGPA 3S29A 1NX9A 3FNRA 4DARA 1EWQA 3GRRA 2COEA 1XOIA 1KFKB 2BDTA 1OT3A 3ZTTA 3EIFA 1J21A 1PT5A 3GXOA 5DNCA 1ODKA 2REBA 3CG0A 5FWDA 4FNMA 2X41A 1Z73A 4ZVQA 1E66A 2P6RA 1AQ6A 2AOVA 1DINA 5AKKA 3TXYA 2EP8A 5DN6D 4J16A 3GP5A 4JDUA 1AGRA 1H0HA 5IJZA 2VJCA 5DI3B 2F3RA 3B9RA 1ZRSA 2I3AA 4F3YA 3DFUA 3PEEA 1IEWA 5KSYA 1QHNA 4GZ3A 4LWZA 3OZVA 4MJ3A 1EUDB 2GB4A 2GEUA 4L8LA 1T34A 3QLVA 2VPIA 4AXXA 5DNVA 1L4NA 2OC9A 1F6BA 2REXB 1PGPA 3CRNA 4GRAA 4TS4A 1O96A 4IVNA 1U1IA 5I01A 4G5XA 1VXRA 4H0NA 4CZ2A 1Z9BA 3ZW7A 4ESHA 4HQKA 2PS9A 5ILGA 4B33A 3A1FA 3UBTA 1KNQA 4R68A 5AI0A 4XVHA 4TLDA 3HP4A 4XIGS 1KFEB 5LYJA 1JHQA 2HWYA 3MBKA 3IO5A 4IFEA 4G2TA 3THYA 4YFYA 4N0MA 3EZ6A 5EI5A 4O1HA 2AFVA 2HRBA 4UU8A 1E1MA 2PX3A 4LHSA 4RJLA 1SQ5A 5B3JA 4BVFA 1B8UA 1FFHA 3M7IA 4ZA2A 5JNLA 4G1VA 1G21A 3O8QA 1X8KA 5TJ9A 4Q1VA 4Q47A 4HDAA 1AKYA 2BGGA 1NMQA 3R7BA 1PTKA 2O2JA 2WJ6A 5FOXA 3ADBA 1TEZA 1DLJA 1TKRA 1V0JA 4JQSA 2WQZA 2NIPA 2I4MA 2WI8A 2ZBGA 4IQ4A 2P9HA 2P1RA 1MZVA 3RJ9A 4HYTA 3JSXA 4LJAA 3FY4A 1U80A 4JUFA 2BWJA 2WD8A 3V8MA 1EFVB 1XR3A 1I30A 3QH4A 4ENPA 2AMYA 4OTZA 1P4SA 4RETA 3STTA 3LQYA 3TGPA 4G4SP 3IEXA 4OJTA 3TYXA 2TMDA 4CQNA 3BERA 2QUBA 2PXAA 5LPNA 3IE0A 2GO1A 3HR7A 2IE0A 4M9UA 4Q4HB 3D4OA 4BVKA 1P60A 4ZYYA 2QBYB 5E6UA 1T2AA 2BRUC 2R6FA 4OJQA 5AUNB 4OM8A 3BFVA 1BCSA 3HKCA 2OG2A 3RLFA 1R2QA 4G85A 1D4ZA 3I8OA 4IUBS 4OUDA 2WTBA 2ONJA 1VHDA 1JYFA 2V59A 3LQQA 3WKAA 1YS7A 4OV6B 3S68A 1KEEA 1DBRA 1Y63A 2X77A 3L8FA 5FRDA 1Y1LA 2VHCA 4ROTA 3RUIA 1N3IA 2PT9A 3VSBA 4D44A 1ZEMA 5BT8A 1XPUA 4LFAB 1C0EA 2W6MA 1NJ5A 3FRHA 2PLFA 1FYXA 2IX3A 3JQBC 2JI9A 4B09A 4KR6A 2GCEA 3O92A 4PSVA 3GN1A 1JSCA 3GLFB 5DM1A 4GDFA 4B3MB 4E94A 1L5KA 4QPDA 1KVRA 1R8YA 4WK4B 3GP8A 2GAOA 2P79A 5D86A 1ZA2A 1FLNA 1ZRMA 3DXYA 3GRFA 3P71T 4UJ5A 5CRIA 5FBLB 2PU5A 1UKYA 4U7DA 1SVIA 5HDQA 1I7DA 3JS5A 1OHHD 2JI7A 3SBOA 1ZA1A 2VF5X 3ORYA 2FB9A 2GJKA 2C5SA 2PYZA 3UAVA 4C1BA 1NULA 5CB4B 2GBCA 3CVWA 1EX6A 4HAYA 1YB4A 4M49A 1DKMA 2ODEA 3GJ0A 4X20A 4NYJQ 2PRJA 2YHSA 1IULA 8AT1A 1PF7E 1U6KA 3L4JA 1JSLA 2FZGA 2IT1A 3JZDA 4E5KA 1GNSA 3WGKA 5K03A 1FP6A 2PZGA 3JALA 2AEFA 2AD1A 1F8GA 4KQJA 2AYZA 2GNOA 3LBFA 2YTZA 1VCNA 3ND9A 3FPHA 5KNCH 5K0LA 4DRXA 3AL0C 1Y9AA 3JQAB 1ABFA 1YB6A 3DEKA 3UZUA 3EX7C 3UMMA 1BGVA 4KAJA 1YRLA 4JBYA 5EE5B 1GZ4A 3E81A 3K92A 3LYHA 2QD5A 3D02A 3MUNA 2GX6A 2Y1CA 2I2FA 1SGWA 3A1WA 1X7YB 2G8NA 1C5KA 4C5BA 6ADHA 1HZZC 3OQVA 4C4PA 3GCDA 4ZYZA 5CBPB 1WB6A 3ESCA 3U4HA 1WXFA 5FI3A 4DJAA 2AJBA 4P81A 3EYAA 3O73A 3ZEIA 1R0KA 4GQIA 1ZMTA 2DR3A 2H07A 5AKGA 2H92A 1MTOA 5AJZA 3G0GA 4FSXA 5BQ3A 7GPBA 2VHQA 3VBCA 4B6GA 2VXCA 1M2VA 1WXEA 3ZX4A 1V2GA 1VIVA 5F2KA 3VR3A 4Y2RA 1I01A 5BOSB 4EYKA 2CD9A 4C43A 1RLUA 2HYDA 3KVVA 3D0QA 5KIAA 4CR6A 1QNFA 3TPZA 1I6LA 4KVGA 3QVGB 4MV7A 1AM4D 3V1KA 1X19A 4BBPA 2NV6A 2WF8A 2JAPA 3ZQ6A 3DOFA 4R2HA 5KOHA 1Q21A 2Y1LA 2I29A 3DEZA 3RRMA 3X1JA 3N7AA 4F5WA 4N6GA 1ZR4A 1X9IA 5DBIA 1BHO1 5BN4B 4F7WA 3GU3A 2J4CA 5EAIA 3TZKA 3ZNPA 2H1FA 5EJMA 4DUYB 4HS9A 4DY6A 1JEDA 4Q93A 4G5HA 1OC2A 2O2HA 2P9QA 3EPRA 3M6XA 1MMFB 1VFPA 1P2SA 4IO0A 3AO0B 3KFVA 4OBEA 3TM4A 4GI1A 4K86A 4J1TA 3M4JA 3ZK7A 5EL0A 4GNRA 1IBRA 1JFFB 2X8LA 3Q98A 1FMCA 4XUGB 3HJGA 3RT9A 4R2MA 2FWBA 1K3FA 1FRQA 1RQLA 2NPIA 3RAGA 2RJ3A 4C7MA 4C0WA 3V48A 3HN7A 4FDLA 2O3QA 5EA2A 3HDVA 4YIHA 5I4BA 1BXGB 1XKLA 4AQDA 5BWBA 1OI2A 4I1YA 2ZSFA 4RFLA 5F1PA 5G2OA 1WS6A 6CHYA 3OO1A 2L17A 4J9VA 1HDEA 3OOJA 4MW2A 1F2UA 1ZOLA 3LXRA 3WGOA 5AQ1A 3S1SA 3FOEC 1JKFA 2J3JA 5EVCA 3UXHA 4MYHA 4IXMA 2D5LA 4EIWA 1CEEA 1HFWA 4RD6A 2MDTA 4TQAA 3UH0A 3WB1A 4JB8A 4CT4B 5CLJA 4BECA 1JLHA 3GI1A 3OZUA 4PCLA 1B8PA 1BXZA 1M0SA 1YA8A 2D13A 3B1YA 4ZAYA 5G0TA 5A7HA 2VATA 1U63A 5DCUA 3COJA 3GFOA 2BKLA 3AR4A 1Z2NX 2QLJA 3Q7RA 1EP3B 2YICA 2W11A 4MO2A 4WCVA 1UINA 2XUQA 3BB4A 1XZHA 3WGGA 1LNSA 1JG7A 1WCWA 2ZR0A 1V4VA 3DMTA 5LDGA 4ND1A 5TQVA 4F86A 5F2NA 2G06A 2IS2A 4ZICA 1G4UR 4IHJB 2O06A 3CR7A 2FEAA 1NR7A 5TGZA 4BZWA 1V9CA 3W3AD 3KS9A 1QRUA 1UXOA 5AKEA 4N3NA 2IWRA 2NO7A 5A6VA 3JYHA 1XPJA 3TIVA 3AJRA 4X8OA 5A4MS 3SU8A 1VE1A 1NMXA 1EBUA 2IP4A 1Q50A 2OBLA 2P9CA 2ZKLA 1GZSA 3QTTA 1AKWA 3S4YA 4HS4A 1PJ4A 3RO7A 1C1XB 2Q3MA 3ZCXA 1PGNA 5TMEA 2XVAA 1I80A 4DNOA 4QARA 1ONOA 1NNI1 3YASA 2MJLA 4M7PA 1ND6A 5A0VA 2IYFA 1E2UA 4L75A 5K3AA 1SCBA 1TU3A 5CA1F 2H63A 4D9EA 1BE6A 1PSWA 4GMFA 3VNRA 3D1VA 4U7GA 5DXFA 5DI9A 3TG8A 1RACA 2A9OA 1LF5A 3MFQA 5TY0A 5KYYB 1G5RA 5K8LA 4C14A 4UPEA 2WUWE 3OJ0A 2IV3A 3A6JA 3AFHA 1JQ3A 3OPMA 4Q4DA 1T9ZA 1D2MA 2EFEB 2ERXA 2GPTA 3H1FA 2GVZC 3KXIA 3JWGA 3MWEB 4JMPA 4P31A 1VL5A 2IV7A 1OFIA 3EUAA 1UBNA 1Z5NA 4ZT6A 3WBJA 3A1NA 1ZX1A 5IN4A 3CXUA 1BOOA 5G41A 3KQOA 1QBKC 3PUKA 2WFZA 1SUPA 1T4GA 1WZUA 2D1QA 2RH8A 2BHRA 3VAYA 2PL3A 4BX0A 4EG0A 4IILA 3E22A 1KDTA 2IYZA 1PT6A 4WCDA 4BBJA 5J58A 3DB2A 4Y67A 1J2UA 2QGFA 3SHQA 2R8RA 2JPDA 4YAKA 2K2WA 2UKDA 3CF2A 2LP4Y 2QRNA 5HGJA 3B5JA 4U7WA 1Q6YA 1OBCA 1WA5A 1WXQA 1XVUA 2R5FA 3JU3A 4HGOA 4YJKA 4C4ZA 2EQBA 2OBXA 1RQ7A 2HQBA 3FDIA 3MNFA 4C7BA 2H1HA 3EY9A 2ZJ2A 4C6TB 1U9CA 2OQVA 2VDVE 4PCVA 3AKZA 1QMPA 3WY9A 3D1JA 2FRDA 1RYDA 3RCBA 3IV9A 3V32A 2C4TA 4KQGA 1FSZA 1NUUA 1C7RA 3AILA 2ZRCA 4MQ5A 4ZFNA 1LV7A 1Y5IA 2EOAA 2N3ZA 2A0FA 4OB7A 3TLKA 1GWNA 2OHFA 2G9NA 3ANLA 3D8SA 2CXTA 4JELA 3R76A 2H4WA 3SHVA 4TVBA 2NTVA 2GPBA 4P6VF 3CKLA 4C7VA 4JXXA 2Z6AA 3V4VB 3RAJA 4BFVA 2J8ZA 3L0PA 1V6CA 3Q7SA 3ZBUA 3BD7A 1IK4A 5LVAA 1Y48E 4JP2A 2JFYA 1H5QA 3E15A 4GL2A 4Y2XA 3FCSB 4JGGA 3E6AA 1FTQA 1AXRA 5I6DA 4AT1A 1RQXA 3CR3C 2EF0A 1PLLA 2IS1A