4M9QA

Crystal structure of c-terminally truncated arl13b from chlamydomonas rheinhardtii bound to gppnhp
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
196
structure length
195
Chain Sequence
GPRKITIALLGLDNAGKTTLLNSIQGEDRDTTPTFGFNSTTLNEGKYKIEVFDLGGGKNIRGVWKKYLAEVHAIVYVVDAADPGRFEESKMTMAEVLENQFMRDKPICIFANKQDLPTAAPAAEVVKGLGLATCRNSHNVFPCTAKMPAGQDVDHRLRDGLKWLVGTVDREFGRLDPRVQTEAEEVRQEEARKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the small G-protein Arl13B and implications for Joubert syndrome.
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Hydrolase
molecule keywords ARF-like GTPase
total genus 71
structure length 195
sequence length 196
chains with identical sequence B, C
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2013-08-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4m9qA00
3AVXA 4II7A 4NCHA 4L16A 4FWIB 3DKPA 5AR1A 1ZCBA 4IDPA 4NCNA 3VR4A 3ZS9A 4OJQA 1U9IC 1U0HC 1P60A 1WA5A 3LLUA 3QXHA 1EFHA 1ZUIA 3VX3A 2IYRA 1M7BA 1KO7A 3A1UA 3AVOA 3AV0B 4P4TA 5HCNA 1KSFX 2QE7D 4BRWA 4I1OA 3EC1A 3WXMA 4JSYA 1RYFA 1VKJA 3QKRA 4BECA 4E5UA 4OK6A 3AP2A 5H8WA 2QM7A 3DO6A 3U61B 4JL8A 3CNOA 4JYBA 3VR6A 3AEZA 4AKIA 5GJWC 4IVPA 1OB5A 1ZC3A 2WWFA 5E4FA 3IIMA 3OAAA 5P21A 3R8FA 1PLJA 5BQ5A 2JLSA 3WY9A 2JLVA 2CEAA 3PUVA 1D8TA 2HEIA 1Q44A 2V55B 2FG5A 2YC2C 3BS4A 4F92B 2ZI3A 1PV4A 4EKDA 2UVQA 4R71A 1P2UA 4FI3C 4WA7A 2D06A 2ZJ2A 5C46F 5FTJA 3MWKA 2MMGA 3PITA 2Q6TA 4GNKA 2AR7A 1S2MA 4BFVA 5F3WB 2FEOA 2XZPA 1KZ7B 4KBFA 1ZW6A 3QVVA 1VYUA 4KV9A 4KXFB 2JA1A 2OFWA 2UZIR 2H8KA 621PA 2J3EA 3HR7A 1Z6GA 5KPDA 2D2FA 3QPWA 5AJZA 5B64A 4YDSA 3TIFA 1TUEA 3T06B 4Q7KA 4I1VA 5HKKD 1U8AA 3I3SR 3U7GA 2CNWD 4MYTA 3ZIAD 3I92A 4R2IA 1DAFA 1P9RA 1X8KA 2W6ID 4MH0R 2IEZA 4RD2A 4F38A 1L8QA 2F1RA 1N0UA 1ANKA 4ZKDA 3EA5A 2WWWA 3T1VA 4RFSA 221PA 4CIDA 1S96A 1GKIA 2GK7A 5J5CA 2GJAA 4TL8A 5EP2A 5FBWB 4QHSA 1MH1A 3IO3A 2CK3D 2NMVA 4BASA 3K9GA 3KFVA 2FMXA 1Z47A 4NE2A 3W3ZB 4B3BA 1DG3A 4EFNA 2QE7A 5EP3A 1YQTA 2PH1A 1A5TA 4M0LA 4HAUA 1N5JA 1AM4D 2Q9AA 5FUYA 4V0ME 3ZD6A 2GJ9A 1ZM3A 3GCGA 1XMIA 4LJ8A 3U5ZB 1E1QD 1S3SA 3P27A 5GVSA 2XXAB 4QGFA 4AI6A 2ZUCA 4ZDJA 3GLIB 3KKOA 5C2JB 4Q4AA 1VYTA 2VEDA 5JBQA 3RSOA 3EW9A 5H1YA 4FXPA 3AKYA 1VPLA 2CDNA 3UXMA 1XPOA 4DCTA 5E7IA 3K9LA 2J9RA 2UZ3A 5AJWA 3RC3A 2PT7A 5EE3A 1UAAA 3QKTA 4QL3A 5CM9C 5IHPA 4AKHA 3DKVA 3TAUA 3CR8A 1FFHA 1EFCA 3D3QA 2DWPA 1FPMA 3N5CA 1YRBA 3VKHA 3KKPA 1SZPA 4MYCA 1OF1A 5G41A 4TLBA 4P0TA 1E2EA 3SU8A 4PR0A 1RJ9B 1NSFA 2BC9A 4US1R 2YC4C 4K81B 1BMFD 1XJQA 4LYJA 2HUPA 1Q1BA 4AYTA 4A2WA 3K0SA 4S2EA 5HE9A 4BFTA 1RRFA 2ZRBA 4JMPA 2ERXA 3AKEA 4Y0VA 4PZLA 4KFSA 3ZD7A 4JVMA 5FBRB 1I4DD 2D4HA 4DEYA 4URVR 2VPPA 1G20E 3KQUA 1EX7A 3FGNA 1SVLA 1H8HA 3IQWA 1SVOA 1XP8A 2FFBA 2ZROA 3CR7A 4MYHA 4A0RA 1TUIA 4DLRA 4KAXA 4EDHA 1N0WA 2HF8A 4PSKA 2WJHA 3A4LA 4ZDWA 2JATA 3U3JA 5B58C 3U60B 4ZCIA 4NYJQ 4V03A 3MUFA 3PUWA 2EFEB 3R7WA 1O3YA 1G8FA 3TVTA 4Q7JB 1E4YA 2ZRGA 3K09A 3RAPR 3AVPA 4C0KA 1W7AA 2Y8EA 1HH4A 4FMDB 3KQHA 1Q1EA 2O8FA 1MR3F 2WJVA 1FP7A 3LV8A 3WNDA 4Q02A 3THYB 3VMFA 1DARA 2JIZA 1W4AA 2ZYTX 4GOJA 1IONA 4I99A 4D82A 4A0GA 1AIPA 1XMSA 1XD9A 2QTFA 2WWIA 2ORIA 3A58B 1I2MA 5BWMA 5JI2E 4KO8A 2D3WA 1L7VC 3K0AA 4RFSB 3QJYA 1Q1QA 2WJYA 2IYYA 4IJMA 2WPDA 4LGMA 1QBKC 1Z0IA 5AUNB 4DVGA 3BJIC 1SXJB 2XTZA 2Z83A 4B3DA 3AP1A 4TYWA 1JR3D 1WBDA 2OLKA 4EJSA 1ZVQA 3OFND 2JJ8A 4RZUA 1FQJA 4FIDA 2PL3A 5FPHA 1Z6XA 3PVSA 1G19A 5KU1A 1RIFA 3U3MA 1HQCA 1GUAA 2ZIAA 4L8GA 4EPXA 1E69A 2JJ1D 2G1KA 4AIIA 4XVQA 4KVAA 3K70B 1XXHB 2MSDB 2J87A 2PZFA 3PUYA 3QXJA 4HI0E 5HR5A 2GTPA 1E1RD 4NHOA 2NPIA 3SJZA 2GESA 4TLCA 1D2NA 2ZETA 3Q5DA 1VDZA 3M1IA 1AZTA 4JBYA 2O8EA 2QSYA 3C8UA 4FN5A 2QTVB 4LI0A 4ACBA 3CRMA 1OXUA 2XZOA 2J0SA 1N6LA 2I4IA 2VQSA 4U7DA 1DPFA 2WMNB 3GLGA 4RKEA 4GPTA 5GVRA 5JJKA 2QQEA 3ADDA 3CX7A 1ZNXA 2BBWA 5FR1A 2IF2A 2ZR0A 3IPYA 2GAOA 3P20A 5CK5A 3SDZA 3X1XA 4QM7A 3A6PC 4R9UC 1VHTA 2HXSA 2PZGA 3VFDA 2QPAA 4KCGA 2ZQ5A 1WB9A 2C78A 2O8BB 2OFOA 1OW3B 1G5RA 3CUEF 3FYHA 5IK2D 4QM6A 1SVMA 1NVWQ 5CYOA 2GXUA 2W6JA 1ZINA 2P65A 3IGFA 3P4YA 1M1YE 2F9MA 3EC2A 4C0LA 2FE4A 1J2JA 1VG9B 1DS6A 2D7CA 2PMDA 2ZI9A 3TAHA 4PAOA 1WP9A 2GEVA 3F8TA 4GSYA 4C0QC 5FTLA 2FSFA 2ODWA 2CJWB 2IXEA 1ZP6A 3SS8A 2EQBA 4DRZA 1G3IA 4QGGA 3PUXA 3ASYA 3Q7PA 4WIAA 4ZCMA 5FBVB 2CL6X 3BE4A 4KITB 1W5SA 1BYUA 1JR3A 5CB6A 3EA0A 2IW3A 2F43A 4GZMA 1TU3A 2IBMA 2IYUA 4C30A 4RD1A 4HLQB 2QAGC 1FMJA 1NY5A 2FX3A 3RDPA 5ELXA 4QBIA 1DAHA 2QAJA 5L3QB 1DOAA 1ZIOA 3ONWA 2DBYA 1SVSA 2QAGB 4JT4A 2AHOA 1A2BA 4K8OA 4MITA 4ESHA 3REGA 3QY0A 4XTRA 4GOKA 3KFXA 3PG5A 2HJVA 4CZ2A 2W2VA 1EWRA 1P9NA 2E87A 3CO5A 2G77B 2QN6A 2XB4A 3F5FA 4OJKA 3TH5A 3EZFA 4TMTA 2CVFA 1ZD1A 3C15C 8OHMA 4V0MA 1JALA 2PX0A 3NC1C 2WICA 4MYUA 2HLDD 2CCJA 4X8HA 1D5CA 2HXYA 1E9FA 4JSTA 4PO9A 4TTPA 2J46A 5JJLA 1NLYA 4PFSA 4ILEA 1AKEA 4ZPXA 2IHYA 3DL0A 1GRRA 3GFTA 4HZUB 2OILA 3U6KA 2ZAMA 2HYDA 5EXSA 4C4PA 2PJZA 2BKEA 1U90A 4LHZA 1BIFA 2YOFA 4H1UA 4DCUA 2XTMA 2O8BA 2ZJOA 2CLCX 2YVUA 2VRWA 4B3FX 5K8UA 2BBTA 5JWRA 1BYIA 1UDWA 4R2HA 3THXB 1RVDA 1V5WA 4BLQA 3AF0A 4JVLA 5C1BA 2ZE7A 2EVWX 3EZ6A 2BEJA 4BFYA 4POAA 1H8ED 1Q3HA 1S4QA 2H5EA 3RWMB 4L4UA 4Q4HB 2W2TA 3FPAA 3TJZA 2VHUA 2A5YB 4NKRA 2VP5A 4B2IA 2FSHA 3I5XA 2C2HA 2WOOA 2KJQA 3DM5A 4I1UA 4IDQA 3V9PA 2OBNA 3QI2A 1KYIA 2F1IA 2AXNA 3QNUA 4OI0A 1NLZA 4BRUA 5KSZA 5SZKB 4DT1A 4BZXA 2CMKA 4A2PA 2AK3A 2NGRA 3DDCA 4Q9IA 5EE1A 2DPXA 3KXLA 4Q1DA 5DYGA 1E9SA 4BEJA 2QRZA 3BC1A 1AA9A 4XD7A 3CRRA 4ZIRA 3IEUA 3OZXA 4P31A 4UNNA 1CEEA 1G7CA 4JLDA 2QGZA 4F4CA 2GVZC 3EWSA 4URWR 4LHXA 4DDVA 2QENA 4WXPA 3H86A 1KHTA 1BO6A 4D4MA 1RJ9A 1CLUA 2GCPA 4MGZR 1AK2A 1XTIA 3NH9A 4NU0A 1U8ZA 2VSOA 2RHMA 2FZLA 1FNNA 2IYTA 5B30A 2WAXA 1ZD8A 3H4MA 2ZTSA 1AZSC 3N2EA 1Q12A 3OIYA 1HT2E 1F2UB 4MRNA 5J4LA 1NVXQ 2IT1A 4KU4A 4YXWA 3TSOA 4PANA 1AGPA 3EZ7A 1XMJA 4B6FA 3I5YA 2QAGA 2XZLA 2BJWA 4C0HA 1ZU4A 2PEYA 4Z54A 4M1OA 4B75A 2OAP1 4KLNA 3E2IA 1YZLA 5JI3E 4KI0A 5C4MA 2VSXA 4EPTA 4A2QA 1ZBDA 1P75A 3MJHA 2JDIA 3WHLA 1J70A 1H8EA 4B3GA 3TR5A 4PXAA 1E2JA 2KBFA 2FA9A 2IYVA 5JSZA 3TRFA 2YWFA 2VP0A 3AKCA 4JLOA 4CVNA 4Q66C 5D3MA 4CEJB 1S0UA 3K0EA 5FPTA 1FW6A 4DUGA 3GJ6A 2QI9C 1IN5A 1KY2A 3GMTA 2ZE8A 4NCIA 2WWGA 2RGCA 2I3BA 1KDRA 3LD9A 1TADA 4A6XA 3K0AB 4FWTA 1WRBA 3DVLA 4AURA 1Z0FA 4JKIA 3SOPA 1OH5A 2GDJA 3FTQA 4TT3A 1Z83A 5TXGA 2P6RA 2QRNA 4PO1A 1W46A 1NVVQ 4S35A 3IKJA 4LJ5A 4FINA 2AWOA 3Q5EA 4Q47A 4A0HA 2BMEA 4C0JA 3CIOA 1GRNA 4WZAE 1PLKA 2IYSA 2ATVA 1OXTA 1DEKA 4NPHA 4DCNA 2Q9BA 4A8JB 5UKDA 1R5OA 3I8XA 1P2VA 5CITA 2FPLA 3CM0A 1JPJA 4ZO4A 2ZJYA 3OIWA 2QMOA 5DHAA 4XSGA 2DR3A 1VECA 2HJGA 2P5TB 2WKRA 3LH5A 1L4UA 1UKZA 5JRZA 3FDIA 1YKSA 1YE8A 1ZNYA 1T6NA 1EESA 1SXJC 2PX3A 3K9HA 2CE2X 3NBZC 3E5HA 5D3QA 4Q7LA 2H57A 4U00A 1T9HA 3TR0A 2P6UA 4UXIA 4Q21A 1G8HA 1P62B 1NN1A 1UM8A 2RB4A 4OHVA 4Q18A 3U3RA 4BFUA 2KI5A 4B3XA 5FFMA 3I73A 4BQSA 1FUUA 1QDEA 2VA8A 1IHUA 3SFVA 3PEWA 2A5DA 3PIRA 4RCYA 3TE6A 3LW7A 3ZH9B 3DZ8A 4US0R 2QT1A 5BYJA 4B44A 4XVRA 3U6BA 4WXRA 3CKLA 2WTUA 3KZ1E 1JXOA 5EE9A 2BBSA 2CXXA 3MJRA 1P6XA 4JLPA 4F93B 1GRQA 4B34A 4C2UA 1JEEA 3TQFA 2OO7A 4IVRA 3GJ4A 1IXZA 4G5QA 5FPYA 2J7PA 3KUDA 2R6AA 1D9XA 2OCPA 2SHKA 4MKHA 3SZRA 3WNBA 4YONB 2QMUA 4IOJA 2O0HA 1MO4A 3RS4A 3LVRE 2EFCB 2ZRLA 3PEVA 5DI3A 2XB2A 1ZYUA 5KHOC 2HT6A 4NBSA 4ZV4A 1CJUC 4RVCA 5HTKA 4G5RA 3SNHA 4P4UA 1XJ0A 4IEEA 1Q1ZA 1KK2A 3EIEA 1KOFA 5F2EA 3B9PA 4TMZA 4YC7A 1KO8A 4XWKA 2ZUBA 4BE7B 4FD2A 4BLTA 5H70A 5J4VA 1QVRA 4V0LA 3TVDA 4ZDKA 5K8LA 4XWAA 3OFNA 4BFZA 4QNMA 2GRJA 3Q85A 4NONA 2C9OA 2QROA 3R9WA 3W34A 4HEJA 4HAYA 3T1QA 4YQFA 2WVJA 2WHXA 2ZYVX 4AKEA 1OH8A 1CBUA 4QG7A 4N1AA 1GNQA 1RRGA 4PHHA 3GLIA 3T61A 4FMBB 4NTZA 2GXQA 1LS1A 2IS2A 2W2XA 3ZVRA 3GQBA 5DSZA 1YRAA 1HE8B 1PUJA 4U02A 2G1JA 2FGJA 4MKIA 1V43A 3L8ZA 3THWA 4MUBA 4OYHA 4QNRA 3TLXA 2V9PA 4PAQA 1G6HA 4Q19A 4QHYA 5DHFA 4Q9KA 2X77A 3W90A 4QXAA 1Y3AA 2R44A 1QHGA 1Z0AA 2JLZA 4JLNA 4HAXA 4Q9LA 1FTNA 1CTQA 4MGKR 4Y0AA 5KDLA 2G88A 4AY2A 5JCPA 1OE0A 2CVHA 2H7VA 3I32A 5CDFE 4PHGA 5IK2A 4TTRA 3FFBA 2H92A 1E2HA 4DLZA 2FFHA 2ASEA 3QBTA 3TUZC 1ETUA 4RD3A 2IS6A 2ZI6A 2LKCA 1OJLA 4RZXA 3VHXA 4EPRA 5HE8A 5GJVC 2YWEA 421PA 1Z07A 3ZLJA 2YZ2A 3A1VA 3QKSA 3L2OB 2IA5A 5DO9A 2OUKA 1LVGA 3N70A 4G1UC 1M2OB 2ZU6A 1GKUB 1MO3A 3IPXA 3PV0A 2FJUA 4LPKA 4BFXA 1XEXA 1FP6A 5TV2A 1N6OA 2JLYA 1UEIA 1RYHA 4LYFA 4LV8B 1GKYA 3BXZA 3UWKA 3Q3JB 2JLXA 3QG1A 4URUR 2ODEA 4PHFA 4BLSA 2BCJQ 5GJBA 3B1VA 1QHYA 4CDGA 1XTQA 3MRSA 1J7KA 1EX6A 3OIUA 4TMKA 1W44A 2ZPTX 4O0MA 3KJIA 3SC3A 4US2R 4D81A 5F9HA 3K70D 4W7SA 2LWIA 4Q5IA 4MGYR 1P9WA 4UXHA 1LF0A 4M22A 2ANCA 5KNBA 1JR3E 2GJKA 1JEDA 4TL9A 4M4SA 2VP9A 1TTTA 5DIFA 3N2IA 1XD8A 1IN6A 3FKSA 2B7BA 1IN4A 2H1LA 1E96A 1OKKA 2CLSA 1W4RA 3WRXC 5GJCA 1X1RA 2IWRA 4QRHA 3BORA 3WYFA 3ZS8A 3PJRA 3UKDA 1E4VA 2BEKA 3REFA 2FDCA 1Z29A 4A8JC 4QOSA 1MO5A 3GP8A 3AB3A 3LW8A 1UKEA 1QHSA 4PC3A 1N2CE 1J99A 2XAUA 1KI7A 1WMSA 1TF2A 1GITA 1AGRA 3HWSA 4GP6A 1YU9A 1G4UR 1GG2A 1Q3TA 2R65A 2ZJ5A 3UG7A 1E9BA 3C7KA 4EPYA 4CW7A 2VLIA 3C41J 1KI2A 1R5BA 2J0QA 4Z8YA 5IRCD 4DEXA 1NI3A 1GL6A 1KI6B 1QF9A 3KXIA 4IFEA 2D62A 2WOJA 4M9XA 5HKKA 2C99A 3MLEA 4YLGA 4QBHA 3BB1A 1XEWY 1U94A 2VBCA 5JS7A 3U7FB 2ZJAA 2NPFA 2W6IA 2O8EB 1F60A 5A4JA 2YWHA 4P32A 1XCGB 2RKOA 4TYPA 1R4AA 4QC2A 3THWB 1BKDR 1DVRA 1TU4A 2GJ8A 4N3NA 4TL7A 5TB5A 4XTCS 3KB2A 1E32A 3BAFA 3EXAA 4L5BA 3GLGB 3CPHA 2ORWA 1Z8FA 1HQYE 2CK3A 4GOXA 4QJ3A 3PCRB 4GMXA 4ACAA 5JWOA 3B9QA 2PJRA 1LV7A 1UJ2A 4PQYA 3U44B 1EK0A 4JVSB 1MV5A 3O8BA 2EYUA 2BMJA 4EQ6B 2D74A 1AS0A 5FOTA 2XSZD 3FB4A 2RMKA 3CPJB 5DISB 3T5DA 1N6PA 1G8YA 1DAMA 5L3VA 1WCV1 1AN0A 5BW8A 4URZR 3GEHA 1LW7A 2XTNA 3A1SA 2F6RA 3LY5A 6Q21A 1KIMA 1N6KA 3CX8A 1LF5A 2OCBA 1EG7A 3DPUA 1GTVA 1VYVA 2A9KA 3ADCA 1XZQA 3ZVMA 3RANA 4B35A 3NBXX 4KHZA 1HT1E 2XXAA 1R10A 4OI1A 1XPUA 5CIWA 1K6MA 5HZKA 2R2AA 1TF7A 1G3UA 1IM2A 3LFUA 1DO0A 1D2MA 3OEHA 4Q4LA 3CB4A 4OHZA 1YR6A 3W8RA 4Q9JA 1KNQA 1KMHA 3AGPA 3KQKA 5KO2A 1NKSA 5CIQA 4XVUA 2GEUA 1OHHD 4UNRA 1LS6A 1OH7A 1E2FA 1NVVR 5JEEA 2IXFA 5K8IA 4E07A 2BWJA 1T0HB 1EFUA 3E1SA 3L8YA 1RPZA 4PZYA 4IVQA 2QPTA 2Z4SA 3VU9B 5E3HA 1E2NA 2ZRDA 5BYKA 1I4TD 4ITRC 2ZVQX 1W36D 1UEJA 5BN3A 2AL7A 1G291 2WKPA 1E94E 3RS7A 1XBTA 5CM8B 2ZM5A 2ZS8A 4A92A 2F7SA 2WV9A 3TKLA 4LZZA 1DAGA 2GEDA 4PHTA 1DELA 1FX0A 1H8HD 3R9XA 4DIDA 4MRVA 2JDID 4DSUA 3LRPA 3L82B 4DB2A 2X8AA 2RGXA 3X1YA 2WZQA 4DCSA 1B23P 3SI7A 5E7MA 2RHDA 2IYZA 2V3CC 3VKGA 2QBYA 3KJHA 2ZE5A 4BWYA 2DFLA 1XF9A 1OXSC 3TBKA 4D0GA 1HV8A 1KTVA 4Q1EA 2Z4RA 2BDTA 2WKQA 1KKLA 1VCMA 4DLYA 4TZ0A 3SYNA 4KSBA 3TSZA 4HUTA 2FNAA 1G5PA 1P73A 1KJZA 1X86B 3GFOA 3RRZA 3QVUA 3QUSA 2A7QA 4BLPA 3R9IA 3MWJA 2P2LA 2JIZD 2HT1A 2L0XA 2X19A 2O8FB 4M1YA 5EJEA 1ZM7A 4TT3D 4J0QA 3H1TA 2VL7A 2UKDA 1MRNA 4AC9A 2QY9A 3GJ0A 1Z2CA 2OBLA 2ZSBA 4HAWA 1NMYA 4W5JA 2ZJZA 4JBXA 3BFKA 1I4LD 3KTAA 4MKGA 1NMZA 4PC1A 3RSLA 4YMTA 5JHGB 3U7HB 3DM9B 1EFRA 2G6BA 2QQ0A 4MKFA 2V8OA 2V6JA 5KNCA 5EP4A 3X2SA 4AYXA 5JJIA 3B5JA 3QKRB 1Q57A 3LXRA 5J4YA 1OHHA 3AQ4A 3QEJA 5AUPB 3GEEA 3UMFA 1JI0A 1HURA 4B74A 4F91B 4DWJA 4OHYA 4DT1B 4M1SA 4PPNA 1F2UA 2GBLC 2ZRFA 1G5TA 1Z0DA 2WWHA 4IOLA 4WZBE 3THOA 4EAQA 1F5NA 4E22A 5DNYB 4L9WA 2GZHA 4RZ3A 1E2IA 1E0AA 1AKYA 2OCAA 5M04A 1WBBA 2HYIC 3NG1A 2Q3FA 1OIVA 2XX3A 2VP2A 2J41A 4PAMA 1E1RA 1YZNA 3BH0A 3GJ5A 2EU8A 1E0JA 2ZRMA 2QP9X 1E9CA 1KNXA 4O2LA 4EUNA 2QMEA 1KK1A 1OXVA 1SKYB 1NBMD 4AKGA 3NTUA 4GBMA 1IBRA 2MSEB 2Q9CA 5IF9A 2PLRA 2JLUA 2GKSA 3PENA 4UXJA 3RS2A 4A0FA 3HP1A 3B60A 2JLQA 2WIBA 2XOKD 1A4RA 4MRSA 5C4GB 2O0KA 2YWGA 4IHQA 4OI4A 5JSZB 4WW0A 1XJCA 1M7GA 1UPTA 2YNMA 3ASZA 4Q7MB 3FKQA 2QG6A 4YMWA 1ZAKA 4CEHB 4L9SA 2IX3A 1TX4B 2J7PD 3CONA 3GLIE 1TQ6A 1Z6AA 4M1WA 1II9A 2VO1A 1MO6A 5FL7D 1C4OA 4HB2A 2A3RA 4L15A 3WYAA 4H1VA 2ZSFA 1XTKA 4GMDA 5DLQC 3CWZA 1GWNA 3GLFA 2AFIE 1NLFA 3TK1A 4DC9A 1II0A 2DFKB 3B13B 2ZYUX 1N6HA 4DIEA 1K5DA 3RYTC 3AM1A 2CCGA 1P2TA 3GEIA 1HTWA 2ODBA 4UQOA 2ZSDA 3NEJA 1SGWA 2R6DA 1ZC4A 4LJ4A 3R20A 4GZLA 2ZI4A 1EFRD 5KOYA 2CJWA 4XWOA 3FMIA 2QP3A 5JLJA 1NIJA 1Z0KA 4D25A 2JLWA 4O3MA 3IBYA 3L0OA 3W6OA 4G5SA 5AJYA 3MG9A 1HE1C 4QJ5A 4HDCA 3WP0A 3A4MA 3S1AB 1MT0A 4V02A 3KJGA 2JEOA 2EFDB 1XWIA 4OKSA 4LUCA 3J81k 3G0HA 1R8SA 5CB8A 3M0EA 2GETA 3C5CA 2O8DA 3CNNA 1Z6TA 1NNEA 3OHMA 3KKNA 5BXQC 4URXR 4D0LB 1W0KD 3ZQJA 4PSVA 5AUQA 1NBMA 1YR8A 1S3GA 4P4SB 1TQDA 3L43A 1LFDB 2IF0A 3OESA 3RRMA 1TQ2A 2OZEA 1Q0UA 2IHBA 2BM0A 4RD4A 4BGDA 5L3RA 5L3SA 4HAVA 1DAKA 4FMCF 2XNSA 3BERA 4D2IA 2BVNA 2DFTA 1X3SA 1SVIA 4IOMA 1T3HA 3RS3A 4TQAA 2GCOB 4IW3B 4KVGA 4E03A 5B57C 2CNWA 3HU3A 3SJBA 1QHXA 3GJXC 1XFAA 4DZZA 5CJPA 2EYQA 1KO4A 2WWYA 1XDBA 4M9ZA 3U7EB 4D4JA 1L2TA 2ZRNA 3ZVNA 3RS5A 2FEMA 3CF2A 4QGHA 5ANRB 3RVBA 3VR3A 2CCKA 4JLVA 3CH5A 4JLKA 2XJ4A 1EGAA 1GL7A 5KNDA 3ETLA 2RGGA 1ESNA 1QHHB 1XCMA 2ECKA 1ZNWA 3B6EA 5E7JA 4JIMA 5SZIA 3RHFA 4EIWA 3EPKA 2ZRHA 1QHNA 1G41A 1EXMA 2H18A 5FBQB 3EASA 4EQ6A 1VG0B 4W9MC 2IK8A 2AXPA 3B78A 4DLXA 4M1TA 1G21E 4B6EA 4ZCLA 4EJSB 3EZ9A 1ZNZA 3KL4A 3HYRA 3W6NA 5JWHA 4LRWA 4F4IA 3WBKA 4AK9A 3OEEA 2FPKA 3LQQA 3NKVA 5CYPA 1FOEB 3FE2A 3LBNA 1R0YA 1QVAA 1W1WA 1UF9A 3NBYC 3UK6A 1F2TB 2OSBA 4DLWA 4ASUD 1W5TA 2NTYC 2C95A 1YZUA 1VHLA 1KSGA 4U5XA 2DCUA 4PPQA 1IY0A 5G3YA 3ZZUA 1GAJA 3MD0A 1WQ1R 4JLBA 4A36A 1OKKD 1FZQA 2OCYC 4YMVA 1ZJ6A 4LBVA 3U3OA 2QA5A 1TQ4A 1BS1A 1S9HA 3HDTA 4TMWA 4LJ6A 4UKDA 4X8MA 1SHZA 3IDQA 3M4YA 3K0CC 3GLHE 4ZKEA 2ZYWX 4R7ZA 1ZM2A 1G7RA 3W5JA 2R6CA 3UMRA 4DLUA 1N5LA 2X2EA 3LX5A 3MAAC 1R8QA 4IKEA 4F7WA 1RRCA 2V1XA 3RRNA 4Q4JA 3WRYC 1D2EA 2VH5R 3EIQA 1CP2A 2X2FA 4QJ4A 2IS1A 3BD9A 3VNUA 4HAZA 2GHIA 2OBMA 4MGIR 2GXSA 3NH6A 2V4ZA 3BH6A 1UDXA 5FBLB 4NMMA 5CLLA 1YJ5A 1C9KA 2MMCA 5EQTA 1R7RA 1QHHA 1G3QA 1SVWA 3JZAA 3AVYA 3VX4A 2VF7A 4X8OA 1NJGA 3AF3A 3CNLA 1W2HA 5FOVA 2DHRA 4OHXA 4DLVA 4HLDA 3SBDA 2Z0MA 1I2DA 5JMTA 1OYWA 5JCZA 2QT0A 2GWHA 2QU8A 3AUXA 4QGAA 4CEIB 3NHBA 3O47A 1NG1A 2BBOA 1QRAA 3OEED 3QPUA 5CLQA 2ZE6A 3UWOA 3EPLA 2N42A 1AQUA 4PSAA 1G1MA 3ZYCA 4KODA 5FUVA 5DI9A 1FNMA 3H2YA 3WMGA 4FMCB 3LAWA 4UJ5A 1KY3A 1NF3A 3O8DA 1OSNA 4LJ9A 4C3ZA 1NMXA 3LLMA 3KTAB 4KFRA 4NH0A 3O8CA 2OFXA 4ARZA 2VP6A 1NL3A 5KSOA 3WHKA 2ZRJA 3FHTA 3B1ZA 4DDTA 3WBJA 1YR7A 4Q4AB 2WIAA 4LHYA 1YZQA 3IUYA 3TUIC 2VTKA 4RY2A 4Q01A 2IS4A 3LA6A 3QEOA 2GBLA 2ZRCA 3HU1A 1FL9A 2OLJA 1E99A 3M6AA 3VTKA 3AVVA 4DSOA 1EWQA 1DADA 1W49A 4CRWB 3VQTA 1SXJD 2AK2A 2O0JA 2VYFA 1CIPA 3L0SA 4IDNA 4MQBA 2KBEA 4NYMR 2HCBA 1IOZA 2RGNC 4G5GA 4WZ6A 2KB0A 2W00A 3NWJA 1E98A 4I4LA 1DTSA 4OQNA 2IC5A 2REBA 4N0EA 1OFTA 5G40A 3Q9LA 2ONJA 2PT5A 4Q00A 1F2TA 3C16C 5E95A 1P7CA 1XCPA 1IN8A 3BFVA 5FUXA 3MSXA 4JL5A 4KJZA 5KTYA 3HR8A 3P4XA 5FPSA 3RWOA 1GL9B 1RZ3A 2ZU0C 1SXJE 2NG1A 2NZ8A 2W83A 1Y63A 3OE7D 4HLCA 4DDUA 2PCLA 3O8RA 5B2ZA 4A15A 3QOFA 1NSTA 1TEVA 4Q9HA 4D4LA 2W0MA 1CR2A 1X1SA 2FU5C 3AF4A 2CE7A 2FWRA 2ZS7A 3OF5A 4TL6A 5EUQB 4HATA 1KI3A 1T5LA 4Q4HA 3EWAA 4LJ7A 5KYKA 1OFIA 4P3YA 2J5XA 3CPEA 5KDOA 2B6HA 2PBRA 1NVUQ 4UNQA 5TARA 4QKQA 3F3YA 1GNPA 4DJTA 4RD6A 1GM5A 1Z2AA 5LDDC 4TYNA 1II8A 1VCIA 3LQRA 4M1KA 4TZ6A 2ZVPX 3WYGA 1WF3A 4HUQA 4RFVA 3Q8XB 1TF5A 4URYR 3BH7A 4Z51A 2GAAA 2IUSA 4M2LA 1LTQA 3B85A 2OT3B 3EARA 2C9YA 3X1WA 1TNDA 1XD2A 4TSFA 2RH5A 4LJAA 5FR2A 3WP1B 5TVKA 1G64A 1DG1G 4I1SA 2F55A 2QEQA 3SBEA 4GI7A 1XXHE 4Q03A 1PLLA 2RAPA 2J45A 2VHJA 1AS3A 3EG5A 2E9SA 2PLFA 1E9EA 2YHSA 3TNFA 4B43A 3EZ2A 5SZHB 5DI3B 2ZREA 4DKXA 3F0TA 2WJGA 3CX6A 1XRJA 1SXJA 3U2QA 4FCVA 2FF7A 1E2DA 4LY6A 1KMHB 1ZMXA 2QL6A 4Z8XA 1Q20A 2DYKA 1M6NA 4BZQA 1DAEA 1R0WA 1NN5A 1HY3A 4BPBA 4CEIA 2EW1A 3LDAA 3DOFA 1VTKA 4HB0A 1UBFA 4A4DA 4G3XA 1GNRA 3THYA 1Z6YA 4BFWA 4KFUA 1G7SA 4IEIA 4OI2A 2RGBA 1WXQA 1U8YA 2FH5B 4JZKA 2C5LA 3FOZA 4DSTA 4YMSA 5C18A 1E2PA 4B2PA 3WMEA 3BB3A 4NYMQ 3DMDA 4RD0A 1TMKA 1GOTA 2PEZA 1ZU5A 1XEFA 2R62A 1J8MF 1W2GA 2WAYA 2N46A 4LX0A 4MDEA 4XH9B 4JL6A 3ZZ0A 3QF4B 3FHCB 1AJEA 1KKMA 3FHOA 4JBWA 4LYAA 3CH4B 2ANBA 1GZSA 1E2QA 3QSYA 2V6IA 4JVNA 4C9BA 4DLSA 1CR1A 1Z5ZA 1II8B 3IBGA 1E2KA 4BLOA 2HCJB 2GA8A 3ZJYA 3AVWA 3QQ5A 2B7CA 2CL0X 4NDZA 4TSFD 1KK0A 1LNZA 1JAHA 1COWA 2WJIA 4LBYA 1E3MA 2ZI5A 1DAIA 5FL7A 4B3CA 1HYQA 2ZRIA 5LD2C 4H9GA 5DN6D 2QUZA 3A37A 4PPGA 1E0SA 2FZ4A 2GXAA 5EZ6B 2AFHE 3MFYA 1CRPA 3P32A 3T5GA 1MKYA 3AKDA 3NEYA 2IYXA 5FOXA 2LCFA 1N25A 4NYJR 4G5OA 1OIXA 3K70C 2J1LA 1UADA 2BM1A 2Z5FA 1KJWA 4TYYA 3PUZA 3K9NA 2ZRPA 4BZPA 3FFAA 1CJMA 1Z08A 1OH6A 1T0JB 1XZPA 4HLUA 1CR4A 2C03A 2W58A 3B1WA 4MUAA 4DBLC 4HDOB 3LXXA 1A7JA 4D6PA 5AWFC 2I1QA 3H84A 4OQFA 1XD2B 4BUJA 4IFBA 5KDDA 3K0FA 2R6FA 3WMFA 2XNDA 1QHIA 1T8UA 2AN9A 2JAQA 3K09C 3C5HA 3V00A 4GRAA 1ZD9A 4IOKA 1KZGB 1Q22A 2XEXA 5HCIA 4JJKA 3PR1A 1RRPA 1XNJA 2C04A 3ZDQA 2E1RA 5JS8A 4NCKA 3G82C 2QORA 1G7TA 5DYIA 1UKVY 2HV8A 5DE3A 1NIPA 1U2RA 1F48A 3QXCA 1XX6A 4O25A 1W0KA 3L0IB 1JECA 4TN1A 3PXGA 121PA 2ODNA 2C9CA 5FI0B 2IYLD 2QM8A 4KYUA 1SKQA 1G8PA 1U0LA 1E79A 1K5GA 2DB3A 4Q1CA 3BGWA 1BOFA 2K5UA 3QG5A 2DFNA 4V0NA 2A78A 4LWZA 4KSCA 4M9QA 3NIBA 4NYIQ 1KSHA 2ZRAA 1E9RA 3QF4A 2NO6A 1ZUNB 2AD5A 1GSIA 1S1MA 3T35A 3DOEA 3ECCA 5EE0A 2OHFA 1AS2A 4HZUA 4A6PA 4ESVA 2XGJA 1COWD 3GFPA 3GJ3A 3ZGXA 3VAAA 2FSIA 3PEYA 2Q3HA 3UPUA 4KYIB 5IT5A 2YJTD 4Q48A 1A1VA 1AQYA 4JKYA 3AF2A 3A1WA 4TLEA 1JQLB 1KI6A 4C2TA 1Z63A 3A8TA 1PJRA 1VIAA 5FUWA 3W9YA 4GDFA 3OIVA 1IJFA 1XTRA 3IQXA 3T1OA 3AF1A 3X1DA 3EPJA 3THXA 3D6TB 2OXRA 3ICQB 3KJEA 4IDHA 1Z28A 3AVTA 2VIIA 3T15A 4DUGD 1OFHA 1T3SA 3SFZA 4OL0A 3UMSA 2V7QA 3HYTA 1UFQA 4B32A 1ONBA 5KPJA 3TW8B 2NIPA 4Q1AA 1JJVA 4UJ3A 5EP1A 1GFIA 4I81A 2IUTA 4PC6A 4NZYA 3PQCA 2Q21A 4O2RA 1KAOA 3B2EA 1JR6A 1E9AA 2B92A 1JBKA 4GT1A 3U44A 4CGZA 2C96A 2HDNB 2XNDD 3BK7A 3KXKA 4PPFA 5H68A 1SHKA 3KUCA 2F1JA 1KI1A 2CHGA 2XITA 1TPZA 2FOLA 1VCNA 2GNOA 3K0FB 2WPDD 2QGNA 2R6GA 2BHRA 1TAGA 4WAUA 1ELOA 2C77A 3NXSA 2ORVA 2A5GA 2J59A 2VHCA 1NBME 4ZIRB 2LKDA 4LCBA 4OBEA 2A30A 3SR0A 1U9IA 2PMKA 3T1TA 1HEIA 4MRRA 1H65A 1ODFA 4PTLA 1CKEA 1IQPA 2P3SA 1E79D 1OLOA 2PZEA 3QENA 1X8JA 1XXHA 2JLRA 5L3SB 2ZJBA 4CF7A 2EFGA 1XU4A 1RFLA 1ZRHA 2VHQA 3SHWA 3GLGE 3QE0A 2ZEJA 3KKQA 5LB2A 2WMOB 5FOUA 2BJVA 4KLZA 5TY0A 3I8SA 2ZSEA 1N0VC 5DH9A 3S1AA 1NJFA 3Q72A 5A5GA 1KDTA 1Z22A 5AJVB 3FWYA 5G53C 4DB4A 3AVUA 2RGDA 3KKMA 4AG6A 3H0KA 3W6PA 4LBWA 4V0OA 1NN3A 1VG1A 1YVDA 4OQMA 4TMXA 4WVFA 4DSNA 1VMAA 4LHVA 1JB1A 3CRQA 4FMDF 5J4KA 3UG6A 1ZM9A 1JPNA 2JGNA 2FGKA 4PZZA 721PA 3TGPA 2ZANA 4JYCA 2V7QD 4HLUC 3BBPA 2J7KA 4ERNA 1E9DA 1J8YF 3RLFA 4HDQB 1OV4A 4IDOA 4RSGA 4JS0A 1DBSA 2G0TA 5LBIA 3SQWA 1KI8A 2W6JD 4LPSA 3G5UA 5JHHB 2VSFA 3ND8A 3CBQA 3R8CA 3HPQA 1US8B 5BN5A 3IHWA 4NCJA 1P3JA 2IUUA 2QBYB 4TLDA 2VF8A 2P0EA 4FW9A 821PA 4PQFA 4A9AA 5DGXA 3FMPB 3QPVA 4PQRA 3U4QA 4KBGA 2IXGA 4EPVA 1T8TA 5G3ZA 3EX7C 1U0JA 3EIHA 1W4CA 3CWQA 3I1FA 2G0NA 2RCNA 1CS4C 2F43B 1M8PA 2V54A 2NO1A 3B1YA 1JAIA 1VCOA 2QSZA 2REOA 4PC7A 2BMDA 4XIGS 3ND9A 4B76A 3W5IA 4HZIA 5K8TA 2F3TA 3BWDD 4DDWA 4RZ2A 4M53A 5J47A 2WM9B 3GPLA 2AX4A 2Z6VA 3CZPA 3DZDA 4B73A 3D8BA 1HUQA 4Z1MA 5L3QA 2QMHA 1L4YA 3FMFA 5D3MB 4CEJA 2KE5A 2CL7X 1W0JD 4HB4A 1CRQA 1KSJA 1E0KA 2QNRA 4NP6A 2ONKA 3MCAA 5FTMA 1D9ZA 2NQ2C 1Q21A 1ZM4A 2IEYA 2C8VA 2PCJA 5F9FA 3OAAD 5EUMA 1CR0A 1QG2A 2ZS9A 3SJCA 1IY1A 1CXZA 2BMFA 2FSGA 1NY6A 1KI4A 5J40A 3TMKA 1R0XA 3NDBB 3VHLB 2P5SA 3JVUA 2TMKA 4D26A 2WSSA 1JNYA 3LVQE 4P33A 521PA 4M9SA 3BFXA 1RW4A 3MGCA 4FCTA 2HLDA 1W36B 1BH2A 4WOPA 4YMUA 2OEPA 5AUOB 2AKAB 3RRYA 3ZZTA 4ABYA 4XJXA 3W8NA 4JJZA 4G01B 3GLHA 3KDSE 3K1JA 4ZI2A 1E2MA 2ERYA 1GP2A 4X8LA 4JT2A 4UNPA 5F98A 4QFMA 2N1BA 3AP3A 5AK0A 2J0UA 3K53A 3BOSA 3L0PA 1HA3A 1S1CA 1R6BX 5JEDA 1CU1A 1P5ZB 2F9LA 1Z0JA 3ZIAA 1FQKA 4LC0A 2OV2A 3LO5A 2VHTA 3QIAA 1NG9A 2GCNA 5FTNA 1E6CA 3SHFA 3VR5A 2O8CB 2GJSA 5FOWA 4QHTA 2ZUDA 2G9NA 4HYYA 4EFMA 4C7OA 1UBEA 1KO5A 4ON9A 4LJYA 1YZGA 4TTQA 1ZCAA 5A0FA 2IYQA 2JASA 4PO8A 3ADBA 1MOZA 3GLFB 2DY1A 3B1XA 1XTJA 4D4KA 1JJ7A 2WSMA 5EXPA 2F1HA 2FV8A 1N6IA 4B47A 2YOHA 2YOGA 3LBIA 3NVAA 4TYQA 5FPKA 3RC8A 4Z1MD 1UBGA 3AGQA 2G3YA 1W0JA 4UNSA 2ATXA 3CF6R 1A82A 3A1TA 3HU2A 3VU9A 3HJNA 1US8A 3BRWD 1E1QA 2HF9A 3P1JA 4MA4A 4C0SA 1IXRC 4LYHA 1W36C 1IAQA 4XD7D 1GIAA 2A5JA 3AUYA 3TUJC 1XTSA 3DMNA 3SJAA 1N5IA 3SN6A 4ARZB 1NKTA 2WWXA 5HPYB 2WSSD 1W48A 4HSEA 2Q3MA 3QBVA 3RNLA 3UANA 1A2KC 1YR9A 5LB4A 2OM2A 4CT4B 3P26A 1NN0A 1YHNA 3C14C 4C0BA 4BEBA 2W0SA 4XOIA 1CJTC 4AWXA 3FKSD 3GJ8A 1SKYE 3EPHA 1EFTA 4PX9A 5KSYA 4W5WA 2ZAOA 1E2LA 4RJLA 3KB1A 1G3RA 5SZJA 3NBFA 4BFSA 3K8YA 4BLRA 1MABB 4GFDA 4E09A 3TQCA 4YXWD 4AG5A 1F6BA 2GVDC 1BMFA 1O87A 1TEXA 2Z43A 1P61B 3BIFA 5AJXA 2OESA 2VP4A 3CW2A 3K0CA 4RCZA 1RE0A 2QPOA 2G83A 4QBGB 1KGDA 2QZ4A 4TQ9A 2BKUA 2CHVA 4HB3A 2J0UB 3ICEA 2QP4A 1W4BA 3MMPA 1FMLA 3MWYW 3Q7QA 5FH9A 4GL2A 4JLAA 3TW4A 5EZ5A 1G3MA 1SQ5A 4A1FA 2CLDX 4W5HA 1FX0B 3FVQA 5KSPA 2DWOA 3B82A 4M21A 5IDVA 1KI9A 1IN7A 5DN6A 3GJ7A 4WBSA 4V0KA 2OAQ1 4Q1FA 5J4HA 1M34E 1UKYA 2O8CA 2NOAA 4PC2A 3HPRA 4EFLA 5JFGA 3CRW1 4F4JA 2ZR9A 4LBZA 3NDPA 4TQUS 1Z06A 5CK4A 1PVOA 1CJKC 3EAQA 3I4LA 3V4FA 4A82A 5CDFA 2OE2A 1B0UA 3RS0A 4TWZA 5JRJA 3W3AA 2ZR7A 2XJ9A 1G18A 3CLVA 2JJ2D 1LY1A 3X1ZA 1R2QA 2XSZA 4JLMA 1PZNA 3D7MA 2V1UA 1N6NA 1OFUX 1U98A 3PFIA 1X6VA 4OK5A 2IYWA 1OB2A 2MSCB 1D6JA 3CZQA 3IEVA 1S9DA 4IRUB 2NO9A 1G16A 1CJVC 1ESMA 4A8JA 4ASUA 1DO2A 3KQNA 1P4SA 3SQXA 2YINC 3SEAA 3I62A 2IWHA 2BIFA 3AH8A 3RABA 1OPXA 1E2GA 5CJ2A 4TMVA 4LOAA 2FFAA 2AD1A 2X1VA 1OYYA 4LV5B 2WBLC 4XSHA 5LPNA 1XEXB 3VR2A 5KUTA 1R5NA 4EPWA 2A2ZA 1U99A 3OEHD 3A4NA 2BOVA 3KQLA 1QG4A 1KK3A 2P67A 2FN4A 3QF7A 5TDHA 2B8TA 4C0AC 5L8VA 1KAGA 2OXCA 4LSGA 1G8GA 3VNVA 1CULC 1SVKA 1XB2A 2JJ1A 4DXAA 2ZXUA 4CEHA 1MABA 1OIWA 1M7HA 3GLFE 4TLAA 1FTSA 3QXXA 3PEUA 1T5IA 2GZAA 3JZMA 4GP7A 4IXMA 2P6NA 1KJYA 1U81A 5LD2B 4OK3A 1NP6A 1C1YA 1YZTA 3MWLA 2OG2A 3LBHA 4NL4H 3GD7A 4Q4JB 2B21A 3B7GA 4DHEA 4M1MA 5FL3A 3I61A 2KWIA 2JCSA 2REXB 1KMQA 1OT3A 2GF0A 4ZI3A 5FTKA 2O5VA 1G4AE 3E70C 4G0NA 1ZUHA 2F3RA 1X8LA 1LB1B 1NRJB 1M74A 2JJ2A 3LWNA 4R98A 2C98A 4IXNA 3T12A 2ZI7A 4B2LA 2YYZA 2O52A 5TMPA 2ZJ8A 2BV3A 3U4QB 1YZKA 3FMOB 1OXXK 3ZQ6A 1XEWX 3T34A 2GILA 1Z3IX 3IILA 3A36A 1KO1A 2EFHB 3R7WB 3KX2A 3LNCA 3CRVA 1W47A 1N3BA 3DHWC 4JLJA 2YKGA 1GILA 2H16A 1P2SA 3NC0C 1SULA 1KDOA 4OQXA 4EJSC 3BB4A 4K46A 4YDHB 1UBCA 3IO5A 3DEFA 4OQLA 2I1VB 4KFTA 1FUKA 4NYIR 3QKUA 2CBZA 2AKYA 2ZITA 3B8HA 2R8RA 3JVVA 5FOSA 5BN4A 4M8NE 2GZDA 3U3KA 1IY2A 3UATA 4CT5A 4Q1BA 1TL7C 5EXXA 4LC1A 2WJJA 1J90A 5FI1B 4LK2A 3SYLA 3V4RA 1P72A 2NZJA 2KSQA 1G6OA 1XPRA 3IIKA 4B33A 4MDFA 2ZSAA 1GDDA 2J0VA 1K8RA 3IHLA 2EWVA 2RGAA 4B71A 4D0NA 1RC8A 1CF4A 3UIEA 2CHQA 5JZVA 1F3OA 1QZXA 4MRPA 1R0ZA 2FPMA 1JQJC 1ZIPA 2Q0HA 3C4JA 1VG8A 4B48A 1T4GA 2D2EA 2O8DB 3TSWA 3AVQA 2YV5A 1G9XA 3VR1A 1JXMA 1WDTA 4N0DA 4LHWA 3GLHB 4D80A 4FCWA 4P4SA 5GADl 3OE7A 4DLTA 3I72A 1GVNB 2A5FA 4DCVA 2GK6A 4LV6A 4QBFA 3VKWA 2NO0A 2NO7A 5HZHA 3D31A 2D7DA 2DWQA 1IJEA 2XOKA 2H17A 3LX8A 3ZVLA 3CF0A 1T3LA 1G17A 4RKFA 2GCOA 1MRSA 3QXSA 1S8FA 3NHAA 2AWNA 1DE0A 4AD8A 2B8WA 4LDJA 2FFQA 2GF9A 2R9VA 2RGNA 3ADKA 4CYMA 1XMVA 5JECA 5EE5B 1T91A 4OHWA 5EXTA 3QKSB 4C7OB 1WE2A 3SE0A 1IXSB 2RGEA 1VIYA 4AYWA 3WNCA 1N6RA 4HUQB 2IL1A 1N5KA 2QTHA 3IIJA 4ZDIA 1PUIA 1RKBA 1KDPA 2EWWA 3SYKA 2BCGY 2ZRKA
chains in the Genus database with same CATH superfamily
4O8CA 2RAVA 3LHDA 2Q07A 4ZO9A 1ZCBA 4LN1A 3K2BA 3LKVA 4NCNA 1Z37A 3UK7A 4UBJA 1U8XX 1WA5A 1A2OA 3BFJA 2Q4BA 1M66A 1M7BA 4UZFA 5J2TA 3ZNOA 2OC4A 4G1MB 3RPEA 4TMFA 2CUNA 2PLWA 2VJCA 3AG5A 1A0OA 3RROA 4BNUA 2MOKA 4CFSA 1UWVA 4RZHA 3K9WA 3V6LA 3IEXA 3WXMA 1T9CA 5JRDS 4JI0B 4CF7A 2VXOA 1VZ2A 4ID9A 1NX9A 1RYFA 4UVGA 1IL0A 1VKJA 1TYZA 4JYAB 4Z99A 2HAEA 2IEAA 1B6RA 4JA2A 1CY0A 2E5LB 1CY8A 4F12A 2FPOA 3VR6A 2HJSA 3AEZA 3GNTA 5EIHA 4AKIA 1NUPA 3UA3A 1ZC3A 3H5TA 2EX0A 2WWFA 2HA5A 3IIMA 4MDHA 3W7BA 4EECA 2PYZA 4MPPA 1SUAA 4YVFA 1YF3A 2KHZA 4L0MA 3EXG1 4Z4IA 2X4LA 4LNAA 1RP1A 1NQ5A 2V55B 2X4GA 2FG5A 4ZI7B 4AZWA 1RVV1 1A9PA 2ZI3A 3C3KA 1Z4JA 3LK6A 1Y6FA 5CT5A 4EKDA 1DCFA 1B26A 4ZO8A 2FN7A 1EJ2A 5J5AA 4BU1A 2FP4B 4R71A 1YB4A 2P9YA 2A7XA 1Y80A 1V4BA 2J3KA 3PITA 1KDZA 3RAFC 4QDXA 1FSFA 2Q6TA 2JHFA 1LXCA 2IIBA 3T8YA 4AWBA 1S2MA 2BL4A 4OGWA 1AQIA 1JZSA 2WTMA 3S2EA 1CUSA 5MFZA 4O2AA 1YRYE 1KZ7B 5C5EA 4KBFA 3VTAA 4KV9A 3EEQA 1FW8A 1X8XA 2AIRA 1R8XA 2IU6A 5KPDA 1VSVA 2D2FA 2VJLA 3TXYA 1U0RA 3EQ9A 3TD2A 4M88A 5F7OA 3HB7A 1TUEA 3T06B 3MGAA 2PVSA 3PHLA 1Z74A 4HS4A 4B09A 1YBAA 1OT5A 2QX7A 4R2IA 3IAUA 3ZIAD 4F38A 3ND7A 2OSVA 1R15A 3FZEA 3QFHA 4TV9B 4OFXA 4CU5A 1TCBA 1JRLA 4ZKDA 3EHEA 1ULTA 3EA5A 2UXBB 3VR3D 4RFSA 2VOEA 1JFFA 1T1IA 3PXBA 2D2IA 1S96A 1GKIA 2GK7A 2LTAA 4MGHA 2C1ZA 2GJAA 3M5DA 1GRCA 1XSEA 4MWTA 4OGLA 2ZK7A 4QHSA 5EP2A 5FBWB 3IPAA 1Y5LA 3CZCA 1K8YB 2CK3D 3RH0A 4NE7A 5F23A 3KFVA 4HO1X 1Z47A 3W3ZB 3FCUB 4B3BA 4QWWA 4CUJA 2QE7A 4KPUA 4PYJA 4AU1A 1SUPA 5JJBA 2AOTB 3K7EA 4M0LA 5B5SA 4RQUA 3LKBA 2VAMA 3L0YA 4LRQA 2WWVD 3DTYA 3LC1O 4PNHA 3ITEA 3ZD6A 4NRDA 4J7XA 1YUNA 1G5FA 3KKZA 5D2CA 3OZTA 2Y1XA 1UWLA 1CIVA 1SXHA 4LJ8A 4RV4A 4C7BA 2LRHA 1PTJA 2V4MA 1S3SA 5GVSA 1WHSA 3FG9A 2EG9A 5C2JB 1VYTA 4ENQA 1DBWA 1MEJA 5JBQA 4WKGA 3AY0A 5E2IA 1V8PA 3ZWXA 5E4TA 4OYRA 1JG2A 4FB5A 2J9RA 4HBGA 4JNCA 5AJWA 1NUUA 5AK5A 1V37A 4UU7A 5FA6A 4X64B 2H1CA 1EJBA 3QKTA 3QWBA 2IEGA 2GFHA 4YECA 4E3WA 3D3QA 3Q8WA 2JAPA 1CB7A 2NU9B 3VKHA 4O5AA 1E8DA 1NDHA 2IYPA 3DMYA 3G59A 3KKPA 4KN9S 3EISA 1CUXA 1OF1A 2XCQA 3PC2A 2EF1A 1NE7A 4OOEA 1K4YA 3LM8A 3JATB 3D9QX 1RJ9B 1NSFA 3LUFA 1U4OA 2QZ9A 1J56A 4C06A 5C8VA 1DQZA 4KDFA 5T7BA 4O2BA 3TIVA 2GEFA 3GDOA 5I4IA 3K0SA 4S2EA 3G2NA 4GX5A 3WLQA 5ARBA 4JJ8A 2WU4A 2BFEA 1H2FA 2AG1A 2ERXA 3E8MA 4PO3X 1BHQ1 2GRAA 3NUQA 3A1FA 4E11A 5JTUA 1L5OA 1S8AA 4DEYA 2VPPA 1G20E 4Y9SA 2PMWB 5EXXA 2QHXA 1IQ0A 3A2LA 1TO1E 2GEKA 3IQWA 5CFRA 2FFBA 1VSQA 3COPA 5SV2A 4JJAA 4A0RA 1L8LA 1BDBA 5DHPA 1N0WA 4JBNA 4PSKA 3UQYS 4HQ6A 1YUBA 1L5GB 2H3EA 2QM0A 2JATA 1E6LA 2X2OA 4QJ4A 5B58C 2XKJE 4MW0A 4HADA 5MGNA 2GVNA 5L3ZA 2DTXA 3F5DA 3MUFA 5CW1A 4Q3AA 4H1WA 3R7WA 2VNIA 2X1MA 1G8FA 2AEMA 3THSA 4Q7JB 5B1HA 3RAPR 3A6LA 3UH1A 4C0KA 1IMJA 4WGFA 5KYNA 4JB0A 5JCJD 3L7LA 4YP7A 1Q1EA 3HJHA 2FG7C 3JWJA 2O8FA 2PWZA 4MVJG 5B1SA 4DV3B 1IE3A 3A4YA 1KBOA 4TWRA 3O83A 1QRRA 2WLSA 4QFDA 3ZWYA 4TRMA 4MAMA 2JIZA 3LPNA 2ZYTX 4HUJA 1IONA 3NDJA 4ZCPA 2VK2A 2QTFA 3E27A 2FZCA 1AB6A 1GQYA 2WWIA 1YWGO 4YPOA 1J9EA 2ORIA 2P7IA 3AU8A 1NYRA 1EZZA 1V5FA 2HA6A 3S2UA 3T0IA 4UULA 2D3WA 1YASA 4MHOA 2HMVA 3CE9A 4LGMA 1Z0IA 4WJLA 3S27A 4DVGA 1Y4UA 3R40A 1GTSA 3KYDA 4M0FA 3SPXA 3CXUA 4GVPA 1DDIA 2O48X 4TYWA 3GELA 2G1UA 3VSEA 3WLOA 5BOVA 2H2IA 4FIDA 3BWMA 3QKIA 3HC7A 2AC4A 2H9IA 1HQCA 4QPPA 2J3IA 1V39A 3C6KA 4G09A 1RD4A 2W2KA 4BVKA 4AIIA 4ZOLA 3IV7A 1RYYA 3F6PA 3LGAA 5EJGA 1H93A 1ESDA 4K9MA 2JI7A 3F5SA 4B3HA 2WV7A 4KE6A 3HBLA 2NV6A 1D1PA 1D2NA 5EVCA 4ICIA 1AZTA 5CNMA 3SBOA 1MX5A 3IERA 1O8CA 5A4DA 4ACBA 1V11B 3DAPA 4UD6A 2CDRA 2XZOA 4RJKA 2J0SA 3BL5A 1N6LA 4GQBA 2VQSA 3A1NA 5K3FA 1XKLA 4CQMB 1I14A 4YCMA 1DPFA 5B6PA 4F3KA 2QI9F 3GLGA 4GSKA 4H08A 4II3A 2QQEA 1DC5A 2JAOA 1INLA 5KYWA 1OROA 1RXUA 1T8YA 3WX0A 3ANYB 5FWYA 3ZLTA 4ZXFA 3W06A 1DWOA 5EIOA 2XWJI 3P20A 4FOTA 1OLXB 2GAOA 2I8CA 4RNDB 3X1XA 3A6PC 4RVGA 1JIVA 1NSYA 1CVIA 3VPDA 1XMPA 1BJTA 4IKOA 4ODIA 3M4XA 2EHJA 3VFDA 4KCGA 3A3PA 2PUBA 2JIOA 5HJEA 1FZTA 2RDMA 1DXQA 3INNA 4EJ6A 3HABA 4QM6A 1NC3A 4BUZA 2P65A 4OV6B 4DRXB 2FE4A 1LJ8A 4Q0MA 2IUEA 1J2JA 1J5EB 1K3FA 1F8FA 1VJRA 1DS6A 1X1BA 1Z7YA 3PPWA 4J16A 3F8TA 4RHTA 2JCGA 1RWWA 4ER3A 2QVCA 3OZIA 5HX7A 3RK1A 4ZP1A 3NV7A 2FSFA 2W2LD 1I0LA 3UCEA 4PQEA 3GN2A 4ZYLA 2IXEA 3SS8A 4F5ZA 1JR2A 4IZ6A 1B1CA 1ZQ1A 3PUXA 1Y4SA 3Q7PA 1ZOPA 4FDLA 4QGBA 4ZCMA 3OTHA 1Q1GA 1QYCA 3TRHA 2EQ5A 3P9IA 1K9SA 4N82A 3HCEA 1Z33A 3EA0A 2IW3A 3CEHA 4DNOA 1TU3A 1T10A 1GXSA 1UK7A 2W6ZA 4EUSA 2PXXA 3TE7A 3IMGA 3MM4A 4PZDA 2ZB8A 4ND1A 1JF8A 2ZSHA 1ZH8A 5ALYA 3L6EA 5FWAA 4PIMA 2H51A 1D6MA 1M0TA 4ZZ3A 2OB1A 4OX9B 3GH3A 1XQ9A 2P9TA 3OD5A 2AW5A 1DOAA 2WHEA 4XYMA 4FE4A 3MS4A 3UGTA 1SVSA 4JT4A 2Q1YA 2BFBA 4FD3A 4MITA 4ESHA 1C3LA 1KEZA 5BSEA 3IP5A 3KQOA 3QX3A 1X1CA 3DE1X 3PBKA 5HK8A 2OZPA 3PR3A 3NCTA 4GOKA 2P3LA 2AN5A 2W2VA 3I3OA 3CO5A 4MPJA 2XB4A 1WB6A 4OJKA 1KOLA 1RI2A 2CLHB 4PZCA 2E7ZA 3SK0A 2OC9A 1E5XA 1SZDA 1ZD1A 2CVFA 2UYOA 5G1PA 4BO4A 2QRLA 4R5MA 8OHMA 1Y8ZA 1GYPA 1U5BB 2WF5A 2O59A 1ODKA 1FYXA 4EA7A 1KZ6A 4GKVA 3CO0S 4YRZA 2AXEA 4MYUA 2CCJA 1RCTE 4X8HA 2C82A 2GJ4A 1ZUD1 4NMXB 2ID8A 1E9FA 4PO9A 1BWRA 2EJUA 1SMKA 1UC4B 1W19A 3N2GA 2IU4A 3NIWA 4IMIB 1ISPA 5AHKA 5I8ZA 4GBGA 4JJ4A 3TG8A 3ZE7A 4PFSA 1VHDA 3LIIA 4C43A 5KMGB 2SNIE 4GPBA 3LP8A 2AMFA 2Y1FA 1V45E 3L7DA 2IHYA 3OFSA 1GRRA 4NFSA 3M3HA 3TAXA 3GGJA 5F1OA 5CFLA 2ZAMA 1J0DA 5IDXA 4GR4A 1L7RA 3OWOA 4GLFA 3LUJA 5JS2A 1J2UA 2BKEA 1I7DA 5JQGA 2GPYA 5EUBA 4H1UA 3P2KA 4JQOA 2JI6A 3FGPA 3NTLA 3V1MA 2YVUA 1ODTC 3RBZA 4L8LA 3GZJA 4FFPA 1Z6QA 2ONYA 5JWRA 3JSAA 1I10A 1JDPA 4LFCB 4DRXA 3E61A 1SBQA 1RVDA 4LVNA 3P0RA 1V5WA 4N41A 5EKTA 4CQMD 3AF0A 3FMGA 3GRYA 1F3LA 1YBMA 2OCGA 2EW2A 3EZ6A 2BEJA 4DWWA 5A02A 1S4QA 4L5IA 3RWMB 1XVAA 5ALTA 3ETHA 5IG2A 2VHUA 1HYBA 3OM8A 4U9HS 3RJ9A 2A5YB 1FRZA 1IUOA 2IYEA 3LUCA 1CDOA 2AMYA 2P2GA 4C6SA 2C2HA 1N33B 2C0QA 1ZVMA 1ULHA 2QVLA 3AJEA 2XUOA 4NI5A 1T1GA 4LGCA 4BJ3A 4JI7B 4FFDA 3PHGA 3KCQA 4KN5A 2F1IA 4J4HA 5BMVA 5JS1A 3G7UA 1BAPA 1N1DA 1RYEA 1NFQA 3ZGZA 5JR3A 3OQNA 1E7QA 1U3VA 2WTBA 3GMIA 1NATA 3RT9A 2BT4A 3DTVA 4N39A 1D4OA 2YFYA 8LDHA 1EFKA 1HLFA 3SXPA 4DDHA 5BORA 4YB8A 2QN8A 5ECDA 2M6LA 3WK5A 5EE1A 2VJMB 4QXQA 3ZV7A 3QUTA 2DPXA 4R8RA 1THZA 1ZKDA 3REQA 3C39A 5KBYA 5AO9A 2A86A 2JD1A 4DR6B 1KBQA 1TIBA 4W6ZA 2AG8A 3BSSA 4Y3UA 1T4BA 3COSA 4AN4A 1Z0UA 4CL3A 4URWR 3F4BA 4M6WA 4P3KA 5B6JA 2HCTA 3NBUA 4QZVA 2R8YA 3PIDA 1K86A 1CLUA 1O03A 2JEZA 2JK1A 2I87A 2X8LA 2GCPA 4MGZR 4O08A 4OVKA 4TKUB 3NWEA 1TJ3A 3NH9A 2RHMA 3O31A 1IM8A 2B69A 2IYTA 5EJ2A 4D45A 2LZ0A 5AI9A 5IFLA 4W9RA 1ZD8A 3BA6A 3D2CA 3H4MA 2ZQYA 3WOVA 4QT4A 3L06A 1HT2E 3G7NA 2OYSA 2DPLA 1SA0A 1C1HA 3L1VA 1GADO 4HDMA 4PANA 4N9QA 2JL1A 1LUAA 1HC7A 2E3JA 1GR0A 1I7NA 2DY0A 5JC8A 3TIXB 3PQ4A 3CVYA 2RHHA 3T3OA 1W76A 1ZU4A 4HWKA 1L4FA 2JZNA 4DLBA 4LOKA 5C4IA 4QQFA 4D6PA 3ECSA 5D7BA 1PBTA 4FT4A 4XDYA 3BTOA 4GWLA 4HVAA 4LW8A 1GPMA 4BYGA 5ITZB 1O96B 5CLFA 1KVSA 4EPTA 4XWWA 1FVOA 4NSNA 3E1GA 1IZ7A 3WHLA 4YV0A 3DBOB 3SLGA 4B3GA 2ON6A 2ZFUA 5IKOA 5JNTA 1EFVA 4PXAA 1P7ZA 4YXFA 5CB0A 4PVDA 3UB4A 1T1JA 2WMYA 4OP3A 5ENDA 4CG1A 4BP1A 3M6IA 5IBCA 3KUXA 2W6OA 3KUKA 5F2OA 3G5MA 4GYWA 5D3MA 1S0UA 3LPCA 4LZAA 4BJ1A 4F1WA 1NI5A 2FSPA 4DUGA 1XN4A 2QI9C 4LF8B 1OC2A 1OA1A 3NNNA 2JJYA 4NMHA 3GMTA 4JI2B 1QC5A 2E48A 1ADFA 1RM0A 1W29A 4HK4A 2Z2JA 5EPOA 5EZYB 3WNVA 1IN1A 1DX6A 3UFXB 3K9QO 1KYVA 1Z2DA 3AIIA 3K9BA 4JI8B 2FQYA 3AHHA 3NOOA 4H0CA 2KYRA 1M9NA 1WRBA 1ZPDA 1L7NA 2YQ5A 3D2BA 3DVLA 3WIVA 4AURA 4E0BA 3AWDA 5JATA 1OH5A 2AZXA 1DIRA 4MWSA 1JXQA 2FLWA 2D8AA 3R6GA 1Q0QA 3IAXA 3ZEAA 3CLRD 1DX4A 4N47A 5K3CA 4COOA 4G0OA 2Q4OA 4M7WA 1JEYA 4LJ5A 2EX1A 2REQB 4A0HA 3NAGA 4C0JA 2C7RA 1GRNA 1LC0A 2HWUA 1DEKA 1FDOA 1G2QA 1CR6A 1FMCA 2Q9BA 4U6NA 5FEUA 3MPUA 2RHLA 2PMFA 1YNSA 3TOCA 3SMQA 3AHEA 2Q1SA 2HR1A 4HL6A 2NSHA 2Y2VA 5I7AA 4DDKA 1NLMA 3CA8A 4XGQA 4L5AA 1T2EA 4AL4A 5HQ3A 5DHAA 3C3MA 4TKUA 2HJGA 4GLJA 1MVNA 2IXAA 3PT5A 4PG4A 4QEZA 5LXTF 4DRYA 5JRZA 3FDIA 1ZNYA 2QL9A 3CLTD 4CM9A 4RANA 1EESA 1P77A 2PX3A 1KE1A 1UFOA 3RSQA 2I4OA 1ZIYA 4NZMA 3QFCA 4Q7LA 5D3QA 3ZNQA 3ZLUA 2H57A 4K6KA 4U00A 2JFOA 4G4IA 3PUHA 1GN9A 4DLAA 4OHVA 1UM8A 4E2WA 3T4EA 1YVRA 4DQDA 4RK0A 3NGXA 1ZI6A 4BFUA 4F3RA 4JEMA 3ROXA 3WHPA 5BQFA 4HN4B 4BMCA 5CVJA 3PEWA 1BJKA 4RCYA 2VKQA 3SDSA 2CV0A 2ATCA 2QT1A 4M7OA 1EGVB 4XVRA 3U6BA 4WXRA 2J6HA 4WMLA 4WCFA 2WTUA 3HDJA 4H3SA 4RPHA 1EK6A 1QM5A 3EZXA 3P9QA 4F8YA 3MUNA 1L4KA 1MV8A 4Z1OA 2DTDA 3I9NA 1XZLA 1A8HA 2BR4A 3TW0A 1P6XA 4YJ3A 5B4VA 5LNK6 3MMXA 1WQ4A 3HH8A 3SP1A 2H5IA 3LRTA 3EK2A 1PJSA 1FTGA 1I3CA 1JEEA 3TQFA 5ED4A 1KR5A 3GJ4A 2LUOA 3QV2A 4I8IA 5LWQA 3VU1A 4CLXA 3LZDA 2WDZA 2QTNA 4HTAA 4OHFA 1L9KA 3QLTA 5KYYB 2SHKA 4V1CB 3KAKA 4H6WA 3T3NA 5AHWA 2QMUA 3CVXA 1QC5B 3UAWA 5EWLB 3DKIA 1J49A 4YCLA 3JYLA 4PZ0A 1PR0A 1MO4A 2F9FA 4S1PA 4LVUA 5H82A 4ITVA 5H3HA 1HORA 3PEVA 3WLPA 2ZIUB 5EY5B 2XB2A 3OPYI 3L84A 2C58A 1JHUA 3C1OA 5FQOA 4NBSA 2Z9DA 3V55A 4LJRA 3EH2A 2XDQB 4HXYA 4XI9A 2BKLA 4AJNA 4KFCA 5C1OA 3L6UA 5TVGA 2D5IA 4U7PB 1KK2A 3PQDA 3U40A 2BY4A 4RIGA 1YZ3A 3UY4A 4S12A 3UJAA 3PT9A 4TMZA 1NUSA 1KO8A 3MGKA 2ZUBA 5FRDA 3RU2A 3TLGA 2Z9CA 5H70A 1GZUA 1QVRA 1U80A 3DULA 4BLTA 5TT1A 3WG9A 4J0JA 1L8XA 4MVJI 4B4WA 3TVDA 5K8LA 4PLHA 2YXNA 3OFNA 4QNMA 4NONA 1HDGO 1JLLA 1Q1NA 4QICA 1PJBA 1UDCA 4QUIA 3STVA 3SE7A 3V8BA 3IHTA 5HNKA 4HEJA 4JI3B 3Q7RA 4DA0A 1VPTA 4HAYA 1P1HA 3JD4A 1DDGA 2WVJA 4FUQA 4YQFA 2ZYVX 4LXXA 5AK4A 4GPZA 4ZAWA 1Y7HA 1CBUA 3GLIA 4N7JA 3ZDRA 4PHHA 1I7SB 4KREA 3T61A 4FMBB 3VKFA 3PF9A 1BE1A 2W2XA 4ZT5A 4RKYA 1HE8B 1PUJA 3WQQA 2XADA 4OBBA 2FGJA 5CXSA 4MKIA 5LZ5A 2NXJA 2AJ8A 2H7XA 3GRPA 3HXTA 2HDWA 3T7CA 3TLXA 4A16A 2VBGA 1YIAA 4HQOA 4Q19A 4QHYA 3TLCA 1WXIA 4DIBA 3D81A 1XQWA 1YCFA 4QXAA 1Y3AA 2R44A 1KMMA 3FTEA 3TFWA 5GGYA 1MQ9A 4HAXA 2VPIA 4D8UA 2A35A 5ALOA 3D3WB 3AM5A 4Y2VA 3SC2B 4GQAA 4AY2A 4GPD1 3ICOA 3OZGA 2WKWA 4RV9A 3I32A 3V8MA 4YJ3B 1QX3A 2B36A 3QKWA 4FFOA 4PYLA 3CKKA 2IZOA 1ADBA 3FFBA 1Z0SA 4J0IA 4S1OA 5HRAA 3B7PA 3N7AA 3EEBA 3KR2A 1O97C 3QBTA 4HJXA 1ZVVA 4BXOB 3DDOA 2ZI6A 5ADVA 1IZZA 2LKCA 1OJLA 4OGKA 3NDRA 5HE8A 1FFDA 3MF4A 5GJVC 1APBA 4CQJA 3A1VA 1KQOA 1UBSB 2C4WA 5COBA 2ETVA 5DO9A 4ZGWA 5ESRA 5SY4A 3N70A 4G1UC 1ABEA 1M2OB 5E1DA 5TS2A 1XAIA 5IT9A 2CJXA 2VF4X 3VV2A 4ZGBA 3IPXA 2ZJ0A 4JI6B 3QJGA 5BUZA 4G5XA 5B6IA 5KSWB 2XDQA 1OXBB 3WGVA 1ZGBA 5AJUA 2EERA 4O1IA 3OMXA 1RYHA 5CJJA 3F98A 4JGIA 3PJDA 4LV8B 3UWKA 3O3MB 1I5EA 1XZDA 2O2YA 3ZCSA 4D92A 1M33A 4OKIA 4B45A 2XMZA 2FTKE 4PHFA 2XHZA 5JH7B 3AHFA 2IIVA 2O50A 1SBYA 3B1VA 4CDGA 4TMKA 3RAEC 1EX6A 3I6QA 3Q15C 4ZOAA 4CE6A 5THXA 3KJIA 3DEAA 4TWBA 4D81A 5KAPA 3K70D 4W7SA 3ROKA 2PXHA 1JLLB 3HP7A 2JFHA 3OUTA 4RV5A 2E4AA 4OFWA 4G0YA 5I7SA 3TTVA 5LLDA 1CQJB 1DHTA 1L0BA 4FOSA 1VLZA 2AUMA 4M22A 1DRKA 4ALNA 1QWOA 2Q99A 2BHSA 1QP4A 4V2IA 4MWDA 4M4SA 1MIOB 4KKVA 3N2IA 4X1YA 1XD8A 5HRUA 4IIDA 5DW0A 1IN6A 2I6SA 4QDUA 3RVNA 4PRKA 3PRKE 1M72A 4AN1A 1R9GA 1W4RA 1R88A 1X1RA 2A9QA 3G7SA 3WRXC 1ZHHA 2ZOSA 5AESA 3FD8A 3DCIA 1RRVA 5F3WB 4YP6A 1M0EA 1V11A 4BAGA 3L8MA 4NCXA 4DIFA 2PUTA 3Q3GE 5EMHA 1M6HA 2WYUA 4LCJA 5K2OA 3EFHA 5IKPA 4UM5A 3PA8A 1T5BA 4MCHA 1WMSA 1V4NA 1YA8A 2RHBA 4OSPA 3K71B 1YU9A 1Q7EA 2R65A 3JALA 2VQFB 2PZ8A 1U04A 2V7WA 3B1FA 4OBXA 4EPYA 1RWPA 4KWTA 4LXTA 5JXJA 3M3DA 1IBLB 1KI2A 3EEIA 3G2JA 4Z8YA 4UHFA 5CA1F 1NI3A 3PGXA 1DLJA 4PCLA 1AV6A 2D62A 3VDQA 1DQPA 3JQ6A 4IAOA 3LUPA 4M9XA 5HKKA 4MV5A 4YLGA 3COYA 5JS7A 1U94A 3U7FB 3D4IA 2ZJAA 5L6LB 1YE5A 2W6IA 2NPFA 5L4LA 2DLCX 2O8EB 4P32A 3TQQA 2ZZMA 1YNOA 2PQMA 1CEQA 1MIHA 4LWPA 2F62A 1E32A 2ID7A 2VDVE 1RBMA 1TFUA 2Z2KA 3EXAA 3OM0A 4EG7A 3CPHA 4EW1A 5AW9A 4DE5A 2XCTB 2WFAA 2ONZA 2VAPA 2HPZA 3FDFA 1BJRE 1Z68A 4RABA 4GMXA 3TL3A 4FHFA 3THRA 5BXYA 1C0EA 2HNAA 4JEHA 3UAOA 3G6KA 2JKVA 3ANTA 4EQ6B 3AF6A 2GPSA 4IGIA 5HGJA 4BVGA 1OFUA 1D1QA 4YJGB 4LXIA 3ENVA 3DPIA 5DISB 2RMKA 3CPJB 1SNYA 4U7FA 4GC5A 2YNMC 4W8GA 5L3VA 3ROTA 1NR7A 1H2EA 3FYDA 2CXTA 1HWYA 3OE4A 4Q3EA 4HGQA 4URZR 5BW8A 1RKVA 4OQPA 1RBYA 2HK8A 3BYZA 3LY5A 6Q21A 5KNBD 2BFBB 3R1IA 4AAYA 1IEWA 1M1NA 3N7UA 2OCBA 4GS5A 1OVGA 1Z9BA 3DPUA 3HCWA 1VYVA 3UPDA 2HK7A 1XZQA 4H2DA 4KAJA 3ADCA 1FNCA 4B35A 3N39C 4KSYA 1J0CA 3GUCA 1R10A 3ZHQA 3NORA 3FVVA 4DG5A 1TF7A 2V6GA 5LP6C 3LFUA 1K6IA 1ZY2A 2R7NA 4OFZA 3OICA 4G89A 4PV7A 4TWAA 5C1PA 4JJ6A 3W8RA 3WLFA 5MFPA 1ISIA 1KNQA 5TJHA 2POCA 3V80A 2VT2A 3ZG6A 5KO2A 1NKSA 1YDEA 2V9ZA 4GWKA 3ZU2A 1XU7A 4UNRA 1X0XA 4X3CA 3HM9A 1E2FA 1NVVR 2OO5C 2PGIA 3L8HA 2R47A 4IG4A 3SM9A 1WVGA 2QPTA 5EKSA 5E3HA 5BOSB 1E2NA 1G98A 2ZRDA 1I4TD 2X0DA 4XGIA 1SKAA 1FXSA 3O1HB 4M0MA 4UUAA 3ITDA 4TVKA 6NULA 2VUSA 3N2LA 1G291 3WA7A 2ID9A 3UTCA 4IQFA 3ABQB 3OWXA 1L1RA 3E3LA 1FRQA 1I30A 5CRIA 3RS7A 4JCOA 3WSTA 4C7KA 2F7SA 4QJBA 3GR6A 3ENWA 4LZZA 2GEDA 4ZI5A 1TAUA 3WGYA 5NLLA 4B17A 3BJMA 2IH4A 3LDFA 1DBIA 1NAHA 2JDID 4DSUA 4W4TA 3BQ9A 2PD3A 3B6JA 5KCMA 4B0PA 2RGXA 3CSDA 3H04A 5EJMA 1NNUA 2D6FA 4DCSA 1J42A 3D8UA 4G24A 4X3PA 5BRNA 4O4LA 3I12A 1E1YA 1GR1A 1A72A 1OTXA 2QF7A 4KR0A 1XF9A 1VJDA 1GEEA 3R3XA 4FXOA 4QYIB 5HIIA 2JA2A 3T4XA 2NUAB 5IM4F 3A6JA 1NJ8A 1X39A 2X23A 2OCLA 3DSRA 3K32A 1CZOA 1GCAA 1G2PA 3IVCA 3SM3A 3SYNA 4AJJA 4TS3A 1G5PA 4G0QA 1P73A 1KJZA 1UJ4A 1X86B 3PJGA 4QL3A 3WYNA 1QIFA 2NUBA 2P2LA 2WVGA 3QU4A 3WLMA 4XB2A 2N47A 3GVCA 3Q4GA 3RCBA 1U7OA 5CURA 1BDIA 2XD4A 1Z26A 3GJYA 3Q41A 2WM2A 1JHDA 1SKUA 3H1TA 3H5IA 2UKDA 1MRNA 3BSYA 3I0NA 3NS7A 4NZ9A 1YL7A 2Z56A 1GDTA 1Z2CA 1N5MA 4Z0TA 4DJJA 4HAWA 2YIVX 3CZRA 3DE3X 3PEEA 5IYZA 3BFKA 2XQFA 3A9CA 3KTAA 4IVNA 1J23A 1CDDA 4XGNA 1EFRA 2G6BA 1GY8A 3EVZA 3LXRA 5J4YA 3BQMB 1OHHA 3QEJA 5BSVA 3GEEA 1HURA 1LDGA 4B74A 3BK1A 4Y2SA 2FN3A 2C5FA 3TZKA 4F91B 1X80A 4UW9A 1Y3FE 3QYPA 3DKRA 1GCOA 1WU8A 1C9DB 4WZBE 4WLVA 5FYQA 4EAQA 4Z4EA 4FGLA 4IZOA 4E22A 4L9WA 5DNYB 1Y6RA 4KLAA 1E0AA 4KXNA 1AKYA 3C5WP 2HYIC 3OZUA 3S8MA 1SWVA 3ZGOA 4PAMA 3TDMA 1YZNA 3GJ5A 4R2MA 4KL8S 3C87A 4AZ0A 2QP9X 2LBPA 1KNXA 1VZ3A 3KL2A 4BUCA 4EUNA 3K1YA 5MN4A 2FW8A 1KK1A 4DQLA 1SKYB 2ECFA 3J81A 3NTUA 4M98A 1CRPA 3VPAA 1L4HA 5KKCA 3C6YA 4NH4A 1Q7BA 5A9SA 1T8SA 4WHMA 1M73E 1QYWA 4TS4A 4UXJA 3RS2A 1HOTA 3FFXA 3HP1A 3L77A 3WGOA 2JLQA 3DG9A 5CYFA 4S1TA 4BKMA 5BVGA 9GPBA 3IAM1 4ZT2A 4WW0A 2VXYA 2HBYA 5LQDA 3ASZA 4D9JA 1XU9A 2QG6A 3LXUX 3P9SA 3Q7SA 3A1CA 2IX3A 4YRPA 4PCUA 1UR5A 2JRCA 4MVJF 4P7JA 3TS1A 2LIVA 4YGYA 1Z6AA 3GLIE 5IH7A 1UM9B 3VTFA 3JVDA 4CT0A 5KJ6A 2OOSA 1C4OA 4L15A 3UICA 1SQFA 2HJHA 4B6RA 3AM4A 1DKRA 2ZSFA 3VSDA 1GWNA 2NU7B 3ZV4A 2AEEA 3F73A 1II0A 2DFKB 3B13B 3C0KA 3DMTC 1Q2UA 1L7DA 4A26A 5G1NA 5EMNA 2PKXA 3NTXA 4PZEA 3CWCA 1P2TA 1QIKA 1UQRA 4MZDA 5J63A 4EABA 2RAUA 3G2MA 5DGHA 1ZH0A 5ALRA 4INOA 3P71T 4FOOA 3FW1A 1EWVA 2NX2A 3R20A 4GZLA 4LJ4A 4XLTA 2ZI4A 2PHZA 3PHJA 4LQ4A 5G2OA 3ZWAA 4BWFB 1X9GA 1P4AA 4JU8A 2D1YA 5IYZF 5HJ5A 3DZCA 3QUQA 2QP3A 2ZYAA 4C6HA 4PG8A 3PPYA 1YAJA 4D9GA 4IIFA 4JDPA 2YMLA 2ACVA 5K03A 4ZEMA 2FVXA 2Y1DA 3VNSA 3ZQUA 4DLLA 2PE5A 1WF6A 2FE1A 4QX6A 3OQOA 4QJ5A 5FJIA 1NW9B 2XCSB 3ONVA 3BIWA 3SCZA 3QLVC 3S1AB 3W8DA 4MW9A 4MS4B 3KJGA 2JEOA 4C0WA 1G8JA 3MWDB 2BMVA 4QFCA 3EUEA 1W75A 4FDMA 5IM4A 4RPJA 3M49A 1VJGA 4EYSA 3C5CA 5CB8A 1Z6TA 3OHMA 2GM3A 4D0LB 2F90A 3HSYA 1NBMA 1NVKA 1OZFA 2ZR8A 1LZKA 4GGOA 5K4HA 1S3GA 4TRJA 4CNQA 3L43A 4HQLA 3BDAA 1LFDB 3OESA 3RM3A 2YYYA 2VNHA 4UC0A 4XKJA 5DULA 5F64A 2FKAA 4WCFB 1F9EA 3QUAA 2X9QA 4BGDA 3U1VA 4HAVA 1DAKA 1XZAA 3R7AA 4E5SA 2FF5A 3GAAA 3TNJA 4GGMX 3FPEA 3MRXA 4YALA 1KORA 3RS3A 4KXVA 1W5BA 4JI5B 4DCOA 3DXZA 5ICCA 1N7HA 2HA4A 3C1AA 2P91A 5JBNA 1QHXA 4F2DA 2WNIA 4AVYA 2KM1A 1XDBA 2AOVA 3HADA 3SR4A 4V1CA 4EOGA 3RS5A 2FEMA 3CF2A 3EGCA 3OO1A 4RMHA 2CCKA 1XZHA 4JLVA 4JLKA 5KCZA 1JG7A 2RH8A 2RGGA 1QHHB 4KBYA 2ECKA 1ZNWA 2VDWA 2ZAIA 3B6EA 4BZZA 1E6UA 3QU2A 3TDKA 1U0SY 4RACA 2JARA 3FOAA 5SZIA 3EPKA 2AUNA 1EM6A 1P8JA 1PR5A 3WOHA 1J8FA 1C9JA 4K9KA 2XT6A 5EGNA 5FBQB 3OQ1A 1DL5A 1PJZA 1RWMA 2V45A 3IT0A 2I54A 1SQ6A 2WPNA 2I3GA 1JFRA 5AI4A 3UNXA 4WNAA 4A23A 4CLRB 1TMGE 4Z0NA 1G21E 4B6EA 1DJMA 4HC4A 4ZPJA 1L7AA 2WJWA 3BRQA 4BDSA 2V7UA 3VU3A 1LBHA 3R3UA 1XVVA 3LI2A 2WJPA 4LRWA 2GTHA 3UT0A 3OBBA 4FDUA 5DM1A 4F4IA 5ITSA 3QA3E 3R77A 3FFTA 4HFMA 2YY5A 1P5RA 3OEEA 1R12A 1GUYA 2P2CA 3AEXA 3NV9A 5CYPA 3FE2A 1N3YA 3FR7A 1UF9A 4YRIA 3W2EA 2UVDA 2V4UA 5CT6A 4YJKA 5KJEA 1W5TA 1N7GA 4DLWA 4FYWA 1KSGA 2VJAA 2NT3A 2X7JA 4Y2YA 1Q5PA 4PPQA 3OM1A 4V3BA 1GUBA 5G3YA 3ZZUA 1DXHA 1ESZA 1GAJA 1H2YA 4JLBA 1BDJA 4A36A 2NTNA 4RH0A 3D5QA 1JHAA 1QKIA 1NJ2A 2OZLA 2NZYA 1S7CA 3KAJA 3BMQB 4EZIA 3WDLA 2R1TB 1PRYA 3QBEA 2GOYA 4EB6A 5LZ8A 1E6KA 3QP9A 2PL1A 1P6UA 10MHA 4UTPA 5J23A 3HDTA 1PZEA 2ASVA 4AQDA 3O3NB 2WD7B 3HB9A 4LJ6A 1T9ZA 2R7KA 3IDQA 1KQ3A 1LVUA 3GLHE 3K0CC 3M4YA 4YP9A 4BE4A 1B14A 2GNPA 2R5FA 5B4TA 4IX9A 5CBPB 1FLNA 2V0CA 3QVSA 2B9VA 1OZ0A 1NVFA 1U0NA 2EKLA 2RSLA 3EG9B 3HMKA 3LX5A 4MIEA 3DGFC 4F7WA 2B9EA 5C8YF 2YMPA 3GW8A 3TZBA 3LP5A 1D2EA 2VH5R 2GCIA 4EHLA 1CRWG 3A26A 3BD9A 1RXYA 1GNSA 3H2SA 3QA9A 3WA6A 3D6VA 4BL5A 3P45A 3PFFA 2BN4A 2XRMA 3VI3B 4Y1FA 3OQIB 2I9KA 3EQ6A 3LYUA 1LA2A 3KK0A 2NTJA 2MMCA 1EX1A 4PYQA 5EQTA 1ADCA 4R54A 3C3PA 4LVCA 1E1DA 1VL1A 1QHHA 1AKWA 4JKOA 1SVWA 5GWXA 3TKYA 3UC5A 1BCSB 3EOBI 4YDQA 4DAEA 3AVYA 3L02A 2VF7A 2M1XA 4IJ5A 4X8OA 3SHTA 1NJGA 1B7GO 4JQCA 4C4OA 3E48A 3UKJA 2FXIA 3CNLA 1T35A 3TR6A 3TXAA 1W2HA 2V5AA 3GO4A 1ACLA 1FCJA 1C8LA 2DHRA 3IMFA 4BN0A 2BKVA 4ZODA 1RXEA 2IHUA 4LWQA 2GAIA 1E9VA 1YJAA 2P75A 3C98A 2QT0A 3G02A 2FR1A 3JU3A 4QGAA 4QREA 4ZVRA 3WGJA 4CR7A 4DA8A 1QRAA 3UCXA 3UWOA 4BNKA 2ZE6A 3U37A 4P54A 4K86A 3K0KA 4ZK2A 2RAFA 4KIJA 1I1OA 2J3MA 3E05A 4IIUA 3MBIA 3U81A 4KODA 3ZYCA 3MLAA 4QUKA 1K9VF 1YQQA 1E3WA 1LPBB 2R4QA 2VF5X 3H2YA 3LX4A 2XE4A 1N57A 4FE3A 1C1DB 1NF3A 5AKIA 5B58T 1WW2A 3VRHA 4C3ZA 2GLXA 5K0EA 2AQKA 1FBNA 3O2NA 1VSUA 4FVTA 5CX1B 1NL3A 3WHKA 5A04A 3WNZA 1Y37A 3WBJA