3L1KA

Sad structure solution of proteinase k grown in potassium tellurate solution
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTDILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteinase K
publication title SAD structure solution of proteinase K grown in potassium tellurate solution
rcsb
source organism Tritirachium album
molecule tags Hydrolase
total genus 102
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2009-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3l1kA00
3QTLA 1GTG1 1A2QA 1R0RE 3ZXXA 1WMEA 4NE9A 5B1DA 1GNVA 2Z2ZA 4DZTA 5ARBA 3QMPA 3PRKE 1SIUA 3DW3X 1KDYA 2DP4E 2W2OA 4YN3A 2Z2YA 4RYDA 2IY9A 1KDVA 3HJRA 1SUPA 3QFHA 4OV6B 2SICE 1KE2A 3DE6X 1R64A 3ZXYA 2WWTA 4HX2A 4H6XA 1BH6A 2ID4A 1TM3E 3EDYA 3BPSA 3Q5GA 5JXGA 1SUEA 3I30X 4NMXB 4JP8A 5FAXA 1IC6A 1SCAA 3DVSX 1AF4A 3LPDA 1R6VA 2DUJA 2PWBA 1ZVJA 1SVNA 2ZWOA 2W2QA 2IXTA 4C3VA 3AJ9A 1EA7A 1OT5A 1Y33E 4J94A 4FONA 1GTJ1 2SNIE 1LW6E 2P4EA 1GA1A 5FFNA 3CO0S 4OMCA 1SUBA 3GT3A 1T1GA 4M1ZA 3DE4X 4BWGA 3TI7A 4AKSA 3LXUX 1Y48E 1KE1A 3AFGA 3EE6A 1OYOA 2B6NA 1GCIA 5SICE 1PJ8A 4CG0A 2Z2XA 1SIBE 3WIUA 1V6CA 1AV7A 1GT91 4NE7A 1AQNA 3DE2X 4CFZA 1PTKA 3GT4A 3A3OA 3A3PA 3I34X 1SBCA 3CNQS 1YU6A 3VV3A 1TECE 4ZARA 1Y4DE 2W2PA 3SICE 3WIVA 2Z30A 3SQOA 4MZDA 1YJAA 3I37X 1ZVKA 3TECE 3BGOS 4LVNA 2PYZA 1BFKA 2HD4A 1SBTA 2G4VA 2ST1A 3EIFA 1WMDA 4ZOQI 1GA4A 5AVJA 4Z2AA 3DE5X 3DVRX 4DJ5X 1P7WA 1AK9A 5I9SA 1HT3A 5ARDA 4I0WB 5K7SA 5CW1A 1BJRE 4KB5A 5FBZA 2GKOA 4KPGA 1TM1E 1Y4AE 5ARCA 1Y3CE 1Q5PA 3I2YX 2PWAA 4WOBA 1WSDA 2WUVA 2HPZA 1WMFA 1Y3FE 3F7OA 4AKTA 3L1KA 1SH7A 3DE0X 3Q40A 1BFUA 1S02A 2PKCA 1C9MA 1SIOA 1TK2A 3DE1X 1SCBA 4OMDA 2DQKA 2Z58A 1Y3DE 4KG7A 2E1PA 3WQBA 1NDQA 1GTL1 2XRMA 1AVTA 1XF1A 3F7MA 4K8RB 1IAVA 1Y1KE 3AJ8A 1TO2E 1TO1E 2SBTA 3PTLA 3VSBA 3WHIA 4C3UA 4WOCA 5B1EA 1C9NA 2PQ2A 5JXJA 2TECE 1SBIA 1ST2A 3TI9A 1NLUA 1P7VA 1AU9A 1YJBA 1CNMA 1Y9ZA 3DE3X 1P8JA 1EGQA 1SUAA 4H6WA 3GCXA 3D9QX 1C9JA 3F49S 2ZWPA 1Y3BE 3LPCA 1BE6A 1GNSA 1DBIA 3DDZX 3P5BA 5AQEA 1S2NA 1SBNE 1T1EA 2W2NA 1NDUA 3VTAA 1OYVA 3OSZA 1BE8A 1SUDA 1SCNE 2PRKA 1S01A 1PEKE 4H6VA 2W2MA 3A3NA 1SUCA 1MEEA 3BX1A 1ST3A 3DYBA 1SCDA 2QTWB 3DWEX 3DE7X 4LVOA 1SBHA 1UBNA 1SN7A 1YJCA 3VV2A 2Z57A 2WUWE 1THMA 3D43A 3DVQX 1TMGE 4GI3A 1TM4E 2ID8A 1CSEE 3UNXA 1C3LA 1WVMA 1AH2A 2ZRQA 3VHQA 2Z56A 1JEAA 4B5LA 2XTJA 5JXHA 1SCJA 4HVLA 1DUIA 2X8JA 1TM5E 3H42B 2PMWB 2X8JB 1SPBS 2V8BA 1Y34E 2SECE 1KDZA 4DWWA 5JXIA 2WV7A 1TM7E 1VSBA 1GA6A 1MPTA 1PFGA 5JMOA 5AMXA 1SELA 3VYVA 3GCWA 3T41A 4CFYA 1V5IA 3LPAA 5AVKA 1T1IA 3DW1X
chains in the Genus database with same CATH superfamily
3QTLA 3NH9A 2LV8A 4S1WA 2EZTA 4JLJA 4KODA 4YI3A 3T34A 1I3LA 1BCRB 1MX1A 1B16A 4Y6LA 1TUEA 1ZBDA 2FZ4A 1TVKA 2C2XA 5CITA 4DLZA 4UM9B 1BOOA 1E0AA 3H75A 1WEKA 4IIJF 1D09A 1U3WA 4D9MA 2W2TA 5LLTA 1FRNA 1QYVA 3VUEA 2FSIA 4PPQA 1ISRA 2C5HA 3PKJA 4JB2A 4GXTA 2LR0A 3IAAA 4K3UA 1BDMA 1LLCA 1YRQA 5TARA 3RYIA 4ZGWA 3JW8A 4U63A 1XWWA 2W2OA 1KC3A 3L6EA 3VJRA 4PSKA 4BTEA 3GFGA 1G42A 2IY9A 1HYEA 4HRYA 5LCXA 4D0RA 4EPXA 1EMDA 4K5QA 2B9VA 4HUTA 4AJLA 3HDHA 1Z45A 4IXWA 4PTLA 1G2PA 2C9ZA 1LF5A 1BO6A 5HUQA 3OIFA 2X5NA 1GCGA 3OQ6A 3OZDA 3HXMA 4ARCA 2ATEA 2IA5A 4F4DA 4DT1B 4BKPA 1WM1A 5K6AC 2XDWA 2ATIA 4JLDA 1S2IA 2LDBA 2JGDB 1II0A 2N1BA 3EXHC 1ESMA 3FF4A 2WAMA 3FJYA 2EJWA 3H5VA 1L5QA 3TS1A 5C8ZA 5KYWA 2OP1A 5ILOA 5L3SA 1R9JA 4L6IA 5GQSA 2ZSBA 1M2WA 3KTDA 4W8GA 4BVKA 4DANA 1S5PA 1GYQA 4RLFA 3ZW7A 4M8IA 1A2BA 3OFND 3SCZA 2Q6VA 3MUOA 1SM4A 4AS1A 3LPDA 3LWZA 1V47A 1QH8B 2YQ4A 1NLMA 1QYWA 1A9XA 2PWBA 4L5AA 4FBLA 1SD1A 4JYBA 4D6YA 3EVBA 1QIDA 3QE9Y 1H6AA 3X3HA 3ZWKA 2QVBA 1R1DA 3JASB 1R3DA 1KZGB 2CEKA 1Y7TA 4Q19A 4QASA 3OWOA 4MV7A 1Q15A 2V59A 3DR5A 4UOQA 2GRUA 1UXJA 3MILA 4KHZA 4MP8A 4DM4A 3FZEA 1JP7A 2IS6A 1OREA 4CF5A 5IAKA 5TVGA 4CXMA 4O4HB 2Q2WA 2HA4A 1N3LA 4D9KA 3ORYA 1DIRA 1YONA 2D2XA 1FIUA 3ESAA 2W2LA 3RFCA 4UZEA 3EAGA 1YKSA 4AJIA 2JH9A 1DG3A 1L8XA 3K2BA 4P4SA 5B3LA 4B3GA 1JYFA 2FN7A 4HP8A 1JG1A 4R98A 5B1SA 3BILA 3OKPA 1X42A 4H17A 4ONEA 4DDMA 1GARA 4N82A 4U5QA 3HY3A 5FFNA 1WMSA 3COZA 4MKRA 4W5HA 3VTFA 1X15A 4JV5B 2HAEA 3DTYA 3EA4A 3H2GA 3O9MA 2O5RA 2WIBA 1E8NA 4JLBA 4PR0A 5J1SB 3PFIA 3COPA 3MBOA 5TQVA 1K88A 3IE0A 2GAFA 2YNMD 1ZQ1A 3FSRA 3PQ3A 4L22A 5CR9A 2I6UA 5AVYA 5JWRA 1J22A 5JSZB 2F55A 4WKOA 5IF3A 2PLRA 3MOSA 4R7ZA 8AT1A 1V35A 4B7UA 1E9VA 4G1BA 3K9HA 2DM6A 3TFWA 3QUQA 4LFBB 4X41A 1JJFA 1XPUA 3AR9A 3U4GA 3H86A 3IBFA 4E94A 4AWAA 1GFWA 1NJFA 3OZFA 4V38A 5CUQA 1RCFA 3B7GA 4RK1A 4OQMA 2MTBA 3KT3A 3UHJA 1XTIA 5KYGA 5IT4A 2EQ5A 1UWCA 2ZSJA 1F60A 3BGDA 1SXJC 1L5MA 4BDTA 3E1SA 1YOBA 2NN3C 1GZDA 3OQ1A 4PSDA 4EB6A 2Z2XA 3QXSA 1ZINA 3TLZA 1GXSB 2XNJA 3ZJTA 5FTNA 1UC9A 2W48A 1UJ2A 4Y2XA 3EVEA 1Z3CA 1JR3E 1DB3A 1CZHA 1UXOA 3TIVA 4RJTA 3QJGA 1V6CA 2DFNA 5CM8B 2NU8A 2JC3A 4GM4A 3H97A 3EPKA 4B44A 5F3RA 2XNDA 1C3OB 2XVMA 3CT4A 1H69A 3NBUA 2JIRA 3H99A 2NSDA 3UG6A 3LUCA 4G4IA 3R7BA 1H6DA 3TQRA 2PXCA 4FX2A 4A92A 2ZUEA 2R47A 4CFZA 3DCNA 2W8ZA 3I23A 3OQVA 3T5TA 3EEQA 2POCA 5HNKA 2BFCA 2LGJA 3GAZA 5BSKA 1W1IA 2C98A 1KZ6A 1LEHA 4YREA 1TL7C 2ZANA 3TGPA 1Q0HA 1T5SA 2AXEA 1GZ4A 1XHEA 3UAGA 2AX4A 3PC3A 2Z5VA 4PZLA 3EOAI 2J6BA 3CLTC 4EFNA 1TGVA 4JA0A 4TLCA 4ZOLB 5J40A 3AF2A 1ZU4A 4GPD1 3T9DA 3WIVA 1PNQA 4O2LA 3CH5A 4CJXA 3NEYA 2R751 2B3DA 3OEWA 1JJVA 4LOIA 3ZHTA 2H5JA 3JZIA 3CLVA 4UW9A 4C7MA 2MSNA 4MV5A 4JYZA 1G38A 5DT2A 2XVYA 2OR3A 2H4XA 3W7VA 4ID3A 2BBOA 2WVHA 1N5JA 2JZOA 3WMGA 2BHLA 5KUTA 4NLLA 1EZ1A 3B8HA 2DY1A 1YU9A 3SBDA 3ZX5A 3BFPA 3K0SA 3H9UA 4UC0A 3IQWA 1TF2A 4CUJA 1PKEA 3LFTA 3K2QA 4HGNA 3H3XA 3EIFA 4P84A 2QSZA 1R6BX 2C1EA 3EQ8A 3IBSA 3WWCA 3ANLA 1RZRD 4MAMA 3SBEA 2OXFA 3GB9A 1FTWA 1KIAA 3VX4A 3UJ6A 2HPAA 3SIPA 2BN4A 4J4BA 3DE5X 1YTLA 5ENVA 4ZCLA 2TMYA 3MNFA 2VJAA 3ZX4A 1OPRA 6CHYA 3V8VA 1GU1A 1ODFA 1SB9A 1C80A 1F20A 2WOJA 4XJXA 3ZU6A 3SHTA 4ZVRA 1BDHA 2ISQA 2VHWA 4XTCS 5KINB 4D6PA 3NI2A 2Y1DA 4Z9AA 1JHMA 2YC4C 3SX4A 3AR6A 5D01A 3LY9A 1I51A 2VPPA 3WMXA 4AY2A 2W6PA 4OJQA 3D4IA 4R1MA 2B82A 4H0FA 1P1FA 2VDPB 3NBYC 3BRCA 4AKIA 5HCNA 1J7KA 1LNZA 1Z6ZA 2AD1A 1L5OA 2PKQP 3RG2A 3L4BC 5CXXA 1BFDA 4BYGA 5K5EA 2I4MA 5AW1A 2WTUA 5JUWA 3GLGA 1W0JA 3QWBA 3GJ8A 1WTCA 4AYXA 1JAHA 4RKWA 3VR4D 4DVJA 1CBUA 3ZQUA 4OLJA 1XTVA 1CUXA 1UAYA 1WXFA 3C97A 3DZCA 3EBOA 4J1TA 3SVZA 4E2FA 1WLYA 2WAOA 5IFKA 2D1TA 1ABFA 3PR1A 1X7YA 3IAM6 5KOJB 3SEAA 1NN5A 1L7BA 1H94A 1YDHA 3QVWA 3SJ7A 4BU0A 5HIMA 5I5GA 3TXXA 2WYHA 1FSSA 3L0SA 2R11A 3PWSA 5BY2A 2P9TA 5TVKA 4HB3A 1PJ4A 4GFDA 2PE5A 1Y5RA 1VRVA 2GD2A 4UBLA 3BB3A 4K9NA 4O1HA 1L3BA 1ZC4A 1FSGA 4URHA 1DXQA 2O2EA 1T2DA 1O96A 3SJBA 4IUBS 5BWBA 1ZGJA 4QFBA 1RYMA 4H60A 4M53A 4QREA 4X3OA 4TSFD 3K9LA 4EBBA 2HJHA 4NYMR 2PYIA 1OY1A 5FIUA 1VIYA 3D6MA 4QU8A 5JNTA 1JIJA 1W5SA 5KWIA 3JQ9A 5HHTA 3PPWA 4DPMA 1NYRA 2KHZA 1ZUHA 1IAQA 4OHWA 1KI9A 1YMQA 1XQ1A 3FPBA 4RPJA 4GX2A 1QK3A 1L7OA 3TEMA 4NCHA 1J25A 1YB4A 3NHSA 4TYPA 4RVGA 5JO9A 1Q0QA 2HZ7A 2JD0A 5KWVA 1HK7A 1VJRA 2B1QA 5DXJA 5G0UA 2ZUTA 2BKAA 4H4CA 1AVTA 2P79A 5ECWA 4DVGA 5AQ1A 2C20A 5AOBA 2BEUA 4MLPA 3I04M 3FGNA 2ECKA 4UHEA 4ARBA 3T3IA 2H1VA 3L07A 2OUKA 3EGCA 5G3YA 4A0SA 1Q0RA 4YPFA 1SBQA 2LCFA 2XKBA 2ZT7A 3M9WA 3BJMA 1AKUA 1EWKA 3G7SA 3NUGA 1SQ6A 4I9HA 1B2LA 4JGIA 1SR8A 2GILA 2Y92A 4B35A 1W6UA 2IUEA 4RFLA 1JIVA 3MRXA 1DAEA 2I4OA 4LRSB 4QWMA 5JFTA 4XARA 2XSZA 1KEVA 2OHIA 1ZR4A 3U1TA 1X14A 4HZUA 4JASB 1G18A 4PICA 2PRZA 2Z8YA 4Y2GA 4JT4A 4ZD6A 3JRWA 5IK2D 5IEBA 1AGRA 4D5EA 5LC1A 3FCYA 5CFPA 5C8DA 3UOWA 1WIWA 3G2JA 4AULA 5AM4A 1SHKA 5DBGA 4PSUA 4KQIA 4UE6A 1K6IA 1DX6A 1EK5A 2VTEA 1L5LA 4NG5A 3WS7A 4FYYA 2G88A 4R9UC 1GQSA 2OOSA 4CM3A 3D3WB 4ICIA 3S8EA 4Z9BA 3OY7A 3IEKA 3U60B 4CCYB 1LK0A 2GLUA 3P9RA 1TDJA 3M6UA 3L04A 1R66A 2YJ6A 3L4JA 5IXJA 4KHPB 3PLRA 2A6PA 3TINA 2D7CA 3NHMA 4MS4A 3F49S 4YJ2F 4ZT3A 4BCBA 4AX8A 1UWVA 5HFNA 3PFGA 1SXGA 1YS6A 2BGWA 2HEGA 3H5WA 1O6CA 3CZMA 3HACA 4PLVA 3KNZA 4UTZA 4EY4A 3ZWQA 4LQLA 3DDZX 1WLSA 3GFSA 3QU7A 2AFVA 5D6NA 1G19A 1HUQA 3H7AA 4MQ4A 5D8DA 5J9FA 3ZHCA 3DMNA 4BFZA 1RWMA 4EP1A 1WHSB 2O3TA 1SBNE 2XMPA 3F5QA 1S8OA 3ICWA 3G02A 3L40A 4HDRA 4LRUA 2IP1A 4D6XA 4RD2A 4JX8A 4AS2A 3AT1A 5JECA 1TEZA 3T9FA 1GDTA 3RU2A 3THWB 2V5AA 2WWVD 1WP9A 1VL6A 2DBYA 2DTDA 4PLTA 1YL5A 3DMTA 2NP7A 4FILA 1H4QA 2Z5GA 4NJMA 3ZDXB 1WUKS 3DOOA 4DJFC 3NC4A 4B34A 2TS1A 4QGFA 1EHIA 4HAUA 4BEVA 4XIJA 1GZ3A 2A84A 3MW8A 4HG2A 5EJ9A 4I1VA 4JYAB 2YZMA 3SF8A 1YAHA 4DJJA 2Z8XA 2QPLA 1IJFA 4II3A 2BTQA 3SS8A 1OH8A 1VPDA 3USES 2BFFA 2CBXA 3EW9A 2FPWA 4ZOAA 1MQ9A 4CN8A 1LQUA 2YJGA 3A3NA 3RU3A 3L7IA 1JGTA 2UYQA 2GHIA 2V7BA 3VQTA 2JRCA 3VO9A 4ZRDA 3ZLVA 1CIVA 2VJYA 1MO6A 3HV2A 4R3WA 1DEKA 5KNCH 5J2UA 2CJYA 3OM0A 4FI3F 4HYQA 3L7KA 1QO7A 4P3NA 3QPDA 4D0LB 2G1UA 2IW3A 2C2YA 3CH6A 3JCZA 2QOEA 4ZQIA 2AJTA 1Z4JA 2D1FA 2I4IA 2RB5A 2IEBA 4ZCMA 2GFIA 5CP8A 2AVNA 2F43B 2QYHA 2IOHA 1EFCA 2XRFA 4KGDA 4AUNA 4EFLA 2R62A 4NECA 4UM9D 4B7XA 2DHCA 1G291 1XTBA 2AJLI 1W48A 1MGOA 1Z38A 2EHDA 1E7WA 1EE9A 2P75A 2VAWA 3GEEA 5AKKA 3TZBA 3UK0A 4EI7A 2V7WA 1MORA 2J87A 2D3WA 2JG3A 4M8LA 1RADA 3JXEA 4CG1A 1M2VB 5K3FB 5BV8A 2XBLA 1N5MA 5D00A 2WW8A 1DO2A 4L4SA 3WQRA 2BFWA 2QT9A 2FMUA 4PPNA 3AIIA 2JLWA 2WINI 2QW0X 1CJVC 3DJYA 5F76A 4MS1B 1X0VA 4L4UA 4Q1BA 4OLHA 4WIAA 5GZ3A 2HGSA 1CSEE 4F1WA 1OV6A 2FDRA 3CXRA 1GV0A 5A3RA 3DAFA 2C31A 4IEFB 4EB0A 1A7JA 5BQOA 3STXA 3A4YA 1U0NA 2WJHA 4NZZA 3NIBA 4UVGA 2WSIA 1RDFA 2QR3A 1E2PA 5K2MA 3EC7A 1FB5A 1T9HA 5D3MB 2PBLA 3A4LA 4NX2A 4D74A 1ZEJA 1JDSA 1Y34E 5LU8A 3HHEA 4D3FA 2IOQA 3KWJA 5LD2B 3GA0A 2FR0A 1PS8A 3ITNA 3AEKB 3OM9A 1BS1A 3Q7IA 4PLCA 2HADA 5I7OA 4A15A 2V0GA 1LBHA 4MGHA 1NF2A 1DIHA 2Q5QA 3NWOA 3RNOA 3NIWA 4XYMA 3MTEA 3W5IA 4B31A 4DN6A 1TAUA 2GOYA 1CB0A 1QV6A 4O8CA 1MPTA 4IINA 4U2DA 4JQOA 3RK0A 3TOCA 2UUCB 2WP0A 1XBTA 1RMQA 4P3PA 2JFVA 4GOJA 3RB8A 2R66A 1X74A 1SELA 1JVBA 1VFPA 1T4CA 1OT3A 2ZKLA 3T3HA 1Z2OX 5JY6A 1S2GA 1NY6A 4CR7A 3TGWA 2HKIA 1LY1A 4RHYA 1GRQA 3E1KA 1FK8A 1ZU5A 1KORA 2ICAA 2WYWA 3LC0A 2HFJA 2QMQA 3A6ZA 3NR2A 3V4VB 4BO1A 1GHTA 1V5IA 4PHFA 4BZQA 1CQIA 1YBMA 3NWJA 3OPYB 4G1FA 4OH7A 4C6RA 4RXMA 2J45A 4DWVA 5BN5A 4LBZA 2ONCA 2P9CA 1Z2AA 3OQHA 1EQUA 2V45A 2H2FA 2ZQZA 3L6UA 1NU8A 4M8KA 4UOEA 4MTCA 5F2OA 2JHAA 2QBYA 2C84A 4GPEA 4LOLA 2VJPA 2J8ZA 2VTKA 1AUPA 3UWPA 2IIPA 4A36A 2QI9C 1EKXA 2G5GX 5AM5A 4BZWA 2GVZC 5TGZA 4YUWA 2Z2ZA 4XGRA 1PL0A 5LB4A 3UCXA 4DDUA 4X7PA 2R00C 4DMCA 3ZGOA 2XWSA 2Z6UA 3QMPA 3LYAA 3P9QA 3UMBA 3AV3A 1RXCA 2PGAA 3IODA 5IN5A 1U3FA 2Z2YA 1HFKA 3OG9A 2YR0A 5ALEA 5KTKA 3FR7A 4HPWA 4YO8A 2JLSA 5TEWA 1KDVA 3WSWA 4C4ZA 4C88A 1OZAA 1TX4B 4C7JA 1N34B 4O02B 4UVEA 4Q9KA 1P18A 2Q1TA 1U8AA 5BWMA 4ASUD 2UU9B 2VS1A 5DWVA 5AVXA 1MXHA 1G1AA 4LDJA 4P4LA 2WWTA 1DJMA 4KIJA 4Z9FA 2RB4A 2HMVA 2ID4A 4NFYA 3QXGA 4QIHA 3T35A 1ISPA 1W36B 1J8FA 4ALKA 2WUGA 4ISBA 3I30X 4V24A 4DCMA 2ZULA 1TYEB 4RQBA 4O2AB 2YOHA 3DVSX 2JH3A 3O0DA 5A3QA 3QF4A 1OW3B 3GEHA 3EUEA 1KEPA 4GL4A 4BQOA 5AXCA 3QVKA 1M0SA 5EP4A 4EFMA 5H82A 1WZCA 2RKBA 5CH8A 3FVWA 3M5WA 1CE8B 5HBGA 3PEEA 3CX8A 1RC0A 4WASA 4M0FA 2B98A 4PGAA 4EMTA 4LZAA 4ZHQF 5AUNB 1G2OA 2QIOA 1EK6A 3MFQA 4C6HA 2WF5A 3KO8A 3FB1A 3S0JA 1TLTA 3TN7A 2ZXFA 9ABPA 2Q2NA 3PHCA 2NACA 2PX6A 3R9IA 3GPCA 2OXEA 4BNWA 4FYWA 3WK6A 1F2VA 3E61A 5AJVB 4BX2A 1AQYA 3T7RA 1K63A 1U2TA 3IVRA 4Q0MA 4YAWA 2PNJA 1H1DA 3CRRA 1IOZA 3HZZA 4C0AC 3KZNA 1RBMA 1RWNA 2CBZA 3EFHA 1SG6A 3H9QA 3LW7A 3O26A 4GICA 4URUR 1XZNA 4R8MA 4GXNA 1YZYA 2ZCUA 3AR4A 1HGXA 2Z6VA 1NFFA 3WKCA 4FMPA 1M1YE 3MINB 1JYSA 5BOSA 1EFDN 1RHUA 1XVAA 3TFOA 3GA7A 2XIQA 1XJWA 3CCCA 1TJPB 3IDFA 2ZQ5A 3K70D 2JIZA 3NTUA 2IT1A 3ZHYA 2CVQA 1JIUA 3KL2A 5EJGA 1MIOB 3R7DA 1QG0A 1CHDA 2EJCA 3BULA 3IP7A 3H1AA 1CQZA 2VHXA 3MD9A 4S1NA 2FE4A 2FHPA 1CVLA 1N2GA 3TJZA 4EG8A 4CIAA 1UDAA 1M34A 2OKCA 2H1FA 5DM4A 4O2BA 4OMCA 2PKEA 1QC5B 3GT3A 1YB5A 1KFCB 3B9RA 3KKOA 1BA3A 1XALA 3RQIA 1ACJA 4DLRA 1DWUA 1Z74A 4X61A 3WSTA 4Q47A 4C0QC 4EKGA 2ZQYA 3CEPB 4AMZA 4RTOA 5CDYA 2QTFA 3KX2A 2B1RA 4OIFA 4CRWB 4E21A 3EVDA 5EGNA 1Y48E 1DRWA 1PV1A 3CR3C 5IDYA 3DBLB 5JATA 2KJQA 3V34A 3H05A 5BYBA 4LOJA 1DINA 4J90A 1N7JA 2BBSA 2VYVA 4ZICA 2AG8A 3MMXA 2Z8ZA 4MRSA 2XDQB 2Y27A 1M8KA 4RESA 4ZVVA 2P30A 4J7XA 4FEYA 1R3UA 1US8B 1HLPA 4N5HX 4CM8B 3KHTA 5KYYB 2OHVA 3CLKA 3T99A 3WNDA 3M82A 4MVJM 2WZBA 2G80A 1UAAA 1B6RA 4QXMA 2ZVPX 2FPGA 1IOWA 1REQB 1SK9A 2OP0A 3OZVA 3QA3E 3RJTA 3MJRA 5E95A 2R2AA 3E27A 4EZIA 4O5OA 1PL7A 2HLDD 4HGOA 4X6LA 1DAPA 5K3OA 4MHSA 5AESA 4QQFA 4H15A 1O97D 2YMQA 3B51X 3CN9A 3UY4A 1TIPA 4JBXA 1Q7CA 4E15A 3QU5A 3EQ9A 1XCLA 3M6VA 2J9YB 3MT8A 1RM3A 1RMYA 3B2NA 4A0FA 1H2AS 1E5QA 3J80A 3E8MA 3ISJA 1OA0A 1RLMA 2JB9A 1E1KA 2WC1A 4WK0B 1SBZA 1XKXA 4DILA 2PMDA 4E5PA 1P3Y1 3IMFA 2HQRA 4EYSA 3PEVA 1RWKA 3EBLA 5H83A 3ZK8A 4EZBA 4ZDWA 4QJ5A 2G8NA 4ZVUA 1Q1AA 2JJ1A 1C7QA 3ZIAA 4GOKA 1KH2A 2A9RA 1U98A 4QL3A 4BV9A 1MT0A 2QZJA 2FW0A 2QUAA 4NF2A 1T0HB 2XWBF 5GZ6A 3TQFA 3QQPA 2OV6A 3ZE1B 3ZGZA 3GJ4A 1PGNA 2X15A 5LP1A 2FU5C 2B30A 2QP3A 3BEDA 4B3MB 3I8SA 4MZDA 4I6GA 1UPUA 2CUNA 1Z8DA 2YVQA 5HUJA 3KHKA 1NQVA 1G5HA 5BUCA 1JQDA 3L84A 2FVYA 3RSSA 1S6YA 1TEHA 2HU5A 2C8LA 1F6WA 2XD9A 3R5XA 1OXUA 4R1OA 4BO2A 1AHNA 4FS8A 1HC7A 1XZIA 4LVNA 1BFKA 2VAMA 2X6TA 1RLTA 3QM1A 5ELMA 1SQGA 2DHDA 1E5VA 3AESB 5LP6F 1CCWA 3PE4A 1Y7LA 3QPBA 2IF2A 4Q4AB 5T6MA 3VR6A 2C5AA 5FPQA 3X1MA 5C5IA 3HXLA 4OO3A 2ZWAA 3LUDA 4W5NA 1C1XA 4AO7A 4FDMA 3RYHA 1OXMA 3PDJA 4B33A 1GA4A 5EQTA 1CJSA 1JT9A 4JDUA 3F6BX 2DHRA 4Y2JA 1AQUA 3BH6A 5L3ZA 4NK4A 2PD4A 4AIRA 4Z2AA 3CBQA 1VYVA 2E4XA 5DM0A 3VI4B 3CMMA 4XR9A 4DWWA 1GG2A 2QDKA 5DULA 5E7JA 2W9XA 3FZNA 4QUDA 4XQ0A 2UZ0A 3NOQA 3IIEA 1PX0A 2CEAA 4E3WA 2LBPA 3ONWA 1U2SA 2DWQA 1UPAA 4DXDA 4CZ2A 1ORIA 2INGX 3N2KB 5TQ2A 3RH0A 4RKYA 1YCDA 4N3CA 3TD9A 3TXAA 4GI5A 2QLNA 5EYPA 4DMMA 5JRZA 1PJLA 3L0CA 4G0NA 2RHGB 5A4KA 4EJSC 4W5RA 3OTWA 2FSGA 2GWRA 1OH6A 3VVBA 1Z63A 2OZPA 2KLHA 2V6FA 1O9BA 4RKFA 4WLUA 4B3FX 3PHJA 5K01A 4ILEA 1Z7WA 2Q5LA 3CX4A 4FJ0A 1UDCA 5AUQA 5ILGA 2HWUA 2EOAA 1FTYA 1K7SN 2ZE7A 3G2MA 3QXHA 1OPXA 4LNAA 4LZPA 1A5BB 2HF8A 3HO6A 4RAOA 5JBNA 1Y8ZA 1E59A 3F90A 2V6IA 2PZAA 4H77A 4LXUA 2NADA 1AKTA 2EJVA 2NO0A 3GVXA 3QKSB 2JFQA 2C99A 1JQ3A 2OWDA 4RLSA 4DNXA 4Y9DA 4DCVA 1P8AA 3LX5A 5LOVF 1IY1A 3H9JA 2ZTVA 1L8OA 1X19A 2NU6B 3EVZA 3GRFA 5HSGA 2G0TA 4FC7A 4ND6A 3NBMA 1Y7PA 1OJLA 4EI2A 2WUVA 3U80A 3EHDA 4X5OA 1F14A 5C2JB 4OB8A 4CMBA 4QDUA 2L18A 3QUSA 1TW3A 1WMFA 2ZI9A 4G23A 1Z4OA 1WNFA 2GPTA 4RY0A 4F3KA 5LWQA 3R8FA 1GDHA 3KPVA 1FX0A 3KZVA 1OX5A 4DGQA 5C4MA 1GQYA 3F3MA 1C9MA 3FE2A 3MWEA 3TB4A 1LUAA 5IZCC 1FFEA 3HBMA 3TSYA 3ZCUA 4HLUA 4IXNA 5F1YA 1SHTX 1YZGA 2GPJA 2EEZA 4EFDA 5BR7A 1V7CA 2HBQA 3EVGA 3L1JA 2JI4A 3GJQA 1TJ3A 2ZTMA 3OLYA 4MYTA 5LMZA 1BS2A 2DULA 3ZK7A 2RARA 2WSSD 5BRNA 1V45E 1XI2A 2J59A 1NW8A 5ED4A 4Q16A 3RM3A 3IT2A 1AZTA 4JUIA 4CKBA 1EVYA 1RACA 2BGNA 1YQDA 1MNAA 1ULHA 3HA3A 1G8MA 3CF4G 1DO0A 3VDRA 3DYIA 4QQNA 1T8PA 3X1XA 1JDZA 1YJ5A 4CM9A 4OY3A 1FFDA 1I7LA 1F6DA 2Q3CA 3A9UA 3IJEB 1SWVA 3MWYW 1O5IA 4GGPA 1RKBA 1NVWQ 4JNCA 2R86A 4K6OA 1CJKC 5TX7A 4BE7B 1C0KA 5AIBA 2BGGA 3EZFA 4GKJB 2J4CA 1QU3A 3CIOA 2DQZA 1EM8A 4KOEC 5F9MA 6REQB 1N3IA 4EM6A 3NS7A 4E2XA 3VPAA 3D6AA 4DR7B 1RD4A 4OLFA 4D9BA 1T5LA 4AXXA 4DR5B 2GNAA 1ORWA 2WWFA 4WOJA 1W5BA 1ZOPA 3D3NA 3DMFA 5FUXA 3JQFA 3WNQA 4AMBA 4WBNF 3LGXA 5JJKA 2FWBA 4QRDA 1QUEA 4TZKA 1T5TA 1VJ1A 5F7XA 5IYZA 1CY8A 3OD1A 4GI1A 3ENNA 2WKQA 3H2SA 3HJHA 5DM60 3MWDB 4LYFA 2X86A 3T5AA 4WFKA 5AM1A 3P2KA 5JSQA 2WSMA 5KOHB 3IEXA 4M89A 1ADFA 3T1HB 1SKYE 4TRJA 5K0EA 1FVOA 3ZHOA 2IYQA 1UADA 5E4JA 3E3MA 4PO8A 4BNUA 4BCCA 3IAS6 5CK5A 4YRIA 3GGDA 3GNLA 3U26A 4OYYA 2POQX 1H85A 4B8ZA 1G21B 1Z73A 2GD1O 2J46A 2XA9A 4HLQB 3AM3A 2VP4A 4L9SA 4N7BA 5DM1A 4A6DA 2ODQA 5K8IA 4C4TA 5DZSA 2COKA 3LDGA 3NJ8A 3ZJ5A 4DCSA 5KC8A 2FG5A 5ICEA 3HN6A 4YY3B 4Q48A 1D1TA 1K7YA 3M6WA 4Y67A 3ROEA 2AKEA 1YCGA 3OBBA 5EIWA 2AYZA 3RLFA 3UHAA 4EG3A 1SY7A 1DJNA 1THZA 1X7GA 5KWSA 1OH5A 3CSUA 5IW8A 4CTJA 1B00A 4IHKA 2PMFA 4NCAA 1NQ5A 2FPUA 5AQEA 1S2NA 1Z6GA 4ZV7A 3T52A 4FXOA 1UC5B 2W5UA 3HY4A 3PQEA 4R71A 3EQZA 3EGWA 4WVFA 1D4AA 1GRRA 1ZM4A 3L06A 2AFRA 3O83A 4N3NA 4NS4A 5IHXA 1RS0A 5HF8A 3A9TA 4KIFA 3DP9A 2C0QA 3A1UA 3O3OB 3X0DA 2O0KA 1OYVA 4OAOA 2VDOB 3ZDRA 4CF3A 1LI5A 1JTVA 4IUDS 4BNHA 1V37A 5GTDA 3G0HA 3FNGA 1JSCA 5COAA 2G7MC 4L0CA 4QBTA 3N8NA 4D9HA 1WB5A 5TF4A 4WADA 5H70A 4MRAA 4CL0A 1S01A 1SXQA 1L6RA 4H4DA 1JF8A 3TIGA 1OX4A 2AN4A 2GPSA 3ZV4A 4D9EA 3ZE7A 4RJLA 3WLJA 4YDQA 3CNEA 3TFQA 5ITSA 5JNRA 1RP7A 3KS9A 1ZGZA 2XRZA 2VPQA 1MEEA 3CR7A 3V8RA 1R4ZA 4V0OA 4XJTA 3R5TA 1NM5A 3EB9A 2VHTA 4UTVA 2BR3A 1EIWA 4YX9A 5IAEA 5JEEA 4I4TF 3N2ZB 2I22A 4J03A 4MS3B 4Q21A 5KNBA 3LZDA 4Q4LA 5FEMA 3IQFA 1J42A 4WOPA 4JOBA 3UHPA 4E32A 2AQHA 3FVVA 4RLQA 3C98A 5FV7A 3VV2A 3L7AA 1KP3A 1WKBA 3GH3A 4H1VA 3RTGA 1BMFD 1O89A 4IBOA 2D5BA 3WLQA 1U1CA 1XNHA 2OFXA 2YW9A 3DEAA 1FTNA 1FBTA 2HV9A 2IEAA 3I2JA 4G56A 2BEJA 4JLOA 2NQ2C 1UBEA 3I2KA 3WNVA 4AF7A 4UUMA 1AKVA 1USGA 2P9QA 4DIFA 4TVSA 2P1DA 5J4KA 1XRSB 1E2QA 4Q4HB 4I4NA 2XGJA 3UWSA 1TM4E 2JGRA 2OPHA 3VR3D 4ALNA 2G82A 9LDBA 2F3UA 3TNFA 3UCEA 4RIGA 5FFMA 4K6CA 2HCBA 4BV3A 5JE8A 2Z04A 1GU7A 4HDMB 4NBRA 4DV7B 4URXR 3X43A 1KSHA 2VDKB 2N0SA 1DRJA 3A4NA 2ACEA 1G64A 2WUDA 4ZAYA 4GT1A 1EFRA 2E5FA 1RVDA 4NBLA 1CETA 1NKSA 4HGRA 1N2BA 4PGGA 5HCIA 5FOWA 3T5PA 2N75A 2QM7A 3NGLA 4HNAA 4TKUB 1D2HA 4JOCA 2M2IA 2PMWB 4YDHB 3JAWA 4N3AA 1UQTA 5LDDC 3ESQA 1N1MA 3NBZC 1SA0B 5GM2A 1SZCA 2DOKA 4YCBA 1EXVA 4BNZA 3BAFA 3PI7A 5EE5B 2GFHA 4HEA1 3Q12A 1RWVA 3A3YA 5ALYA 3VR0A 2FR8A 1UKZA 2QU8A 4GMXA 4TS1A 4MA4A 5TMEA 1Q0SA 4TMTA 1E98A 4OJNA 4BU1A 1FJXA 1GA6A 5DNVA 2I6QA 3BMXA 3V00A 1KS9A 3V6MA 3J81A 3FXAA 5SY9A 5B7NA 1THTA 1R0LA 4AZTA 1RFGE 1Y1PA 2QS9A 1GKKA 3PDHA 2W6JD 2NNLD 5BNIA 1HYGA 4QEKA 3QUBA 1A1VA 2Y1OA 5JD6A 5FP0A 5CXSA 4C0SA 2CFOA 2YS6A 3QE0A 1P9OA 4X7RA 1UWKA 3C5WP 2XMRA 5A2QA 1R37A 2E5WA 2GFQA 3A6LA 1XD2A 1GKYA 3IURA 5FBKA 3RRFA 4B4DA 4IRXA 1HNXB 2O7SA 1USKA 3EPPA 3E3OA 4KU4A 4NESA 4AK9A 1K8XB 4K9DA 3NT2A 4QRIA 4DY4A 4LHSA 3MQ4A 1Y6FA 1BWQA 5HXAA 1FFAA 3IQGX 4MKXA 3S5JA 2VDWB 1XT6A 5FYQA 1UP6A 2XGOA 1K8RA 1Y5LA 3K96A 5CHYA 4EPTA 1MXFA 3OVMA 2C4UA 3VVLA 4BO3A 5KWJA 4L5CA 4LC0A 4HQNA 1CY6A 1Y1TA 1ZXXA 3AR8A 3FFAA 1P29A 2J5RA 2O2CA 3HK2A 5EZ5A 4JQCA 2Q3JA 4GKKB 1NVEA 2R6CA 4JJ7A 5IC5A 1U2RA 1J2TA 2JGAA 5DTEA 5A6VA 3IULA 4RUKA 2GZ1A 5KSWB 1Q16A 4ZPJA 3TR5A 5F1KA 2ZWIA 1UZUA 4JUDX 4Q7QA 2QTZA 1CFZA 4YQYA 1KSJA 5FV4A 2O8FB 4I81A 5IC6A 3G8BA 4PQGA 2Z6QA 4Q7JB 1UDRA 3GGCA 4LX8A 3D7MA 4M7PA 1I1NA 1TM3E 1I9GA 4JR0A 4LWQA 4P8RA 4DRXB 4HVCA 1ADGA 1I1OA 2XV1A 1QRSA 5ALXA 1OIVA 4W9NA 4X3PA 5M2QA 1V48A 4MTLA 1PS9A 2ATXA 2H2GA 5EZYB 1RWXA 2JGLA 1KJQA 5KVCA 3W2FA 1Y1SA 4YEDA 4IDFA 2CHUA 5B5SA 1LTHR 2PBZA 2VXOA 3LUKA 2OFOA 4P92A 4G5SA 3HLKA 3VHXB 2AMFA 3PHLA 3R5HA 2ZYSA 4JI1B 1NPTO 3BHMA 1OLUB 4FFBB 3F98A 4EKDA 1AOXA 1ZVJA 4DKJA 1O57A 3EHEA 4IIYA 4GC5A 4F71A 2Q4DA 4HDNA 4MV4A 1UK6A 3H6HA 3IELA 3AGPA 4GS5A 4Q03A 2IHNA 2WQ7A 2GPBA 5DSZA 5HKAA 8MHTA 4RXTA 1AXRA 4QYIA 1IMJA 2GXSA 2NWQA 5J47A 1IZYA 4Q4CA 1V71A 4EX6A 3EZ2A 4CM4B 4DC1A 1SZPA 6ABPA 2YN4A 3R7NA 4KACA 5AVZA 3CF0A 5JVDA 1V3TA 5AI0A 1IN4A 1L4YA 4MZXA 3D2CA 4MO9A 3P96A 4JI6B 5BNWA 4KR6A 4LTMA 4WY8A 3K9GA 2B2XA 3A2LA 4Y9RA 1QWSA 2J3QA 3DWIA 3WV5A 4DFDA 1NNUA 1N6HA 3H5OA 3M81A 2PX0A 3QVVA 3VC1A 2HZBA 3BDVA 3GROA 2Q21A 2VHCA 4DV5B 3RC8A 3QVGA 1T8TA 3JWGA 2FMHA 2Y0EA 2P2SA 3N0TA 1GA1A 3OZSA 3O1IC 2CB9A 2F8MA 3EA0A 4C07A 3Q5EA 4C20A 1JDNA 1MEJA 3C4JA 4QULA 4QU5A 3FIJA 4PONA 2C94A 3W78A 1YS2X 5IJZA 1EK0A 3L7NA 2BEVB 5CLQA 1A7KA 3PDIA 1XN4A 1V8DA 3QX8A 1OAOC 4HX5A 4NBSA 3INYA 4X95A 1DHTA 4LQDA 3TRJA 4BWGA 2PSJA 1ODLA 3LXUX 1ZNWA 3G23A 4LZZA 1PQWA 2H57A 3FY4A 3EULA 4DAOA 5DYIA 3UAYA 4N48A 3WHLA 5KTRA 3LDAA 1DL5A 5I9TA 2EFJA 5LL6P 1X39A 4J0FA 3HKBB 1W19A 2ECFA 4EG5A 4CI9A 1D2MA 3DLTA 2VH5R 1CNEA 1XLUA 5IRCD 1G5QA 3AB8A 1AGXA 2GBLC 3JVVA 4QDJA 1E7QA 2DKNA 1XAJA 1XIVA 4YV7A 4H08A 2B5WA 1RAFA 3OCXA 1ZM3A 1GGEA 3IHWA 4ARSA 3OFNA 5L3VA 2W6NA 2YH2A 1AXEA 1QRDA 5JIBA 2I7XA 4OEHA 5K8TA 5EUBA 4JITA 1G59A 3IQHX 3P45A 3K71B 2WAXA 1D2RA 1TQ6A 4FCVA 1PFYA 4JROA 5TT1A 2D1SA 1G8JA 3P97A 4AZ0A 2QNIA 3TMKA 3JQAB 3FCCA 1Q3TA 2H06A 3PGMA 3AVPA 2WFMA 3MJDA 5KREA 2BGUA 4RCVA 1O94D 5HILA 3UAVA 4C0HA 5JYBA 1IHUA 1Y8RB 1NI4A 3A3OA 3EGDB 4EGFA 2EKDA 2G76A 2GARA 2ZI3A 2O7VA 2VSFA 4GOOD 3OMWA 4LJYA 3SDZA 3WWOA 1LDGA 3HADA 3EOZA 1HNZB 1JG2A 3VV3A 5DEOA 4ZHQB 3KP1A 2Q1SA 3V1NA 1U7PA 4A0HA 1QFSA 1N5RA 3GQVA 3AONB 1G6KA 4F60A 3GFFA 4KMRA 5TR9A 3F6RA 1NQTA 1IN7A 4CW7A 3G0CA 3WKBA 2A59A 3T54A 1J8MF 4ZQFA 5JADA 4ABTA 1H5NA 1TEVA 2C3YA 5LXTB 1ZVKA 3HP1A 2J07A 3FFWA 3W6OA 3ZWAA 4ETMA 4B3SB 1DC8A 1RQPA 3AEZA 1WHTA 3TDKA 1TYAE 4AVYA 3E2PA 3SSOA 3K16A 1GGVA 4UMDA 2ZJBA 3ROFA 4GLOA 1CHNA 4P82A 2JARA 5LBIA 2YNMA 1KEEA 5HRUA 3H9GA 3CCBA 3RSHA 3UZUA 3FCSB 1G20B 4MUNA 1UMCB 3SMVA 4QGSA 1XGKA 3KSUA 4UHCA 1DAHA 3ONEA 1P77A 5B64A 4FKZA 2ZI6A 2X9VA 4YS6A 4YC7A 5EKSA 2GN6A 3K32A 2OHOA 1U9IC 4K9RA 3AFMA 1XWIA 2HH9A 5LA6B 3UXYA 1J5PA 4BGUA 1F7UA 1LLFA 4N0MA 1T15A 2FPSA 4Y7DA 5DW3A 3ZHVA 4WACA 3KFXA 3IUEA 3VJMA 3DEHA 1DJLA 4GI7A 3WLMA 3RRXA 1H9CA 3R3SA 1U9ZA 2CMDA 4KL8S 4XCXA 3I2IA 1C3VA 1KK3A 1Z4LA 3PT5A 4I2NA 4JBWA 4P93A 4U39A 4P36A 1KYIA 2WU4A 1KDRA 4F3TA 4J3NA 3TLBA 3RBXA 3KD3A 3QE2A 8LDHA 3JALA 1ORTA 3O95A 2O1XA 4BN0A 1X13A 1BJRE 2IVZA 5T64A 3GLKA 5M29A 4V2IA 3A7EA 3RU9A 1PG5A 4HQRA 5L9AA 5LUAA 3HJNA 3D7LA 4IL5A 1TU4A 5IG2A 5ALGA 1ZICA 3LU1A 2QX8A 1PQPA 2HIHA 3C6YA 3CH7A 5DASA 4EVRA 2QAIA 2PY6A 2D2VA 4RY8A 1KO7A 2ZRLA 2D0IA 3D1JA 4HQ0A 1KAOA 3EXHB 4PVCA 4Y2YA 4D9CA 3EWAA 4X64B 1FFHA 1IUPA 1NOKA 1C0EA 2WOOA 4HWGA 3TLKA 2HA6A 1N7IA 3HYTA 1GQQA 5KYVA 3EIOA 3CVJA 4OP3A 1KNXA 4BLPA 2VYQA 5LZ2A 2ISCA 4R1QA 3SC3A 1FXSA 4NAUA 2ZJFA 2DT8A 4DMFA 5C9ZA 3T1YB 3HKCA 4PCLA 2OO5A 3NHFA 4G5OA 3LFUA 5IJ0B 2X8LA 3DC2A 4TZ6A 2HPVA 5ICCA 3MTJA 2ORED 2AN3A 3L6CA 4J43A 4RHUA 4R1NA 1O03A 3QP9A 4GE3A 1BFUA 4Z0PA 3FWYA 4DY6A 4D56A 1PDWA 5HWSA 5AKEA 4XSGA 1YV9A 4R8VA 4U00A 2KX7A 4WXRA 5DYNA 3IVCA 4L6AA 1V1JA 3NXSA 2O0HA 3ZPXA 1XYVA 2FN3A 3DE1X 1SCBA 4MLDA 1DAGA 5BMVA 5JAQA 4A0QA 2PH7A 4QE3A 2BFEB 1NUSA 3AERA 3EDRA 3NBAA 1IB6A 4YQZA 2QQEA 5J2TB 1IWBB 2XMGA 4W82A 1NSFA 3AEYA 1RZRA 1AUQA 3GMSA 1VKJA 2I2XB 5LBTA 1KYYA 3VR5H 1C4WA 1GT6A 1I4DD 5JAIA 1MDFA 2I9PA 4IG9A 4QOHA 2GETA 2V58A 4NL4H 2IWHA 2C2BA 3OIWA 3SJCA 2XUAA 2HRQA 2V7PA 2ZUDA 4LK3A 1JDTA 4U7GA 4CDMA 4LJLA 4EHIA 1GITA 2QD5A 2QWXA 2VLBA 3LQ4A 2L42A 1ESCA 1CXZA 1JE0A 3AI1A 1Z0AA 2BGMA 1TTHA 3IX7A 3R0QA 2WD9A 4V0MA 5AJHA 4AI6A 4HEQA 3QFRA 1Z82A 4HYTA 1LKZA 4EF5A 2V4MA 1O6BA 4WT7A 2AXPA 1HOTA 3VMFA 3G7NA 3PUHA 1PKXA 1U7WA 2VSNA 2C7GA 3QSYA 3Q7SA 2ODAA 3WLSA 2Y1EA 3BHIA 13PKA 2B25A 4H3KB 1I01A 2CLOB 5EXTA 2IHBA 1HI9A 3U56A 1PNVA 5G0WA 3KKLA 4RDIA 4Z5XA 1W87A 2DFLA 2XXAB 2W93A 2DLDA 4Z99A 5LMUB 1NLUA 3NMUF 3VR4A 1T3LA 2YHUA 1AU9A 4FFPA 1PT6A 1SXJB 4P3YA 3T7SA 3WV4A 2D8MA 3S7TA 3QTTA 3N2GA 3RFXA 1LWNA 2G9UA 3OPXA 2JFUA 4LGCA 4MQBA 1RPAA 1P44A 3JWEA 5BR8B 1RYBA 3KDPA 1BXZA 4L9WA 2NQ8A 1AB5A 3LHFA 4BQPA 3N8IA 3COWA 1C9JA 2ZAYA 1PP4A 1MW9X 1U1GA 4IIHA 5HJ2A 1LCIA 5A05A 1KP9A 2NYVA 1KQPA 5DNCA 1YDGA 2OB2A 3ADOA 3GW8A 5I8ZA 3GNSA 3W2EA 4BKQA 1FXWA 2VDQB 4KIGA 2N9UA 2ORVA 3DEJA 1F9AA 1IBCA 4CMEC 4MJ7A 5A9SA 1RLIA 3K6SB 3RWBA 2PL1A 3ANTA 5EQJB 1GGFA 2FFHA 4X91A 4RAQA 3MJHA 5AFSA 5HM6A 1C14A 1QIIA 1Y82A 5CLIA 4Q1AA 1ZXLA 1R6TA 1T3SA 4Y98A 3UENA 1L5KA 2RH9B 1ZONA 3U5ZB 3ZE2B 1GPNA 5EXPA 1T6ZA 1YQGA 4YAOA 4YRJA 3WGIA 1L8AA 3O47A 1LDNA 1MC8A 3VZRA 2A86A 3MMSA 4RC9A 5KTMA 2LNDA 4IGAA 4PZUA 4JH0A 2VFAA 5CIWA 4TROA 4EBFA 5DLDA 4X20A 4XIIA 4DUYB 3L41A 1BS9A 3EG9A 1TYDE 2CVOA 1B42A 2WJPA 4KR0A 2FUKA 4P4NA 3R7WB 3ERCA 1FP2A 2ZRJA 1DV1A 4OA5A 3VR1A 3Q8MA 3AY6A 4LF8B 3JS5A 4LZNA 5DLQC 2VJDA 2ZYRA 4JI5B 4OI0A 1NLFA 1BGXT 4M2LA 4RTJA 3L1UA 1TUGA 1ES9A 4NAHA 1TUBB 4QBIA 2ZZNA 2WHPB 1LZKA 1UBTS 3EZ7A 4O4JB 4OUDA 4R9VA 4ZT4A 1FUIA 1Z68A 3HU2A 5IDQA 4OX9B 3AYZB 4TV8B 5JQGB 5IK2A 1SU8A 1CEEA 2V97A 4W9RA 2RFLA 5A62A 3FFTA 3V55A 4YRPA 1Y4ZA 1X7WB 2AYYA 5F4ZA 1CUBA 2J48A 3K2EA 5CGZA 3WDLA 4EENA 4E5YA 1CQJA 4ZV4A 4WAUA 2R5WA 4ZDKA 1C1DB 1E92A 2BI4A 1L5GB 5C52B 4JP2A 3IRVA 2Q5EA 2PMCA 3IA2A 3QKRA 1JHXA 5ICGA 3PEYA 3R4CA 4YRSA 1DCKA 1FYDA 2HCFA 3P20A 1N0WA 1P3DA 2YWFA 1G5PA 3ZWYA 1H22A 5A4DA 5CB8A 4I6JA 1ZGGA 5FO1A 1NASA 3AF6A 1W4AA 4UUQA 2AI3A 2UVPB 3ID6C 1I3MA 3JQCA 3SZMA 1UBKS 3Q2IA 3UVEA 3W1WA 4EG6A 3QQ5A 5CCEA 3SWWA 4F6RA 4QT0A 3WNBA 3RROA 2IEIA 1LVGA 1ZNQO 2QL5A 2ZRFA 3WOHA 4C04A 4C29A 2Y77A 1CR6A 1DP4A 4B46A 4DA6A 3E70C 2X0DA 3FTPA 5D3KA 5CH5A 2G5PA 1XLVA 1XHFA 5H3LA 2OAQ1 2IOFA 2DR0A 3OFSA 4L4ZA 5ALVA 4RXUA 1AHPA 1SPBS 1QIEA 2PG3A 4HYEA 2WHEA 1KDZA 1I33A 2CDAA 1P4SA 2RJNA 2TRSB 4NMHA 1SZJG 2R8BA 2FEPA 2X1LA 3L9XA 1MGPA 3LT0A 4M38A 4TL6A 1H2HA 1ZHOA 1FYFA 2YZKA 2ZRPA 4ZEVA 1ANKA 1GM5A 2AKAB 4FFSA 3MOGA 4Y9SA 3KEMA 4OD0A 5DJ5A 1Q1BA 4YLGA 2QV0A 1OD6A 2IYPA 3RNLA 3UA4A 2KBFA 4RU1A 2CXOA 3C3KA 1CVIA 3THRA 1WAMA 3GFTA 2FEKA 4Z86A 4B4VA 3AU9A 3I2HA 2BFBA 4PYIA 4TS4A 1LDYA 3IKMB 4N5IX 1E6KA 1P7CA 5L7WA 4MIOA 3CZPA 3FPAA 5JSKA 3KQVA 3D4BA 1T36B 4K81B 1I94B 1CRQA 3PIRA 2DH6A 5E4YA 3LVQE 4JYCA 2WPDD 2EVWX 3DTVB 3GAFA 3NFRA 4IQ4A 4ME6A 3SXJA 3MA0A 4ZK6A 4WOKA 1ZK0A 2VDNB 1ZRNA 2N46A 4KR3A 3DW1X 4GP9A 4XW2A 1GPAA 1W4BA 3GG2A 4YGYA 4DLWA 2GF0A 5CAEB 3RWMB 3R9XB 1UDBA 5EXSA 4IVQA 3C6MA 2IZ5A 4R1TA 2XWQA 3C39A 3V7WA 4YR7A 1Z7GA 4YMLA 4J0CA 3ZXXA 2IVFA 4NE9A 4ODIA 4XQEA 5FUQA 4QPCA 2O3UA 3PGLA 3A7DA 5EN4A 1HL3A 3EZ6A 3KYCA 3SC2B 1WBBA 1H2YA 1HZJA 1TEXA 3WADA 4JC8A 2CC2A 5A04A 3EEBA 4H3VA 3HDYA 3HI4A 3A05A 3WWEA 3ZVMA 1CR2A 4KXNA 4L8WB 1W581 2OYCA 3VDQA 2PGJA 1QF6A 1M75A 3GLUA 5AUPB 5DVZA 2E2WA 2JA1A 4PWZA 2IODA 1UUFA 1DIGA 4RYDA 3ZE8A 4J7AA 4LF5B 2O8DB 3B2EA 4DREA 4AJ9A 4R0NA 4C06A 3W9YA 1MAHA 1KP2A 3D6VA 1OZHA 2O2IA 1QFMA 3ZD6A 1DKOA 1TD1A 2ZUBA 3C1AA 5LQCA 1L4UA 4X66B 1FFBA 2BFMA 2CL7X 4RCZA 4JQYA 4W63A 1KPHA 1SFRA 4YCDA 1W36D 2W58A 1CZNA 2JGDA 4IVNA 3ZV5A 4UZFA 3PGJA 2JIOA 3L6DA 1KAGA 1PG0A 5AXAA 3VKWA 1I2AA 3Q5GA 4YQFA 1GPH1 1D9ZA 3N6XA 1H4SA 1ETHA 4OBXA 1PX2A 1OGYA 3VU9B 1CUJA 1RI4A 3AIOA 4AS3A 3NUZA 5FNVB 3TRHA 4LGMA 3TLGB 4HB4A 2GJSA 2Q0SA 1FP1D 2QPTA 3CBGA 2X0RA 2H59A 4NQRA 5E38A 4AJEA 4MPJA 1QH8A 5JYCA 1F4PA 3ABIA 4J1QA 3X1JA 2JK1A 1XG5A 3BORA 3G2KA 3OX4A 5CB0A 3OP4A 4UEOA 3JQAD 5B55A 3BJEA 3GT7A 4F56A 2BTEA 3IVXA 2G71A 3NU1A 5EJEA 1K3UB 3GEIA 1J7JA 1N9GB 3SJZA 1EUZA 1NPYA 1QMPA 2BKVA 2EKZA 2O52A 3I64A 5DHAA 2VEDA 4DMHA 1POWA 3AW8A 2FPIB 4B43A 2FPKA 4AN4A 1LPBB 1M9NA 4BECA 2BV3A 2HK8A 3KXDA 2V1UA 1TQDA 3B6ZA 2XE8A 2C4TA 1GTMA 3LUAA 3MBKA 4O4HA 4R0VA 2FXVA 5E3JA 3OPNA 2RGGA 3QVTA 4FONA 5CT8A 3LBHA 2W22A 1NN0A 3KCQA 2VF2A 4TMWA 1TYZA 5K9ZA 2NYUA 1ICEA 2JLYA 3OCZA 4U7FA 5HMLA 3VO1A 5T67A 2G5TA 3JWIA 4LYGA 3USZA 1BWPA 1PUJA 4DJTA 4UMVA 3QX3A 3P4UA 3W5SA 2AG1A 4FCCA 4UTRA 1DGQA 3H9CA 1U8XX 1QGUB 2AVDA 1PK9A 2F64A 2BRUC 5JBQA 4FNGA 4H1HA 4Q01A 4BUZA 3C45A 4MROA 1Z17A 3NBXX 2QJRA 3RIYA 5IJWA 5IKPA 5JSZA 5B58C 4G0UA 2NIPA 3ILHA 2CSUA 5CFZA 1AKWA 5HM8A 3ELWA 4TYQA 4Y2UA 4QNNA 2FX2A 3C5CA 1EEHA 3NOXA 4UU8A 4RF3A 1LTQA 2WM9B 3I92A 3OKFA 4ASUA 3NALA 1YE5A 1Z35A 3ZQJA 2A0KA 1ZZEA 5JXWA 2JAQA 2EGGA 2ZBGA 2HEIA 3PIIA 2NO7A 4QXQA 2OQVA 3C8MA 3RUDA 1Q19A 4ZHSA 4RTMA 3WKEA 1KBZA 1SEPA 1H8HD 1OGJA 1ZO8A 2QNBA 3V4OA 1GXSA 3AM1A 2LCQA 5AHKA 1YJXA 2CLIB 4WZBE 1HMPA 4YJFB 4C87A 2B83A 1RABA 2A9VA 3GVIA 3HCBA 4YCSA 3EGIA 3QMMA 1C3OA 2ZJOA 1DCTA 3LK7A 5DPMA 4QPDA 3FIUA 1C0PA 3H11B 4G0OA 1DEHA 3MPUA 1B7GO 3QLVA 1GOTA 1M5UA 1XKQA 2EWWA 1XAHA 1CP3A 3GXBA 3JAKB 4J2TA 4YT5A 1E4OA 1R88A 1UQRA 1IU9A 3E3NA 4JT9A 4RMNA 3KKQA 1U02A 2XUFA 1CRLA 2FRDC 4JR2A 2X0EA 4MKIA 4IHQA 3V4LA 3EFOB 3EH1A 4G9BA 5FAKA 3Q6MA 4QXPA 3E3AA 3WKAA 2O2DA 4F12A 1MAAA 4X8HA 3ZJVA 2JKZA 3L3BA 1W73A 1KAHA 3A3PA 1FZQA 3JTEA 3PJGA 1D03A 3OT5A 4LEIA 1QZXA 4PCAA 3RHTA 3ZCVA 3KOWA 4BUJA 4HX9A 4D79A 1WTAA 2ZUWA 4GUDA 4ENPA 3EDOA 1JN0A 1YU6A 2G28A 1HMYA 2IPXA 4D3SA 4EYKA 1YB7A 4XYLA 2PEZA 2JLQA 1C8LA 1D8TA 2CBGA 5KKAA 1GSOA 2X1HA 1YFLA 4A8TA 2X1MA 5A6SA 1KVTA 1N2OA 1YULA 3DKPA 3FYHA 3HYLA 2G9RA 2C5BA 2X4DA 4IWXA 3AWDA 3FBTA 2GK7A 3PCXA 2MCFA 4WE3A 4YAUA 1OLSB 1SPXA 2DUNA 2Q6TA 2QP4A 4G09A 4ANFA 1URPA 1CWUA 1OXSC 4FP9A 4RV9A 1V7QA 4K9OA 2A7XA 2ZSAA 4HXGA 3C3BA 4KSBA 5AKLA 1L1FA 5JJ5A 1NRWA 2BOVA 2NXJA 3FOEC 3P9ZA 1DOZA 3RS8A 3TOSA 1E18A 3OAAD 3NHWA 3R0ZA 9ATCA 1ZL2A 2HSWA 2AT1A 5AM0A 5JJBA 2F1JA 1EDDA 3KJXA 3O8QB 1SBYA 4XVCA 3G89A 3R3VA 3ULKA 5HIKA 1KY5A 3HP7A 4MJXA 4QUIA 4WINA 2BGRA 4LYAA 1EDOA 5I47A 3PPIA 2P5SA 3J7AC 2HIGA 3QXCA 2WJZB 5C7YA 1IDOA 1BQ4A 3V42A 2DHEA 4WKGA 2VZ9A 5E9QA 4AUMA 1AB6A 1UPBA 3P2YA 1AC5A 2IYZA 3LCVB 1W85B 3EXIB 1XMSA 1V9CA 4DBLE 4BEBA 3P9IA 2EFHB 2QVYX 1NU6A 2R1VA 1ZQ9A 4KBGA 2HLDA 1ZD9A 3AO0B 1Q91A 4BX8A 2WFLB 5FXMA 4GLFA 4DAEA 1EE1A 3IKLA 1IH8A 2K7ZA 5EIAA 2D2IA 2YQ5A 1T9GS 3WFIA 1VECA 3A2MA 3ROPA 3VSAA 5THXA 5C4IA 4OQYA 4CEHB 2WU1A 4RELA 1N2XA 5ARCA 5AD1A 3ELDA 1QVZA 5KIAA 4BNKA 4DNQA 1G60A 2ZI4A 3A0UA 1SXJD 5TPZA 4D4IA 3ZNNA 1XK7A 1ONSA 3COSA 3KPYA 4P22A 4MIEA 4TXLA 2EFDB 4UNSA 4TMYA 3T3MB 5KOJA 2A9QA 4R05A 3RPEA 1TA9A 5FQNA 3E9YA 2HC9A 3OCJA 4OHBA 1B8NA 3OC0A 2J7PD 3ELYA 4L5YA 4NY1A 2D7DA 1TJYA 3IKJA 3VZPA 2ZBVA 3KE9A 1W0KD 1Y3FE 5KVSA 7YASA 2NO5A 5B6IA 3T4UA 3LYLA 4Y2HA 1BRTA 4AJPA 2BYTA 1SH7A 4YUXA 4RULA 1T24A 3A6JA 2OBYA 4B6FA 3BMNA 4FDTA 3MLAA 3HYNA 2AE2A 2B20A 2DH5A 2IZOA 2C2OA 2LP4Y 2JVKA 2G09A 3UIEA 2ZYWX 3FHLA 3CLTD 4PZ9A 2JIBA 1C30B 3W9BA 4NNPA 4Z4GA 3DNMA 3AVWA 1H3EA 3E9QA 4A3SA 3WJ2A 4NG4A 3AKZA 2P40A 2XUDA 2Z58A 3GG9A 1R2QA 2WD7B 4I5EA 4JB0A 4TWJA 4WZ6A 2Q0XA 3FUVA 4MR8B 4P98A 4OGGA 1YRWA 4JC5A 2DAPA 4URVR 4EITA 1FOEB 1NDQA 5ADWA 2AZDA 4HNQA 4H18A 2OXIA 3D2AA 4HDAA 2E21A 5AW0A 2KMLA 1S3IA 4CETA 1Z2PX 1ESZA 2R4QA 1X9IA 1FJHA 5B4UA 1VPEA 4X1IB 3SBOA 3PCRB 1A5AB 5ALNA 5JW6A 4Q7EA 3PR3A 1E99A 3O84A 3D5QA 2I65A 3CPEA 3DPIA 2PPVA 1J00A 2P1ZA 3FW1A 1DXHA 3DFIA 4HRXA 1DEOA 3R2JA 1QKIA 3LUFA 5A7FA 3OICA 2HRDA 5BQ3A 1NXXA 4DLLA 2QXYA 5J23A 2AF4C 1XZJA 2VO1A 4FFLA 4PAWA 1HV8A 2QZ4A 4YCMA 2ZYGA 2JLXA 3M4XA 1KO1A 2OD7A 3P26A 2ODPA 3ZBPA 4FOOA 4YH1A 2A0WA 3NEAA 4WCVA 4UHBA 3EZLA 2O14A 1SBIA 3V2UA 1J4AA 2I8LA 3C14C 2O6LA 3HY6A 4L7VA 4FNOA 3D3WA 3DHNA 4HQKA 5BV7A 3UYKA 4YMWA 3W3AD 3QV2A 1UINA 4NZ9A 2FUNB 4XZ3A 5IS2A 1CF2O 4TTQA 2PLAA 3K09A 3BGIA 1R9MA 3OTHA 4O2BF 1NJ2A 3IUYA 5JAZA 2B4TO 3IP8A 1G4AE 4GPIB 4CKCB 1NVVQ 5DHPA 4B9EA 5BVHA 5EHXA 1X7ZB 2DVMA 2B61A 1ITZA 1UBUS 3OEYA 1KYTA 4OKNA 4XFDA 3DC7A 3VYUB 5L3QB 2I0FA 3K30A 4EJ6A 1W5FA 1USWA 2K4MA 4HNGA 4CDGA 3WWYA 4EY5A 3OQPA 2RD2A 5D84A 3RSFA 4ZVKA 1I4OA 1JHOA 1MJ5A 4RPLA 1RKVA 4C9BA 2CF6A 4NDNE 2CFSA 1WHSA 5CLFA 2HMTA 4QPZA 2IYFA 3K9CA 3C3DA 4KYVA 5BN1A 4KMSA 4K7JA 4DEVA 1D07A 4MIKA 1PR1A 3G8AA 2ORIA 3HKEB 3PI6A 4XIFA 5DO9A 4DJEC 2V0CA 2NZXA 2PWPA 2QRPA 3E0QA 4HDOB 4NEQA 5L4LA 3THWA 3P0RA 1JPJA 5BQ5A 2K87A 2DU8A 2UYCA 1CX9B 2WSSA 3MTIA 4YDSA 5K2OA 2EX1A 5L8VA 4LF4B 5JCZA 2VNHA 4DR1B 2HWWA 4KVAA 1YSCA 3I42A 4HWRA 1XX6A 1YKGA 4HL6A 2MYTA 4TRNA 4WCFC 4IJQA 1C8VB 4RNCA 4CIYA 1F17A 3FGZA 5U4XA 1NL3A 4C5CA 4CVNA 4Z7NB 1BE8A 1A97A 4LKRA 3K4PA 2GPAA 3KZKA 2QAJA 2J85A 2C5LA 3DOEA 3ET5A 4IJWA 5K3EA 1PZMA 3ZWXA 4HAXA 2PWYA 5AO9A 2J6IA 5FBHA 1NP3A 1SGWA 3A9CA 4QVIA 3C3PA 5ALTA 1JA9A 3PQFA 4E2ZA 3UTDA 1Q50A 5KVAA 1Z4IA 1FMTA 1IN8A 3N9IA 3EIXA 2PK3A 3HDGA 1KBQA 3NXKA 1KXJA 2ZUCA 1Z0UA 2YJNA 3A36A 3DTVD 3LQ2A 4J7CA 4L95C 4C0KA 2GCOB 1R50A 3E53A 2FMXA 5BYAA 2G0NA 2AG0A 3AF0A 4ZYVA 2F43A 4EY7A 2CDBA 2MDTA 1ZD5A 4D9IA 3IMKA 3LL4A 3Q9UA 3KQHA 2OL4A 4KYIB 3IV7A 1RIIA 4X44A 4KFCA 4N65A 5AW6A 3A1EA 1QG4A 2I67A 5JG7A 3WIOA 1P62B 5JWHA 4BQSA 2WFZA 5HX7A 1H42A 1JXQA 1HLGA 3FYUC 1Z4QA 4P33A 3S2IA 3D6JA 2HJGA 2J0EA 2PUTA 3S8MA 5JEDA 1ZGCA 1U8UA 2DWUA 4H59A 1BU5A 1XXLA 4HVLA 1THMA 3DVAB 2HGZA 4TMVA 4W1QA 1N5LA 1IVYA 2ZG6A 4MS1A 5EAIA 3CF6R 3WZ2A 1ZITA 2QF7A 3AR3A 4XE5A 1ZW6A 3PGXA 4GI3A 3ZCRA 2XJ9A 1CU1A 2VRBA 3HEMA 3KL4A 3N3BC 1J90A 4EJSB 5C18A 3CLRC 4X8LA 5FA6A 3ZGYA 3DMDA 3QOWA 3FRHA 4ZN6A 1UBLS 4FYKA 5C7LO 2MYNA 4R8KA 1WVMA 4LMRA 1C9EA 1Z56C 2XDYA 2QQFA 3A10A 2QN3A 4KI7A 2KWIA 4BNDA 221PA 3IAFA 5LDHA 5JMTA 1FUEA 1PJAA 3RVRA 4PFJA 4C0LA 5D3MA 1G2IA 2WMOB 3WGJA 3BZBA 4IJKA 3I4LA 3BWEA 3A9SA 4CG3A 4KQ6A 5KQGA 1TO6A 4JMLA 1SKMA 5D7BA 3WQQA 4XVUA 5KU7A 3AEKA 1Y37A 2SECE 4FFOA 1XRQA 1XVUA 1UKAA 4IILA 5DBFA 1NR1A 1NTOA 4RD3A 1UEXC 1AO3A 2VK1A 3HM2A 2I2AA 4PXYA 1MTZA 2G83A 4XQGA 5KKNB 1WDLA 1YUBA 4L50A 3I09A 1EUCB 3BXFA 1XZKA 4AJ2A 1LDMA 1VCOA 1TM7E 3KELA 4ZEWA 4FHGA 3ZKAA 3HBNA 3HDVA 2R68A 1U4NA 3L7BA 2Q9AA 3EZNA 3ZU4A 4LOKA 1VL0A 3DV9A 5AK3A 3EYAA 1AO0A 1QQ5A 2QG6A 3LJKA 1JAXA 1W46A 3O4GA 2BMFA 2D0OB 1XRPA 3WRYC 2R25B 1Z2DA 3K9WA 5HQ3B 4C7OB 3AC0A 4ZRMA 1L8QA 5K3AA 5DK6A 2E5LB 2VP9A 5K09A 1W35A 1W59A 1ZH8A 3OPYA 2A4KA 3SS7X 4B6RA 4E5KA 5CJPA 3D7SA 4MV9A 5LQUA 1B0ZA 3LPAA 2R6GA 4OK5A 3KT8A 3LUHA 3GX1A 2WV9A 2W6ZA 2E85A 3DZIA 4YRLA 3U17A 5C3MA 2R97A 1N2CE 3IMCA 1EZ4A 3KSDO 1JI0A 4F97A 4WK4B 2QROA 1VXOA 2P2CA 1V16B 4JXJA 4TS9A 1MD9A 3B8EA 3UAZA 5L7TA 2P65A 1H1LA 4MP3A 4OMUA 5KQSA 3GJSA 1FQOA 1BMFA 1DJPA 3OJCA 3MM4A 5FBRB 5J58A 4M9CA 2DBZA 1FNMA 3SN6A 2VYFA 5JH7B 4C4SA 3PFWO 4PFQA 4RHTA 4JLAA 3BKXA 2P3LA 5FA5A 1CRZA 2VZ8A 4IQFA 4KO1S 5K03A 1KY3A 1YRYE 2GZAA 1S4QA 2XOKD 3IP1A 1Y81A 2JJYA 1Z5UA 4WQMA 3VR3A 2XITA 1KI4A 1II9A 1RQXA 1P45A 4DGSA 3JQ6A 1XZPA 4M60A 3ETJA 2BCEA 1L7RA 2Z2KA 4RK4A 3RS4A 3O8NA 3S40A 4OFXA 2IS2A 2D4AA 2D62A 2XYQA 3Q8XB 1P3JA 1ODTC 2EF0A 3D6UA 3T7DA 4UXIA 4Q18A 1KMIY 1L5ZA 4E1BA 3LQRA 2DF8A 2QJWA 4N54A 1OKKA 2YZ2A 4YYEA 5P8WA 1QXSA 3A04A 2XT6A 1G0NA 2WU0A 4GBED 4OKIA 2WWIA 2FPRA 3M3HA 4O2AA 4XB1A 4BAZA 3VZBA 3OJWA 3WB9A 2ZRCA 1QTNA 5EXXA 2FR1A 2X3YA 2FMTA 1I9CA 3L8ZA 4KMMA 1CE8A 2GZ2A 4QU9A 5D51S 4BY9E 4G4SO 1TFRA 1JQ5A 1AF4A 4FE4A 1ADJA 1XMPA 1H05A 2A0UA 2OT3B 3IDQA 2HUPA 4MINA 4X93A 5JANA 3Q9SA 4YT8A 1IDN1 3MWKA 4BLOA 2OTCA 3TYXA 2ZE6A 1E66A 2IZ6A 3D7KA 1PWEA 2OQ2A 1EP9A 3FPHA 4O33A 5K3CA 2W6JA 4M99A 1Z2CA 3WC4A 3ZE9A 3FOZA 3CONA 3HHPA 3GUCA 4FT2A 4JBIA 2ORYA 3O0TA 2ON6A 4PO3X 1WVGA 1MABB 1XFAA 4Y7CA 1ZGHA 4C1BA 1C3EA 1SHLA 1Z26A 2ZJ0A 3AJ9A 3CUKA 4FZ3A 2G5CA 3H6KA 2OPBA 4OMFG 1KMCA 4RS3A 3GFQA 5JFGA 3MINA 5JNUA 3HVIA 1EEXB 2Y6VA 5EE3A 5A02A 4D8WA 5JS8A 1ZS9A 4COKA 4QGGA 4RH3A 4V0ME 3C3JA 1XMOB 4CEJA 1KI7A 1RWBA 3TM5A 3PXXA 5IJ9B 5DOZA 4AZWA 3O94A 2YMMA 4W8HA 4IFEA 1EJ0A 5AKHA 4AJ4A 4BRZA 3WAJA 1CR1A 2CUTA 3GOQA 4WXEA 5AHRA 1VE9A 4NZNA 1UOEA 1JR2A 3DB1A 4CKZA 1L7AA 3OIGA 3DNPA 3FLEA 3LHDA 4B87A 3KJQA 5JNWA 1OILA 1YVEI 3D0KA 4Y2PA 4S0XA 1QC5A 5DLPA 1QHYA 2XYPA 1DWPA 3NP7A 4PYQA 1RFLA 2AFIB 1DUVG 3BDAA 1QGOA 4RGYA 3JVDA 1I6KA 1E1QD 3G0BA 1QIKA 4BO9A 4LJRA 1DRKA 2PAAA 3GQBB 4I7EA 1YUMA 3NHLA 3PPXA 4LY0A 1JKIA 1IY9A 3E58A 2ZSDA 5I8WA 1OVMA 1SVMA 3IOMA 2QSYA 3QFCA 4PX5A 2GASA 2XDQA 1CUYA 3DBRA 4G0YA 1RQ7A 1VE6A 1PVDA 2A9PA 4XSVA 4NV0A 4UAGA 3U62A 2ZBUA 3FPLA 2DETA 1WZEA 5IU6A 1I3NA 4KFSA 1REQA 4AB1A 1JAZA 1OQAA 1U0RA 4CG0A 2QV7A 4XM2A 2UVDA 2WIDA 1T43A 1ILEA 1A9RA 5K0SA 1W75A 4F06A 4ZVQA 1TU3A 3QVLA 4O3FA 2B5VA 4RDCA 3NW9A 2HMWA 4RE6A 3OEED 1AV7A 4MVWA 3WGKA 3O5AA 1GADO 3C5HA 3FOWA 1JSRA 4YCJA 4RHEA 3Q88A 1Y9DA 2HCTA 3ZLBA 4ADSG 1SKBA 3QV1A 1EI9A 2HPHA 4YK7A 2ZR9A 4FOSA 2G1KA 2OMEA 4OYRA 1T0PA 2XI4A 1LLQA 3NJRA 4LCJA 3TNDA 4B80A 3KPWA 5TXGA 3KOMA 3SZLA 2G25A 4KWCA 3TL6A 4XYEA 4PBTA 4GR9A 2IPAB 1Q7TA 3CVUA 3HBAA 1BEEA 2G0AA 1WMAA 3A1TA 3FWNA 4DQXA 3Q0IA 4KKXB 3R75A 1SKAA 2I3AA 5FX2A 2ZSFA 3RAEC 2EGUA 3HXOA 1GG9A 2Y67A 4QLAA 1ECJA 2YV1A 3D7NA 2VJMB 4CPDA 2CVFA 1DQNA 2ZB3A 3EEYA 3MG9A 3RRZA 5B36A 1BHO1 3FKSD 1DFHA 3QFFA 4FFWA 5EP2A 5JSHA 4D3ZA 2J5XA 5C5CA 2REQB 1SVSA 4H3HB 3RK4A 1XELA 2H9AA 3EFBA 1UQUA 4MUXA 5EJFA 4B0PA 4CE6A 2XAAA 3NDPA 1KQNA 2IL1A 5EG5A 3ETNA 4RPKA 2QVLA 1VLHA 3RUHA 2WHRA 1RE0A 2QGNA 2EG9A 3VH1A 3UJ8A 5DLEA 4Q4AA 2NVUB 1GG5A 1R0ZA 1DTWA 1M2NA 3OUZA 2BR5A 4PZZA 3PYXA 1Z6YA 4YRAA 2G4VA 2E4ZA 3C70A 2AGVA 2DBRA 4D8TA 3T3NA 3ROZA 4KP7A 1VYHA 4H7HA 3AU8A 2Q29A 3PFBA 3CA8A 3LL7A 4AXBA 1U3UA 4P3KA 3OX1A 1ZH6A 1PSDA 2IHZA 3LLUA 4YRNA 1BX3A 4J1TC 4WVLA 2XB6A 1XLWA 2E37A 2GPWA 3PC2A 3LO5A 4US0R 1Z6PA 3HDJA 4CV2A 4LWPA 3K6KA 4WLNA 2WWWA 1W2HA 2GM5A 1GNRA 1Q3HA 3N2KA 4YJ3B 1O6FA 2LKCA 2O7QA 3ZCQA 1EBUA 4XDHA 1H2WA 1L9XA 1JMVA 1XEFA 1UANA 1KK0A 4OHCA 1KXZA 1U0HC 5K7SA 4MK4A 1RP1A 2D1QA 3VHLB 1OIWA 3BN3A 2N47A 3CRVA 1IYZA 1X38A 1BTOA 3K2IA 4S0ZA 3UJHA 3WIEA 4DIMA 5KOYA 1M2FA 3T5GA 2PZFA 3QKSA 5KYUB 4ZDIA 1O94A 1IHYA 2BH9A 3I52A 3SKYA 3HCCA 4ZCIA 3ZD7A 2VCYA 1FFSA 4OQ4A 3QPCA 4D9JA 2ZIGA 5T3UA 3NNNA 5K05A 4IHJB 3AKEA 2RE8A 5FJIA 3CWCA 5IFLA 2CJWB 4IV0A 1U2GC 1I36A 1CLEA 1UJMA 4PC2A 4BIMA 1MVLA 2YUTA 3U16A 4BX0A 5HDBB 2AG6A 4WWHA 4AL4A 2HT6A 3D6FA 621PA 4K03A 3U3DA 4HJRA 3WHPA 3JD1A 1JEQA 3PSAA 4FOLA 2WB4A 4DDWA 4ML3A 2ECQA 4A26A 1KYXA 3BD8A 4UXHA 3U3ZA 4C6TB 1N5IA 2QW8A 3FD8A 2AMJA 3QVUA 4UASA 2G08A 1NJ1A 3SZRA 1MBZA 5EMNA 1XD8A 2KM1A 3BL5A 1ZD8A 4IUYA 3IEIA 5CXUA 3FRJA 3RVMA 3JZAA 4J0JA 3I39X 3LIIA 3NHPA 3R77A 4KQGA 1EGHA 1PT5A 4I6EA 4L8FA 5A1TA 2OQIA 3B1XA 4OXQA 3N6VA 2AOTB 2VTBB 1OZGA 4WNIA 2G3YA 2EIXA 3VR4H 1T4BA 1XKTA 2DRIA 4TMXA 1I3CA 5BNFA 3B3QA 5CEEA 1B6GA 4YV2A 4UEWA 1SQ5A 1PBTA 3JYPA 5IBCA 5KAMA 4XR4A 3DNFA 1M73E 4EA6A 3I01M 1MTOA 3LBAA 1NW7A 3KLMX 4LHEA 1N33B 4P3OA 3U48A 1DKRA 4NCJA 1GL7A 2COEA 4C4XA 5HBRA 3D02A 2XRMA 1IZ0A 4ZI2A 3F6CA 4EX7A 4CDRA 4DJDC 3IT1A 3IPRA 2RHTA 1X2EA 2R1UA 5JJIA 2QAGA 1DOHA 1GJRA 1HNNA 1S8NA 1YZTA 2EARA 5HKOA 3UKDA 1FTSA 2H3EA 4P0TA 3WGHA 6REQA 1ZR2A 4MQLA 1TO2E 3CNBA 1ADBA 1WCWA 1U2DC 2NUTB 3HPRA 4Y0NA 4XLTA 2QZZA 4TZ0A 3R20A 2C7BA 3QKIA 3IUQA 3R4VA 4LOHA 4WDQA 2JW5A 2LIPA 2XUQA 1Y6JA 1T5HX 2YQZA 5JVDF 1H0RA 1MV5A 1Z28A 1U9CA 1XVIA 3RCBA 4ND2A 5H3CA 1NLYA 4GKVA 3RYTC 4UOZA 3MWDA 3UWKA 4EW3A 2EEPA 2PQ2A 1FE8A 3DT8A 5KOHA 3FZGA 1JXOA 3N2YA 2XVZA 4RFSB 4OK3A 3KZMA 3EXAA 1T8YA 1P7VA 4MVCA 3RANA 3EIUA 2XVXA 1QOZA 4MW4A 1Q6YA 1Z3IX 4DRZA 4YRFA 2H4HA 4GMGA 3BA1A 1KERA 2YN0A 3DE3X 3NYQA 5EA2A 1T5OA 1G21A 4RETA 3VC2A 3C24A 1F4LA 1I8TA 3F9RA 4H16A 1E0SA 4Q00A 4IMJB 2RH5A 2FEOA 2ZBEA 2HM7A 3L79A 2CJFA 3D9QX 4J0HA 4JNKA 4P5PA 2WJGA 3AK4A 4GOND 5FUVA 1M2EA 3I5AA 1FNCA 5HS6A 2B8TA 2H7YA 2B0CA 3AIKA 2E6KA 4GQBA 4ZVMA 3SAJA 5CXQA 2O7RA 5FHQA 1VI2A 1YFKA 1D9XA 3SYKA 2VCHA 2QD4A 3HM9A 2RKOA 3PUXA 1AMUA 1DBIA 1JQLB 5E7IA 1B26A 2Y8EA 3RQSA 1RRPA 4KXUA 3W9UA 2IYNA 4D4MA 4U2BA 2PT7A 1N2IA 4CMKA 2C78A 1RJFA 4NZOA 3RVNA 1GR1A 2FMIA 1DDIA 1OIXA 1XDUA 1XU4A 5REQB 2WY2D 4YXFA 1ONBA 1YDMA 2Q6IA 1PL8A 1TK3A 2FFRA 2OCLA 4ZOCA 2O8NA 5CBPB 5FBVB 1IONA 2A0YA 4BLUA 5HZGA 2ZETA 1EB9A 2B0JA 5HA5A 5KVQA 1XLTC 4G8JA 1PF7E 4NENB 3ZVKA 1UM9B 3QW4B 1AUOA 1TF7A 1MOPA 1S2MA 3Q7PA 2JLZA 4HY3A 4PG6A 1OZ0A 3SPXA 3P9KA 1NN1A 2IZ0A 2QVZX 2YXDA 1D4OA 3GRRA 4F8YA 4OQQA 4S24A 3NPMA 1ZNXA 3N86A 1BE0A 5KYKA 4ND4A 1Q1ZA 3IKVA 1ID1A 1J2YA 2CUZA 4GZ3A 2FEMA 4EW6A 4DHEA 4YLYA 3MEQA 1ZKMA 4KX5A 5HKKD 1OWOA 4AWXA 2ZJ5A 3LMKA 4YTEA 1UKVY 4YWJA 4C22A 2Z83A 3HB5X 3UW3A 3D4PA 1Z33A 4ROSA 2CLDX 2O1WA 3TH5A 4W1RA 4RVCA 3LOUA 2OFFA 1Z6QA 4HDSB 3WL7A 1PRYA 2RC5A 1N5OX 1SBHA 2XMZA 4EJ0A 4V0QA 5J59A 1XVTA 1U81A 2YC2C 4R41A 1QWOA 3OTGA 4G1UC 3L01A 1NVTA 1BU8A 1WU8A 4RKRA 3OKCA 3RSOA 3K0HA 5DGTA 3JY6A 3V97A 4E5VA 2XGGA 3H1PA 4OQDA 1YZLA 3UV7A 3CLSC 3DZ8A 3SVTA 1T1RA 2UXBB 1E7RA 3DD5A 1A8HA 3DVQX 4ARVA 2Q1UA 2J3DA 2C9DA 3MWFA 4KW7A 2PKWA 3G0IA 5B1HA 4DEYA 1KI1A 4DWJA 3QVXA 4JI7B 2YVAA 4AG5A 2JGNA 2W98A 2Y1XA 2ID8A 1GYPA 4UAUA 1UP4A 1NC3A 2QDXA 2FOLA 3E81A 4HDMA 1KSGA 4DG8A 1CERA 3DF9A 1C3LA 3I6IA 4QX6A 1MMFB 3BC1A 2PX2A 4P4TA 4DSAA 4DNOA 1VQ1A 4RANA 3DAOA 5GINE 3FNBA 3KB2A 3KDSE 4CKYA 3C3CA 4M6WA 1IB0A 2P6PA 4DNFA 4HAWA 4TKUA 4NICA 4XASA 5BN4B 3WB1A 1M6VA 3FBGA 3IESA 3KB1A 2BMAA 121PA 1RQGA 2C04A 2C88A 1Q0PA 1SA0A 2WYIA 2PRYA 3D8RA 3FMOB 5E1BA 5HE9A 3KR2A 3EGOA 4CMGA 4EGJA 3AETB 4MI3A 5D7NA 1UMKA 5GMOA 1WXQA 1BDBA 4MKFA 1NOIA 1N9ZA 3DZFA 1C7RA 4E1VA 1KC1A 1OFVA 3D1VA 1TFUA 4YXWA 2C9CA 2YJZA 2XKAA 4L0QA 3ZW8A 3LXMA 2QR2A 4P0PB 1E62A 1M33A 1CY4A 1YL6A 1VSBA 2Q4RA 3LD9A 3ORSA 2C3MA 2XYGA 3NUQA 1TT5B 5IWAB 3IV9A 4KQJA 4KQ2A 4FMCF 2P7IA 2OC4A 4HAVA 4G84A 2YWHA 4J4HA 5AMXA 4DBZA 5FWXB 5JS1A 2GM9A 3LC1O 5D85A 3PXUA 4ZIRB 3F2IA 3H5IA 4EECA 4IJVA 4F8EA 3GCWA 4TTAA 3IDAA 2Q5OA 1NWHA 3GGJA 1MH1A 1J21A 4GYWA 2PXAA 2UUPA 3A11A 4IWNA 3RIXA 1J8YF 2VDVE 3A26A 1WXDA 1HE2A 1JQBA 1LB1B 1PQUA 2B4AA 4W6QA 1E4EB 4Q6BA 1F6BA 3HE3A 3KJZA 2PSHA 1BW9B 2XE6A 4KBFA 5AWFC 3TO5A 2VDWA 3T9EA 3ZHZA 4D4HA 4D3YA 4D5GA 3UJ9A 1DQZA 5JZBA 2F8SA 4IICA 2QIPA 1N6IA 4FJ1A 4KK4A 4CF4A 2QJOA 3NHUA 1PEAA 3S27A 4AFNA 2VUHB 4MQUA 3STVA 1FDSA 2GQ0A 2RGNA 3NOOA 1KL7A 3H4IA 3OWHA 4G8BA <