3W8NA

Open form structure of cmp kinase in complex with cmp from thermus thermophilus hb8
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
204
structure length
201
Chain Sequence
b'GIVTIDGPSASGKSSVARRVAAALGVPYLSSGLLYRAAAFLALRAGVDPGDEEGLLALLEGLGVRLLAQAEGNRVLADGEDLTSFLHTPEVDRVVSAVARLPGVRAWVNRRLKEVPPPFVAEGRDMGTAVFPEAAHKFYLTASPEVRAWRRAPQAYEEVLRDLLRRDERDKAQSAPAPDALVLDTGGMTLDEVVAWVLAHI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytidylate kinase
publication title Crystal structure of CMP kinase: insights into initial substrate recognition and reaction mechanisms
rcsb
source organism Thermus thermophilus
molecule tags Transferase
total genus 62
structure length 201
sequence length 204
ec nomenclature ec 2.7.4.25: (d)CMP kinase.
pdb deposition date 2013-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02224 Cytidylate_kin Cytidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3w8nA00
3L2OB 1JAHA 4B6FA 2FX3A 4V0NA 2WSMA 1U8ZA 3RYTC 1OV4A 4YMWA 4L9WA 2J7PD 5EZ5A 3OIWA 721PA 4KU4A 5L3RA 2ZRFA 1OT3A 2BMJA 4OHXA 1QVRA 3KXIA 2NZJA 4D26A 4AI6A 2VH5R 1ELOA 5HZHA 1Z6TA 3EWAA 1NN0A 4GDFA 2IYUA 4RCYA 3AVXA 2BJWA 5FR1A 4Q21A 2WOOA 1Q21A 4OHYA 4B74A 2VF8A 2W0SA 5CK4A 2DFTA 4OI2A 4NP6A 5CB6A 1XBTA 2IL1A 3DM5A 3K9NA 3EA0A 1Q1BA 4FMDB 4PQFA 1C1YA 4QHTA 1SQ5A 5F9FA 4RFSB 4PQYA 4DLUA 3TAUA 3CX8A 3BE4A 4D0GA 4ZI2A 3EPHA 3TMKA 4OQXA 1ZM3A 1WXQA 4L15A 3OIYA 3W9YA 3SC3A 1OB2A 5JSZA 4AD8A 3KJHA 1KAOA 1KJYA 3M1IA 5HR5A 3TE6A 3GLFE 1PLKA 1N6KA 2DCUA 4KBGA 5IK2A 1G1MA 4FINA 4CVNA 1VCOA 1EXMA 2B92A 3PEYA 1XPRA 2ZJ5A 1RRGA 1W0KD 4ZDKA 5JJLA 4Q1EA 3QF4A 3B78A 3CPEA 1RIFA 5FOXA 1T3LA 1DARA 1FNNA 3EPJA 3C16C 2IHYA 2C95A 1E69A 3MSXA 4QHYA 1JEEA 3CX6A 1VYUA 4XVUA 4R9UC 1N0WA 3CPJB 1D9ZA 2PH1A 2V6IA 2IS4A 2Q6TA 3X1WA 1XJCA 1IN8A 4Q9KA 2Z6VA 2HJGA 2ZITA 1KKMA 2J45A 3CF2A 3SBDA 1OIWA 2DWPA 2WAYA 3AF3A 4LBVA 5CIWA 3CBQA 4A0FA 3U7HB 4L4UA 3Q3JB 3HU1A 3EZFA 1YU9A 4A82A 2MSCB 2EYQA 1GNQA 4KO8A 5B58C 3AVTA 3L0OA 2HYDA 4NL4H 3KB2A 4UXJA 4ACAA 2BCJQ 4QJ4A 5ANRB 5FTNA 4BFXA 1TQ2A 2KBFA 2FF7A 3LVQE 2JJ8A 1P72A 1FX0B 4DB2A 4CEHA 3PQCA 2HF8A 3ZVRA 2J59A 1D2NA 1FQJA 4UNQA 4TLAA 1E0SA 1TEXA 1W4BA 4QNMA 2FFBA 3P1JA 2ZQ5A 2AX4A 4A8JC 4XWKA 1W4CA 5KNCA 3FOZA 1YZTA 3HPRA 2V7QA 3B1VA 2G88A 1NNEA 1H65A 1IXZA 4PHHA 1R0WA 2WAXA 4LV6A 3KXLA 2YKGA 1CJVC 1L8QA 2ZVPX 3LV8A 2P6UA 4KFUA 4KAXA 4ARZB 1N5KA 1Z0KA 3HPQA 2J87A 1US8A 3LQRA 1VIAA 3DVLA 2YHSA 3KTAA 4DLTA 2DFNA 5SZKB 3BS4A 2FFHA 4OI4A 1JR3E 4II7A 3RANA 1QBKC 3SJAA 2PEZA 1COWA 3KQNA 2OCAA 2QTFA 3CR7A 3K1JA 1YKSA 2KB0A 4FMCB 4LC1A 1SVKA 4P31A 4ZDJA 3ZZ0A 3ICEA 1PLJA 3AKDA 3CH5A 3HU2A 1KDRA 1OFHA 1HH4A 3K0FB 1HV8A 3MGCA 3CRQA 4TT3D 4HUQA 2F9LA 3N70A 4TTRA 3W34A 1RJ9A 2CDNA 2F3RA 2RHDA 2VP2A 2N42A 4LJ5A 1KJZA 1XXHA 4V03A 4IXMA 5EJEA 1YZKA 2R6GA 2BV3A 3DKVA 4NMMA 3RAPR 4BEBA 1IHUA 1Q1QA 1UBEA 4IXNA 5CDFE 3EZ7A 5DN6A 1E9BA 2H1LA 4DDTA 3ZS8A 3MMPA 4RD1A 1XTQA 1HEIA 1XX6A 2ZI4A 4UNRA 1UFQA 1KDPA 3V4FA 2EWWA 2FMXA 3L8ZA 4LHYA 2A7QA 4XTCS 2IF0A 4OQLA 2Q0HA 4XJXA 4QBGB 2QTVB 1AZSC 2IWHA 1Q1EA 2KSQA 4EJSA 2ORIA 5BYJA 1YJ5A 1HYQA 1AS3A 2CJWB 4U00A 2CNWD 2FG5A 4NONA 3THXA 4LUCA 1JAIA 2RGAA 2DPXA 5JEDA 5JRZA 1N6PA 3SR0A 3T34A 2C78A 3RNLA 3NTUA 3ZQ6A 3QY0A 2V1XA 1WCV1 2GXUA 4PC2A 5FPYA 3LLMA 3NEYA 4YXWD 3CX7A 1ZUHA 4LX0A 5E4FA 3WYFA 5FPHA 5HTKA 1JNYA 1XMSA 2FPKA 4CT5A 5F2EA 5JWOA 2HEIA 2ZI7A 1RYHA 1X8KA 3QG1A 4LHVA 2H17A 1NVVR 4HEJA 5FPKA 2AKAB 2R6DA 3VR2A 1LW7A 2UZIR 5KTYA 1ZBDA 2C9CA 2GJSA 3B1YA 1NVXQ 2WPDA 5J4YA 4PO9A 1EFTA 4B48A 1ZD9A 1GWNA 5G3ZA 1NY6A 1FTNA 3N2IA 2G83A 3HYRA 4W5JA 4LWZA 4HB0A 1TAGA 3CNOA 2PMKA 1SXJA 3KQUA 5FBQB 3I61A 4JBYA 3AF1A 4PSKA 3FE2A 4FIDA 4DRZA 4B3FX 2Z4RA 1E3MA 4FCWA 1OKKA 5AK0A 1W5TA 1LFDB 1ZIOA 1N3BA 4LYHA 1HE8B 2PL3A 5AJVB 4BFSA 1EESA 5B57C 3SI7A 3V9PA 2WJJA 3SQXA 4O2RA 5IDVA 1GUAA 1FZQA 4DCNA 2JCSA 3B2EA 4F4CA 3ADDA 1E99A 1G4UR 1XMVA 1DELA 1ZM4A 2NTYC 4H1UA 4KYUA 2HXYA 4LJAA 5FOVA 4DSOA 3ZD6A 5JECA 2O8EA 4LGMA 3MCAA 1N5IA 1IONA 1CU1A 1SKQA 2IC5A 3EC1A 2NGRA 2H7VA 1T91A 2ZI5A 3R9WA 3QQ5A 1DBSA 1XJQA 1ZCBA 3M4YA 4EPTA 1JR3D 4DIEA 1Z83A 2WWFA 1DG1G 2QSZA 4GFDA 5JLJA 1SHZA 3L43A 3AQ4A 5EXSA 3T61A 4JJKA 2XTMA 1ZVQA 3KUDA 1GOTA 1E0JA 1NY5A 1QF9A 2GVDC 2GESA 1HQCA 3EZ2A 2WMOB 3ONWA 3EARA 1CR1A 1ZD8A 4UKDA 4C0LA 2YWFA 2PLFA 3PV0A 4PPGA 3WMFA 2CK3A 2GJKA 5EE9A 3BRWD 4OI0A 3AGPA 4NYMR 4AKEA 3GJ7A 1G64A 4GP6A 3NKVA 2ZE8A 5FBWB 1H8ED 3ZDQA 1W49A 3LO5A 2YOGA 3NBYC 1G5TA 2HUPA 3VHXA 2GXAA 4Z1MA 3W6OA 4JLDA 2D7CA 621PA 4DLVA 4BFVA 2EFEB 1P2SA 3FPAA 3L0PA 4IDOA 5GJBA 3LBIA 4Q1DA 5KPJA 5HE9A 5C4MA 4LJ4A 4YDSA 1UADA 2VA8A 4Q4LA 1J8MF 1GAJA 1A82A 4A15A 4OJQA 3AGQA 1XEWY 1YZNA 1F6BA 4NTZA 4RZUA 2R44A 4MYHA 3NIBA 521PA 2O8FA 3RRMA 2RB4A 2ZSBA 1E2GA 1KI6B 2CXXA 1OXTA 1NIPA 2EFGA 5L3SB 3PUVA 3FHOA 1QHHB 3BBPA 3QI2A 3SHWA 1QHNA 2O8CB 1P2UA 2O0KA 5LDDC 1ZC3A 3MRSA 4JMPA 3IO3A 3GJ8A 1W0JA 1NSTA 4RJLA 3SBEA 2DYKA 2B6HA 3IQWA 3C5CA 2FEOA 2I3BA 3NEJA 3U2QA 1UF9A 2H57A 2F43A 1RE0A 3KXKA 2IHBA 2ZJOA 4DCVA 2NO7A 1S3SA 3LA6A 4DBLC 2OBLA 1MOZA 1P2TA 2RGXA 4IDPA 4BLPA 3CLVA 3BFVA 1YR6A 4NH0A 4WAUA 4QRHA 1GNRA 3A58B 5L3QB 2GHIA 4PHGA 4FMDF 3OEHD 2QMUA 2G1KA 3NHAA 2CCKA 1OE0A 1RRPA 1DOAA 4B3CA 4LJYA 1EGAA 4NU0A 4XD7A 1R0ZA 5FPTA 4WOPA 3CZQA 4TQUS 1E1RA 3MWKA 5E7JA 4DHEA 2PCJA 3CRMA 3DM9B 5HE8A 5K8LA 4D4MA 2NO1A 5FL7A 4D80A 4Z8YA 4EPYA 1XTIA 2FOLA 4JVNA 1KI1A 1XXHE 4C7OB 4D0NA 2KJQA 3AF4A 2A3RA 5AWFC 2Q3HA 4JLJA 4MYTA 2UKDA 2XB2A 4TN1A 2JLUA 3RS7A 1G3QA 1F60A 2CVFA 2P5TB 2ZRJA 3VKHA 5FBVB 1M6NA 5GVSA 2JLZA 4JYBA 5LB2A 4I81A 3K0AB 4MUAA 1XEXB 2Z5FA 3VR4A 4AIIA 5HPYB 3PENA 1S8FA 2N46A 1EX6A 1NLZA 3Q8XB 1PJRA 2G6BA 1A4RA 5IK2D 3HR7A 3U61B 1RC8A 1KZ7B 2VPPA 4V0OA 2GEUA 3PR1A 4M1OA 4QBHA 2FNAA 2IUTA 4C2UA 3B82A 3C5HA 2D3WA 2ZR7A 4PQRA 2JIZA 3LX5A 4MKGA 3R7WB 1WQ1R 2ERXA 4MGZR 4PAMA 3IHLA 2WKQA 3QJYA 4JLPA 3BD9A 1UDXA 4HLQB 3A1UA 3LLUA 1EWRA 3KJGA 1NVUQ 3GJ0A 4BFTA 2TMKA 2EFCB 3GLGA 1BKDR 3IUYA 4B71A 3RVBA 4R2IA 1IN6A 2WIAA 4C0BA 2PT5A 2LKDA 4RY2A 1D5CA 1J70A 1JBKA 2OUKA 1XJ0A 4A9AA 5JJIA 2ZAMA 1NLFA 4HDOB 4JVMA 1U9IC 5DI3B 4XH9B 5FTLA 3SZRA 1TX4B 1YZUA 1F3OA 4A0GA 5FH9A 5CLQA 5JBQA 4QHSA 1FUKA 1LF5A 1UKEA 2Z4SA 3P32A 4BWYA 3QSYA 3ECCA 1GFIA 1GILA 3QKRA 1XFAA 2WBLC 1ZNWA 2PZGA 2FEMA 2OBMA 4UXHA 2OE2A 1SXJE 2IYRA 2XAUA 3WNDA 3A1VA 2PZEA 3QKSA 4D81A 1R6BX 4X8HA 5KU1A 5J4HA 1ZM7A 2ZUDA 4EFNA 2OESA 3NWJA 3S1AA 1B23P 4A2QA 1GITA 5G53C 2QPAA 2QAGA 2GWHA 4XVRA 821PA 1E1QA 1Z0AA 3DMNA 3QVVA 1P9RA 2QN6A 2QNRA 2V7QD 5FUWA 3UG6A 2OLJA 4UNPA 4A1FA 4ERNA 1T0HB 4HB2A 4KJZA 4IKEA 4MGIR 3VHLB 1IXSB 1ZD1A 4HAYA 1ZU5A 3BJIC 1AA9A 1M2OB 1UPTA 3SS8A 4KHZA 4KFTA 5GVRA 3RSLA 3NHBA 2IXEA 1GL6A 1M7BA 1RRFA 3KDSE 3RHFA 4QNRA 2OAQ1 1D6JA 1XPOA 3O47A 4D25A 4FMCF 1GP2A 4DLWA 3DPUA 2ZS7A 4TMWA 1N6LA 5EZ6B 8OHMA 1LV7A 4M1YA 1A2BA 2QM8A 1EWQA 2C96A 1JB1A 4ZKEA 1OH5A 3K09C 5J4VA 1COWD 3AF0A 3LAWA 1P60A 1QHXA 4BFZA 4CEIA 1N6IA 4LI0A 2CVHA 2CL7X 1W36D 3GLIA 4PR0A 4RVCA 3VAAA 3CONA 1JQLB 1E6CA 3EW9A 4IOKA 5JHHB 1NMXA 1TF5A 2ZR0A 4QM7A 2VF7A 1XTRA 2ZSFA 4FMBB 1JQJC 2ZSAA 3BB4A 1E9DA 5CYOA 5EE0A 1MH1A 2PMDA 1E98A 2WWWA 2ZI9A 2XGJA 3GQBA 2JLVA 2GZHA 2VHCA 4R71A 2V4ZA 2GILA 5DN6D 1CXZA 2FZLA 3DZ8A 2ODBA 3H1TA 1X3SA 2WV9A 4URUR 2QBYB 1NMYA 4JLVA 3WBKA 1ZAKA 1YR9A 1NJGA 4B3DA 3T12A 3ETLA 2FZ4A 1F2TA 1N2CE 4Q9JA 2GCOA 4O0MA 3K8YA 2GJ8A 3EPLA 2JASA 1G20E 3PVSA 1R10A 2RGDA 3HDTA 3N5CA 5A0FA 3K0CA 4IW3B 3JVUA 4ZCIA 2IK8A 3DEFA 3W8NA 2MMCA 3RWOA 2IXGA 3U5ZB 2XJ9A 4EAQA 4ACBA 4ASUA 4DLXA 1N25A 2V9PA 5B2ZA 4P0TA 2C5LA 1R2QA 2YOFA 3AVQA 2L0XA 4FD2A 1CP2A 3BIFA 3P4YA 2NPIA 4A0RA 2CE7A 3KQKA 4F91B 1HT2E 4V0MA 3GJ5A 4QXAA 3V4RA 1ODFA 4RD2A 2EVWX 2ZJYA 2D62A 2PZFA 4HLUC 1KSGA 2IX3A 4DEXA 5BN5A 4MGYR 2V3CC 5F9HA 2BEKA 4JJZA 3CUEF 3LQQA 2XXAB 1BOFA 1T4GA 4LSGA 1OXVA 5EP4A 4FCTA 3VR1A 3TBKA 1NP6A 2V6JA 1Z5ZA 4RFSA 1NKSA 1G8HA 2HJVA 3R20A 1P9NA 1Z2CA 2VLIA 3QNUA 5J47A 2C03A 2DBYA 2W2XA 5IRCD 1OKKD 2Z0MA 3FMFA 4PO8A 1G7RA 4BEJA 4ZCLA 4OHZA 4K8OA 2XB4A 4L5BA 2XZOA 1U0JA 5TY0A 1YE8A 1QG2A 1JJVA 2QEQA 2YJTD 2VP0A 1E2EA 4A6XA 3C14C 2J0SA 2HCBA 3J81k 2LWIA 1W2HA 4MRVA 2GAAA 2BBSA 2GXSA 3KJIA 1VDZA 4JL5A 4YDHB 2IEZA 2QPOA 2BM0A 3NC1C 2LKCA 3PCRB 5AJXA 3K70D 2AXNA 5AUPB 3KKNA 4MDFA 1P2VA 3PEUA 3BH6A 3AUXA 4ABYA 3U4QB 1KIMA 1KMHB 1VTKA 2IA5A 4CT4B 5BW8A 2BWJA 2JLWA 2IYSA 1CBUA 1G17A 4P4SB 3UK6A 2R2AA 1W48A 3N2EA 4C2TA 2AK3A 1FP7A 2CCGA 4BE7B 4PAOA 5JMTA 4XVQA 1S9HA 2GAOA 4W5HA 4KCGA 2FE4A 3QXJA 2B21A 3GLGE 1CR0A 4L9SA 4B34A 2CK3D 2XZPA 1NRJB 3EG5A 4LC0A 1HA3A 1HY3A 1KO4A 4MUBA 1G8PA 2W6IA 2YC4C 1ZNZA 4R2HA 2QP9X 3FDIA 2MSEB 3BFXA 5E95A 4EQ6B 2REBA 1E32A 1VG0B 4Z1MD 1LY1A 1XZPA 3EZ9A 4TMVA 4EFMA 1GRNA 4V02A 4Z51A 3IPYA 2W2TA 2P5SA 4C0HA 3BB3A 3THOA 2H16A 5EP1A 4GSYA 4OBEA 3SHFA 1DTSA 1OLOA 4FXPA 1II8B 3Q72A 4QJ3A 3A1SA 1XPUA 2BBOA 5C46F 3ICQB 5D3MB 1KK1A 1VG8A 1E2LA 4QKQA 2P6NA 4EDHA 1L2TA 1UEIA 4LCBA 1L7VC 1JPNA 1IN5A 2GNOA 3DO6A 4B3XA 3A4MA 2V54A 3FVQA 3B8HA 2WJHA 3O8BA 3VQTA 1FW6A 2GCPA 4RZ3A 2ANCA 2QP3A 4Q03A 2GJ9A 1ZU4A 2RCNA 1TUEA 4JLNA 3V00A 2GZAA 4IVRA 2FJUA 3AVPA 1F2UB 1ZM9A 2J46A 5EE1A 3W6NA 5B64A 2AK2A 1FOEB 3E2IA 5EUMA 1R8SA 2ZU6A 5EXTA 4LBWA 5FUVA 5KDOA 2IS6A 3Q7QA 4WXPA 3ZIAA 2ZJZA 1DS6A 1VCIA 3T1OA 3KL4A 3X2SA 2ZSEA 3PUXA 2R6FA 5EUQB 2B8TA 2QROA 4Q9IA 1WDTA 2IBMA 3Q7PA 1Z6YA 2D74A 4X8OA 1QZXA 2ZEJA 2E9SA 5AJYA 1OH7A 3IBYA 2YWHA 3I62A 1E2IA 2GEDA 4C9BA 1AQUA 3I5YA 1FL9A 1VMAA 4KSCA 1OSNA 5K8TA 3GLIE 3UPUA 1OFTA 1UBGA 4LYAA 1E1RD 3TGPA 1W1WA 2YOHA 4DXAA 4MQBA 1T6NA 3H84A 4TQAA 3CB4A 1NG9A 2G0TA 4JLAA 4PSAA 2WSSA 2B7BA 2ZRAA 3MFYA 4PC7A 3W8RA 4ITRC 1Y63A 4LHZA 2CCJA 3ZS9A 3EZ6A 4D4LA 1KY2A 2PEYA 3FMPB 4DEYA 1X8LA 3EASA 4IHQA 3SDZA 2VHQA 3F0TA 4W5WA 2BBTA 1OYYA 3A36A 4U02A 1P75A 3QEOA 4NPHA 1E2QA 2OFXA 4K46A 1OXUA 1Q0UA 2G1JA 2ZRMA 5H1YA 1OB5A 2G3YA 4PC1A 1CJTC 4OQMA 5AJZA 5TXGA 4B2PA 1P4SA 4AK9A 1IJFA 1KJWA 4QGHA 3QF4B 3B5JA 5CLLA 2X2FA 2IXFA 3BORA 2SHKA 2JLYA 3NG1A 1NLYA 1AKYA 2XITA 4HAUA 1W36C 3KZ1E 2RAPA 1L4UA 1ZUNB 4LJ7A 5CB8A 3GPLA 2HT1A 1LS6A 4I1UA 3SQWA 1P6XA 1DAMA 3TIFA 1E79A 3GJ4A 1TF2A 2XSZD 2OFOA 3BGWA 1Q22A 3T1VA 3TVTA 3TVDA 4JIMA 1KI7A 3FKSD 2A5YB 2EFHB 4JLMA 2Q9CA 1OHHD 3AM1A 4CEJA 1PUJA 2NZ8A 1V43A 5KSOA 1PUIA 3TJZA 3R9XA 4ZO4A 2F1HA 3FHCB 4Q7KA 2GETA 4NCNA 4ON9A 4V0ME 2G77B 4FWIB 1XF9A 2ZR9A 2W0MA 3LWNA 4KVGA 5HCIA 4A92A 5H70A 2ZANA 2FPLA 1YVDA 2VL7A 2JJ2A 2ZE5A 2V8OA 2ZYTX 2H8KA 3SYLA 4EJSC 2NO9A 2ODNA 2OSBA 2ZJ2A 2YC2C 2YNMA 3KKMA 3LW7A 2ZIAA 4M1WA 4CEHB 2VTKA 3MWYW 3SEAA 5TMPA 1ZNYA 1GZSA 3GEIA 3VU9B 4NCKA 4W7SA 2FDCA 2AR7A 2K5UA 1E1QD 3FFBA 4QGGA 2WWHA 1IJEA 3M0EA 1KNXA 2PCLA 1I4DD 2AKYA 5LBIA 4A8JB 2CLDX 2PT7A 5FTMA 2ZS9A 4IJMA 4URYR 3DDCA 3W6PA 3B13B 2ZYWX 1WBBA 3PUWA 1VYVA 1GG2A 3T06B 4KODA 1IY0A 3PITA 3QXSA 5BXQC 1G5PA 421PA 2A9KA 3VR5A 1Z47A 3QEJA 5FFMA 2QM7A 4Q00A 1MR3F 1XCMA 3LW8A 1NBMA 1IN4A 2OEPA 2FSGA 4MKFA 4LBYA 1SXJC 2BMDA 3TNFA 2KE5A 121PA 3SU8A 3OFND 2VSXA 3LRPA 5CIQA 5G41A 1X1SA 4NE2A 4U7DA 3FKQA 1G8FA 3I8XA 2QZ4A 1NI3A 1E9CA 4M0LA 4DVGA 1Z8FA 1G291 1E2NA 4PX9A 1RJ9B 4RKFA 2VSFA 5KSYA 4G3XA 3SYKA 3OHMA 4CYMA 3BH7A 2H5EA 3RSOA 5EP2A 2XTNA 4BQSA 3QPWA 2NG1A 1E2FA 2ZUBA 4BRWA 1KDOA 2CLCX 5DYGA 3QKTA 1ZW6A 3LBNA 1BH2A 5KUTA 1TNDA 2ZTSA 2W2VA 4F4IA 1KI2A 2BBWA 4QJ5A 4AKIA 1E4VA 1FNMA 2J41A 5JHGB 1BO6A 1NF3A 4AKGA 1X6VA 5KDDA 3VR6A 3AVUA 3A4LA 2VRWA 2IYQA 4Q02A 2ATVA 1BMFA 4F92B 3EC2A 4Q48A 1K5GA 1QHHA 4TSFA 1E4YA 4TYYA 3THXB 1GKUB 2IYTA 2O8CA 3QKUA 2RGCA 1FP6A 2YV5A 2QA5A 2QGNA 3MAAC 4BPBA 2OXCA 2ERYA 2ZRLA 3OE7D 2P2LA 1XD2B 2J5XA 2IYWA 2QE7A 3GFOA 3CWQA 3WYAA 3ASZA 4TL9A 4F38A 3B1ZA 2C9OA 5JRJA 2X77A 4DCTA 3ND8A 3C7KA 3UXMA 4LDJA 4ASUD 4ZIRB 4WZ6A 3RRYA 2VP5A 2QGZA 4URXR 5D3QA 4R98A 4TMTA 2ZXUA 5DISB 4DKXA 2HT6A 1KMQA 5EE5B 2FGKA 2ZSDA 3BAFA 3H0KA 221PA 3I3SR 3E5HA 5L3QA 3THYA 1H8HA 1XRJA 3H2YA 3K9LA 1G7CA 4ZV4A 1J90A 2GA8A 1E94E 3A8TA 1G18A 1KGDA 5JJKA 4EPXA 1RPZA 4MKIA 1KK3A 1EG7A 4FWTA 4TL8A 1A7JA 4URVR 4OL0A 5AUOB 3EPKA 2WHXA 4C7OA 1VCNA 1CULC 3KJEA 2IS1A 3LH5A 4A2WA 1T5LA 5KPDA 3UMSA 1G8YA 4LYJA 1ZCAA 3RRZA 5HKKA 4JL6A 3UANA 2IEYA 3AP2A 4GBMA 4BFYA 4WW0A 1DAGA 3K0AA 4Q01A 3NBFA 4O3MA 1XEXA 1OH8A 2BJVA 2R8RA 1XCGB 4DT1A 4KITB 1PV4A 4HZUA 2F9MA 4V0KA 4OI1A 1BYIA 4C3ZA 4TYWA 4DCUA 4MGKR 1NVVQ 2UVQA 4DDUA 1IBRA 1AZTA 4F7WA 1FPMA 1AJEA 1P3JA 2E87A 1ANKA 3K70B 1KZGB 4LBZA 1N6RA 4E03A 1G5RA 2W6JA 4DWJA 4S35A 2CMKA 3OF5A 5LB4A 3U60B 1RW4A 4AY2A 4WVFA 2OO7A 1NKTA 4GOKA 4BZXA 4NKRA 5F3WB 2F3TA 2DHRA 2RHMA 3HU3A 3KKPA 4EUNA 2NMVA 2J0VA 5KDLA 3NXSA 2J3EA 4EFLA 3EA5A 1Q57A 3CF0A 3THWA 3AP3A 1QDEA 1HUQA 4YONB 5B30A 5HZKA 3CZPA 4D82A 2F6RA 2OG2A 2REXB 1G8GA 3KX2A 4M4SA 2ZROA 5TB5A 4JYCA 3UG7A 3VX4A 1FMLA 3B1XA 2KBEA 3SE0A 2P67A 4P4UA 3PG5A 3CM0A 3RS4A 4IDHA 1X86B 1S96A 4NCHA 2E1RA 4MA4A 4Q4JA 3WYGA 1LF0A 1D2MA 3D3QA 2JDIA 4US0R 2MMGA 2ZE6A 1YHNA 1MRSA 3OIVA 1XWIA 3Q9LA 3RS3A 2OCYC 4IEIA 3AVVA 1F48A 2ODEA 2HXSA 3I32A 1G4AE 4PZLA 2F7SA 3HP1A 2UZ3A 1CIPA 2P65A 1W5SA 3OZXA 4DZZA 4PC6A 1UJ2A 4L8GA 2OBNA 5TDHA 1RRCA 2QTHA 2ZE7A 1IY1A 2GKSA 4NYIR 2HV8A 4QFMA 4E5UA 3P27A 5BYKA 1P62B 1F5NA 1Z6XA 4M2LA 5JEEA 3EIQA 4MDEA 2VP9A 1VPLA 1WRBA 4Q19A 4KLNA 4URZR 5BN3A 4U5XA 5ELXA 1E9EA 4WZBE 3QENA 4WBSA 1JALA 2O8FB 3GLHA 4LOAA 4ZI3A 1OFIA 1TUIA 1W4RA 2RMKA 4BLSA 4FN5A 1EFCA 2D2FA 4Q1FA 4AG5A 4TYNA 5E7MA 2AHOA 4KXFB 2CHQA 1I2DA 4NYMQ 3U3JA 5JI3E 2WTUA 2O8DB 2ZYUX 1N0VC 3L8YA 1CKEA 3T5DA 2XJ4A 3RDPA 3ZJYA 2RGNA 4PPFA 1XNJA 2YWEA 1JXOA 4LJ9A 3IBGA 2QU8A 1J7KA 2O8BA 4JZKA 4RKEA 5AJWA 4YMUA 2O5VA 1KO1A 3WHKA 1XU4A 1X8JA 2F43B 3KUCA 1DAHA 1IOZA 5FOWA 1VHLA 3OAAA 3ZIAD 3VKGA 1ZJ6A 4HB4A 1QG4A 3G0HA 2ZRCA 4OK5A 1NJFA 4TT3A 5L8VA 1GSIA 1TEVA 2QP4A 3CH4B 5CITA 1LNZA 3IHWA 3TSOA 1S4QA 2ZREA 3K9HA 1G21E 2QAGC 3LDAA 3TSWA 3U44B 4PSVA 3RLFA 4BECA 1O3YA 1Q1ZA 3E1SA 2Q3FA 3RABA 2ZRPA 1KSHA 1Q20A 1XTKA 3GEHA 4Q5IA 5DIFA 2QQ0A 4MRPA 2ZRBA 1T5IA 4D2IA 4NHOA 2WSSD 4FW9A 5CM9C 3MG9A 2J0UA 4PZZA 1JR6A 2W00A 1G19A 4PC3A 2ZVQX 2QBYA 1XB2A 4ILEA 3LX8A 4C0KA 2Z43A 4B2IA 4A0HA 1P5ZB 1JPJA 2OAP1 3AP1A 3EAQA 3FYHA 2CNWA 2QG6A 2ZI6A 3PEVA 4JS0A 5GADl 3RRNA 1MABB 3I4LA 4DUGA 3IKJA 3BOSA 1NL3A 1HE1C 3TW8B 5LD2C 4XOIA 4IVPA 1U99A 3D31A 3DMDA 1KY3A 5FBRB 1ESNA 4MRRA 4JSTA 4NCJA 5FOUA 4EPWA 4Q7LA 4CF7A 2VYFA 3F8TA 3LVRE 4NYJR 3GJ3A 4ZDWA 3RS0A 2O0HA 4HZIA 1OIVA 1E79D 3I8SA 3GLGB 1Y3AA 5KHOC 2IYVA 1I4LD 3VR3A 2BOVA 4NBSA 1RYFA 3H86A 2DFKB 2WWGA 1T8TA 1S1MA 4KSBA 5TARA 3TUJC 4TTPA 4Q4HA 1YZGA 3U3RA 3UMFA 3QG5A 2YWGA 4KFRA 1E2JA 4G5SA 2XXAA 4PXAA 5JWHA 5JZVA 5IT5A 1J99A 1Z0JA 2CL0X 3KKQA 3P26A 4B6EA 4DDWA 4TL6A 3GLFB 2BC9A 2ZRDA 4XTRA 2WOJA 2OM2A 3IIKA 4JLBA 1VECA 4DLYA 4PPQA 4E22A 3I5XA 1QHGA 3QKSB 4PAQA 1OYWA 1XDBA 2FWRA 5KNBA 4OJKA 3S1AB 3K0CC 1KNQA 3RWMB 4QC2A 4HLDA 4JLKA 4TTQA 2GBLA 1KKLA 4MITA 2QAGB 3R8FA 2A5DA 4CZ2A 1W44A 4KI0A 1Z6AA 4N1AA 2HLDA 4GT1A 2ZRNA 5CJ2A 1I4TD 1G3RA 2NOAA 2WKPA 2GDJA 4HI0E 4PANA 3F3YA 3W5IA 3U4QA 1TPZA 1ZNXA 5FL3A 1S2MA 4UNNA 3SFZA 4KV9A 2J1LA 1BYUA 3ZD7A 4HAVA 4Q4AB 4C0AC 5KOYA 3K0SA 2WICA 2O0JA 2FH5B 1IM2A 1JJ7A 2WPDD 5C4GB 4G5OA 4YMVA 1FFHA 4TMKA 5DE3A 1WMSA 3D8BA 1YRAA 2IYLD 2KWIA 2WJGA 4B43A 5LD2B 4A36A 2CLSA 1VKJA 1SXJD 1H8EA 1SKYE 1K8RA 1MO5A 1YQTA 2C04A 3CKLA 2JLQA 4JVSB 4TYQA 5HCNA 4B47A 4X8LA 2EQBA 3GLIB 4LJ6A 4BUJA 1WB9A 1W47A 4WA7A 1Q12A 2Q21A 4LZZA 1E9RA 4PPNA 4CW7A 2B8WA 1Z2AA 2JGNA 1DO0A 1NIJA 5BQ5A 3AVYA 1WA5A 4WXRA 2HDNB 5JI2E 4DLSA 4IOMA 4O25A 3KFVA 5KSPA 3GJXC 1KOFA 3T1QA 3QF7A 4M9XA 1MKYA 4M9SA 1II8A 2JLSA 5EE3A 3CNNA 3AKCA 3TUIC 5D3MA 3AV0B 3AVWA 4BFWA 1CRPA 1QHSA 1JXMA 5P21A 3JZMA 1U98A 5EP3A 3QE0A 1CEEA 1DAKA 5TVKA 2G0NA 1W46A 1ZRHA 2QL6A 2RGEA 2YZ2A 1UEJA 1VG1A 1E2KA 1F2TB 5FR2A 3W90A 5KYKA 4HAZA 2GCOB 2IYZA 2QT0A 4D4KA 2QY9A 4EKDA 4RFVA 1BMFD 3ASYA 3QXXA 4HAWA 4TSFD 1XZQA 3W3AA 1EFRA 3GLHE 3NC0C 3NBXX 1F2UA 4DSTA 1U0LA 2A5JA 5CM8B 3ZZTA 2F1IA 2JA1A 3QBVA 1CS4C 4G5QA 4M8NE 4I4LA 3U7FB 1RVDA 2VHUA 2QE7D 2WZQA 4TYPA 4EPRA 4XWOA 4OQNA 5E3HA 4XSGA 2WWYA 2ZJ8A 1Z0DA 3K9GA 3CNLA 1R0XA 2BM1A 3I1FA 3U7GA 2XOKA 3ZVLA 2OZEA 2OT3B 1DVRA 4DC9A 1GTVA 1NSFA 4M9ZA 5KNDA 3LFUA 3T5GA 3REGA 4B35A 4HLCA 4GPTA 2ONKA 1K5DA 3OEHA 5DLQC 2GVZC 3BERA 2YYZA 4OKSA 2VEDA 3BK7A 1NN5A 2QMHA 4IFEA 1H8HD 3BXZA 3FMIA 2IF2A 1FX0A 3QBTA 3X1XA 5CYPA 3IQXA 1HTWA 1UKVY 3FTQA 1U94A 5J4KA 4R7ZA 1AM4D 4H9GA 1HURA 1Z63A 3BWDD 4DSUA 1M34E 1R8QA 2PX0A 3CPHA 4UJ5A 5SZJA 5FTKA 4F93B 3GJ6A 3AF2A 1TADA 4Q47A 1JECA 3L0IB 1CTQA 2FSIA 5TV2A 4E07A 1OH6A 2HYIC 4TZ6A 3GD7A 4KBFA 1OIXA 3MUFA 1ZINA 3SYNA 1DE0A 1II0A 3C4JA 3OEEA 4I99A 4M1MA 3U3OA 3VKWA 3GP8A 2GRJA 3EXAA 5HKKD 3IEVA 1KI4A 4ARZA 3ND9A 4A4DA 2J0QA 2CE2X 4L16A 4XSHA 3SN6A 2RGGA 2OXRA 3NH6A 4BZPA 2CHVA 1ZM2A 1Z29A 1PVOA 4UXIA 5DH9A 4MRSA 4Q18A 2VQSA 5JWRA 2REOA 2GTPA 3FFAA 3CWZA 4Y0AA 1W0JD 4M1SA 2GXQA 5H8WA 4N3NA 4US2R 2IYXA 1N5JA 4JKYA 4V0LA 2W6JD 3SJZA 4CDGA 3Q5EA 1W4AA 3EX7C 4B73A 3PUYA 1XMJA 3KFXA 2AN9A 3K0FA 1RKBA 1EX7A 1YZQA 4BGDA 1D9XA 4X8MA 1G7TA 2CHGA 2JJ1A 1U81A 4Q7MB 5JCZA 1KI9A 2QQEA 4JLOA 1IXRC 4ZCMA 1SGWA 1RFLA 5DYIA 3TSZA 4AYTA 3B60A 2A78A 4XD7D 4JT4A 3O8DA 4HAXA 3TR5A 5AUNB 2X19A 2AFIE 5EQTA 5FL7D 1Q44A 4JSYA 3HWSA 4GRAA 4QBIA 4S2EA 3ZZUA 1Z07A 2EYUA 2D06A 4B32A 5K8IA 2BVNA 3MJRA 3VX3A 3DOFA 3B1WA 1W7AA 2FFQA 2JDID 2QRNA 3NH9A 5FOTA 4C0QC 2J9RA 4HB3A 1SULA 5JSZB 1G3MA 3LXXA 2IWRA 1KO8A 1ZC4A 2D4HA 3RS5A 3U7EB 4RCZA 4TWZA 1XD8A 5H68A 2WIBA 1DO2A 2DWOA 3QOFA 4KYIB 2CJWA 2EW1A 3VU9A 4G01B 4JBXA 3C8UA 2WJIA 4LK2A 1R5NA 2FV8A 2C9YA 5FUXA 4CRWB 3ZGXA 1EK0A 4J0QA 1U8YA 1XP8A 3A4NA 3IPXA 1U2RA 1Z6GA 3NBZC 4A8JA 1CRQA 2P0EA 3LXRA 1P7CA 3Q5DA 3QPVA 2ATXA 4ZDIA 3W3ZB 2JIZD 5C1BA 1SVOA 3CRW1 3GFPA 3WNBA 1E2DA 1TQDA 4CIDA 3WBJA 3G5UA 3IIMA 1S3GA 2NQ2C 1V5WA 5C18A 1AN0A 1A1VA 4POAA 1WF3A 2ZI3A 1AGPA 3H4MA 4MKHA 3PFIA 1T3HA 1UKYA 2R9VA 4GMDA 2XNDA 2NO6A 2NO0A 2OFWA 2QRZA 4QG7A 2BCGY 4BLTA 1K6MA 4GP7A 1IY2A 5KO2A 2GF9A 3OAAD 1R5OA 3A37A 2YINC 1G41A 3IO5A 3FHTA 4P3YA 1E9SA 5FBLB 4PO1A 2FU5C 1N0UA 1GKIA 1OFUX 3W5JA 4MYCA 4NDZA 4WZAE 5DNYB 3ADCA 2XZLA 2ASEA 4RZXA 2QMOA 3I72A 3T1TA 4UNSA 3VTKA 2BKEA 1NG1A 5IHPA 1EFHA 1N6OA 2JAQA 1XEFA 1M1YE 1KHTA 5A4JA 1UDWA 5DSZA 2P6RA 1A5TA 2HCJB 3QVUA 2JLXA 1P61B 3G82C 1OW3B 4N0EA 4RD4A 1ZIPA 2WM9B 3CO5A 3IGFA 1CR2A 1FMJA 3AB3A 4E09A 2X2EA 3WRYC 1US8B 4XIGS 2IW3A 3KTAB 1OPXA 2XTZA 3GMTA 5A5GA 4P32A 2ZRIA 1II9A 2Q3MA 2EFDB 1UBFA 2V1UA 3PIRA 4EIWA 2QENA 4DUGD 3MWJA 2D2EA 1XD2A 2H18A 6Q21A 1KYIA 1S9DA 2ECKA 1ZUIA 3VFDA 1J2JA 4LV5B 1NN1A 2ZJAA 5DGXA 2G9NA 1KO7A 2RGBA 4TL7A 4ZIRA 3TRFA 1W36B 4LJ8A 1R4AA 1ZYUA 3UATA 3BFKA 5FI0B 4F4JA 2GK6A 4HUQB 4P4TA 4NCIA 3DL0A 3X1ZA 1DADA 1UBCA 4KFSA 3U3KA 3U6KA 1TQ6A 4GOJA 1XXHB 3MLEA 3ADKA 4LPSA 1OJLA 1Z08A 3A6PC 2OILA 3QUSA 1IAQA 4M9QA 4QL3A 4CEJB 3KKOA 1Z28A 3LD9A 3QIAA 3FWYA 3MJHA 2QUZA 5GJVC 4TMZA 1CJUC 2QI9C 4DIDA 2XNSA 1J8YF 1Z06A 1T8UA 3OESA 1S1CA 1E9FA 2H92A 1SVLA 2DWQA 2WWXA 3A1WA 1KI6A 1OXSC 5UKDA 2HF9A 1AS2A 4QGAA 5L3SA 5LPNA 4EJSB 3TH5A 3WP1B 4HYYA 1M74A 3EIHA 5E7IA 4BRUA 4C0SA 2MSDB 4HDQB 2AWNA 1C9KA 3PUZA 2R62A 4Z54A 4DCSA 2GK7A 2J7PA 4JKIA 2ODWA 4IRUB 3WMGA 2ZRKA 4P33A 3IILA 2VP6A 1U90A 1AK2A 3F5FA 4JVLA 3AUYA 1GRRA 1T0JB 1Z3IX 2FPMA 2HLDD 2I4IA 1TMKA 4PZYA 5DO9A 5J40A 4OHWA 4WIAA 4GOXA 1GDDA 3CIOA 3AKYA 5AUQA 4A2PA 2WVJA 4M1KA 1E9AA 4H1VA 1G3IA 3WNCA 1CJKC 2F55A 2ZRGA 4BLOA 1QRAA 4Q1AA 4I1VA 2F1RA 3PJRA 2C98A 3LY5A 4FCVA 4LHXA 5FTJA 5JFGA 4KVAA 2GZDA 2OLKA 3B9QA 3L0SA 3NDBB 4JT2A 2BEJA 5FI1B 4RSGA 1GL7A 1SXJB 3B9PA 2BHRA 3VNUA 3NDPA 2NIPA 2JATA 3C41J 1XTJA 4LY6A 1KO5A 4BLQA 1R5BA 2W58A 1E0KA 2CEAA 2QORA 3TR0A 4YLGA 3FGNA 2A30A 2QPTA 1L4YA 2ZS8A 3IEUA 2ANBA 1G7SA 2N1BA 3BB1A 4QM6A 2ORWA 4YQFA 4AWXA 3P4XA 3RC8A 1CJMA 1DAEA 1P9WA 2ZUCA 1JI0A 4PHFA 3BH0A 1O87A 2Y8EA 1W0KA 2FFAA 1DAIA 3U3MA 5GJWC 3GFTA 1CR4A 2VHJA 3KB1A 3WP0A 3ADBA 2O8EB 1N5LA 2WKRA 3AEZA 1KTVA 2FN4A 2Z83A 3DKPA 5JS7A 4JL8A 1WBDA 1XMIA 5C2JB 4LPKA 3R7WA 4HUTA 4GZLA 4PHTA 1UKZA 3UKDA 5M04A 3SNHA 1FQKA 2OCBA 3O8CA 4HATA 3RS2A 1GVNB 2Q9AA 3AH8A 2O8DA 5EXXA 2X8AA 2RKOA 4BZQA 1EFRD 4FI3C 2ZAOA 2I1QA 2WMNB 2FGJA 5EXPA 5L3VA 1MRNA 4DJTA 5DHFA 2QAJA 4IDQA 1CLUA 2A5FA 1TQ4A 4G0NA 2F1JA 1TU4A 2CBZA 4US1R 1R7RA 1VCMA 2ZETA 1UAAA 1FUUA 3FB4A 5DI3A 2BKUA 1E2PA 4OK3A 2XOKD 4AYWA 2IS2A 1GNPA 4QGFA 1HQYE 5BN4A 3SOPA 2ZYVX 1SZPA 1PZNA 2W6ID 5K8UA 3THYB 2XX3A 1XEWX 1ZMXA 1KAGA 1MO3A 3UIEA 2VP4A 4OYHA 4Y0VA 5CJPA 2VIIA 4KLZA 2QSYA 3ZH9B 2R65A 2DR3A 3CRRA 1TL7C 3U44A 3D7MA 4C30A 1SHKA 4G1UC 3OIUA 1X1RA 4AYXA 3QPUA 2DY1A 2PLRA 4BASA 1YRBA 3T15A 4B76A 1I2MA 4Z8XA 1S0UA 4HDCA 3UMRA 2R6AA 1D2EA 1AGRA 4Q9LA 2LCFA 4AURA 3U6BA 4PTLA 3TAHA 3PEWA 1TF7A 1GRQA 3I92A 4GNKA 5IF9A 1C4OA 3O8RA 4G5GA 3WXMA 1BS1A 2ZM5A 3OEED 4IOJA 3GEEA 4Q9HA 1Q3HA 3TW4A 4DT1B 2RGNC 5DHAA 1SVMA 4DSNA 4HZUB 4TQ9A 4AKHA 1IN7A 1WE2A 2VO1A 1MABA 1GIAA 4LHWA 3TQCA 4B2LA 5CK5A 1G16A 2AXPA 3B85A 2OV2A 4C0JA 4EPVA 2EWVA 4N0DA 1WP9A 3QXCA 2AD5A 2OCPA 2IT1A 2Q9BA 2PJRA 4W9MC 1NBME 2BDTA 3I73A 4M1TA 4IEEA 1TU3A 2XSZA 3FMOB 2IUSA 3R8CA 4YC7A 4C4PA 3WMEA 1B0UA 2GF0A 1E0AA 2IYYA 5F98A 1CF4A 3THWB 3DZDA 3FKSA 2ZRHA 4M21A 3WHLA 4LRWA 2JJ1D 4G5RA 1SKYB 4GMXA 4ESVA 2WJVA 2WWIA 3GCGA 1OHHA 3X1YA 1P73A 3JZAA 1KSJA 5FOSA 1LS1A 1M7HA 1Z0FA 4MH0R 1D8TA 2X1VA 4B33A 4LYFA 2A2ZA 1A2KC 3HYTA 4YMTA 4TMXA 4Q4JB 4QBFA 4B44A 1Z0IA 3L82B 2FA9A 3GLFA 1LTQA 1M8PA 1U9IA 4HSEA 5J5CA 1ZP6A 1E2MA 4TLCA 4OQFA 2PX3A 3TLXA 3DOEA 3MD0A 1MO6A 3NVAA 3RC3A 3UWKA 3C15C 1U8AA 2AWOA 4M22A 5J4LA 1G9XA 5SZHB 1QHYA 2DB3A 2ZPTX 5SZIA 4AC9A 4RD6A 1XTSA 2ONJA 1G3UA 1KI8A 1U0HC 3WY9A 5JCPA 2PJZA 4TLDA 5JS8A 4OK6A 2ORVA 1G6OA 3CRVA 1KI3A 1Z22A 2GCNA 4IVQA 4Q66C 2ZJBA 4YXWA 3GLHB 4URWR 2RH5A 4DLZA 1E2HA 1VG9B 3CW2A 3HJNA 3PXGA 3T35A 4Q7JB 2VSOA 5BWMA 1YR7A 2BMEA 5FUYA 1AIPA 2JEOA 1SVIA 1KK2A 3WRXC 4ZKDA 1NN3A 1QVAA 3EWSA 1OF1A 2B7CA 2D7DA 4IDNA 1YR8A 1N6HA 4Q4AA 3TUZC 1MO4A 2W83A 2O8BB 3IDQA 1KSFX 1VYTA 3TQFA 1ESMA 3OFNA 3K53A 4CGZA 2XNDD 3SJBA 3KQHA 3R9IA 3TKLA 2BMFA 1ONBA 2C99A 5GJCA 3K09A 2DFLA 4GZMA 2A5GA 4IOLA 3QKRB 4NYIQ 3D6TB 1VIYA 3IIJA 4B3BA 1LVGA 1T3SA 1DAFA 3A1TA 3Q85A 2AD1A 2JJ2D 2GBLC 3QXHA 4BFUA 4D6PA 3ZLJA 1JEDA 5DI9A 1ETUA 3SJCA 5FPSA 4AG6A 3AKEA 5AR1A 2NPFA 2BIFA 1AKEA 3TK1A 3P20A 2YVUA 2VHTA 2ZU0C 4B3GA 4Q1CA 2R6CA 1EFUA 4OHVA 3X1DA 4DDVA 1KDTA 2FSFA 5G40A 1GKYA 2O52A 4B75A 2GJAA 2J0UB 1E96A 1VHTA 3SFVA 3ZQJA 1OXXK 3K0EA 1GM5A 1M7GA 1HT1E 1TTTA 3M6AA 1SVWA 2AFHE 1JR3A 2C77A 4ESHA 1NMZA 4UJ3A 1LB1B 4O2LA 1KMHA 5G3YA 4JBWA 2IUUA 4D0LB 2AL7A 4P4SA 1DG3A 3OE7A 4I1OA 2WJYA 1XCPA 1UM8A 3LBHA 4M53A 4QOSA 1NBMD 2J7KA 1Q3TA 1R0YA 4K81B 5KSZA 4TZ0A 3E70C 2KI5A 4ZPXA 2P3SA 4Q1BA 4RZ2A 1NVWQ 4XWAA 1G6HA 4TLEA 2C2HA 3B6EA 2EU8A 4GI7A 2FSHA 1DPFA 2JLRA 1MV5A 2QMEA 4CEIB 4I1SA 4MRNA 1RZ3A 4RD3A 1MT0A 4GL2A 3BC1A 4EQ6A 5CDFA 1DEKA 3VMFA 3ZVNA 4YMSA 2XEXA 3MWLA 4Q4HB 2GEVA 1FTSA 3REFA 4DLRA 2V55B 3HR8A 2VBCA 4IFBA 4NZYA 4RD0A 4D4JA 4A6PA 3LNCA 1W2GA 4HLUA 3DHWC 4DB4A 1KK0A 1QHIA 1XD9A 2C8VA 3ZVMA 3UWOA 2OHFA 4TLBA 2I1VB 1N6NA 3AVOA 3JVVA 1AS0A 1PLLA 3CF6R 3B7GA 1YZLA 1SVSA 2PBRA 2CL6X 4PFSA 3CR8A 2QT1A 3EIEA 3VNVA 1T9HA 4MYUA 4LV8B 3ZYCA 1BIFA 4NYJQ 3KQLA 1AQYA 4BLRA 1IQPA 3K70C 1GL9B 4UQOA
chains in the Genus database with same CATH superfamily
1ONSA 1UZUA 2FX3A 3MPOA 4YFVA 5DRTA 3WV4A 3V7FA 1JHMA 1UJ4A 4U5QA 4UAUA 2JJQA 1O77A 2Z08A 3SZ3A 1ISHA 4N47A 1I9CA 2J7PD 3D0KA 5BNFA 3QA9A 4F85A 3E8MA 1GZHB 1KAMA 2JAWA 1R0LA 1YA6A 2L82A 3KXIA 1GGFA 5E9AA 1X38A 2NZJA 1Z4PX 4D26A 1TZMA 3F3MA 5CX1B 1ELOA 2RBGA 5KS2A 4CIVA 1DZ3A 3TL2A 3RUHA 5BMOA 4HDAA 1DQNA 1QBGA 1V8OA 3WYBA 1CZLA 2WOOA 1Q21A 4EW6A 5BUZA 4DCJA 2QZ9A 2VF8A 2IEGA 2W0SA 4DJAA 3L9WA 4AFNA 5BN5B 2DFTA 3RVLA 1XBTA 2IL1A 2IFTA 2OK8A 3K9NA 3OTWA 1ODTC 2C84A 1W85A 1NFQA 4PQFA 1LBIA 1C1YA 2CLMB 2FUG6 4IIJB 3KPVA 5F9FA 4RFSB 4KR6A 3Q2KA 2A0XA 2P68A 3CX8A 4TV9A 1FXWF 2IHNA 2O3JA 1QORA 5KYVA 4D0GA 3TMKA 1ITZA 4OQXA 5FEMA 2DERA 2M1ZA 1WXQA 3I6QA 4P58A 1C9MA 3DHYA 4LA4A 2ACVA 4X1YA 4JWTA 5JSZA 1HT3A 1NLMA 3LHKA 3L7YA 3HCNA 3HKEB 4CG0A 3VH4A 3M1IA 5ALKA 2P9HA 2VCYA 1DJMA 2CFRA 5IK2A 2X7XA 4L5CA 4B3SB 4MZXA 2E0IA 1LLFA 1EXMA 3E53A 3LBYA 4JEHA 2YRXA 5EWJA 7ABPA 4EA6A 4KGZA 4MUKA 5JJLA 2IQ5A 3EVGA 2PD4A 3N6XA 3HM2A 2PR2A 1D2RA 4GSLA 1D1QA 1JQDA 4K6CA 1T3LA 3KHSA 1FNNA 2OVBA 3N8NA 1TT5B 3E48A 3UKJA 1RXCA 2C95A 3DNMA 1T2DA 3MGAA 3FAKA 4KRYA 4TM8A 3PPXA 1ZVJA 1Y1QA 3ABQB 2GN8A 2VZEA 1N0WA 3CPJB 2PH1A 4RH0A 2AIRA 3O8NA 4IIGA 5LN1A 3DWIA 1QHFA 3CNEA 1C9NA 2JFQA 4QJBA 2CDRA 4V39A 3DS8A 3P2IA 3SBDA 2DR2A 1IPEA 1Y1SA 3CF2A 2DWPA 4XSVA 2R8XA 4BVLA 2HV9A 1LDMA 1A7AA 1HPLA 4J16A 2F8TA 3CBQA 5DZSA 4A0FA 2VHWA 4RXTA 2O8NA 2OQIA 2PKYX 3HJCA 4A82A 1NF9A 1GNQA 3W77A 1PNVA 5DNEA 4KRGA 1THZA 2QJRA 3M4ZA 1QHEA 2BI4A 2NZYA 4JVOA 2M9MA 1TYZA 2R8EA 3P52A 3P5BA 4W99A 5BW5A 1MG0A 1JDZA 1DC3A 4ACAA 1YK0A 2EDAA 1TQ2A 3LVQE 4P34A 1X77A 3N6RA 2IHTA 3A6LA 3FG9A 1D2NA 2XNJA 1M2HA 1TEXA 2HHCA 2VA9A 3H1EA 5FFFA 4QNMA 1EJ0A 2XCRB 5BPFA 2AX4A 4MQ5A 4A8JC 5I48A 2G88A 4HBGA 3AEXA 1JLHA 4KMSA 3SICE 2WWTA 1CY4A 1NNEA 3GEGA 3O8QB 1IXZA 5EIXA 2QD1A 1BX3A 1CJVC 2BFPA 1AD2A 1QV7A 2QM0A 4MV7A 4PYLA 1NBAA 3VRHA 3T7TA 2C5AA 1FTGA 3JCZA 3TS1A 3QWAA 1O5IA 1N5KA 3OOJA 1SNYA 3C6QA 1PQUA 1U1DA 2ABWA 1PGPA 3ZV6A 3KO8A 3LQRA 4YRIA 2VDPB 1FU8A 3WOVA 5JLAA 4BJ6A 1YXMA 2YZKA 3AHCA 1OI7A 4KR0A 3BS4A 2AN4A 5SZKB 4BKRA 1J42A 5MN6A 2R1VA 4MV1A 1QBKC 1Y9DA 2DWCA 4MVJP 2AZ4A 2ECPA 2Q4OA 3ZOKA 5K0GA 2EP5A 2FG7C 2OC9A 4JN6B 2OCAA 4LGVA 1P1IA 3RO7A 1QC5B 1AKQA 5BOSA 2KB0A 4G4SO 4LC1A 1SVKA 4ZDJA 3ZZ0A 1EFDN 3AKDA 1EGQA 3CH5A 1OFHA 1ZD4A 5DLPA 1RKUA 5JH7F 1HV8A 4M38A 3RS8A 3E7WA 4F4FA 1UMKA 2BFDB 3CRQA 4HXYA 4BLWA 1M5RA 1B0PA 2NUTB 4TTRA 3W34A 1RJ9A 4A6DA 3PXAA 1WULS 1O4VA 1Z7EA 4LJ5A 1O4WA 4OPMA 4HDRB 2QL5A 1CZUA 1VP9A 2GHTA 2IHKA 3GPCA 3PPVA 1YZKA 3EXIB 1SRQA 4RK4A 5EJEA 2B7LA 2IEAA 1WD7A 3TBFA 5CAEA 4WY8A 4IHJF 1NW7A 3QOYA 4Z9FA 5J59A 1Q1QA 1EUCB 3C0KA 1A8PA 2A84A 1E9BA 4I4TA 5CW2A 4KO2S 5GPBA 1FY2A 3P2YA 1XTQA 1SC6A 1XX6A 1CF2O 1YHZA 3DBIA 3JQ8B 1PTKA 2FZWA 4U2EA 1OA0A 4BMNA 4UNRA 1AHHA 1E3LA 4UREA 1N8TA 1UBRS 3QIVA 4D8WA 1FFYA 3FUTA 1FFXA 4F2HA 1GZ5A 1M8KA 1MMFB 1L5SA 4EJSA 5KKCA 2ORIA 1HYQA 3HMQA 2CJWB 3GXBA 2CNWD 2NU8A 3THXA 2Q62A 4LUCA 2NYVA 2RGAA 5HUHA 2DPXA 3P9ZA 1VBKA 4HG2A 4MQ4A 4MS1B 2DUUA 4E14A 3NTUA 3SSMA 2FUEA 3QY0A 5EMHA 5ALOA 4IYJA 1YJ8A 2H2AA 3NEYA 4YXWD 4O63O 4LX0A 3WYFA 1MXHA 1XLTC 2O06A 3L7OA 2CMDA 3BWXA 3EN0A 3HV0A 5DLDA 4BO5A 1EFVA 1O2DA 4CT5A 4FGLA 1E1LA 5LYJA 1CWUA 3M3HA 1PWEA 3I34X 5JWOA 3UBTA 2H3HA 3CF4A 3VTFA 4LHVA 1NNSA 1NVVR 4X93A 5D8DA 2R6DA 4D42A 1UBKS 3FM9A 3VR2A 1Z4NA 2UZIR 1GFZA 2TMDA 5KTYA 4JBIA 2GJSA 2VC2B 3COZA 3B1YA 3WJ1A 4EHNA 3EGVA 1RM4A 5EJ2A 1WVMA 2XMDA 3OCUA 4X6LA 5JAOA 4LWZA 3L7KA 2XKBA 4JY7A 4HB0A 2Q9UA 2QD4A 1DHTA 4UEJA 3R9XB 1A9QA 4OQDA 1GQQA 1YCDA 3LKZA 2PMKA 1SXJA 3F6BX 4G25A 4G5YA 4JBYA 2BFOA 4PSKA 4UMDA 5CDSA 3OPYB 1JMVA 4KYVA 1G21A 4FIDA 4MUXA 4TRMA 4UW9A 1BE8A 2JFXA 4FCWA 2Y1CA 1D1TA 2CT8A 5AK0A 1W5TA 4BFSA 4IMPA 1B6TA 1APBA 4XUEA 2PRZA 1F14A 2DUNA 3P9PA 2F48A 1A9YA 1SEVA 1K4YA 1EDBA 1J07A 1K08A 2AOVA 3D2BA 3H3JA 4N6GA 3VTZA 1HDEA 2BHNA 4O2RA 4ZJPA 3AEQA 7REQB 3ZI7A 1ADCA 2Z3WA 4FW8A 4NOKA 5ESXA 2OWEA 1GUAA 3NW9A 3QLUC 4WZBB 3O83A 3SWWA 1NOJA 1L5RA 3L6EA 3TRJA 3ZHTA 1MLDA 1YQUA 3B2EA 2OYCA 3ADDA 4KGDA 2X0RA 1B6GA 4KYUA 5FOVA 3JAWB 1OTYA 3IAAA 3IR7A 5JECA 5T57A 4Y18A 3SZMA 3WL7A 1K9SA 3I9JA 2IODA 3OTOB 3MCAA 1NUHA 2WU1A 1JTEA 2H7VA 3CGWA 1ZIYA 3ASUA 2PSSA 4M54A 4WRRA 1UUFA 1YRLA 4DIEA 2WWFA 2NUPB 4K86A 2F90A 2J5RA 4LJSA 1DG1G 2NQTA 2PKWA 3MNFA 4RPCA 4ZT3A 2XV1A 5BO5A 3RSSA 1LSUA 1JWBB 2OXFA 1UPCA 5EXSA 3T61A 3MHTA 1ZVQA 1VGRA 2VXCA 4M7WA 3VDRA 1E0JA 4JASB 1WETA 2WMOB 3EARA 1UJCA 2Q50A 4C4YA 1CR1A 1RMQA 3QUTA 4C0LA 1WQ4A 3UAZA 3JWHA 3PV0A 4DLAA 4TWAA 2CK3A 3D7SA 1E7RA 1VLVA 3UWDA 3RYHA 3SD7A 5BP7A 2IZZA 1ULHA 1W73A 4ND7A 3R7BA 4AKEA 3PC7A 5HQJA 1V4BA 4DYHA 1G64A 1MFZA 1RDFA 4BBAA 3EIOA 1O6FA 4H2DA 3LO5A 4Z53A 4TXMA 5EZYB 3VHXA 4YAIA 2IV2X 3L8EA 4MVXA 5DTRA 3SSAA 1UH5A 3RFVA 3NTVA 5JT1A 3OKAA 2XUAA 2Q2VA 1Y7TA 3LDFA 4CMIA 3DF7A 5GJBA 4M1EA 3IAM1 2AR0A 1YDFA 3WHPA 3UMJA 5HE9A 5DOVA 4QLAA 2BHSA 4LJ4A 3GOQA 3O73A 2W90A 4GYKA 2VA8A 3EQ8A 2B2CA 5EXDA 4MR8A 1CRLA 4NTZA 1F6BA 4RZUA 1QRSA 2R44A 5EUCA 3U0BA 5LXTF 3K0KA 1OV6A 2G4LA 1G20A 4ER5A 3BPSA 3QFRA 4RSMA 5K3DA 4CKZA 2P5UA 1KI6B 2ZSBA 4WUTA 3CRNA 5L53A 1EM6A 1PBNA 3MVEA 1HWYA 2NTNA 2XUHA 5B58T 3U1BA 2LE0A 1KEZA 3BBPA 3LLVA 2P2YA 3IP6A 4N48A 3EEFA 5H9VA 4D97A 5LDDC 3EODA 1ZC3A 2W71A 2GLXA 4OSEA 2CDBA 1N9ZA 2ECFA 1N2ZA 2NX2A 3GJ8A 3OCCA 1VLJA 4II2A 3ET5A 5A5EA 2DYKA 2B6HA 1CY2A 1G2IA 3C5CA 4FOSA 2XUDA 3QKIA 2I3BA 2Q1XA 4IZHA 4KO1S 3NEJA 2NV2B 3PHHA 2X7HA 2F43A 1RE0A 3TFOA 2ZTVA 1LLUA 2IHBA 3WLIA 1TM2A 4QOEA 5HDBB 3RTAA 1S3SA 5EHZA 3GAFA 3KQPA 2OBLA 3NHKA 1CR6A 4BLPA 1N9KA 4RJJA 3BFVA 5AW5A 4KP7A 4IDAA 1IQUA 2GHIA 4FMDF 2ST1A 2G1KA 4MS3B 4B3CA 1DOAA 3GWZA 1L5KA 4NU0A 1HDGO 3IVCA 2I2XB 1R0ZA 3NBQA 1TO2E 3ZI0A 1KH1A 4TQUS 4B3RB 2HA0A 1D7OA 2IYAA 2OCXA 3DM9B 3DLPX 4QPNA 5DTIA 6PFKA 2B83A 3LGAA 4D80A 4Z8YA 1M1NB 4XPZA 3SR3A 3YASA 4JNKA 4D92A 1XXHE 1KQGA 1G66A 5ILOA 2ZP1A 3C1OA 5K3CA 4D0NA 4DIOA 4JBNA 2KJQA 3FPLA 2W2LD 3J81A 1TLTA 2LCIA 3BSSA 3R6TA 4MYTA 1NVTA 4G97A 1NNUA 4PFJA 3JQAA 1TJYA 2P5TB 1HL3A 2QXUA 2VS1A 2WYWA 3NVMB 3ONEA 4LMBA 3UCXA 1UBOS 1EBFA 1RKXA 1Y9AA 2CD7A 3UXEA 1ULTA 1M6NA 5FBVB 2JLZA 2FZGA 1YMUA 1VBFA 4HX2A 3P0EA 3VR4A 5HPYB 2N46A 1JEYA 1LI4A 2CZCA 3Q8XB 4PIVA 5C8DA 1ZN7A 3LWDA 5IK2D 3HR7A 2JIDA 3ZCSA 4DG9A 4RVSA 2VPPA 1AF7A 4I14A 5G02A 4CLXA 4TM7A 3U61B 2AFHB 2CFIA 2C07A 2Q29A 4V0OA 3WK8A 2VQFB 1D2AA 1ECGA 1IBCA 1M1XB 3HZHA 4XRRA 1N7HA 3WGVA 1YJBA 2PUDA 4XZ3A 4M1OA 1NULA 4QBHA 3GRUA 1FFDA 3L4BC 4M0FA 3B82A 4P80A 4G0OA 2ZR7A 4C2UA 5F3DA 3HY3A 3LU1A 4PQRA 3VC3A 5ITZA 1BDMA 1SD2A 4MGZR 5CTJA 4HH4A 4D9GA 1PR5A 3UXYA 4CKCB 1J00A 1WJGA 2YIMA 1PV2A 3C6BA 3AY3A 4YAUA 3RJZA 1DDGA 1EWRA 2C3OA 1NVUQ 1DL5A 3GJ0A 1I1NA 3HLKA 3KJGA 3LLUA 1H2ZA 2EFCB 4QUEA 3WQQA 4Z4IA 4XQ9A 3IUYA 4FT2A 3T54A 2XI4A 4B71A 2OAGA 3IJRA 1U6IA 4DRXA 3EVBA 4RYLA 2PUVA 3QJGA 4E3WA 4QXOA 5C81A 4YUWA 1ZWLA 5AK6A 2OUKA 3NATA 2HADA 5JJIA 3HA2A 1U8XX 3LHSA 3ZZ1A 1PFYA 2B35A 3GMIA 4F11A 3IQFA 3PJFA 1SELA 5DI3B 4FEEA 1XNRB 3QELB 1YZUA 3JARB 4A0GA 5FH9A 4QHSA 4EG6A 1U0SY 1MAHA 2XDYA 4BWYA 4X71A 2EKPA 3DZHA 4PZUA 1F0KA 1HEUA 3AI2A 1O6CA 3VSCA 3CPSA 2VQEB 1VRCA 1FTWA 3V4PB 4M8IA 1ZNWA 4LDPA 1XTBA 1QYXA 4R8SA 2X1LA 4C21A 2VDJA 1FP4A 1PJBA 3MWDA 3JD1A 4TLMB 1Q74A 3WNDA 3QKSA 4AP9A 4X8HA 2P9ZA 3HWRA 4MRMA 4WWHA 1ZM7A 4FLMA 4RTNA 1L0BA 1VSQA 2ILVA 1ESEA 4N0PA 3WWZA 4A2QA 5C5EA 3ES9A 1AXRA 2AJDA 5G53C 2GZ1A 3E5RA 3EDYA 3DMNA 4L5IA 1U8UA 3QVVA 3V55A 1P4JA 1HNZB 3WNVA 4UNPA 1T0HB 2G82A 3C8DA 3U4DA 2I9PA 3VHLB 4UTVA 4C1NA 1ZU5A 2UVPA 4NE9A 1AA9A 2IXAA 5HKLA 2ODPA 5TS3A 4KFTA 3P94A 4DAOA 4KPFC 4EB6B 3NHBA 1RFGE 1J9GA 4RTJA 3PL1A 5T64A 4C3VA 1RRFA 4YCAA 3QNWA 1I3CA 4D25A 3LYAA 2QYOA 3BDAA 4FMCF 1GP2A 2HGSA 2GZMA 2V65A 3A70A 1PJAA 4WVLA 1JFTA 3CVWA 1PT6A 5F52A 4QULA 1LV7A 4M1YA 5I8PA 3VOSA 2C96A 1C9DB 4XGNA 1LJUA 5EQFA 2VQ6A 1U02A 3P19A 1HDXA 1XQ1A 3O93A 3JU3A 1K8ZB 3W4KA 1Z38A 2IV3A 2EGHA 4I4CA 2C8KA 3C5VA 3NTQA 3VMMA 2A1TR 4CMEA 3EUAA 3C48A 3CONA 1JIKA 2WTXA 4U1RA 3O2NA 2RKBA 4BGEA 2PGJA 2NYUA 1QDLB 4C7VA 5JHHB 4IOKA 4D3YA 5AKIA 5AKHA 4HEA1 1D7AA 1ZZGA 3PHGA 3KVYA 6ABPA 1XTRA 2ZSFA 4JT9A 1TRKA 1Y9ZA 2QNIA 2AA3A 3TB4A 1MH1A 2PMDA 1E98A 3PQFA 1CHDA 1WB5A 1GNSA 2GB4A 3GQBA 5IG2A 2UZ1A 1C8VB 2VHCA 2GILA 2X6QA 2XOXA 2FZLA 4OFWA 4QAQA 3L5KA 2DT5A 4BX2A 3H1TA 3F3KA 2WV9A 3AL0C 5L95A 1QYCA 2JGFA 2JHAA 4D8TA 2QBYB 4GG1A 2DULA 3BTVA 3CLUD 3IKVA 1LU9A 1NFFA 1YR9A 1RPJA 4DZTA 2F1KA 3KM0A 3KU1A 2BGJA 2ORYA 2XMGA 3PRKE 4EHLA 2FZ4A 4HV4A 3OG9A 1F2TA 4O0MA 1M73E 3V42A 1GPLA 2DBVO 3E5NA 1R5JA 1XCLA 2VXYA 1NJ2A 2E3JA 3NWEA 4MICA 4CTOA 1LBQA 4IW3B 1XAGA 5JNSA 2GNPA 1I7DA 3WNZA 5GTDA 3BSFA 3AR6A 3DEFA 1N8KA 2SCUB 1TUGA 2IXGA 1J06A 1QQ6A 1HFEL 2V45A 2FHPA 1Q1AA 5LU8A 2OBYA 1QO0A 4ASUA 2WU3A 2Q6VA 6REQB 2C4NA 3EUWA 3O90A 3PUKA 4PX3A 1N25A 4Z0NA 4FQ5A 4G5FA 4QATA 5JQGF 3D02A 1WMAA 1R2QA 2IEBA 4H6VA 3EEIA 1EIZA 1VQ1A 4DA8A 4EX7A 4BQPA 1KQNA 4LVCA 2BI7A 5BQ3A 4WKPA 1R50A 1X9HA 1KETA 2NPIA 1L4HA 4H1TA 1MJGM 4H7PA 5HIIA 3V8VA 1YONA 4RV9A 3B51X 4G4GA 3VR2D 4AU1A 4BGVA 4BQQA 3E5MA 4QXAA 4QUBA 3RG2A 3HJHA 5IDXA 4RD2A 3PXCX 2G67A 1FBNA 5AI8A 5DM60 4MGYR 3MTAA 4R6XA 3E8XA 3K4QA 4BP1A 1HLDA 3CUEF 4OH1A 5L45A 1E1YA 2PFKA 2XXAB 2OC4A 4QVKA 5BWNA 1ZOSA 1NP6A 2O8VA 1E62A 1YQWA 3KKZA 4G81A 1Z2CA 2AS0A 3QNUA 3UY4A 3DQQA 4Z3DA 2DBYA 2A9QA 4G9GA 2W2XA 5CPFA 1G7RA 2H06A 4RF4A 2PT6A 1MH9A 3DD1A 4DMHA 4HVCA 5A6SB 4L5BA 2B94A 4CF5A 2XZOA 1T1SA 4LG1A 1U0JA 4RHXA 3L46A 5IKPA 2QEQA 4QOFA 5EQJB 2HWXA 3ESZA 3PC6A 1E2EA 3ZBPA 2YY5A 4UZEA 1LX7A 2Y27A 3DEYX 4H77A 1D09A 2LWIA 5EEHA 3UO8B 3J81k 2GAAA 1O0BA 1HZZC 4QPJC 2GXSA 3KJIA 4CL3A 3QI7A 3QU9A 1ZGHA 3EUEA 2VJPA 2QPOA 2G36A 4DOMA 1VMEA 1M2NA 3D6MA 3LC2O 3PCRB 4H7IA 4K6FA 3T3MB 3UMBA 1XP5A 1RZUA 5AUPB 3ZWDA 1XN1A 4MDFA 1BGWA 4IG4A 2VHEA 3AUXA 4G89A 5EC8A 2IA5A 4CT4B 4RMJA 3AERB 5A3VA 4CM8B 1EDEA 3I9NA 3RYIB 2IYSA 3GEBA 3HUTA 3KJZA 4N8EA 1TPYA 2QRPA 1W48A 1SXIA 3K6JA 3UK6A 1FFAA 1UKCA 4LDQA 4D79A 2CCGA 5AESA 5JTTA 3PKJA 4FJ2A 4AY3A 2BZ0A 3L9XA 1HL7A 1H6DA 3OZWA 1LKZA 2B1RA 2FE4A 2ZBPA 4WNIA 3RBVA 1AGXA 3FNFA 3GD5A 2C4KA 3L3BA 3UGTA 2AVDA 2CK3D 3VZBA 3HE3A 3JZIA 1VLQA 2HJ9A 3VUFA 2JKYA 3ZWKA 5K01A 4Q0MA 5B2FA 2G04A 4AMBA 5HVNA 1DWUA 2YC4C 1MUUA 1WCWA 1JL3A 2KS6A 3V1YA 3PF8A 3BFXA 4GKVA 5E95A 1KZ4A 2REBA 1VG0B 2ZIXA 4R9SA 2EL7A 4TMVA 3A6FA 3WL6A 3VR0A 1KJIA 2A1TS 2Z3ZA 3CE6A 4OM7A 4V02A 1IBMB 1AH2A 3P7MA 3CUYA 4TTAA 1WKCA 1QYWA 4E1VA 1P0IA 4C78A 4Q34A 1HDCA 1OY1A 2H16A 3F4LA 5CVUA 3RQSA 1KY4A 2XUOA 4OBEA 3T9AA 1OLOA 5K20A 2CMFA 3A1SA 3C2QA 2BBOA 1K6IA 2GWRA 4I5GA 4O6VA 5AKEA 3SHTA 5HG0A 5CB4B 3AXTA 5D3MB 5K8CA 5H0IA 4GAEA 5GONB 1TVKB 1QE0A 1HNNA 1XDSA 3PFGA 4X61A 4EDHA 4LCBA 1UEIA 1WPXA 3PYLA 1JPNA 1U3TA 1RM5A 1ENZA 3ZOZA 4RORA 3VO2A 2QRVB 4P7FA 3FCOA 5EINA 2WJHA 3K1ZA 3O8BA 4KE6A 5CM2Z 1FW6A 3IXLA 1O97C 4UD6A 5ALJA 1U28A 4RZ3A 3CNHA 5EVJA 4AICA 4Q03A 2GAIA 2GJ9A 3KZCA 3WL4A 1RWWA 4A8TA 2J3LA 2QV7A 3KSDO 3R6DA 2JFYA 3AJ9A 2GZAA 1V11B 4IVRA 3V00A 4AN4A 4C2AA 5BV1A 5F4BA 4OAPA 4G1BA 5IYZF 1F2UB 1ZM9A 5B64A 1ECJA 1OWLA 1FOEB 2JRCA 3DB1A 3KXDA 3DLHA 4UD2A 3PLNA 5E9JA 4ZT7A 3ZU5A 3HEAA 4P7KA 4OXRA 2AOUB 4LBWA 4M76B 5FUVA 2V6GA 2IS6A 2M6KA 1P9LA 4BO8A 4FOTA 3GY0A 3Q7QA 1DS6A 4IICA 3FZQA 3AC0A 3AEKB 1PL6A 3L92A 5M7EA 2W8BA 1PQPA 3LZ6A 3UC9A 2FPUA 4U2FA 1BKSB 3T1OA 3KL4A 3OT1B 1ZSVA 4I66A 2B8TA 2QROA 4LW8A 3TYXA 2QN7A 1Z6YA 2O7VA 3FYTA 4X8OA 3GN1A 4BX8A 4TS1A 3ZQKA 4ZYUA 3IBYA 2YWHA 4Q82A 5TQ2B 3STYA 1GA6A 5L4SA 3UCEA 1J33A 1T9BA 2DH5A 5CCDA 3KKEA 1MX5A 4TVKA 3I04A 4CL0A 1RTKA 1S2OA 4GD3Q 2XQGA 3R3YA 5CLHA 2H85A 2PL5A 1Y1RA 3VBEA 5HWSA 1I6LA 3H84A 1MB3A 3TW6A 2QRHA 5ULLA 4DLLA 3CB4A 2ZJFA 1NG9A 2WSSA 4NBNA 3PJDA 1FVHA 3QOXA 1C0KA 1NP7A 1U1IA 1Y63A 4ZAGA 2HA7A 2QRMA 3GEPA 4RY9A 5I7AA 3JQAD 1TTQB 2PEYA 4CI0B 3SDZA 2V3WA 2WFLA 2Y1FA 3F7OA 3F0TA 4W5WA 1XAIA 1YOVB 4PCAA 3A36A 3V2GA 3PFNA 2GT1A 1P75A 2P41A 1TAUA 3UMMA 1E2QA 4K46A 1L4MA 4O2AF 2HDWA 5E2IA 3VR4D 4D44A 3AT1A 3GDOA 2ZRMA 1PK8A 2AEJA 3PDIB 4RVNA 3R9KA 4UM7A 5KYYA 1CJTC 3KL2A 5AJZA 3A0RB 4MQEA 2WILA 4AK9A 3T7KA 1BCRA 4V0RA 3B5JA 1I24A 3INNA 4PXYA 3VYVA 2IHVA 3BORA 3GGSA 1AKYA 1R9GA 1ISJA 1UJBA 3HYSA 3KZ1E 1D4FA 1U5BA 1ZUNB 2YR0A 3JVIA 4W9NC 2ZPUA 3CEAA 4G07A 3R3VA 1JJAA 3JYHA 1AK1A 4V2UA 4GQAA 2C7GA 3FCYA 1DAMA 5EIOA 3PXEA 5LDGA 2X0JA 3CG0A 3SKVA 3GJ4A 2RH4A 2XSZD 3Q15C 4CCAA 4D99A 4QREA 1Q22A 1L1RA 3D6VA 3HXMA 4ANFA 2Z2XA 5ECYA 3GHYA 5DKFA 5E2BA 4JIMA 4ZYXA 2E4AA 3FKSD 1NR7A 2CVZA 1KFEB 3SC2A 2AE2A 1BU5A 1QR2A 2Q9CA 2XR1A 2YZ7A 4DSAA 3AM1A 3IEIA 4O4IA 1QP4A 5DF1A 2NZ8A 3WIVA 5B7PA 4WFJA 3DMPA 2VK1A 3QFSA 4LOLA 5TPZA 4WBNB 1DJPA 1VP3A 2F1HA 3EWNA 2B8EA 3FHCB 4J0HA 4PICA 4UC0A 4V0ME 2W0MA 1DIBA 2YJGA 3HVKA 4I4IA 4ZYVA 2P9CA 1F1JA 1Y3BE 5IULC 4F3RA 2ZANA 1AGYA 4DGSA 3TGWA 2E85A 1MX1A 3ZHRA 3W5HA 2OCKA 4EBFA 2JNWA 2I2FA 1BS9A 3U62A 4RKQA 3TOVA 1R4ZA 1BD4A 3G1UA 4M1WA 1P7VA 2P5YA 4XPIB 3NT2A 4FZRA 2VTKA 5I9SA 1PDVA 2PXAA 3TOCA 4RY8A 1BA2A 1RE1A 3OCVA 3EXFB 1GZSA 3GEIA 1GNTA 3MRTA 1JTVA 3G5TA 3SZUA 3ZCQA 2AR7A 3RFXA 5KYXA 3LECA 3FFBA 4O4HF 1IMJA 1W8DA 4CU2A 2ACWA 1KMNA 5LBIA 5E0OA 2Q8NA 3NHFA 3SBXA 2IPOA 2ZJ3A 2YN2A 2ZS9A 1OYOA 1ZIDA 2A9JA 3BE6A 4IDGA 3PUWA 3HK2A 2C88A 3U4IA 2G70A 2VQDA 4KODA 1ORIA 1XWWA 3EJWA 1U8TA 1X7YA 3SSNA 4DDUA 1IY0A 4YRJA 2VSYA 1B6SA 2FW9A 5CNIA 3PITA 4WLVA 1JHZA 1YAHA 1K5PA 3VR5A 1J23A 4FZ5A 3TLYA 2Q45A 5JANA 2FPWA 4I46A 4J91A 2QM7A 5HQ3A 5TR9A 2FSGA 2CMGA 4EO4A 1FSSA 5CDHA 5LA6B 1A9PA 3DFIA 1EFPB 3A9UA 2P2ZA 4UOQA 3MIZA 4ZAXA 4GPAA 1TUBA 5I4CA 1X1SA 4X1IA 5JMPA 1L9XA 2WG2A 3NS7A 4FDLA 4NE2A 4U8HA 4U7DA 3B3QA 1OLUB 3L84A 3WFJA 4DV7B 4DILA 1B8NA 3I8XA 5LZ4A 4DHWA 4M0LA 1Z7YA 4Y1EA 2PZ8A 1FDIA 4IX1A 4Y9RA 1KH2A 3SR4A 4RKFA 5E6RB 3H9EO 3L79A 1T6XA 1PU2A 3K4PA 3ORSA 1HNWB 1Z0UA 2PRJA 3LLSA 4BO7A 3RKRA 3FUUA 1J1UA 1C7JA 4XGIA 2YICA 3BH7A 4KUEA 3RVDA 3RSOA 4ZYYA 1PJ4A 4F3CA 1AKWA 4BQSA 1A04A 3QPWA 5C34B 1E2FA 3A6GA 5A06A 2JEZA 4JQOA 1JFSA 1HK7A 4BRWA 2WVHA 4O1IA 4RTRA 3DHEA 2HGZA 5FCDA 2PUFA 3G9ZA 3K0HA 3QKTA 2DJIA 3NCTA 3HYNA 1CVIA 3SQDA 3ICWA 1BH2A 3PFKA 1B1CA 1N2HA 1TNDA 5LZ5A 3VV2A 1J97A 3FHLA 3GT0A 4ZVPA 1KI2A 2BBWA 1J20A 4QJ5A 3UPDA 1VC2A 5BNWA 1AA6A 1E4VA 1FNMA 3GUYA 1IJKA 2CXPA 3M6MD 5I5GA 4Q39A 4TKLA 4AKGA 1X6VA 2X41A 4RTKA 5DBEX 1NX9A 4R40A 2OR3A 3C1TA 4Q48A 4F92B 1K5GA 4JGGA 4PPYA 4ZEOA 5H3LA 3M3PA 1GKUB 4TXJA 1FP6A 4GEKA 4WERA 3ROKA 1DAOA 2QA5A 2QGNA 3G6KA 3H7IA 2OXCA 3IP3A 4G4SP 4JJ7A 1E77A 2JFZA 3O1HB 1XD2B 2C61A 3OO1A 2IYWA 3GFOA 3P4UA 3CWQA 2D5LA 4FFSA 4HMPA 2HA5A 3ASZA 3C3PA 4LVOA 4TL9A 4I9GA 3T3HA 4D3XA 3RC7A 3B1ZA 5JRJA 1UZMA 1YI1A 1EP1B 1OWMA 4MW2A 3CE9A 1QO0D 4ASUD 3G2IA 2VP5A 3I9V1 2QGZA 4URXR 1IZYA 2BR3A 4P3OA 1FUIA 3IQGX 3AFOA 1F4VA 3C8MA 4BXOA 4TS9A 2CMHA 3H0KA 5BRNA 4AUMA 3LKBA 4BNUA 221PA 2BR5A 2I3AA 2X3UA 3E5HA 4RK6A 5L3QA 1H8HA 4WD3A 2H1OA 3H2YA 1H3NA 1CS0B 3AEUB 4IWXA 1G7CA 4G0MA 2GA8A 2QTAA 1G18A 2YCBA 4H7JA 1WS6A 4JEMA 4JROA 3OFJA 4NNOA 1L5OA 3V2IA 1JB9A 4W7IA 1JQAA 4EPXA 5JJKA 5FAXA 3ABIA 1AQIA 1ENPA 4EW1A 1YC5A 2W2KA 4NBUA 3TQIA 5AUOB 2E55A 1PJTA 3VAZA 2WHXA 2YW2A 1CULC 1WY7A 2J31A 4F2DA 3TQHA 3PEEA 3DHNA 4CFZA 5KPDA 3L7JA 1G8YA 2Y68A 2OFFA 1WEKA 3H8WA 3JATB 4O08A 3RT9A 4IMIB 4MCAA 5ELLA 2CGEA 4JL6A 3UANA 2GARA 1JPVA 1AV6A 4MR7A 3K0AA 2WNHA 1O95A 4ID3A 4HRYA 1V6SA 3NP7A 4MLCA 4M1QA 3RFTA 3DYVA 4OI1A 2VJLA 4C3ZA 2WJ3A 4DCUA 3HDGA 4DR4B 1PJZA 2D00A 4MGKR 4K28A 1D1SA 4ENPA 1NXXA 3K1AB 3I1IA 3MOSA 4NECA 4RA6B 2P40A 1DFIA 5B7NA 5CFMA 5TPWA 3H0EA 2AV6A 1MJNA 2E87A 1ANKA 5EIHA 5CFNA 2ON6A 3K70B 4MO2A 4DQKA 3RIXA 1JZQA 4KUHA 4DADA 2OO7A 2ZKIA 3AW9A 2VT2A 1GT6A 3D1VA 4FGKA 4C01A 3AUJB 5J63A 3UWMA 4BZXA 2BF4A 2GPWA 4R1PA 3M34A 3TF5A 1EAYA 3D3NA 3HU3A 1SCUA 1U9YA 2RHMA 3F6PA 3E6AA 3LIIA 3SXUB 5A9SB 2W48A 3NXSA 5C51B 4JAVC 1MHTA 4GPBA 1Q57A 4PZ0A 1L3BA 3B9RA 1QZUA 4P2BA 5BVHA 4HLNA 5HZKA 1FFCA 1GA4A 3B53X 3G88A 4RH1A 2NVBA 2PNJA 2REXB 5MHTA 1V2GA 1DTWA 5TB5A 4OEHA 1KPHA 3B1XA 3TJRA 2MYNA 3T3DA 2RDMA 3DV0B 5TLSA 1Q91A 5K0LA 2H1WA 1YU6A 1ATIA 5JNUA 4RAQA 3ACBA 1YQDA 3WYGA 1XPJA 4B17A 4PY2A 2A3NA 3WLJA 3KRTA 3USCS 2I65A 1WG8A 3VC2A 3HI4A 2G09A 2ZIUB 3PI7A 2ZE6A 1IEVA 3OIVA 1MRSA 4B7UA 5B7QA 5HP4A 3WBBA 2OCYC 3EXHA 5AH0A 3ZEAA 1XF1A 3OKCA 4FGZA 1LBSA 3PQEA 5K3FA 4PZLA 1P31A 2F7SA 2OV1A 4RA9A 1O94A 2HMYB 4P4NA 2E6KA 3PGKA 4J76A 1K3TA 4YQEA 2OBNA 2J9XB 4N03A 5K6RA 4MJ7A 4NYIR 2IOYA 2XMBA 3FA2A 1Z6XA 1F5NA 1AKVA 5F1OA 1HR0B 4IUBS 4MDEA 3MTEA 4UPVA 1WRBA 4AO6A 1UKAA 3T7SA 4EABA 2AMYA 1XV5A 2FLKA 4ZQFA 5BN3A 1LDBA 4NU6A 1ZEMA 4CNQA 1ZSNA 1TUIA 1W4RA 4B8YA 1KYWA 5JCJA 3KQVA 1EFCA 2C7QA 2I5PO 2OHVA 1UWVA 2AHOA 5AHKA 3EHDA 2O1WA 2VFAA 4YDQA 1VJ5A 3QUAA 4COOA 3BTSA 2YN0A 3NWBA 3RYFA 2RGNA 1DCMA 1OREA 3ZCXA 3WGJA 1KBOA 3R0XA 5K1ZA 2OD9A 4CI9A 5JAMA 2C29D 1I3KA 1YA8A 1ZCFA 1CG6A 3D1JA 3PXXA 4KPGA 4QVIA 4RKEA 3QM1A 5MDHA 3V1NA 1XU4A 1Z74A 3KCQA 4FOOA 1IOZA 1Q6ZA 1VHLA 4M55A 5JFOA 3G0HA 1MEJA 1SKAA 1NJFA 3L1VA 4TT3A 3DFFA 5BN4B 4AUKA 1DC6A 3KZNA 4LJLA 3A6JA 4ND6A 1MNQA 1PTJA 1FUYB 3PDUA 2YW9A 5CVDA 2WZCA 2IUYA 1QQ5A 5CITA 1C4KA 5EGSA 3OD1A 4RZSA 2Q0SA 3TSOA 3CEHA 5CDTA 2Z3VA 1EVQA 2XH8A 2WVGA 3NOVA 1F0PA 2QAGC 3U44B 4PSVA 1NJ6A 4BECA 2W6ZA 1Q1ZA 2DX7A 2R25B 3E1SA 3RABA 1T2UA 2EIXA 1N2XA 4JCCA 1IWBB 1XTKA 4EHBA 4X24A 4Q5IA 3U13A 4A10A 3GHHA 3PGVA 2QQ0A 4U39A 3UB4A 4DMRA 4ZHQF 2ZRBA 4DV6B 1SC1A 3EMVA 4D2IA 4G26A 1MOSA 3FWPA 4GPD1 2WSSD 4BYMA 2J0UA 2EZTA 3BQNB 4R6WA 2W00A 3QMMA 1XB2A 2PTHA 4ILEA 3LX8A 2Z43A 5AW8A 1DRKA 1I6WA 1LA2A 1WTAA 1Z3CA 4P83A 2W43A 3EAQA 3FYHA 3L40A 1TTHA 5JAHA 3RIHA 2DHDA 1ZA1A 2GNAA 5YASA 5IKMA 5GADl 3O4VA 3EBLA 4UHFA 1O9HA 4OCZA 2P4HX 1C3XA 3GDFA 4PZAA 4TTSA 5HILA 3U1TA 3UENA 3IKJA 3OZEA 2OECA 1N3IA 4UMVA 2PL1A 3R09A 3SNKA 4IVPA 3D31A 4QOJA 5FDFA 2HH9A 5THKA 4ZOLF 5IW8A