4BV9A

Crystal structure of the nadph form of mouse mu-crystallin.
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
309
structure length
303
Chain Sequence
RAPAFLSAEEVQDHLRSSSLLIPPLEAALANFSKGPDGGVMQPVRTVVPVAKHRGFLGVMPAYSAAEDALTTKLVTFYEVPSHQASVLLFDPSNGSLLAVMDGNVITAKRTAAVSAIATKLLKPPGSDVLCILGAGVQAYSHYEIFTEQFSFKEVRMWNRTRENAEKFASTVQGDVRVCSSVQEAVTGADVIITVTMATEPILFGEWVKPGAHINAVGASRPDWRELDDELMRQAVLYVDSREAALKESGDVLLSGADIFAELGEVISGAKPAHCEKTTVFKSLGMAVEDLVAAKLVYDSWSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Mouse Mu-Crystallin Complexed with Nadph and the T3 Thyroid Hormone
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
molecule keywords THIOMORPHOLINE-CARBOXYLATE DEHYDROGENASE
total genus 99
structure length 303
sequence length 309
chains with identical sequence B
ec nomenclature ec 1.5.1.25: Thiomorpholine-carboxylate dehydrogenase.
pdb deposition date 2013-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02423 OCD_Mu_crystall Ornithine cyclodeaminase/mu-crystallin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1780.10 Alpha Beta 2-Layer Sandwich ornithine cyclodeaminase, domain 1 ornithine cyclodeaminase, domain 1 4bv9A01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4bv9A02
3MWEB 2BLLA 4JP2A 4B3HA 4BO9A 1QV6A 2B37A 4YPOA 5JLAA 3WXBA 1V3TA 2DFDA 4M49A 3LQFA 4LISA 4W7HA 3ZHZA 2W2LA 4DXHA 3F5QA 4MIEA 4UUOA 3K30A 4RPLA 3U3XA 2PH3A 4FJ2A 2CF5A 3RC9A 4L73A 2EIHA 1QRRA 1TT5A 3OJLA 3MJEA 1BSVA 1OFGA 3G49A 2VZ8A 2VCYA 3CUKA 3WFJA 3B70A 1H5QA 1HE3A 1Z45A 3BTOA 1I24A 3L4BC 4YAEA 3RWBA 4XYEA 3WB9A 4I1IA 4Z3KA 1UH5A 4BO2A 1SB8A 1PIWA 2EKLA 2X9NA 1DIBA 2Q2QA 4DRYA 1BVUA 3OA0A 2NV6A 1Z73A 4J1NA 5JE8A 5TT0A 1K89A 4L75A 1IB6A 3PRJA 3LC1O 3WMXA 3VAZA 1CWUA 3IL2A 3DBVO 3DZIA 1NPYA 1CQJA 3WYBA 2X0IA 4LCJA 4OAQA 1EZ4A 3S1LA 1KYQA 2G17A 4NDNE 1P45A 1P1FA 1I5RA 3ZU5A 4YVFA 5TNXA 3JD2A 1BXGA 3ZU4A 5GZ1A 5LDHA 5CHEA 1E7SA 3GPDG 4IZHA 3RJ9A 1KY4A 2BELA 4WUVA 4B7UA 4I8XA 1JAXA 3F6YA 4BQRA 5ENVA 2OUIA 2ZYAA 4B4OA 2XF8A 2C07A 1GQ2A 3JQ8B 3DMYA 2FPGA 4IBOA 3LVFO 4XGIA 1NHGA 2W2LD 3FNGA 4J9VA 4LCEA 4PRLA 1OAAA 2PGJA 2WD7A 1T2AA 4B8WA 3L6DA 2HJSA 3KOUA 4S3MA 2Z1MA 4GH5A 2C2YA 1NYTA 4LVUA 2BGKA 3DFZA 4MVJP 3M2TA 1K5HA 3VH3A 1BTOA 3D4OA 4M8SA 2AXQA 1WNTA 2HMVA 2GN8A 4M1QA 4GKVA 5JCJD 2BFAA 1B2LA 1IZ0A 1U5AA 3TL3A 3ZNPA 3AUAA 3KLPX 3HN2A 2JFFA 3F3SA 3QJ5A 4AJKA 3BTUA 1LSJA 4BNHA 3DMTA 5IF3A 4YACA 3KUXA 1RJWA 3R6DA 3LDHA 3QWHA 1FJHA 4U5QA 2CDAA 1NBOA 4R1TA 1DRUA 1YJQA 4MVJF 1ZK3A 1DIRA 1B8VA 4G65A 4B4VA 1VRWA 4MVJD 3PPIA 2PLAA 1DJQA 4Y6SA 1T4DA 5TC4A 2QIOA 3K8ZA 4G5HA 3LF2A 1E1NA 3NTOA 3E48A 4BNYA 2YV2A 3KEQA 3FHLA 1M75A 2VWHA 3JQFA 4MVJI 1LLDA 1Z7BA 1LSOA 4JCOA 2JAPA 4NZ9A 4CMCA 4Y6RA 3Q2KA 3C7AA 1P33A 1UJMA 6ADHA 4I08A 3HDYA 3SC6A 3TQHA 3EAGA 5A05A 2YFQA 1H6DA 3O9ZA 4IJWA 5FI3A 3HN7A 1Y7TA 3OHSX 1GYPA 3SJUA 3QA9A 4PGFA 5DF1A 4E2ZA 3K73O 1UXJA 3QW2A 3WDSA 2YYYA 4P4NA 4BNUA 4TRNA 4GMFA 5A06A 2C5EA 1ULSA 3NDRA 2RH8A 2DVMA 4PN3A 3A9WA 5BR7A 3WNQA 1K3TA 1YB4A 3B1KA 3O8QA 2ZB3A 4CQMB 5BSGA 4AJNA 4BVAA 2FY8A 4AICA 4Z6KA 1E1LA 3GPIA 1Q0HA 4A7PA 3ONEA 1PL6A 1QLHA 1WMBA 2HU2A 1VPDA 1WDMA 1T1SA 4IJKA 3WNVA 1GEEA 2FRDA 1R6DA 1YOVB 1N5DA 3NDJA 1N8KA 1LDEA 2PWZA 1JQBA 3JQAA 4JXKA 1U28A 2DTEA 1R0LA 4GL4A 3CH6A 2XXJA 3DQPA 3LC2O 3IQDB 3KSZO 3FI9A 3RKUA 4DBZA 5HS6A 3HWRA 4BGIA 3OQ6A 3A4VA 4J0FA 4QFDA 3TL2A 1GADO 1GV1A 1NHWA 2FMUA 5EL0A 3I52A 3S2FA 4GSKA 3RUAA 4E4YA 2IYOA 2P91A 2QZ9A 3A06A 3HDHA 5JNLA 2P5UA 1YOVA 2J3KA 4IQ8A 4W6ZA 4MO2A 4E5KA 1OI7A 4EI2A 1E3SA 3H9UA 4HFMA 4JROA 4L9RA 3ORFA 3H4VA 1LDGA 2GCGA 3NUGA 3S8MA 2JCYA 3JQFC 1I36A 3ZU2A 3CKYA 4HV4A 3NTQA 3PHJA 4OOFA 5IG2A 1IHXA 1X0XA 4L76A 2YUTA 3GUYA 4RF3A 3STHA 1DXYA 4NPCA 5CP8A 1DDOA 1X1EA 5CDUA 4EEXA 2X23A 2DAPA 1M6HA 2YFHA 1RM3A 2XPCA 3L0DA 3GMSA 1YDWA 3VH4A 3VZSA 5DZSA 3WGQA 4A5OA 3IC5A 4Q9NA 1I0ZA 4KP7A 1M66A 3O4RA 4I5EA 3F5SA 1GDHA 2B5WA 1ENPA 1TT5B 3PGJA 1A9YA 4FQ8A 3PIIA 3KYDA 4J7XA 4ZA2A 1LSSA 1MG5A 3NJ4A 4FB5A 1VJTA 4R01A 4OQZA 1NFFA 1NPTO 4CMGA 2WE7A 1ZKMA 2YZ7A 2X6TA 2ZTMA 1YE3A 2O3TA 4IDDA 3RROA 2W90A 3EYWA 3L07A 3ROQA 2Z5LA 4YRDA 1B8UA 3GA0A 4YBZA 2AG5A 4RQTA 4BGVA 4INAA 1NVGA 3PHIA 4CM9A 2AEFA 1EQ2A 1G6KA 1ARZA 1IOLA 2J5KA 3MOIA 3QE3A 4RVSA 4W7IA 1N92A 4XYMA 2YHIB 3D3EA 3P7MA 3GN2A 3JQBC 2GZ3A 2NQ8A 3NT5A 4BHTA 1JU9A 3LC7O 4FFRA 4EITA 5KTKA 2HKIA 3Q9UA 4TRJA 4CM3A 4ZQGA 3EZYA 1TEHA 2CVOA 4WGGA 3DZFA 2PK3A 4YR9A 3QWFA 4MVJM 4Z9XA 1P3DA 1FF9A 4AL4A 1H6CA 2DTDA 2IXAA 3OJ0A 5BQFA 1LDYA 3DO5A 1D1TA 3BMQB 3ICPA 2O2SA 3CIFA 4JQCA 3RU7A 4U0JA 3VDQA 3V1TC 4YT4A 5H81A 2E37A 2X1HA 2HDHA 1ISFA 1NFRA 2O7SA 2ZKLA 3PYXA 2A35A 2ILTA 1WZEA 3JQ9A 4RPKA 2A92A 1ONNA 3PYMA 5DT9A 5JSFA 1EE2A 3F4LA 2FSVA 4J91A 1P77A 5K9ZA 1KIFA 2ZTUA 1GV0A 1SNYA 3R0IA 2PNFA 1XELA 1UZNA 1PWXA 3HNPA 4L4SA 4TROA 4BO6A 3F4BA 3OETA 1C0PA 1J6UA 1C1DA 2QYTA 3H8VA 1JLLA 1Y9AA 4CM9D 3DONA 1SB9A 4UEOA 5A03A 1UXHA 5CPBA 1VM6A 3U4DA 4WK6A 1T2EA 4WLUA 4ALMA 1NX6A 5AYVA 3F46A 3SXPA 1E7WA 4DIBA 2AEMA 3UF0A 3PGXA 2OBNA 1DOHA 1YL6A 3JQ7A 2B69A 4OH1A 4WEQA 4NNJA 2VZ0A 3TPCA 4R1SA 3X2EA 3DHNA 3ZI0A 4D0RA 4BOYA 3LU1A 1EUCA 1R37A 3BA1A 3EMKA 4WEOA 1N2SA 5TSDA 4DLLA 4TZTA 1HT0A 1IHYA 2NTVA 2BRUA 3U62A 1EDOA 3ULKA 2EKQA 2GN4A 4MPDA 2BFOA 3RU9A 1SOVA 2V65A 1W4ZA 4XCVA 4E5NA 4J4BA 2O50A 1DLJA 1LTHR 3OECA 2VOEA 4IQ0A 4CMEC 2QRLA 3ITKA 3V5NA 4UVGA 3HHPA 1A7AA 2RH4A 2Q50A 3OBBA 3INGA 2DPHA 4EJ0A 2X4GA 4MKXA 4JN6B 4J9UE 3WLFA 9LDTA 2FZEA 4WCDA 4WPGA 2H9IA 3KHUA 1Y8QB 5L7YA 4J1QA 2E6UX 2JCVA 4CM5A 1EVYA 1KEPA 1P1KA 1R4MB 3PFFA 4XRRA 3FBTA 1PGJA 5TJ9A 4F6CA 2R00C 2VHWA 1HDCA 2ZTVA 3JYQA 4PLGA 4BB5A 4LSMA 4W9NA 3ROKA 5C7OO 5AXBA 1QYWA 1ENOA 4MVJE 1PSDA 4BMVA 1TI7A 3IJPA 4HNGA 1LC0A 1R16A 1X0VA 1MXFA 3C8MA 4L0QA 3JQ7B 3Q9NA 2G82A 2HK7A 4XGKA 1U7TA 2CFCA 4HFRA 1GL3A 3K5PA 4OGWA 4QO7A 4Q3NA 3K96A 2YQ4A 2B35A 1EMDA 4J43A 2I67A 1PJQA 2WYVA 3K2BA 1HDXA 1C1DB 3DTYA 3DZKA 1XDWA 2JFHA 1H0KA 1MFPA 1QP8A 3VDRA 4P4GA 4UEJA 1DRVA 4WNIA 4DUPA 1I2BA 4ESOA 3OIFA 1HDYA 2C7VA 4J16A 1FDSA 1V3VA 3R3JA 4YAIA 2ZYGA 4NBTA 2BH9A 2UDPA 4JJFA 1VJ0A 1FDVA 3WICA 1PZHA 3E03A 5T64A 3QIVA 2VHVA 4OSPA 3VVBA 2OORA 2PD4A 3GY0A 5IN4A 3I23A 1PQPA 5A3JA 5TIIA 1ZUD1 4FGSA 1YBMA 1C0LA 2QW8A 2Y66A 4OM8A 3WIEA 4RVUA 1GUZA 2Y1DA 5IZCA 1U3UA 4TKLA 1UAGA 3QSGA 1XU7A 3DBLA 1HZZA 2GDZA 3WWYA 1DC3A 1P74A 1UP4A 4RV9A 3GVXA 4MVJA 2P4HX 3L6OO 1NVMB 3GVIA 1YBAA 2GYYA 2G1UA 3AW9A 4CJXA 2PKQP 3JQBA 3WQSB 4PLZA 4CMAA 4NH4A 5KVCA 2X5JO 3JQ8A 4FJ1A 3WYEA 5AXCA 3Q2IA 3RFXA 2QZZA 3BMCA 3D4PA 4M55A 4QXMA 1Q0LA 2CSUA 1X15A 2CVQA 3ZV3A 1GZ6A 2UUPA 1JVSA 1YBVA 3U4CA 4R3WA 1I3LA 5IXSA 1MV8A 1SBYA 3CSDA 3I9OA 4KWHA 4OSOA 1JKFA 4W82A 3UKOA 2O3SA 4HXYA 3LZ6A 4ZRMA 1PZGA 4E0BA 5L4NA 1U4OA 1KS9A 5CPFA 1K6XA 3V1UA 4LGVA 1QYCA 4UUPA 3ZZNA 4B4UA 5L40A 3E9QA 4UUNA 3C7CB 3IOYA 4EGFA 3GOHA 2BKAA 1PTJA 1PU2A 1NP3A 1KOLA 1DFHA 4NR0A 2V6BA 4XJTA 3IMFA 3DOCA 1IY8A 3HDQA 4H15A 4MIYA 3DB2A 3PQEA 4YJFA 4E5YA 3KETA 3FNFA 4EUFA 4O6VA 5G0WA 3WGZA 3G1TA 3NJ8A 5KJCA 5JFOA 2CY0A 2X58A 4B79A 5A04A 3GVCA 4DC0A 5ENDA 1A7KA 1E3WB 1MG0A 4ALLA 3QVXA 1LDBA 3ZWVA 4I9UA 5A02A 3GVHA 1X1TA 2Q4EA 5L53A 2JCXA 1CQIA 2NWQA 3EY4A 2GO1A 1QYDA 3CE6A 9LDBA 2IRWA 1NTOA 2O3JA 4MKZA 4YWJA 3K6JA 2NU8A 3L77A 5COBA 5JAIA 4WCFB 1DO8A 3W8FA 3ENKA 5HWSA 1L7EA 3FCOA 3GVPA 4URFA 3PQFA 3LF1A 4CLOB 3CZMA 3DOOA 2O4UX 1NNUA 2X22A 4NJMB 1I30A 1ISJA 3ON5A 3SEFA 2ZCUA 1NASA 2I65A 2D1YA 4YJDA 2VYVD 5L3ZA 4FSHA 1R15A 4BMSA 1DRWA 4FFLA 1XYGA 3GN1A 4RQUA 5TLSA 4TRRA 1W73A 4FC7A 5JO9A 4HY3A 2J5QA 3N58A 3C7DB 3PFWO 4RZIA 3GAFA 2JHFA 5JYEA 3ETEA 4HNHA 2AQHA 1TB4A 5JAZA 2DLDA 1EK6A 5IN5A 4IDFA 1VKOA 2JFGA 1B14A 1A27A 4O59O 4XRGA 4PLFA 5T6BA 4PZEA 4AJ1A 4CV2A 5U1PA 1DBVO 1GYQA 2IYPA 1AN9A 4PG6A 2NM0A 4N54A 2B4RO 5FF9A 5JBIA 4HKTA 3WTCA 1QSGA 3PK0A 1PR3A 3ONFA 1ZSYA 3CEAA 5B12A 2Y1FA 1AE1A 3HB5X 4GX1A 2X8LA 3C3XA 3LT4A 5CEJA 1LEHA 3OJEA 1V9LA 4FFOA 1I8TA 3GRPA 1T4BA 3PJFA 4DYVA 4ND1A 2DTXA 5KKAA 3I4FA 4ONEA 3O03A 4CQLA 3RQSA 1O8CA 2VQ3A 2XOXA 4U8GA 2V6GA 3JCZA 1SO8A 5L4SA 3ABIA 4BGUA 2FOIA 1D4FA 4MJLA 1AXGA 1PX0A 2GGSA 3WGHA 1E77A 3I4CA 4I9HA 3ZHYA 5JO0A 3ZH2A 3HQ4O 3I1JA 2RCYA 3ICCA 1KETA 5JY6A 3AUUA 4WOKA 5IDQA 2PV7A 4Z0HO 3W4JA 1NQOA 1YRLA 5EESA 3TJRA 3FN4A 5KJEA 3DMTC 2GZ2A 3P5SA 5IDXA 1XCBA 1VL6A 1PJCA 3TZ6A 4QEDA 4HBGA 1RYEA 4J2HA 5BNTA 2RHRA 4YAGA 1EUZA 5CEEA 1Z75A 1DFIA 2FPPA 2W4QA 4FFMA 4RL6A 5KNLA 5B4VA 2Q46A 1LRLA 5TX7A 4GKBA 2PKRA 4AJ2A 4M89A 4AG3A 4XB1A 3ZN2A 1P1IA 5ILGA 1Z7EA 1N7HA 3WJ7A 2ZB7A 3KLMX 3C1TA 4DMLA 2E48A 4ZVVA 1GCOA 1CETA 1OOEA 2CVZA 3GG2A 2TMDA 4CLDA 3HE3A 5TS3A 1NXQA 3TNLA 5I7SA 1HRDA 3LK7A 4YRAA 1KY5A 4FIZA 1Y8RA 4AJ4A 2NACA 5A9SA 3PJDA 4J4TA 4E13A 5KVQA 2EJVA 4BQPA 1NVTA 3UN1A 5DCUA 4WOJA 4ZQBA 3ZHBA 3PHLA 3G1UA 1R4MA 3DL2A 4DTIA 2HMSA 1LQUA 4J0EA 3QWAA 4OMUA 3VPGA 2C54A 2HRZA 3HDJA 4FBGA 1GZ4A 1B3RA 1MB4A 1YGYA 3GEDA 4I5DA 4D43A 2HQ1A 2O3QA 3ASVA 1PGPA 3NYWA 2OMEA 3ZV5A 1F12A 4UULA 2PFGA 3GHHA 2TMGA 4JX8A 1Q2XA 1C0KA 2POQX 4CMIB 3JYNA 3M2PA 1XKQA 1D8AA 1UUFA 2VRCD 1XLTA 2C0CA 3F1KA 4G2NA 1C1XA 3OEWA 2Y1EA 1Y5RA 3MEQA 4JLWA 1T24A 3RVDA 1PS8A 1JKJA 4XX0A 1DIGA 2D5AA 2OL4A 5JXWA 7ADHA 1U9JA 3K31A 2W2KB 1JA9A 4DIOA 2NSDA 1ZEJA 4PZCA 4CV1A 2O23A 4BGEA 2CNBA 1R4NA 1Q1NA 3SVTA 4J1SA 5U4QA 4XB2A 2E49A 3EW7A 3G0OA 4R1UA 4LSWA 4YT5A 1BW9B 3M1LA 4TRMA 4PLVA 4YEDA 3OF2A 4NG5A 3C1OA 3KBOA 4NU6A 2NADA 5T8KC 2HMTA 4IM7A 5DBIA 3OQ1A 3JQGA 3VC7A 4EJMA 2VYND 3PHHA 4HFJA 3GR6A 3AM5A 2C5AA 3I6QA 5IDYA 5AQ1A 1DJNA 3QVSA 2AQKA 1Q0QA 4RLHA 3RIHA 5CG1A 2DPGA 3MJVA 1PGOA 2PZMA 3RI3A 5DP1A 4BNJA 4TWRA 3JSAA 4A10A 3AI3A 1EVJA 3VPXA 3DBLB 4KDEA 3ZV6A 3VH1A 5F5LA 2VRCA 5GZ6A 1D1SA 4LVCA 3ZWYA 3I9KA 4R41A 5HRUA 4NMHA 3A28A 4IQGA 2ZATA 4B8ZA 2JAHA 1MFZA 3H9JA 3D4NA 1PL8A 3JYPA 1YO6A 4BO0A 3AM3A 5EINA 3S2EA 2AE2A 3AOEA 4R4JA 3TF5A 3CMCO 5JYDA 5FWNA 1ZBQA 2PGDA 4L4XA 1HEUA 2BI7A 1U8XX 4YDRA 3WSVA 4E30A 1RM5A 3B1FA 4QO8A 1GQYA 5LCXA 3E5RA 1GAEO 4IIVA 1FDWA 3JQGB 4C4OA 5JMWA 1X7HA 4L8VA 4AJPA 4R9RA 1U4SA 5B37A 2NVWA 2UUOA 3MTGA 4FDAA 2F00A 3UVEA 3R3SA 5IZCC 4BIIA 5L95A 3RFVA 1SC6A 4BS9A 1UR5A 5CDYA 3FNEA 4D45A 1J4AA 3NEPX 1YVEI 1ZMOA 3FWNA 4EUEA 3GEGA 3FBGA 5IAAA 3VOSA 1ISGA 5EERA 3HSKA 2IZ1A 4QTZA 1E6EA 4DREA 1FK8A 3A14A 2YV3A 3AY6A 3AK4A 4N18A 4IPTA 3D7LA 4RF2A 4XYGA 3ZDFA 4BL5A 3TZQA 1QMGA 2XAAA 3GMDA 4YYZA 5G4KB 3D1LA 4DMMA 1ZK1A 3QP9A 5COAA 2JHGA 4OOEA 3S2GA 5L4LA 4DC1A 3GEMA 5B1YA 3PDJA 4DL9A 2CD9A 2V6MA 1YWGO 2NVUA 3I3OA 4MVJH 1VI2A 2VTEA 1BWSA 2WSBA 3E9NA 4Q3AA 4CPDA 3U4IA 1DPGA 4ILKA 5A5EA 4ITUA 1DIAA 1ZXLA 2Y1CA 4IDCA 4CR6A 2EWMA 4PLTA 2R00A 3HFSA 2NNLD 1GFSA 4L4RA 2O4CA 3PJEA 5ILOA 2Y99A 3ZCXA 3NGLA 4ZN6A 4CMHA 4DLBA 5ES3A 3WFIA 1AUPA 4RVFA 5DBGA 4FR5A 2ZCVA 1JAYA 3UOGA 2DU8A 3A1NA 1AXEA 3HADA 4GSLA 5BNIA 5GZ3A 2NVBA 2R6JA 3ZU3A 1EUDA 1ZMTA 1E7RA 2JJYA 2GN6A 3GF4A 3LLVA 5I7VA 4XGNA 3TOXA 1D3AA 1QLJA 2ZJ0A 3FRJA 4BNNA 4XYBA 1R0SA 3AM4A 1GYRA 3JQAB 2FWMX 5AOVA 3ZWMA 1PJTA 2JL1A 3AY3A 1DC4A 3GGOA 2Q99A 2DUWA 1ZXBA 3VKVA 1B0AA 4Q3DA 1JKIA 3WLEA 1CDOA 3IDSA 2BFMA 5HTOA 2RIRA 2DC1A 3BHMA 4XQ9A 1U7HA 4K28A 2DQ4A 4W9NC 3RCBA 1SPXA 3PLNA 5I9MA 1BRMA 1P1RA 2AQIA 2OBYA 2Z1NA 2WEKA 1L1FA 3RBVA 1U3WA 2J3JA 3FF4A 4CM7A 2X9VA 4PLHA 4XYLA 3QRWA 1LDMA 2X5KO 1BVRA 3V1YA 2VHYA 5ICSA 2EGHA 5DBFA 4MP6A 1F06A 1LSUA 3ZW9A 3KO8A 4R68A 1I3MA 3NAQA 1SAYA 3RBZA 4M54A 3CXRA 4WLEA 3QV1A 3ADOA 3IS3A 1YDEA 1ADBA 3TWOA 1PS9A 4J49A 4UREA 2GASA 2EV9A 3KB6A 3D3WA 2NQTA 1ISIA 4RPJA 5JAMA 4CLRA 4CMBA 2IEDA 3T7CA 3TZKA 3UGKA 4EYEA 3GNQA 2CDBA 3OMLA 3KSDO 4KMSA 2NU6A 3T4EA 1KVQA 1RM4A 3ETDA 1MC5A 3H5NA 4B7CA 3QVOA 2YDYA 1Y1PA 2NLOA 2IE0A 4IMPA 5G2OA 3T4XA 2I3GA 1W8DA 1U2GA 4EJ6A 4BNTA 1Y81A 3K92A 3SJ7A 4XIJA 2WM3A 3OIGA 1LXCA 1Y8QA 3B20A 1NWHA 5G0UA 1WXDA 1N1EA 3DBRB 2NVUB 1T26A 3G79A 4H16A 3VPHA 1PJBA 1H93A 1MX3A 4Q3EA 1XQ1A 5I7FA 2HSDA 1E92A 4XR9A 3IJRA 1KEWA 1U5CA 1YONA 2EW8A 5FEUA 5JDIC 1T2CA 1QXSA 2A94A 3GDOA 4K9DA 3SX2A 4U6SA 4YJFB 3E82A 1RKXA 4K26A 3PQDA 4YTEA 3VTFA 4DIFA 3I9LA 1CYDA 5KWEA 4WLOA 5C5IA 4WECA 2JD1A 5CFZA 3PJGA 1SZJG 2QHXA 1P1HA 4CV0A 1A4IA 3E18A 3OSUA 4OIMA 1DAPA 3DBRA 1YH3A 4YA6A 4BO8A 3GGGA 4QECA 2WD7B 1LQTA 2FSSA 4BNGA 1LLCA 1TVEA 3EC7A 4KDFA 4KUGA 5AVOA 3EDMA 5H83A 1PJ2A 3DZGA 5IDWA 1XIVA 3H3FA 3L6EA 1WDKA 3VTZA 4GPD1 1EBUA 4LRTB 1K0UA 5JCJA 3ANMA 3QVWA 1WP4A 3NDIA 4NU5A 1YL5A 4LMPA 4BV8A 3WGIA 3DTTA 1PQWA 1H6AA 4RVHA 4XIYA 2VRBA 3QHAA 2B4QA 2FN7A 3U5TA 4Q39A 1S6YA 4GGOA 4WE3A 5ER9A 3RUCA 2B36A 2OOSA 3PZBA 1K6IA 3KSUA 1F14A 3HG7A 3KYBA 4BKRA 5K6AC 3KEOA 4G81A 1MA0A 3ASUA 5EQFA 3ITDA 5EPOA 5DDIP 2E82A 2BI8A 2VUTA 2CMDA 1SOWA 1R66A 3I5MA 5EN4A 2VYVA 3ANNA 3DAPA 1E6UA 2Q45A 5G4LA 4NK4A 3VH2A 2X86A 3PYLA 4F3YA 1ZJYA 1MLDA 4XR4A 1A72A 2I76A 3O8QB 3IP1A 3DEYX 1I33A 3QQPA 2GD1O 3RUEA 3WQRA 3ZHXA 3ZWNA 2VT3A 3SLKA 1E1MA 1ONOA 2I9PA 2IZ0A 3VZRA 2X9GA 4JBHA 2P5YA 3HUDA 1U3VA 3P19A 5EIOA 4JP3A 5K6AA 1G0OA 1HTBA 1NFQA 4UAGA 4CM4A 1Z74A 3IP3A 4I5GA 5KKCA 2A9FA 5H82A 4MP8A 3OQBA 1W0CA 2QX7A 4BKUA 1I2CA 1UDCA 3P2YA 5CEFA 1E5LA 1HYEA 1QORA 2UV8A 1ZVMA 5L51A 1N7GA 1PJ4A 4NBVA 4NI5A 1V35A 4WASA 1I01A 4EW6A 4H3VA 3GZNB 3WIDA 5ER6A 5TGDA 1LBEA 4GGPA 4IXWA 5HM8A 1H6BA 5JDCA 2OP1A 4PCVA 1TA4A 3CTMA 3WG9A 1NPDA 3NGXA 4YJGA 2AHRA 4UVDA 1ZH8A 3DXFA 1RWBA 4Y9DA 4YAKA 3H9EO 3WTBA 1HWYA 1ZK2A 4YB8A 4CLXA 2IEBA 1YS4A 4E33A 3TOZA 2HUNA 1H9AA 1IL0A 3ONDA 2Q1TA 4CM8A 8LDHA 4DYDA 2G0TA 3R1IA 1ENYA 3ZV4A 1NQTA 1ZCJA 2YY7A 4E12A 3WYCA 1JN0A 1PZEA 4CODB 4GX2A 1UDBA 3INTA 3HJAA 1ZJZA 4Y67A 4ZQHA 4R9SA 1V6AA 1WLYA 2DM6A 1E3EA 3L4BA 3PWSA 2F1KA 2HK8A 3C1AA 4KOAA 3IIEA 4Y98A 5AXDA 4E5MA 3I9MA 4O5OA 5TT1A 3JQDA 4OJNA 4IMRA 1I3KA 5KJFA 4BNIA 1GU7A 4II3A 5B4TA 4U6QA 4CUKA 1LI4A 4N7RA 4UVHA 6LDHA 1Y5MA 3AU9A 2Y1GA 3D5QA 2I3AA 1GUYA 2ZYDA 1ID1A 4C7JA 4R16A 3ZWPA 1NAHA 2J8ZA 2IODA 5JDCC 4J2OA 3BTVA 4CLOA 4RORA 3GC6A 2PD6A 4PG7A 4RDIA 3UCEA 4D7AA 3KTDA 1HSOA 2EXXA 5G0SA 1CERA 2WJPA 4PIVA 1XR3A 4TSKA 3ETGA 1BXGB 1HETA 4CQMA 2X5OA 2NTJA 4YRBA 2J5RA 3H9GA 5DP2A 4D42A 4GAEA 3E9MA 3ANLA 1DHRA 2Q49A 2PR2A 1T1RA 3KYCA 1YB5A 1P0FA 2D5CA 1Q7GA 3LYLA 5L45A 1ENZA 1UXIA 5U9CA 4ZD6A 4MVJG 4IUYA 1O0SA 4JBIA 4PG8A 4IXTA 3W1VA 1Y6JA 2O3UA 1KBZA 4QQRA 4U7WA 4OXKA 1JW9B 1ISHA 3BAZA 2DUUA 3DHYA 4NBUA 1I3NA 2UAGA 3FWZA 2EP7A 3BHIA 2DFVA 4KWIA 1TXGA 1IUKA 1BXKA 4UUMA 2ZK7A 3FR7A 4GVLA 1UAYA 1H2BA 1B8PA 2PKQO 2ZIZA 1ADCA 1DFGA 2H1SA 1LUAA 4OKNA 2WE8A 3C24A 1WMAA 2FR0A 2Q4BA 5IJZA 4JGBA 3OICA 3L9WA 4A0SA 5J23A 2Y93A 1HDZA 2C20A 2P9EA 3S55A 2GSDA 3NX4A 3PTZA 3U09A 1I32A 4GWGA 2GERA 2R2GA 3UFXA 3OM9A 5ADHA 3G17A 3PEFA 3FPCA 3BMCB 3GT0A 3RJ5A 4B4WA 1ISMA 4EDFA 3MJSA 3OA2A 3TRIA 5A4DA 3PWZA 5A1TA 5HS4A 5JW6A 3I83A 5JPIA 2AQ8A 5HBRA 3X2FA 1VJ1A 1EBFA 1LJ8A 5F3RA 3I6IA 4ALJA 5T5QA 2GRAA 3D64A 4D3SA 1HE5A 1GPDG 2VNAA 3U49A 1AHHA 2VYNA 3D3WB 4UVIA 2CUKA 4Z3DA 1CJCA 4QX6A 3ENNA 1HXHA 2YJZA 1LRKA 3MJ4A 3RC2A 4X54A 1NR7A 3RD5A 2X0NA 2C2XA 1MC4A 1WVGA 3KYCB 1M67A 1V3UA 4CR7A 2WDZA 5K0ZA 4BMNA 3MOGA 1ZFNA 3F9IA 1RYDA 4FOOA 4FC6A 4NJMA 2YDXA 3VVCA 3O26A 2PGLA 2NU9A 2BGMA 4XQEA 1HZJA 1XSEA 4FPXA 1H9BA 4WCFA 4W99A 1UDAA 4UEKA 4TZKA 4AJEA 1EFKA 1P0CA 1T25A 5TQVA 1ADFA 3WWZA 2C59A 4BNWA 2PD3A 2DBZA 1BMDA 3JD3A 4BNKA 3BTSA 3SC4A 2H63A 2OP0A 3RAJA 2H5LA 4I5FA 4IDBA 3RUHA 3I9NA 1QV7A 4J4HA 4XEHA 1E5QA 5T57A 3RBXA 1TLTA 2CF6A 3ZNQA 1NQAO 2FP4A 3JD4A 1BG6A 4MIOA 3UW3A 4N5NA 3W4IA 2PZKA 5C3MA 3VPFA 2W2KA 4J90A 1BDMA 5LC1A 1G0NA 1Z82A 3ZWOA 3AI1A 1U3TA 4DQUA 2P9GA 1PEDA 4OYRA 2QRKA 5GY7A 1LX6A 2ET6A 3LLSA 2Y0DA 1VE9A 2Q1WA 4IGEA 2C29D 1RPNA 4D0SA 3AOEC 4RO0A 3Q0EA 1J5PA 1WW8A 4WNCA 4CMEA 3U9LA 3OJOA 5CG2A 4RPGA 1KC3A 3H2ZA 1BHSA 3Q6IA 2Q2WA 1CRWG 1H2HA 4JIGA 3JQCA 1C0IA 5KJ1A 1UP7A 4FJ0A 3DZBA 2ZJ1A 4K6CA 3RC7A 1LNQA 1V8BA 4Z9YA 4P38A 2Y05A 2YHUA 2LDXA 3H9QA 1JTVA 3VPSA 1DC5A 3WX0A 5I8WA 2Y1OA 3QWIA 4ND4A 2HRBA 2ZQZA 2GR9A 1E7MA 2VWQA 1WZIA 2I99A 4CQLB 3BZUA 4R3NA 1FDUA 3GGPA 4YJHA 5F21A 1IPEA 1ORRA 4E6PA 3IAHA 3TZCA 3DFUA 1W6UA 4Z0PA 3VHRA 3WBFA 2VWPA 3RC1A 4ZRNA 4WKGA 1MXHA 3WBBA 4E31A 2V6FA 1HSZA 1R12A 4NBWA 4IINA 1M76A 4I9NA 5EMHA 2Y68A 2PZJA 5IFLA 3F1LA 3GFGA 4MOWA 2FZWA 5CDTA 3GRKA 4A73A 1QYXA 5A9RA 5DCWA 2WYUA 4OXYA 2FR8A 1M6WA 3PDUA 2HK9A 1ZNQO 5MDHA 3P2OA 3RUIA 3TSCA 2EKPA 4OL9A 1BXZA 2QG4A 3QLJA 3DHEA 3JQ6A 4II2A 3TZHA 1XQ6A 8ADHA 4FN4A 4R5HA 3UICA 3PIDA 4IZIA 1NWCA 1EE9A 4IS2A 1QYVA 4ZJUA 5IXYA 1DB3A 5TJHA 1D7OA 2H6EA 2ZB8A 3AI2A 1A5ZA 4IY1A 4OXNA 2VTDA 2PY6A 2D2IA 5A9TA 3V8BA 2DT5A 1KEUA 4AJOA 1Y9EA 1P9LA 1U1IA 4GLOA 4NFHA 4CL8A 4PLWA 2EEZA 2AEJA 4FS3A 4N5MA 1XEAA 3H65A 3NT4A 2GLXA 4GMGA 3W6ZA 3DWFA 3ZW8A 4WJZA 4GX0A 3KXDA 3E8XA 2P68A 3JD0A 4PG4A 1MGOA 2RHCA 4K6FA 1E1KA 4JK3A 1Q7CA 3L9XA 3GUCA 2PZLA 4YQZA 1C3VA 4RLSA 2NTNA 4ND3A 1O9BA 4E2YA 1XWFA 3WQQA 1PL7A 4GQAA 4PZDA 4D41A 1B26A 3W4KA 2Q2VA 2WD8A 3GNSA 5I9LA 3AY7A 4O1MA 4FD3A 3GK3A 3K2EA 3ZNNA 2P9CA 5I7EA 4GVXA 1LC3A 2ZQYA 4KTTE 5EQDA 3GZ4A 3MCVA 4MINA 4B3IA 2JKVA 1J0XO 3DR3A 1F8GA 4A2CA 3C85A 5I9NA 1DEHA 1HYHA 4ND2A 3EK2A 1WAMA 3GHYA 5F5NA 1UZLA 4AFNA 3LT1A 4ZU3A 3JYOA 1J49A 4D3DA 2J6IA 3EZLA 3F47A 4GX5A 4NBRA 1R0KA 1ZSNA 2BFPA 1KERA 4XD2A 3V2GA 1UXGA 3IUSA 3UH1A 4DPLA 4BNXA 1HF3A 3WSWA 5ITWA 3PWKA 4A27A 5DCYA 4TMFA 3FSRA 2VN8A 4DVJA 3TFOA 3UXYA 5F1PA 3D5TA 3NKLA 2VUSA 1A9ZA 1XU9A 1Q7BA 3E6AA 1HL3A 5COQA 2OFPA 2OZPA 2CZCA 2GZ1A 4BO4A 1OC4A 3N7UA 1DSSG 2VOJA 2WMDA 5T8KA 3UUWA 3PP8A 3QY9A 3COSA 4D44A 4N5LA 3AWDA 4E2WA 2B83A 1DC6A 4CQMD 3E1KA 4Y8VA 3SLGA 4MKRA 1S7CA 4C7KA 1XA0A 3M1AA 2O48X 4IJVA 3NV9A 1O5IA 1PJSA 1KVTA 1FXSA 1K2WA 3K9QO 4NK5A 1EQUA 3G3EA 1FMCA 3ZWXA 4ALNA 2LDBA 1E7QA 3I9JA 4PLPA 3KV3O 1VL0A 3ROPA 1A4UA 4YT8A 4BO5A 2UYYA 2NUAA 3JQ9C 4DA9A 4KQWA 3RSHA 1WDLA 3H6KA 2YHIA 1GZ3A 4BV9A 1E3IA 1GQQA 1VLLA 1YB1A 4BKQA 4BO3A 1E7YA 1KC1A 2VZ9A 1YQGA 1JDJA 2DBRA 3JTMA 4OQYA 1HE4A 4TVBA 2HLPA 5F1KA 3IKTA 2I5PO 2DBVO 3PZRA 3B6ZA 4LW8A 3L4SO 1O95A 3H5RA 1OZAA 2HMUA 2VUUA 3PI7A 4CM6A 1HYGA 2WTBA 5JS6A 4OHUA 1R4NB 3KZVA 2QQ5A 3AOGA 5L9AA 4PLCA 2J3IA 1E0DA 4IDAA 3LT2A 2CDCA 2OGUA 1EVIA 3FR8A 3LT0A 5THKA 5JY1A 1F17A 2B0JA 3WR5A 5BT9A 2E4AA 2D4AA 1B7GO 5TF4A 4DBVO 1YKFA 1V0JA 3AJRA 2O2YA 2YV1A 4YQYA 1X7GA 4IGFA 3UAGA 4CM4B 1VSUA 4O63O 1E3LA 1BGVA 3ZGYA 1XHLA 2G5CA 3GNTA 3HFGA 2OO5A 3BXXA 4ALIA 4DPKA 4QT0A 5THQA 5L7WA 4D3FA 3DZJA 3RFTA 4CUJA 4JBGA 2IXBA 3EVTA 5LDGA 3DBHB 4XWYA 3EHEA 4HX5A 1B15A 4KTVE 5CDSA 5DN9A 5HA5A 1ZZEA 3HZZA 4LK3A 5G4KA 3CZRA 4GLLA 5I8ZA 4FCCA 1UZMA 4E32A 1U8FO 3CMMA 4HWKA 2EG9A 1YL7A 1ZSVA 4AJLA 1X7DA 1Y8RB 2HJRA 3EGOA 1E6WA 4ROSA 2Q1UA 1GPJA 1PS0A 2B5VA 4TVOA 1VL8A 2WWRA 5JCXA 3RUFA 3PHGA 5CDGA 2PTGA 3MZ0A 1LA2A 1X13A 4NJOA 4NFYA 1SEVA 2Z95A 3JV7A 1H94A 1DAOA 4Q3BA 4E3ZA 4RCVA 5TRTA 1DIHA 4E5PA 4D79A 4YJHB 1CEQA 1HE2A 3ADPA 5ICMA 5C7LO 5JC8A 4RF4A 4CL3A 4BNMA 4EBFA 3V2HA 2EF1A 5JC1A 3BYZA 3NRCA 1YQDA 4IDGA 1E3JA 1VKNA 3WJAA 4QFCA 1AHIA 1LLQA 4XKJA 1ZIDA 4BUCA 3NT2A 3OH8A 1ML3A 2PA3A 3VZPA 3H2SA 3TDKA 3HB4X 1NR1A 1B3BA 3KVOA 1IULA 4PRKA 1ULUA 3OP4A 2D3TA 5CAEA 3DDNA 2GN9A 3AUTA 2O3RA 1GUFA 1KVUA 4QUKA 4YJGB 3PXXA 3MTJA 3ROMA 4ZICA 3NTRA 1SMKA 1WPQA 4CUZA 5C7IO 3DZHA 3T7EA 3WOHA 4BNVA 3AUSA 3BMNB 1UXKA 4OKIA 5KOIA 4J1TA 4BO1A 4FFNA 4B7XA 4B3JA 2GUGA 3EUWA 3JQEA 4HUJA 1KVRA 1C14A 2C82A 3GAZA 4J6FA 1ADGA 4IIUA 1YQXA 2AE1A 5KVVA 4XA8A 3OJFA 4R54A 3FTPA 3GLQA 4KZPA 5ITVA 2BGLA 1P31A 4KQXA 3RUDA 3FD8A 2Q3EA 4D46A 1P1JA 3GDFA 4YT2A 4KUEA 1OC2A 1PGNA 1GY8A 4BNLA 3OFSA 1GTMA 1TT7A 4RF5A 4XDZA 3D0OA 5JAQA 1PJLA 2Y0EA 4NHEA 3W6UA 1AGNA 4ZHSA 2BMAA 2I6TA 3FTNA 1I10A 2G76A 3WMWA 3DOJA 1DLIA 3JD1A 2VHXA 1UP6A 2VT2A 1KEVA 1U2DA 4BNZA 4U0KA 2AW5A 2VWGA 2GPTA 4R69A 4F46A 3V2UA 3VKUA 1M2WA 1GEGA 1CF2O 4DQXA 1IPFA 2Q1SA 4LMRA 4RGBA 2VNSA 4RPHA 3M6IA 1GR0A 4BO7A 4OO3A 4FOSA 1B16A 1RM0A 1OMOA 2UVDA 5A3VA 4CLRB 2IDZA 3BMNA 2DKNA 2QRJA 1K6JA 4YAJA 4FFPA 1ZEMA 1EEHA 1HKUA 3MJTA 3S2IA 4CMIA 4E21A 4GWKA 2EP5A 1ZK0A 3KM0A 5BSHA 3BMQA 2C7GA 2ZTLA 2JD0A 4O0LA 4XQCA 3WS7A 1IYZA 1NM5A 3DAGA 2X7HA 4NIMA 1YJ8A 3WGYA 1EFLA 2W8ZA 2P4QA 4MDHA 4ZGWA 4J3FA 4E2XA 5GMOA 5G0VA 2EJWA 2YQ5A 4CLHA 5F1OA 1GCUA 1IE3A 4Z9FA 3JQAD 4BKOA 2D0IA 1XGKA 5L7TA 1JVBA 4KUHA 3UCXA 4ID9A 5A9SB 3DAFA 1EDZA 1QG6A 1HLPA 2V7PA 2Y0CA 2ZB4A 4HP8A 4LN1A 3ZWWA 2GF2A 4CV3A 1BW9A 1VSVA 4RZHA 1QR6A 3WGTA 4PLYA 2W98A 4FGWA 2VHZA 4WLVA 5KCZA 2X0RA 3FPLA 4F45A 3W8EA 4XQGA 3PLRA 2P2SA 3GFBA 5T67A 1PGQA 3ZWBA 5DNAA 1E3WA 2EW2A 1HDOA 3EVNA 3KYDB 1N9GA 4WLNA 3SBOA 4JJGA 3UCFA 1EK5A 4Z0TA 4ND5A 5FYDA 5BSEA 5MGBA 5AXAA 2OXIA 3TFQA 2PH5A 4DQVA 1C1XB 4WCFC 3BIOA 1DHTA 4CMJA 4XDYA 4CLEA 2NU7A 1LLUA 2HCTA 4Y6PA 2RAFA 1OBFO 4RJTA 1O6ZA 4W4TA 4CM8B 3DBHA 4ZQEA 3U4HA 2X0JA 4XZ3A 5IZ4A 1A71A 4A26A 3AFNA 5DOZA 3WGGA 1HLDA 2BHLA 4AJHA 1LRJA 1F0YA 4XJSA 4H7PA 1QKIA 5KVSA 4LRSB 1LDNA 3INRA 1HDRA 1N1GA 1X14A 1PQUA 3IKVA 4IJUA 4YCAA 3OIDA 4WLFA 1XG5A 3GH3A 4BKPA 1F8FA 3RKRA 3O38A 1FDTA 4R1NA 4CM1A 3DC2A 1JWAB 4RDHA 1ZO8A 2EGGA 1Z6ZA 2WYWA 1SCUA 3WGOA 1O94A 4TQGA 5G0TA 5KJ6A 1LU9A 1NAIA 4PVDA 1N9GB 3RASA 3B1JA 1GD1O 5BSFA 5B4UA 4M86A 1IZ9A 1L7DA 5JDIA 4K1LA 2D59A 4ALKA 4P22A 5EJ2A 1PWZA 3TN7A 3AU8A 2HMWA 2SCUA 1WWKA 4P4LA 5FFFA 4S1VA 4DLAA 2EERA 4AVYA 4CR8A 1SEPA 4GI2A 2O7QA 1PJ3A 4JNKA 2FPIA 2HO5A 3GG9A 3W8DA 5A5FA 3LSYA 5DOVA 2EHDA 4AJIA 2AA3A 1I2ZA 2J3HA 3CINA 1MP0A 2BF7A 2I66A 3VZQA 1ZW1A 3UHAA 1PZFA 2B4TO 3BMOB 4BNFA 1KVSA 2D8AA 3BMOA 3QVTA 1EVZA 3ZNOA 2HAEA 1VC2A 4EUHA 7MDHA 3H7AA 5BNFA 4R51A 3BHJA 3ZWAA 1P44A 3MWDB 3PVZA 4PG5A 4PVCA 4TKMA 4J7CA 2YW9A 4CMKA 2JD2A 1ONPA 2GNAA 3MJCA 3KRTA 2AG8A 4JJIA 1PR9A 4RVDA 1JWBB 1T2DA 2Y67A 5JMPA 4R5MA 3H3JA 3Q1LA 4GBJA 4Q3CA 3ZWCA 4NFSA 2BD0A 4EEZA 4DPMA 1O89A 4HFNA 1HDGO 4MP3A 3U0BA 2RBEA 4DGSA 3AFMA 3Q11A 3N74A 1NQ5A 2DBQA 2OHXA 3GZNA 2AMFA 3OEYA 3H5AA 4IS3A 2XXBA 4ZQFA 4IDEA 5C37A 3FNHA 4UVEA 4DWVA 3Q3CA 4A03A 4M87A 3GQVA 4PFJA 4RVGA 4BB6A 5KIAA 2QYSA 1CIVA 5FI5A 1YXMA 3CPSA 1G1AA 1ZK4A 3QWBA 4F6LA 3JYLA 3E5MA 4P8RA 5DULA 3ST7A 2FHSA 4AJJA 4EZBA 4YXFA 4QSMA 1MUUA 2IZZA 1BDBA 4FW8A 1T2FA 4HADA 4J7UA 4L74A 3GDGA 4NQZA 3IUPA 2A4KA 2FR1A
chains in the Genus database with same CATH superfamily
3QA3E 3IIKA 3N53A 4JELA 4JP2A 2CEKA 1RLJA 4O02B 1QV6A 4BO9A 4DAEA 3WXBA 1N0IA 4MZXA 2DFDA 1H3EA 4P7JA 1X92A 1ZD1A 5D1HA 3LQFA 2CNLA 3DP7A 4BU1A 3DNFA 3Q9LA 4MIEA 4O29A 2D7JA 2ZR7A 2ODQA 3A8TA 2CF5A 1COZA 2AG6A 3ANTA 2EIHA 2FEAA 5EFOA 2W6OA 1YZQA 3OJLA 3QJGA 1E94E 2NVOA 5LYJA 2HPAA 3X1WA 2VZ8A 5CMLA 1HE3A 3L4BC 1N2EA 1FDOA 3L8ZA 2XE8A 1UH5A 5HJ2A 5KINB 2R1ZA 3HB1A 1QIJA 3HY6A 5SYAA 4MYHA 2YWJA 1MABB 3RWMB 1PIWA 3Q8XB 1DIBA 1Z5GA 2X3YA 2G0AA 1KIMA 4EB6A 2V5VA 1K89A 1SG6A 1Q1GA 1POXA 3PRJA 3KQWA 1LF5A 2H52A 3LC1O 4LXYA 2G3YA 4K9NA 5JAHA 5CAEB 3DZIA 2RHTA 1YGPA 4TS4A 3RRFA 1IZ7A 3LCJA 3QUCA 4E4RA 1NPYA 3R5JA 4XVCA 2QUZA 3NHAA 1F2UB 1XXHE 2X0IA 3L1IA 4LCJA 4OAQA 5K3SA 3DTNA 2IY7A 3RFCA 2G17A 1EFVB 4U6NA 521PA 4GMDA 4I1OA 4UARA 2IELA 4YVFA 5TNXA 3ZU4A 4DDVA 2C83A 1L5YA 3GPDG 3RJ9A 4MDEA 1JTFA 4J0HA 4B7UA 5AVRA 3L7DA 4EWLA 4RA9B 2QL6A 1P2TA 1NG1A 2ZYAA 1E64A 2V3CC 5C8XA 1O4WA 4AZTA 1U2EA 3JQ8B 1KQ3A 3Q8MA 2QNRA 4JL5A 4XGIA 1NHGA 4J9VA 4LCEA 1KK3A 5FUVA 1DBSA 3TMYA 1QV9A 5HOEA 2YXPX 3BXPA 3R3ZA 5LVAA 1T2AA 2BMJA 4DDTA 4YV7A 2HJSA 3UT0A 4C01A 4AUNA 4LJ7A 2OESA 3H99A 5HVNA 1WKVA 3URKA 1LF0A 3D4OA 1UPXA 2ROQA 2CVPA 3PX3A 4M1QA 821PA 2OUKA 2BFAA 2VAWA 4N76A 2XXAA 2I2WA 4ZMBA 1SUWA 2Z9DA 3QOFA 1U5AA 3EODA 3OIWA 1D07A 2W43A 3AUAA 3BXOA 1M1NB 3TTWA 1OH6A 1COWD 2IZ7A 1EAYA 2ERCA 3F3SA 3HN2A 2I1QA 2R7KA 2UZ0A 3FHJA 4OLFA 4Z86A 5LFAA 1Y6GA 1IVYA 4WKOA 4BNHA 5JMTA 3K70B 4CWAA 4DG5A 3UYLA 5FWYA 4MIKA 4BX2A 3QKWA 3TW8A 3QWHA 3NWOA 2IU4A 4MGIR 1JFFA 5CNIA 1YCFA 5TMEA 3NM4A 3CB4A 2HNKA 3CLKA 4U5QA 3TH5A 4PQRA 1SKQA 2AB0A 1SBHA 4GI7A 4RVOA 5DASA 3O1HB 3UHJA 4TPKA 3ESQA 2IITA 3FOZA 1FZTA 1YZVA 3R6TA 1EWRA 3OQIB 3BL8A 1T5TA 3A05A 5K0NA 3AV0B 3CN9A 4Y6SA 2VAPA 3GFVA 3ZTTA 4IILA 1ZOPA 4DLVA 5IVHA 2CXPA 2JARA 1E1NA 3NTOA 1RWNA 1JJVA 1CHDA 3E48A 2FWNA 2OO7A 1E66A 3K32A 4GOJA 3ZE6A 1NP6A 4HDNA 4MVJI 5JCOA 2UYHA 1HYQA 1LSOA 4JCOA 4PBSA 4OHVA 4OQPA 1NULA 5AW8A 3T35A 4D9CA 3SYTA 5I4CA 3DMFA 2JLZA 2VFAA 1KAGA 2ZXFA 2WVAA 3A7DA 4X90A 5IVKA 4BYGA 4XM2A 2B3TA 1N2HA 2HCBA 4QDKA 4HQ6A 4WVFA 1OLOA 2BEUB 2ZZKA 3OEHD 1DJOA 1Q84A 2EJBA 2YV4A 4FMCF 2A5YB 4MV8A 3V1MA 4L6IA 4XLZA 4B7ZA 3H04A 3AEYA 3E8SA 3ZCPA 1LPOA 3HN7A 1EINA 1Y7TA 4JA2A 6GPBA 1GYPA 2XDQA 3GT3A 4FEAA 3QA9A 4MRMA 4MUMA 4MSUA 3SJUA 2E5LB 4ED9A 4E2ZA 1UXJA 1AQIA 4PANA 2YYYA 2I0FA 3N8KA 4Q24A 1SZDA 4UM9B 5L3VA 4Y9SA 4A0GA 3AHHA 2O2CA 3NDRA 4GYKA 2RH8A 3R3YA 4C22A 1MQSA 1U2RA 2ANBA 1SVUA 1W5AA 3FGPA 4PN3A 1EXNA 4QHYA 2VH1A 3T34A 5BR7A 2N75A 2BP7B 2WC1A 1YB4A 4YCDA 3H2GA 2A3NA 1W5BA 1K1EA 5GONA 2CBZA 3BF8A 4K6OA 3V2IA 1KPHA 3C70A 3AVUA 1MPTA 4Z6KA 3GPIA 1Q0HA 2IX9A 4B74A 3ONEA 4RD0A 2BAGA 1WMBA 2BFCB 2Q4RA 3BKXA 1CRPA 1OE0A 4LYEA 1GEEA 3V55A 1CLUA 2VJMA 1R6DA 5KQRA 1N8KA 4JOQA 2CHGA 2W0SA 2VXOA 3CLSD 3JRWA 4GUAA 5EIXA 3LBNA 1U28A 4QYIB 2IYSA 5EZYF 4HVTA 4GL4A 2XCSB 3SOZA 1D2MA 3WXMA 3DQPA 3MELA 4G63A 4V3CA 3LC2O 3IQDB 3RTAA 3SZOA 1Y3IA 4D9KA 1MW8X 3RKUA 3HWRA 2QDKA 3OQ6A 4JEHA 3A1WA 1GV1A 3L0CA 5CBKA 2SECE 3S2FA 2VBFA 4QVIA 2IXTA 2EQBA 3HLTA 3VUEA 1T91A 2VEOA 3DWIA 5F12A 3HDHA 4M8KA 1V37A 5JNLA 1VRCA 2V4ZA 2WRZA 3C15C 2J3KA 5DU2A 4WFQA 3BJIC 5F9HA 4M22A 4W6ZA 1N5OX 3H2YA 4NPAA 3ZYCA 4RDXA 4AULA 1OI7A 4URYR 3ZHVA 1SJ9A 1TJNA 3ZZ1A 4L9RA 1BS2A 2QRVA 3H4VA 4I5IA 3BGVA 1XVAA 1EFUA 5EE1A 3GQBB 1SK8A 3ER6A 1FU7A 3KJQA 3AFOA 3O90A 1OTXA 1ZZGA 3CKYA 3NTQA 1GWNA 3KOYA 4IH9A 1C9NA 1B0PA 3V7YA 1YC5A 4BX9A 4KIUA 1X80B 2DULA 1J22A 2WG1A 3IPAA 4DLNA 3QLEA 3WBJA 4LFBB 1LWNA 3CG4A 3KE9A 5BW6B 1H0RA 4W6QA 5A6VA 4RELA 1KO4A 1X1EA 1EWTA 1UKBA 4X1KB 4DC9A 4EEXA 1UDXA 2DAPA 4JUIA 4V0KA 2XPCA 3LGXA 4YGYA 3KR0A 4R8KA 5AJWA 5TDHA 3AONB 1NONA 3VU0A 1KOFA 1VDMA 1X1RA 4L4YA 3P2EA 4H0CA 1P8AA 3W78A 2C4UA 3U9SA 3R8CA 4A5OA 1HQYE 1I0ZA 1UJBA 4N9WA 3BJRA 5EXTA 3IKMB 2AEEA 3KLBA 4I5EA 4YMGA 1ZHOA 1GDHA 2B5WA 5FTKA 2Q7XA 3I8OA 4IXDA 1ZR4A 1A9YA 3E1GA 3MTQA 3UK7A 4J7XA 4DXAA 1LSSA 1M1ZA 1MG5A 3FG9A 3NJ4A 2FP4B 4LY6A 5HOQA 3DLBA 1DKOA 4UE2A 5K3AA 2POCA 4DV1B 2WE7A 1ZKMA 1O7JA 2YZ7A 4M1WA 1O94D 3G23A 2J4DA 4MCAA 4B2YA 5KMGB 4IDDA 1V4VA 2EJCA 3LG2A 2W90A 3I2YX 3EYWA 4LWOA 1ZIXA 3GOQA 4GBMA 3DCNA 2FK8A 3G59A 5K0FA 2FZGA 2AG5A 3D7RA 3KT6A 1CUBA 2GARA 1NVGA 1E4YA 2MMCA 2SNIE 3NC1C 1EQ2A 4PQGA 4BGVA 1KNXA 2COKA 1FC0A 4U2GA 3QE3A 2J5KA 3TNYA 2V3WA 3TK1A 1H05A 4NBLA 3EVZA 2VDWA 1BC5A 3OBIA 1N92A 3DDHA 4GXNA 3D3EA 3OCJA 2WHYA 3B5EA 3H1PA 1WUYA 2NQ8A 4YBRA 1N78A 4C0WA 1JU9A 3RU3A 3L8DA 4JLPA 4TRJA 5JARA 2AI1A 1C3JA 4MYCA 1IIBA 1M2VA 2NIPA 3AF0A 3OZUA 4NCIA 1NF9A 4PPQA 4F71A 3DZFA 1ZM9A 4LE0A 2PK3A 5A3SA 3RS4A 1A5BB 2Q3DA 3QWFA 4NICA 4KDRA 4MX8A 4V38A 5EWMB 5KCMA 1ZKDA 5HF6A 2PYZA 4UM8B 2DTDA 3GYBA 4TTPA 5KYKA 1CUIA 1LDYA 1QHGA 2P3OA 5D3ZA 1D1TA 3BMQB 3ICPA 2Z5VA 4R2LA 3CIFA 4DDWA 3RU7A 1N32B 3VDQA 1H22A 2CJYA 3S28A 3V1TC 2JLSA 4BJ1A 4YT4A 3P9QA 3M6UA 2A0UA 2X1HA 1NFRA 2OM2A 2XCLA 3PYXA 1Q15A 2E4ZA 3DFIA 2GTHA 3VGJA 1X1CA 3CRZA 4MWZA 3PYMA 2ZJ7A 4XVUA 1HNWB 3N2EA 1QRDA 4PY2A 5JSFA 5KWSA 1A97A 1SKUA 4Q1DA 2ZTUA 1LTQA 2DP4E 3PGKA 3TLYA 1TL7C 3CFYA 5LN1A 1AOXA 4P32A 3PXDA 1N2IA 3BXFA 1L9XA 2ZVDA 1PNVA 3I2HA 3K6SA 4D56A 2QYTA 1J42A 2IH5A 3M6WA 4I7EA 1Y9AA 4CM9D 2H59A 2YJTD 1SB9A 3D6VA 4N1AA 4RZXA 1R4ZA 4WN9B 3D8UA 4QUJA 5CPBA 3ABQB 3EVFA 1A95A 3EXIA 1T2EA 1CUDA 3OEHA 3TS1A 4U63A 1KMCA 5TGZA 3SXPA 2P6OA 1RCFA 2WQZA 2MHCA 3IR5A 2AEMA 5EA2A 4EMBA 2I03A 1GVHA 3KPVA 3P9RA 4MB6A 4DBLE 4DM7A 1OU0A 1XBTA 4ZICA 4HAOA 2EDCA 3WOVA 4M8IA 1DOHA 1XL1A 3JQ7A 3HH8A 2AYZA 5CJJA 3VNUA 2VDUE 1IEVA 4OH1A 3R40A 5L6MB 7GPBA 2HGZA 2BEWA 3IQEA 1XTJA 1R3UA 1SKBA 3CVOA 1LJUA 4GM4A 2D13A 3OPNA 4Q4AA 4TS1A 4ABYA 1PVOA 2BKVA 2CHQA 3AR8A 1OX4A 2G9VA 4RY2A 4D26A 3EAQA 2RIPA 4LX0A 3ZVMA 2ZI3A 3K70C 3HWWA 2IPAB 2ZRGA 1HT0A 1S1CA 3DZ8A 1A2BA 4Y0VA 4TUYF 2NTVA 4JLVA 1KBQA 3ULKA 2GN4A 5JROA 2BFOA 3COYA 3E0XA 4LRYA 5BN3A 5ULLA 2VQ6A 4OI2A 5L3SB 2B2NA 3L7MA 3UMVA 4XCVA 3DDUA 4R2IA 4J4BA 5FUWA 1ORTA 1DLJA 2R86A 3B8EA 2VOEA 4MRRA 5AUQA 2K5UA 3HHPA 2JGAA 2Q50A 1VRVA 2D1QA 3LW8A 1J5EB 2DPHA 3VJKA 2Z56A 5BXQC 1RI3A 1A2QA 1U0SY 2X4GA 4ZOAA 2ZIVB 4GF5A 2R44A 4YUYA 5LIPA 3TGLA 1G38A 1ZVVA 1A5TA 2FZEA 4Y6QA 4FGKA 2RHBA 2H9IA 2J32A 2V55B 3B89A 3E35A 1YRAA 1U6JA 3BILA 4AROA 4DZRA 1OTHA 2OT3B 5FUYA 5TS2A 3TXAA 3KPWA 4CEJA 3PFFA 4KQEA 1PGJA 4WK0B 3TLKA 1J2RA 1JIUA 4H4CA 4BEWA 4YFYA 3X1YA 3PWTA 4GYWA 4TTAA 4WBNA 1XVIA 4CCYA 3LKBA 4XE5A 3QFTA 4P83A 1M6NA 1QYWA 3D1VA 4EX7A 3M70A 4P0QB 4MVJE 4OJMX 1TI7A 3IJPA 2DHQA 3G13A 2FUG6 3C8MA 4L0QA 2CHEA 3I5AA 4I55B 3SZMA 1R3DA 5TB5A 4H18A 2JJ8A 2ZRDA 1FFWA 3PENA 1U7TA 2CFCA 2R8RA 4IOKA 1TYAE 1Y5NA 1GL3A 5DX1A 3JAMA 3DF9A 4JKIA 4XPIA 4A0RA 1KAEA 1P5FA 4UFPA 2PG3A 1SU7A 3MINA 4Q3NA 3K96A 3X2SA 1JDSA 1OLUA 5EQTA 1EMDA 2QP3A 3GV0A 2I67A 5TPZD 2UVPB 2F3TA 2YRXA 4B6SA 4ZKDA 1LD3A 1C80A 1FSGA 3RIYA 1H8EA 1EI9A 2KLBA 5F64A 1XDWA 2JFHA 2V59A 3E2IA 3I32A 3QX7A 4HMOA 4OHWA 3R7BA 4F5DA 2YQZA 2ZAOA 4MARA 3AIIA 4X20A 3L8FA 4GT1A 1L7NA 1RIFA 3QVVA 4DUPA 3OIFA 3V8MA 2QX8A 3BH6A 1WE2A 3NBZC 2G67A 4P53A 2HA5A 4OP3A 5E6RA 4Y2HA 1YTLA 1K8ZB 3CXUA 2UDPA 3D6JA 2X5NA 3WICA 2YN2A 1JJAA 2VHVA 3PG5A 4N8EA 2OORA 2PD4A 4OSPA 2C77A 1RMQA 1JKMA 2CXHA 5A3JA 2IEYA 1YBMA 4IVRA 4JBXA 1NG9A 1LPAB 2Y66A 3KELA 4EG1A 5BV0A 5JASA 2G1JA 4TKLA 3ED1A 1U0EA 4NJEB 3UHFA 3QSGA 3OCUA 3DBLA 1VIVA 1HZZA 2Z2ZA 1XA3A 4WKBA 3MGBA 1P74A 4XUEA 4OI1A 1NV9A 1VIYA 5EHQA 4MVJA 4CKXA 1TTPB 2GEDA 2X8BA 4CJXA 3ZU6A 3JQBA 1OSNA 4PLZA 4CMAA 2G8NA 2X5JO 1B8NA 2JI6A 3LP8A 4J03A 2WP0A 3DTVB 4I46A 4EK9A 1SZCA 3Q2IA 2J45A 1E2QA 1CB7A 2O7NA 3VAAA 3BMCA 4M55A 2QTWB 4QXMA 2ZRQA 2FW6A 3AFHA 3PT9A 1FNCA 1X15A 5IC5A 4C0SA 1JVSA 1YBVA 3U4CA 4TYNA 2GN2A 5F33A 3I01A 3WJ1A 2WPDD 2RGYA 2RGEA 4OTZA 5ECWA 2G71A 3OAAA 2O3SA 1TM1E 1Q1ZA 4RVNA 3IHWA 4ZRMA 2ONJA 4E0BA 1U4OA 1DTWA 1T6NA 3FPEA 5E9WA 3V1UA 1QYCA 5K0BA 3OWHA 3UAVA 3JATB 4PQFA 4DARA 3SSMA 5BQ3A 5AKHA 4KR0A 1VHLA 5SY9A 4DSNA 2F64A 1DU4A 1GZUA 5L40A 3VXKA 1O6BA 4UUNA 1DV1A 4EH1A 4EGFA 5A4MS 2BKAA 1FQJA 2IXFA 4P7KA 1KOLA 4EKNB 2YNMC 3OIVA 1DFHA 3OIUA 2V6BA 4G97A 4XJTA 4CE6A 2A5DA 2O07A 3ZE0B 1GGKA 1REQA 3DOCA 1IY8A 4YJFA 4QGFA 1H4QA 2H4JA 4O6VA 5G0WA 3ZGNA 2GM3A 2O1EA 3GARA 3OZDA 1K7SN 2PRSA 3NU1A 1BYUA 2P41A 1MG0A 2HPHA 2QZ4A 4B3DA 1PJ8A 2IOFA 4FUTA 3ORHA 3QEMB 3LVRE 4NMXB 4I9UA 4D25A 1T0BA 3GVHA 3IA2A 2L0XA 5K8IA 2Q6TA 4UHJA 1IBSA 5F3WB 1K8XB 1CQIA 1SU6A 1ADJA 2GO1A 2Z5GA 2GK3A 3A9TA 3CE6A 4EKYA 3AIKA 1LNSA 2ZRJA 1Z9BA 1ZAKA 2XUAA 3KVVA 4YWJA 1L5ZA 4X3PA 2NU8A 1DBWA 5HM6A 2F4VB 1XTIA 3OFVA 3MRXA 5H80A 2NU8B 1CDDA 3VGPA 4JVNA 1ZNWA 2J09A 3OOYA 4L50A 3IV7A 1ODSA 2VPIA 1E3DA 2O4UX 3NNSA 4OQFA 2NSLA 1M8PA 4EF5A 1IRIA 2GVNA 3ON5A 4XUCA 4L7VA 1HPLA 1PTJC 4WGFA 2J87A 2P1RA 3FNBA 4UBOA 2O8CB 1U02A 1U28C 3W2EA 1UT6A 3KKKA 3CRVA 3V8QA 4CIBA 3L01A 4NJEA 3AHCA 1KH2A 1DRWA 2G4LA 3DWEX 1XYGA 2P27A 2NPOA 3BSWA 3VSCA 2VDRB 2P3QA 3OZFA 1TUEA 5C46F 3HKDB 4GE3A 4XLTA 1QIGA 2J5QA 3N58A 3LX8A 1IHDA 3PFWO 4RZIA 1X38A 2ENUA 4KJZA 4Z8XA 4ERNA 1SD5A 3N8GA 2XT6A 1F48A 5HZGA 1XF1A 3PFIA 3FJ1A 5IN5A 3P45A 1VKOA 4JZYA 3IALA 2JFGA 2IUSA 5KTPA 1VTKA 5AW9A 4A6PA 5BYJA 4JSRA 5BUCA 2YS6A 5T6BA 4P5EA 1MX1A 2R2AA 4RXUA 5U1PA 1DBVO 2HSZA 1UOQA 1AN9A 2P9QA 2VK2A 4ZQCB 5GINE 5JBIA 4N54A 2B4RO 1Y82A 2GJ9A 3W5BA 2FPIB 4ACAA 4IMJB 4LDRA 4ZZIA 3SQXA 4RUKA 3ONFA 1N0VC 3LKZA 4PONA 1Y37A 4D9GA 2I71A 2NSJA 3AF1A 1NLUA 3HB5X 3PIRA 4GX1A 3U7QB 2X8LA 2FG7C 3LT4A 2AOVA 1J24A 4PPFA 5KREA 2XT0A 3ZLJA 1RT9A 3M6MD 2JZOA 1Z15A 3E7DA 1CQZA 3F49S 3VNBA 1JDZA 1N1MA 1R0WA 4Q4DA 3W8NA 3FX2A 1F5NA 1ZRMA 1JYEA 1WOMA 3JVEA 1BCRA 4IDPA 4ZYUA 3PJFA 3UQYS 4TV9A 2DTXA 3L7KA 5KKAA 1ZCFA 3O03A 1ABFA 1F0KA 1EXMA 3BRWA 4R8RA 1ZW6A 2H57A 2VQ3A 4U8GA 1MU0A 2XMRA 1ZOLA 3T15A 5L4SA 1YK0A 2J4CA 3ML1A 5DGXA 4MJLA 3N6VA 3WGHA 1FP6A 3DMNA 3D7SA 5BSMA 5JI3E 3I4CA 4I9HA 4J0CA 4M1YA 3QUSA 5LOVA 3NWEA 4QNNA 2ZANA 5H9VA 3WP0A 2BH2A 3UOWA 3U9TA 4JC8A 2RCYA 2OKGA 3ICCA 3NIGB 4IFBA 1KETA 1NBME 4I3GA 4L0MA 4TZ6A 4EVQA 2ASEA 5GV8A 3EQ7A 5HDBB 5IDQA 5ICGA 2A5JA 3E7XA 3C8DA 3TJRA 2B8JA 1G5QA 2B99A 4S2EA 1A9SA 5KNBD 2GZ2A 2W6CX 1GTJ1 2BHRA 3AP1A 3GGJA 5IYZB 3SHOA 1NUUA 3EBOA 1IXYA 1KZGB 4Z4CA 4EHIA 1NVEA 1RYEA 3G5UA 2PEZA 4NESA 3I5XA 2RHRA 3RS7A 1EUZA 1N6IA 1DC7A 1Z75A 1DFIA 2FPPA 4FFMA 4LIPD 4YDQA 5KNLA 5B4VA 2GRUA 1LRLA 3KOWA 4HEJA 1N6KA 4KL8S 2AJ8A 2PZEA 4AY5A 4M89A 1WV1A 1SUSA 4GQIA 4XTRA 3ZN2A 2O0LA 2VNHA 4HC4A 4BVJA 2GPSA 3FDIA 2FZLA 4DIEA 1RQ2A 1JVNA 3C4VA 1WMFA 1PX2A 2YBEA 3LD9A 3ZDBA 3UAZA 3JZDA 4LFAB 3H1GA 1GPBA 3KLMX 4ENPA 2DKOA 3C1TA 4DMLA 2D0OB 3H2IA 8GPBA 4MS1A 4HAVA 1X9IA 2TMDA 3CF0A 4FGUA 3F8TA 1QK3A 2M98A 3C41J 5CW1A 4FZ3A 5TS3A 3OWXA 2X0DA 3DEIA 4P92A 1HRDA 1NT4A 2YZGA 3NORA 4WW0A 5JWOA 5I9IA 5EJFA 1FMJA 3QI7A 1MKYA 2A7QA 4JODA 1JDVA 2DH5A 4ARUA 6ABPA 4CCYB 2XADA 3B53X 1SXJA 3HDTA 4YIKA 4RVCA 3UN1A 4HH0A 2FPPB 4DLXA 2VUIB 3IE2A 3PHLA 4ZQBA 3L0PA 3DE2X 3ZHBA 3AV3A 4DTIA 1T2UA 2BIFA 2OILA 3IQXA 5FQOA 5PNTA 1JQ3A 4J0EA 3QWAA 1K92A 1JHQA 2XZTA 3OZWA 4YFVA 4GG1A 4B3FX 4P3PA 2XWPA 4EEKA 1MB4A 2GOYA 2VIIA 5ESRA 1XN4A 5IH7A 3ASVA 3H5WA 1PGPA 4GR5A 4HH3C 4J7AA 4XM1A 2EX4A 1Z5PA 4KGZA 4U7TB 3ZK8A 3ZV5A 1NX9A 1F12A 3OY2A 2XGGA 4ETNA 2AMYA 4M9CA 1GJRA 2TMGA 5AVKA 1Q2XA 3THXA 4CMIB 2HWKA 1DP4A 4IUCS 3JYNA 4A2PA 4JENA 1LK7A 1D8AA 1RI1A 1UUFA 1HNNA 3QFSA 2L19A 1ODCA 5HZKA 1HFJA 1WQ3A 1GHTA 1XLTA 4OMDA 3G5TA 3ZWQA 1SKMA 3F1KA 1Z0AA 1JSXA 4G2NA 1KKUA 1C1XA 2RI1A 4XSHA 2F3UA 4Y18A 1PT5A 4XX0A 1DIGA 2I80A 4JI8B 1SA0B 5JXWA 1D9XA 2DY0A 1U9JA 3CRMA 3K0AB 2HY7A 4MCIA 1G5IA 2VQEB 1IZYA 1MX9A 1ZGHA 2JFUA 4ENRA 5C53B 3ENWA 2BEVA 3LHDA 5EP3A 1SCDA 1N5MA 4BGEA 2WFLB 1VMIA 1QQ7A 3SVTA 1TUIA 3MIZA 3QE4A 3EG5A 4OYLA 5T4HA 2LCIA 2HA0A 2E49A 1O87A 3EW7A 3IQWA 4PYQA 2V7EA 4QICA 4F3NA 3DUFB 4YT5A 3ZBQA 4CU2A 4GP9A 4PLVA 4YEDA 1PBTA 4CGYA 1JEEA 3IQZA 4C06A 5I9NA 1F0PA 2C2GA 3C1OA 5T8KC 4C7OA 2NADA 3C3BA 2HMTA 1WSWA 5SZJA 4ZI7F 3P20A 1K5GA 1GXSB 3P1JA 3NVAA 1T4CA 4HFJA 4P81A 2YY6A 3UUEA 2BSQA 3OM8A 1JLHA 1RR6A 3I6QA 5IDYA 4ESVA 2QN8A 2GAFA 2V03A 5IEBA 3SE0A 1GN8A 3VTAA 3NRBA 1Z2EA 1Q0QA 2A30A 1V1RB 1FU4A 2DPGA 3HVHA 2PZMA 1ZD2P 3MJVA 2QX4A 4WFIA 3SLRA 5DP1A 2NO4A 4P4SB 4TWRA 1VJDA 1H9CA 1UJ2A 3HYLA 4LWZA 1XHEA 5CB4B 1HQKA 4L2IB 3OWOA 4LVCA 3ZWYA 5K3DA 1W1UA 5ALLA 1UBSB 2W2OA 1WEKA 5HRUA 1AD2A 3FUUA 1IUPA 3KKOA 2ZATA 4RD2A 4B8ZA 3AYXB 4BFTA 3N05A 4EYOA 2PGXA 4BLOA 2IHVA 2IQIA 1U2ZA 1MFZA 4UHEA 5CCBA 2FCAA 3D4NA 5H0IA 1PL8A 3JYPA 5K8VA 2WOJA 3WLQA 3SXJA 4DJDC 2RDMA 4R4JA 3SPXA 2F8SA 3CMCO 5JYDA 1Q5PA 3L7AA 4L4ZA 5FWNA 2D7DA 1ZINA 4X7MA 3IDOA 4F4FA 5FT9A 3BE6A 3IP5A 1U8XX 5ALYA 4EJSC 4NCKA 1T9GS 1ZA2A 1RM5A 2RONA 4P7FA 2IOYA 3C14C 2G7MC 3FM9A 4LCBA 3WGLA 3L4EA 1FDWA 4QQ8A 4C4OA 5JMWA 4UJ5A 4ZOEA 1K4YA 4WN3A 4L8VA 3T3NA 3C3DA 1RTKA 3K4QA 5JADA 2VRWA 2C4VA 4TLCA 3PKIA 4ZV9A 3LHIA 1QQ5A 2QVYX 3R23A 5ANRB 4FDAA 4YXWD 5K0EA 3LCVB 1NW4A 2HHCA 3FHCB 2YXBA 1NRIA 1NVFA 4RWEA 1VG9B 4K40A 4CF7A 1XMIA 2AJTA 2WZQA 2ZR8A 4KR9A 3LPAA 4LQ4A 3HRHA 2BR4A 3KIPA 1E2EA 5KNCH 1LS6A 3KPJA 4K9LA 1QX4A 3PQCA 1ZD8A 4AY6A 3NEPX 1ZMOA 4I1UA 1VL5A 3VOSA 1MOQA 2VJMB 4M1ZA 5EERA 3C5EA 1W5SA 1XMPA 2JRCA 3FFAA 4G5RA 1L4UA 2YV3A 3R8FA 5ESDA 3AGPA 4KR2A 1H1DA 4IPTA 4JLDA 4G24A 3WJ2A 4BL5A 1REQB 4F4UA 5ALZA 5JSHA 2XAAA 5KNDA 4YYZA 5G4KB 3HY4A 4Y1EA 4ENSA 5BNWA 4DMMA 3QY0A 3QP9A 4OQNA 1KEZA 4CFZA 1WULS 2Z3WA 3ABZA 3D1JA 1JHYA 3ISVA 4COKA 3GEMA 3B1ZA 3G8AA 2VT6A 2OCPA 3BXZA 4G56A 5EAIA 1T8UA 3JATA 2V6MA 1YWGO 4JJ8A 4NE2A 4YJ3A 5BN5B 4M0MA 2F9MA 1DTWB 2QKYA 5IT4A 5D3KA 1UWKA 3E9NA 2WSBA 4B6JA 4BRZA 4C21A 3I2IA 3MWEA 1JZSA 4LDJA 1JJ7A 2QJRA 3EIQA 3U4IA 4RKRA 4BCBA 2P67A 4Y1FA 5CVUA 3TR0A 4YMVA 2Q6IA 5KC9A 3VR3D 2Y9MB 5JWHA 4ALNA 2Q6VA 2QRVB 4ITUA 4KKXB 3VPBA 4DSOA 1AHPA 4LRQA 1UOOA 2HLNA 4YRFA 4HBZA 1R0ZA 5IT0A 3TCNA 3OFJA 4J76A 4ZAFA 3HSSA 4KIJA 2R00A 2W6NA 3QEBZ 4H6XA 2PKEA 4L4RA 4AIRA 2VTBA 1VG1A 4XIFA 3NGLA 2NU6B 3WFIA 1E59A 1AUPA 4QSHA 4A91A 4FYMA 1A2OA 1Y7PA 3PFCA 4EHKA 4CI9A 1S0UA 1JAYA 1WU8A 4AY4A 1GSOA 1AXEA 2HREA 5GZ3A 2NVBA 2QXYA 3N59A 4C2AA 3L1UA 1AKVA 1FP4A 1ZMTA 3K9NA 2JJYA 3KB2A 1NU6A 4NECA 5D2CA 1B8OA 1QLJA 3FRJA 5D87A 2GJ4A 3NCTA 4K2HA 3KLNA 2YKGA 1NI4A 2WFMA 1GYRA 3AM4A 4QGBA 1ZWLA 2JL1A 4ZAGA 3VU9B 4GI3A 2DUWA 1CG6A 5IK2D 1N8NA 3W2IA 3VKVA 4QOEA 1B0AA 1OJ7A 1QZXA 2A78A 1JKIA 1ZM3A 1CDOA 3EMVA 1YQTA 3IDSA 4S0XA 1FLDA 2PAFA 3KZCA 5HTOA 4XWAA 3ZY4A 1A8PA 1U0OC 4DSZA 1E58A 5ALVA 1SPXA 5DK6A 1TFRA 1RXYA 1KR5A 1WXXA 1Z8NA 2E18A 2J3JA 2RJOA 3FF4A 2BGWA 1Z7GA 1MAWA 2CHUA 3NHBA 3QRWA 4AYTA 1IK4A 5DBFA 1UQUA 2V9CA 3HL4A 3SYLA 5CITA 2XXAB 1U7OA 3EC1A 2XUZA 5K0SA 4HGZA 1NNI1 3ZY2A 1QTNA 1W2HA 3EZNA 4EMUA 3CXRA 4A2WA 4WLEA 1YDHA 3NIBA 4LF7B 1JXQA 2WKQA 1Z5WA 3ZHTA 5J4HA 4R31A 1T3SA 1KP3A 3KB6A 3D3WA 3VR2A 2NQTA 1CUSA 4HRYA 4HXGA 4N8DA 2JGDA 5KYXB 1YTUA 3WB2A 3RREA 5JAMA 3HVKA 1C41A 1BH6A 5J43A 3ZZTA 4R1PA 3GNQA 1F4LA 2CDBA 3O2NA 4FD2A 4LPSA 3UV7A 4DABA 5JANA 1KVQA 1RM4A 3ETDA 1MC5A 2RHMA 4QFBA 2CFIA 3T5DA 5CA1B 1RW4A 4QGHA 5G2OA 5B6PA 1SELA 2OGZA 4C6SA 3GJSA 5E6RB 3YASA 4DWWA 5BP7A 3QEOA 4BNTA 2V5AA 3GBSA 4RZ2A 3TFWA 3SHVA 1CZNA 4TM7A 1C7FA 4ENQA 3SJ7A 1N2CE 3OIGA 2WD9A 1WW3A 3B20A 1WXEA 5CXQA 3A3YA 1ZNYA 3R5SA 4KVZA 5DNWA 1F2UA 5DHPA 3DBRB 4UQPA 5I7UA 2NVUB 4ZEVA 4Z4QA 2CVFA 2OB2A 3VR5D 1IVSA 1SCNE 5I7FA 2FN9A 3RG2A 1DZ3A 4XVQA 1C7RA 4KC0A 4XR9A 3SNKA 5HFAA 4QODA 2FMKA 4Z4HA 1XMOB 3U2QA 1WHTB 3L5KA 2XWQA 9ABPA 1ZUHA 4EOGA 4Q48A 5JDIC 4HLUA 3SX2A 1KU0A 2ONKA 3L84A 3TQOA 3F3YA 2Z3ZA 3E82A 1RKXA 3KZKA 4YTEA 1I5OA 4ND7A 2WWVD 3UG6A 3I9LA 1CYDA 4DIFA 4KXFB 1YUBA 4TYWA 4WLOA 2YYSA 3ILXA 3URMA 5C5IA 4WECA 5CFZA 2W2VA 3QM1A 3WA6A 4UAUA 3ZX4A 2J59A 2A84A 3GUZA 5FP0A 1XTKA 5LBUA 4BU0A 2DY1A 2ANCA 3P0EA 1V1MB 3L8MA 2QHXA 4DJFC 4E1BA 3RC8A 3DEAA 1UK6A 1ACLA 3E18A 4O1HA 3GLHA 1CS0A 1FUKA 2YVAA 4BQOA 4KO2S 4OIMA 1DAPA 4LGMA 1PKXA 2D2EA 3GGGA 3NM5A 3HA5A 4KE7A 1FE8A 3IUJA 1TM7E 4OYHA 2VA8A 3KPYA 4KDFA 3EC7A 3W90A 3M1YA 4KUGA 5AVOA 4EELA 3NVDA 2OZLA 3C8HA 4RHXA 3DZGA 5IDWA 3FFXA 4DFDA 1J9GA 3Q10A 3A9UA 4EHAA 4LRTB 3WLJA 4JR1A 3TE6A 4LJKA 3SJCA 5J1TB 2VJAA 1MEJA 6Q21A 3U60B 4NU5A 1ZJWA 3HCWA 2V6JA 1US8B 4ER6A 4QLOA 2JK0A 1OREA 4LMPA 1EFPA 1QLWA 5AW3A 5JNUA 1P4HA 2IYVA 3VVLA 4BAGA 5C52B 2XNJA 3QHAA 1YMQA 4N82A 2B4QA 1ZRHA 1XV5A 3F98A 5CB6A 3OP1A 4Q39A 4UDOA 1A9RA 1A8SA 2J0VA 2QK4A 3D6NB 2H5IA 2ZS9A 3ZD9A 2B36A 1KI6B 2OOSA 3PZBA 3I6MA 2LE0A 1EHYA 1B6SA 1NYLA 3KSUA 5KQMA 3KEOA 5CVDA 1QU2A 1CY7A 4JVLA 3U16A 1MA0A 1PFKA 3ASUA 3HCEA 1VKJA 3IAFA 1RC0A 4L9AA 2QPAA 4YMUA 3GRUA 5EPOA 1SBQA 4QYXA 5DGCA 3W77A 1BH2A 1M2NA 4G5OA 1SXJD 3PCTA 2GBLA 2RKBA 3LIPA 4QQNA 2VYVA 2I3BA 1E6UA 3VH2A 4NK4A 4N0PA 5CT5A 4AKTA 4L3OA 3T61A 4OX9Y 1ZJYA 4GIBA 3FMIA 4TV8B 1C7EA 2O52A 2AG0A 4PINA 1FLNA 2V9ZA 4AO8A 3W5DA 4RKYA 1EQAA 1YOBA 2J3DA 3AHEA 3CWCA 2B1GA 3DEYX 3G9XA 1XD9A 3QQPA 4OJKA 4RFLA 2YWXA 1XPUA 1BA3A 4ZKEA 3WDMA 4DCGA 2QVZX 5DKFA 3LPMA 1E79A 4M98A 3ZHXA 1TEVA 2ZSUA 3EWNA 2AUTA 4DQDA 4ZYXA 2X9GA 2P5YA 2IYFA 4GM0A 4QPDA 2WSSD 3ORQA 4MGEA 1C3XA 1CIPA 1Q44A 2AX4A 3EUAA 1KFEB 4EO4A 5EMLA 2QMUA 5T7BA 1ZXXA 3CUUA 3IP3A 4PO9A 2GFQA 5KKCA 2A9FA 4C4XA 3FOFC 2JANA 1H4TA 3SVZA 1W0CA 2I91A 3QPCA 4TWZA 1P81A 4KQFA 4TWJA 2IFTA 4X6YA 3RYTC 5CEFA 3C6MA 4JDPA 2QG9A 5SYMA 4AX4A 1HYEA 1G4HA 5DMXA 1IMJA 2ZZNA 1PJ4A 3Q8KA 4NBVA 1P2DA 4NI5A 3WNCA 1JLRA 1XZCA 2FUEA 2H00A 1XRQA 4FGLA 2AUMA 3NGMA 3SHWA 3N3BC 4BQSA 4YNBA 2H2AA 5TGDA 3DCIA 1XFAA 4EGQA 1I13A 4BVEA 5JDCA 3AQIA 2K6GA 1N3YA 3DEKA 4LDAA 3CUVA 2AHRA 4P54A 2IPMA 1IIRA 1JDUA 4MWSA 1ZH8A 3JWJA 3DXFA 2J0UA 1RWBA 3BSYA 3PL5A 4Y9DA 1DKRA 1K6EA 2QD4A 3EOBI 5DH9A 4Q9IA 4RPCA 4YB8A 1XRMA 1B93A 4CLXA 3O31A 2PE5A 3F97A 1ZN9A 1PUIA 2X4IA 3H84A 4UU7A 3ISJA 3HCAA 3NUQA 4JFRA 1WO8A 1YJXA 8LDHA 2BUAA 3WYDA 4F3CA 2BMWA 4DSAA 3WKBA 3GQBA 4W5RA 3DB1A 1XLTC 3V3KA 5LBTA 2FHPA 1ZCJA 2JFYA 1SCJA 3M81A 3IT3A 4IVQA 3WYCA 4TTRA 2HF7A 2IV3A 1PZEA 1VYUA 4CODB 4Z4GA 4LNUA 4Y67A 5EE0A 3FPGA 4R9SA 1WLYA 3PWSA 1E3EA 4AS1A 4EBBA 2PXXA 3C1AA 3MJHA 4TXNA 1E18A 1RABA 1I7SB 5CYGA 3JQDA 2O7RA 5DN6A 5FFMA 2HU8A 1CJUC 3PFBA 1E3MA 4G0QA 4J1TC 4BNIA 4QM7A 1N6OA 5B4TA 2R8XA 4K7JA 2HHJA 2MMGA 4OA8A 3VR6A 3WWOA 4AMGA 4GR4A 4JI7B 2QU7A 4RH1A 2PT6A 4HN4B 2ABWA 4NEHB 5B36A 1LQ2A 3K1TA 1OPXA 5DHFA 1ID1A 1TYDE 4RIHA 3SYNA 1UK7A 3ZWPA 1JPNA 1J06A 3A31A 3IUEA 3ZCTA 2HZBA 1SKYE 2JW5A 4S0ZA 2NSYA 4DN6A 2WLSA 2QJFA 3THSA 3UXMA 2DCMA 2OBMA 2A67A 3HU3A 2RGUA 3M34A 4LYYA 1ECCA 4TYPA 1N6NA 2V7WA 3HKEA 4L02A 4OGLA 3F8WA 3EZ6A 4RTMA 2RCNA 2VO1A 2NU9B 3L4KA 3KR2A 4PIVA 1NVWQ 3WL7A 1XR3A 3F6PA 3ETGA 2VKQA 4HDQB 5IAKA 4Z51A 2X5OA 1MT3A 1N1DA 4PHFA 5AKYA 4AZVA 3L7LA 1RLIA 1UM8A 3H9GA 1ZISA 1TU4A 5DP2A 4D42A 5JISA 2QYOA 1Z68A 2PR2A 1T1RA 2DFTA 2QLMA 3AERA 3EPRA 3KYCA 4N5IX 5EGNA 3ZH9B 2B9VA 4F86A 1P0FA 2D5CA 4XGQA 3WYFA 3B51X 1FNMA 1RAAA 3QYAA 1JHDA 1YRWA 1KZ4A 1R0CA 1UZUA 3MTBA 1IY9A 2FEMA 1UXIA 3MBOA 4PZZA 1NMYA 5FOXA 1O0SA 3QPDA 2WZCA 4JBIA 4IXTA 1W94A 2O3UA 2DZDA 4C78A 4KQ2A 1L7OA 4PZPA 2BVNA 3FAZA 3HFRA 3CJRA 2ZYWX 3EDQA 4NBUA 1E1CB 5AO9A 2C9MA 3CF6R 3HCRA 1YQEA 3NHLA 2V58A 4OBWA 3G88A 4JI2B 4C7MA 4KWIA 3DXXA 1HQDA 3A9CA 3RSOA 4UUMA 2J3LA 1GO2A 3FR7A 1ULTA 5ED0A 4EHHA 1UAYA 4R0VA 5IH3A 1H2BA 1XZBA 3I62A 2WYIA 2ZIZA 3L93A 3LYHA