4BV9A

Crystal structure of the nadph form of mouse mu-crystallin.
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
309
structure length
303
Chain Sequence
RAPAFLSAEEVQDHLRSSSLLIPPLEAALANFSKGPDGGVMQPVRTVVPVAKHRGFLGVMPAYSAAEDALTTKLVTFYEVPSHQASVLLFDPSNGSLLAVMDGNVITAKRTAAVSAIATKLLKPPGSDVLCILGAGVQAYSHYEIFTEQFSFKEVRMWNRTRENAEKFASTVQGDVRVCSSVQEAVTGADVIITVTMATEPILFGEWVKPGAHINAVGASRPDWRELDDELMRQAVLYVDSREAALKESGDVLLSGADIFAELGEVISGAKPAHCEKTTVFKSLGMAVEDLVAAKLVYDSWSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOMORPHOLINE-CARBOXYLATE DEHYDROGENASE
publication title Crystal Structure of Mouse Mu-Crystallin Complexed with Nadph and the T3 Thyroid Hormone
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 99
structure length 303
sequence length 309
chains with identical sequence B
ec nomenclature ec 1.5.1.25: Thiomorpholine-carboxylate dehydrogenase.
pdb deposition date 2013-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02423 OCD_Mu_crystall Ornithine cyclodeaminase/mu-crystallin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1780.10 Alpha Beta 2-Layer Sandwich ornithine cyclodeaminase, domain 1 ornithine cyclodeaminase, domain 1 4bv9A01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4bv9A02
4CLDA 3TZKA 1GEGA 4NPCA 4BO4A 3G79A 5THKA 1AUPA 3VOSA 1BRMA 1YS4A 2FN7A 3EZLA 3LK7A 4ITUA 1DJNA 2PY6A 4UEJA 2G1UA 1CWUA 1LLQA 1PX0A 4DIFA 2Y1GA 3H5NA 3K9QO 1QMGA 2C7GA 1LXCA 1O0SA 4ALIA 4B3IA 1KVSA 2DFDA 1E3WB 3GG2A 5F1KA 4O5OA 4D7AA 5H81A 4E21A 1SB9A 5B4VA 2DBQA 3B6ZA 4GMFA 2G5CA 4WPGA 1ZXBA 1PZFA 1K6JA 4TVBA 1GL3A 1I24A 1LI4A 5L9AA 2JFFA 4CMIA 3H3JA 2OBNA 4XGNA 4BNFA 5B4TA 2C07A 3CMCO 2Y0EA 4YT8A 1JKIA 3WNVA 2DBVO 4QO8A 4CQMA 3ZCXA 4HBGA 4D45A 2SCUA 2YZ7A 3BTUA 2B35A 2I66A 1CETA 5EINA 3L4SO 5KVVA 4CM6A 1YL7A 2AEFA 3ITKA 1J5PA 2VYVA 4NFSA 2PKQO 1XU9A 4BNKA 4Q39A 1VJ0A 4IDDA 2VNSA 5DBIA 2NM0A 2ZCVA 4OQZA 1WNTA 1YBAA 2FSVA 3UCFA 1UP4A 3G0OA 4PFJA 1BXGA 4YBZA 4HFJA 2DQ4A 4E4YA 1B14A 1LC0A 2A92A 2PH5A 3GUYA 1H6BA 2AW5A 1EUZA 1RPNA 4UAGA 2ZTVA 5JC8A 1XWFA 1EUCA 4CJXA 1E3EA 1E5LA 1MLDA 5TGDA 4E5PA 2V6MA 3DL2A 4B4UA 5I9NA 3OA2A 2E82A 2VUSA 4L4RA 1IY8A 1B2LA 5FI3A 3WQRA 2EG9A 1BW9A 4NDNE 3WNQA 2VUUA 4IXTA 2AE1A 4E3ZA 1PJSA 3KV3O 3Q3CA 4TQGA 2DLDA 2DTDA 4DBZA 6LDHA 4OOEA 2Q99A 1NNUA 1RM4A 3GZNB 4FR5A 3RC2A 3WB9A 4PVCA 1D1TA 3DFZA 3RKRA 3QP9A 3DBRB 3BHMA 2FR0A 4QQRA 1XGKA 4RVUA 1C14A 2VTEA 4JXKA 4WCFA 2IEDA 1SOVA 1Y1PA 4H3VA 4NK5A 3A14A 3RUCA 4DREA 5B12A 5GZ6A 3VZQA 4E12A 1HXHA 1NQOA 3WWZA 1HL3A 1IHXA 5C7LO 1GPJA 5CDSA 4YRAA 1QSGA 4A27A 4P4GA 4FD3A 2WEKA 4RJTA 1X15A 4YQYA 2CF6A 3VVCA 4XR4A 5T8KA 2O3RA 1N1GA 1XQ6A 2GN9A 4IDFA 1NR7A 3TFOA 3Q0EA 1N7HA 3DQPA 4LRTB 2BFMA 3OEWA 4W7IA 4BNUA 4GVLA 4D3SA 2FHSA 2QRJA 1GZ4A 1JWBB 3ONDA 4IZIA 4EUEA 1OC4A 4QT0A 1HE3A 3PJDA 3SX2A 1GUZA 2A94A 2OGUA 3D3WB 4HFMA 4MIOA 5A9SA 4BNXA 5IAAA 3GLQA 3X2FA 3F1LA 2C20A 3WQSB 4WLVA 1R6DA 1NBOA 3DZGA 1GEEA 3LLVA 5EESA 4BNGA 3DZBA 3F5QA 3EAGA 3RBVA 3BTVA 1P77A 1IL0A 2Y99A 3DTYA 5FFFA 5JFOA 4FB5A 3RI3A 1HZJA 3GDFA 4DYDA 3G1UA 3OM9A 3VH3A 3RKUA 2GCGA 1XEAA 4RPKA 5JDIC 4XDYA 3O26A 2CDCA 2X5OA 4TKLA 3C7CB 1KEUA 2JHFA 1EUDA 1B8UA 2FRDA 1BXZA 3DEYX 1A4IA 1AHHA 1ZXLA 4DXHA 5ER9A 4GSLA 4O59O 2Q45A 2QRLA 4OXNA 3DXFA 2P9GA 3VZSA 5EQFA 5F21A 1R0LA 3B70A 3W8DA 4B3JA 3WLFA 1ZK2A 1LUAA 2C54A 5C7OO 3HUDA 2FZEA 1VSVA 4Q3NA 1JLLA 1T26A 1DLIA 4KTTE 5IN4A 4Z0HO 5G0SA 1Q0HA 2X22A 3B1FA 3KUXA 3ZU3A 1VKOA 2IZ0A 4INAA 1GADO 1NPYA 4ZD6A 4DWVA 2I9PA 4EBFA 2CDAA 3OICA 4C4OA 1P31A 1Y8RB 4PRLA 4FQ8A 1B15A 1NPDA 1PGPA 4P4LA 1ULSA 5JE8A 1GZ3A 1LDBA 4MVJA 4WLEA 4RORA 4MIYA 1QYCA 1LTHR 1ZEMA 5EPOA 1I3KA 1DEHA 4XD2A 4UREA 4NHEA 3RSHA 4ND2A 3CMMA 2Y1CA 2F00A 3P5SA 2VWGA 1U4OA 4IGEA 3BMNB 1U28A 4IPTA 2D8AA 4O6VA 3H3FA 4GSKA 4UVDA 3QW2A 1KOLA 3W6UA 2PZMA 2BH9A 1W4ZA 4BV8A 1YVEI 4XGKA 3ON5A 3RUHA 3ZNQA 4S3MA 5JXWA 3KBOA 1U1IA 2HMWA 4JBIA 4UUOA 1QORA 4NR0A 1YE3A 4R9RA 3PTZA 4ZQFA 4CR8A 4FCCA 5H82A 4PZDA 1GR0A 3JD1A 4J4HA 1EQ2A 2Z95A 1H6CA 3BMOB 1IHYA 1X7HA 3HFGA 4Q3EA 4RPHA 2D1YA 2HCTA 1SZJG 1HE4A 2GLXA 3AK4A 4EEZA 5A9TA 2A35A 3NJ4A 4PZEA 4XA8A 1AXGA 1PL6A 1P1JA 2PGLA 2PLAA 3PRJA 4KQXA 3DZIA 1G0NA 4FFMA 4BKPA 4ID9A 4J0FA 5HWSA 4NK4A 4MJLA 3DAGA 1RYDA 2VOEA 3O8QB 5JC1A 1T4DA 4CUZA 3D0OA 1FK8A 1OZAA 3GEMA 3K92A 5CFZA 1TVEA 1ADCA 1R4MB 5JCJA 1LU9A 2W4QA 1WW8A 2X58A 1C0LA 1RJWA 5I7SA 3I9LA 3H65A 2DBZA 2DTEA 5BR7A 5IFLA 1PQPA 4L75A 3GGPA 2YHIB 4CMGA 1LBEA 1T2DA 3I6IA 1TEHA 3NYWA 3C85A 4N5LA 3JD0A 1YDEA 2Q4BA 2ZYGA 1DC4A 5L7YA 2PTGA 2YQ5A 5AYVA 4KTVE 4QSMA 1TLTA 5TQVA 1TT7A 4IY1A 5A1TA 1DHRA 1YOVB 4E31A 5JAMA 2P91A 2J3KA 1IPEA 2ZTMA 4CM8B 4QEDA 1NM5A 3TWOA 1R4NB 4E5YA 5KJ6A 3ZNPA 3QLJA 3TF5A 1EBFA 2JHGA 3E9MA 3TRIA 4W7HA 3I23A 4WOJA 2ZQYA 4RPGA 3JYQA 4CR7A 4IMRA 1M66A 4OMUA 4U6SA 1YQDA 4CM7A 4BO3A 3E9NA 4ALNA 4B7XA 3IL2A 3EW7A 2X5KO 1IZ9A 3BIOA 4YAJA 1QG6A 4UVGA 1LX6A 2D5AA 2JKVA 1A9YA 5JO9A 4HNGA 1H9BA 1KVRA 1X1EA 3EDMA 2EP7A 3O9ZA 2P4QA 4CQMD 2IEBA 3FR7A 3AM5A 1CEQA 3ZU2A 4HFRA 2UAGA 4BL5A 2EHDA 3D3WA 2H6EA 2VWQA 3HDYA 2O50A 2V7PA 3EYWA 4FFLA 1G1AA 2IYPA 3GAZA 2YY7A 1ADGA 1QKIA 4GH5A 3WG9A 3D7LA 3ZWNA 2VYVD 2XXJA 3L77A 3V1UA 1GD1O 3PPIA 5AXDA 1LSUA 3HN7A 4AJLA 1WWKA 2RHRA 1ID1A 3UFXA 4CR6A 3OJOA 3FF4A 3H9JA 3PYLA 4DLAA 1ZCJA 1Q0QA 1MG0A 5L40A 3PHLA 3U4CA 2EEZA 1FDVA 4W4TA 2GGSA 3T4EA 2AG8A 1HDXA 4OL9A 1DAPA 3C3XA 1GU7A 4HKTA 2W2KB 4BB5A 3LZ6A 5A02A 2FPIA 2PGDA 5BNFA 3AI2A 5JAIA 1D1SA 1Q1NA 1GCOA 3P2YA 4XYGA 4YA6A 1ZSYA 4PZCA 3GG9A 3ZV6A 2PKRA 2OL4A 3CKYA 1LDGA 3FHLA 4PCVA 1N5DA 1PJTA 3S1LA 4TROA 4M49A 3DBHB 3VAZA 3BMQA 5HM8A 2ZCUA 4Z3KA 4M54A 3I9JA 3S55A 1EVIA 3IUSA 1I0ZA 4GLOA 1ONNA 2PH3A 1DDOA 1G0OA 4RF2A 2HAEA 4WCFC 3G49A 4J2OA 1WDMA 2VRBA 3L4BA 4L9RA 2HMVA 4NG5A 4F6CA 4FJ0A 1Z73A 3H9EO 3MTJA 2X0IA 3ZWBA 5KKCA 1IE3A 1GCUA 1YO6A 3KTDA 4KDEA 4NQZA 1WDLA 4OKNA 5TX7A 4JNKA 3E5MA 4QFDA 4BNHA 2CDBA 1K6XA 4BNLA 3KLMX 4FFPA 5T8KC 1KS9A 2FY8A 5TJHA 4ZQBA 1KY4A 4IBOA 1HLDA 1QYVA 3PQDA 1ISGA 2ZYDA 1ZZEA 3ETEA 4BQRA 3IJPA 3IMFA 3FWNA 2X8LA 4CM9A 2DM6A 3O4RA 2GN4A 4DL9A 3EVNA 1HF3A 4ZRMA 2DUWA 3OSUA 4RDHA 3WYEA 1A5ZA 3O38A 3OHSX 1U5AA 1IPFA 4UUMA 4XYEA 4GX5A 1GAEO 2J5KA 3NKLA 3SC4A 2PFGA 3NGLA 2PV7A 1F8GA 2WMDA 4OAQA 3F9IA 2CUKA 3U4HA 2C59A 2ET6A 3TL2A 3ZU5A 3GVPA 2VYNA 1PGQA 1NVMB 3BMOA 3JTMA 4W6ZA 1OOEA 4U0KA 3RFVA 2CNBA 4KUHA 2HUNA 1ONOA 1ONPA 2TMDA 1G6KA 3S8MA 2JAPA 2GO1A 2F1KA 4BNIA 4BO5A 2ZB4A 2ZKLA 1R37A 5DBFA 1P1FA 4OSOA 3ZW9A 6ADHA 2WD7A 3P19A 2AE2A 4MP6A 1LDYA 1X7GA 2HRBA 2RAFA 3STHA 1N92A 2C82A 2OO5A 3COSA 3GEDA 2Z1NA 4TRNA 5CPFA 3RROA 4TSKA 4K28A 2O2SA 2VT2A 5T57A 2LDBA 4Y6PA 1O95A 1TA4A 2IDZA 2J5RA 5DP1A 4CLOB 2GZ2A 4YYZA 5BNTA 5G0UA 4AJEA 3VH4A 5TIIA 3KLPX 2XPCA 2BF7A 1E7QA 3MJVA 4BGIA 4RVSA 1VJ1A 3JV7A 3FNEA 2BMAA 4I5DA 1YOVA 4RVFA 4E5NA 3BMCB 1TB4A 5AXAA 5TT0A 3EK2A 3ANLA 4ZGWA 3HSKA 4MVJD 1WZIA 1R4NA 1K89A 1DFGA 2H5LA 2RBEA 3F4LA 3VKVA 4DGSA 5HTOA 1A72A 5DCWA 5KJCA 2BFPA 3PYMA 2AMFA 4XCVA 4XZ3A 1PJLA 1BWSA 2WD8A 4WASA 2I5PO 4YT2A 1U2GA 3JQ6A 5CHEA 2ZQZA 5F5LA 3NEPX 5KKAA 3G17A 3FNHA 5CDYA 1V9LA 1OBFO 3QVXA 4DPLA 4ALKA 1KC3A 3GQVA 3GVCA 2WJPA 3UW3A 4F6LA 3GK3A 1JAYA 3WICA 2DPHA 3AM3A 1XR3A 2HK8A 3C1OA 5EL0A 4H15A 4P38A 3JQGB 3AFNA 1VI2A 3INGA 3S2IA 4E5MA 5TJ9A 1GQYA 2OOSA 2FMUA 1X0VA 1Y9EA 3AM4A 4ALLA 1ZK3A 3EC7A 1BVUA 3NT2A 1SB8A 3LC7O 2EGGA 2GPTA 1PJQA 2FR1A 4QECA 2WDZA 3F4BA 1A9ZA 1NX6A 1Y9AA 4BO7A 1HSOA 1V3TA 4OIMA 4CM4B 2AA3A 3P7MA 3HHPA 3WYCA 1YWGO 3ANMA 1K0UA 4IDAA 4RVHA 2DBRA 5TNXA 4IJUA 4YJFB 2XOXA 2NU7A 4IDCA 3NDIA 3LYLA 3LT4A 2Y1DA 2B83A 2QG4A 3UVEA 5ICMA 5IF3A 3D4PA 5MGBA 3IDSA 1BDMA 3U4IA 1O6ZA 4P8RA 2Q1WA 5JCJD 3WR5A 3RAJA 2PWZA 2X0RA 3DFUA 4R1UA 1ZSVA 4CMJA 2JD0A 1WAMA 4YJGB 1OI7A 3OEYA 3R1IA 1HETA 3S2EA 1NQ5A 1CRWG 3PDJA 1ZVMA 3PLNA 4W82A 1N1EA 2ZJ1A 3AI3A 4EJ0A 1A7AA 4MVJI 2JD1A 3AJRA 1LNQA 3RCBA 4GWKA 4LISA 3ZWXA 2DPGA 3QV1A 3EZYA 5L7WA 5G4KA 1EMDA 2W98A 2Y67A 3UAGA 4E2XA 3CIFA 3FN4A 4RVDA 1NHGA 1NASA 4II3A 1DFHA 1LA2A 1T2EA 2R2GA 1UXJA 4OQYA 4XX0A 2AQ8A 3QE3A 2Q50A 3QWIA 5IXSA 1FXSA 4R3NA 1E5QA 1IUKA 1I2BA 2EGHA 3X2EA 4QXMA 4DQUA 4BVAA 4IZHA 5ITWA 4IQ8A 4L4XA 5EQDA 3V2HA 1F14A 3GRKA 3V2GA 4DC1A 3MOIA 4J90A 3A9WA 5G4LA 4AL4A 3PWKA 4YAIA 3RFXA 3ZWOA 4HP8A 3I83A 4IIVA 5EN4A 3OIDA 1H6DA 3I6QA 3DZHA 2Z1MA 5FYDA 1R12A 3KEOA 5COAA 4WLFA 4A73A 1O89A 3L9XA 3GHHA 1Y5MA 4Q9NA 3ZV4A 1E7SA 1T1RA 3AOEA 4R01A 4L76A 4Z3DA 1EVZA 3GGOA 2POQX 1E77A 1DIHA 4DQXA 2J3JA 4B79A 1A7KA 3TZCA 3K96A 3W1VA 4PLYA 3F47A 4J9VA 4WEQA 1DPGA 4E6PA 1NFQA 1WDKA 3K73O 3GVHA 4YB8A 5IDXA 4HXYA 4LMPA 4I5FA 4PIVA 3ZNOA 4FGSA 3RQSA 4WOKA 4LK3A 5A4DA 2ZB8A 3WDSA 4FIZA 1OC2A 2VWHA 1X0XA 2YV3A 1HDYA 1F17A 4RPLA 3WGHA 1SAYA 3KXDA 3EMKA 1NPTO 2BHLA 2YJZA 1HRDA 1I10A 3ETDA 3BHJA 3L0DA 4CLHA 3U3XA 3JQ7B 1UZNA 3GNQA 4UUNA 4NH4A 3TFQA 3QIVA 2Q3EA 3I4FA 2QHXA 2X6TA 1I32A 1VRWA 2PNFA 4MVJG 4XJTA 4J91A 4PLGA 4DQVA 1HDOA 2JFHA 3RUFA 4CODB 3DBLA 2GN6A 5JAQA 1D3AA 3VDRA 3ZZNA 4BGEA 2BRUA 4NMHA 2NACA 4U5QA 1KETA 3OQ1A 2YV1A 2GERA 3L4BC 2AXQA 2P68A 4GWGA 2BLLA 1V0JA 4NJMB 3WJAA 4B3HA 4CMBA 1LLUA 1NQAO 5L45A 4KWHA 1LRLA 1NTOA 1VC2A 4JQCA 4MKXA 4A10A 3FI9A 3QWBA 4PN3A 3OJFA 3UF0A 2NQ8A 3ZW8A 3M1LA 4PG8A 4R1NA 3LT2A 3S2GA 4EJ6A 4CMCA 1BXKA 2O48X 2I67A 5JPIA 3CSDA 4GLLA 3ZGYA 4R5HA 4CMEC 4YAGA 1X1TA 1NAIA 3DHNA 3VHRA 2C29D 5KJFA 2C7VA 3MEQA 4IM7A 4CM9D 5G0VA 3WGTA 2I99A 2O4CA 1ADFA 5BSEA 1CJCA 1CQIA 2ILTA 5JDCA 1Y8QB 3JQAB 5CPBA 4TRMA 3T7CA 3I9NA 2O3TA 4KMSA 4RLHA 1YRLA 4G5HA 1MXHA 4WLUA 1VL8A 3FSRA 3WXBA 2A9FA 4I08A 1VL6A 3LVFO 4D46A 4HNHA 2WM3A 3E1KA 2Y93A 4CLRB 1YQGA 1ZW1A 4IQ0A 4EW6A 1EK6A 4DLLA 5CEFA 2VYND 3DWFA 4JK3A 1ORRA 4AJ1A 1WP4A 4OKIA 4BKOA 4PLVA 3E5RA 1E7RA 1UAGA 1KVQA 3L07A 4B7CA 2UVDA 3LDHA 1CYDA 2Q2VA 3AY7A 5G2OA 4CM4A 2G0TA 1W73A 5I7EA 4PLTA 1KYQA 3WBBA 4URFA 4YJFA 5F3RA 1OMOA 1VJTA 5JSFA 2BGLA 5CDTA 3DZJA 3SC6A 1FDUA 4GKBA 2Q1UA 5KVCA 2VZ8A 5DZSA 3ETGA 4YJGA 3C1TA 5MDHA 5IJZA 4ND4A 2V6GA 3KZVA 5F1PA 3KO8A 1JU9A 4F3YA 1EBUA 1CERA 1KEVA 2O7QA 1LSJA 4E2YA 3AUSA 1B8VA 3DOCA 3JSAA 4YTEA 1GFSA 3JYPA 1F8FA 3N74A 4YQZA 1XYGA 5L53A 3GGGA 1KEPA 2NVUB 4KUEA 2VT3A 2UUOA 3MZ0A 3GDOA 4FOOA 1EFLA 2NTNA 3DMTA 3MJCA 4CUJA 5A04A 4MKZA 1NQTA 3EUWA 1SC6A 4A2CA 4RLSA 1ENYA 4N5NA 1L1FA 2GNAA 3LU1A 3PHJA 3PWSA 5TS3A 1E6WA 2GF2A 1JWAB 3DOOA 3L9WA 4GX1A 4R4JA 4A5OA 2D3TA 3PFFA 1FF9A 1VM6A 3OJLA 4AJHA 3K2BA 4PG6A 4EJMA 4NBTA 4OXKA 4FBGA 4D3FA 5BQFA 4YR9A 1PWZA 1TT5B 1SO8A 3MJEA 4NU6A 2Y1EA 1N9GB 4FC7A 3CPSA 1U3UA 1CIVA 2RIRA 1E0DA 3JYNA 3LT0A 3MWDB 2NUAA 2ZB7A 3PEFA 2B36A 4HADA 4YT5A 2CZCA 2D4AA 1E3WA 3RC7A 2B4RO 4HWKA 3QWHA 1EDZA 4TVOA 2QIOA 2AG5A 1ZSNA 4A0SA 4DMMA 1B7GO 4BNVA 5DNAA 4IJKA 5BNIA 4W9NC 4BO6A 1E3LA 2Q49A 3OF2A 4Z6KA 4OSPA 3FTPA 5CG2A 2PD6A 3SLGA 4FSHA 1QYWA 3Q2KA 4AJJA 1ZMTA 1S6YA 5A3VA 1HE2A 4JBGA 1U3VA 4WNIA 2X0JA 4I5EA 4QTZA 2HO5A 2NTVA 1O5IA 2X0NA 1SNYA 2FSSA 1DC3A 4LCEA 3C8MA 1GUFA 3E82A 2YV2A 1UR5A 1QRRA 5AXBA 1XIVA 4OHUA 3HN2A 3LC2O 2P9CA 4E2WA 5L4LA 4EITA 3NX4A 3JQ7A 3M6IA 4HX5A 1E7YA 3ASVA 3PVZA 4KDFA 1WMBA 5LC1A 3L6OO 3WGOA 1V35A 5A5EA 4J3FA 4IMPA 3NRCA 1H9AA 1O8CA 3PWZA 2VHYA 3PLRA 3OFSA 4JJGA 4LGVA 2Q1TA 2ZK7A 1WXDA 4ND5A 3U0BA 1FDWA 2R00C 1Y7TA 1ZK4A 1I30A 2VHXA 4GGPA 4ZVVA 3ZV3A 1VSUA 3UUWA 2NADA 4NJMA 1OFGA 2HMTA 3RBXA 2BGKA 4ZA2A 3T4XA 2IRWA 5ILOA 3SEFA 1IB6A 4BQPA 4XRGA 3GY0A 3H5RA 5CG1A 3JQ8B 1A71A 1LDNA 1HYEA 3GZNA 2CY0A 3DBRA 1L7DA 1Y6JA 2WTBA 3BZUA 1GDHA 3V1TC 2C2YA 3GVIA 4JBHA 4MVJP 3H4VA 1YXMA 2W8ZA 3H9GA 1ZKMA 2VTDA 3GZ4A 2X9NA 3KEQA 4N54A 4W99A 3NAQA 1NP3A 5DF1A 5KIAA 3ZN2A 3AOEC 1KERA 4HUJA 4DYVA 1UP6A 4XIYA 1UZMA 3RVDA 2P2SA 4EEXA 1T4BA 2IXBA 2PK3A 3JQAA 1NFFA 2CSUA 2AHRA 1Y81A 3AOGA 1ZJZA 5TLSA 1OAAA 5L3ZA 1DIAA 5T6BA 1DJQA 3AFMA 4CV3A 5TRTA 1PGOA 2GZ3A 2H1SA 3NTQA 4CLRA 4R9SA 1DC5A 5GZ3A 5CAEA 9LDTA 4TZTA 4EYEA 3W6ZA 2JCYA 2BKAA 1E1NA 2I6TA 2IZ1A 3CZRA 1CDOA 3QHAA 5ES3A 1BDBA 1JKFA 3QVOA 2HMSA 2YHUA 1U7TA 4JX8A 1UXHA 3ZHYA 3ZWWA 2I65A 1IYZA 5ENVA 5EMHA 3PK0A 1DOHA 3WGYA 5DOVA 5I8ZA 1X7DA 2AQHA 4G65A 2B0JA 3DBVO 1GPDG 2UUPA 5TF4A 5JAZA 1U5CA 1JA9A 2B69A 3WSWA 1BSVA 4E2ZA 2B4QA 5DN9A 4BNZA 4Y6SA 1DLJA 1NHWA 4L4SA 3WIEA 1NAHA 4XYBA 1E92A 2OBYA 4BNJA 1ADBA 4L8VA 4R3WA 1M75A 3WJ7A 2O3QA 3HB5X 4NBVA 1BGVA 4DMLA 3F1KA 2YFHA 1V6AA 3FR8A 2GR9A 2HJSA 4Z0TA 1HYGA 1LLDA 3A1NA 3JQ9A 1CF2O 4I1IA 1PZHA 1R0SA 4TRRA 3UN1A 1SEPA 1EFKA 1JDJA 1EDOA 4LSWA 1K2WA 5K9ZA 2NVUA 2NU8A 1F12A 4EUHA 3LQFA 4EUFA 4M89A 5C7IO 5KJEA 4J49A 5LCXA 5L95A 3WBFA 3D4OA 3KSZO 4PRKA 4CLEA 3D4NA 4J0EA 5CEEA 5EERA 1PJCA 3AUAA 3TSCA 1P1HA 4EZBA 1UAYA 4IDBA 3H7AA 5K0ZA 4RVGA 3IS3A 1PQUA 3KB6A 4P4NA 5DCUA 5JLAA 1Y8RA 5EJ2A 1HDZA 4PG4A 3VVBA 1R15A 2GDZA 2EJWA 1ZMOA 3JYOA 4CM5A 5JDCC 2PD4A 2Q4EA 1N9GA 2XAAA 3ZWCA 1I01A 4CL3A 1F06A 4FS3A 4LVUA 5L51A 1LRJA 1P44A 4HFNA 1N2SA 5JW6A 4DIOA 3B1JA 3BMNA 3I3OA 5IN5A 3E03A 5JYEA 3FCOA 3VZPA 3FNGA 1PL8A 3HG7A 4EDFA 4YPOA 3AWDA 3KSUA 2HJRA 2HMUA 1PTJA 1O94A 2Q2WA 4N5MA 5GY7A 4MDHA 3GVXA 2OXIA 1UXKA 1I8TA 1EEHA 3PHIA 1GQ2A 3PGJA 5FF9A 4YJHB 5KJ1A 4ZHSA 4AJNA 3U5TA 3IKTA 4QUKA 4BO2A 4B8WA 4DA9A 4XQGA 5HBRA 3HDHA 1YB1A 4XB2A 1KVUA 3QVSA 4KOAA 4NU5A 4CMAA 1JAXA 5A03A 2QZ9A 1C0PA 3LSYA 4J2HA 4U7WA 4ZQEA 1M76A 1Y5RA 3KSDO 1HDCA 1DXYA 2X9GA 2B5VA 3ASUA 4PG7A 4I9NA 3TZHA 2NVBA 5AOVA 4LCJA 1LQTA 5HS4A 4J1TA 1H5QA 5JNLA 4CMIB 2C0CA 1Q0LA 5ILGA 1GYRA 1DRVA 1LDMA 1ML3A 5U1PA 3WGIA 3O8QA 4AJKA 5BSGA 3C24A 4J1SA 4CQMB 1R4MA 3ONFA 2XXBA 3UKOA 1XKQA 1Q7CA 2VN8A 4LW8A 4UVEA 4RL6A 3BTOA 3BAZA 1E7WA 3D1LA 3ROPA 1YL5A 5IZCA 3DMTC 1JW9B 1P9LA 4C7JA 3QA9A 1IOLA 2YHIA 3JQBA 4Z9XA 3SVTA 4AG3A 2JD2A 3MTGA 5FWNA 3RD5A 1SEVA 1T2FA 3IP1A 4BB6A 1PJ4A 2FOIA 5F1OA 4CV1A 2E4AA 1XHLA 1P3DA 3GAFA 3HDJA 2IXAA 2BI8A 1HDGO 2PZLA 3ZHZA 8ADHA 2B4TO 4H7PA 3PHGA 3E6AA 3GNTA 4O63O 1NYTA 3OECA 2NU6A 2GSDA 1I33A 5T67A 4CM8A 4IDGA 2CF5A 4GX0A 2FWMX 3FNFA 2DAPA 4GBJA 1H0KA 4ND1A 1LC3A 3I9OA 4PG5A 1FMCA 1ENOA 4BMNA 3PJGA 4D42A 2C5EA 5GZ1A 3S2FA 1DRUA 1BW9B 4J7CA 9LDBA 4M55A 3ICCA 2CVOA 1VPDA 3RWBA 5BSFA 4FDAA 4CM3A 3INRA 4ILKA 4M1QA 3GUCA 4BV9A 1QLJA 3F6YA 5LDGA 3FRJA 3K5PA 3WFJA 3TJRA 3OIGA 4DTIA 2NU9A 2Y1OA 5CP8A 1V3VA 3PP8A 5DT9A 4WCFB 3NDRA 1BMDA 1ZK0A 1Q7GA 1ZO8A 3E9QA 3RU7A 3VPHA 4MVJH 1QV7A 1YL6A 2X9VA 3NT5A 2AEJA 2EKQA 1RKXA 4N18A 4WLOA 3VH1A 5BSHA 1PJ2A 1W0CA 3HZZA 1RM5A 4JROA 3GA0A 4NJOA 5KNLA 1XDWA 3LC1O 1D7OA 1R0KA 3TPCA 2ZTUA 1K6IA 4G2NA 1N8KA 3GMDA 4AFNA 4AJIA 3K31A 1AE1A 4M8SA 4NNJA 2W90A 4IIUA 2X4GA 3VPSA 3QQPA 4BOYA 2W2KA 2QX7A 3DR3A 4BGVA 3GC6A 3CEAA 1I5RA 4CMHA 4OM8A 4B4VA 4XGIA 3CE6A 2PZKA 3D3EA 3QVTA 4YCAA 7MDHA 4HY3A 1M2WA 1D4FA 1HKUA 2HRZA 3OQBA 2QZZA 4XQ9A 2EIHA 1FDSA 3Q1LA 1MUUA 3U9LA 1EVJA 3DBHA 4Z0PA 3WTBA 4BKUA 7ADHA 3SLKA 3RASA 4RO0A 3V1YA 2J3HA 4QO7A 2DT5A 4DVJA 8LDHA 3H6KA 4YWJA 3KRTA 4NBWA 2EKPA 3OIFA 3TL3A 4BKQA 1ULUA 4Y98A 2Z5LA 4EGFA 2OP1A 1DIRA 2E37A 3HWRA 2VQ3A 4UVIA 1WPQA 4LRSB 3LLSA 4IS3A 5FEUA 5JCXA 4P22A 2CMDA 3HDQA 2GN8A 3FPLA 1QYXA 5LDHA 3CZMA 3FTNA 1XSEA 4YDRA 4PLZA 4JGBA 1Z7BA 4AJ4A 3GFGA 3OH8A 3JQAD 3GH3A 3GMSA 2VUTA 4AJPA 3HB4X 4Q3AA 1DRWA 1HE5A 4Y8VA 4DPMA 4JLWA 4WKGA 3RC9A 4M86A 2X1HA 4WLNA 3WWYA 4OJNA 4Z9FA 4Y67A 4L0QA 2PZJA 3WGQA 4JP2A 3BYZA 4C7KA 1H94A 4CLXA 4BO0A 4U6QA 2O3SA 2NLOA 3H9QA 3Q2IA 3DDNA 1XLTA 4D0SA 4I8XA 2PGJA 1PL7A 5EIOA 1NXQA 2J6IA 4AJOA 3U4DA 3V8BA 4CPDA 4LVCA 1VLLA 4YJHA 3JQFA 3G3EA 1Z74A 5DDIP 1GQQA 2HDHA 3VPFA 2HLPA 4J1QA 1TXGA 2Q1SA 1H2BA 3DAPA 5B4UA 3EGOA 5T64A 4DPKA 3QJ5A 3RBZA 2IZZA 3QSGA 1YQXA 1P1KA 2AEMA 1KY5A 4R68A 4E0BA 4L73A 1V3UA 1W6UA 3G1TA 4CV0A 4BNWA 4MVJM 1I3MA 1U2DA 4OYRA 3ZWYA 4KZPA 1YDWA 1Z45A 4XYLA 2WYWA 1PGNA 5ITVA 4BO1A 4YACA 5JBIA 3VPGA 3PFWO 3ZHBA 4KQWA 1UXGA 5L4SA 2BFAA 3JQ9C 2UYYA 2Y68A 4K26A 1P33A 3ZDFA 3NTRA 1P1IA 3M1AA 1I3NA 1HEUA 5ICSA 2IYOA 2OP0A 3PHHA 3GN2A 3A28A 2DUUA 1C0IA 2YQ4A 3KOUA 3WLEA 5AXCA 4BGUA 4DUPA 4CLOA 4E13A 1WLYA 3V5NA 3PJEA 3Q6IA 1L7EA 4IINA 3PQEA 4D43A 4RV9A 3NUGA 3IP3A 4RPJA 2P9EA 3WMXA 5HS6A 1HZZA 3BMCA 2OZPA 2UV8A 3PXXA 4UULA 3DZKA 4QFCA 3H5AA 2O7SA 3RU9A 3QWAA 1HLPA 1HTBA 3RIHA 2QQ5A 4FPXA 3UXYA 4Q3BA 1C1DB 3GEGA 4GPD1 1MX3A 3MJTA 1PWXA 1KC1A 2GYYA 3I52A 3WS7A 3MJSA 3PZRA 1P45A 5DP2A 1ENZA 3JQGA 1GYPA 2Q2QA 1DAOA 5I9MA 2NV6A 2BD0A 3ZWMA 1PIWA 4UVHA 1JN0A 4XQCA 5CDUA 4R16A 3GRPA 4GKVA 1ZEJA 3WMWA 1JKJA 1JQBA 2X7HA 3SXPA 3OP4A 4TMFA 4R54A 5KWEA 3FD8A 4XB1A 5BT9A 3RFTA 4ZU3A 1N7GA 1LSOA 5TT1A 1J6UA 2D5CA 4E5KA 1YJQA 3L6DA 4FJ1A 2VHWA 1MB4A 5A06A 2G82A 3W8FA 2E6UX 1YH3A 3I9MA 1PSDA 2HKIA 2VHVA 1JTVA 3ICPA 2W2LA 3KYBA 3U09A 4UEKA 3F46A 1B8PA 1KIFA 1J0XO 2OFPA 4JJFA 1MFZA 1PEDA 5IZCC 4JJIA 3JD2A 1HWYA 4CUKA 2C5AA 3Q9NA 4KWIA 2ZIZA 1PS0A 1T1SA 1Z7EA 3JQBC 1ZNQO 5L4NA 4QX6A 1GZ6A 3UCXA 4RF3A 3MCVA 4TZKA 5K6AA 5KOIA 2FPGA 4UEOA 5DCYA 2NNLD 5IXYA 3CH6A 3I4CA 3P2OA 2I76A 4NI5A 4YAKA 2ZJ0A 2VRCA 3KYDB 1A4UA 2DU8A 2GUGA 3JD4A 3PGXA 4GAEA 4J7UA 1W8DA 2WSBA 3LF2A 1T24A 3AU9A 3PZBA 3OMLA 4AICA 1MP0A 1LEHA 4O0LA 3IQDB 3LT1A 1PS9A 4I5GA 1PR9A 1ZJYA 4GX2A 4HV4A 2GZ1A 4YJDA 3GF4A 4YAEA 4WCDA 4RGBA 1E3IA 2WYVA 5KVQA 3C7DB 1DIBA 3SJ7A 1GYQA 3RUAA 2D0IA 4J7XA 4WJZA 1U3WA 2WE7A 1YBMA 2VOJA 4FN4A 4OXYA 2G76A 4B8ZA 1EZ4A 1T25A 1LJ8A 1O9BA 1U8FO 1YGYA 2PKQP 2P5UA 3JQEA 3QWFA 3IJRA 5T5QA 2VNAA 2HSDA 1C3VA 3BMQB 4AJ2A 1ZIDA 1AXEA 1UDAA 3ONEA 4MVJE 4YT4A 1GV1A 1SMKA 2PD3A 4IQGA 3A4VA 1H2HA 1XQ1A 2JAHA 4H16A 4NZ9A 4GI2A 3HADA 1H93A 1PJBA 4R69A 4ZJUA 4BIIA 2Y05A 4ZRNA 3TOZA 1MA0A 4WEOA 1E7MA 1M67A 2X86A 1E1MA 2YUTA 4R1TA 4BHTA 1IZ0A 4JCOA 3IOYA 3ADOA 4MP8A 3VZRA 3UCEA 2Y66A 2OUIA 1WVGA 4IJWA 5C37A 1ZUD1 3D64A 4DRYA 5I7FA 2I3GA 2ZB3A 4J6FA 3O03A 2AQKA 4NBRA 1M6HA 3M2PA 3ZI0A 3BTSA 2ZYAA 3ZNNA 3NT4A 3E48A 2FR8A 1ZBQA 4M87A 4U8GA 4A03A 4PLPA 4G81A 3JQCA 4RQTA 2O2YA 5JO0A 5ENDA 1U3TA 1DHTA 3VTFA 3W8EA 1UP7A 2V6BA 3TQHA 3AI1A 4JIGA 1CQJA 4ALJA 2GRAA 1DBVO 5A3JA 1E6UA 3ADPA 5TC4A 4ZN6A 5ER6A 5KTKA 3MJ4A 1RYEA 3DOJA 4GQAA 1WMAA 3BXXA 1P74A 1ZK1A 2EP5A 2EW2A 3PJFA 2CVQA 3JD3A 4RZIA 1MFPA 1FDTA 4D79A 4A7PA 3FBTA 3R3SA 4GGOA 1J49A 2X23A 1DC6A 2O3JA 4BNNA 5G0TA 4LMRA 5L7TA 3CTMA 1YB5A 4U0JA 2WD7B 3T7EA 2QYSA 3ZWPA 4BS9A 4XIJA 2YDYA 4ONEA 4RZHA 3TZQA 2YW9A 3V2UA 5JYDA 1HDRA 1PS8A 1RM3A 4RCVA 3OA0A 1Z6ZA 4R1SA 2NQTA 3GOHA 1XU7A 1D8AA 3CXRA 3HE3A 1DO8A 1YJ8A 3FBGA 3HJAA 3TN7A 3NTOA 2I3AA 5G0WA 3RJ5A 1C1DA 3NDJA 3E18A 1B3RA 1UDBA 4WUVA 2EW8A 3TDKA 4GVXA 5I9LA 1EE9A 5F5NA 4KUGA 5ADHA 2EERA 1GTMA 2IE0A 1Y8QA 4TKMA 3JQFC 4S1VA 4BNMA 3TOXA 4E33A 2IODA 4CQLB 1LQUA 1GY8A 3OBBA 2DKNA 4ESOA 5I7VA 4RQUA 3WFIA 1AGNA 1BHSA 3ROKA 2O4UX 3OJ0A 2B5WA 4IXWA 4BUCA 3DTTA 4XKJA 4K9DA 1ZH8A 1UXIA 3GNSA 4F45A 3R3JA 3ROMA 1ISFA 4BNTA 4DBVO 3K2EA 1Q7BA 2GD1O 3GR6A 3JQDA 2ZATA 4ZQGA 4MVJF 1PU2A 3GN1A 3I1JA 3WGGA 3WYBA 3OJEA 4MPDA 1HYHA 2Y1FA 5C5IA 1RM0A 1XCBA 4B4WA 2PR2A 3DAFA 2A4KA 3AY6A 3PDUA 1MXFA 1P0FA 3WX0A 3KYCB 3W4JA 3BA1A 1JVSA 1QXSA 1EQUA 3DHEA 4OGWA 1NR1A 4BO8A 5COBA 3W4IA 5AVOA 1B26A 3ZHXA 2RH8A 1SOWA 3SBOA 1KBZA 1ISIA 3DB2A 4J16A 1ISHA 4D3DA 3R6DA 2R6JA 4ZQHA 4XRRA 3AU8A 3KYDA 2D59A 5FI5A 3JCZA 4J4TA 4YRDA 4II2A 3U62A 4XWYA 2O23A 1I2ZA 1SPXA 2Q46A 4O1MA 1LDEA 4XQEA 1H6AA 3VH2A 4I9HA 3VPXA 1U9JA 3R0IA 4LSMA 2FP4A 5JMPA 1LLCA 1B16A 4FC6A 5J23A 4WGGA 5IDQA 1E1KA 3DHYA 1YBVA 3IUPA 1WZEA 4WNCA 2JFGA 1U4SA 4FGWA 1E3SA 4K1LA 5JS6A 2G17A 3EVTA 1XG5A 3Q9UA 5DBGA 1K5HA 1K3TA 3PQFA 4PLHA 1P0CA 1C1XB 4WECA 3VC7A 4FFRA 1DB3A 3ZWVA 3UH1A 1E6EA 2OORA 3KM0A 3WIDA 1TT5A 2QRKA 4RF5A 4Y6RA 3UHAA 4CV2A 2BI7A 4D41A 1LSSA 2FPPA 4Y9DA 5U4QA 2PA3A 2OHXA 4Z9YA 1U7HA 5G4KB 2JL1A 1A27A 1RWBA 3BHIA 3CINA 4L74A 3UGKA 1XA0A 2J3IA 3IIEA 1DSSG 5U9CA 2Y0DA 1LRKA 1ISMA 1P1RA 4XYMA 3RUDA 5CEJA 4PVDA 1UDCA 4I9UA 3C7AA 2QYTA 3ITDA 4J9UE 2WWRA 3ZU4A 4NIMA 1ZFNA 2E49A 2V6FA 3B20A 2FZWA 3L6EA 4R5MA 3PYXA 3NGXA 1R66A 1NWCA 4MO2A 3ZWAA 3AW9A 4NFYA 3PI7A 3QY9A 2HQ1A 2RCYA 4TRJA 3HNPA 4ALMA 1BG6A 4OOFA 1T2AA 3GPDG 5IZ4A 4CMEA 1MC4A 4PLWA 2P5YA 2W2LD 1QYDA 2CFCA 1MV8A 2JCXA 2VZ9A 2H9IA 4PGFA 1MG5A 3DZFA 4BMVA 4ROSA 2GASA 5CDGA 1JVBA 5K6AC 4PLFA 3ENNA 3C1AA 1EVYA 2YYYA 4JP3A 5C3MA 1KVTA 1E1LA 1QV6A 1MC5A 2V65A 3GFBA 3JYLA 2TMGA 2VRCD 4WE3A 5IG2A 3WSVA 1ARZA 2NSDA 4Q3DA 3ABIA 3ORFA 1T2CA 2D2IA 3WTCA 1HSZA 4B7UA 2RHCA 2YDXA 3EHEA 3ANNA 3GT0A 2BELA 3HQ4O 3N58A 5DULA 1PZGA 3KETA 2C2XA 1EE2A 2JJYA 4BKRA 4TWRA 1PQWA 3Q11A 2H63A 2NTJA 5B1YA 3AY3A 3JQ8A 4CL8A 2P4HX 4IGFA 2WYUA 4D44A 3EY4A 4R51A 3PIDA 2BGMA 4XEHA 1SBYA 1BXGB 2NWQA 5H83A 3M2TA 1V8BA 5KVSA 4GL4A 1NFRA 5IDWA 4CMKA 2XF8A 1XELA 5JDIA 4FOSA 4BO9A 1QLHA 3DBLB 4OH1A 2DC1A 3INTA 3A06A 1DFIA 4JN6B 4LN1A 5A9RA 5JY6A 3D5TA 3UICA 1F0YA 1QP8A 4CM1A 3B1KA 1QR6A 3WGZA 2DVMA 1U8XX 2EKLA 1SCUA 3K8ZA 4MP3A 4OO3A 3WQQA 4YXFA 1IULA 2B37A 2CD9A 4FJ2A 5B37A 4NBUA 3UOGA 4CQLA 1Z82A 3OQ6A 4DC0A 1YONA 5HA5A 5TSDA 1Z75A 4BNYA 4BMSA 4IJVA 1BVRA 5GMOA 1X13A 1I2CA 1ENPA 4F46A 1VE9A 1GUYA 1KEWA 2Y0CA 4FFNA 4A26A 3ENKA 3NJ8A 1NWHA 3FWZA 4N7RA 2OMEA 1PJ3A 1S7CA 2VHZA 3F3SA 3H8VA 2HK7A 3MOGA 3ZV5A 4MINA 3RC1A 4NFHA 1NVTA 4YEDA 1FJHA 3ROQA 1I3LA 3VTZA 3F5SA 1PR3A 4J1NA 4FFOA 4RDIA 2EWMA 3IAHA 3RUIA 1X14A 5COQA 2RH4A 4ND3A 3ZH2A 2YFQA 3NV9A 3K6JA 4MOWA 4FW8A 3GPIA 3QRWA 1AN9A 3H9UA 1VL0A 2QW8A 4XR9A 3PIIA 1R16A 2E48A 2DTXA 1B0AA 5A5FA 3LF1A 2NVWA 1C0KA 3I9KA 3KYCA 4YVFA 4EI2A 4UUPA 4GMGA 2DFVA 3N7UA 3W4KA 2UDPA 5I8WA 4WK6A 2HK9A 4D0RA 1I36A 3HFSA 2EXXA 3KVOA 3DMYA 3DONA 3H2SA 3TNLA 5A9SB 1EK5A 3DC2A 3DO5A 5IDYA 5JY1A 4W9NA 5HRUA 2VZ0A 2HU2A 5JMWA 1HT0A 4K6CA 4PLCA 5KCZA 4IUYA 2BFOA 3AUUA 3OETA 4MKRA 4XJSA 1YB4A 4K6FA 3SJUA 4X54A 4DIBA 2JCVA 1M6WA 3FPCA 4R41A 1UUFA 2EV9A 1YKFA 2O3UA 1AHIA 2EJVA 3H2ZA 3D5QA 1PGJA 2WE8A 3CUKA 5AQ1A 1UZLA 3U49A 1TI7A 4ZICA 1DIGA 1NVGA 4XDZA 2LDXA 3VKUA 2EF1A 5DOZA 1UH5A 2ZTLA 1C1XA 1MGOA 3WOHA 1GV0A 4MIEA 2VWPA 1UJMA 2J5QA 4E32A 1B3BA 3IC5A 4J43A 3AUTA 3VDQA 2AQIA 3IKVA 2VCYA 1Q2XA 3TZ6A 1E3JA 4IS2A 3MWEB 3RJ9A 3I5MA 5THQA 3GDGA 2CVZA 4YRBA 5A05A 3RUEA 2R00A 3K30A 4AVYA 2J8ZA 4RF4A 4IDEA 4B4OA 3ST7A 2X5JO 4E30A 4DLBA 3ULKA 4KP7A 4J4BA 1VKNA 3GHYA 1J4AA 1ISJA 3QVWA 3E8XA 3KHUA 1PZEA 4Q3CA 1BTOA
chains in the Genus database with same CATH superfamily
4RCZA 2IYXA 4NPCA 1KKMA 5EUCA 3QLUA 1CQZA 4BO4A 3KX2A 1EVLA 4JXXA 1U2PA 1VSBA 3C8DA 4PNHA 4F5DA 4HYYA 1NP7A 1M0EA 4AZVA 3DCYA 1DJNA 2PRKA 2PY6A 4JUIA 1A97A 2V5VA 3PNLA 3PDIA 3DPSA 2O6HA 1VCNA 4DY6A 4DY4A 4DIFA 2Y1GA 3FSGD 3R8XA 4E5DA 1THGA 4AB1A 2C7GA 2QXUA 1O0SA 4P86A 1KYWA 5DNUA 1CVRA 1KVSA 3K0FB 1K97A 1WF6A 2DFDA 2ZQ5A 4S1TA 3FHCB 4LJKA 1UPAA 3KT6A 2GK6A 3MTIA 1SB9A 4RNDB 5H81A 5I5GA 3GQBB 4Z2YA 5B4VA 3B6ZA 4F9FA 4GMFA 4WPGA 1H8HA 5B3AA 1GL3A 1QFXA 2WJ3A 2JFFA 2PT5A 4OBXA 2CLMB 2CYAA 2XWQA 2VSQA 4U63A 3OP1A 3FUVA 4BNFA 2Q5HA 3KSAC 3UAYA 3QSYA 1FP4B 1Y3DE 5DVZA 5JWHA 2J9RA 3CMCO 1NBEA 3A0UA 3E0XA 3VTAA 2FSHA 1LPNA 4KODA 4QXRA 4TTJA 1JKIA 4XSVA 5LM3A 1EJBA 1OXUA 2DBVO 1JAIA 3IILA 3OCWA 5U4XA 5BXYA 1G64A 2Q6KA 3FETA 4XOIA 3ZQUA 2C8LA 2WM2A 4DLRA 1N1DA 2ASEA 1ZI9A 2QZ4A 4HLUA 2GZRA 2B30A 3BTUA 2B35A 1ZZGA 2I66A 1DELA 4TMKA 1XTJA 5BNWA 3LIIA 1L7MA 2AEFA 3PUXA 3ITKA 4OQMA 1PR6A 3I09A 3K9WA 4MSUA 1XCLA 5FOWA 1E2HA 4BU1A 4EGJA 4YX9A 3UT6A 2GAIA 3ZI7A 2VYVA 2PR7A 2PKQO 4NFSA 1XU9A 3AIIA 4BNKA 4EY4A 1GFWA 4Q39A 4BXOA 1RWQA 1VJ0A 2ID8A 2OCKA 2VNSA 2WHEA 1XZPA 3FLMA 3HCRA 4R2MA 4V2IA 2PSHA 3CW8X 3I1YA 3N2IA 1WXQA 5AK5A 1MB3A 4XE5A 1M8FA 1WNTA 1WZ2A 1B0ZA 5FR1A 1A9RA 2FSVA 1UP4A 2JDID 3H04A 4YBZA 4HG2A 4KNYA 2A92A 2PH5A 3GUYA 4YJKA 2YIMA 3N0RA 1RHKA 4ETNA 5DM60 4QIHA 1QBGA 5K03A 1O0BA 4UAGA 5CNKA 2PS9A 1EUCA 5TGDA 4P81A 3JARB 4E5PA 2AWNA 2OSBA 2C7QA 3EVDA 2R8OA 1W0KA 5CGZA 2VDKB 3FLEA 2GHRA 1IG0A 3I2YX 3IXLA 1Y7IA 2VUSA 3LUKA 4HWSA 4KK4A 4M46A 5CJJA 1B2LA 2IBSA 2I2XB 2P5SA 5CFPA 3ZJTA 3MD9A 1ETUA 3LUGA 3WQRA 5FWYA 2EG9A 2XQKA 3LRXA 3WBKA 2MHCA 2GPYA 3PFKA 4UCFA 4A8TA 1AKEA 1O97C 2PUHA 5IMSA 2AE1A 1I6KA 2A33A 2FA9A 1PJSA 3KV3O 3H6HA 4HMQA 4I4LA 4XASA 2OKGA 4II7A 4UMDA 2AFHA 3ZVKA 3PEWA 1B1CA 2HSEA 3FXAA 4M8KA 4OOEA 1JEYB 2VP3A 5DSXA 5LYJA 1NNUA 1RM4A 4C1NA 1Q19A 4HR7A 1YRBA 3QP9A 4LF7B 3BHMA 2FR0A 1L7BA 3DMFA 1XGKA 3IA2A 1XL0A 4M37A 3BVPA 3PQ6A 4RHFA 2XWBF 2ISQA 2ATCA 3NWOA 1JSXA 4H3VA 4HVTA 4DREA 5B12A 2B5OA 2XCUA 2W42A 4E12A 1HXHA 1QANA 2WVJA 1HL3A 1IHXA 1YZNA 2XE4A 4O2BB 3W7BA 3WWZA 4ED9A 4NMXB 4D8XA 4YRAA 1QSGA 5LMCA 4DCGA 4NBSA 1FTGA 2HHLA 4G63A 4FUTA 4HGPA 3JATA 4JVLA 2WEKA 4BJHB 1KI8A 1S2DA 4XR4A 1XTIA 5T8KA 4OH7A 4IDFA 1JEOA 1XHFA 3WDMA 2CXPA 3FOBA 3Q0EA 1AT1A 3QJYA 3OEWA 4TYNA 5LQUA 3EQ6A 3EEOA 5DTMA 3VRHA 3R7FA 4GVLA 1BCSA 3TG2A 2J07A 2QRJA 1JWBB 3IV9A 1IU9A 3U4AA 1XU4A 1Z5GA 3L46A 3QKRB 4EUEA 3IAFA 4TYQA 1TKAA 3GLSA 1H0HA 3LG2A 2NXCA 4HFMA 5A9SA 5IAAA 1Z47A 1K4KA 2C2MA 3L40A 5ECWA 4IV5A 4RK4A 2G70A 4PXSA 2C20A 2FJ0A 2GXQA 3WQSB 1II8B 5LLTA 4TL6A 3VU9A 2EJTA 4QXOA 2JGKA 2IY9A 1LBTA 5LP1A 4C2AA 5FPPA 2XLCA 4KFUA 5EMJA 3RBVA 4P4SA 3UMJA 1DT3A 2FMKA 2Y99A 2WP0A 1O96B 5JFOA 4GM1A 2PKYX 3TTVA 1YQEA 3ZDRA 2XGJA 4GBMA 2D3WA 4HB0A 3L8FA 1LBIA 1PNTA 4OMCA 4BP3A 4Y2QA 3D7SA 3ZXSA 4CKCA 4QZVA 3WRWA 3QUSA 3O26A 5REQA 1VHLA 3IHLA 4R1LA 4ZQIA 3WGNA 2C94A 1DTWB 2X5OA 2O8VA 3WK5A 3DE4X 4OG2A 1JDPA 3PKZA 2H16A 3M1YA 1B8UA 2FRDA 4PC2A 3TX6A 1BXZA 1ORDA 2FW6A 2RKOA 4Q6WA 5ER9A 5G02A 4ER7A 2XKAA 1U04A 2B9EA 4C4AA 4O59O 2WVAA 1O77A 4ZVMA 2C1ZA 2IU3A 1V26A 4N4AA 4L15A 3T12A 4D6YA 5BR8B 3IHKA 4X64B 1R0LA 2BMEA 4UZSA 3ROZA 1TMKA 2XE7A 3IFSA 1SUFA 4N65A 1XN4A 2C61A 2ZSUA 2C54A 2QAGA 2WHXA 5EKUA 5D7NA 5THKA 2JGIA 1T5IA 1NUTA 3QITA 2KHZA 5LNK1 2WC1A 1T26A 1DLIA 2HPZA 4KTTE 9GPBA 4S12A 4CG2A 5HHTA 4CI0B 5F52A 1J2TA 1Q0HA 2ZPUA 3KUXA 3MRVA 1FQOA 4C88A 3WNDA 4J7AA 3I9FA 4Y1GA 3LMKA 4OXIA 2A3NA 3I53A 4UMFA 2CDAA 3OICA 5GOZA 1Y8RB 4Q1BA 2JFZA 4JC5A 4XEUA 2BJVA 5BV2P 4BFWA 4KACA 2F3TA 1BD4A 4PGHA 4RORA 2HRDA 4MIYA 3RT9A 2XT9A 5EJ6A 2WSYB 3PKIA 3RVOA 5JZ9A 5IF9A 3KTAB 3UJ9A 1OQAA 1UC5B 2I22A 4Y2XA 1GKUB 2P65A 5IM5A 4PHHA 3COYA 3OCCA 4HAXA 3GFTA 1QHEA 4YDQA 1IVNA 1YI0A 3H0EA 3BG5A 4Y3UA 1ZOPA 3MXOA 4O5AA 2HW8A 1ND5A 4GSKA 3RV4A 5BSRA 4PV7A 4C01A 4UPVA 3W6UA 1QF9A 5HCNA 2BH9A 3BF8A 4R71A 1YVEI 3A04A 4EBBA 4YO7A 2RGNA 2ODEA 1QIGA 2YWXA 3QYAA 3SIWA 1KYXA 5JXWA 5LJLA 2ZI9A 1R6AA 2PV0A 4C76A 4BMZA 1G6HA 3HO8A 2Y1WA 5TEVA 4INOA 1TMGE 1QORA 4ZYXA 4JYZA 2BMFA 1VL2A 2BFCB 3RSOA 1P5FA 3TNFA 3IEXA 1C9EA 4NH0A 3SHFA 1J8MF 3B53X 1RKVA 1XQXA 1EQ2A 2Z95A 4V0ME 3BMOB 1IHYA 2ZVPX 1X7HA 1EB8A 3BE6A 2C3PA 4Q3EA 1JQEA 2H3HA 2QX8A 5HNKA 1YS9A 4BVJA 1FXWA 2GLXA 1MB9A 1IY1A 3AK4A 4EEZA 3ISJA 3IAS1 4ZT3A 1HFWA 3OEED 3K09C 1AXGA 1P1JA 5HRAA 1N2CA 4KQXA 4LV8B 3VR6H 4FFMA 3L8DA 4ID9A 4TTSA 3UXHA 1FNDA 2PCJA 3DAGA 3OKFA 3MT9A 4X9XA 2ZJ3A 5K4HA 2NVOA 1L1RA 1HFJA 3S2SA 1JECA 1IHUA 3K92A 1ISRA 4ZHQF 1TVEA 5CFZA 2GNPA 1YQ9A 5KNBA 2JA2A 2ZUSA 3ZR4B 1KZ1A 1XN1A 2GBLC 3JQPA 2ZW9A 2G4VA 5BR7A 2PRJA 2XBUA 3NTUA 1ONBA 4L75A 2GFHA 4HN9A 1RNLA 2XNCA 1A5BB 4DT1A 3SGLA 3TRKA 3EIUA 1Y1SA 1FRQA 4J03A 2CEAA 2JI8A 3EDCA 1ESCA 1LVUA 2QRGA 3C85A 3NYWA 2ZYGA 2Q4BA 3OEHD 3T0FA 2YKGA 2PTGA 2GEUA 2J3DA 5LQRA 1O8BA 5A4MS 2ZYWX 3D7NA 3KVYA 4KTVE 1T9KA 4YP7A 1QK3A 2NIPA 5B55A 3DTNA 5H16A 4UUQA 5DGCA 4UTNA 2WJYA 1GTJ1 3I04A 4W8HA 5TPZD 2HIMA 3T3NA 2IX9A 3F0TA 3IVAA 4MEJA 4UEQA 5LMZA 1IPEA 3CLUC 2ACEA 2X2OA 2BEUA 1NM5A 3EULA 1R4NB 2QYOA 4E5YA 1B0PA 5DYWA 2V0GA 2Z9CA 3DP7A 3WV5A 1YZGA 3TRIA 2JJMA 1MF7A 4W63A 1W19A 3MMNA 3I23A 3ML1A 2JCSA 3TUJC 1RJGA 4IMRA 3AERA 3PHBE 1M66A 5DBOA 2G0AA 3HA7A 3QM1A 4F4HA 2E4UA 4P31A 4CM7A 5CA1F 4ALNA 5AJWA 2YMLA 2X5KO 3M6UA 3OY2A 5B57C 5DFAA 2DX7A 1K88A 2BBWA 4Q12A 5HMLA 3VO9A 4Y9RA 4RSMA 4F3KA 3IURA 4QL3A 1A9YA 3A1CA 5KNDD 1A2QA 1KMNA 2YVKA 3OCXA 4WZZA 3OCJA 1PK9A 5LBUA 1EM6A 2P8SA 1FVXA 3L5OA 2IEBA 2A5GA 3D1JA 3M8KA 3V8EA 3C6MA 1CEQA 3WBJA 1XLVA 2AOTB 4HLUC 4TV9F 3TSOA 2D4HA 3WK8A 5ICEA 4MYUA 2EHDA 1EP9A 3ROTA 1PQYA 2ZVDA 2OCXA 4HB4A 3HABA 3ME5A 2WJ6A 5KYXB 3U4QA 2V7PA 1I14A 2OECA 4FFLA 3ZD9A 1G1AA 2IYPA 3A1FA 1B4DA 4HF7A 3PITA 1IHDA 2P4SA 2RHOA 4NCKA 5K3DA 1UAAA 1HMPA 1RAEA 1E6MA 1OW3B 1FP6A 4D9CA 4GH5A 5KPJA 4D4KA 3ZWNA 3GL9A 1WXEA 3EASA 3L77A 1EAYA 2IEZA 4KXXA 3DOUA 5JS1A 3WZ2A 1CVLA 2JGRA 1OD6A 3PF8A 4B87A 1KAOA 2AOUA 2FSVC 3UFXA 4L4UA 1SCNE 4IJ6A 1K7XB 2FSFA 3EIEA 3N2KA 4WKOA 1F8XA 3QMPA 1MG0A 3RHZA 3PHLA 2QLMA 4F4JA 5L40A 3R6GA 1MIHA 1TO2E 2QTTA 4CCYA 2RHWA 4G2TA 4LYFA 2OHFA 1GU7A 3KKNA 4HKTA 3TRFA 2W2KB 2QXYA 1BAPA 1TIKA 5A02A 2O5EA 2IUYA 5SZJA 5BNFA 4G5RA 5JAIA 1QCYA 1G18A 4XYGA 1SC9A 2HLHA 1CLEA 3GG9A 4GNRA 4MW5A 4TMWA 4BX3A 3JTEA 3EIHA 1CJBA 1ZGZA 1LDGA 3FSEA 3WLLA 1PJTA 1QCCA 2P2YA 1J2RA 2FEKA 2VHJA 1WCIA 4I1RA 4TROA 3VHXA 1ESMA 2YC2C 1FL9A 1XAHA 1Z5NA 3N8IA 3MTEA 4M7RA 3DBHB 4M49A 4OQNA 4QQNA 1KFCB 1KJNA 4KW7A 3U1TA 3HA2A 1CR1A 4FQ7A 1XZEA 2LKDA 2MIIA 2ZCUA 4JJ4A 2OVBA 3V4FA 1YB7A 3I9JA 4E51A 3N6XA 2RHLA 2JFPA 3D6NB 3DT6A 2OILA 4FBMA 2H1HA 1MVLA 3HB9A 4RD4A 1ZWKA 2B78A 3G49A 2HN9A 5FUXA 4IO0A 3KQUA 3BPSA 2AUMA 2ONYA 1ATZA 2VDVE 4QYWA 4UU8A 3FW1A 4XX0B 3TLBA 4F6CA 4YRNA 1U8ZA 5AVTA 1J0CA 3MTJA 3K70C 3OX3A 5BQPA 4QVGA 3N5KA 5KKCA 5CM8B 4KDEA 1YO6A 4NQZA 1ZOIA 2NZVG 4QFDA 4BNHA 4L3VA 4LEIA 2CDBA 4BEBA 1K6XA 3BQ9A 3L1HA 3KLMX 4ENTA 5T8KC 1IK4A 1KS9A 2CZQA 2FY8A 3D8BA 3FYUA 4IX1A 5EWLA 4AMZA 5IXJA 1QG4A 3CNOA 3X1YA 2R7KA 3ZOKA 1XPOA 5AUQA 2RHTA 2EKBA 3LGSA 4M9XA 1TCCA 2G77B 4ZO9A 1KOGA 3PQDA 4F71A 1BU5A 1NVWQ 3EDQA 3H11B 2ZYDA 4G89A 3STUA 1G1MA 4ESHA 4LZAA 1ZZEA 4ZV4A 1X7WB 3IJPA 1RWNA 3FWNA 3H1FA 2Z2KA 4CF6A 2Y76A 1D2EA 2A1UB 2IYEA 4RK6A 1B00A 1PUXA 1W0JD 2DM6A 1CKEA 1IM5A 3GRUA 4U3JB 4DL9A 1ZM4A 3EXIB 4ZRMA 2IQIA 2AKAB 4D96A 2AOVA 1U5AA 5BORA 4DIUA 2XLBA 5B7NA 821PA 1GAEO 2J5KA 4G5OA 1QX3A 1L5GB 1KDTA 5AUNB 2PV7A 2BGTA 2WMDA 3I6BA 4G25A 4OAQA 1K7EB 3Q3VA 1A69A 1YE5A 2CUKA 3GVPA 2QR3A 1PGQA 1NVMB 3JTMA 2NOAA 4M1EA 4Q02A 1T5LA 4W6ZA 2M6RA 2CLCX 5E6UB 2IYUA 1QOQB 2JB9A 4JB0A 1WCYA 2HUNA 4D9IA 4P80A 5E8JA 4A92A 2F43B 1ONOA 3WY9A 1IVSA 1P6XA 2NPIA 1GGFA 1KMQA 2J45A 4LQLA 1UM9B 2GO1A 3A9TA 2FRDC 3ROEA 5I7RA 4YQFA 1JA0A 2ZB4A 3ONVA 1GUBA 2ZKLA 2UZ3A 3DM5A 1XMQB 4AWAA 4GXNA 3J7TA 4N9QA 1USGA 1P1FA 4OSOA 1S3GA 2I87A 4OF4A 2CJWA 1R9MA 1YZTA 3R7WA 3ZCUA 3KWFA 4LWPA 3KKMA 1LVHA 2RAFA 5EYPB 3KFVA 1SH7A 4JBYA 2X76A 3DP9A 3N87A 1BFDA 1Y82A 3QELA 3TR5A 1MO5A 3GJ0A 2LUOA 4G4SO 5T4EA 1UIRA 3LKZA 3RROA 3LVRE 5IP5A 1VYHA 3CUVA 5DE3A 2H08A 4BEWA 1JIIA 3ZJYA 2LDBA 2J5RA 2CXNA 2QW0X 2ZIFA 3JZFA 2A9RA 1Z4MA 4MLPA 4TN5A 5G0UA 4PBTA 5HMMA 3CH7A 1EGQA 1WIWA 4F85A 3TAHA 1FX0B 1MO3A 2H8KA 2ODBA 1E7QA 4RKYA 5HW0A 2WUFA 3MJVA 4OY3A 2VH1A 1RYNA 3FNEA 2BMAA 2IIVA 3BIWA 2BMDA 3O47A 1ULAA 2IYLD 2W6ID 3FWPA 3OWXA 4EVIA 4E5NA 5F7XA 4W9MC 1ZD3A 3COPA 3RKSA 3EK2A 2OSVA 4QOIA 1EM8A 1WZIA 3QE4A 2B82A 4M0CA 4UATA 5ALMA 1GAJA 5SV2A 5ABPA 4B3SB 4QRHA 1UT8A 2LE0A 4JFRA 3ND7A 4XZ3A 1R9JA 2HUPA 1U0GA 5DO9A 1ORVA 1BWSA 1VDMA 2J4CA 4V0KA 3KR0A 1AUXA 1CTQA 1G16A 3FJ1A 1RYFA 3NQ41 4WASA 3UA3A 4ZO7A 5G1OA 4ZAGA 1U2GA 3IAM6 2R86A 1QHSA 3Q7QA 4CEHA 2C1XA 3O2QB 4N12A 4M7PA 4S24A 1UKYA 4Q48A 4TMYA 5DISB 1FSZA 4WZBB 5F64A 2HNAA 3BCHA 4LXUA 1CDDA 4ALKA 4BAUA 2IH5A 4I1VA 5FPYA 4F6LA 5GVRA 1NUUA 2RGNC 2A30A 2Q2OA 1R8SA 2VJMA 3KTFA 4PANA 4PSDA 2FHPA 4R2IA 4TS9A 2DPHA 1KZ9A 5DX0A 3RVQA 2OHVA 3HEBA 1XL1A 1NKTA 1B6GA 3X1WA 2XUZA 3AFNA 3M5WA 3INGA 3S2IA 4E5MA 3KEFA 5TJ9A 3O73A 3PQ8A 3SF8A 1Y9EA 3AM4A 2GVDC 1ZK3A 3NRBA 4EO4A 1Q1ZA 3EA5A 3ZZUA 4WZ6A 1BU8A 3K9NA 4D97A 2P1ZA 4X24A 1I94B 2YWRA 2ZI7A 1AB6A 1TJ3A 3K53A 4K9QA 4QECA 5KSZA 4MAFA 3BMXA 1Y9AA 2AK3A 4MGKR 1ZNZA 2A5LA 4A6EA 4BO7A 3NHRA 1EYZA 2Q2NA 3HDGA 4C6RA 3IE2A 4OIMA 2GJSA 1K0UA 4H7FA 4JB3A 4RVOA 5J63A 4IDAA 1RKBA 3QE2A 3GBVA 4D5GA 2NMVA 1YSCA 4IJUA 3RREA 5IULC 2HQRA 1OWLA 3NDIA 4IDCA 3GCGA 1GR1A 5BWNA 1NMYA 3OJCA 2CDRA 4AF7A 2IYQA 3EJWA 4MUFA 1WUYA 3M4YA 1QNLA 1SD5A 1Y3BE 4UHKA 5FO0A 1O6ZA 2DJ5A 4P8RA 2Q1WA 4Z86A 5ECDA 3RAJA 3LD9A 4AU1A 2X0RA 3CR3C 3N7AA 1NJ1A 1ZSVA 5TMDA 2DEUA 4YJGB 4C06A 1SKYB 5EKDA 3ZDYB 8MHTA 3FOAA 4M3NA 2YUIA 3PUHA 1F6BA 3NHYA 4YJ3A 1HETA 5KYVA 3S2EA 4UM7A 2PBRA 2DR0A 4P6VF 4AKSA 3HZRA 1G41A 3M4JA 4CF3A 1TK2A 2PMDA 3PDJA 1ZVMA 1WX1A 5HFNA 1ZUNA 4CVNA 3C3KA 4GYYA 1A7AA 2JI7A 1D09A 4UPEA 4FYXA 1SIOA 3AJRA 5FT9A 4B45A 2IHNA 3C15C 4RE5A 3U3DA 2OZKA 1CUGA 3ZWXA 4KFTA 5BQ3A 3VR4D 1TZJA 2DPGA 5CR9A 1QP0A 3MMXA 1RXUA 2EVWX 3DVQX 3EEYA 1YU9A 4BYGA 2C04A 4GNKA 4EOGA 3CIFA 3AG5A 4FYPA 1NM5C 2P6MA 2DLNA 3NBXX 1NHGA 1NASA 4RVDA 5AKIA 1LA2A 2R2GA 2A0KA 1OHHD 4FTWA 3DKVA 2IF2A 5E7QA 2G80A 1ZICA 2AS0A 4QDOA 2Q50A 1GHTA 2CHVA 4DCPA 4NABA 4BQNA 2C8JA 1U8TA 3MHTA 3BAFA 3FNRA 2MINB 4DQUA 1REQA 2RGXA 2QY9A 4LDNA 2GYUA 1H2EA 4MPPA 2XIJA 4EO9A 5IH7A 3WL7A 1RRGA 1BEUB 4PZUA 3CZ4A 3MOIA 4UNNA 1GIAA 3G5LA 5G4LA 4ZCPA 3ZKWA 1JBEA 2G08A 1C80A 3PWKA 4YAIA 1ZU5A 3LCVB 4EG7A 2LBPA 4LI3X 4UBKA 2ZR0A 4B6RA 2PU7A 4IIVA 1ZAYA 2P4EA 1X7YB 3WP1B 4DG9A 3OIDA 3TJMA 4DR2B 4X7BA 3P94A 3I6QA 1KZ4A 4ZI7B 3AMVA 1ULBA 3KEOA 5COAA 5EUBA 3I39X 4WLFA 5J2TF 2NUAB 2EBWA 2AFIE 3CV3A 3RSGA 1BOFA 4DHEA 1ICEA 1XNJA 1NR5A 2JLRA 3L9XA 3GHHA 4PPFA 1CE8B 1Y5MA 2Q8QA 3AVOA 3EDRA 1T1RA 1ESNA 1W5FA 4LZOA 3UK2A 6REQA 1U3DA 2IHTA 4Z3DA 3ZYZA 4RENA 2YMMA 4RUKA 5HE9A 2HIHA 3TW0A 4N7BA 1FY2A 2POQX 1E77A 3BWXA 3FPKA 1QGDA 3QKSA 3WICA 2JLXA 3BXFA 1IPHA 2QL9A 2RJ3A 4DSTA 2H2AA 3OU7A 3KD2A 4XLTA 3GLRA 5DIZA 5KHAA 1A7KA 1BEZA 4X1KB 2XQGA 3TZCA 1JLSA 3BULA 5GM2A 3V3TA 4BB9A 5JIBA 2H1LA 3Q7PA 4JI7B 4PLYA 1U5BB 1EB9A 3NBUA 2VFAA 5LWQA 2ZM5A 3OTIA 4L4YA 3PE4A 3F47A 2L19A 3URMA 1MO4A 4ND8A 1W29A 4PYJA 3GVHA 1GKIA 4V1CB 3LLMA 4I5FA 3ZNOA 3KNZA 2YCLA 3RQSA 3OHMA 2GEKA 5DLDA 4EVRA 3VO1A 3A6GA 5CHYA 5AW4A 1OC2A 1UWVA 2XUDA 3LUCA 2VPXA 1PEKE 4FNGA 2VT7A 3E8SA 4RPLA 3WGHA 1SAYA 4CCWA 3EMKA 2JJ1A 1YASA 1OTYA 2IZ6A 1XHEA 3CZ9A 4MIKA 4B71A 1Z29A 5AW0A 1BE1A 1ISPA 2XVZA 4GKKB 1U1EA 4ZAFA 4DB4A 2VTVA 4BVKA 2SKCA 3GNQA 1Z6QA 1UPFA 4UUNA 5KTYA 2DQSA 3KQTA 5HRCA 2OORC 2IGTA 2QHXA 1WCXA 1Z18A 3ZZ1A 4DQVA 3RUFA 5B58T 4TLDA 2G9RA 1D3AA 3LQYA 2VDQB 3R5TA 4AT1A 1Z4PX 2IS1A 2XUOA 4I6GA 4NMHA 4MGZR 1M1NB 3OQ1A 3P97A 4N41A 3KB2A 4I81A 5ICCA 2YV1A 1ZMRA 2DPXA 2YWEA 1U1CA 4KYUA 1VSTA 5TE9A 3P9PA 2CEKA 5HKKD 3PA8A 4KWHA 4M6WA 1NMXA 5KSOA 1C7QA 3QKWA 4LZWA 5DSTA 2OCAA 1IN5A 2C8KA 3FI9A 3IGFA 4H3KB 5F9FA 2YNMD 1GTSA 3MIIA 3OZTA 2NQ8A 3FYUC 3CF4A 3M1LA 4HHEA 2CLFB 3HWX1 3MAJA 4R1NA 3LT2A 4NCAA 4Q9IA 3UEOA 3SP1A 3S2GA 3CISA 4CKZA 1D4AA 2J7PA 2WHQA 3VYWA 2O48X 2I67A 1VB5A 4QNRA 2I1LA 3R9WA 1IVYA 3U3XA 2YXPX 1V9CA 3O84A 2XEXA 1RHMA 1JFLA 3B6MA 4OLJA 4EUKA 2J67A 16PKA 4P7GA 4UPDA 5D6NA 4FONA 5GADl 4BE4A 2C29D 3O8NA 3F5DA 3DVAB 2C7VA 1XD8A 4CM9D 3WGTA 2FSPA 5BSEA 1QFSA 1DKPA 5ADWA 2H7YA 1Y8QB 2E21A 3T7CA 3QFHA 3N2YA 4RU1A 1RYYA 4X8MA 2WKSA 4G5HA 2P4UA 3EXFB 1AH2A 2F1HA 3FSRA 5FBLB 3U1VA 2CBGA 3G0DA 2VVTA 4NCHA 3LVFO 5AMXA 3EXEA 3NPMA 3UYKA 4G09A 3SOPA 2EARA 2PO7A 1Q2UA 4AKIA 4CT5A 2ZRJA 5EIFA 2ZUVA 4DLLA 1CXZA 4JK3A 5L3RA 2OGSA 3SFVA 4PLVA 1RLJA 1OX6A 3E35A 3DDOA 3L07A 3ILSA 3OD1A 1ZGCA 2QL5A 4G5QA 1TZCA 2JFUA 3K9LA 5BWBA 4P7FA 4DA6A 4ZZ1A 2W6NA 4HBZA 3PKJA 4YJFA 4IP0A 2W48A 2ID4A 2V6JA 4GO1A 3UMVA 5FI1B 5JSFA 1KHTA 3TQOA 4QEKA 3MWKA 3IB3A 2JW5A 4IL5A 1IN7A 3I6MA 4FMCB 1GGHA 4V0QA 1YI1A 1Z6PA 4ZHQA 1QK4A 1LPAB 5JSQA 4RTOA 2NYRA 1OLXA 3DR5A 5IJAA 3UWOA 4EGAA 5MDHA 4ND4A 3AEQA 3JWJA 1J70A 1LPPA 4JFAA 1G2PA 1OBCA 5CB4B 2V6GA 3AP3A 5F1PA 3KO8A 2C9ZA 2QTWB 4OL0A 1DQNA 2BEVB 1TC2A 4WN3A 3TD2A 5IS2A 1PVDA 2P2DA 2C84A 2VQFB 5DT2A 1O95D 3AUXA 1FMTA 5T3UA 3FLAA 4YWHA 4N48A 1GG5A 2O8BB 1LSJA 3SYMA 6AT1A 1Y6QA 3AUSA 4ZQCB 3DOCA 3VQTA 1LWNA 4IJ5A 3JYPA 4YTEA 1Z2NX 4LA4A 1U7WA 1XYGA 2HYDA 2JKYA 4FDLA 5B3LA 5IZCA 5F5XA 1KEPA 3ELYA 4RK7A 1AXRA 2E5FA 2A8YA 3RHTA 1U7XA 3RSQA 1HORA 1D4ZA 1U2ZA 2A4MA 5AM3A 1RLUA 3U7QB 1CY2A 3PXEA 5EZ5A 1A9XA 4MKZA 2GBIA 1NQTA 3EUWA 4CN8A 4OA5A 1L8AA 3K9HA 4K6HA 1ENYA 1L1FA 3OIYA 3PHJA 1R18A 3HJFA 4I50B 4NU8X 4XUCA 2ID7A 3NCHA 4JU9A 1ZXXA 4NECA 3STYA 1U2GC 4QBFA 3R75A 3L9WA 3NOVA 3DEIA 1CNEA 1MRSA 4P4TA 4R4JA 5EKSA 4A5OA 4ZOBA 2HPVA 4EMBA 3CRRA 2I29A 4LY6A 4PG6A 4C2BA 4EJMA 4NBTA 1E0AA 2ZAIA 1AV7A 1Z2AA 2HL6A 1ZUWA 4MS3A 5EIBC 1XD9A 1BDHA 4KRGA 5GONF 4BX8A 5CA1A 1SO8A 2XCSB 3MJEA 1JEJA 2H2GA 2LD4A 1OF1A 2FPPB 1E9EA 4HRYA 4JYPA 3RJTA 2DH5A 4ARSA 1Z17A 2PMBA 4RY8A 1E0DA 1WS6A 5KTKA 2O1WA 2JFQA 3CVWA 1X3LA 1EFHA 2CV1A 4QG7A 1CJTC 3DD5A 1OJLA 4TV9A 2A9OA 4JSTA 1T6ZA 1PSWA 1ZSNA 4LYEA 4DMMA 3HHEA 3L8GA 2CCJA 4FOLA 4K6GA 1B7GO 1SXJE 4BNVA 1M5UA 1W76A 2MSDB 2J1LA 1Y6GA 1QE3A 1A9QA 1PEYA 4JSYA 3L41A 4DDKA 1E3LA 1UK8A 3DW3X 4U7DA 1Z37A 4I1YA 2X0FA 1BCRB 1NYLA 2BBOA 1JG7A 1Z5WA 4MKFA 2WT8A 3LY7A 3FTPA 2Q1XA 4MQFB 4CW7A 1KTVA 2JJ2A 4DSNA 2IEAA 2D7DA 4RQBA 2XITA 4NC9A 4FSHA 4DYHA 2NO5A 1A77A 3GPBA 2FK7A 4ARZB 4I55B 2QMQA 2XGSA 2RGRA 3WRYA 3PFCA 3AETA 5TGZA 1RTTA 1GDTA 4WXRA 3A6ZA 3ORYA 3TD9A 4LRYA 5SY9A 3R3VA 1HE2A 4ZO8A 1U3VA 2AUNA 3QG5A 1M7BA 2XQFA 3FB1A 1I7NA 2FW7A 3QPBA 1G8KA 3QX7A 4QTZA 3EBLA 2ZSEA 3LBNA 1AZLA 1M72A 1ZA2A 2VAWA 3LKVA 4K2AA 4QXAA 4LCEA 4U7JA 5HK9A 3IKTA 1H1LB 2CLDX 1E5TA 1UR5A 2YV2A 4XCQA 5AXBA 3RYFB 3T7AA 5FBZA 1HC7A 5LZ8A 4OHUA 1H5NA 4Z4CA 4QA9A 2Z4SA 3HN2A 2M9MA 3T7SA 5DPMA 4AP5A 1NDUA 4EITA 1JQDA 4HX5A 4RCYA 5D8DA 4Q18A 3PVZA 2NAPA 5D84A 1IBSA 3L6OO 2I4TA 1L5RA 3DJYA 4Y2GA 1V35A 5A5EA 1QTQA 3F90A 4H1HA 4IMPA 5CLQA 1IONA 3L2OB 3LY9A 4V0MA 1O8CA 1HK7A 1Z07A 2Q41A 3M49A 4S04A 3CVYA 4EJSA 4JJGA 4TV8F 1KMCA 2IYAA 2Q1TA 2ZK7A 1FW8A 1E96A 2H8GA 4FINA 1FDWA 4RM2A 3U0BA 3VR2A 3ZOZA 2ZJ8A 5B36A 1Y7TA 3G02A 2Q3FA 2VHXA 2OHIA 1E1YA 2P1DA 2BZGA 3ZV3A 3EGEA 3UUWA 4FWBA 2NADA 2VDJA 2WYOA 1NZFA 4ZA2A 3T4XA 5LOVB 1E2PA 1P4GA 3OPYA 3DGEC 3NO4A 3QOWA 4AMUA 2A3RA 3OPNA 3H5RA 2XGMA 3FX2A 3SI7A 1JHYA 4KAXA 3UA4A 2QSYA 3QU7A 4O4JF 3BJEA 1H2WA 4CEIB 1JJFA 1N2XA 2D5LA 1R9GA 1T5BA 2IOYA 2H9AA 4HYEA 5KX5B 4CIAA 5ELXA 2HTFA 4BFSA 3DBRA 2HREA 3KLOA 1EFDN 2WTBA 3BZUA 2ZWIA 3SNKA 1F60A 2C2YA 3GVIA 3WI7A 2H4JA 5AIBA 1A2OA 1ZKMA 1DG1G 2VTDA 5HUJA 4UE2A 4W99A 1LPOA 1FZQA 1KZ6A 3E9CA 2JI9A 3RFCA 3ZN2A 3HU2A 1UP6A 3RVDA 3BGWA 5KHLB 1QBKC 2P2SA 4EEXA 5C35A 2PK3A 3G0GA 1OH7A 4YRGA 3OZBA 3M34A 3TQTA 5GIPE 3IEMA 1F9AA 1EUYA 3HV2A 4QBHA 1E0KA 4QPJC 3D8TA 3C16C 4B80A 5CB0A 2QY6A 2A7QA 4IFTA 4JB2A 3W6NA 3COWA 1HNXB 2GZ3A 2H1SA 2CKDA 4COKA 2XRFA 4IV8A 3T4UA 1NXWA 4AYTA 3RSCA 1YUBA 4UDOA 3WGJA 1IN8A 2R6R1 5CAEA 2QT1A 3W6ZA 2NU9B 3CH4B 3NBAA 2I6TA 4ZVTA 3Q5DA 2AD1A 5CB8A 5IBQA 1KO4A 3KZKA 2IWRA 4C2UA 3MLAA 2I65A 4HNAB 5ENVA 4H77A 5EMHA 1N3YA 1U8CB 1DOHA 2JLQA 2KYRA 2QA5A 3G6WA 3MJDA 3PK0A 4RA9A 4QOFA 5DOVA 3M4ZA 3FUXA 3JS5A 1X7DA 2E5LB 4G65A 1UBUS 5EA2A 2UUPA 1VYTA 3NC1C 4M99A 4NHOA 2XTMA 3G5MA 2XYPA 4FM9A 3IP5A 4RDHA 2QVCA 2V74B 1AKRA 4HX9A 3WSWA 2B4QA 4L4SA 4Y6OA 2Z4TA 4DR6B 4FHDA 5JPDA 1NAHA 4L6CA 4EG4A 4X92A 4XYBA 2D1RA 1M6EX 4B17A 4WH0A 1C7EA 2FQ1A 3PSHA 2P2ZA 1WSDA 5DWDA 2XD9A 3HB5X 4ILEA 3WLMA 4C0HA 1OXXK 3FWKA 1SVOA 1VHTA 1D04A 3NP7A 1R8XA 3N8KA 3UPUA 2HJSA 2E6KA 1LLDA 1XA4A 4WD3A 1PZHA 3N9IA 4MV7A 3HCPA 1RJFA 2GJKA 3N0XA 1K2WA 2B99A 3EQ8A 2NVUA 2EFDB 1YR9A 2ZBVA 1F12A 3I6ZA 3PQ3A 3ZGXA 3LQQA 1DXOA 2FEWB 3K0EA 5L95A 2HA4A 1OIWA 3AEUA 4CLEA 3RVSA 3D4NA 3QBTA 3KQKA 3KK0A 2Z08A 4A1OA 3WIVA 4WUTA 2ZSKA 1E66A 5EJ9A 1XC7A 1RI5A 4Z4EA 2N9UA 4LSGA 3MPUA 2G4CA 4RVGA 3MJRA 3KB6A 3I9V1 5IHXA 2C57A 5EJ2A 2ZIXA 1HDZA 2CFRA 3E5HA 3L82B 4PG4A 3RJMA 2AXNA 3VVBA 4WDQA 1JEQA 3X0DA 2F3RA 4GLBA 1UL1X 3O8CA 2FZLA 5HK8A 3RVBA 2H1WA 2ORIA 2RI0A 4AKTA 4ER5A 3TLYA 3TBFA 3MWDA 2QX6A 2H51A 3O91A 4IW3B 3RFFA 5L51A 2BEKA 5KYTA 3IDAA 2DSTA 2R8RA 4HFNA 2V7VA 2C88A 5LFAA 4UM9B 3UC5A 4DIOA 1XZ8A 2X2PA 4WFJA 4ZV9A 3A2KA 2PRIA 3CJTA 2N1MA 4KXWA 1X7ZB 4BWVA 4PNZA 1SCJA 3HU5A 4PBRA 4DG8A 4OP3A 3NG1A 5LZ4A 3B2QA 4EDFA 3AWDA 1AQLA 3EAQA 3EZ9A 2Q2WA 4N5MA 1P2BA 1TM3E 1XZHA 4HDSA 4CQJA 2JAOA 3FNQA 1GU0A 4V1CA 3PHIA 2J9FA 1QDLB 3C4JA 4K8RB 1QGED 4I3FA 4FN5A 4X95A 4HC4A 4QUKA 3WJ1A 3MFQA 1YACA 2KBEA 4AJNA 1GZVA 2A0UA 5JOQA 5KOJA 2BEJA 1JJAA 3OKPA 4HQ0A 5H68A 5ESXA 4M9UA 1CUXA 2IYFA 5ERYA 1H2YA 2ZGVA 2IDKA 4KOAA 3RG8A 3RNLA 4NU5A 3DZCA 2YWGA 4C0KA 4LMBA 4E70A 2CW5A 2GCIA 1J1UA 1H2XA 2PRYA 2ONZA 3LSYA 4GPBA 4J2HA 4KQEA 2HLNA 4MUMA 1Y5RA 2RB5A 2LNDA 4KQKA 3R3WA 4E1AA 2X9GA 1X74A 3C41J 3ASUA 2B1GA 3DKPA 4PG7A 3V3KA 1ZPDA 1P73A 3GRRA 3EGXB 5FPQA 2R5NA 4DV2B 4YUXA 5KREA 3OUUA 5E9JA 4OLFA 5JNSA 2Y2UA 5CDFE 4J1TA 3EIWA 1I3CA 4TTTS 1L5QA 4BCDA 3B5JA 1R88A 1TKRA 3F3MA 3IYLW 1IUOA 1GWNA 1M8JA 1UWLA 5JASA 1Z22A 4L27A 4Y1RA 3IVMA 4KO2S 4D4LA 3TSYA 4HL6A 4BWFB 1V5FA 2A1IA 3HXPA 4P84A 4CQMB 1QVVA 3ONFA 1M0TA 3UKOA 1XKQA 1Q7CA 4LW8A 4LWZA 4RL6A 5C8ZA 2WI8A 2JBHA 3BAZA 1VKRA 1YR7A 5IJ9B 3ROPA 4YRCA 1KFKB 2BZ0A 3ND9A 1P5HA 4W8OA 2Q3JA 2XGOA 1P9LA 2L2QA 4RM3A 5JBQA 3QA9A 1MR3F 2JATA 3JQBA 4Z9XA 2Q9CA 1T3HA 2OTCA 1XVIA 4ZGGA 1SEVA 1T2FA 1AM4D 2P1RA 1EWYA 5FWNA 5JAUA 1EGVB 2FOIA 1NVUQ 2CMFA 3U4GA 5F1OA 3L8MA 5HUQA 3F2IA 2E4AA 1Z4QA 2IXAA 2BI8A 1HDGO 2AR9A 3EGDB 3OFVA 4CIBA 3E53A 4TMXA 2B4TO 2EKDA 3HBJA 3G89A 3NU1A 2J4FA 2QW1A 2ZUDA 2LTAA 4C4YA 3DLHA 2C78A 1B23P 3ZDXB 2Z2YA 3BK7A 1V11B 4IDGA 1JDZA 2W6OA 3LL4A 1E1CA 4GX0A 2IVZA 1WUTA 1T9CA 2GEJA 3A32A 5DYIA 2FN8A 3ODGA 4PZ0A 4BVBA 1FRNA 3LZCA 2RC5A 2DAPA 5J2TA 3I9OA 5E8RA 1QP4A 2GN2A 3VBCA 1IN6A 3ZH9B 1ENOA 1WP9A 4LFBB 3UBTA 2GZMA 3S2FA 1Z2PX 4X6YA 1PN3A 3B8HA 2XOKD 3R8FA 4UHFA 2W58A 2XB6A 1N6IA 1FJXA 2MWMA 2ROQA 4FFVA 1N25A 4CT0A 4BQOA 1VPDA 3FDZB 3RWBA 4K88A 5BSFA 2PQ6A 3WXMA 2H0AA 3SHQA 4CM3A 3HKDB 4EG6A 1Z8NA 3NHZA