3C3XA

The multiple phenylpropene synthases in both clarkia breweri and petunia hybrida represent two distinct lineages
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
310
structure length
310
Chain Sequence
GMKSKILIFGGTGYIGNHMVKGSLKLGHPTYVFTRPNSSKTTLLDEFQSLGAIIVKGELDEHEKLVELMKKVDVVISALAVPQYLDQFKILEAIKVAGNIKRFLPSDFGVEEDRINALPPFEALIERKRMIRRAIEEANIPYTYVSANCFASYFINYLLRPYDPKDEITVYGTGEAKFAMNYEQDIGLYTIKVATDPRALNRVVIYRPSTNIITQLELISRWEKKIGKKFKKIHVPEEEIVALTKELPEPENIPIAILHCLFIDGATMSYDFKENDVEASTLYPELKFTTIDELLDIFVHDPPPPASAAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Eugenol synthase 1
publication title The multiple phenylpropene synthases in both Clarkia breweri and Petunia hybrida represent two distinct protein lineages.
pubmed doi rcsb
source organism Ocimum basilicum
molecule tags Oxidoreductase
total genus 108
structure length 310
sequence length 310
chains with identical sequence B
ec nomenclature ec 1.1.1.318: Eugenol synthase.
pdb deposition date 2008-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05368 NmrA NmrA-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3c3xA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 3c3xA02
3DZHA 5DP1A 3RU7A 1PL6A 1LQUA 4MVJG 1XA0A 1BGVA 2HRBA 2ZQYA 2CF6A 4CMHA 1AXGA 2LDBA 4AJ4A 4CM9D 3RC7A 5A1TA 1FK8A 1M76A 3UKOA 6ADHA 3BMQA 4NJMB 1KERA 3LT4A 3WG9A 1YL5A 1C0KA 2P4HX 3MOIA 3M1LA 4XCVA 4A7PA 3PHJA 5JXWA 4I5DA 3QQPA 3ZW9A 3FPLA 2IZZA 4FFNA 3GMDA 4R41A 5G0WA 3H9GA 2YUTA 1NQTA 3K92A 2Z1MA 4D79A 2Y1OA 1XSEA 5IZCA 4DIBA 3CEAA 2IRWA 4AJOA 1N1GA 3RBXA 3WS7A 9LDTA 2Y67A 4AJLA 5HS6A 1P1KA 4BO9A 2O4CA 2YW9A 4A10A 4E31A 1P9LA 3PGJA 1H6BA 1D8AA 1U3TA 1P1FA 4FJ0A 4OXNA 2D5CA 1NXQA 1NNUA 1AUPA 2P5YA 3EK2A 8ADHA 1X7HA 2CDBA 3ITKA 3MJCA 4JBIA 3HDJA 3WWZA 1U3VA 4AICA 5K0ZA 2Q1UA 3GN1A 1W6UA 1CF2O 4Q9NA 1I33A 4MKZA 2VCYA 5A5FA 4D0SA 1CQJA 3T7CA 4WJZA 1FDTA 2P2SA 3IL2A 4RVUA 4LVUA 1PWZA 1VJ0A 3V1TC 3PLNA 3WBFA 1O5IA 1I3KA 3TJRA 4K1LA 4BO1A 4B3JA 1B8PA 3BHMA 2PZJA 4D0RA 4GX5A 2ZB3A 3G79A 3V1YA 4A73A 4MKXA 2VUUA 3EUWA 5I9MA 3VVCA 2YDYA 3K2BA 2ZCUA 3VKUA 3KYCA 3ZNPA 1M2WA 1DRVA 2P9GA 1DLIA 3C24A 4OMUA 4KWIA 4Y67A 2UVDA 2ZKLA 3DHNA 3INRA 1C0PA 1WZIA 1LQTA 3HFGA 1CIVA 1EE2A 1RYDA 2O4UX 4N5MA 3TSCA 2HRZA 1HYGA 2CFCA 2GGSA 2SCUA 1NQOA 4E2ZA 2DFVA 1KVQA 4EJ0A 2G5CA 1ISFA 4IPTA 4TKMA 5TF4A 2NVUA 4EJ6A 4A26A 1LEHA 1XYGA 4I1IA 1AN9A 2VT3A 2X5KO 3OIDA 3ZNOA 2OOSA 3ADPA 4XKJA 3PHGA 3DBHB 3NTQA 3BZUA 4XDZA 1OC2A 1QMGA 4MIYA 1ISHA 4UAGA 1IPFA 1DIAA 2IYOA 4ONEA 1HE2A 1PJ2A 1MLDA 2HK9A 1JWBB 2V6FA 4CLOB 4QUKA 4CR8A 1JKIA 1QSGA 3EC7A 5HTOA 4BMSA 2E37A 1I01A 4DQUA 3GHYA 4L76A 4CUJA 4OSOA 1O94A 2RAFA 3A28A 1YRLA 3K31A 1E1LA 3C3XA 2X5JO 3QE3A 4YXFA 4BVAA 1IL0A 2NLOA 1BXGB 1Z7EA 1LDBA 5TT1A 1M66A 3IKVA 2BGMA 1L7DA 3S2EA 2C59A 3ZN2A 4JCOA 2AEJA 2PNFA 1QYXA 2ZYDA 3W8FA 4A03A 2HMVA 2DPGA 4CQLA 2GZ3A 5KWEA 2PGJA 4UUNA 4RQUA 3HFSA 1ENOA 4PG8A 1F8FA 3AK4A 2WJPA 1ZK2A 2NM0A 4XGNA 2CDAA 1NM5A 1P1RA 1V0JA 4LCEA 3H7AA 1U28A 3DXFA 3SJ7A 1SZJG 3LU1A 3DTYA 4YDRA 5BR7A 4NK4A 1DFGA 4DYDA 5C37A 1YB5A 3ITDA 3PJEA 3UF0A 3HUDA 2TMGA 3E82A 5FI5A 5KJ1A 1PZGA 2WEKA 1T24A 3FNGA 4EYEA 3TRIA 4NZ9A 4TQGA 4OOFA 1L1FA 3SVTA 2VRBA 1NQAO 4KTVE 3F6YA 2X0RA 1E7QA 4NIMA 4CLRA 3C1TA 4KDFA 5L51A 2X0IA 5IZ4A 4GGOA 4DL9A 5DCWA 3WGGA 2B4TO 1WDMA 1G0OA 3GT0A 4YJFA 3KHUA 5ITWA 3FI9A 1NHGA 4TMFA 1ZH8A 3GDOA 3S2GA 2NWQA 4N5NA 1KC1A 4MP8A 3JQGB 2BFMA 1EE9A 3WGZA 5EERA 5I9LA 4BKPA 3EYWA 2BI7A 5T8KA 3D64A 2HKIA 1BMDA 3L6EA 4Q3DA 5CFZA 4GKBA 1M67A 4G5HA 4ALLA 1KVTA 3KEQA 4IGFA 3DB2A 4TWRA 4PLPA 3UH1A 1UJMA 4DYVA 3O4RA 3RUFA 2PKQP 4BNMA 4ILKA 2AG5A 3RFVA 4N54A 3GVHA 4JQCA 2GN6A 1W73A 1PZHA 4CM3A 1VLLA 1LLCA 1ULUA 1NR7A 4IMRA 5ADHA 1P1HA 1C1DA 4Q39A 4ESOA 1VKOA 5DBFA 3WXBA 5THKA 1IB6A 1DIBA 1M6HA 4ROSA 4RPLA 2NU6A 1A4UA 1D7OA 4R01A 4YRAA 1I36A 1TI7A 1RM4A 3TNLA 3SX2A 1CETA 1MP0A 1YBMA 1EUZA 5TRTA 5CDTA 2H5LA 2WD7A 4FGSA 3F5QA 3WTBA 3JQ8A 4CM6A 1LSJA 3ROMA 1PGQA 2DBRA 4DGSA 4XQGA 4ZQEA 3Q0EA 1WWKA 5G0VA 4A5OA 4DC1A 4CJXA 4IQGA 4B3IA 1R4MA 3LT1A 2VYNA 3WYEA 3PTZA 5A02A 4I08A 1R0SA 2P9CA 3DZFA 1GQ2A 4LISA 3HDQA 4OKIA 2YQ4A 2DTDA 3OBBA 4MVJM 3DC2A 3VDQA 2F00A 3O03A 2Q99A 3W1VA 5CP8A 1CEQA 4BV8A 3VZQA 3CZRA 4JK3A 1T2FA 5JLAA 2W8ZA 4DVJA 1UP6A 3NT2A 4ZVVA 4NBWA 4BGEA 3ZWNA 1HSOA 2C7GA 4A2CA 3L6OO 4BQRA 1T4BA 1Z45A 2GCGA 4Z6KA 3M1AA 5CHEA 3AUTA 2BMAA 3I3OA 4QSMA 2UAGA 2E6UX 4C7KA 1O89A 4BO3A 5T57A 3AM5A 2YQ5A 3IQDB 4GQAA 2G17A 3D5TA 5I7FA 2IEDA 3IDSA 1ISJA 1EDOA 5B4UA 3PFFA 3HJAA 2POQX 2D1YA 2EERA 3DR3A 5C7LO 1X0VA 1E3LA 5B1YA 1EFLA 2OXIA 4LCJA 5G4LA 5IZCC 4K26A 4TKLA 1PQPA 4B4WA 3W4IA 3H3FA 3RUAA 1FDVA 4XGIA 4BNUA 5L7WA 4AJHA 1VSUA 1QP8A 4YT8A 2XF8A 1HLPA 2P68A 4NDNE 5I7SA 4MIOA 1TB4A 4QECA 1ZK1A 4FFLA 1E7WA 1JA9A 1U5CA 4U8GA 3ON5A 4CMCA 2BFOA 4MIEA 1I0ZA 4URFA 1HXHA 4N7RA 4HBGA 4M89A 3MTGA 1E1NA 1VRWA 2RIRA 3HADA 3NV9A 1HDYA 3RUCA 4PZCA 1LUAA 1DAPA 1ZCJA 2J6IA 1QLJA 4IZIA 1B7GO 4PVCA 3GVIA 3FTPA 2JFGA 4BB6A 1ZFNA 3CE6A 3ONEA 4C4OA 4WASA 4H16A 3GPIA 1I3NA 4HNHA 1DOHA 1EBFA 5G4KA 5AOVA 3WIEA 4RDIA 5BT9A 3D4PA 3AWDA 1NR1A 2FOIA 3K6JA 2BRUA 4NPCA 5F5LA 5B37A 2FPIA 4CL8A 1K5HA 4J1TA 4GPD1 2NTVA 4PLHA 1SPXA 3AUUA 3DBLB 1LDMA 5IN5A 3W4JA 1SC6A 3PWKA 4CR7A 4CV2A 4XRGA 4YT2A 2H6EA 4RJTA 3R3JA 3M6IA 3WSVA 5FWNA 1F8GA 3GNSA 3I5MA 3I6IA 5BNTA 1X1EA 4OXKA 2DUUA 1VSVA 3RUIA 1T25A 3VH3A 1AXEA 5L4LA 3QW2A 4YYZA 1A71A 1ADBA 3F4LA 3O8QB 4YAEA 4DLBA 1HE3A 5KJCA 1RM0A 4R5MA 4XB2A 2D2IA 4HFMA 3QHAA 4JIGA 3P5SA 1HYHA 4MVJP 4NFHA 3I4CA 1AE1A 1XELA 3AJRA 4JBHA 3E5RA 4ALIA 2PH5A 1YONA 5I7EA 1B16A 5ILOA 5G0SA 2J3IA 4LMPA 1LLDA 3HHPA 5IDXA 4B8ZA 1M75A 1EVYA 2EJWA 3H6KA 5JE8A 2JJYA 3OFSA 4J9UE 3WB9A 2GN4A 5JYEA 4UEOA 2Z1NA 4FD3A 4OJNA 4BUCA 4O63O 3PDJA 2C5AA 2O7SA 3JQ6A 4Q3BA 4K6CA 1DEHA 4I9HA 5HS4A 2ZB4A 3GR6A 1PWXA 4HX5A 2WSBA 2G76A 4XRRA 4BNVA 2J3JA 3ASVA 2Q49A 5B12A 1PX0A 4YJGA 2WYUA 1A4IA 2GR9A 3BMCB 3FNHA 3GNTA 2R00A 6LDHA 5CG2A 2VHZA 3KVOA 4CMIA 1NPDA 2VYVA 1Q0HA 3E8XA 4S3MA 3IJRA 3F1LA 4XX0A 3GAZA 2GNAA 3VHRA 2DUWA 3O9ZA 1ZJYA 3RUEA 1SBYA 3SJUA 1R0LA 3OQBA 4OL9A 4NQZA 3ANLA 3GHHA 4FFMA 4KDEA 4RGBA 3BTOA 4N5LA 3C7DB 3DZKA 1J49A 1HKUA 4F3YA 2H63A 4PZDA 3LDHA 1U7TA 3ROKA 1PJ4A 3LLVA 2X7HA 4EJMA 1JAXA 3ZHYA 3IUSA 1U8FO 1WPQA 1UXJA 2YJZA 1BDBA 4BNNA 3QWFA 5KJEA 4DQVA 4ZA2A 5CDUA 1GUYA 4MPDA 1UXKA 4BMNA 1R16A 1ZXLA 4TVOA 3PHHA 1YVEI 1MG5A 4KUHA 4IQ0A 2JKVA 2O3QA 3IAHA 4R9SA 1ZBQA 3EDMA 3RCBA 4PG5A 3S8MA 4DBZA 3CXRA 5A06A 5AVOA 5JDIA 2Q4EA 2Q1SA 3W8EA 5GMOA 3IKTA 1PTJA 5JCXA 4HFNA 4ZICA 2ZQZA 4PGFA 4AJNA 1HT0A 1SB9A 4XJSA 4CM9A 1UP7A 2VWPA 1PGJA 2JAHA 1LX6A 3KXDA 5T8KC 4OQZA 4WUVA 1GR0A 4IDFA 4DTIA 4CMBA 1JVSA 3OJLA 3WBBA 5KVCA 4U6SA 1JAYA 2ET6A 3VZPA 1KBZA 3WDSA 2V65A 3BYZA 1PIWA 3VTFA 3DL2A 1R15A 2I67A 2X0JA 5C3MA 5JAQA 5BSGA 1P1JA 3ENKA 1X15A 3GZNB 4HNGA 3UAGA 3WGHA 5A3VA 3PWZA 1J4AA 4D3FA 3IJPA 4PLVA 4RPJA 1YDEA 3OMLA 4CMJA 2AXQA 4I9NA 3EAGA 4UULA 4WE3A 1WW8A 3FSRA 3L4BA 3WFIA 4D44A 4ND5A 3JQDA 3KTDA 3D7LA 1GYQA 3TL3A 4YJDA 5DDIP 1FDWA 4TRMA 5A9TA 4PFJA 4EUEA 1H2HA 2VOEA 3UW3A 5KJ6A 4M55A 2ZYAA 4XJTA 1PU2A 2O48X 3QWAA 3U0BA 3G3EA 1NP3A 1PGOA 4DWVA 5IN4A 3WNQA 1B26A 4L8VA 1MGOA 3CKYA 3FR8A 3LZ6A 5L3ZA 5LDHA 1N9GA 2XPCA 4HWKA 3ZHXA 2AEMA 1QV7A 4L4SA 4RPGA 2BLLA 3JQ8B 1OZAA 4AL4A 1E3EA 2Z95A 2ZJ1A 4EEZA 2VUSA 4TVBA 1R4MB 3ICCA 2W2KB 4PLGA 2Q1WA 1GU7A 4W99A 2ZJ0A 5FI3A 3GPDG 1J5PA 8LDHA 1OI7A 3E48A 3EGOA 4YJHA 1GZ3A 1I2CA 4FW8A 3WQSB 2PD4A 3FN4A 3FCOA 3B1FA 3P7MA 1YS4A 4J90A 4DXHA 2IE0A 1JKFA 4IXTA 1HDRA 4FFPA 4XA8A 5CEEA 2H1SA 1QG6A 4RPKA 1PEDA 1SCUA 5KJFA 4FIZA 2QYTA 1HF3A 3FR7A 3L07A 3QVWA 3UXYA 4B8WA 4NBRA 4JX8A 1I3MA 3MWEB 5GZ1A 2OO5A 3L4SO 2RCYA 4CUZA 5ITVA 4DPKA 2JHGA 1I2ZA 4KQXA 2EW2A 1K3TA 1PJ3A 3TZHA 1EFKA 1TLTA 3DDNA 1QXSA 2Y1EA 3OETA 3QV1A 1BVRA 1YL7A 2AHRA 4DLLA 4ZQBA 4J2OA 3D3WA 3QRWA 4E12A 1R0KA 3EVNA 5EL0A 3VKVA 1NVMB 4PN3A 3ZWWA 4GSKA 4WLVA 4XR9A 4WEQA 4MDHA 4Z0HO 3RIHA 2BI8A 2WYVA 4II2A 3F3SA 1PJBA 2VZ8A 3RFXA 1EVZA 4Q3EA 3ZV5A 2GLXA 3GGGA 2G0TA 4BNWA 4OYRA 1YOVB 1RM3A 3KOUA 3OIFA 1GAEO 3HSKA 4AJ2A 4IXWA 5U4QA 1DJQA 4WECA 1ARZA 1K2WA 1SEVA 1DLJA 3AOGA 3CMCO 1T4DA 1HRDA 5T67A 2FR0A 2DT5A 2PZKA 1SO8A 2AQKA 1U9JA 3D4NA 4HADA 4D7AA 4MVJF 4Z9FA 3WJ7A 3NGXA 1A9ZA 2B36A 1Q0LA 4W9NA 3S2IA 4WK6A 2FHSA 2VQ3A 3ICPA 1YDWA 4R5HA 1LSUA 3UCFA 1CJCA 1UDCA 4NK5A 4DIOA 1ZUD1 4CPDA 5JAIA 3ZWBA 4J1SA 2YFQA 3A9WA 4CR6A 4EUFA 1O8CA 3GNQA 3HWRA 3PWSA 1Q0QA 2YHIB 1OBFO 1Q7BA 3N74A 3WYBA 1DFIA 4WLNA 4FPXA 4BL5A 4F6CA 4FBGA 1OFGA 4YWJA 4WOKA 2WE8A 3GVCA 1GFSA 3MTJA 3SBOA 2Q50A 3KETA 2Y66A 2HAEA 4QX6A 3IS3A 3KZVA 1T2CA 3LYLA 4DPMA 1DPGA 1V35A 5KNLA 3DFZA 3VPFA 2GD1O 2ZCVA 4GH5A 3RD5A 2BFAA 1DIHA 1S6YA 3U49A 1P44A 4WLUA 1ISGA 3C7CB 3K73O 3ANMA 4OXYA 3ZU2A 4CL3A 2V7PA 3OM9A 4DREA 1IZ9A 1PJCA 2VUTA 1MUUA 4IJUA 2GF2A 4PIVA 2YHUA 4W82A 4O59O 3ZWVA 1QKIA 4LK3A 3I23A 1LI4A 2PKQO 2GZ1A 4RVDA 2R00C 4XQEA 4CLHA 3JYQA 1RM5A 4UEKA 3U4CA 4F46A 3K5PA 4XIYA 2Q45A 1XR3A 3WSWA 3NTOA 4EEXA 3BMNB 2HMSA 1CDOA 2VRCD 2V6BA 2O3UA 3C85A 5F1OA 1BW9B 1DIRA 2O3JA 2UDPA 3DAGA 4XQCA 4BNTA 3K30A 4QEDA 1BG6A 2OFPA 3SLKA 4CV3A 5A9SA 3TOXA 2HMWA 4KP7A 4BKRA 4J7UA 1LSSA 2NACA 3OH8A 4KWHA 3U4IA 1EUCA 2CSUA 1FMCA 3NRCA 4CMGA 1DC4A 4CQMA 4FJ2A 4MVJH 4RF2A 2QZ9A 1NX6A 1JDJA 4INAA 3KYBA 3RI3A 1W4ZA 3UN1A 2CVZA 1NWHA 2DTEA 4GKVA 2FWMX 4I5FA 1UAGA 3I9NA 5JC8A 3C7AA 3H5NA 4XYLA 2D5AA 1E6WA 2Z5LA 3IC5A 5BQFA 3F46A 5EESA 2VHYA 1QYVA 2W98A 1OOEA 3MCVA 4U6QA 3KYDA 1SMKA 2C7VA 1Y6JA 4CV1A 5JDIC 1HETA 2JD1A 1PGNA 3GOHA 1ADFA 1DO8A 3QVOA 1E3SA 3IOYA 1M6WA 3ZW8A 5L95A 3PLRA 4IIUA 3W6UA 3I83A 2PGDA 4QQRA 4MVJD 1QORA 1TVEA 4NBVA 1NPYA 3SC6A 4BNLA 5DBGA 3ADOA 2NQ8A 1ZEJA 1T2EA 2IZ0A 3LVFO 3H5RA 4CM8B 1BHSA 4UVGA 4N18A 5L7YA 1F0YA 1PS0A 1E92A 3OIGA 1UR5A 1LRKA 1OAAA 4NI5A 1GADO 5DN9A 3INGA 4PG4A 3UFXA 1YBAA 1ZNQO 3Q3CA 3L4BC 2CUKA 1GZ4A 2F1KA 5KVVA 3CINA 5FEUA 4CM4A 1X1TA 2X6TA 7MDHA 2PWZA 4J91A 5BNFA 1E7RA 2AQIA 1VJTA 3Q1LA 4WCFA 4D3SA 4B3HA 3PHLA 1C14A 4D42A 4E2WA 2OGUA 4BNHA 1A72A 4R1UA 5DP2A 3SXPA 3G17A 4GSLA 2NUAA 3TFQA 4RO0A 4WEOA 3H3JA 3HDYA 3NDJA 2J3HA 3JQAA 1WAMA 1Y8RB 1YB1A 4R1SA 4NBUA 4FN4A 3GFBA 4B7XA 1HWYA 1BRMA 1NQ5A 1P0FA 1Y9EA 3MJVA 2CF5A 2EHDA 5ICMA 2CDCA 2I65A 4ND3A 3VPGA 3KB6A 1LBEA 3KLMX 1H5QA 5T64A 3E6AA 4D3DA 1G6KA 3OJOA 1N9GB 4M49A 1EEHA 4Y9DA 5H83A 5HBRA 3ZGYA 2GZ2A 4BO2A 2UUOA 3I9KA 4H3VA 3PYXA 4OSPA 3GLQA 1GCOA 5EN4A 3GK3A 4CUKA 5I8WA 3OJEA 2Q1TA 1DAOA 4PLFA 1MV8A 3HE3A 5CG1A 1E7MA 3WGTA 5JY1A 4PRKA 4R68A 1BWSA 3BAZA 3WMXA 4RQTA 2I3AA 3AY3A 1XHLA 3DBRB 1R37A 1NPTO 2QRKA 1KVSA 2ZIZA 2CVOA 4RZIA 3OEYA 2JAPA 1UXIA 3EHEA 3JQFA 1KIFA 1I2BA 4DQXA 3V2GA 1XQ6A 1Y8QA 4AVYA 2C07A 4A27A 4X54A 3NAQA 4BO6A 3AUSA 5G0TA 1DHRA 4FFRA 3I4FA 3L6DA 4KQWA 3AUAA 4UEJA 5JY6A 4TRRA 2EW8A 4XWYA 4UUPA 3U4DA 4XDYA 1BSVA 1PS8A 4ND1A 2Q2WA 1R66A 1T2AA 1IZ0A 2IZ1A 4DRYA 2CNBA 5JS6A 1TT5B 1MXFA 2X22A 3JD1A 2YV2A 1HTBA 2ZTMA 4EGFA 2O2YA 1W8DA 1V3TA 1PQUA 3LT0A 1WP4A 2AEFA 3UCXA 1MA0A 1GD1O 1X0XA 3JYPA 1Q1NA 2OBNA 4U0KA 4E13A 3BMOB 4YAJA 4Z0TA 2W2LA 2XXBA 1ZZEA 1LJ8A 4GWKA 2HMTA 1LDYA 3O38A 5COAA 3ROQA 1T2DA 3ZV4A 4ND2A 3ZV3A 5A4DA 3CUKA 5G2OA 3Q9UA 3V2HA 4CM1A 1EK6A 1LRJA 4HV4A 4UVIA 3CIFA 3U5TA 1IE3A 1XDWA 4JP3A 4Q3NA 5JDCA 2VWQA 1CERA 5CPBA 3ETGA 4D45A 1XCBA 3B1KA 1GCUA 4FFOA 3GEGA 3GQVA 2VWGA 5IFLA 3FRJA 4CMAA 1EBUA 1PZFA 4EUHA 1MG0A 4W9NC 4IDCA 1YB4A 4GLLA 1BVUA 2E82A 4IS3A 4HFRA 3S1LA 3BMQB 4PLYA 1J0XO 2RH8A 3PIIA 2P91A 3QWHA 4KUGA 2EV9A 3K8ZA 3K2EA 4XZ3A 1KEVA 2E49A 4B4VA 2X58A 4NG5A 2BFPA 3TDKA 1DJNA 3JYOA 5F1KA 3GG9A 1DHTA 1R4NA 3BHJA 3NJ8A 4LRTB 4DMMA 2HDHA 2NTJA 1JW9B 3IP1A 3GEDA 2QQ5A 1LNQA 3G0OA 3JYNA 1JKJA 3EZLA 5HWSA 4NU6A 3GAFA 1Q7GA 2IEBA 4D41A 4RVSA 3ABIA 1MXHA 2AQHA 4J9VA 1GQYA 2J5KA 3DOOA 4UUOA 4BHTA 2O3SA 4O6VA 2WYWA 2DBQA 3E03A 1LTHR 3FWNA 3B1JA 3VZSA 3JQ7A 2DLDA 1UP4A 1OMOA 2PGLA 4AG3A 3KBOA 1BDMA 1S7CA 4IDGA 1E6UA 1GTMA 3G1UA 3GDFA 1LLQA 1A7AA 3BXXA 3PZBA 1E3WA 4PCVA 5TSDA 5TQVA 3PQDA 2VOJA 2GSDA 4FOSA 3NYWA 2ZTLA 3Q6IA 3RUHA 4NR0A 1XGKA 5CDGA 1E3JA 1UH5A 3D1LA 3KYCB 3OA0A 1G0NA 1A27A 1ID1A 4BKUA 5KVQA 2PA3A 4JBGA 1PSDA 4JJFA 1LA2A 3DO5A 3MZ0A 1EMDA 1IULA 1VPDA 2BF7A 4QFDA 1WVGA 1ZW1A 1JN0A 2WWRA 4NJMA 4ZGWA 2E48A 3RKUA 5DBIA 2JD2A 3LC7O 4YR9A 4FCCA 1T1RA 3K9QO 4P4LA 4Z9XA 1TA4A 2HCTA 2YFHA 1LXCA 3H8VA 4R4JA 3ZWOA 3A14A 2NVUB 4BO0A 3N58A 4CQMB 3ST7A 2UYYA 2NVWA 2DKNA 5FF9A 4O0LA 1XIVA 2X9GA 3DEYX 2OL4A 5IAAA 5IF3A 3IMFA 1D3AA 5JC1A 1TEHA 3GRKA 2OP0A 4BNFA 1E77A 3NT4A 1XU9A 2VNSA 3DZGA 3FWZA 3QY9A 4BNZA 3OJ0A 3AY6A 1U3UA 4YEDA 1Z74A 5DCUA 5DT9A 1YGYA 3H2SA 4GX0A 2QW8A 2JL1A 2O7QA 2Q4BA 2X1HA 5CPFA 2Y1FA 1I10A 5EQFA 2QX7A 2WM3A 5F3RA 2PLAA 3NJ4A 3TOZA 1UXGA 1HDCA 4IS2A 4WLFA 4OOEA 2HMUA 2X23A 3R1IA 4YA6A 1HDXA 1X14A 1UZMA 5BSEA 2FMUA 3RSHA 4CLXA 3SLGA 2FZWA 1PS9A 3KSZO 1H93A 3DZIA 4EW6A 1P45A 1YJ8A 2O50A 2QIOA 3RC9A 3I52A 2VN8A 3LSYA 4GX2A 3ROPA 4XR4A 3LC2O 1SEPA 1I8TA 3T4XA 3ZWPA 4B79A 4MVJE 4P38A 1HSZA 4R69A 1ZK0A 1BXZA 3NGLA 3GN2A 2Q2VA 5AXBA 2VTDA 3S2FA 4CQLB 4R3NA 4RCVA 4WCFC 2Y0DA 3PDUA 4B4OA 1PJTA 4GL4A 3C1AA 3F9IA 4BB5A 3G1TA 3KV3O 3TPCA 1ZK3A 3DFUA 3ZWYA 2IODA 1JVBA 5KOIA 1GEGA 4S1VA 4YB8A 5TS3A 1YJQA 2A9FA 4M54A 3BTVA 3DOJA 4J4HA 3A4VA 4GMFA 5HA5A 2PD6A 2AE1A 3E5MA 3ZCXA 2OZPA 3DBHA 1DFHA 5I7VA 1IPEA 5IG2A 3VZRA 1U7HA 3JQAB 1WMAA 3FBTA 4IBOA 5TIIA 1ZVMA 5A3JA 1RWBA 4E32A 2C2XA 4CLRB 1P0CA 1KS9A 4CLOA 3V8BA 2EG9A 2R6JA 5IDYA 1JU9A 3IUPA 3ZNQA 4YJFB 3AM3A 1KOLA 1LLUA 3OA2A 4QXMA 3AW9A 2HSDA 4PLWA 4YACA 4E0BA 1YH3A 3AI2A 4OO3A 1XG5A 3OQ1A 4E30A 3I1JA 4F6LA 2CD9A 3OP4A 4BNGA 1BTOA 1YKFA 1BXGA 4NH4A 5MGBA 1U4OA 3GZ4A 2ZK7A 3H9JA 1FDSA 4J7CA 4J6FA 5G0UA 3JQFC 4BGVA 4G81A 1EDZA 4CV0A 4J1QA 5T5QA 2HU2A 3GGOA 1U1IA 4PZEA 4LW8A 2O3RA 1DRWA 2NNLD 2P9EA 5F1PA 3FNEA 1ISIA 1H9AA 2FP4A 5THQA 4BNJA 5CEFA 3QP9A 3JD0A 4W7HA 3TWOA 3QWIA 4BOYA 1AHIA 3A06A 2I3GA 5AXCA 1H0KA 2FZEA 1Z7BA 4PLZA 1C1DB 4QFCA 3VH1A 2VNAA 4CODB 3MWDB 1NAHA 1P77A 1HZJA 1SAYA 4R3WA 3SC4A 1E6EA 3FNFA 2OHXA 3X2EA 4M8SA 2Y0CA 3ONDA 5F5NA 4FC6A 2X9NA 1ZXBA 3RBVA 5B4VA 2JD0A 1MC5A 1NFRA 1DC3A 4MO2A 2WD7B 5DZSA 3ZU5A 1MFPA 3GGPA 3PQFA 1U2GA 1ENYA 1Z75A 4JGBA 2FSVA 4MINA 1KEPA 2JFFA 2IXAA 3RROA 4Z0PA 4Q3AA 1H2BA 1IHXA 2DTXA 4J16A 3AY7A 1MX3A 3CSDA 3FHLA 3HNPA 2VRCA 4RORA 3WX0A 5JDCC 2B5VA 5EJ2A 2NU8A 1LC0A 3JD3A 1E7SA 2B69A 3RJ9A 1NYTA 3WQRA 2YDXA 3T7EA 1IHYA 1YQDA 4EDFA 3VOSA 1EVIA 3QWBA 2B5WA 5DNAA 1A7KA 5EINA 1HDOA 1R6DA 4GBJA 4RLHA 4DLAA 3S55A 1KVUA 2D8AA 2ILTA 4B7CA 5TX7A 1A5ZA 3VH2A 4MJLA 3JQGA 4O1MA 1QRRA 1GPDG 1ML3A 3AU8A 1VL8A 3T4EA 3GRPA 4XIJA 3JQCA 2C20A 2JFHA 3WQQA 4W7IA 4Z3KA 1QLHA 2P5UA 3LT2A 4XYBA 1Z82A 4R16A 5CEJA 5EQDA 2YYYA 3DQPA 1E5LA 1ZSVA 3IIEA 5LDGA 4PLCA 3TZQA 4XD2A 1D1SA 2DPHA 1GYPA 1WDLA 4IDDA 3ZDFA 2B83A 1ADGA 1MFZA 4LRSB 3VPSA 1RKXA 2A92A 4YRBA 1V9LA 3AI3A 1Y81A 3GMSA 3MJ4A 4RLSA 4RPHA 4ZQFA 1VM6A 4YAIA 5GZ6A 4YQYA 4NMHA 4IGEA 4RVHA 4TZTA 3TQHA 4DIFA 1F12A 3P2OA 4YPOA 5IJZA 3U09A 4DMLA 3AM4A 2PZLA 4XQ9A 2DBVO 4EI2A 4YAKA 1LRLA 2NTNA 4Y8VA 4YT5A 4ZRMA 5TC4A 3ZU3A 3RAJA 4WKGA 5IXYA 3R0IA 3ZWXA 1N92A 1N8KA 1V3UA 4ALKA 5JAMA 2GO1A 4XYGA 5B4TA 2FY8A 4ZHSA 3CMMA 4IY1A 5FYDA 3M2PA 3C8MA 3PYLA 3QVSA 4NJOA 3W4KA 5KIAA 3JQ7B 3PZRA 5G4KB 4D43A 2C82A 1Y9AA 3ETEA 2BD0A 4J4BA 3OQ6A 2PZMA 1KVRA 1ZKMA 1XQ1A 1F14A 1DDOA 1ZIDA 3V1UA 2D0IA 2HUNA 4WCDA 2DBZA 5GY7A 4OH1A 3P2YA 4AJKA 4U7WA 1O9BA 4CM5A 1WXDA 4U5QA 1FJHA 4I5EA 3Q2IA 1U5AA 3CTMA 5JPIA 4MKRA 4FC7A 4YAGA 4YQZA 4BNKA 4DPLA 1MB4A 1W0CA 3KUXA 2I99A 1RYEA 2PH3A 4BV9A 2Y0EA 2Q3EA 1CYDA 1IOLA 5AYVA 3DTTA 1ZSYA 3OJFA 1SOWA 3GFGA 3V5NA 4I9UA 2ZB7A 1ENPA 3Q2KA 4CMEA 5ILGA 5ICSA 3ZWMA 1G1AA 4ZJUA 3E9QA 4E5PA 3TF5A 4KOAA 5H82A 2PV7A 1N5DA 2X4GA 4BKQA 3KO8A 5JMWA 3GC6A 3OECA 1K6JA 2XXJA 3L9XA 4GI2A 4Q3CA 1P74A 2TMDA 2NU7A 2ZTUA 3DAPA 3WFJA 3QVXA 5AQ1A 4UVDA 3QLJA 5CAEA 1X13A 4RDHA 5ENVA 2X9VA 4MOWA 4ZN6A 5AXAA 3TL2A 4L4XA 4ALJA 4BS9A 1ZJZA 1IY8A 3E9NA 3FBGA 4CLDA 1B3BA 3N7UA 3VTZA 1YQGA 2WD8A 3B6ZA 2J3KA 4G2NA 4BO8A 3INTA 3JQ9A 3UICA 4J7XA 4YJGB 1WDKA 1LDEA 1JTVA 5K6AA 1ULSA 1ISMA 4A0SA 3GF4A 4P22A 4CMIB 3MJTA 3NDIA 3JQBA 1BXKA 3DBLA 1C0LA 3JD4A 4E5MA 1H6CA 3WGQA 2RBEA 3KM0A 3WYCA 1PL7A 4J1NA 2GRAA 4OKNA 1NASA 5MDHA 5JCJD 2NV6A 4E2YA 2I76A 3E1KA 5DOZA 3TFOA 1O95A 2XAAA 3BTUA 1H9BA 1DC6A 2B4RO 4NBTA 3VVBA 3WLFA 4FS3A 1E3IA 3D0OA 3FTNA 3WLEA 4ND4A 3RFTA 2DM6A 1ZEMA 3EW7A 4RF5A 3O8QA 2VTEA 1GQQA 1ONOA 5BSHA 1P31A 1HE4A 1K6XA 2BELA 3PIDA 1T1SA 2PR2A 2Y68A 3ONFA 4J43A 3WTCA 4BKOA 2EWMA 1K0UA 3DWFA 1XLTA 5DF1A 4C7JA 3LC1O 5CDYA 1VL6A 3WMWA 3EVTA 4ZD6A 1VL0A 3NTRA 4R51A 4RVGA 4TSKA 1O0SA 5TJ9A 1LDGA 2WE7A 4AJJA 2NQTA 4PG7A 2X0NA 5L7TA 4FOOA 4J49A 1Y5MA 2VHXA 3CPSA 3O26A 3ZHZA 2AG8A 2AMFA 2C54A 2Y93A 3E9MA 5J23A 2B35A 2NVBA 3ZWCA 1RJWA 1YQXA 3BIOA 3RQSA 1ONNA 2VHWA 5U1PA 1Y5RA 3HG7A 1HZZA 4ZU3A 3LLSA 4CM7A 2PTGA 3L77A 3RBZA 2NADA 2GYYA 3ZZNA 4KUEA 2PK3A 1TXGA 2JCYA 3BMCA 3PJFA 4I5GA 4R54A 2EF1A 3COSA 4P8RA 3L9WA 4RF4A 2EEZA 1JLLA 3AOEA 3R6DA 5JFOA 4PG6A 1HEUA 1ONPA 2LDXA 4IZHA 5A03A 2E4AA 4IJVA 3QIVA 3FPCA 4KTTE 4B4UA 3JCZA 5COBA 3WJAA 1IUKA 1UZLA 4QO7A 4XB1A 1VI2A 4HXYA 3GVXA 2I6TA 3ZH2A 3DAFA 2Q46A 2HJRA 3EY4A 3WR5A 4EITA 4GX1A 2G82A 2VZ0A 2UUPA 2IYPA 4UUMA 3AU9A 2C5EA 4Y6SA 4M87A 4WLEA 2JCVA 3W6ZA 4K9DA 3LF2A 1DBVO 1B8VA 4RZHA 3A1NA 5JBIA 3ETDA 1Q2XA 2DU8A 3EZYA 2AQ8A 2CVQA 3ZV6A 3GUYA 3H9UA 1NVTA 3U9LA 1I32A 2EKQA 4H7PA 3WWYA 2GDZA 5F21A 2GPTA 2HLPA 3HN7A 4IJWA 3RKRA 3QVTA 1Z6ZA 3I9JA 1NVGA 2J8ZA 1ZMTA 1HDGO 2CY0A 4FR5A 3I6QA 1P3DA 1V6AA 3QA9A 3ASUA 4NFSA 1FF9A 1PZEA 3MOGA 3I9LA 3F1KA 3OSUA 3Q11A 1LSOA 4FQ8A 1TT7A 4YJHB 3F5SA 4E33A 4G65A 1E7YA 2JHFA 2QHXA 5L4NA 5CDSA 2NU9A 2FPPA 3AI1A 1D1TA 3KLPX 1WMBA 4HKTA 1KY4A 3GDGA 1J6UA 4BIIA 4Y98A 1O6ZA 2D3TA 2XOXA 5A5EA 3H65A 4TROA 1K89A 3GZNA 3RJ5A 3GY0A 4ZRNA 1EK5A 1UAYA 4R1NA 1H6DA 3D3EA 1DSSG 3LK7A 2J5RA 4Y6RA 2EGHA 4OAQA 3OICA 3KEOA 2ZATA 1GL3A 2V6MA 3D5QA 1P33A 3W8DA 2OBYA 2Y1CA 1GV1A 1D4FA 3JD2A 5I9NA 4FJ1A 3HZZA 4IDBA 5LCXA 1LU9A 1H94A 2ZB8A 4LGVA 3D3WB 1ORRA 4HUJA 4QT0A 3DBVO 4FSHA 1YXMA 2GASA 1HLDA 2HQ1A 2R2GA 3PFWO 4JROA 2EIHA 1PR9A 4PRLA 4ZQHA 2CZCA 4M1QA 3WGIA 4D46A 2AA3A 1NTOA 4OIMA 3JTMA 1PL8A 3PP8A 4ALNA 4GAEA 5EIOA 4JP2A 3H2ZA 4CQMD 4Z9YA 1Y1PA 3ZNNA 5L45A 4IQ8A 4E6PA 3AFNA 2GUGA 4Z3DA 2V6GA 3TZCA 2EXXA 2W2KA 5KCZA 2Y1GA 1ZO8A 3H5AA 1NHWA 1PJLA 4DUPA 1KYQA 1KY5A 1PJQA 1NWCA 1XEAA 3HDHA 5TGDA 4GVXA 2W90A 4L74A 2C29D 2OP1A 1HL3A 1F17A 1AGNA 2I9PA 1OC4A 3ZWAA 1YL6A 4J0EA 1B0AA 4OGWA 3ENNA 5ER6A 4DBVO 3U4HA 4CMEC 5GZ3A 5DULA 2PFGA 1LC3A 2IXBA 3HN2A 4L73A 4UREA 1C1XA 5EMHA 3PXXA 5H81A 3UHAA 2O3TA 1IYZA 4AJEA 2G1UA 4WLOA 3RC2A 1GUZA 1UDBA 4HY3A 5KTKA 1N2SA 5L40A 4MP6A 1N7GA 1YE3A 2NSDA 1GYRA 2QZZA 3DMTA 5ER9A 4BO7A 2FR8A 3FF4A 1A9YA 3K96A 5U9CA 4HP8A 4RL6A 4XEHA 1YO6A 1B14A 4LSWA 4WOJA 1EQ2A 4TRNA 1E1KA 4JN6B 2OORA 3JQ9C 1YOVA 3QSGA 2P4QA 3I9OA 2GERA 3CH6A 3H9QA 2WTBA 5K6AC 2A4KA 2VZ9A 3RC1A 1HE5A 1PGPA 5L9AA 4BNYA 3JQBC 3JQAD 3KSUA 4KZPA 5C5IA 1I5RA 3DOCA 4JXKA 2CMDA 2I66A 1KEWA 2D59A 4FDAA 4NNJA 2BKAA 3PPIA 2B4QA 1CWUA 1U2DA 4NHEA 3WGYA 1KETA 4GLOA 4IJKA 3VH4A 3VPHA 5A9SB 4J4TA 4NFYA 3SEFA 4K28A 2PKRA 1N1EA 3G49A 3OHSX 2I5PO 5TNXA 4EBFA 2QYSA 2WDZA 1B15A 2B37A 3HB4X 4PLTA 4MVJI 1I24A 1XU7A 3KSDO 2DC1A 4II3A 5JAZA 2YHIA 4EZBA 1B3RA 1PR3A 5DOVA 4IUYA 2Y1DA 3RVDA 2DQ4A 3PYMA 1VE9A 5IDQA 3B70A 1K6IA 1X7GA 5JSFA 4BMVA 1AHHA 3KYDB 1I30A 3PHIA 4E5KA 1DXYA 3NT5A 4OHUA 4YTEA 4DC0A 4TZKA 4BO4A 2FSSA 4J0FA 3LQFA 3JYLA 2EP5A 1C3VA 3AFMA 5I8ZA 2Q2QA 4UVEA 4R1TA 4L4RA 4AFNA 3ZU4A 2EKPA 3F4BA 1L7EA 2EKLA 3JV7A 3PK0A 5C7OO 2HK7A 5FFFA 1Z73A 4RV9A 3WOHA 5JMPA 3PEFA 4JJGA 3PQEA 2O2SA 4J2HA 2W4QA 2HJSA 3AOEC 5L53A 1E5QA 4JLWA 2W2LD 4DA9A 3BMNA 2VYND 4YRDA 3LF1A 1H6AA 1BW9A 4WNIA 4J3FA 1FDUA 3D4OA 1VKNA 4WGGA 5JW6A 4XYMA 5L4SA 4OQYA 1E1MA 4L0QA 4AJIA 2DVMA 3DZBA 1R12A 1SB8A 4CM4B 4ZQGA 3HQ4O 1PJSA 1JWAB 3KRTA 4WCFB 2FR1A 5ES3A 2HK8A 1NFQA 2A94A 1QYDA 2BGKA 5TLSA 3WGOA 5TJHA 4I8XA 4W6ZA 1DRUA 2ZYGA 2X8LA 1Q7CA 4BO5A 4IDEA 2IDZA 3HB5X 4YT4A 3DZJA 3NEPX 4IM7A 3MJEA 3BTSA 3PRJA 1SOVA 1NAIA 3ORFA 4LN1A 3VDRA 5EPOA 3WIDA 3E18A 4BGUA 1V8BA 1GZ6A 4E2XA 3PJDA 4F45A 5C7IO 1N7HA 3ZI0A 4L9RA 2J5QA 4U0JA 1VC2A 4H15A 1SNYA 1V3VA 1GPJA 3BA1A 5KVSA 3GA0A 1B2LA 4E21A 4KMSA 1EVJA 4BGIA 4ALMA 2AW5A 3RU9A 2RH4A 2EP7A 4E5YA 2AE2A 4GMGA 5HM8A 2VHVA 3DHYA 4AJPA 3UOGA 2A35A 1E0DA 1T26A 3ANNA 4OM8A 1HDZA 3IP3A 2D4AA 4CM8A 4IDAA 3M2TA 4RVFA 3C1OA 2EJVA 3TZ6A 5BNIA 2O23A 2X86A 2YV3A 3GVPA 3PJGA 1UXHA 1DB3A 2BHLA 2Y05A 3QJ5A 4IIVA 4WPGA 3ULKA 5BSFA 5HRUA 1QR6A 5KKCA 4WNCA 4MP3A 4UVHA 9LDBA 4ID9A 4GWGA 4B7UA 1MC4A 1Y8QB 4XGKA 2UV8A 3RWBA 4AJ1A 5JYDA 1QYWA 2DFDA 1DC5A 4JNKA 1I3LA 4XYEA 4Y6PA 2FPGA 1C0IA 5A9RA 3WNVA 3DONA 3OEWA 3RUDA 2Y99A 2ZTVA 4LVCA 1EZ4A 2C0CA 2X5OA 3NKLA 3PVZA 4L75A 3U3XA 1VJ1A 1NFFA 4LSMA 1GEEA 4R9RA 3CZMA 1B8UA 2QRJA 1DIGA 2GN9A 2YV1A 4CMKA 5LC1A 1JQBA 1QV6A 3NX4A 2YY7A 3UGKA 1Y8RA 4GVLA 3EMKA 1GDHA 1U4SA 4GGPA 3TN7A 3GH3A 1F06A 4ITUA 4O5OA 3BHIA 3FD8A 1XWFA 3PGXA 3DMYA 2OMEA 1GV0A 1UZNA 3GUCA 2DAPA 3NUGA 4E3ZA 2WMDA 1CQIA 1QYCA 3Q9NA 3X2FA 2JCXA 5JCJA 2H9IA 4QO8A 5ENDA 5A05A 2OUIA 1ZSNA 4K6FA 4W4TA 1U3WA 3VC7A 1ENZA 3UCEA 2BGLA 5IDWA 1EUDA 5T6BA 1ADCA 2QRLA 3OF2A 2HO5A 1YBVA 1RPNA 4P4NA 2VWHA 3DBRA 4YVFA 1WZEA 4BQPA 1EQUA 4QTZA 3WICA 3JSAA 5TT0A 1P1IA 3F47A 1PQWA 5A04A 4NU5A 5DCYA 2QG4A 2VT2A 4PVDA 4FGWA 3MJSA 4YBZA 3B20A 1ZMOA 4JJIA 1R4NB 2VYVD 1UDAA 2RHCA 2FRDA 4RF3A 4MVJA 1FXSA 3UUWA 1KEUA 3PI7A 4IMPA 1C1XB 4LMRA 1YWGO 4YCAA 1TT5A 3DMTC 3H9EO 3JQEA 1UUFA 2YZ7A 1NBOA 2B0JA 3TZKA 3U62A 3GEMA 5K9ZA 3VPXA 1ZK4A 5IXSA 2PD3A 3P19A 3VAZA 2PY6A 1KC3A 3BMOA 4E5NA 3L0DA 4E4YA 5JNLA 1HYEA 5AXDA 4P4GA 3RASA 1GUFA 3R3SA 4M86A 2BH9A 4BNIA 3DHEA 2RHRA 1WLYA 4IINA 5COQA 1Y7TA 3ZHBA 1X7DA 3UVEA 2GN8A 4TRJA 3GG2A 5JO0A 5JO9A 3H4VA 4FB5A 1WNTA 2EGGA 2FN7A 3NDRA 3STHA 4CLEA 2C2YA 1XKQA 5KKAA 1E3WB 3MEQA 4BNXA 4HFJA 1LDNA 1U8XX 1CRWG 3V2UA 1GY8A 7ADHA 3I9MA
chains in the Genus database with same CATH superfamily
1FTNA 5G1PA 3W7AA 5DP1A 2RGXA 1V16B 4MVJG 2V7VA 1T5IA 1BGVA 4FLEA 1CY4A 2XB6A 3I2FA 1LNSA 2CF6A 4M53A 4MR8B 4DDTA 3L4JA 3ZDAA 4TPKA 2P2YA 2WT8A 4D0LB 5FUXA 3I9V6 6ADHA 1FK8A 3UKOA 5LYJF 4HQOA 4BVJA 2ZBVA 2QZPA 1KERA 1D2EA 5FTMA 3WG9A 3Q8WA 1YL5A 2P4HX 2RGAA 3HCDA 2PQ6A 3PRHA 5CLGA 3TQRA 1ATIA 4L78A 5ALVA 5JXWA 3QFTA 3EPPA 3Q3JB 2VPPA 3QQPA 4MEJA 4DJAA 5KTPA 4GMKA 2HPAA 4YFYA 5HKLA 3GMDA 3KS9A 1SD5A 1XP8A 5KI6A 4AI6A 2YUTA 3ZHTA 3K92A 4Y2HA 1L9KA 3NBAA 4MR7B 3TD6A 5FXMA 1YZTA 2ANBA 5IZCA 3BWEA 2EX4A 4XVQA 2IRWA 3WS7A 1X19A 3LQ2A 5HS6A 3OZAA 4BO9A 2PSSA 2YW9A 4OUDA 1HORA 1FQKA 4EYOA 2AJLI 4AROA 2OV8A 1YS6A 4IGAA 2D5CA 4OXNA 1CF4A 1NXQA 4YXWA 3EQ8A 1NURA 4ZARA 2V0NA 1AUPA 8ADHA 5IKXA 3AHHA 2R86A 3CWQA 3MJCA 3NTLA 3T5GA 3HDJA 4RXUA 2FG6C 3GN1A 1W6UA 2H06A 1CF2O 3ES9A 4EYSA 5SZJA 4C3VA 3AETB 1UC5B 4MKZA 1KDTA 5A5FA 3I72A 4F5EA 4XIIA 3SJBA 3LX8A 2WHPB 4FNMA 5E1DA 5FBHA 2C88A 2AFIB 3IL2A 1IVSA 2V3VA 4N4AA 5DHPA 1PSZA 1EDEA 2JCGA 1PWZA 3L40A 5F64A 4B5KA 1VJ0A 2RJNA 3FYDA 1GPAA 1GRVA 4M9ZA 2C97A 3EOAI 1OIXA 2O2JA 4HTAA 3UG6A 4BO1A 1TM4E 3BXZA 1REQB 4D0RA 3EZGA 4L85A 1NNSA 1KH3A 5KZMB 3V1YA 2J5XA 5KUTA 5DU2A 2CSXA 1C1YA 1NYRA 2PS0A 5D6NA 5CJ2A 3EUWA 2R1VA 2X8JA 1JQJC 1RRGA 3DL0A 1ORWA 1IAQA 2VZEA 4LNHA 5KQLA 1M2WA 1YKGA 1CY7A 1DRVA 2YN0A 5FEMA 5LOVA 1IWOA 4AO8A 3C24A 1RBQA 1S8OA 3FYHA 2Z09A 4OMUA 2WV9A 4B3RB 3AUKA 1T5BA 4Y67A 4YGYA 1XB2A 3UBMA 1WZIA 1NT4A 1U3FA 3K9HA 3QF7A 3W2GA 3U6BA 1RYDA 1BD3A 5BV7A 2Z1DA 3B7WA 1HYGA 2CFCA 1NQOA 3S4YA 3HM9A 1XNGA 2Y2UA 5HJ7A 1KSHA 2YOHA 3FKQA 4HSGA 2I2BA 3G9QA 1ISFA 3H1TA 5TF4A 4EJ6A 3QTLA 4NJEA 3ILXA 5CIWA 3H84A 3L82B 2JAUA 4I1IA 1JXAA 2X5KO 2AT1A 2EFCB 2AFHA 2QLLA 5E7JA 4MRAA 3SFVA 2ECOA 1Q19A 1EZZA 4BMDA 4GOND 1U63A 5EEHA 3QU7A 1G6HA 3INYA 3BZUA 4KR6A 1AO3A 4OBBA 1QMGA 4HR7A 1TQ4A 2D5BA 1OXVA 1IPFA 1UMDB 4MIYA 1M6YA 4UAGA 3TLCA 4WBNF 1YZFA 4GYYA 1MDBA 4AY6A 2PLFA 1S2OA 1ZVQA 3KZMA 4LG1A 5EP4A 1SKMA 1ZQ9A 2JEYA 4CR8A 5LA6A 5HTOA 3WLAA 2YIDA 2E37A 4KRYA 4JQYA 5BWLA 5C5EA 1XTIA 1PZMA 4U7TB 1CV2A 1W9HA 4XPIA 5DK4A 4FYJA 2G5PA 3PNOA 4OSOA 4O1HA 1FBTA 1PFUA 5JQGA 2RAFA 5B5SA 3HXMA 2FLWA 1K0FA 2J6CA 2QQ0A 1YRLA 3CXUA 2Z58A 2OUKA 3IPRA 5A4KA 3CX3A 1EXNA 1K68A 1VE3A 2WILA 3LL4A 2NLOA 3LVQE 1WQ1R 2J0QA 5BP7A 4LDPA 1Q3HA 2JFYA 4JQSA 3C5VA 3DAOA 1MEJA 1Z6PA 3R6WA 3S2EA 3ZN2A 3GZJA 3ZXYA 2XMRA 4MV5A 3FOBA 3U1TA 1IN5A 4GPIB 3JTEA 2H4XA 4J0DA 3ZD7A 2B82A 2LCFA 2VJLA 3N87A 2Z6AA 3W8FA 4OGGA 2LWIA 2MSWA 2W2NA 3KJZA 2X0DA 3EXEA 3HXLA 4KH0A 4PG8A 2IPNA 2FH5B 2XYQA 1ZK2A 2NM0A 4DMRA 5DPMA 4A0QA 4HDAA 1XVAA 3NHAA 3P71T 3WYDA 3RHZA 3KC2A 4G2TA 3KTAA 4QDTA 4BWFB 3G9ZA 3RVKA 5HZHA 2PT6A 2QTLA 2P9TA 4OB6A 1HFKA 3ZYCA 3NTXA 4O29A 3RR2A 4BN4A 4WESA 3ITDA 1X1BA 3PJEA 1U8TA 3EWNA 1KI6A 2HCBA 2TMGA 4KRXA 4EW2A 5JBQA 2WEKA 1M0EA 1T24A 3FNGA 4CFSA 1Q12A 1T6XA 1NC1A 1TO2E 1WCYA 2G40A 3MRXA 2JDID 2XNDA 4OX9Y 2VJMA 5LYYA 4ZVMA 4AMGA 4TQGA 3NS7A 5IJ9B 2O5RA 1U31A 4L8YA 3ZXSA 5T3YA 1NQAO 3HO8A 2IW1A 2X0RA 2WMYA 3ME5A 4NIMA 3GLIE 1UEJA 3GJ6A 4W8OA 4B71A 4UQLA 1NVWQ 2B99A 4Q4JB 3WGGA 2LGJA 1J06A 1V5WA 3A1CA 1G0OA 2NYVA 4DOMA 2WIJA 5ITWA 2PJUA 2ZGVA 1NHGA 1Y7LA 2O2EA 4E14A 5JYBA 3GDOA 2D2VA 5DHTA 4UHBA 4XTCS 1JQLB 2NO4A 1AQYA 1KC1A 2LVBA 3JQGB 3NTVA 1ML4A 1G6OA 4BX8A 1P18A 1IM5A 5I9LA 1G21E 4LVNA 3F5DA 4HNAA 2BI7A 2DFKB 4NZPA 4QXAA 2FWAA 2LXNA 2QG6A 3L6EA 1NBEA 1QGZA 2HPVA 5IYZB 1M67A 2GZDA 4MPTA 4MQEB 2PN1A 2Q7OE 5D86A 4LF8B 1X7WB 3DB2A 2C83A 4PLPA 1AHPA 4P7GA 4YY3B 3JW8A 3BZBA 3RUFA 4FDMA 4N54A 3VRHA 1J8DA 4ZFNA 2JGJA 2FX2A 4JQCA 3P4YA 3RFFA 3WWEA 2GN6A 1FFAA 1W73A 4CM3A 5B6JA 5EHGA 1DAEA 3LYAA 1DG1G 4WA7A 3HM2A 5ADHA 3CLSD 1ACLA 1M1XB 2CVPA 3ZDYB 4DMUB 3NBFA 1P1HA 4ZODA 4PIMA 2DWOA 2J4CA 1C1DA 5LD2C 1SVNA 1I6LA 2CLCX 2NTYC 2OFXA 4L3WA 4EMSA 1RPZA 3WXBA 1XHFA 3BS4A 1JQ3A 3E81A 3IQZA 2QYHA 4H35A 4KI7A 4CTKA 1H1LB 1M6HA 3PV0A 3O8CA 1QX4A 3QEKA 4RPLA 5IVPA 3IUQA 5JPCA 1GPH1 1M1UA 3BD6A 2B1JA 3TEJA 1I36A 2O2XA 1NI4B 1FU4A 1PR5A 1QH9A 3AIIA 1CETA 2FUG1 3DT9A 1PN3A 4FZVA 3UWSA 1EUZA 2XB8A 2H5LA 2WD7A 2ZAMA 2FGJA 1LS1A 4JSTA 5BSUA 1LSJA 4DLZA 5C1DA 1A77A 3U9TA 2OLEA 1VYVA 3Q0EA 4GS5A 4A5OA 2H00A 2WVGA 3T99A 2VAXA 3TNJA 3WZ2A 4B3IA 1R4MA 1L5YA 3VMFA 3G82C 4M9RA 1KPGA 2OVFA 2P9CA 3MF4A 3NHZA 4UKDA 5I45A 1SXQA 1MDFA 4LY3A 4MVJM 3DC2A 1E4OA 4AUNA 5CURA 4TUYB 2AMJA 2JAXA 2OAEA 3K0AB 4X1KA 1GR1A 3TJZA 4HH3C 3VDQA 2QMQA 5GOZA 4WY2A 4GL2A 1ONSA 1PDVA 3DOHA 1QLWA 2A0KA 3VZQA 4IIFA 1P2FA 4OL0A 4NCIA 5AOAA 5CT5A 3ZS9A 1QG2A 2IK8A 2WKRA 5JLAA 3TX6A 1YBFA 3CVOA 1UFQA 4HC4A 4I99A 4ZU6X 3NT2A 1IEXA 1QAQA 2C3PA 4BGEA 2FWIA 2C7GA 1WU8A 3L6OO 4RU1A 3MCTA 4A2CA 4BRUA 4Z6KA 3L0IB 1DBIA 1U8YA 5CHEA 3AUTA 4BFSA 2H4YA 4ZMRA 4GD3Q 4F4FA 1T5DX 3L41A 4QSMA 4NE7A 3LTNC 4LZNA 3ETLA 3ESDA 5B2EA 5BYJA 2VPIA 2DUMA 3BXGA 4WZAB 1TMYA 2JIBA 1FRNA 3IQDB 3WLQA 4D99A 3D5TA 4MAAA 3AL3A 3BCRA 1X94A 3E4CA 5B4UA 3PFFA 3HJAA 2HJHA 2WYOA 5LM3A 5DMHA 1LV7A 4JLNA 1X0VA 4F4CA 2QRUA 4E1AA 1PNRA 6REQA 1EFLA 1G4UR 3Q6MA 4RA9B 4NSNA 1KP9A 2Y71A 1N4DA 4UU1A 1RZUA 5EMJA 1PQPA 4X1IB 4EA9A 3L1KA 3H6HA 3DLBA 1DX9A 1FDVA 1LK0A 2DYKA 3F9CA 2BEVA 3OD1A 1QP8A 2QM0A 4O2AA 5DVZA 4AJHA 5LMUB 2XF8A 4RESA 1GO2A 3M4ZA 4XIFA 1OH6A 4PAOA 3RU3A 2PU5A 1JYEA 3SF8B 2WFZA 2NT3A 1CR0A 1E7WA 3UK1A 1NRWA 1TCCA 1U5CA 1NBHA 2P2CA 3AF5A 4GT1A 1DBRA 2I4NA 3AVQA 3PSHA 4CGYA 1VE6A 4CMCA 3KJIA 4OMFG 2C2WA 2EFYA 3ROZA 4K9PA 1RQNA 1OB2A 4PTLA 4DSUA 1E1NA 1VRWA 2OV3A 3NV9A 3RYTC 2XTJA 2W6ID 1DAPA 3DOIA 3FHJA 4D74A 4JJ7A 3UV3A 5TXGA 4YRMA 2HA4A 4UQPA 3U3ZA 2FSIA 2QN6A 3OEHD 3I0NA 1I3NA 2FPWA 2GCNA 3JWPA 4HNHA 4PV7A 5IH7A 3PRKE 4EGQA 3QEJA 5AOVA 3WIEA 3BOSA 4OJQA 3U13A 5GVSA 1KGSA 3A3OA 3Q15C 1GL7A 1SR8A 3BPSA 3VR5H 2Z8ZA 2M6SA 4RMHA 4DN6A 1N0HA 2FPIA 3TAUA 4RTKA 1KOJA 2VPZA 4ZV7A 4WXPA 1CNMA 4GPD1 1PCXA 2IYZA 1TJPB 3JRNA 3TQQA 3W5UA 1C81A 4CV2A 4PQEA 4RJTA 4X3PA 4P08A 2JJ2D 4F06A 3R3JA 2NZ2A 2WOOA 3M6IA 3WSVA 5CX1B 3A3KA 1X1SA 1BA2A 3O4IA 2Q3HA 2V1XA 3K94A 3LW7A 2QTNA 4UMFA 1TJNA 4YJKA 3TB6A 2PAAA 1L9XA 4S2EA 3MS7A 4D3ZA 5FOQA 2JLZA 3DL7A 1XJQA 2CBXA 3PGLA 3QKWA 4IZOA 4OXKA 5BNTA 1VSVA 3RUIA 2LIVA 4MSUA 4GC9A 1K8XB 1OAOC 1CE8A 4UU0A 2QPLA 2GYWA 4DDWA 1S0UA 2WKWA 4NYJR 1ADBA 1QJ4A 1ZLYA 3DUWA 3F4LA 4YAEA 3SZUA 1GPYA 2HHAA 2PMDA 3E9EA 1G5QA 4KE8A 4L5YA 4QOIA 5KJCA 2D2IA 4GZLA 3WISA 2DWPA 2XNSA 4TMZA 3PWTA 3TRHA 3A4NA 1YZUA 1AE1A 1XELA 2APJA 4JBHA 2ZVJA 1NE7A 2KI5A 4LHXA 1GKLA 2DKOA 2PH5A 2X6QA 1T9AA 2ZAYA 2ZIAA 5AHWA 5I7EA 5KYKA 1B16A 1OWLA 1V4VA 4G0XA 2J3IA 4G9EA 4KRGA 4BFCA 4AUKA 4QWMA 1RJ9A 2P8JA 5TMEA 4V1CB 4B8ZA 2PX0A 2QJWA 5EJEA 4X9XA 2P35A 5EE9A 4H7HA 1TZJA 4KMMA 4ZAFA 5JE8A 2P2GA 1FQOA 4J9UE 4NV0A 3WB9A 3BWMA 4TKVB 1K1EA 4D8XA 5JROA 3THRA 2BDTA 3DWEX 4RD4A 5BVHB 4ZTUB 4UEOA 1G8MA 3OCUA 5FPHA 3TAXA 2GVNA 3TOCA 2P9JA 1OGJA 2I8AA 4OLBA 1XJWA 1BVYF 2BSXA 1DEHA 2NXNA 4I9HA 2ZB4A 4HX5A 5E0OA 5HS4A 3M34A 2YN2A 1XF9A 4XRRA 5CXQA 4K6KA 2J3JA 3ASVA 4LE0A 1KAEA 4ARIA 2QRGA 2G0NA 3R6LA 3OQIB 3AWIA 4KK3A 1WVIA 3BMCB 1ORHA 2AYYA 2EHJA 3FNHA 2GPWA 4GRDA 4JA0A 1MQ8B 4M0DA 4LZPA 4QASA 4WT7A 3RARA 5CG2A 4EG5A 1Q1QA 5DNCA 3GQBB 1Y1KE 2XHZA 5D1HA 3PE3A 5MHTA 2YNMC 3VHRA 3RAFC 4YROA 3THXB 3RUEA 5KQMA 3QV2A 1C3OA 5JYCA 2DT8A 1K7XB 3HVKA 3ORYA 2ZAGA 3EXIB 4NQZA 2QMZA 3CB2A 4RMJA 1NM5C 5FTNA 5C5DA 4OX9B 1J49A 3GFVA 1SY7A 1U28C 2EKBA 2ZRBA 4KSBA 3RHSA 3V7NA 4DNFA 2XUKA 2B20A 2IYUA 3IIIA 3PPWA 4AUEA 2GAJA 3IUSA 1U8FO 1QQTA 1ID8A 1UXJA 2YJZA 3EJ6A 1BDBA 1WJGA 4BNNA 4RADA 4ZT3A 2Z56A 3UAVA 3LKDA 4ZA2A 4X24A 2QLNA 1XL1A 4BMNA 3OFJA 3TRKA 4KQ2A 2AMYA 3G5LA 2BONA 1JFFA 1LPMA 1LD3A 1QDLB 1YCGA 1OBCA 4JOBA 4PRYA 1CBUA 4LKOA 4IQ0A 4U2EA 1F48A 3ENWA 1VYHA 1KO7A 3L43A 1R5JA 2D2FA 3ET4A 3AW8A 1SKBA 1C3XA 2G09A 4KHZA 3PLAE 3B9QA 3FLEA 3I04M 3S8MA 7ADHA 3B3FA 5AVOA 2XVYA 3DLCA 2Q1SA 3DMPA 3W8EA 2AMVA 1PTJA 1USGA 3IKTA 1QK3A 1L5HA 3M5PA 3WMGA 4ZICA 2O07A 1JEYB 2ZS8A 1A9QA 3TIVA 1XV5A 2WNIA 4RY8A 5JIBA 1HT0A 1SB9A 1KFJB 1XQWA 4D9JA 2IA5A 5B53A 4KR7A 2COEA 3K6KA 5JG7A 1J97A 3D6JA 1TYAE 2IGBA 4K87A 4R1PA 1WMFA 2MU1A 3EVZA 3EIUA 2CLSA 4IDFA 2CXRA 4XWWA 2C4UA 4KO4S 4D6PA 3OJLA 3WBBA 2AN3A 5H02A 8OHMA 4U6SA 3GOQA 4B2IA 1KBZA 4Y18A 4W1SA 4EVQA 2HLHA 3TE6A 1V7ZA 3DMDA 1R15A 2GFIA 3W90A 3T34A 1CU1A 2ZE6A 3E2MA 5KAPA 3V1NA 5BSGA 621PA 1O0CA 4CF4A 5JVDA 5A3VA 2IU0A 3G8BA 3A7EA 1AKUA 3NCTA 1S2LA 4R9VA 5HMLA 3UK6A 2I6QA 3O1HB 2OHOA 3OMLA 4CMJA 4KJXA 3W6PA 2FUKA 5FR2A 4BZPA 4I9NA 3C3EA 3TPFA 3EAGA 3OLCX 2PZBA 1P2TA 3L4BA 1IQPA 4P3KA 3KTDA 5DGIA 4UJ3A 2YHAA 3KZ1E 3RC8A 4PSAA 3FGOA 4R84A 2R96A 3QUBA 3KUKA 4PFJA 1OYVA 4NYIR 4EUEA 1K3FA 1Z7WA 3STXA 4Y6GB 2ZSUA 1QNFA 2H9YA 2WFLA 3S2YA 3CG4A 4R7ZA 1XRQA 2I80A 1TD9A 1WXQA 3RT1A 4ERXA 4BQFA 3N3BC 5KTOA 4MYSA 2IP4A 3PRYA 1MGOA 3CKYA 5AK6A 3VC2A 1C9DB 3QBVA 4MDFA 1K5PA 1QV7A 2I1QA 4B4UA 4C3ZA 1T2NA 2G04A 2J9FA 1RS0A 1ICEA 3JQ8B 3K9BA 3D0RA 1UJ4A 2R8RA 1ADJA 2ZJ1A 4N9WA 4ID3A 1PRYA 4EEZA 5K8TA 2LKCA 4KXUA 4QNMA 4TVBA 1XK6A 1XCMA 2X2FA 4HQFA 4G36A 4BBPA 1S89A 1DTEA 2Q1WA 4JP1A 4LX0A 3OMWA 2B7LA 2C5LA 5FI3A 5JD5A 1FIUA 4G5YA 5J4KA 3M6FA 5KU1A 1J5PA 3NBQA 3HJUA 4B9EA 2Y9MB 1U0JA 1LJLA 5HZKA 1G8FA 1KH2A 1J7KA 4H3KB 5F73A 2QSJA 2D1SA 3P7MA 1NF3A 3VMMA 1JKFA 2OXFA 4IXTA 3T5PA 1X1QA 4NBSA 5JJLA 3W04A 1QG6A 4BN5A 1PEDA 1WLSA 2RHOA 4KXXA 4KPUA 2QYTA 1HF3A 1U0GA 4BVLA 4NAVA 3UXYA 3N2KA 4GR9A 4JS0A 1HT3A 4OHXA 3MT8A 1XRSB 5FHRA 5BN1A 1EKXA 4H0FA 1KQ3A 3AVOA 5DX0A 2Q6KA 1XDSA 1O03A 1FNDA 3A05A 3RDPA 4CUZA 4D4GA 2DETA 1BVHA 3MD9A 1WB5A 1I2ZA 3HA5A 1GG5A 3MWKA 1OB5A 4O3MA 3TQFA 1K3TA 2BMEA 2PMEA 5HJ2A 3RAGA 3DEIA 5CX4A 1TLTA 3ENQA 2Y1EA 3OETA 1KI3A 1TCBA 3ZEIA 4AYWA 1LI7A 4FE4A 1MENA 3ZLJA 4DLLA 1G5RA 4WN9A 1U2ZA 1SXJE 4S1OA 4DSZA 3A1WA 4J2OA 3OEED 1V11A 1JR6A 2VPYA 3QRWA 5HF6A 4WNYA 1R0KA 4U8HA 1B41A 2OHHA 3EVNA 1RRVA 3MUEA 1NVMB 3EC2A 3TW8A 1JVNA 2DERA 4NF2A 4WEQA 5JSKA 2IYAA 4Z0HO 4ZZIA 4UDOA 5J2TA 2A4MA 2WYVA 2PGOA 3DV0B 3DXZA 4KMOA 1PJBA 1EVZA 2A0UA 2P9QA 4EVRA 1J0EA 1GPMA 1CVIA 1FMTA 4GI3A 1FW6A 3LGXA 2ORIA 4BNWA 1PT5A 5LQNA 5IU6A 4Q1FA 1T4CB 4OP2A 1E8DA 2JC3A 4WBXC 2QLBA 5FX2A 1QPZA 1J2RA 2BRUC 5C35A 1H0HA 4PYMA 3CRZA 4IUDS 1O8BA 4J1TC 3AFGA 2W6QA 1DV2A 2VP0A 4JMPA 1NR5A 3UGJA 2C2BA 3AOGA 4WOBA 2OMKA 4H7IA 1ABBA 3W8NA 3P2JA 4RCZA 4JXJA 4HADA 2AZ4A 3OY2A 1NIJA 2FX5A 4RK1A 3EVCA 4Z9FA 2CNDA 3U3KA 3NGXA 2EQ5A 2I8CA 4F11A 3BC1A 4QUIA 2B36A 2W0MA 4W9NA 3S2IA 1AQUA 2O8DA 1O6GA 2C7RA 4U2GA 3THWA 3ICPA 3AVXA 3AR8A 5KYYB 1H3FA 1EFPA 1UDCA 3QHQA 3UCFA 1RPTA 3R0ZA 4B1FA 1ZUD1 2GH1A 4FU0A 2RMKA 4Y2XA 2FN4A 1J2YA 1WSBA 4J1SA 4L0DA 3ESZA 5BMVA 1UDXA 1T6ZA 3HWRA 2B6HA 2YHIB 3LQRA 1NBMD 1XTTA 1DFIA 3P9QA 2Y4OA 2B1QA 3GI1A 4FPXA 4EUSA 3E15A 3HNOA 3KAKA 1G38A 4WOKA 2FPXA 1BJTA 1IZ7A 2YMPA 4KKVA 4QUBA 3IS3A 2BV3A 5H1YA 4KITB 3KZVA 3C1UA 1YR2A 2AKAB 4MUBA 4FHDA 1JFSA 1DPGA 4IO0A 3UHFA 5AI6A 3VPFA 4CVNA 2ZCVA 1PYDA 3IR6A 3FOCA 4MI1A 3ZDCA 4GH5A 2PMCA 2BFAA 1XLVA 1EM8B 1O3YA 2J5BA 1GRRA 2PRYA 4WLUA 1JV2B 1ZJJA 1Z4LA 5DB4A 1S9HA 4F72A 2V7PA 4EX6A 5DK6A 1O57A 1IEVA 2NO9A 1IZ9A 1DAHA 1PJCA 1MUUA 1OWOA 3IV9A 3W1WA 4C0KA 1UPTA 2DQYA 4LWOA 4FI3F 2YHUA 3HYSA 3ACDA 1FSSA 1NDQA 1TA0A 4AMBA 3RJTA 1CJKC 2P0EA 3G8YA 1GILA 3ESCA 2A5GA 1VZ3A 3U4QA 3F2VA 4X0EA 4XQEA 1EESA 5IJ0A 1RM5A 4UEKA 3RGGA 5MN5A 2QLJA 2GRUA 3NBUA 2O0KA 3WSWA 2XDYA 3PC6A 2Z3VA 3QELB 4I0WB 4RK0A 1HH4A 2VDNB 3AIKA 2HMSA 1CDOA 3GRCA 4QYIB 1OX4B 3C85A 1YHYA 3H9CA 4DQKA 5JSZB 2XE4A 1NVVR 2QRQA 3BERA 3DAGA 5CTJA 1OYWA 1DKRA 1V26A 1W1WA 3QMMA 4JCCA 3TQTA 5FKJA 1BG6A 1SCJA 4D3YA 3KFVA 2OXTA 3G2PA 4H60A 3QBTA 2QN8A 4NZOA 3SBEA 4UM9B 2BGRA 1Z0IA 2W2MA 5T7BA 1M0WA 1JXMA 4REQB 4KWHA 3LXRA 3OH8A 4AZWA 3U4IA 1EUCA 1KGDA 1HK7A 4CMGA 4KN8A 4QUHA 1Z0AA 2AJCA 4FJ2A 3TLYA 4DSOA 1P3JA 3FAZA 1R0WA 3DZCA 1NX6A 3L7CA 1Z06A 4DBLC 5DMXA 2DFLA 2Y6UA 4H0NA 4CIAA 3OHMA 1NRXA 1XCOA 1NWHA 3M3PA 1FFHA 2G08A 4R2IA 4RA6B 1P9WA 4BX2A 5JJ5A 2A84A 3F7MA 5JC8A 2RK3A 2P5TB 3L01A 4JD5A 4W5RA 4Q4AB 3JPWA 1GSHA 3P9PA 3CC8A 2J30A 1X92A 1IZZA 4GPBA 1H2RS 4HYTA 1JJVA 3BBPA 1QH1B 4L4YA 3M89A 4R05A 2HOQA 2R79A 4CV1A 2WI8A 3DEFA 4KYVA 4BJHB 5JECA 4RS4A 4CDRA 1A1VA 2QAGA 2V8OA 4CL2A 5SY9A 4PCUA 1PGNA 2GO7A 1ADFA 4MQBA 2CLEB 1KEKA 1CRLA 2QRMA 4YP6A 3FWKA 1T3TA 3DV2A 3VR0A 2D1FA 3G68A 4LHEA 5LOVF 4CKBB 4F04A 3IVGA 4IIUA 4LYYA 1AZLA 3QVGA 3I83A 4J76A 2PGDA 4EA6A 1QORA 1NW5A 4RFVA 3L18A 4D3DA 3ZLUA 2ZT7A 2A78A 2NQ8A 1B93A 2F7SA 3RTGA 4I4LA 5IEJA 2OLKA 3EGDB 3R3WA 4LXHA 1T3HA 4NC9A 5CA0B 3FWYA 5E2AA 2R97A 4AWXA 3VO2A 4N18A 1F0YA 4KQ6A 3V6MA 3LV8A 4YMGA 4I9GA 4M0LA 1R8JA 3ADCA 4OV6B 1FTYA 3CHYA 1Y9DA 2FKNA 1ZUWA 5EJ6A 4NI5A 3INGA 1MOQA 5C53B 1BMTA 1YBAA 3D6HA 3Q3CA 4KODA 4CKWB 4NE9A 1GZ4A 3AEYA 1BN6A 4YCMA 4K88A 4CM4A 3OLQA 4RH3A 4DJ5X 4JX9A 4ZAXA 4LE2A 1GTRA 2J46A 1E9RA 1T0HB 3ZIUA 1TZKA 2PWZA 4J91A 5EMLA 5BXYA 5H16A 3Q1LA 4WCFA 3C3DA 3WLOA 1QTQA 1D4OA 5HRAA 4D42A 8GPBA 3NHJA 5LA6F 3OUTA 1ULAA 3VR6D 4AN1A 1OVMA 5EVCA 5AW0A 4IILA 3U4GA 3OX1A 2AJBA 4EQZA 2O0MA 2PU7A 4GSLA 2NSYA 2NIPA 2P65A 3EIEA 4RO0A 5JQGF 3CLRD 5M29A 4EJSA 2PXAA 4HUQA 1XZJA 2Z4SA 4G41A 4KACA 3I64A 2R7NA 3HA3A 3JRXA 2UZ0A 4OK3A 4AMYA 2PO5A 3HU5A 3O74A 3ROGA 4B7XA 1Y9EA 5ARDA 3U17A 4MVCA 3OTIA 3GJZA 3NKVA 2CDCA 4AB1A 1S2GA 5AW8A 1LBEA 5REQA 1G6KA 2HTEA 5KS2A 1N9GB 2W48A 4RQBA 4JITA 2WFMA 3EF1A 3JQQA 3NNDA 5BWNA 2CLOB 3I9KA 4H3VA 1F0PA 3WLNA 3ERCA 2IXEA 3GO4A 2J6HA 3SGLA 1M1ZA 2F2TA 2ROQA 4RMIA 4L4UA 2HF2A 3D3NA 3LQKA 3ILSA 3Q88A 3N0RA 5I8WA 2Q1TA 1OA1A 2JGRA 1PTKA 1W8IA 1XRRA 1E2MA 2FV8A 2Q6OA 1C9NA 4EY6A 2B7BA 3MILA 3OM8A 4MB2A 1L7PA 1OZGA 1TUBA 2BFBB 1NVEA 3BE5A 4NCXA 4PRKA 1BWSA 3A1VA 4R68A 4U6NA 2AR0A 3DBRB 3FJ1A 3WO0A 3DNFA 5CW1A 3IHTA 2QRKA 3K9CA 2ZIZA 4QVKA 2CVOA 3KOWA 4R1QA 3OEYA 4X8MA 1XDDA 3UHJA 1KIFA 3R40A 3ROEA 5AUNB 4KGXA 1XD9A 2ODNA 1G5IA 2X4IA 2ZTHA 2OO5C 2XSZA 1Z9BA 3FIJA 3OPQA 3PQ7A 4FYPA 4K3UA 3ZGLA 1Y8QA 5EJ8A 2BKVA 1SCUB 3AXTA 4QHTA 4UCXA 2HADA 1H2ZA 1LNZA 5AW5A 3FVQA 3DYIA 1T0UA 1E1RD 1RHQA 3H87A 1N2GA 2X41A 4FFRA 3V7FA 4BLQA 3L6DA 4KQWA 2DGDA 3WZMA 5JS7A 2A59A 2BCEA 2FEPA 1JDNA 2GZHA 4TRRA 5DSZA 1AT1A 4F2PA 1J99A 3ECSA 2ZM5A 3OC0A 1R66A 3M5CA 4GP6A 4HXFB 2XE8A 5IJAA 1GNVA 1PJ8A 4GRIA 4UOEA 1C9YA 3FHCB 3ML1A 2QX4A 1JLMA 2R65A 4MV0A 2PMFA 4DJJA 4EGFA 4HVCA 2ZRQA 3KFXA 3LT0A 1PQUA 3PJRA 1X0XA 4ZJPA 1Y8AA 3HFJA 3EXHB 3NC0C 3KXLA 4N39A 2XXBA 5AHRA 2C8JA 4CTMA 3KQOA 3C70A 3UAZA 2G5GX 2HMTA 3OZEA 4GWKA 4HDMA 3REOA 3ROQA 4A0HA 1Z5WA 3ZDDA 3N2GB 3ND8A 4RDXA 5G2OA 4WOCA 5BUZA 3UMJA 1W5TA 4M0EA 2C3OA 4Q16A 4JI1B 1XNQB 1LRJA 4HWPA 5FTKA 3THYB 1IE3A 4JP3A 1R0ZA 3KQYA 4B46A 2WP8J 4Q3NA 2VWQA 3VX4A 1CERA 4KIUA 3N6VA 4QHSA 1N5RA 2Y6VA 4I1UA 3ETGA 3AHCA 2WTXA 5I3ZA 2DR2A 2AGVA 1U2EA 3COVA 3DV9A 3EDQA 3FMIA 5C4GB 5HVNA 1PZFA 4LRQA 2FSUA 4XM2A 2IPXA 3BRQA 1XROA 3PXBA 4NMWA 4U39A 4YDQA 3ICVA 1UPUA 2QLFA 5J4VA 3KZCA 4QTXA 1BVUA 2ZZMA 1ZNYA 4NOMA 5MF6A 5B2ZA 1AKNA 1UIMA 3S1LA 4NABA 5B6PA 5MFZA 3RG2A 2ZRIA 2GZRA 3M6AA 4PLYA 3PIIA 5LP6A 2REOA 1KJYA 2NG1A 3HU3A 4LHZA 5LZ8A 3O83A 1AD2A 4WADA 3K2EA 4K9KA 1A50B 3EGXB 2ZJ8A 4B4VA 3L7AA 4DCPA 1RCUA 1C30B 5IEBA 3RS4A 2RARA 2GFHA 3BK1A 4C06A 3EMDA 3RVMA 4OI4A 3TDKA 3OX3A 3I5XA 3VUEA 1DHTA 2CJXA 4YH1A 2BTEA 5ALOA 2P0YA 3JAWB 4DMMA 1P5RA 4JNCA 1JKXA 1JQKA 2DSNA 3FDXA 3IODA 3IP1A 3SZRA 2OD7A 1RRKA 3T9AA 2Y0BA 1LNQA 4PYIA 3JYNA 4UJ5A 2QMUA 4KOEC 1GT6A 2EFJA 2FAXA 4ZYXA 2IYYA 3K0HA 4HLUC 4DV0B 2V0GA 1N6KA 2IZ7A 1I7SB 4RVSA 2DJIA 1M83A 2YW2A 3ABIA 4G56A 3DKVA 1RI5A 1GQYA 1VPLA 2J5KA 2JIMA 1V8DA 3WK4A 4BHTA 4PGGA 3D2CA 1A8HA 2BJWA 1AZTA 4TLLB 2DBQA 3T9FA 5AHXA 2YVKA 2CDRA 5GVRA 4OCZA 2PT5A 3CFYA 4FT4A 5BSWA 4YV7A 1U81A 2GPNA 1L5ZA 2YVLA 2R60A 1JNXX 2BBTA 3EQ7A 3O2SB 2JI9A 3OKFA 5ES4B 3A6PC 4CHGA 1E3QA 4RWEA 3H16A 3DF9A 3UJAA 1U4NA 3KBOA 1QF7A 4NE2A 3V4PB 4KBGA 4FNOA 4I66A 4X65B 3H75A 5A4AA 5LU9A 3CVVA 4YR7A 1SIUA 3SKYA 3LKBA 3G1UA 4QOFA 2JZCA 4J1GA 4FFBB 1M7HA 4C2UA 3C5CA 4NYJQ 3HBAA 1K2VN 1W5FA 1WSDA 2GOYA 2GSDA 2ZUWA 4BFXA 3NYWA 5IVDA 1EQAA 1OBVA 1XGKA 3OPYI 1DC7A 1UH5A 2XAUA 4O2AF 4TZ0A 3E58A 1K7CA 2XXAB 1YZ3A 4YREA 1VIVA 1LA2A 2QT0A 3CLTC 1ZNWA 3DO5A 3QU2A 1IULA 1EA5A 2BF7A 1F4LA 1JN0A 4OQMA 4ZGWA 4AYTA 5PNTA 1WW3A 3LUJA 2JD2A 3FOAA 4H1TA 4LXYA 1T3GA 1ZD9A 4QIHA 2ZYSA 4P7JA 2SCUB 3WP1B 3K9QO 4NMMA 1AGYA 1QFSA 2HCTA 1TZCA 4CCYB 2RGYA 3H8VA 1OH8A 1FTWA 2WABA 2K7FA 1RMQA 3QEBZ 5AK0A 4DCNA 1Y3HA 3GFFA 2WD9A 1H8HD 5EIXA 1EHYA 3WAJA 4FOPA 1X7YB 3PNLA 3ZGZA 1HC7A 5EWJA 1CY0A 2OZVA 2OL4A 2XYRA 3V7UA 4C87A 1YKSA 3T5CA 3WRYA 1VOTA 1K08A 3GRKA 1OFUX 3BH0A 1E77A 1XU9A 4Y7DA 1G8GA 1CY8A 2RHBA 2ZVQX 4L7QA 3RVLA 4OY3A 4M0CA 5CHYA 4MRVA 3OU7A 3GLUA 5EZYA 2VP3A 2YWHA 5F98A 2X1HA 1C41A 4PANA 4EGCB 3LNCA 2EGUA 4YRNA 5EHXA 4MQ6A 1CUUA 1F2TB 2B9EA 3LCVB 3LZCA 5EYPB 1FFYA 1HDCA 1RFLA 4IS2A 2ZJ4A 3HU2A 4TLMB 2IITA 2UZ1B 2IC5A 2HMUA 5BSRA 5CCEA 4LYDA 4MKGA 2Z5FA 3OZRA 1UZMA 4YGXB 1ZRNA 5BSEA 2EQBA 2FMUA 3SNKA 2VK2A 3U40A 1FYXA 4OK5A 1PF7E 1P62B 2VS1A 2XRFA 4D9HA 3ENVA 4W5TA 3WHKA 4UFPA 3DZIA 1AUVA 1KQPA 2Q3LA 4MMZB 1P45A 4EW6A 3PXEA 3J7AC 2GK4A 1UM9A 1X9GA 3A6DA 2VN8A 3LSYA 1K5GA 3E3OA 4EFNA 2LV8A 3D81A 3GDWA 5EIHA 3ZWPA 4B79A 2ZRNA 4P38A 5LIPA 1HSZA 4MLPA 4R69A 1JDSA 2W70A 1RYZA 1Z39A 3GN2A 4BE7B 4LJLA 4F85A 4EOGA 4YQEA 1U9IC 2BTOA 1SRQA 2R47A 1QE5A 1PJTA 3MRSA 3KR1A 3CX4A 2O6HA 4GL4A 1MRZA 1QHXA 1SUWA 4KO2S 5BQ5A 2QD4A 3L4KA 3TPCA 5EHQA 2POCA 4PHGA 3LGAA 3DFUA 4WFQA 1YMUA 1OROA 1A9PA 1OUMA 2IODA 4E07A 4C4SA 2XZLA 3C7KA 4OUKX 2A9FA 1WNFA 1MABB 3BTVA 1MOSA 3A4VA 3N59A 1XJCA 4FXOA 2YWRA 4GMFA 5HA5A 3UJ6A 4P98A 5A5GA 1LKZA 3E5MA 4OHFA 2QDXA 1NUSA 3CZ4A 1TTTA 3DBHA 3SZLA 1DFHA 1G20E 3R7DA 1AS3A 3QXHA 5E2IA 1SUSA 1LK7A 4G23A 1TNDA 3WWYA 3NUQA 4N48A 1RWBA 1VPEA 2WR8A 4E32A 3KSAC 3UKDA 2C2XA 4IVNA 2IOFA 4IMIB 4CLRB 3AHDA 5IDYA 3WBJA 4WDRA 2I78A 1F3OA 1JU9A 3IUPA 3G8AA 1LLUA 1RLJA 3N5CA 3I45A 3LUDA 1FDOA 4QXMA 4HGZA 3LBYA 4PLWA 1SPBS 2QLMA 4DLRA 2VDWB 4E0BA 2RKOA 5GJWC 1JR2A 3I1IA 4OO3A 3SU8A 1D6SA 2QU7A 1USKA 3ZIAA 1XG5A 3OQ1A 3WA6A 3BWYA 3I1JA 2CD9A 3KKPA 1P5JA 3AKDA 1DARA 4BNGA 2VTBA 1BXGA 1USIA 2PVPA 3WWDA 3GU3A 2ZK7A 3H9JA 4J0JA 1Z36A 5G0UA 4YRPA 3I62A 3RIYA 1EAMA 4KAFA 1O87A 4L0MA 5ARBA 5HP4A 4J1QA 3T5MA 2AR9A 2QW1A 2PZFA 4B35A 4DFDA 5DXJA 3KBBA 3GH1A 4KL8S 2D3WA 3UOAB 1QZUA 2V59A 4C0JA 2ERYA 3Q10A 4G0ZA 3E0QA 1DDGA 2B8WA 1MOPA 4WZBA 5CEFA 5F1PA 3FNEA 3HO1A 2WF5A 3JD0A 2Q5JA 4W7HA 4YECA 3TWOA 3ADBA 2CCKA 2DRIA 3A06A 1RTKA 2I3GA 3EJWA 3DC7A 2R6GA 4PLZA 4PYKA 2VAMA 4ZVSA 4EGAA 1GA1A 3SXUA 4R1LA 2WKSA 3C16C 1SAYA 2FUCA 3DGFC 1UBJS 2F4NA 2Y3IA 5CK4A 3F49S 2OGTA 1P5HA 2OHXA 2PTHA 3V7YA 5CLJA 2Y0CA 1VSQA 1SM4A 5F5NA 4CTOA 4FC6A 3EYAA 1P2GA 1OLUB 5H70A 3NC1C 3RBVA 3H1BA 5B4VA 4FYHA 1W2GA 1AQNA 2PBFA 3SQDA 2PWBA 5J5AA 1NFRA 4FDTA 4LVOA 3RRYA 1QJCA 3GGPA 3PQFA 4URUR 2JI4A 3ESQA 4ZCQA 1QHFA 3ESAA 1QC5B 5J4LA 2A5FA 3H11A 3VNVA 4Q3AA 1R6UA 4G9BA 4IDXA 3N0VA 2AZTA 2ZITA 1YIAA 3IPLA 1MX3A 2GILA 2LPMA 4GI1A 3B5IA 2ZZKA 4YONB 2CHFA 2WIFA 3MRVA 2IYXA 5KHAA 3IQIX 3GLHA 5EJ2A 1AN0A 4G63A 2RDMA 1NYTA 4I50A 3WLMA 5JVDF 5IVHA 1GL9B 5ALTA 1VG8A 2GBGA 2HB6A 4NULA 4DGQA 3RYHB 2W93A 5HKOA 1ESDA 3UUFA 1HDOA 5D7NA 3PNVA 4ZYUA 2YZMA 3OTWA 1GDTA 4KFRA 3HCAA 3B51X 4PZLA 4DLAA 4JL5A 4HZUB 1VKZA 3KTFA 2OTCA 3KQSA 1QRRA 1SU8A 3AQIA </