3L1KA

Sad structure solution of proteinase k grown in potassium tellurate solution
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTDILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Proteinase K
publication title SAD structure solution of proteinase K grown in potassium tellurate solution
rcsb
source organism Tritirachium album
total genus 102
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2009-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3l1kA00
1GA6A 1SIUA 3VSBA 1MPTA 3AJ8A 1KDVA 5AVKA 2SBTA 1NLUA 1WVMA 1IAVA 2XRMA 2ST1A 1SCBA 3VHQA 1OT5A 2W2PA 1YJBA 3PRKE 1GA1A 1SBNE 1Y34E 4NE7A 1YJCA 1BH6A 2E1PA 2W2QA 4M1ZA 1AVTA 1TO1E 3AJ9A 2W2MA 2DQKA 1C9JA 4H6XA 1AH2A 5B1DA 1SIOA 3DVSX 3GCWA 5AMXA 1PEKE 2HPZA 3WIVA 4FONA 2HD4A 1A2QA 3PTLA 4OV6B 3UNXA 3VV3A 1DBIA 2DP4E 1GA4A 1WMFA 1Y48E 1GCIA 1AV7A 3DWEX 3QMPA 1WMDA 4H6WA 3CO0S 2ZRQA 2WV7A 2W2NA 3DYBA 3ZXXA 5JXGA 4OMCA 1XF1A 5B1EA 2G4VA 1HT3A 4C3UA 1KE1A 3A3NA 1EGQA 3EE6A 1T1IA 3GT3A 3DVQX 1TM4E 1T1GA 1SBIA 3LPCA 1AK9A 1GTJ1 1AF4A 2Z2ZA 3F7OA 3I37X 5AVJA 3LPDA 1TO2E 2SECE 1Y4AE 4LVNA 3DE4X 3I2YX 1SUDA 4K8RB 5JMOA 1TM7E 3I34X 1BJRE 4B5LA 1IC6A 3TI9A 3LPAA 3DE6X 1TM5E 3VTAA 4DZTA 1SCNE 5K7SA 2PWBA 1SN7A 1R64A 3DDZX 3DE1X 3EIFA 4I0WB 2GKOA 4WOBA 1SBCA 1R0RE 3Q5GA 2WWTA 1JEAA 1MEEA 3VYVA 1SELA 2Z2YA 3WIUA 3T41A 1SCDA 4KPGA 1C3LA 1SH7A 1KDYA 2IY9A 2W2OA 1NDUA 2TECE 5JXHA 5JXIA 2QTWB 2V8BA 2X8JB 1GNVA 5JXJA 3H42B 2SNIE 1TECE 1C9MA 1BE8A 3WHIA 4ZARA 2PRKA 1SUPA 4NE9A 5ARCA 1SVNA 3QFHA 1ST2A 2XTJA 4CFYA 3AFGA 3BGOS 2IXTA 1SUCA 4DWWA 1LW6E 4YN3A 1Y3DE 3LXUX 4AKSA 1PTKA 4ZOQI 1AQNA 3L1KA 1P7VA 1V5IA 1Y33E 1S02A 2ID8A 2SICE 4AKTA 4CFZA 2WUWE 1SUEA 3CNQS 3P5BA 1CNMA 1GTL1 3ZXYA 2DUJA 1Y9ZA 5ARBA 2PMWB 1S2NA 5FAXA 1Y1KE 5I9SA 1VSBA 1KDZA 2Z30A 1KE2A 1TM3E 3GCXA 1OYVA 1SCJA 4NMXB 4HVLA 3SICE 1V6CA 2Z57A 3DVRX 1GTG1 1BFUA 3BPSA 3D43A 1PFGA 1SBTA 1NDQA 1Y3CE 3F7MA 1C9NA 3I30X 2ZWOA 2B6NA 5AQEA 1SIBE 2WUVA 1S01A 4WOCA 4BWGA 1BFKA 4JP8A 2PKCA 5CW1A 1Y3BE 2Z56A 4OMDA 4HX2A 5SICE 1P7WA 4MZDA 1TK2A 3TI7A 1P8JA 3DE0X 1OYOA 2ZWPA 1WSDA 3SQOA 3D9QX 1TMGE 1WMEA 4H6VA 3HJRA 1ST3A 2PWAA 1T1EA 1GT91 2PQ2A 4CG0A 1THMA 4C3VA 1DUIA 3A3PA 2X8JA 3EDYA 1Y3FE 1SPBS 3F49S 4KG7A 2ID4A 1YJAA 3DE3X 4KB5A 1Q5PA 3BX1A 2PYZA 2Z58A 1SCAA 3OSZA 1UBNA 1R6VA 3TECE 3A3OA 1CSEE 3DW3X 4GI3A 1SUAA 5FBZA 3DE2X 1ZVKA 1GNSA 1BE6A 4DJ5X 1EA7A 4RYDA 4Z2AA 1YU6A 1PJ8A 3QTLA 3WQBA 3DW1X 3Q40A 1SUBA 2Z2XA 2P4EA 3DE5X 3GT4A 1Y4DE 4J94A 1AU9A 1TM1E 3VV2A 1SBHA 4LVOA 1ZVJA 5ARDA 5FFNA 3DE7X
chains in the Genus database with same CATH superfamily
1DV1A 1GA6A 2GEFA 4AJLA 5CA0B 1KC3A 4BLQA 3TTWA 3UAVA 3N7UA 3AL2A 4BVLA 1EG2A 5T4EA 3FSEA 3KDAA 1YDWA 5D00A 1R6DA 1KDVA 2CCJA 2JB9A 3M2PA 3TPFA 3VU8A 2O5VA 2OUIA 3OQ1A 3K1YA 4Y6PA 4FTWA 4NG5A 3VH1A 4ARBA 1CWUA 1YHYA 2J45A 2HREA 4DR2B 2BZ1A 2Q0HA 3MBKA 2AI3A 1OXBB 3A37A 4I3FA 1SCBA 5JD3A 3T35A 4C5AA 5CXXA 1SG0A 4ID3A 4E6PA 5MFZA 3MERA 1NUSA 1UBOS 4MW5A 4A8HA 2VNHA 3A9CA 3E5NA 1TYCA 3JAWB 2BKUA 1V6SA 2PJUA 3NAZA 2ZI6A 1T6YA 1YUBA 3GLHA 4RSHA 4U2FA 5TMBA 3ZV5A 4EELA 3DLHA 1M5TA 2ONCA 4ATNA 4C4ZA 2WE8A 4Q9HA 1DWUA 2XOXA 2QJWA 2Y1OA 4CT4B 3WWDA 4OFWA 4LJ8A 1N8TA 5AVQA 2A5YB 1CUCA 1DX9A 4B4WA 2GXAA 1F2VA 4C4PA 1QYWA 4HEA1 4OXRA 1YJCA 3E9NA 3EEFA 4DIBA 4F3CA 1IUOA 5B6IA 1AHPA 1YAJA 2B98A 3KJHA 4WAUA 5KTRA 2CVHA 3AEYA 1US8B 5JJLA 3O26A 1U8TA 1ZESA 4JKYA 4AMGA 4LBZA 4RV9A 2F1OA 4JLNA 1K5PA 4ENRA 2Q6IA 1AH2A 1U8UA 3E05A 2XUOA 2PZBA 3CONA 2J7KA 4HEHA 4UJ3A 1GGJA 5DGHA 4GBJA 5B1DA 1G9TA 4HUTA 3ACDA 4KQ9A 5DX8A 4AG5A 5LQJA 1XD9A 1NNLA 3Q7QA 4IRUB 4WOJA 4Q48A 5KDLA 1NVTA 3RS2A 3RS8A 5AIAA 4OSOA 2V45A 4EFKA 2VPQA 4EOGA 1M7BA 2ZFUA 5EE9A 3K9FC 2ZUBA 2IE8A 5AMXA 5KYNA 5CNKA 3MWDA 4IFTA 2AE2A 4JLMA 3WKBA 4WFQA 4EJ6A 1V43A 4X60A 1ZM3A 1SKMA 3P9IA 3NGLA 5DIZA 3WJ7A 2ZXFA 1E0JA 2IDZA 3ER6A 1G20E 1GKUB 2VP0A 1YB5A 1R0WA 3E2MA 4DF3A 1PSDA 1DBSA 1WJGA 1Z75A 4BE9A 1FSPA 1L5WA 4O59O 3SX0A 1UBKS 2WY2D 4PCVA 3IDSA 4ZOEA 4NBWA 2NV2B 2NXNA 1GCIA 1XEWY 2Q50A 1JJAA 2VP6A 4J29A 3TZ6A 1S3FA 3WZMA 1QRUA 4E2YA 1EINA 3HFJA 3PC8A 4F6LA 5EYPB 1OKKA 4NYJR 1OAAA 4U2CA 4CHGA 1D1QA 3PPIA 1QLWA 1HEYA 1PT9A 1TL7C 3AKEA 1N5LA 1XAIA 4OU4A 5C31A 4CUJA 1VI5A 2BDEA 2O8CB 1GPWB 3UFBA 2IY7A 2JFPA 4XWOA 4HNUA 2Z8YM 2BGLA 3A2NA 1FMTA 4JI6B 3X3HA 4CM4B 1GAJA 3G0DA 3R23A 1LBTA 4L5IA 3PNLA 4UULA 5DHPA 1BXRA 1UFOA 4M4SA 4QJIA 1Y82A 1L8AA 2ECKA 3WLTA 2IH4A 1S2LA 4DDWA 3PT5A 3ONDA 1JA1A 4X3OA 1GHTA 1Z0UA 3L4BA 3SG0A 3DR3A 3DKRA 1ECBA 4DIOA 4OL0A 1GAEO 5MN4A 1RXWA 4TS4A 3QQPA 2IOYA 4XFKA 2QUZA 3FHOA 3CEHA 3PC2A 1EXWA 4RVHA 1IHPA 2F1KA 3T4PA 2F3TA 5IFKA 4RK5A 2A5GA 4FE4A 1G9XA 4LZNA 3V8MA 1Z0AA 4HADA 2FVYA 4D80A 3VPXA 2ECPA 4HR7A 4DV3B 3WB1A 3DCYA 3KVVA 2DPMA 2QW0X 2B3TA 5CCEA 3K8ZA 4G2NA 1KR5A 3RQIA 5COBA 3U3RA 4X24A 1CJMA 3TIFA 4K46A 2TMDA 1PGJA 1N4AA 4JVMA 1QOQB 3LSYA 2YMLA 3UAYA 2R48A 3FMOB 1NF8A 1YMVA 3MLAA 1JQDA 2BP7A 1B4DA 1YRWA 1XROA 2HIHA 1KC1A 1F2TB 1O8CA 1O5OA 1NMEA 1SUDA 5AKXA 5ALRA 1S7GA 3T7RA 3TD6A 1SHZA 1VJ5A 1WD5A 2PAAA 4W1PA 3TQIA 1E0AA 5B64A 1E4EA 3ZWPA 5KWIA 1C2YA 2YV2A 1VLQA 4PCLA 5JS8A 2VDNB 4ZK2A 3C8ZA 3PUYA 2DLNA 2IHTA 3JR3A 3SI7A 5IMSA 4FEYA 5KCZA 2ZSAA 3TOSA 1DFGA 1L4UA 1Z0FA 3S7TA 1GG5A 4FINA 1CDZA 3U17A 5I8ZA 3U62A 1Z8FA 3C98A 1RYHA 1KEKA 2C82A 1Q1NA 3BCUA 3D7KA 2VXYA 3T1NA 1UXHA 1Z17A 2IHZA 4A1FA 1WDKA 1Z8DA 1TM5E 3OWOA 2BF4A 4MI9A 1GV1A 4QAQA 4X7MA 5LVAA 1WUTA 1YK1A 2C31A 2WUEA 3I01A 3CJQA 3KQKA 3ICWA 4WL0A 3JD1A 1H8EA 2HV8A 3Q3VA 4IKOA 5ISMA 4JA0A 2NSJA 5EQDA 2ZSDA 2DWOA 3FBGA 2OTCA 1QC5A 4UU8A 1XTVA 3AUUA 1Z4JA 2YYYA 3CRW1 4N0PA 2K87A 4TWIA 5TE9A 3DE1X 1XTZA 2OOSA 2C59A 1T34A 2EGGA 4ESVA 3TTXA 1U8FO 1YL5A 2AOUB 2QT1A 1HT0A 3DTNA 3ROEA 1CR1A 2AUNA 4JP2A 2JLZA 4DVJA 2AX4A 2FRXA 4KQHA 5LQSA 1FQJA 5CTAA 2JHAA 5EQJB 4PNHA 2PUCA 1KWGA 1AE1A 4MUIA 4RJ2A 2AW5A 4JJEA 2IEAA 1IY1A 3ACBA 2AN3A 4AFNA 3IALA 3T41A 4HL6A 1P5JA 1O6CA 3LYAA 3O92A 3PWZA 4XVRA 4IHAA 4X7RA 2RE8A 2J0SA 4C9BA 4F3TA 1E1YA 2DTXA 1KYZA 2ZSFA 1GNTA 2OGZA 2N47A 1HO3A 1Z82A 1YDFA 2ZQ5A 2B1RA 1FYFA 3KYBA 5JPDA 5JXHA 3FWYA 5LLDA 4B6QA 2ZJYA 4DILA 3HCEA 4C4TA 3T3NA 3FYUA 4KEAA 1FJ2A 5DRYA 1YT5A 4GSYA 1DCKA 4BFYA 3W5BA 3WGUA 2EF0A 2MR5A 1JKXA 5PNTA 4RXMA 1YDGA 5EOVA 4H7PA 3VHXA 1L8QA 3D4PA 3H42B 3IAM1 3KXIA 4YV1A 4MCAA 1OZFA 4FWBA 1J8QA 1S7CA 3R5TA 4DC1A 3AETA 3NHWA 4X8OA 3TB6A 1GTRA 1L6IA 3B3JA 1HFEL 4AJ4A 1ZOIA 2H2WA 4DCGA 1KK1A 1X9HA 3IHTA 2PRKA 4IO0A 2ZG6A 3K6RA 4DMKA 4JUCA 3ASYA 4XSVA 3ZXIA 5DSXA 1KFKB 4IIUA 1HOTA 4BP9A 3G5TA 5KHLB 3BD7A 3AHFA 3LWNA 3EF0A 3QKWA 4Z4CA 4UDYX 5JSKA 4ZZ2A 3H9QA 4YN3A 5FOTA 2C00A 3IE2A 4ZZ3A 1XRQA 3T7TA 3RS7A 5A5VA 1XTRA 1T8TA 4KR7A 4DN6A 1EDDA 2CMDA 1P39A 4MQFA 1WZEA 2IV2X 4C4OA 1JUDA 1XALA 1NXSA 2PN1A 5E6UA 3SKYA 5HKKD 1P7VA 4YA6A 1ZMXA 1YIAA 4BYGA 4AICA 2AJCA 4OAPA 1XZEA 4OGKA 1QF6A 3HWX1 4IOKA 3I45A 1JIXA 2IGBA 3V32A 4DGQA 1T9ZA 3ND9A 4XPIA 1RP7A 1SZJG 3L7JA 1BW9B 3MTQA 1WPRA 5I51A 5B2EA 4UFOA 5F1OA 1SUEA 2OSVA 2CZCA 3DAYA 4XQ0A 1FK8A 2AJDA 2EFYA 3IAHA 2B83A 1H8HA 3GGGA 4FZRA 4KZKA 4EJ0A 4MKIA 1K08A 5FBHA 3T5PA 4LYAA 5JSYA 4RL6A 2PMWB 3GVXA 4O29A 2HK6A 4W1RA 2HOQA 1VSTA 2Z5FA 1XCLA 4BC1A 4ECEA 3ZH9B 2JLYA 3BMCA 3K0CA 4PANA 4WLNA 1D4OA 4H0NA 1JH9A 2IV7A 2YWXA 3CQ9A 2YNMC 1J25A 2IL1A 2XD4A 3RRBA 3WK4A 1Y98A 3CLRD 1I2BA 4NCKA 3SLKA 3K92A 3PQ6A 4K05A 3QXCA 1XZMA 4KO3S 3T3MB 3U56A 4YAEA 3GCXA 2XHZA 3F2VA 1ZXBA 2F48A 3H9UA 3PUVA 3RDPA 5H9WA 4NHEA 3E9RA 5B2FA 1Z34A 1VXOA 2BV3A 4LXTA 4U39A 3ROQA 4OJMX 3RHTA 5ALZA 1J90A 1V6CA 5ALFA 2JLSA 2P2SA 2FI1A 4MICA 3PNSA 1MDFA 5BUZA 5JIBA 4MWSA 3RWMB 2HO4A 4RFSA 4BEBA 3UJHA 2GN2A 3A10A 2HSEA 4PRYA 1IHDA 1DTWB 2D2FA 2HDOA 1XO1A 5KYUA 1RHMA 1JEOA 4OGLA 1AJEA 1HE8B 4PLPA 1ZVMA 4CTMA 4Y2PA 1COWD 4EJSC 4NZZA 2GCOB 3OZCA 2F8MA 1Z0JA 4G0OA 3ZIAA 4RDXA 4PGHA 3U7RA 1P33A 3R0IA 2VH2A 4YAJA 4IL5A 1P2SA 1IXSB 2H52A 3N28A 5BQ3A 5C46F 1UPCA 1NW4A 1VJDA 3D8SA 3OIFA 2WUVA 1TPYA 3AR5A 1TFRA 1E77A 3IUQA 3TYXA 3R3HA 4MA0A 1GPAA 1VIVA 1EWYA 5DBHX 1Y5LA 4ZAYA 3KELA 1RI3A 2QTHA 3ZZ0A 1YE5A 2W42A 4NFSA 2LKDA 4B2LA 1W36C 4GYJA 2XNSA 4YRDA 4DIMA 4TSKA 4NECA 1HG0A 4WDRA 2OO5C 3UK7A 5KPDA 1CQIB 3WOHA 1BKYA 3ZJUA 4D4LA 4JVNA 4P3OA 2H4JA 4R7TA 1RYYA 4YXWA 4S1NA 3BXGA 3H05A 4W5JA 2H1WA 5BNFA 1ISRA 4ER6A 4GW3A 2NXEA 4Q3LA 4F8EA 5HP4A 3I61A 3DM9B 5KIAA 2JIDA 5EPOA 2B5OA 1Y6RA 3D3JA 5DW3A 4FM9A 3TSCA 4HQRA 2D13A 5LLTA 1PX2A 5FL7A 5KYWA 4WKBA 3ZWXA 3NT2A 4I5IA 4B35A 4DV2B 2C9OA 3KYDB 2BFDA 1C5KA 5A05A 3UOAB 4L5BA 4WUTA 2Q5IA 5EIWA 2H08A 2CLMB 3EIOA 1DARA 3EODA 1KRWA 2PANA 2WQZA 4D6XA 1AKEA 4DLTA 4RPIA 1KIMA 2HZ7A 4XARA 5CIWA 2C2XA 3PNPA 5ITZA 1KJ9A 1NR7A 5K8JB 1UBHS 1ANKA 2J7PD 2JAQA 1SCQA 1F0YA 4J1TC 3IESA 4J3JA 5B37A 5IFLA 1JAYA 2JFBA 2QY9A 4IH9A 1F38A 5EINA 2Z3ZA 2ZR9A 3O7WA 4E14A 1THMA 3PHIA 4BNGA 3V4VB 2BI4A 3QFTA 2JGLA 4NMLA 3LM8A 4GPAA 3UK6A 1PWHA 4BIIA 2JJYA 2R751 4N65A 3FLMA 2E5LB 4MWDA 2R60A 4YS6A 1IQ0A 1Q19A 2DPHA 3F7TA 1JLRA 1LBHA 2PJZA 4I50F 1ZCZA 4J4BA 4ENWA 5TIIA 2DERA 2PSJA 4C0LA 3J7AC 1J23A 2RGRA 3N5CA 1G1AA 3H18A 3IAAA 1KO7A 4IQGA 3VO1A 4WECA 4NCXA 3QWAA 3WMFA 5IKMA 1VHDA 4BB5A 2I4LA 2QUHA 2CKDA 1NQXA 2PR2A 2NUTA 2V54A 5K5EA 2I54A 4TQGA 2IOHA 4R9SA 2VATA 2NN3C 2H16A 4ME6A 4EA8A 1P3Y1 1AKQA 1ZICA 2FN7A 3K9NA 4DYHA 4EHLA 1QIEA 1IOLA 1JB9A 2NO6A 4RPJA 1KXZA 2I03A 4DR1B 4WXMA 3HK2A 2LDXA 3O3NB 3LQ4A 3PI6A 1CK4A 2SKDA 3WMEA 1ZHHA 3M6UA 1UF9A 3RVJA 3GEBA 2FGKA 1CJKC 5DRTA 5E7IA 1FQWA 2NNLD 4X7PA 4YIKA 4IIBA 1NN3A 4MUKA 4KITB 2QLFA 4HV4A 3C3PA 4L22A 5LDDC 4BB9A 1NOKA 3WICA 3G13A 4ZI5A 4JQZA 3T94A 4E09A 1WCYA 2AN1A 4Z2AA 4UVEA 5BRAA 3RYIA 1BMDA 5IBCA 1NG1A 3HP4A 3JY6A 1U8CB 3RC3A 2FFJA 4DPLA 1DOHA 2GETA 4Z9XA 4O4IB 4U9IS 1JHQA 1GNPA 2C4KA 1KJQA 2DSTA 4WOPA 5H0IA 2GYUA 4DM4A 4MUMA 3NONA 4HLCA 4JLJA 5FTMA 3UHAA 3RE1A 2P4EA 1DU4A 4LSZA 1JYFA 3OM8A 1MRNA 3OFNA 3VVCA 4G4IA 2JLAA 2CNWA 2E5FA 2GF2A 2P9BA 5EVJA 3RUEA 2VNKA 4A27A 1RWVA 2UZ3A 5GJVC 1R6XA 3MMZA 4MJLA 1HXHA 1U2RA 4MW1A 3SIPA 3VR1A 3PFBA 3A6DA 2WD7B 3O7MA 3RSLA 4E0BA 5ENZA 5JTUA 3ERCA 2ZK7A 2WJIA 3O8BA 4MHOA 4RK7A 3S2EA 3WYGA 4ALNA 2R84A 1OH5A 4IGKA 3MXTA 1I6LA 3T0GA 1VIAA 1VGQA 1EFRD 1R8QA 3DBLA 3KYJB 4JA2A 1M54A 1HQKA 2V6FA 4LW8A 4W99A 5EZ5A 5CIYA 4HMOA 4HDKB 2YASA 3B9QA 2Q2VA 2G9QA 3KTFA 4MW0A 4E1VA 3DCNA 4XIGS 2A2ZA 4IIHA 1SHKA 3LHFA 3F4LA 4FT2A 1OLSB 5KQMA 5I9NA 4WKCA 3DH0A 2G9ZA 4ZOLF 1IUKA 1G1MA 1SXJD 2B9EA 2WKSA 5DWDA 3EYWA 4DYVA 1GYPA 4AZ0A 1NFRA 1WZUA 1JWLA 4PYLA 2KQUA 1DAGA 1Z0ZA 2W2PA 3B53X 3AHJA 2H1CA 1YSCA 2Q9UA 3E8SA 4OATA 3UT5A 1FP4A 1LKZA 1X6VA 4OAOA 4YO8A 2YVAA 1M34B 3B5JA 4M9CA 4RA6A 5F9FA 4R1UA 2P9HA 1RCUA 5AK6A 1C1XB 1PWXA 1N6RA 3AHIA 1DRVA 1XAHA 3QELA 3KWMA 1V6AA 4GKKB 2RBGA 2H2DA 4XFDA 3AIMA 4G25A 4QJBA 4ZDWA 3EW9A 3FSJX 3GXOA 5DYTA 2E1PA 4YI3A 3L7AA 1RTKA 5FA8A 4EJSB 3LNTA 1E3TA 1L7NA 2VOEA 5C7YA 4FLFA 4F5WA 5IVPA 3N8HA 3RYTC 4DJAA 1E1CB 5HF6A 2WSSA 2REQA 2W4MA 3OCXA 3DOIA 4IHJA 4ZAWA 3UAZA 5HK8A 1ZA1A 3A4MA 3FCXA 1F0KA 1Z6GA 1NBMA 4AU1A 4A9AA 1TTTA 3A1TA 5KJFA 3BDVA 4RSGA 1T9GR 3SX2A 3OF5A 2E0IA 3FPKA 1ZUNA 1S4MA 3MRVA 2ZIGA 4EVSA 2O1EA 1D2MA 5JY6A 1W36B 4RACA 4CKWB 4RY2A 3T9BA 4G01B 1L4BA 3LO5A 4US0R 1CS0A 4G4GA 1TYBE 2O8EA 2XX3A 3L5OA 3M8KA 4Y2HA 4RTMA 1E9FA 3FPJA 3L4BC 1FDUA 4WK4B 3FTPA 4WY5A 3DTTA 1DUVG 3QBEA 1I4OA 2VRNA 2DH5A 2ZB4A 1QIKA 3RVQA 5EKUA 4BO8A 1FIUA 1WX1A 1KFJB 2OCGA 4WNAB 4IX1A 1OFHA 2CXQA 4CQMB 5JOQA 4BXOA 2YH2A 3U44B 3PG5A 4RVOA 1O89A 2V5AA 1TUEA 3ECAA 4JASB 3WK5A 4D41A 2F2TA 4I6JA 2LPMA 1V39A 3ZDBA 3NAGA 2JFHA 3HKEA 3VJKA 1KMQA 2YWDA 3SIRA 3QEAZ 2JGRA 2XUQA 1NULA 1TVMA 1T5BA 4X9XA 4BMSA 1MG5A 1P6QA 4HGZA 3AX6A 4TT3A 1P17A 1F9EA 4MLDA 1LPAB 2JFUA 1AQ6A 1CE8A 4L07A 3E81A 1QYDA 3RTGA 1Z74A 1OZHA 1W2GA 2E89A 4JJZA 1FU4A 4WCDA 4BATA 1II0A 2P1RA 4WBSA 4N47A 3FNRA 3R2JA 2Y1KA 3ADCA 1RHRA 1N1DA 3QW4B 1IJBA 1IDN1 1YR9A 2G5PA 2IUTA 3BZBA 3PVCA 2HPAA 8GPBA 3WB2A 2UV8A 3UPDA 1FDOA 4FPXA 4LK2A 3I09A 4GPD1 1PL7A 1XF9A 3AWIA 1JEDA 3AR9A 4LBWA 1JAZA 2XZDA 1HT3A 1OR8A 3ZWNA 4U8HA 3S28A 2LBPA 1HDRA 4Q9KA 1JFTA 4J1SA 5LKRA 1D0SA 2QSUA 4KGDA 5D3ZA 1OAOC 4BVHA 3I58A 2EZ9A 4O2BF 4X1YB 4KQ1A 2P9ZA 3HCNA 1O58A 3B3QA 5KNDH 1A7UA 2WF9A 1IULA 1E1RA 3BTVA 1DUSA 1X8XA 3BB1A 3NBKA 4IIJF 1UT5A 4ZYUA 2G6TA 1BYIA 2ES4A 3EAQA 1AF4A 1J8VA 3FTNA 2BOVA 3LMKA 2G9NA 4RTNA 3BZUA 4WW0A 4IXWA 4R81A 5LOVF 4HUQA 1VPVA 3MK31 1DC4A 3CURA 3AFOA 2EHDA 2L69A 2QL9A 4RE6A 5SYMA 4WLUA 4IXTA 2ZIZA 3O84A 4D97A 2X5XA 3DV2A 2EARA 3SR4A 4E94A 3GFFA 3ROXA 1ZMTA 1QPGA 2KMLA 2RGEA 3GJTA 4BZWA 4Q9AA 4L78A 1M2OA 3O4HA 3UC5A 3TLAA 3L7NA 3U4QB 1D07A 2IUUA 3SKVA 1A27A 5KTOA 1CQPA 3Q9UA 4Q02A 3RIMA 3DTVB 1J39A 2VYCA 3LT1A 3WL3A 5JECA 5G41A 1GQQA 4BVJA 5JVDA 1TUBB 1E7RA 1ML3A 1RBQA 4UFNA 2D0OB 1KZHA 2AZTA 2WC1A 3SJBA 1PK7A 4M9RA 1C4XA 4D8YA 3J81k 3P5SA 4FHFA 2XHEA 1TIBA 5JASA 3KSMA 4EYSA 1IXZA 2PIAA 4V0MA 5BN5A 3FYUC 4GFDA 1FDTA 3VPSA 4PC6A 2VP9A 2F3PA 3PQFA 4U5QA 5IARA 5EUMA 2V74B 3NDJA 3R0QA 2VBCA 1XNRB 4XWYA 4PS1A 5KC8A 3CMCO 2ILTA 4PPNA 1AC5A 1SKYE 3PJGA 1BGXT 4G23A 4A5SA 3HXTA 1LQTA 2XUJA 1JEYA 2C8JA 4XD7D 1FMFA 3B60A 3T1VA 5JARA 2VF5X 4II7A 5LYYA 3UJNA 1ULTA 2HDHA 2GJ4A 2I6QA 3O4GA 4L57A 4R40A 1BS1A 4RL4A 4ZCRA 2VHVA 4CQNA 1P7PA 1Q17A 1LDYA 1XCMA 4JH0A 2B1IA 4EMUA 4TQAA 4EHKA 5EQTA 2AMLA 4QIHA 2WABA 4RKRA 2JLBA 1GRNA 3OTIA 4RA9B 4HNQA 4ZGWA 3SXPA 1XTKA 3OTWA 4AJEA 3FLBA 2PX4A 4PZEA 1N2CA 3F6BX 4IXDA 4N6GA 4PSUA 1LV7A 2GRJA 4RKEA 3AILA 3EVCA 4UU1A 1GCGA 1GSIA 4JYPA 1E2IA 3LOUA 3RRXA 1WXEA 1KJIA 1W73A 1Y9JA 3AJRA 4G1VA 1MX5A 2H9AA 2C5HA 2IP4A 2ZWAA 4OF4A 1V2GA 4P35A 3KB1A 5AW9A 1PDOA 5JWRA 2JFVA 3PV0A 3U31A 1F8UA 3AUFA 3IDAA 2P0EA 4LWQA 4DQ0A 2H3HA 1TW3A 4PXAA 4BPBA 2RJOA 4IDPA 4A10A 3LCVB 2Q21A 4GI2A 2DFTA 4GI7A 1F2DA 5FOUA 3PEVA 4TZTA 1RDFA 2XDWA 4KP7A 4E4TA 1ACJA 1A7JA 4C7OA 2JHCA 1UZNA 3EPPA 1RWOA 4AQDA 4J0KA 5CDFA 4U2GA 1NYTA 5GV8A 5BY2A 4FMPA 4MYSA 1YNSA 1L9KA 3WA7A 2LE0A 2X0IA 1EP1B 1JHAA 1NFQA 1YR7A 1OAKA 1Z16A 2B8EA 3ND7A 3MWYW 4KIUA 5TPWA 1V0JA 4BJ3A 2PE5A 5COQA 4UMFA 1Z5WA 2CXUA 3KJZA 3HB0A 1A04A 2G5GX 1GUFA 3QMWA 3CF6R 1YONA 1Q92A 3CPSA 3O8RA 3BVPA 2Y1WA 3DOCA 3C85A 1J09A 3N0WA 5FNVB 1H23A 4BJ5A 4EZEA 3TXXA 3MAAC 1DAHA 4OQZA 4BQQA 5JRDS 3L1UA 3H75A 5EIBC 3C6QA 1ZMRA 2WNSA 3DT6A 3IMCA 3TN7A 3TEFA 3IPYA 1S3IA 5KX5B 1BVHA 4URHA 2Q0SA 4RHYA 1C1HA 1REQA 2BI7A 1P1BA 3O21A 1M75A 2GEUA 4GOJA 5EG5A 5EJ7A 5DWVA 2NVUB 2DGDA 1DBQA 1SG9A 4HDCA 2B94A 5LD2C 4PYNA 2GZ2A 4NL4H 2GM5A 2GA9A 3AVOA 1PSWA 1CCWA 1YZLA 2WJVA 4HPXB 4PXYA 1FYDA 4OHMA 5DF1A 4PG6A 3W5IA 3DOHA 5E1MA 1M7GA 4IWNA 5BQFA 4H4DA 1C29B 4YAUA 3KCNA 2FPSA 3W0LB 5IN5A 4DG9A 1CP3A 1I13A 5AM4A 2QG4A 4CUKA 5T57A 4BJHB 1Y9ZA 2UUPA 5DHRA 4BKOA 3VYUB 2XF2A 4GMDA 4MRAA 4LSWA 2MSWA 1UFQA 4P7BA 1S8FA 1CYEA 4H35A 1Z56C 1FSFA 2C0QA 2RH5A 1T2DA 4QAJA 1JG1A 2Z6AA 4PTYA 1IUNA 1L4GA 2VPIA 2IKSA 1QZXA 3NV9A 1E4EB 1F48A 4UE2A 3ZHVA 4K0RA 3L0BA 5DP2A 1SULA 4JX9A 4XYLA 4KKXB 4QFDA 1FLVA 4FFNA 4N6NA 2LGJA 1UJ6A 3L49A 1C81A 3EFHA 2NAFA 1UBLS 1XTBA 3X2SA 2WTAA 4EW6A 1C3EA 1RKQA 4S2EA 1OC2A 1FF9A 1KORA 2RGYA 2XCRB 1UR5A 2VJCA 3ZVLA 1NOJA 1DHTA 3O4RA 4ZQIA 4F92B 4AYWA 1XMOB 2FR8A 1U8EA 3ZD8A 1MVLA 2R4UA 4F72A 1Y89A 1KVSA 2OC4A 1ZR2A 4BVGA 4NOKA 3IOMA 3R75A 2Y6VA 5DN6D 4HEJA 2FMHA 3BA6A 2E3JA 1KY3A 3D2LA 2BJWA 1ESMA 2QDKA 3R44A 5FQNA 3D3QA 4YAFA 1GT6A 2VDQB 1C9YA 3BE4A 4N41A 1CZLA 4QDJA 1LPOA 2H59A 3O9MA 5LUBA 3RU9A 3KKKA 2FFQA 5DT2A 4LNAA 4L9WA 4PFQA 1JVSA 4BRZA 1R1DA 4MGEA 3DEFA 3FZEA 3KVNA 1HR0B 3GJ0A 5AUPB 3NWBA 3BXEA 2VDWB 2JA2A 3E18A 3ITDA 2P2GA 5CX4A 5AQEA 4D8XA 3S27A 1YS9A 3K1JA 3W6UA 5CB4F 4B3IA 1ZO8A 1XSEA 3G2IA 5I9TA 5KREA 2AF3C 4E13A 4HB0A 4IZIA 1WIWA 2W37A 1X7YA 1OFUA 3IA2A 3G5AA 3LJKA 3TSWA 4BWGA 4DNQA 2BUBA 2G72A 3T38A 4JI8B 1E2BA 3U40A 4QGSA 4ZODA 5EPEA 3R5FA 2QD4A 4XJTA 1B1CA 1YL6A 2P41A 2JAWA 2P77A 2G40A 1Y42X 2XMZA 2YWEA 2V58A 2PEZA 5ALIA 5FADA 5J5CA 3U7FB 4XYBA 4LRWA 2GX6A 4O5OA 2P4SA 1JFFB 1JIKA 1E6EA 1NNI1 1P4SA 2E49A 2ZSBA 3URMA 2FZGA 4I8XA 2PSDA 4O1HA 2EFJA 1SD5A 3VTZA 3C6BA 1EE1A 2HNKA 3L7KA 1W8DA 3KKEA 4MUGA 3N1UA 1C0IA 1UDWA 4U6NA 3JTEA 5IEBA 4OEHA 4K2HA 3I5MA 3WL6A 3PKIA 2LCQA 3LHDA 3KSAC 2G70A 3AETB 4JIMA 5U4QA 1BDHA 2J0UB 2X9NA 2ZLBA 4U9UA 2V3CC 4NYMQ 4KX3A 1HMYA 2G9RA 4HQOA 3AR4A 3O0DA 5A3SA 4OBBA 3PDHA 3CVWA 2G28A 1NYLA 4I55F 3PHBE 4IQFA 4TXLA 3UMJA 3OZEA 1ZQ9A 3D9QX 2XIJA 1J2TA 1RM4A 4JDPA 4LF7B 1AS2A 2IPOA 4XGIA 4ACBA 4JGIA 3HJRA 4OBWA 1JQ5A 2RBEA 2PWAA 3PNKA 3BWYA 1Q1BA 1T9CA 2G9UA 5LFAA 5K01A 2D2XA 1JDZA 3RFXA 1DX6A 1U0GA 4CG0A 3DTYA 5A4IS 4UEOA 1QP0A 4BQNA 4OA5A 4N7BA 5CA1A 2I5PO 2V7WA 1NX9A 3EDYA 1BDMA 1BGVA 3E8MA 2POQX 4MQFB 4GNKA 5AOAA 4ZQEA 3O2SB 3NLLA 1CV2A 2I2BA 2ADMA 4O33A 3RS5A 2BMEA 1KHTA 2YJGA 1NJ2A 3HE3A 3W6PA 5FDFA 2G4LA 2QSZA 2VPWA 3CH7A 4AWXA 1FMLA 4POAA 1NASA 1R5BA 2IXGA 4NCHA 2JW5A 5G1OA 4XJXA 2FVXA 2I3DA 4XPIB 3T9CA 5JAIA 2IUYA 3UAOA 5DYNA 2IYUA 3WLOA 1PZNA 4OTZA 3W4IA 4PV7A 2FX2A 1PL6A 1UEXC 2WZCA 1MT0A 3L0YA 2QYOA 4OIMA 5D8DA 5EHQA 3FYCA 2P79A 4R41A 3RBVA 1QFYA 2KE5A 3SFVA 3UG7A 4UNSA 4RCVA 3UJCA 3AGPA 4HVTA 1R6VA 4BDTA 2HRDA 1C3VA 5EMKA 3TLXA 1LJ8A 1J20A 5A1TA 5T8KA 1B0ZA 1PKXA 1OJ7A 4YDSA 4S1PA 5ESDA 4EW2A 5AKZA 5HOQA 4JI2B 3DNFA 3FDFA 3QNMA 1UEJA 2A35A 2VNJA 4NAUA 3TR0A 3MTDA 1Y8RB 5AKHA 5L3SA 3NORA 3A11A 3BSWA 3B6JA 4BKUA 4O8CA 3ZJTA 1UM8A 1NQ5A 1RXVA 1H93A 1K5HA 1BHJA 4YP1A 4PO1A 3PE6A 2BISA 4QGAA 3ACCA 5FBRB 4DA6A 2IEYA 3MTAA 1I0LA 3SFZA 5KVVA 3CLUC 1WBBA 2F8TA 4K6HA 3QU4A 2YY7A 4HXFB 3ZGXA 4H2DA 1V7QA 1QFZA 4IJ6A 5D6OA 2VWPA 2Z2XA 4A1OA 3WIEA 3LZCA 1ABEA 1K7YA 1PEAA 2EFDB 1U3VA 1I32A 3BK2A 3LFHA 2M1XA 3PX2A 3C70A 3MTBA 2P4HX 4UATA 5KNCA 3O74A 1F60A 3PLNA 2MDTA 1EA5A 3A4NA 5J1TB 1W48A 4V0NA 1GEEA 1XMPA 1QH8A 1M1YA 3LU1A 4BO1A 4UQLA 1CY1A 5JH7F 1MJGA 3R3XA 1TVEA 3FJOA 3K1AA 2N9UA 3NIDB 4ZRDA 5IEJA 4QEKA 2HUNA 1KFBB 2B8JA 5ECDA 1GAXA 4XVQA 1FXSA 3G2HA 1LRLA 1OPRA 1ZOLA 1TYDE 3I1YA 4C2AA 2B3DA 2DUMA 1KZYC 1VRVA 3OLQA 1ECPA 1FFCA 1ZY2A 2IVZA 4K86A 4DIEA 4G5FA 1FTSA 1P1FA 1Q11A 3GRZA 3OQIB 2ZI7A 2X77A 3MTJA 4NMHA 3MWKA 2QLJA 4UM7A 4QBGB 2YW9A 4ZRMA 3FM9A 3UY4A 2EGUA 2I4NA 2X2FA 1GUZA 2PD6A 4KBGA 4LVCA 3NV7A 3ZTWA 1JU3A 3LECA 2ZYWX 3I62A 5CPFA 1QKJA 2UVPB 5H4GA 5K7SA 2D3TA 1LQUA 1Z8NA 3KKZA 2WAYA 1NURA 1TT5B 3D6MA 2WT8A 5LXTF 5ESXA 4QG7A 3A4TA 2XB2A 3JD0A 4ZKDA 3STUA 1ECFA 4C5CA 1CQJB 3DWIA 2IYFA 2D5LA 1JIUA 4G0XA 3DLPX 3SU8A 3OJOA 4MRMA 1VKZA 3O4IA 1SQ6A 1UBCA 2WR8A 1R6TA 4ABTA 1NDHA 3W3ZB 1V47A 3AJ9A 1UXOA 4XCVA 3D4IA 1VGVA 1AGNA 3PKJA 1XCOA 1WMAA 1G8JA 3LWBA 5G0VA 5JCJA 2HN9A 5C4IA 1T3ZA 2D5CA 3VNBA 4MMYB 2VPZA 3ZBPA 4EB8A 3VISA 5TSDA 3WKAA 2DKOA 3F74A 2QP3A 3ZS9A 1EFUA 3W3AD 5KQRA 4FDUA 4LJ6A 3R3ZA 1ZD4A 3EPJA 2H06A 4II3A 1H6CA 1D6NA 1XDBA 3H4TA 4IHKA 2YQZA 3PCXA 4MA4A 1ZU5A 3QEJA 1PE0A 4HFNA 3PNYA 3U3JA 3SLGA 2F62A 3ET5A 1FFAA 4MWGA 3NBXX 1A2QA 1YKFA 2QRQA 1QRRA 4WBXC 4WA7A 2VPPA 2DSNA 4LOLA 1EUCB 2Q3CA 3QXHA 2K2QB 3TRIA 4R3UC 4AROA 4UM9B 2EX0A 3TTVA 5A9SB 4DLXA 1CW2B 4QG3A 1WMFA 3LRTA 3HZHA 3UB2A 3SMQA 2JFYA 1Y48E 4DQVA 3ETLA 3TBFA 2ODWA 2O2XA 2ON6A 2XWQA 3I6BA 1JDNA 1I4WA 3EVAA 2XH8A 3AEXA 1JR3D 3DO6A 1W2HA 2ZE7A 5MGNA 1V2HE 2OSBA 2Y1DA 1W59A 3KTOA 3VUFA 1TE2A 4OH7A 3CO0S 5F1YA 4AX8A 2PY6A 3OU2A 4QC2A 1JJ7A 1NW6A 1ESZA 1KMIY 3KL2A 4IG9A 1EBFA 1RPNA 4V24A 2H8GA 2Q5CA 4JBXA 4O0MA 2I3BA 5A5DA 1YKGA 1YB6A 4HWGA 1H65A 2H5EA 3JWGA 4HQLA 4C6RA 1R4NB 2RHJA 1H2EA 1HDYA 2WMDA 2WV7A 2W2NA 3H2IA 4F7WA 2PUEA 2TMKA 2GZMA 2JI8A 1WNFA 1ADYA 4GQAA 2XVYA 5LR6A 4KNVA 4G8JA 5CUQA 4YV7A 1ODSA 2Z2JA 4DUYB 2SHKA 4NXNB 1X7HA 2O1WA 2DQZA 2F67A 2QXUA 5H5JA 3N2KA 1UXKA 5IPFA 3PA6A 3RYIB 1CDDA 1U4SA 3OVMA 4IJMA 1YO6A 3C5VA 3L8HA 4MVJF 2HLPA 4Q37A 4X5OA 3KQWA 1RFGE 1ZGCA 3IURA 1JG7A 3NNSA 2YBDA 2R8BA 3Q5DA 5BN3B 3TRJA 4LFAB 5B6JA 3WGTA 1JSLA 4LCEA 3FRIA 2WF8A 3PHCA 3KKPA 1AK9A 1D5CA 1Z63A 3A9TA 2VT6A 4IJ5A 4REOA 3IH5A 2JCSA 2IPXA 4RF4A 3FSGD 2QMEA 1H9BA 3F7OA 2EBWA 2H29A 3IPCA 2FEMA 3FPEA 3TMAA 5DOVA 3S29A 3ZGYA 4TSFD 3WE7A 2VIIA 4KLCA 4KVZA 4TRJA 1N34B 1YBVA 2W6JA 2NO1A 3E48A 2F7SA 3ASUA 4HDSB 3KQHA 5FUYA 4OI0A 2P3QA 1ADJA 1XBTA 1L4HA 3BD6A 3NWPA 4ZQHA 1TQHA 1EG7A 1HNWB 4QUEA 3KRTA 4J7CA 1HYEA 3KZMA 2WJJA 2OCYC 2Y27A 1JPNA 2AG0A 5CLFA 1EXVA 1U3UA 2KX7A 2MR6A 2GCNA 1NT2A 3B9RA 3QKRB 2BMAA 4WLEA 2VDVE 1XCJA 2NU9B 2HJVA 2V3WA 1VIMA 2P62A 3K5WA 1DLIA 4E30A 4Y1FA 5E3IA 2J3JA 1WUYA 2D2VA 5DULA 1XZQA 1LSSA 1TQ6A 4AZ0B 4G0QA 5EJ4A 3QX7A 2VJYA 3UT5B 3KCQA 2EJWA 1FP4B 2PMKA 4AJ2A 3VR4D 5LMUB 2CBGA 3HCAA 3LC2O 3UHOA 1G6HA 4DZTA 1E3SA 1NXVA 2CB9A 5TF4A 5KTSA 3AF6A 5CD9A 1JJVA 3HA3A 2LCFA 2Q2WA 3UJBA 2C29D 2QRKA 1Q7BA 1FJXA 2Q07A 3PS9A 4E5MA 4OQXA 3KPUA 1YQQA 1EXDA 2GAIA 4RHFA 1GSHA 4ILKA 3E22B 4UUQA 3JVEA 1H42A 4IDEA 3VPHA 3RUHA 3VKWA 1Y9DA 4R51A 3EZNA 4MARA 2LTAA 2WSMA 3V55A 1YU9A 1PZHA 3I0ZA 3CPEA 1ZGZA 3A70A 3FTFA 1AZTA 2XMCA 1QHYA 3RC7A 5C37A 2X3UA 2ZQYA 4WT7A 4BZXA 5A06A 3I2IA 1LY1A 4QQRA 2Q3HA 5HPYB 4MVWA 1TLLA 4KXLA 4LTMA 1K27A 4OO3A 5DNDA 3R7SA 4ZGBA 2V98A 4AUMA 1TO6A 2BD0A 2QN9A 4M9UA 5LMNB 1LTKA 1WXHA 2R8YA 4CQLA 1CS0B 3UUGA 2O8EB 3V6LA 1SOMA 3TVDA 4CMJA 5A4KA 1IJKA 3QU7A 1H6DA 2I2XB 5K0GA 1EVYA 4NV1A 1TIPA 3JR7A 2VKTA 5F1KA 3HXLA 1L7AA 3DNPA 3Q3JB 4FFPA 4P4SB 2V0GA 4MLZA 3SY8A 2ENWA 3EGWA 4PPYA 4U02A 1F0PA 1T3LA 4QYIB 2VH5R 4TTSA 1FXUA 5HJEA 2R1VB 2QTBA 3DVAB 3UZUA 3SOZA 4IGIA 5IF9A 2VAXA 4OHCA 2W8BB 3TIVA 1LNSA 3HUTA 4EG8A 5A4DA 4AJIA 3RV4A 3BFJA 2YNMD 5HJ7A 1GFZA 5EE0A 1JEJA 1FRNA 3AHHA 1ZK0A 1NVVR 2P35A 4LAFA 5KSOA 5EJ5A 4HGNA 1J9ZA 4GWLA 1KSJA 2GF9A 3AFNA 3GJZA 3ZYZA 1CE8B 1QZ3A 3ZYCA 4AY5A 4BTEA 2QJTA 3EXHA 1DJOA 1E6MA 1V48A 2ZRNA 4F0JA 3PEWA 2PQ0A 1JR3E 3B6EA 2PS0A 3WOVA 4K3UA 3DZFA 4RVCA 2XVXA 1YVRA 2JIQA 3BXPA 3JWJA 3PLRA 4LKRA 1SOWA 3OLVA 4NICA 2WWIA 1KQNA 2JG3A 3E9QA 3HDHA 3NJRA 3GGJA 2W00A 3OPYA 2YJTD 5CDSA 3ELWA 1KDPA 3E9DA 4KLAA 1I7LA 1U0LA 4JB3A 1XRSB 2W6PA 1Z3CA 3OTQA 4NHOA 3I04A 3SF8B 1JDJA 2WDPA 1V4BA 1SQ5A 2WVGA 2WYUA 5K03A 2GNAA 2HV9A 3ZWCA 4F8YA 3NC4A 4EPYA 4G26A 1IHUA 4X91A 5DWQA 2NZXA 4D99A 2R8PA 3WKDA 4Z7OB 3VYTB 1N6LA 2FR8C 2PZAA 2UAGA 1SHLA 3BWMA 4ND5A 1JR2A 2W6ID 4GVPA 2FPUA 3SYNA 2ZCJA 1TJNA 5D1NA 4CLRB 3E8XA 4HH0A 2RONA 4X8HA 2IS4A 3C24A 4OCZA 4D4KA 3SXUA 1W36D 4BX8A 2F1RA 3ZU3A 5AW3A 3GMDA 1MQ9A 2ZOSA 3FGPA 5FI0B 4OMFG 1PLJA 4RVGA 5FOWA 5IBRA 4B6OA 4BFWA 4JI0B 1PUIA 3BCRA 3EG9B 3LDHA 2UU9B 1OGIA 3TIGA 4AF8A 4YYZA 3IULA 4LDRA 3E7PA 3SD7A 1A3CA 5ESWA 4D4HA 1SVMA 3PGLA 2HK7A 1Z7EA 3FHLA 4MH0R 4Z0NA 1JQKA 2AH5A 4CQMD 3OKAA 1IN4A 1VKRA 1FYVA 1NVFA 2HRQA 2C2ZA 1QYVA 5AIBA 4NOLA 1POWA 2HFKA 4OXIA 4CM5A 3NYQA 6PFKA 2EL9A 3Q6MA 3QG5A 4C7VA 4RUKA 4C2UA 4AS1A 4CTNA 3EGEA 5SZIA 3LC1O 1TM3E 1A76A 2A9KA 2R6DA 2ZWMA 2BGNA 1AKRA 1MJHA 3KLOA 4IYRA 4DMUB 5IJZA 1XDSA 2A7QA 2WTMA 2DQYA 4YRFA 1Q1QA 2EKBA 4LRTB 1P9LA 3Q8XB 4BMVA 3IKMB 1J2UA 4NMXB 2VTBA 3U5ZB 1P4HA 2CBZA 4V0RA 2XA2A 1OV4A 2AEMA 4JBWA 2RG1A 4G5OA 2YN4A 2DUWA 3EIWA 1SWVA 1RRVA 2R8RA 3V8PA 3AO0B 1QH1B 3GARA 1XRLA 2HA5A 3M5PA 1BFUA 4M7WA 5FB3A 4NNJA 4U2BA 5ILGA 4DBZA 2QGNA 1LWOA 1T8PA 4X3CA 2WJ4A 4W4TA 5EJGA 1XI2A 3L8DA 1JSRA 1XDGA 3KFXA 2BONA 4XVHA 5AXBA 5GV7A 1I5RA 1LRKA 4YP9A 1DEKA 3O1HB 4CMHA 1INLA 2Y2VA 2QQ0A 3I9MA 4INAA 4TRRA 2CHGA 2HCTA 1B1AA 3CRVA 5CT5A 5EGSA 4EYKA 1U02A 1LVUA 3OQBA 1TMKA 5HGXA 2WWXA 1B6TA 3ZW9A 5LC1A 2JK0A 3LZ6A 1P73A 2QORA 4JVSB 1J8YF 3K2EA 2J48A 4L4RA 4YJKA 5DGXA 1N36B 2WUDA 1S01A 5B6PA 1YGPA 3EEYA 4G9GA 2JIZA 3R7WB 5GTDA 4NATA 3WDKA 2EZ4A 3WLFA 2IZ5A 1W0KA 2NU6A 3RVPA 4UNRA 1Z5GA 3R09A 4NDZA 5J4LA 1XFDA 3U49A 1QGAA 3L92A 2N42A 2X0EA 4RIFA 6ADHA 3LQQA 3PHLA 4F7DA 4HF7A 1XWWA 3VC3A 2EJUA 3RRMA 4UVGA 3L6RA 2AC2A 4HWSA 1BMTA 2I9KA 4KDEA 2VHWA 5EMJA 3QUBA 4P3YA 1PV2A 5CTJA 5TEVA 5GQSA 3DSRA 1GDHA 5K3SA 1CFJA 3B1ZA 4N0MA 4EABA 4NTZA 1R9JA 5B7PA 4IUBS 1JJBA 3UMFA 4ZTZB 2X1VA 3NXKA 1ZXLA 1B16A 1T36A 3I5UA 1QGOA 1BXGB 5EKTA 1USKA 2Q7OE 3R7DA 2PSSA 3DTVD 3ZBQA 1DO2A 4UE3S 4B84A 3EFOB 4DLZA 3U09A 3HABA 4ZWNA 2EL7A 2I6FA 4MR8B 3OD1A 3RUCA 3BMOA 1QO0A 3LNCA 2VHUA 3LLSA 3I39X 1NYQA 2WAMA 1C3OB 3F8WA 4HQ0A 5B5SA 1VJRA 1R0SA 1DKLA 4RD1A 5K3BA 3ZS8A 3C4VA 5CJJA 3C4JA 3IB3A 1GSAA 2VKQA 4IVNA 1MQAA 4QPJC 5LQMA 2CYCA 2Z43A 3OHPA 4HB4A 1LLFA 4JLSA 3F2IA 4YMUA 5JLAA 1D2CA 3OUZA 1JLHA 1DUIA 1U8XX 1Z4QA 2CMFA 3RKRA 3TOXA 1M34E 4YRRA 4KQJA 4IDCA 1LSUA 1VDZA 4GBED 2VL7A 1Y3FE 2LNDA 3WZLA 5DDIP 2JANA 5DT9A 5FPSA 4F9GA 4W6QA 2X13A 4U2DA 1WDWB 3DM5A 2WZQA 3O0TA 4XSHA 1TCAA 3BH6A 2PX3A 1EE9A 4CMEA 3QVSA 3PD0A 1R74A 1T2EA 5B1HA 1ZJ6A 3SYTA 1RIFA 1W46A 2G9VA 1W34A 1LZLA 1E59A 2DPYA 2H4YA 4F91B 2ICAA 1JEEA 1M1ZA 1T2CA 1SMKA 2CVZA 3QXJA 4CR6A 2C07A 3PRHA 3HB1A 4R9NA 2YOFA 3HB4X 1IM2A 1PEDA 1XZAA 2SCUA 1H1DA 1R4AA 2VJLA 3QBDA 5EERA 3VMFA 4F84A 2C2OA 3B82A 1RXCA 2ATIA 1X39A 4KN5A 1JW9B 2FR1A 2TSYB 3QI7A 3V1YA 5LQUA 4LKOA 1QHEA 3R24A 1GAQA 1Z6PA 5FOVA 3QVVA 1G21E 1E61A 1X86B 1N9GB 1XUOA 3W7AA 3ES9A 3DMNA 5HKAA 3CEPB 1TZBA 2CL6X 2QQ5A 3QLEA 2I1LA 1OKKD 3AUSA 4MVCA 4Y67A 4JNCA 3KNZA 1Y5RA 2GNPA 1XR3A 2JBHA 5KZMB 3N2LA 1MKYA 2CXRA 4RF5A 4ZHQF 3ZU2A 5D1HA 4KZPA 3M70A 3U39A 3KXKA 1UBFA 2BEJA 3H8VA 2D1TA 2I80A 4MGHA 3TJRA 1M0EA 2ZQZA 3KT3A 1I4TD 2D54A 1NBOA 5HS4A 5A71A 5FCDA 5HMLA 4YI5A 1K97A 3AHGA 4H7EA 3GFTA 3DBRB 3T1YB 3E9EA 1H3NA 4YPOA 5F3DA 2HJSA 1GQRA 2VSOA 3LW7A 3GFRA 5LA6B 3LK6A 1O03A 4O4JF 3RV3A 2FZLA 1Z6YA 2QVYX 2B20A 2W43A 1WAMA 2JCXA 3RABA 4DABA 2CL5A 4CODB 3WKEA 5H82A 4B7ZA 4M8SA 2ERCA 2NACA 2UDPA 3KB2A 4G1UC 4HDNA 5MFPA 3LXMA 2A30A 4LJAA 5TGTA 1PHPA 3RYCA 2RGWA 1X8JA 1KKLA 4ND8A 2L18A 1E2QA 2R1TA 3UMCA 4CMKA 3PI7A 4R2JA 1TC1A 3GUVA 4XIFA 5C32A 3IODA 3C1UA 4CCYA 2ORVA 1XPJA 2DBRA 3E84A 1X7YB 2IYVA 2SBTA 3FX2A 3T15A 3H84A 4DMHA 4JI5B 4BNDA 5CBPB 1YC2A 3VJRA 2P3SA 4MGYR 3VHQA 2C7GA 4KMMA 4W7IA 1RADA 5EJFA 4M36A 2H1VA 1X1RA 4OSPA 2GTHA 2JGAA 3IIKA 4TYQA 4W8OA 3GJ3A 4A2WA 1QU3A 2PUTA 1XK7A 3NEJA 1FOEB 3H5OA 4DXHA 4QX6A 1NX6A 2XBUA 4X62B 2XSZD 4C4XA 1J7KA 4REQB 2IZ1A 1ZU4A 2FEOA 4KMOA 1FFGA 1NAHA 2EATA 3R76A 4MUHA 3Q3CA 3ZXSA 2P7HA 4FFVA 2PBFA 2NG1A 1SOAA 4B7CA 2HQ1A 3EAGA 4WZAA 4BO3A 4D4GA 4Z4EA 1HT1E 1NI4B 1QE5A 3D02A 3OETA 4J9VA 5CH3A 5J63A 3ZIUA 3HY6A 4PGMA 5JTTA 2D7CA 4H16A 2W2TA 3OZSA 3JQ6A 2IOFA 3Q10A 4FNGA 3ADPA 4HZUA 5C4MA 4G0PA 3T61A 2P75A 2IVFA 2JI9A 1I6WA 1TA9A 1JMKC 2DWPA 3BIOA 2IXEA 3P9PA 4Y2QA 4Z9BA 1HQYE 4GPIB 2IODA 2WAOA 1YS1X 4FGLA 2JVJA 3KOUA 4Z8YA 1FVXA 4ARZB 2FSPA 2GZ3A 1H8ED 3ZV3A 1WHSB 5D3KA 4FEGA 4B0PA 4LF4B 3QY0A 1N3IA 3LXXA 1W4LA 2QP4A 5JDIA 3FSRA 2GN8A 1ATIA 521PA 1WXFA 4LGVA 1G5TA 4B4DA 3IR5A 3D7LA 2ZS7A 2ANBA 1DBIA 3A36A 2JNWA 3CX7A 4M1QA 3T5DA 5MN5A 4AC9A 4YQYA 4AJKA 1GA4A 3G7SA 5CJ2A 1EZ4A 2R47A 5EXTA 3SBOA 3WRYA 5LBIA 3LTNC 5I8PA 1BCSB 1U2GA 1MH1A 1SVLA 1HNNA 1VM6A 1XRPA 2H63A 4Q9NA 4YACA 3UGQA 4S2UA 4AUNA 3Q15C 5JZVA 5ED0A 4KH1A 2NZVG 4REMA 3HN6A 3GRPA 4ZJZA 3BEOA 3PYXA 4TX1A 2Y0CA 3NETA 3DKIA 4Q3EA 3WHLA 1U2PA 1W75A 4CV1A 2BH2A 4MUBA 4GYWA 5C8DA 4RE5A 4UTOA 1ZL2A 3CUWA 3ZHZA 2RGAA 3QEKA 2PKWA 4GOOD 5J58A 3AKYA 2CLHB 2RHRA 3BE5A 3KXPA 3NBMA 3ZXXA 4GLBA 2F3SA 1E62A 2ZKLA 5FUXA 1FNSA 3OWXA 3KSZO 4FEEA 2R86A 3TQHA 2GJ8A 1E7SA 4X7BA 4Y1RA 3SEZA 3WGNA 3X1ZA 5FWDA 4BGIA 5B1EA 4F86A 1L5YA 4OOEA 1WW3A 5REQB 3AR3A 4QYXA 1ISJA 5ALTA 4DB2A 3L82B 2YMPA 5BRNA 4RK0A 1HKHA 2C2KA 5B7NA 2NO0A 4GVXA 1F20A 1X94A 1C0LA 4EGQA 1KMNA 2BFCA 2GILA 1PS8A 2H4ZA 1K4KA 2V1XA 1FZQA 4RO0A 4X1IA 5EHZA 1MRSA 3KYCA 3ZX4A 2A9FA 2HMWA 4Q4HB 1BOFA 4P7KA 2J32A 2QUIA 2Z2ZA 3LQYA 3OECA 4G09A 4C30A 3RT9A 4DR6B 4EFLA 1UZMA 2YQ4A 3ND6A 1J0EA 2X58A 4OK6A 2QPLA 2COEA 4O2LA 2BIFA 1K75A 1Y4AE 5CK5A 1VHWA 2B7BA 2YKGA 3SYRA 2IBMA 3MTGA 4EL5A 2V8OA 4XM0A 1Z4NA 4MW9A 3DMGA 1KL7A 4D9EA 4DLNA 2QRLA 2VAVA 2YOGA 4B74A 4CEJB 1E0KA 2WHYA 3VZBA 4F4IA 3VKFA 1C41A 3ECCA 4YC7A 1GD1O 3U3MA 2VXBA 1Q1AA 3OE7A 4JL8A 4MNTA 3HFRA 3DEHA 1QR6A 5KHAA 1NPYA 4BHTA 1RRFA 3IOBA 3FNBA 4GKBA 2V7VA 4LECA 4PYQA 1W87A 4GC5A 4EQ6B 5C7LO 1RNLA 1XVLA 4KR9A 3U1VA 2NUPB 1AMOA 4Z7NB 1YBAA 4IZHA 4O63O 4EO4A 3Q2KA 3RYHB 1PI3A 4UEJA 4Q7QA 5TNXA 4RULA 1V8DA 2JZOA 3BOSA 1K0UA 1CS4C 2DQ4A 2IOQA 2CJWB 1YWGO 4G8CA 1UOPA 4L9SA 4P08A 2ZJ1A 5AW4A 2G07A 4IICA 3L0IB 1PWZA 5AVSA 3GJYA 1P5RA 1SD1A 4P1ZA 3RADC 1QIIA 3G02A 5EGNA 2P3OA 3P94A 5EIBD 5IJ9A 2I7TA 3VR3A 4BCCA 1QIDA 1J0AA 1KEWA 1D2NA 4XA8A 3SGLA 4IXMA 1T0JB 2A57A 3A4IA 3USCS 3NOOA 4DM7A 2HQSA 3CNEA 2JFQA 3IEXA 5DK4A 3KQLA 3F6CA 1HX7A 1G4HA 3EXHC 1P0FA 4FLEA 5FUQA 1Q1ZA 2AD5A 4FDTA 4HWOA 2PNJA 1S96A 5GGXA 2J4FA 3L0OA 4L08A 1YQXA 2PS1A 4GPEA 1EUQA 1W4CA 2QX9A 3T06B 3RJZA 4P5EA 2OXTA 1ECCA 4QTXA 1QWSA 4FC7A 3QMMA 4L6IA 1ELOA 4C6TB 1ZGJA 1ECJA 1C3LA 1XV5A 1CXZA 1Z9BA 2XNCA 4PC1A 3F6SA 4FDMA 2PGLA 5CFNA 2NNWB 3X1KA 5T5QA 3ZU6A 1UBGA 4KDRA 1K6EA 3FOEC 2JGJA 5IHXA 2JATA 2A5JA 3ZIAD 5EAIA 4GBGA 2WRZA 3T7KA 2XNDA 2XZTA 1XA4A 2XZPA 3LX6A 1E4YA 2EW8A 5DEOA 5A0FA 4EFNA 3KWJA 4NNOA 3EISA 3ISTA 2JFNA 3GUUA 5TGZA 2YXDA 1PQ4A 2A1TS 4F12A 1NM5A 2NMVA 3VPCA 8ADHA 4ZJYA 2BY4A 2JVIA 2ZRBA 2XDQA 4Z1OA 3GLFB 3GJSA 1AA9A 4EUFA 1X9GA 2RH8A 1FFDA 4C0WA 3HXMA 5KX5F 1BRMA 2NWQA 3RG8A 1NNSA 2NU7A 4MROA 4R6WA 4GEKA 5ARCA 4NJEA 2I3AA 1GN9A 1QQBA 4F45A 1JDUA 3FLAA 1RPZA 5EXXA 1KGDA 4A8JB 2CEKA 3INGA 2IXTA 3ADOA 1MA3A 1XTJA 1A96A 1E2MA 3M4XA 3PEEA 3KEFA 4HJRA 2PMDA 5ICSA 2XITA 3WNQA 1UXIA 3Q7SA 3O4JA 3A31A 2GGSA 3WWEA 4BMNA 4CIBA 4HNAB 3MINA 4KBYA 1A88A 4EBFA 4MITA 2N0SA 3ZDDA 3N07A 1S3GA 2GF0A 3A9UA 4IQ8A 3PTZA 3O2NA 3N6XA 4OSEA 1VG8A 2ECFA 3AJEA 5FD8A 4N9QA 1ZHFA 1BDIA 4A6PA 4ZEVA 2NTYC 5KYXA 2UUCB 1JVNA 1ORWA 1IOZA 2SICE 3CX6A 4PAMA 3B2EA 2XOKD 4GXQA 2PKQP 1O97C 4C87A 3ITNA 1E1KA 1JYEA 4X1KA 3RLIA 3SSAA 4HK4A 3L7MA 1QP4A 3SR3A 1AUXA 3DOOA 2WHEA 3GP5A 1CB7A 1SM4A 4Q82A 2EJCA 1D2AA 1XQ1A 3CZQA 3GBPA 3K7EA 4QVKA 2IOFK 3VPGA 3ZVRA 5FI3A 1PV4A 3ITEA 1CBUA 2X9LA 3TQFA 4YECA 2AR7A 1XRMA 4N01A 3BIJA 4Q00A 2G17A 2Y1CA 4RZ3A 5ITVA 4B73A 5AOCA 1D3AA 1E98A 4UHFA 3D3KA 3LP5A 4DMFA 2HHAA 2OMKA 5IH3A 3U4MA 4JJIA 4KC0A 3IRVA 4UM9D 3RK4A 1XKXA 4ZEOA 4C01A 4BVBA 2YZ7A 2I8LA 4M22A 5KWEA 1FP2A 2X6TA 2OXEA 3B6ZA 3WO1A 2D2IA 1GVHA 5AW2A 3JZDA 4R9UC 3RAEC 3N2YA 5GM2A 1RAFA 4C7KA 3D2BA 3AR6A 3CNHA 3D81A 4PSAA 1RABA 1TVCA 2AHRA 1QQ5A 4QDZA 3TZBA 1RXEA 2GDZA 1J7JA 2VPXA 4M1EA 3WL8A 4BVAA 5LQNA 1A4RA 4MVJH 4WN9A 3GYBA 2FW8A 4P4UA 2YZKA 3N05A 3UQZA 1MV5A 3A9RA 4CCAA 1WA5A 2Q4BA 2ZJZA 4F3KA 2V55B 4RVFA 4W5OA 1UDRA 3NHAA 2R4QA 2GZDA 3GEIA 3CVXA 2C2YA 4M0FA 3OPXA 5EJMA 3QG1A 3WLQA 4UBLA 1E69A 3OOEA 4YJDA 4S1OA 1TK9A 4DIKA 3TTYA 2AJLI 2QVBA 1NLFA 3CR7A 1KEVA 2HFJA 3QEMA 4LC1A 4CLXA 2XUPA 2ZM6B 1ID8A 2JEZA 2NPOA 4PS0A 2WTEA 1C9NA 3DXYA 5C3UA 2IIBA 1KY4A 1X1AA 4LXUA 2OOKA 2CHVA 5K0SA 4INOA 2EG5A 3RIXA 5CLLA 2IPLA 4J8PA 4A0QA 2JRLA 4F96A 4XPZA 3MG9A 5LUAA 4RQAA 2A9VA 2OECA 3IUJA 4GPZA 2ZE6A 1SOUA 2J9FB 3W8DA 3PDWA 4XQGA 1UAGA 4YCMA 5LWHA 4CCWA 2CUNA 4OM8A 4JBLA 2VEOA 4D0GA 3W5HA 1R0CA 3BMNA 4MVXA 3E7WA 1WKVA 2NU8A 1PNTA 2FMTA 1A9XB 1CLUA 1KOLA 5KOJB 4X8MA 4C29A 1SIWA 4UQPA 4N48A 4WHMA 4BQOA 2B69A 1G20A 1U3WA 3O1IC 5CW1A 9LDTA 3UH0A 3EGIA 4EW3A 2H0RA 4RLHA 3EY9A 1FPMA 4MS3A 3GP3A 1CIJA 2QDXA 1R88A 1YQEA 2ZTSA 3M49A 3ZY4A 1G42A 1Z4LA 3AG6A 2J0VA 2P1DA 4ISBA 3W04A 4H77A 4CMEC 4ETNA 3IPLA 5J4YA 5FR1A 3SJZA 2AUMA 4BE4A 5SICE 1GTVA 1QV7A 3FRJA 2O8BA 1K8RA 4FFLA 1TQ2A 3KLMX 3ZHQA 2IP2A 1OX6A 1V8ZA 3NPMA 3PGMA 5JR3A 1ZC3A 5E9JA 1CTQA 1QQ7A 1O9GA 1MVOA 2I4TA 1L5MA 4TYYA 1YOVB 1UBTS 3I4FA 2JAOA 1S0UA 1WSDA 2YQ5A 3K3PA 3MD0A 1E1QA 3H16A 3H86A 5F7ZA 3WXMA 3PHJA 2CDAA 3KXDA 1MR3F 3P9SA 1WF3A 2ZKIA 1U6IA 3RBXA 3MT0A 2MHCA 3RVMA 3V8NA 3VGPA 2Q1SA 4ZJUA 5ICCA 5GOTA 2Q0QA 1G5PA 4YALA 2A1IA 3TTTA 5ER9A 1JRLA 5A2QA 3LCJA 3F73A 3TK1A 3LLMA 3MFQA 4R16A 2EXXA 2WF7A 1QU2A 3OPYB 5JZOA 3ABRB 2DLDA 2WYIA 3VJMA 1L4FA 1AKVA 4ALLA 8MHTA 4BOYA 2BFWA 2B82A 1WHTB 1HH4A 1W5AA 2O5RA 2Y1EA 1R15A 3HYCA 4ALIA 1TM2A 2WJYA 4B2IA 2X19A 1HF3A 3F67A 2NZ8A 3MUEA 1U1DA 3GLTA 1R8YA 4B4KA 3VFDA 2WVAA 3GRCA 1NBMD 4QLBA 5ALKA 3L7YA 3R1IA 1ZNZA 2DECA 1LNQA 2X8BA 4KWIA 4UDNA 4HGOA 1RQRA 2VF2A 1QK5A 5F33A 1THGA 5EWMA 2IF2A 3UT6A 4F56A 5HNKA 3SXUB 1WKCA 4GXNA 3AR8A 1O4VA 4F3YA 5E2AA 2VAWA 3FPGA 4F71A 2J5KA 2VJKA 2YYSA 4TV9F 4X84A 5C51B 4QICA 3GLGE 4Y9SA 2NXJA 3FG9A 2HGZA 1AQLA 4Z7QB 4BO2A 3TQSA 2BMFA 2F59A 1TGYA 4TL8A 1OI7A 1R6BX 2X7JA 4RQUA 4P31A 2VCYA 2GSWA 2CE2X 4MQBA 3FF1A 1U0FA 5IAJA 1L3BA 3ZU4A 2C7PA 2A33A 4QRDA 2Y1GA 2REXB 3DDUA 2UZ0A 1GN8A 3MRSA 2O0JA 1RMQA 2HBQA 4CM3A 2Y99A 4F4CA 1E7WA 2GXSA 2AKYA 1RQXA 2FZ5A 1GG2A 3N2NA 3ZK7A 4GC9A 3OKPA 1PJ8A 2HO5A 1ISFA 1V1RB 1W5EA 2FQQA 3A4LA 4GX2A 3CGGA 2IIPA 1C1DB 1CZNA 3MM4A 4ARUA 5JE8A 2VYFA 3M6FA 4O25A 2CT8A 1OV6A 2O3RA 2XCOA 2ZZMA 2NZWA 2A94A 3E9YA 1WW2A 2QTAA 1NBAA 4ENUA 2UZ1B 5SY9A 1NN5A 2PFKA 3PRJA 1WKBA 2Z0MA 3UGKA 1JX6A 1B0AA 3AOEA 1F51E 3LFUA 4FFRA 3U1TA 1BEUB 3SC4A 3ZLBA 1ND6A 1D7OA 1G41A 4HTFA 5DX0A 2YHIB 3IGFA 1V45E 3DC7A 3WQQA 4RGVA 1YFZA 2BGJA 1F8GA 2R7AA 2VDMB 4OU5A 5AUNB 4IG4A 3LCCA 2OWEA 1AXEA 3SC2A 1Y9EA 1CY6A 4Q4JA 1B6RA 1J5EB 4YIHA 3ZWWA 2VSNA 3HEAA 4P7GA 1OWNA 1X8LA 3D6UA 4D3ZA 1NC1A 1QRTA 1J42A 5KVCA 1L7QA 4PN3A 3IAEA 1S1CA 1G64A 2ORYA 4F2DA 4YRSA 1RZRD 2D1YA 2XZLA 4YK7A 2KYRA 5L7YA 4HX5A 3CISA 3H3FA 5DPMA 1CUYA 3OEHD 1NP3A 1NLUA 2RAUA 4Y2XA 3ZQ6A 1SQ0A 1QB7A 5K8VA 5DTEA 4E5NA 4Q3CA 3ZK8A 1V3TA 3FWZA 5JDIC 2I62A 3DZBA 1T43A 1W30A 4QRHA 1GU7A 4OB7A 3TJZA 2ACKA 1QG4A 1RBZA 3BYZA 3FN4A 3PUJA 1OBOA 5B4VA 2XMDA 2RFLA 2RJNA 4H9GA 1HLFA 2IYEA 3PTAA 2P9JA 4LJ9A 3LG2A 3WRYC 1IEWA 1LVGA 3DDWA 1U7ZA 3Q7TA 4FFSA 1WR8A 1P9NA 1KJJA 3C8DA 4IDNA 1U2GC 1U7OA 1ZIYA 3DWFA 1VE5A 3M3PA 4KQCA 4Q4DA 7MHTA 2CMKA 1NVXQ 2W2QA 1U0BB 1XPUA 3GLVA 3IT3A 2ILVA 2PS3A 3WBFA 4GXRA 3ZDQA 5EJ9A 1G98A 3A26A 5J5AA 3WWOA 4B76A 3GPBA 4C6SA 5LZ9A 4LOIA 5JQGF 2YWHA 4HJXA 1CF2O 5K8TA 2C54A 3TCNA 4TKVA 5JEEA 4TV8F 2C2BA 5G53C 4UM8B 3TL6A 4QOIA 4BB6A 1AGPA 4UEKA 3V1TC 4PZLA 2Y93A 2CWDA 2G8NA 3NJ4A 4RPCA 3BMXA 3EUWA 5HF9A 4ZYVA 4BRWA 5IU6A 1Q7GA 3MTIA 2JJ1D 1A82A 2BGUA 3DBVO 3INYA 1HV8A 4O02B 2C9CA 4LJSA 2HLDD 4I99A 1H05A 4S35A 2ZXUA 4B3MB 3UJDA 2CNKA 3ESRA 1SA0A 1VFNA 2C77A 3KPJA 1PNQA 3NBFA 1VYVA 1S3SA 5ALQA 5FWXA 2VK8A 1DCTA 4OJYA 2CLEB 1ORTA 4OV6B 3THOA 4D9NA 4OXNA 4YT8A 3UMBA 4BNVA 3PWTA 3GY0A 3L41A 4DA4A 3Q6IA 1DT5A 1HPLA 3E9MA 1K1EA 4EVIA 3C3WA 2Q45A 4GE3A 5KQGA 3NBUA 4RELA 1AV7A 3LVQE 4XX0B 2CY0A 2CMHA 3QPAA 1T1JA 4I1IA 4FU0A 4C0HA 5K05A 3GQVA 4N0EA 1GGMA 4I1RA 2C1ZA 1UWKA 2QLLA 3Q72A 4NQRA 4AO6A 3TGPA 5AVRA 4LFCB 3L6UA 2X2EA 3OX3A 4PYKA 3RAJA 3DHVA 3I53A 4HDQB 5HSGA 2RB5A 1BD4A 4IW3B 4HOYA 4IUCS 2OYCA 3FOBA 3A04A 4C4AA 2JIMA 1YQWA 3DYBA 3TBKA 4CRWB 1L5VA 4I5DA 4RLFA 1QNLA 3MJSA 4FYHA 5D01A 1ILWA 3IPXA 3C15C 3TWOA 5H59A 5EXPA 3ZKWA 3GMTA 2NOAA 4B31A 5BSFA 4PXSA 1A8PA 1NBWB 1NVBA 1VLHA 3DT8A 2HHLA 2WVHA 1TRKA 2ZSIA 3ZNOA 4NC9A 2C4VA 3COSA 4NJMA 4YJ3A 1LLUA 4AAYA 1U1IA 1WZCA 4YCBA 3SQMA 1Z3IX 2ORED 1XRJA 5CURA 5ABPA 2QLNA 3HCWA 1N6PA 3MA0A 3UAGA 1IMJA 4YO7A 1U3DA 3WGYA 1R0XA 3D6VA 1GV0A 3OLXA 4IGEA 4NMWA 1Y7PA 2ECOA 1NQTA 4OHVA 5JSFA 3B3AA 2VSFA 3B6MA 3V2HA 1T1SA 3IP3A 3L1JA 4MCJA 4RLQA 1XMIA 3K20A 5HEKA 1UFRA 4CETA 1TQ8A 2DJ5A 1LDMA 3FDXA 1W85B 4ES6A 1TAQA 2CV0A 3CPJB 5KAPA 1MC1A 4DNOA 4C7BA 1XQ9A 2Q49A 1KSHA 1KOFA 3HO8A 2FOIA 3N3BC 4W1SA 1XLUA 4KXWA 4KPFC 1GKKA 5AD1A 5TR9A 3EA0A 2NVWA 1XDUA 2AX3A 4MI1A 4OXYA 4CCYB 4WX2B 3NRBA 1BJRE 4B5LA 3D5QA 4ARCA 1EQAA 4OQQA 1U04A 4JUAA 2H2FA 2XDAA 3OJXA 3L04A 4C2TA 4BNDB 3B8HA 4UUAA 4E88A 4XGRA 1O1YA 3KT6A 5BOSB 3HJCA 1P9OA 3MJHA 3R4VA 2NAPA 2FG5A 3MT8A 3BWBA 1NRIA 2GEKA 1Q7RA 1F1BA 3G88A 2OC9A 1A5SB 1JDSA 2BHSA 2NTNA 3BH7A 3P71T 3K0BA 2NUBA 4NYIQ 1Z38A 3I2JA 4C03A 4GNRA 4RZHA 3VH3A 2FE4A 2DZDA 1RHQA 4ZAXA 2G67A 1SN7A 3H6KA 3PXEA 3FYSA 3TFOA 1E2EA 4CJXA 2DT5A 1NM5C 3GLSA 1NA5A 1T2VA 2R8EA 1UDCA 1JHPA 1WXGA 4L8YA 2AK3A 4N1AA 1W29A 3LBYA 5DTRA 4XDGA 5FLYA 3UGJA 1E2LA 2HB6A 3BH0A 3C7DB 3KETA 1IZZA 4KN6A 3N2GB 3GF4A 2D2EA 2GZ1A 3V1LA 2PGJA 2ZT6A 3CH4B 1GPJA 4DV5B 5BWOA 4INJA 1T5HX 2KLBA 2WMNB 5E1DA 4C0AC 3CF2A 4NU0A 4YCAA 1GM5A 1SCDA 2A4KA 1HRDA 2A0KA 1VCMA 1W0JA 3DKKA 2HWXA 1MW9X 3TSAA 5BORA 1AMUA 2X9VA 3D1VA 4ILEA 1QRAA 4X90A 1ITZA 1KY5A 3O75A 1JKIA 3QE3A 3DEZA 1ENOA 4K9QA 1IY0A 2R6GA 1F9AA 3C39A 2BGMA 4I8IA 4UM5A 3W2TA 1XVVA 2B36A 5DCYA 5IN4A 4TN5A 2PQ6A 1R8JA 2QRVB 4QUKA 2R7MA 4YJHA 3IT2A 2XODA 1XZCA 4LX8A 1EEHA 1JLLB 1U0TA 1KA9H 3T5BA 3WP0A 4B3DA 1ULSA 2Q46A 2Q9AA 2XXAA 5CU7A 3U60B 1DJMA 1A9RA 3L8YA 3ESXA 2RGDA 3RVLA 3C87A 1OCEA 3E3MA 3G6WA 3LBHA 1MIOB 3OEED 5A3VA 3TRHA 1WQ1R 3LAWA 3Q5EA 5FUMA 4KXYA 4FHCA 4HX9A 2O6LA 2GBPA 4BZQA 3TINA 5DGCA 3HUFA 3AFIA 3R40A 3TE6A 5L95A 5I8WA 3T12A 1L4YA 2O1SA 4II2A 3NHYA 4QPDA 1Q77A 4G24A 4AM8A 3EN0A 1M3SA 3TW6A 1RLIA 6YASA 3G49A 3CNLA 4JI7B 4HXGA 4NE9A 4BN5A 3OQHA 5TV2A 2ZUWA 1B76A 3B1KA 4WK2B 3GU3A 3D8NA 2R6CA 3V1NA 3ER8A 1K68A 1VC2A 2Q3EA 5C53B 1G66A 5G3YA 4MUEA 4JEUA 5C8ZA 2Z8YA 1WQ4A 4Q3OA 4DWWA 2A9QA 3K5PA 1OXTA 2I22A 1JL3A 1C30B 1RVV1 3GPCA 5MN6A 4A15A 1V8PA 4PWZA 3LPNA 5I45A 2C3MA 2BFFA 1C0EA 1Y3DE 2PMFA 4LNUA 3OIWA 5BR7A 3K6SB 4JT9A 3EXEA 4B6RA 4DLBA 3E82A 1SC6A 3O31A 5GONA 2CC2A 3VC1A 4DHEA 1SQFA 5TMEA 2A6PA 3D6AA 1U8ZA 1DKNA 5EZYA 1TAUA 1U9CA 1HURA 1V5IA 3A9SA 3FMFA 1BX0A 3GZJA 3OMXA 4OYRA 3FD8A 3NYRA 3GUYA 4PGGA 3KP1A 1LLQA 2CHEA 3HVKA 4F5EA 5HHTA 5HM8A 1UPBA 3U4IA 3W8EA 5CB8A 3KYCB 3UTCA 1EH5A 3WRWA 2QVGA 1MB9A 1Y4SA 3GCZA 2Z8XA 3JRWA 4IF6A 2F4VB 3AP1A 1M2WA 1JZTA 2GPWA 1P91A 1SU8A 1QCZA 2PUHA 1L4KA 1ZK1A 3AHCA 2Q4DA 5AI5A 4Q1EA 1K2VN 4DV0B 1DLJA 3QFRA 4PLFA 5SY4A 1R4ZA 5ADWA 4BO7A 3GRAA 1Y1KE 5EHNA 1P0PA 3KPWA 1YA6A 4JX8A 4OAQA 3G2JA 1COWA 5HS6A 5TT1A 3ASZA 2CD9A 2ZR8A 4WRRA 3WADA 3C7CB 5JFTA 4PAWA 5H3CA 3ZW7A 1FQOA 3FPFA 5I4KA 3I6QA 3M89A 4QBKA 2Q1WA 2V03A 2HA3A 3R0JA 2FEPA 2FGJA 1GKIA 3DMFA 4R8VA 4RHEA 3ZOKA 4F9TA 1O6GA 1WV1A 2XCSB 1CP2A 2YJ5A 3FKQA 4K40A 4K0KB 1TA4A 3I73A 2PSFA 5CG2A 1E5XA 2V65A 5BWLA 3MJTA 1EWRA 1WETA 3G85A 4IDBA 3GD5A 5AXCA 4CMIA 4Y9TA 2XYGA 2YVQA 4BNXA 3ODGA 5KEIA 2NV0A 5J3JA 4R4JA 4AYTA 3AZPA 1MABB 4TMYA 3FOAA 3W5JA 1E3IA 2W8ZA 1Y3CE 4H4CA 1VIDA 1P62B 2DC1A 4KIJA 5KWJA 3RAFC 3KQNA 3FB1A 4O2BA 1FNMA 4J4HA 4B3SB 1FSZA 1DPGA 3BICA 1MAVA 4QPPA 5F35A 3G89A 3RHZA 4I2NA 3LKZA 5AKEA 3UMYA 4OLBA 2B4YA 2MOKA 1XRNA 3JWIA 2VSQA 5IWCA 3P45A 2IH2A 2YRXA 3AW8A 3D2CA 4IIJA 3LT5A 4NRDA 3AUJB 4QXQA 3H1AA 5LOVA 1KIFA 2OGWA 4JYZA 2J5RA 4OHFA 1XJWA 2BEUA 1M6VA 4JEMA 4EYOA 4JNKA 3S55A 2E18A 1NI5A 3NHMA 1D04A 5LNK6 4G1EB 3RNOA 1KSGA 3MQ2A 1Y6QA 5SV2A 3OSUA 4MW7A 2O7QA 1NRXA 2J7PA 2J8ZA 5ICGA 5JS7A 3M1LA 1VI6A 3W5VA 1N1GA 1MOQA 1WZIA 2WFMA 3I2FA 3MS4A 1WL8A 1QS0A 2BBTA 1UQRA 1GYQA 5CAEB 3LQRA 3FF4A 3SE0A 2GFHA 3KPVA 3O90A 2GEJA 1W49A 5GVSA 1B15A 4OMDA 5AW1A 3W2EA 4A3SA 1P4AA 4WZBB 1NVUQ 2CBXA 1BE1A 3B2NA 1DDGA 1HZZA 2ZT7A 5TQ0B 4ZMBA 2V7TA 8AT1A 1GPLA 2XDQB 4N3GA 1MN6A 3L6CA 4HZGA 1OWPA 3TGLA 1K8QA 3ZC3A 2R7KA 3AHDA 4W7HA 4C4RA 2HLHA 2V4ZA 1OXSC 1NF2A 4LNHA 1P5HA 1MENA 1QTRA 3AVUA 2O05A 2OMEA 4JQOA 3IO5A 2B0CA 2WB2A 1Y7IA 4PZ0A 3L46A 1N25A 3NWEA 5ERXA 1WMEA 4KK3A 5JD5A 3LTEA 3FUWA 3GGPA 4Y2JA 2XDYA 1ADBA 1HZJA 4U7FA 2PD3A 1SCIA 3O93A 2PQ2A 2IV3A 2RK3A 1ODTC 2IQ5A 2JGKA 2PX8A 2YFHA 4KWCA 3IR6A 4LHSA 1JBKA 4B85A 3FFWA 4MI6A 4EMSA 3ZZUA 2R6R1 4YP7A 4TTPA 1ZGHA 5D3MA 1DTSA 1IBRA 4XIIA 4M0DA 2WYHA 3KBBA 2A78A 5I7OA 2ZE5A 4XD2A 2G71A 2CNOA 2J9ZB 4TWRA 3FVWA 3OZIA 3EHEA 4QLOA 3S2GA 5B2ZA 3MLBA 1UKEA 3OOWA 5I9LA 3PKZA 4MP8A 5KYXB 1KRHA 2ODBA 5GMOA 5JAPA 3LXRA 5JCJD 1SEVA 4HP8A 4A03A 2IW3A 2C4WA 2WNHA 4LQDA 4OQLA 3VR0A 2VBFA 3PJFA 1NIJA 3LF2A 2ZZKA 1N57A 3AOEC 3QI2A 3IUMA 1QVZA 5FI5A 2CLFB 2HTFA 1JFVA 1NE2A 1OYWA 3E23A 4RDCA 4ZO9A 1BN6A 4CF4A 5HM6A 4EUNA 4KXNA 4LS3A 1MOZA 1CR0A 2F1IA 4NBRA 4RD3A 4UAGA 5D2CA 1H2WA 5FUWA 4B81A 2HDWA 5KTNA 4C21A 3IFSA 4HDMB 4UHKA 5COAA 3SLRA 4X65B 2CLCX 2X0RA 1KWKA 1Y3HA 1I4DD 4BAUA 1T35A 3IBGA 1NV9A 4W9MC 1YV9A 2BFNA 1RQNA 4LXQA 1WXDA 2BELA 2QR5A 3ELYA 1EIWA 2ZM5A 4J0FA 1UK8A 2FPKA 4LZJA 4MZXA 4PLCA 5PGMA 1IQRA 1L4MA 2OCXA 4B8WA 5IKXA 4YY3B 4QM7A 4TTRA 1H69A 2KWIA 3HDYA 3QJ5A 2VT2A 1I80A 2PT9A 1H66A 1FFXA 1E8NA 1EFRA 1KEEB 1LX7A 2YXNA 3O2QB 5C5IA 1ISIA 4B7UA 5KSYA 2RHTA 4NZNA 1M67A 3CZ9A 3UCXA 5FLEX 2QQEA 4WN9B 4C76A 4IIEA 3TLYA 3D8TA 4EY6A 3BAZA 3T1OA 2BSQA 1J8DA 2E87A 1SUBA 1DIHA 1G2PA 1MD9A 2E37A 3G8CA 4MQ5A 1X3LA 3G2NA 5A5GA 4F2HA 5IKPA 4FMCF 2QXTA 4L0CA 4LWZA 2CNLA 4QREA 4HAWA 1A69A 1FDWA 3QU9A 4TTJA 1V11A 5ALSA 3CEJA 4FFOA 1E9RA 4C1NA 5AESA 2O19A 5HRAA 4HXEB 4N18A 5D6NA 5IYZF 4RF3A 3ZZMA 3B2QA 4LVOA 4X54A 1J2EA 1NVGA 1ZVJA 2YY5A 2ZRMA 3QYPA 4QQNA 4EHNA 5LJIA 3UW3A 2ZB2A 4C4YA 4DR4B 3G9QA 4KIGA 3QUTA 4DC0A 5KOYA 3OZDA 2C9DA 4O08A 4AZ3B 1QMGA 4TMKA 3RS9A 4WPGA 4Q03A 4GYYA 1USVA 4QU8A 4V2IA 4BV8A 4I9FA 3WKCA 1BZYA 4J0GA 4TVBA 3TLGA 4RAQA 1PR1A