1ES9A

X-ray crystal structure of r22k mutant of the mammalian brain platelet-activating factor acetylhydrolases (paf-ah)
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
212
structure length
212
Chain Sequence
ENPASKPTPVQDVQGDGKWMSLHHRFVADSKDKEPEVVFIGDSLVQLMHQCEIWRELFSPLHALNFGIGGDSTQHVLWRLENGELEHIRPKIVVVWVGTNNHGHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLPRGQHPNPLREKNRRVNELVRAALAGHPRAHFLDADPGFVHSDGTISHHDMYDYLHLSRLGYTPVCRALHSLLLRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PLATELET-ACTIVATING FACTOR ACETYLHYDROLASE IB GAMMA SUBUNIT
publication title The functional implications of the dimerization of the catalytic subunits of the mammalian brain platelet-activating factor acetylhydrolase (Ib).
pubmed doi rcsb
total genus 77
structure length 212
sequence length 212
ec nomenclature ec 3.1.1.47: 1-alkyl-2-acetylglycerophosphocholine esterase.
pdb deposition date 2000-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13472 Lipase_GDSL_2 GDSL-like Lipase/Acylhydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 1es9A00
4HF7A 3SKVA 5CD9A 1IVNA 2WAAA 1FXWF 1ES9A 4IYJA 3U37A 4K9SA 3MILA 5BN1A 3W7VA 4JGGA 1BWPA 2WABA 4JJ6A 1K7CA 4Q9AA 2HSJA 3DT6A 4S1PA 4NRDA 1J00A 3DCIA 3BZWA 4DEVA 5B5SA 3DC7A 4M8KA 4JHLA 4H08A 3DT9A 3DT8A 1DEXA 2O14A 1BWQA 2W9XA 4K3UA 1YZFA 1BWRA 2VPTA 2APJA 1U8UA 4HYQA 4K40A 3RJTA 4LHSA 4TX1A 2Q0SA 3KVNA 4OAPA 1DEOA 5A4AA 3PT5A 2WAOA 1ESEA 4OAOA 1ZMBA 4JKOA 1ESDA 1ESCA 3HP4A 3C1UA 1JRLA 1PP4A 1VJGA 3P94A 1WABA 1FXWA 4K7JA 5JD3A 4RSHA 4JJ4A 3SLRA 1VYHA 4RW0A 1V2GA 4XVHA 2Q0QA 4PPYA 4I8IA 1Z8HA 4Q7QA 5HOEA
chains in the Genus database with same CATH superfamily
3QWFA 2YINC 3B9PA 2P5YA 3LK7A 2Y1WA 3CZQA 5CLQA 1P1KA 3H9CA 3PV0A 3VR4H 4EW2A 5K01A 3R8FA 1K63A 5L7YA 2Q1UA 1N2CE 1Z3CA 4IIUA 1Y63A 2QMUA 3U40A 3ZLVA 1H2WA 2WIKA 1C2YA 1ONOA 2B4AA 2BFBA 4Q5IA 5EXTA 5BN1A 2W42A 1ZCBA 2PZEA 1R5NA 1KKUA 3FUUA 4LE1A 5DGDA 2FVXA 2P90A 3U9SA 4NAUA 4DFDA 4GE3A 4LJYA 3I39X 4IZIA 1MN6A 3DZBA 4TRRA 4Y1RA 4IFIA 2GPSA 1UMDB 5EGNA 2FW7A 4HGPA 3ZHXA 1K9VF 3GCXA 5DNUA 1E2KA 5JCPA 1LV8A 3KAQA 3FB1A 4ZI7B 3IAFA 1YRLA 1IQ0A 1LXCA 4IF6A 4J03A 3HWWA 1JPUA 2EX1A 2GILA 3CQ9A 1WD5A 1KMIY 4BO6A 3ST7A 3TLJA 1GZSA 4BNWA 3HJFA 3KBOA 5JWHA 2IOFA 1NXWA 3C8DA 1IPFA 1GLNA 3W4IA 1QIMA 3P19A 4PLFA 1JFFB 1Q22A 2HSWA 3EXEA 5A5FA 1JKMA 1CY8A 5LQSA 2XADA 3Q7IA 4WFKA 1TI7A 1POXA 4Z7JA 2AX3A 1YE3A 1K3TA 3SXPA 4OREX 4CT5A 2YMPA 4EJ0A 2IY7A 3QYPA 1NPTO 5C8YF 4P81A 4WADA 2JRCA 1VKHA 3ZH9B 4FT4A 1LPNA 3WSVA 4ABTA 1EUZA 3EZXA 3LUHA 4EI2A 2WFZA 1Y3FE 4C7JA 4WTOA 1M34B 1T4GA 2PRIA 4CMEC 3WWOA 5HX7A 3HU1A 3MWKA 5IAEA 2Q29A 3R5SA 4V0KA 4U2BA 4JI3B 1KRWA 2VP3A 3EASA 3AHJA 2JIDA 1JFSA 3BGSA 1YTLA 3OKFA 5GONB 3GA5A 4NEGA 5FLEX 5CVDA 2CB9A 2HF2A 5HK8A 4DQDA 3PT9A 4MITA 4BFTA 5C5IA 3DTVB 1SCJA 3IERA 3GFFA 1PZEA 4WASA 5DGXA 4HH3C 2EBWA 2ZEJA 3WHPA 3GGCA 3NIDB 2Z8YM 5AW4A 4L8GA 4RXTA 1YZGA 4E2WA 5CYPA 3WVNA 4ML3A 1Y34E 3GRKA 1UK9A 2O1XA 1M34E 1YIOA 4R1QA 3P9CA 3RYCB 3SQNA 3H2ZA 1I4WA 3KV3O 2EHJA 2R7LA 4LHZA 1N0VC 1NNI1 3PS9A 1Z35A 4FR5A 4TRJA 4X54A 2IYFA 4F3KA 4AG6A 4G0WA 2HJGA 1RMYA 3NPMA 4BQEA 4XZ3A 2NOAA 3W2TA 3ME5A 1KZ6A 2DQKA 2HTFA 3IKLA 2IUSA 3DBLA 2YXBA 4GI7A 3RKRA 2O8CA 4D9KA 3GRFA 4ZYVA 3CTPA 1BVYF 4I55B 2QIOA 1KK2A 3C6XA 4C6HA 2VHYA 1CUUA 1F3OA 2AR7A 4OH7A 3AFOA 2XOKA 1H93A 4Q9DA 2W8BB 4ZU3A 2Y9PB 1DOHA 4KXNA 1TZJA 2G6TA 3QFHA 1M1YB 3HV0A 4OJQA 4RL6A 4RTKA 1K66A 1RWQA 5CDFE 4GPD1 4HGRA 5IF3A 5LA6F 6REQA 3ZCVA 1G17A 4OH1A 3GRPA 4XVQA 5CURA 5DJ5A 2GF9A 2VCYA 3MF4A 3MTGA 4DMLA 1IVNA 3KKEA 3V3TA 4AF6A 3OQOA 3LCVB 4E94A 1MO4A 5EQTA 1W48A 2H2WA 4NEQA 1HH4A 2SNIE 1UF9A 1FDOA 1L4MA 1OXTA 1O95A 2FSGA 2HHCA 3OBIA 3UY4A 5B7QA 1VM6A 2XKBA 2QXUA 3P9IA 3CKKA 3EDRA 1E9FA 5LQCA 1Y3HA 1ZN9A 3VH1A 1URPA 3K8QA 2ZYGA 3R3WA 1GEEA 3CG4A 5DM0A 2I2BA 3AR9A 1U7HA 3JQGA 3U31A 1WZCA 1SURA 4NLLA 4Q7KA 3ESQA 4AK9A 1UJ2A 3OIDA 3LS2A 1DKPA 5F52A 1F0YA 4KR9A 4D0RA 1YZLA 3NNNA 2G0NA 3U60B 2IITA 3D2AA 4OFXA 4OJYA 1YR6A 3K09A 4A92A 1H2FA 5B1EA 4JI5B 2H1FA 2WZCA 4YCCA 2X6TA 2FR0A 1TU0A 3C16C 2HJ9A 5K3CA 2RD2A 2NU7A 4Q18A 3UC9A 3HK2A 3QXXA 4OOFA 2QN6A 2LWIA 2OP1A 2YFKA 2NZ8A 1KO4A 3E5HA 3MMZA 3CO5A 4JD5A 4Q19A 4UHEA 3SX4A 2X8JA 4ZO9A 3VMMA 2E3JA 1MO3A 4HLCA 4JVNA 1LRJA 5E0OA 1T3HA 5C81A 1KS2A 5U9CA 1FE8A 3DR3A 2PO5A 1CR4A 5BQXA 4NOLA 1CQJA 4DHWA 3P0RA 4MQ4A 2C04A 3UPTA 4DMRA 1Z5GA 4KN6A 1AXEA 1JJIA 1XCJA 2Q5QA 4K3UA 5C4IA 1PTJC 2O1WA 4LDNA 4BEBA 4X85A 2V74B 3RQIA 1Z26A 2MYNA 1CJUC 4JGIA 4LVNA 4MUYA 2FPMA 4BJ5A 2VQSA 3RRMA 5A4JA 5L6LB 3J80A 4DUYB 3MIZA 3PK0A 1G4HA 1D6SA 1PQUA 1CERA 1XO1A 2Y0PA 3M6UA 4J1NA 4OI4A 4PRZA 1CB7A 2V6GA 1DARA 4KREA 3DEJA 2W6NA 1N7GA 3CVXA 2ZW9A 3PSHA 1PF7E 2R6JA 4IGIA 5JAIA 4HO1X 4J0FA 1C1HA 4IIJF 4N5IX 2QVYX 5K0EA 1EP3B 5LJLA 4ZVOA 3AKYA 2JLAA 4CU2A 3ZNOA 2VRCD 1T0UA 2LDBA 3WGLA 5B1DA 4FWBA 1AQIA 4D9JA 1A8SA 2CVQA 3QPDA 4WA8A 1VRCA 1PZGA 1AV7A 5E95A 3UO8B 4KYUA 4D98A 3AXTA 1IXSB 4BQFA 5ADUS 5I7VA 2FUKA 1GNSA 2FN9A 3CB2A 1MOPA 2J33A 3SQOA 4S1WA 3VPXA 1X94A 1YRQA 4XD2A 1F2DA 3EGDB 3IS3A 4FZVA 2VZ9A 4L57A 4F92B 5H4HA 3VZRA 1W4AA 1F4PA 1PEYA 2BEVB 3WGKA 1A1VA 3P9NA 3IAUA 4RQAA 5HGXA 1UAAA 4DT1A 2RARA 2O23A 3SJZA 4Q24A 2CDCA 4OATA 1MCZA 1LLCA 2D1RA 2X5KO 1CFZA 5IJZA 5JH7A 3ADDA 2OC4A 4FDMA 1U9ZA 4MWBA 4DLYA 4RCZA 1A7KA 3HP7A 1SHJA 2W43A 4MMZB 4PYNA 1KYIA 2QZSA 2X2EA 3TTVA 4DGQA 4D79A 1F20A 1GY8A 2QAIA 3A2NA 4ZAWA 3AJEA 5BXYA 4QVIA 3ONFA 4HNHA 1NLZA 1FMCA 4IJUA 2PLFA 5H7XA 2HIAA 2I4IA 4A8TA 4KVGA 2PIAA 3EEBA 4BX8A 1OWNA 3ZWDA 4BGDA 3IUMA 1ZGCA 4KTTE 3H3XA 1F12A 5G1OA 4KXUA 1QAQA 3BGOS 3FDJA 3E9NA 4RZHA 3HDTA 2JHGA 4KDEA 3X1ZA 1ZWKA 1XCLA 3GNLA 3TUZC 1KHTA 4CGZA 2PMBA 2ZRFA 3E7PA 3NX4A 3U16A 3W2GA 3M49A 5DWVA 3VO1A 2FP4A 4FNAA 4MDYA 4II7A 1DPFA 1M7HA 1B00A 2AMYA 2GSWA 4YO7A 5ALUA 5LYJA 3CH4B 4CMBA 1BMFD 4WJKB 1ZU4A 5JHHB 4KPGA 2BE9A 3RAGA 1NZDA 2C84A 2XT6A 3ETEA 1C9YA 2I4OA 1U11A 3LUJA 4IKEA 1ND6A 4TMYA 4LV6A 3KD3A 4G5GA 4A4DA 4CTJA 3GT4A 3JX9A 3GL9A 2IZ1A 5JFGA 3CUKA 3U4GA 1I2ZA 4BZQA 3G89A 3C98A 3SC6A 2ONZA 1DDIA 3MJVA 1H2RS 1VE1A 1BAPA 4C03A 5FA5A 3IHKA 1OPRA 421PA 5FNZA 1S2OA 3EZLA 5ALNA 1KNXA 2WZDA 2FLKA 5EUBA 3I5UA 1FU7A 5JAPA 1JUDA 1OT5A 1R64A 3I5MA 1OI3A 3QIVA 4L5BA 2BBTA 5IC4A 1TJNA 5LXTB 3IQEA 2D8AA 4CUKA 1A2BA 1XLVA 1DE0A 5JARA 3VOBA 4PO1A 1NJ5A 1QCCA 1R6UA 3EXFB 5H81A 3RSQA 4B2IA 1M2VB 3EDQA 4KH1A 2XAAA 3NTLA 4Q03A 4ITUA 1XZPA 4KH0A 3ZGXA 2AYYA 4DKJA 4YJGA 4M1WA 3LGSA 5D8DA 5DGHA 3G17A 1QFMA 3ESCA 2FMXA 4B3XA 3LQKA 1HNWB 4Z1MD 2Q4DA 3ROQA 5DM60 3O4FA 4IL5A 3N2ZB 5HFAA 5KJ6A 2QV0A 5IABA 1C0KA 4XWGA 4C6TB 4E03A 4P6VF 5HEKA 1B8VA 5DH9A 1IVYA 4JODA 4N7JA 1ISPA 2V7PA 2VUHB 1MQSA 1OREA 4GUAA 3K5WA 3WB9A 4ANFA 2VHJA 4EPTA 3CN9A 3A28A 2X0EA 1XWIA 4F3RA 4UTVA 1BD4A 2H4WA 2R7MA 2SKEA 3GCZA 4HLQB 4R8LA 2HO4A 3TR0A 5K05A 3QELB 3PXXA 2QGZA 2WT8A 5LQDA 2HNKA 5AFSA 2DMRA 1TEHA 5JPDA 3K0AB 1F8UA 1B3RA 3GEBA 1RIFA 2PGAA 2MR6A 4U2FA 4TYWA 1T2DA 4RQUA 4C0HA 1I2DA 1EI9A 1K92A 5D5HA 3NW9A 1QG0A 1G5RA 3F73A 3GG2A 1IRIA 4HMOA 3A1CA 4AZTA 4CBVA 3ZY5A 3FHCB 2AG5A 1E63A 3T3GA 3ZQUA 4US1R 2O2YA 3VKUA 4HWTA 1BRMA 4OQQA 3EFHA 4I5FA 3S81A 1XTKA 1ZQ1A 3M33A 1XVAA 3SBOA 4RW0A 1CEEA 2DPXA 3UJPA 1AZTA 2I3BA 2BI8A 3CLHA 4LE2A 3IEPA 4DCTA 4GMKA 4LJRA 4DA6A 1NSFA 1IJFA 1TNDA 2DH6A 2YZ7A 4MYTA 1JU9A 4L0MA 4OXRA 3ZG6A 5ECGC 1V7PC 2YHIB 2PZBA 4DSAA 3PHBE 5AUQA 2AFIB 5A5GA 4ZOLB 3CLKA 2OPHA 4JL5A 2AC4A 4EF4A 1NW5A 2IYVA 2PXHA 4AB1A 1CY2A 2OB2A 4C78A 1QTQA 4JR0A 4PTZA 2GLTA 2HY7A 2VYCA 2WE7A 3TINA 4HVCA 5LN1A 4MHTA 4FMDB 1Z5NA 3PNBA 1BN7A 4MYHA 3UTCA 3REGA 3TNFA 1DQRA 3DHVA 1AUOA 3F5QA 2H57A 3NYIA 2HRQA 3D4LA 3HYSA 4GI5A 3W90A 2M6RA 4AD8A 4DDKA 1IUKA 3ADOA 5KMGB 1ODIA 2HQRA 1E3TA 3QE0A 1GNPA 4OKSA 2Y77A 3NBUA 3AR3A 2RGAA 2ZCJA 1U2ZA 4NX2A 3LXMA 1Q83A 2AFIE 5LFAA 2VRBA 3RRFA 2OFFA 3K9LA 4PLCA 3E61A 4S1PA 1QYVA 3KSZO 4Y2TA 1CUVA 1YU9A 3D8NA 1KRHA 3CNOA 4X24A 2R1ZA 3TI7A 3ODPA 2JGLA 4HDOB 1P0MA 2BOVA 5ARDA 3KQKA 4UBLA 1CY6A 1JWBB 3M1LA 4P8RA 1XMQB 3DZHA 1IN8A 4DN6A 5KYGA 1EG2A 5YASA 2MSKA 1JHQA 4B2YA 4E15A 1SQFA 1WE2A 3NKVA 1X15A 4M76B 3DMTC 1P6UA 2BFMA 4NZOA 3PHHA 4J29A 4ILEA 7MHTA 1ZCAA 3WKCA 1SKUA 1NTOA 3A6DA 1I6KA 1V6CA 2OZEA 1R9MA 2ZLBA 3S28A 4EIWA 4G0PA 5DP1A 3FGZA 1RM0A 2FUG1 4E4YA 2OWDA 4FHZA 2YQ4A 5EHIA 5BMVA 5KYWA 2QTWB 3H83A 1ZVKA 3N2KA 3JS5A 4GBJA 4WAUA 2H0AA 3PIDA 4JJGA 4UTNA 5CNKA 1JG4A 3CXUA 2EFGA 2ODBA 1UDRA 1J33A 2C54A 2YQ5A 3PL5A 2XVYA 2RE8A 3U7FB 3LDGA 1IOLA 5ED0A 3WMGA 3AT1A 3PQ5A 2PKXA 1IZYA 1W2GA 1FL9A 5DNVA 3WQSB 1OH5A 2X0KA 3NALA 4D02A 3KIPA 2EKQA 3DV0A 1WDLA 4OAPA 4LRQA 5TQJA 1PL0A 4L4ZA 2B83A 3RC2A 2AZDA 2QY9A 2QTCA 5GGYA 3ZLUA 1PUXA 4FYWA 4C76A 1MX1A 2ZRIA 1DUIA 2CVFA 1PKXA 3JPWA 4IF4A 4XB1A 3RBAA 1B6SA 1GA4A 4RH3A 3E9DA 5AOCA 1ZIPA 2RHLA 2FUCA 3WP1B 2J6IA 4GXTA 3O4GA 5K4GA 1EZ4A 2ORYA 2LV8A 3VPAA 1AS0A 2OK8A 3MGAA 4KO3S 2AEJA 4QQNA 4RKEA 5EKXA 2J7KA 4F91B 4M55A 4JL6A 3KKNA 3U5ZB 4MSUA 2C20A 3TKLA 4MEBA 4N03A 4OFWA 3KUKA 3M3HA 3PNMA 5J4LA 1E5QA 3ONEA 1SY7A 4IWXA 4UTRA 2XXJA 2JKYA 2QBYA 3AUXA 3CF6R 1QO0A 2LW7A 1ML3A 2QU7A 2Y27A 4G4JA 5EJ2A 2IDJA 3I6YA 1JR2A 1U0BB 1TDJA 3L4BA 5EP3A 4KC0A 3GZNA 4IJ6A 1M6VA 1RYBA 3JVEA 4G9BA 1X7ZB 1ZJWA 3FBGA 3TRJA 2GD2A 3Q3GE 3K96A 2QNIA 4OP2A 3WK7A 3K92A 3TB6A 4KODA 3UJAA 1X3LA 4OQYA 2G80A 2HIGA 2OHJA 1BDMA 4X41A 3GLVA 1CZRA 5CTJA 4ZHQF 3QA9A 3OCJA 1MENA 5FDFA 5IMSA 3AR6A 2AXPA 5FPTA 2BEWB 1LDGA 2IC5A 5JYEA 3FNIA 4Q00A 1B0AA 3OQVA 5FF9A 4BJ1A 4JIMA 3QSGA 4ZVQA 4B3BA 4YRZA 1NMXA 5IJ9A 2DULA 2ZI7A 1OI2A 3LX5A 2IHVA 4ZU1X 1DEKA 2KJQA 2PMDA 3MWGA 4FGJA 4HB3A 4HR7A 2I5PO 3L77A 1N2SA 2X76A 2J09A 3DYIA 3I0ZA 5HZGA 2FU5C 1LJ8A 2PL3A 5CT4A 2BGRA 1HF3A 1XVVA 4AX4A 5KTPA 1M2OB 1QIIA 2VDJA 1QFSA 3AV3A 3C43A 3HHEA 1ABBA 1AKEA 4JR2A 3U09A 3W5CA 1XGKA 3KYBA 4XJTA 3DC7A 2B92A 2GD0A 1CEQA 2G40A 3FNFA 3IE2A 3LUFA 1TGVA 2J31A 3EAQA 4DUZB 2X8LA 4UQPA 2RGGA 3P96A 4GC5A 4DY6A 1WHTB 4EA7A 2IS6A 3M6XA 1Y6GA 2G28A 4UAJA 2ZT8A 5DT9A 2EG9A 5DOVA 3LOUA 2K6GA 1IN1A 4ZZ0A 1UM9A 2EL7A 4KWEA 4HV4A 4JYAB 3F5FA 3BT7A 1YR7A 1OX4A 2V8OA 3P8ZA 1MQAA 2VRNA 3DLTA 1BG6A 5DGCA 5IP5A 4UC0A 5E6SB 5FBHA 2C2WA 2GCNA 5G3YA 4FM9A 4LQLA 5HQJA 2OBNA 4UM9D 1CF9A 3HJUA 1XYVA 3DAHA 4QOFA 2YC2C 1OGYA 3G9QA 3PNSA 5A3QA 3KSAC 1SOAA 3D6UA 4ASUA 1CR2A 3HJHA 5JU6A 2A84A 4JLSA 3ZI4A 4AJ2A 3AKZA 3IEKA 2YWBA 2WLSA 4X90A 4RIFA 4IIJA 3JYQA 1MVNA 4TYQA 2C0PA 4EQZA 4R2HA 2R6AA 4EX6A 2DY1A 4F86A 3G49A 2W58A 2QM8A 2WP8J 4IWNA 2I3ZA 3QVGA 4IUBS 4EPXA 1TW3A 1QQAA 3RTEA 2C77A 4H3SA 3T9EA 4WV3A 1T9BA 4EGFA 1FMFA 3H9UA 4I1VA 1XDWA 4MYRA 1JKFA 2I29A 4NKRA 4EKYA 1L3BA 2HYDA 2ACVA 1CT9A 4KO2S 1MJFA 4OJMX 5F2OA 5IN5A 3ZW8A 3PPVA 4Y2XA 4DLUA 2IUUA 2VDNB 4CM4A 3P20A 1GFWA 2C99A 1ZMXA 3IJPA 2AEEA 4P84A 4F4UA 1YQQA 2QSUA 5C1IA 1U4SA 4IHQA 1BGXT 3P4UA 4OVKA 1S2NA 3NOVA 3NANA 1GT6A 9LDBA 1JXOA 4K88A 4R1TA 1ATIA 1VKNA 3ILHA 2H9IA 5I4IA 2OO5C 3ZGYA 1IM2A 1IY1A 2AOWA 3JPYA 4M60A 4PX5A 2I8AA 5F9MA 4DAEA 4EUEA 2C7QA 1WETA 1VPDA 3P5BA 4DCNA 1PR9A 4LBYA 1DZ3A 3MIIA 2EGGA 3LQ2A 5IMBA 3ZN2A 4TTIA 2P75A 3IUNA 5I7HA 5LMUB 5J5CA 2Q4RA 3RS0A 1HE8B 4H0NA 5AHKA 1QHHB 2HH9A 1T9GS 1R0RE 2KQUA 3DWEX 4GPIB 3O4HA 3DOIA 2C4MA 1EWKA 1B93A 2W2OA 3Q3VA 3QK7A 4WWHA 4F0JA 1YKSA 1YBFA 2IVFA 1YMUA 1T15A 4LPSA 2F3PA 3Q8KA 2JJQA 1HG0A 3EXG1 4M8IA 5DM1A 3OPYA 4F8EA 4M98A 5FAKA 3PQ6A 1B26A 1GDDA 4RDCA 1VA4A 3GIDA 5THQA 1SB8A 1IATA 3LQ1A 2ZRJA 3RFCA 4ZCRA 1YXMA 5AVKA 3C5HA 4ZGGA 5JAUA 5DK6A 2V6IA 2GJ9A 3AHHA 3DXXA 4LY0A 5DX8A 3QRWA 4ZVSA 3ZY4A 2HV8A 3PYLA 3DQZA 1T8TA 1FIUA 2FMUA 3I2IA 2C0QA 1WCV1 1X77A 1C0PA 5JNWA 4BO4A 1T36A 4G0UA 4I1UA 2CBXA 2P2YA 4HDNB 4HNTA 2G1AA 3HRIA 521PA 1Y1RA 3EYAA 1WXWA 1R0CA 1U8TA 3CCBA 3RHFA 5K8IA 5BNFA 3EWAA 1GZVA 4J9UE 2O8EA 1OA1A 1VLJA 4POAA 4R40A 5KKAA 5SY4A 3DTYA 4REMA 1A5TA 4L9WA 4JLJA 1XKXA 1C14A 4GZMA 1RQXA 3PRYA 4HEQA 1XF1A 4J0CA 4TVKA 3T7KA 4DLZA 4E4RA 4E5DA 2A57A 3C8MA 3LOQA 5DIZA 4YXWD 1TKBA 1R27A 2AW5A 3LECA 3EG5A 1EFDN 1GGEA 1JX6A 2F3SA 2CVHA 2OHFA 1X9GA 3I2GA 3JASA 1OV4A 3R5HA 2WAYA 3K70B 3PGKA 2ZSJA 3EIFA 2VHUA 1DEAA 2CKMA 3ETDA 1BFKA 4HMPA 5C5EA 2WVAA 4BVBA 3TH5A 4CTKA 3IIIA 2QAJA 3MVEA 1N3YA 3W2HA 4RK6A 2WQZA 2FP4B 4JITA 1SH7A 2A4MA 4YRPA 1AG9A 5LYJB 3RS7A 4AJ1A 1BZYA 3HJGA 2FX5A 4G26A 1JR4A 1Z4KA 2WPDA 3DW3X 3U4HA 1KAQA 1U9JA 1I5EA 3LKDA 2IV2X 1TA4A 2ORVA 5BSHA 1WXEA 1W5BA 3ANTA 4QU9A 1HLPA 1NKTA 4R0MA 1ESDA 2P4HX 2VHTA 2NN3C 2XD4A 3TPCA 5KWSA 2H65A 2KLHA 4DNPA 1F8GA 2XBLA 3IHWA 5BNTA 1ESCA 3HV2A 1TJ3A 5BYBA 2BFCB 2FPGB 1JSCA 1UZMA 4JI4B 4QIHA 5CVEA 1FPQA 3PDHA 4PM4A 4DEXA 2IPAB 3LLCA 3A2MA 2HEIA 3LYUA 4R8KA 1V16A 4J1TA 2DKFA 5EE3A 4EFNA 2O3RA 5F21A 2KPOA 2W4QA 5K0TA 1Z74A 1C0IA 3C5EA 3T5CA 1JG3A 2Q5HA 4JP2A 3GJ3A 1J2JA 4RK5A 5EA2A 2QD1A 3F3KA 1QMPA 1NAIA 2FRXA 3KT3A 4PR3A 4DQKA 3BJMA 3BREA 1UJ5A 2GO1A 4GHWA 3ETGA 1QVRA 1CPYA 1YR8A 4L08A 4AJEA 3NWEA 1W581 2O8NA 3Q9LA 2XNHA 4OF4A 4P1ZA 1WMSA 1F14A 3BH0A 2QRLA 4LZAA 1YI8A 1F3LA 2HHAA 3C48A 1J9ZA 2AMJA 4NWIA 4WLVA 5T4EA 1S3FA 4BWVA 1WA5A 1Z2AA 1J1UA 3PHLA 4DDWA 4QQ8A 2NO4A 2IBTA 4LE0A 2WWVD 5CDYA 4C87A 4P38A 3U37A 2GWRA 4JELA 5DTIA 3EX7C 1CBUA 4ARCA 5EJAA 3DDZX 2F43A 3D7MA 1E32A 1U3TA 2WJPA 4BO7A 3AP3A 4H7PA 4JB3A 4NZPA 2W2NA 4KZKA 2GZRA 2LE0A 2WU1A 2IHZA 3I9FA 5K3SA 5FO1A 2O57A 1AHPA 4GDFA 1QV7A 3HBAA 4RACA 4V0SA 4K81B 1IUOA 5JASA 1IOVA 1ODCA 2HFJA 2A9VA 5BW8A 3O8LA 2KM1A 2MSWA 2Q1XA 4RM3A 1WPRA 3T7IA 3TMYA 2IS2A 2R7AA 3OQHA 1W6RA 1XZAA 3OA0A 4F3CA 4UCQA 3CSUA 3N28A 4DPMA 3QE2A 2O8DA 3AHIA 5EI5A 2WNHA 1EX9A 121PA 5B55A 2WTNA 4URZR 1JQBA 3E3OA 2OCKA 3H5IA 4IOLA 4NCKA 4TMVA 5AHWA 3WIEA 3KPWA 4RVCA 3LWZA 3RF6A 5ICEA 1A8PA 4DGSA 1R88A 1Z2PX 4HADA 2BEUB 4YMHA 3IGFA 3U0VA 3H5AA 4RK4A 5KVSA 2ES4A 2ZE5A 1MNAA 4N6GA 3B48A 4X20B 4DLBA 1AQLA 2G1JA 3HUUA 2YZ2A 1U9CA 4FB5A 3V55A 1ZJ6A 4OBWA 5EPOA 4QAQA 1E58A 3G1TA 1U3FA 2H2IA 3T4XA 2GYYA 3COWA 3OMWA 3TNLA 3HYCA 2ZBDA 4A0FA 2ASEA 1N4DA 2OKCA 4B75A 2MDTA 3TQOA 4Y9UA 1TB4A 1LLUA 1OA0A 4U4AA 2LTAA 5EKSA 1Z36A 5HM6A 4DC0A 4I0WB 3R8CA 1PL8A 5TPZD 2FZ5A 3WRWA 4ZAXA 2BGGA 1AF4A 1SOVA 3AFGA 3DTVD 4JYMA 5ES4B 3RREA 2F7SA 4AS2A 2IOQA 2QTTA 3DS8A 3TG8A 6CHYA 2GTPA 1A82A 1XROA 3IILA 2PPVA 2AJ8A 1I10A 2X23A 2ZTLA 3V7WA 1Q3HA 3IT1A 5E6UA 2XBUA 4XDHA 3EXHB 5K8CA 5CCXA 4BNZA 4BFCA 3ZWWA 2WQ6A 1K8XB 5LU8A 1P1FA 2ZWPA 2CFRA 3G79A 1A98A 3OHPA 4RMJA 5CP8A 4C0JA 3Q0EA 5J2TA 1Z45A 2G8LA 4L9AA 4HNAB 4NESA 1GL9B 1PV2A 3C8ZA 4NZNA 1AY0A 1JAIA 1WSBA 4KZPA 1NLMA 4JA0A 3B85A 4XUDA 5EIAA 4F6RA 3QU2A 1K8YB 5BPHA 1D6JA 2ENWA 2X3YA 3FTEA 3RC8A 3FMOB 4LJSA 1JMKC 4IJ5A 4PC1A 2XYGA 4CMJA 4N3GA 4BWGA 3UAZA 3RT7A 1XQWA 2XWBF 1V25A 3EZNA 4Q7JB 4YJDA 1GTMA 4P4LA 5A0VA 4NE9A 4RPKA 4QG3A 2HPVA 1MFPA 1EFCA 2AIRA 2CF5A 2XTJA 3OT1A 2EF1A 2X40A 3ON5A 3Q87B 1N6KA 3OM9A 1RYEA 4MRPA 4ZT2A 5ITZB 4RTJA 3QFRA 4F06A 2OTCA 1B6RA 1HKUA 2QN7A 3KQOA 4CKCB 1XTRA 2ZB3A 5TDHA 2JGRA 2A1TR 1VKRA 1KVQA 1Z83A 1JB9A 1AGRA 3FBWA 1BOFA 1QR6A 3FYCA 5ALVA 1XPUA 2D74A 3ZJUA 2KMLA 3C6YA 3ZWKA 5CYOA 4OFBA 3ZE9A 3ZZMA 3D64A 3LJKA 4G3XA 2WDPA 1PJLA 2IKSA 4B3RB 4GH5A 3EHDA 4N0EA 4JJKA 3KFVA 4F04A 5AKJA 5EP4A 2J3MA 4ZHQA 3I76A 3JSXA 2OP0A 1A2QA 1KU6A 4K6HA 2OM2A 4MH0R 1JVNA 3MTJA 4AI6A 2WIGA 3P2MA 3R0ZA 5H82A 1LWNA 5EIFA 1GUZA 1NKVA 4WK6A 1JHPA 3WGJA 1VZ2A 4PCUA 1SPBS 2ECKA 3BBPA 4UARA 1ZSYA 1TADA 3Q4GA 2PYDA 1JS1X 1KY5A 1PJCA 2WJIA 2NTVA 4MEAA 3PC8C 1J8MF 2DWPA 4M9RA 4UTZA 1COWA 3HCCA 3LNCA 1DKQA 1NUTA 2V5UA 2QBYB 1ZA1A 2UXCB 4Z0NA 1B42A 2WEKA 2ZSFA 3SF8A 1ARZA 3O4VA 4DVGA 1RD4A 2NVWA 4KAJA 1LPBB 1Q91A 1CQIA 4GPZA 2BI7A 1W0CA 3LUBA 1P9LA 2D0DA 3QVUA 4Q9IA 2ZVJA 3LDFA 2GLXA 4XVRA 5EZ5A 3TZ6A 4EA8A 1ESMA 1F7UA 4EHNA 3TBHA 2Y6UA 2ZYDA 3PDIB 5LBUA 1ZH0A 1PGOA 2FNAA 1OKKA 2XSZA 2PX4A 3CKMA 2ATEA 4IQ0A 5L9AA 5AQEA 4LNUA 1GZ5A 1O4WA 3OZFA 5LA6B 2WZBA 3FCSB 3TZQA 3A05A 4FXPA 3VSDA 5CDHA 5JBNA 2PUVA 1TQDA 2FCAA 1SVIA 1Z06A 2VPTA 1K7YA 2WSMA 4FFWA 2ZPUA 5AJUA 3RK4A 4IV5A 3EVGA 3WOHA 1JEQB 3B5EA 4NPCA 4P53A 4WOBA 2XEDA 3IKMB 1RU3A 5EVCA 1TYBE 1NHGA 2GN2A 2NU6B 2SKDA 4G84A 3WLQA 3GEEA 2O3UA 3IMCA 3SIWA 2ZROA 5I7UA 5KNDH 1DAPA 1HDRA 2FQQA 4HAVA 1J8YF 2P4QA 4ZMSA 1Q0RA 3DVSX 3M70A 5D7NA 2HUPA 3OCCA 3PENA 3IKTA 3WL7A 3ZBQA 4BTEA 1WPXA 5FTJA 4G24A 1VG1A 1B6GA 1YS2X 2CNNA 1T34A 1AD2A 5FD8A 3TCXB 5E7QA 1G38A 2IL1A 4A8HA 3KOWA 3IX7A 1AN9A 1K7FB 3LBNA 1ITZA 4BNXA 3GVIA 2MYTA 3DUWA 4MTCA 3OQBA 7REQB 5AVOA 5IM4A 4P7KA 3SIPA 1U2EA 1UOEA 2G9VA 4ZEWA 1O6GA 1Q0QA 1Z6XA 1U0FA 1GUAA 1U2TA 2NZJA 4TXHA 5I8WA 4P93A 3LQRA 1XZGA 1Z6TA 1Z6PA 5J3JA 3EQ6A 2F90A 3R76A 2RHHA 4HLUA 4Q4JA 4ATNA 3WB0A 4KR2A 4R3WA 2E4ZA 2GZAA 5DYGA 1TEXA 5D84A 3WBKA 1Q92A 1U1EA 2AQIA 3BSYA 2VSOA 4WA7A 2B37A 1TKRA 3ZWVA 5DASA 1XMJA 4MKHA 2JAUA 1QWSA 1WMEA 3G8AA 2DT8A 4PPYA 3SP1A 4DA7A 3SSOA 3WAKA 4JI1B 4D96A 3F90A 1DLJA 3AQ4A 3RVLA 1ZX1A 2QG9A 1XKTA 4MXDA 3K4QA 3ZCUA 4D6XA 4QUEA 1U0RA 4F1WA 4LTNA 5CYFA 4E13A 1H4VB 1JE0A 2Q5EA 1SG0A 4EGSA 1D2HA 2V7GA 2ZE7A 1K27A 1ORWA 3GYBA 3L46A 4LWZA 5FOXA 5ITVA 1ID1A 3CEAA 3NHFA 4IIJB 5L53A 1PWXA 3WTCA 2JBHA 1U2PA 3NEPX 3RC3A 1PZNA 3B1ZA 3DP7A 4BMXA 4E46A 1PFVA 2HJSA 4YRNA 4MW5A 3QVGB 1GYPA 4W5JA 4HY3A 4DXAA 3H3JA 3TUJC 4HQFA 4RMIA 1QPZA 1QQTA 2XUAA 3HO1A 1CY4A 3AONB 3H4IA 4XE5A 3TRHA 4GM0A 4RKFA 1C4WA 2X9LA 3GFOA 2CXOA 2Z2XA 3FNBA 2O2CA 1QC5B 1E6WA 4ACBA 3TSCA 4H60A 3K6SB 1NVFA 1WKVA 2OAP1 1HL3A 4GGPA 1E62A 1HQCA 4RWZA 1OC4A 3VAZA 4JOCA 4B79A 3MWFA 4ZRNA 4MRNA 1N2EA 4FYJA 4PCLA 4YUZA 4DPKA 4F97A 1UK7A 3MEQA 3OSUA 3CVOA 5KNBD 3ND9A 4KI7A 4JY7A 4JLKA 5H3CA 3NM5A 2ERCA 3AILA 2ZYRA 2GXQA 4GICA 1VP3A 4MUHA 2Y99A 5TGDA 3VR6A 1JHRA 3ZGOA 4CKEB 2FE1A 4DNFA 4RVHA 2QSJA 4CKBB 4HSGA 2IZ5A 2IPNA 4WLUA 3I28A 3V34A 3FMIA 5TT0A 3NONA 1P4SA 3A0UA 2IODA 4UNRA 5AO9A 2XV1A 4ZXPA 3TZHA 2QM3A 3ONWA 1J09A 2ATCA 4A36A 4F12A 2FK8A 2Y1EA 2BWJA 3KZVA 2Q4OA 1R50A 4OK3A 3LT1A 2JK0A 1SBIA 4FW8A 4AJPA 4KXXA 3EVFA 4IDGA 3RVJA 5ALYA 1TYAE 2J6HA 3CX6A 3A6LA 1R8SA 1NLUA 2A3RA 5I01A 4BYMA 3QXHA 2CV0A 1YFZA 3GPCA 2OT3B 5AVWA 1EVEA 1QCDA 3CJRA 4TQAA 3JYNA 4MWZA 3VR3D 5KUTA 2EZ8A 4MS4A 3K9WA 1XNHA 3BXEA 4W1PA 5JMTA 2W2KA 4DZZA 2IWRA 1F1JA 1ZRMA 3FZGA 2A9FA 4HQ6A 4TGLA 1OXVA 2VXBA 3UEOA 3K72B 1PS8A 3RUHA 4CM1A 1CZNA 3IVXA 2FI1A 3PGXA 3LU1A 3AFNA 1OLSB 4QRIA 2O19A 4QYTA 1GGVA 4BX2A 4EX7A 5AI8A 1K6IA 1HSOA 3QEJA 3LHKA 2J30A 3D5TA 2BUBA 2Z2ZA 2JGJA 1VL2A 2CL7X 1GSOA 1AB6A 2M1XA 2J45A 1KMMA 3BEOA 1NW6A 2WU3A 2B8TA 4EZIA 4YK7A 3VM6A 5JSFA 1OLXA 8GPBA 1XZDA 3JW8A 2HBQA 2QRQA 4O2RA 2VYFA 3JASB 1HE5A 4R3NA 4ZJYA 1Q7CA 3EOZA 5I8ZA 2ODQA 3KTFA 2B1IA 3ZE1B 4C22A 2XGGA 1CUFA 2FPIB 3O9ZA 1XMOB 3C0KA 4GRIA 2TS1A 1YIDA 2E55A 3I0MA 1QUFA 4DMHA 4TZKA 3CLUC 4HF7A 2FJ0A 3U44A 5JNRA 4K1XA 1I4EB 4J0GA 3OHSX 1KYYA 4CT0A 2XB4A 1TE2A 3KQVA 4U6NA 3JVVA 1EK5A 2FPPA 4ER6A 3KWJA 1E94E 2P30A 2PQMA 5HSGA 1TAUA 2Q3CA 2VNHA 1G8HA 4L5CA 3PDCA 2RKWA 1I1OA 4M1KA 4A8JA 3NHWA 3H1AA 4YREA 1TZBA 2E82A 1KF0A 2X77A 5AJZA 1UWCA 5JI3E 1OLOA 1DO0A 1VYTA 2VWHA 1KI6A 3JZIA 4YAJA 4RZIA 1Q3KA 2PLNA 4KYVA 4NENA 4D25A 3EVZA 1KHHA 2ILVA 3U9LA 4O4IF 4DE5A 5IVKA 3TSZA 2JB9A 1GGKA 4AW9A 4DSZA 2W6OA 4RK7A 3SE0A 1G0OA 1DX9A 4GBED 3CH6A 3EZGA 4ZQFA 1IJKA 3CUVA 1C3EA 2ONJA 2FN7A 1W5EA 5T4BA 2GUWA 4DR4B 4AICA 1R6AA 4HC4A 4NCNA 5KWJA 1EE1A 3GD7A 3IBTA 4LTMA 1QKKA 5EXPA 1PBNA 3GGSA 3LVRE 4DBVO 1RC8A 1Q0ZA 1LDBA 2I67A 2OC9A 2H2DA 2QAGB 2Y2VA 2Z6UA 1HURA 1N5DA 4N49A 4AMVA 4BECA 2RHWA 1RVV1 1YK1A 2CKDA 2ZRPA 4X71A 1KP2A 4KQ6A 4D42A 3DM9B 4PGAA 3ZHVA 2OHOA 1N9ZA 5FH9A 4YV1A 3RWMB 4P54A 5SYAA 2EZTA 2Q3MA 4CLXA 3G7UA 3UCEA 3VHXB 2Y1KA 2F43B 3LM8A 3ORHA 1K6JA 1OASA 3DB1A 2PKEA 5EJMA 5A62A 4AYXA 1UUFA 5EVJA 4RTNA 1Z4MA 2HMSA 3TL6A 1RLIA 3SZRA 2O3TA 2IXDA 1UPXA 1SA0B 2ODTX 3INRA 4UBOA 3H5VA 2OA0A 2ZJ6A 5H02A 4RFLA 1T9DA 3KPVA 3PC6A 1LF0A 2BMVA 1OFUX 3A3OA 3HA5A 3U3ZA 3ER9A 2IBSA 3IOYA 3EBPA 3D6NB 1VSQA 4Y9TA 4YT5A 1ISSA 2AG0A 3DMNA 3JD3A 4M1OA 3TBFA 3NEAA 3FOZA 5A6SA 2X19A 4BTLA 5K6AC 2JLZA 3UATA 1EP9A 3CFYA 1RMQA 5GY7A 3RARA 3FSJX 2JJYA 4RXUA 1XD8A 5J47A 1ZI6A 3HKBA 4G1UC 1RBYA 4NTZA 3AR8A 1SBZA 2IYWA 4KTVE 5AK5A 4YP9A 1E0AA 1SXHA 1YUMA 1YKFA 2AG1A 2JASA 1OH6A 4MJXA 3WLAA 2EWWA 2BMAA 4CF5A 1ZVVA 3F4LA 3JWGA 3RADC 3AHFA 1XZMA 1KMQA 4C0BA 2H2GA 4YAUA 4DV1B 3WOVA 2O7QA 4G1BA 5FCDA 1EXVA 4YMVA 1XALA 4D8VA 1OFIA 2WK1A 2B36A 3ZJVA 3FNEA 2C9ZA 1A9QA 3OQPA 4MMXB 4WOPA 3L1VA 3BJIC 2HA0A 1E1QA 3MWDB 2Q6KA 5BYKA 2QUKA 2ZB8A 2G25A 1NP7A 1EVYA 1ZZGA 2RC6A 2PRKA 1E1LA 5CJPA 5F2EA 3WL6A 2WE8A 2RK6A 2P9QA 1DAMA 3WRXC 1XKLA 4Y6LA 2YW2A 4N12A 2IYLD 4UQLA 1JH9A 2HC9A 1IXRC 2GDJA 4WD3A 2C8VA 4CUZA 1IM8A 1GPUA 5CD9A 5EUCA 4QHYA 5BOSA 1TFRA 3PGA1 4JBHA 4JH0A 3EGOA 5TMPA 4CM6A 1M8FA 4MQ6A 2M2IA 3MB8A 4YP6A 4ZZIA 3HI6A 4BVJA 4C4ZA 1NWCA 5IYZF 1EFRA 1P7VA 1TM3E 2ECPA 3JQ6A 4Z4EA 2IOHA 2IGTA 2IRWA 2YUTA 5MHTA 2HWXA 4BWYA 3V7UA 3ZLTA 4DV4B 1W2HA 1PW5A 4L16A 3V1LA 3J81A 4K9MA 4C07A 2FSSA 3HDGA 1M8PA 1PK9A 1WXHA 2CNLA 1N2IA 2JBAB 4NU8X 4KXFB 4CR7A 1W85B 2JLSA 1XQ9A 1AIPA 3ZXSA 4H3VA 3ABZA 3GLHA 2Q3HA 4OYYA 2JGDB 3ZIAA 3U19A 2CV1A 3WGNA 4TN1A 3TQTA 3ZDAA 2BN4A 3A06A 2C2GA 4PV7A 3UMBA 4YLYA 1Q21A 3E5RA 1R0WA 3EEQA 1EAMA 3OT1B 4M8KA 4MKFA 4F96A 4MPDA 4F6LA 4FFRA 2C58A 2EXXA 2GKSA 2X3UA 4ND8B 4WLFA 1H94A 4RFSA 1TRHA 5JD5A 3OX4A 2CL6X 3GI1A 3Q10A 4JXKA 1GQQA 1ZUNA 1SHUX 4NMXB 3BK1A 1HV8A 4HS9A 3EGIA 3ZNNA 3WGGA 1RXWA 1Y82A 1KJ8A 2Q5CA 1G8KA 3BQNB 4US0R 3GJ4A 3LC7O 5U4XA 1NSTA 3NDRA 3SEQA 5DHFA 2ZWVA 4CR6A 3UN1A 1E6KA 1QNLA 1P80A 4QJ5A 5GQSA 5F7XA 2YOGA 5IVDA 1I2BA 5G41A 1Z33A 2NO9A 1L9XA 3B36A 5FTKA 5GZ1A 4U39A 4BCDA 2A1TS 2P9EA 3ZJYA 4TZ0A 1SG9A 3SEAA 1D7OA 1P2UA 3QMWA 4J7AA 2QL5A 3RD5A 2DHQA 2TRSB 5AKYA 4Y3UA 2PV7A 1O94A 3BIXA 5ALFA 1QG4A 3RS8A 3B8EA 4D4KA 5KKNB 1CE8A 4Q1DA 4ND3A 2ADMA 4RPJA 4MVXA 3W06A 5EAIA 2GM9A 1NVAA 2EL9A 2VDVE 2X22A 3I6BA 4XUGB 3BCHA 3SXUB 2B2CA 2R1UA 2WM9B 3ILXA 4BQIA 4ARSA 2F3QA 3E4CA 2TYSB 2FEMA 3NTVA 5CLIA 1TD1A 3AERA 1UPTA 3M4XA 5FBRB 4AXBA 1SC6A 1SUWA 2H92A 4QBIA 1IMOA 1WTCA 1O3YA 1DC4A 3S2ZA 4EGJA 2F8SA 1DMSA 3MSCA 1ICEA 2AA3A 2G77B 3N0RA 4X1KB 2LXNA 5H80A 4RV5A 2DPMA 3NTQA 4UBKA 3OKAA 2X58A 4FDTA 2WG0A 4LNUB 3U3RA 4AVYA 3R9KA 5F7OA 4RVGA 1O08A 4OLJA 4RF5A 4C7KA 1CEYA 4KKVA 3PNYA 4PYQA 2A2ZA 1KQPA 3HSYA 1AC5A 1OYWA 1ZI8A 3BA1A 3STTA 1YF3A 1RE0A 3I34X 3O1JC 3Q7EA 3UJBA 2AF4C 2BZSA 2EKPA 1X1SA 1Z0DA 1N7IA 2PHZA 1X1QA 2BBOA 3N3AC 4ZT4A 3NBXX 5HKOA 5LQKA 3AIIA 5KS2A 10MHA 4WW0A 1L5VA 4K86A 4EF5A 5L3VA 1QO7A 2VYQA 2OO7A 2BFDB 1D1PA 4GYWA 1AGYA 2VJLA 4CL2A 1IU9A 1XBTA 3HJTA 5DI9A 3PI6A 4PBSA 4ARUA 4F8JA 4HUJA 3CZRA 3HBNA 3L82B 4PIVA 4WJLA 4CCYA 3IP6A 3UW3A 4KGVA 1ISMA 3IHLA 4YCDA 3ZEIA 4ZOQI 3W79A 2QTRA 3V8MA 4NU5A 2Q5OA 4QPZA 1K1EA 4J2OA 2GZHA 1I3LA 4TVBA 2IWHA 1S1MA 4DAOA 2WD7A 3CNEA 3P2IA 3DHEA 4FFPA 1OFTA 5EZYF 5IC5A 1JLRA 4ER0A 2ZTSA 3LT5A 1DTEA 1R8YA 5KYNA 1COZA 4P7GA 4EY3A 4QHTA 5FTNA 1FDSA 3V4VB 2WKRA 3BGVA 4CFYA 2GPTA 3I5YA 5GIPE 4RX1A 2VP0A 4K9QA 1DINA 3OLWA 3M6MD 4MUKA 1NBEA 2Q9CA 5KKCA 3EOAI 3DAPA 1RWVA 2Q46A 1DAOA 2VSYA 5F35A 5AVRA 3TR6A 2Z1DA 3BTSA 3N2GA 3OP1A 3UXHA 4EMTA 5B6IA 2NUTA 5IUNC 2AN9A 3ZZNA 5MFZA 1PVVA 4IDDA 2R8EA 1EWQA 4CM9D 2GEUA 4L75A 4DLSA 4LKOA 2I6QA 3EVCA 2XMQA 3TMKA 4PFJA 3EQ7A 1UKEA 3DBHB 1NOJA 5HPYB 4P36A 3PTLA 3K9BA 2P67A 1SXGA 3D8HA 4E1AA 5CBKA 3S27A 4YCMA 3K70D 2WWTA 4YV0A 1YZFA 1QK5A 1GTSA 3FOEC 4D1YA 2LPMA 3PD0A 4EPVA 1T1SA 5DZSA 4B3IA 2E5FA 4IO0A 5BWBA 2IUTA 5JCZA 4BNJA 1GFSA 1BN6A 3QPWA 4BMCA 2XYPA 5FJIA 1R8XA 1SR8A 5C7LO 1V35A 1TK2A 1DTSA 4G5RA 3EPKA 3UMSA 4D4MA 1DBRA 4QXQA 1YQWA 2PBRA 3ONDA 4JT4A 4U00A 2QE7A 3JRXA 4X0EA 3SFVA 1L4GA 1PFYA 1EAYA 1AKTA 2REOA 1Z5WA 2E21A 2VHQA 4O1HA 5JC1A 1BYUA 5CBPA 4Z4CA 2GN8A 1MB0A 2IHYA 1PJZA 1KEUA 3D8BA 5FPKA 2ROQA 5KYVA 2C0CA 1YB4A 5ALXA 5TF0A 5A4IS 1H0HA 3HP4A 1UDBA 2B9EA 3A4VA 4JNCA 4HDAA 2WJ6A 1UFQA 4G63A 4JEHA 3HVRA 1LK5A 4J0KA 3ECSA 1XA3A 1VL6A 5EL0A 2H8GA 1QPBA 4C7XA 2PXXA 2WG2A 1NMEA 1CY1A 4KXLA 2XDAA 4Y1EA 3RYFB 1ODSA 1GNLA 2R6HA 4EUFA 1XJCA 4MWSA 2FK7A 5HK9A 1JPJA 3C1OA 4MVJE 5EWJB 3LW7A 1VHTA 2REQB 4DA8A 1A7JA 1E3DA 3OY2A 2L19A 4BYGA 1RC0A 1C9JA 4NBRA 4A9AA 2PL5A 1N2XA 1WDTA 2HDNB 4C5AA 1ZGJA 4KXYA 4EJSC 3OF2A 2D5BA 3N74A 1OZGA 2F4VB 1X3SA 1AZLA 2AZ4A 2OUKA 3O74A 3NETA 4QM6A 1LI7A 4QT0A 2FEXA 1IBSA 4X3OA 1TO2E 4OIFA 1GAQA 1SHKA 1TZ2A 5NLLA 1CJSA 2HLDD 3ND6A 1JDTA 4R9UC 3QF7A 3W04A 1RDFA 1XNGA 2R68A 4UVIA 1S7CA 4M6WA 3EVBA 3PA8A 1A9XA 1VJTA 1V7ZA 1G8PA 3DMFA 3PQEA 3ZXIA 4F9FA 5CFQA 3K7EA 3AB3A 2FZVA 3CKYA 3PGJA 5HF6A 3IPLA 4BDSA 3W6UA 2PR2A 4RVUA 1OXUA 4X5OA 4OK5A 3C8UA 3G2HA 4MLCA 3OX2A 1U8FO 1UQRA 4E3WA 1SO8A 3CRRA 4H7FA 4EF6A 4C1NA 4UUOA 1JZQA 2WFMA 5AJWA 3U3JA 1KERA 2PANA 4YS6A 3TXYA 3ED1A 3ZBTA 1WQ1R 2A7XA 3JTEA 4N5HX 2FEPA 4ZALA 4A82A 5FPQA 3ESBA 2GS9A 3MAAC 4HHEA 2BGMA 5BSVA 1EFPB 3MJEA 4JYBA 4OSEA 4TLAA 1P9NA 1TLFA 3KJHA 4RTOA 2GBLA 3IUEA 3T7CA 1PQPA 1L5SA 2AI2A 4F2PA 1D4AA 3I2JA 4YRDA 4C21A 2H1RA 1TAQA 2Z58A 1M3SA 1Q77A 2QOEA 3S99A 2MR5A 3FZNA 2NUPA 5EQDA 5GM1A 3VH3A 1GCUA 1I6MA 1I3CA 3CU5A 2QVLA 3CNBA 3HFJA 2FN8A 3T0IA 5BVGA 5EMHA 1OMOA 1UM8A 1WKBA 2QENA 3G23A 1HI9A 1JT2A 1ZH2A 3AZOA 2K2QB 2FFHA 3REOA 4MKGA 1FX0B 3W3AA 1P75A 4INPA 1EHIA 1JHDA 1KEEB 2PX6A 3HACA 4IZOA 3NNSA 4PU0A 4B34A 3UK7A 2KW5A 1Y80A 2WMOB 2I3AA 4FOSA 5JS2A 2O5EA 1KYWA 3DE2X 3NIWA 4IP0A 5IT4A 1JL3A 2F6RA 3BB4A 3SZ3A 2D59A 5IKXA 2WHYA 3HJBA 4BNYA 5HKKA 1WBJB 1BTOA 2C7OA 1Y5IA 3LLVA 1SC3A 3JQAA 1E6EA 1RPAA 2GLUA 5BWLA 3C70A 4M0EA 4PYMA 1J6UA 3UJCA 1S02A 3E7DA 1WXFA 1NVVQ 8ABPA 5CD1A 2Q8NA 3Q98A 1D0IA 2V7WA 3HCWA 3ZXYA 4DTCA 5KNCH 1QF6A 1M0TA 1H65A 4ENRA 4R83A 5ENVA 4AAYA 3S1LA 2R00C 5A4AA 1GAEO 1AX9A 1U9IA 3PEFA 2ZVDA 4X7BA 4MULA 4TKZA 5TQ2A 1G20B 2EFJA 3R44A 1MJGM 3RNOA 1JZSA 1DQYA 4R31A 1V11A 3W2FA 3ZPXA 4LJ4A 4B4OA 1DBSA 1X8LA 3EZ2A 3WHIA 4BLSA 5G2OA 3OOEA 4AYTA 1JRLA 5LC1A 5TMBA 4AWXA 3ZHBA 2VTBB 1F8FA 1IWOA 2H3HA 4HAUA 4OGGA 4LY3A 5TE9A 4JDUA 6ADHA 1AHIA 1UFVA 1ZD2P 5SICE 4HL6A 1P4RA 4KMOA 3PJRA 5C8YB 4W9NA 1E3IA 4FDAA 2FJUA 1U6KA 1FFYA 1AXRA 4GNRA 621PA 3ZCTA 5JJBA 4MV5A 2V03A 1BXZA 4Z7NB 1CXZA 3X44A 4W5TA 1C4KA 2CYAA 2AWOA 2ID4A 3GUVA 4XR9A 4B3CA 1Y6FA 2IXBA 3ABOB 5KOYA 3AH8A 2ZXEA 3KSRA 1ULBA 5KHAA 1RP1A 4XGQA 2V6MA 3AY7A 1EVLA 4WFQA 3U7EB 1TCCA 1VKZA 5AM3A 1D7AA 1N5RA 3V42A 3WLTA 4KQWA 4BO0A 1UINA 4CMCA 3PKZA 3AINA 3OQ6A 4Q3CA 2ZAOA 5EIBD 4YMTA 4KYTA 3THWA 2VXOA 1HZJA 2BDEA 3SZGA 4A0SA 3W5BA 4B6EA 1V47A 3N7AA 1FFCA 1GAWA 1CJCA 3E15A 2Y1GA 1WPGA 3OSZA 4OB8A 1JLKA 4EUHA 2IYYA 4RE5A 2COKA 1VCOA 3RLIA 3VOTA 2D8MA 4OHWA 1DQNA 4R2KA 5CHYA 4AJ4A 2AWNA 1XZQA 4O29A 1RHJA 3HKBB 2HRRA 4IIDA 1CR0A 3FTNA 3O75A 4G6ZA 3CF4A 2J3EA 4KBGA 5IYZA 1I6LA 1YCHA 3I5XA 1CY7A 3IT3A 3EC1A 4B44A 1AUQA 1GTL1 1UWVA 4QOHA 3IJEB 4E0BA 3G6KA 2X0IA 2G7MC 4E08A 5LOVF 1NFQA 1LSUA 4YJFA 3N75A 3PICA 2UZIR 1IXKA 5ICFA 2QXYA 4KSCA 2JGIA 1JBKA 2PBZA 3NB0A 3R7BA 3BRWA 2DQ4A 2G63A 4F11A 2DAPA 2IF2A 2BZ1A 2HB6A 2J5BA 3C4VA 3KWFA 4A91A 5A02A 3RVPA 1N8SA 3GFBA 4ZHSA 7AT1A 3EFOA 2IIVA 5KHOC 4PAQA 3HWX1 3G8DA 4GOJA 5GPBA 4EYOA 1TVKA 3R3YA 4TS4A 4FMCF 2FY8A 2VQDA 1QJ4A 1IULA 2HSZA 5A2QA 4AQ7A 4FBGA 1V96A 4J16A 4M7OA 2I3DA 5DE3A 4NDZA 2VUIB 3ICVA 2QB5A 3P4XA 2AMLA 2XWJI 4PYJA 4BQNA 3WRYC 1ZONA 1O77A 3OTGA 2OAQ1 3OI7A 3WK5A 4K40A 2P79A 2Z09A 1DCMA 2CDAA 4HWSA 4I9HA 2AOTB 4IR7A 3E05A 2A5YB 1VTKA 3EHEA 3IAAA 4LSZA 3GDGA 3H4TA 3AR5A 4P3NA 5LR6A 1W4LA 3M9XA 4FLFA 2GX6A 3DEAA 2OHXA 1C2TA 3PI7A 3GGDA 3R74A 1R7RA 1U80A 1ZIYA 2B34A 3F5DA 3H1EA 3NJ8A 4CDMA 1KBQA 1FQKA 3LCJA 4R7GA 1R3UA 4J0DA 2PH3A 4MQEB 3T12A 1UDXA 2Q8QA 2Y1XA 2ZCVA 3OU2A 5TGTA 1WZIA 2FZ4A 1C3OB 4AUEA 3HCDA 2X6QA 1YI1A 4R5MA 3ZU2A 4R8RA 2GASA 1QVAA 4KYIB 4XXHA 2GA9A 3JWHA 3RM3A 2TMGA 4IS3A 4S12A 4PE5B 5LM3A 4PAOA 3E9RA 2W37A 5TXGA 1W0KD 3I9V1 4JBGA 2SCUB 3HRHA 3DMHA 1BKDR 2JIMA 1NWHA 1YDWA 2P9HA 3I6ZA 1CDDA 4ARZA 2XKAA 3SSMA 3MC1A 1YQUA 1NVMB 4URWR 4K46A 2R8RA 4D82A 5T5QA 3PEYA 2I1LA 2B8JA 2YWFA 5K3DA 4CKXA 1I24A 1GKKA 2QMQA 4R8SA 4ALKA 1HL7A 1F17A 1A8UA 1ISHA 1FRNA 2AJBA 1EVIA 1SCQA 2AHOA 2C9YA 3WYFA 4W7SA 1HFKA 3AFIA 3WADA 2VF2A 2A0WA 2Z9BA 3QOYA 2PZGA 4ZAFA 4Q7EA 5EXSA 3TVTA 4QBFA 4P7FA 5FLYA 3JALB 3JATA 3M6IA 2HCRA 4UATA 4KPFC 2ZBRA 3GFVA 4BJ3A 3K9NA 1MGOA 1T9ZA 2EYUA 3UVEA 2JC3A 4NE2A 4ZCSA 1G60A 4LPKA 4WLOA 1U5AA 3FRIA 1Z3IX 3H5WA 4FE3A 1JDSA 3MBKA 4ZQIA 5BRJA 2QIPA 1FLNA 2AI3A 3OCXA 2OOSA 4JGGA 1YNSA 5FL7A 3ELUA 5B30A 4HNSA 1HMPA 1NUUA 1GO2A 3ZK9A 3AG6A 4NVRA 4PSKA 1XLTA 4YP7A 3AERB 2D4HA 3GQBB 4GW3A 4GOXA 4MCJA 4BNTA 1P5HA 3B3AA 1ZM2A 3QWAA 5EZYA 3EMVA 2Q5LA 2QRNA 3PJGA 4RZSA 4D5EA 4J6EA 1UKCA 5BN3B 3IJ5A 2XCSB 1U7XA 5C5CA 5AVZA 2DBRA 2Y0DA 3O8BA 1Q0LA 2PMWB 5EE0A 4BQRA 3R5FA 4CDNA 7YASA 4JJFA 1J1IA 3D4NA 4LZOA 1EB8A 1G8MA 1GHTA 4X95A 1P3Y1 4UM5A 4JQYA 5FWAA 4E09A 4JB8A 1CEXA 4CV2A 1O0BA 4X3PA 5SZHB 3VHQA 4OLHA 4AJHA 1Z4QA 1EFLA 2ZJ3A 3D2CA 3OECA 4HQLA 4O2BB 1SBQA 3LVFO 2XGOA 5ER6A 3H13A 4ED9A 3AESB 1G21B 1P2DA 5BQ3A 2JD2A 5K3FB 4GX2A 3T7EA 3PFWO 1Y5NA 1DO2A 2W11A 1MZPA 5BN5A 5DMXA 1V7CA 5D1HA 1Z9BA 2M9MA 4LXTA 2R6CA 5GGXA 3S55A 2CLHB 1NW8A 3REQA 4EKGA 5IWAB 2EJUA 1Q1NA 3I1JA 1AGXA 2WUDA 3QY9A 1L8AA 1XEFA 4UNIA 5ALKA 5IKPA 3D4PA 4PY2A 1EK6A 4I08A 1ENOA 1FS4A 1TIPA 2WJJA 3OQIA 2BKEA 4RGQA 4MR7B 4D57A 4TWRA 1GZ6A 1S3GA 2O8VA 3TZCA 1RAFA 3WDLA 5BSKA 2NVUA 1CUJA 1NT2A 2PT7A 4FGSA 3ERCA 1Y9ZA 3EIEA 5EJ7A 1VSBA 2JAHA 2OFPA 4TTPA 5CIWA 3QKUA 3NKFA 3QHQA 1G21E 4B6PA 3KVYA 4ZEMA 5KJEA 5HNKA 4XJVA 1E7SA 1GRRA 3CUWA 5FUXA 1PFGA 3DZ8A 3WWZA 3KEOA 4OQLA 4WINA 4XGIA 4UM7A 3RJ9A 1H1DA 3CUYA 4CQLB 4B83A 2PRZA 2BP7A 1SIOA 3DE3X 2YJ3A 1G59A 1RYHA 1PK7A 2YXEA 3DPSA 3IOMA 3Q7QA 4NYJR 1M74A 2XQGA 4WPGA 4HT3B 2CC2A 4BMOB 1T5OA 2C1XA 3RFTA 1RXVA 3LF2A 4XFDA 4N47A 1FS6A 2E87A 2PMCA 1W0JA 3KEMA 4AY4A 1LSOA 1R37A 3IV6A 4KOAA 4D6YA 1RZ3A 2VHXA 3H19A 3JRNA 5DHRA 3H8SA 4H3HB 4L4RA 5M04A 1M7BA 1VE3A 3IRVA 4NBKA 5UKDA 5JHGB 2YJ4A 3CEHA 3VBCA 1YRYE 3BTVA 4FONA 2OUIA 1Q17A 4WDQA 3SR4A 1P77A 2C3YA 5JOQA 1UPBA 3VHRA 3SQDA 3JQEA 1GR1A 3DJFA 2FKAA 2C07A 1G55A 1BU8A 2GETA 3FPKA 1WF3A 3DO8A 4EA9A 2O6HA 5F51A 1CETA 3GVXA 4YASA 1P74A 3KVRA 3MCVA 2W2MA 5JPIA 5K0CA 4F84A 2PGDA 4Y2HA 1WUTA 3HA7A 3JQ7A 2PGNA 4AWBA 4BC0A 3ND8A 3IRUA 2MT9A 1F06A 2A5LA 2I7VA 3J7AC 4NU0A 3HPRA 3HSSA 1OJ7A 3ZX5A 1VJ1A 2Q1YA 1GXSA 1D0VA 3ZU6A 2VQEB 1FTWA 5C2JB 4FU0A 1UKBA 1O95C 1MMFB 1HYGA 2AKYA 3JR3A 2PSJA 4LJ8A 4ID9A 5J2UF 1BMQA 4QPPA 4UMEA 5DF1A 3R9WA 2CMFA 2DLDA 1LQTA 1JYFA 1PEAA 5TNXA 3KDPA 3SKYA 2Z6AA 3FPGA 2NTJA 3FZYA 3M4NA 3PLRA 1B14A 4UTOA 1PRYA 3OP4A 1CFJA 3DCIA 3GDHA 2BGIA 2F1KA 2LZ0A 3BWEA 3F67A 4YO8A 3RUPA 4YJ2B 1BW9A 3K09C 5E8JA 1NJFA 2WP0A 3VTKA 1H2YA 1KH3A 1GL6A 1MH1A 2JFNA 3EVTA 5I9TA 2O8BA 3TDMA 4EG7A 1E99A 1QH0A 2NUBA 3IA7A 3DVAB 3EUEA 4L9RA 2B4YA 4URVR 3GA7A 2O2HA 1AO0A 2FDRA 1EUCA 4NBLA 4PYLA 3S8YA 1J24A 3SC3A 1ECCA 3BCSA 3PXAA 1JW9B 3EGXA 4ME6A 3NMUF 3J81k 1JIKA 1WY7A 2WWXA 1VRWA 3IC5A 3QVSA 1XTPA 4TTTS 4DXDA 5C1OA 4DIMA 4ITRC 4O2LA 4P7BA 5FJJA 1PU2A 2W9XA 3I45A 1QLHA 3KRTA 1A2OA 2GEJA 4EFMA 3V1TC 2VAWA 5K8UA 2PUCA 3SD7A 1RYNA 3B1YA 5T8KC 2Z4RA 4HFNA 1QBKC 1PDWA 4E3ZA 1W34A 3PX7A 3JYHA 4BMSA 5CM8B 1YHNA 1E0KA 3F47A 1RAEA 3ZD6A 4PW0A 2XNDA 2OQVA 3WWPA 3WLNA 4B2LA 3OZEA 1EGAA 1G5PA 1K8RA 1NMQA 1B6TA 1W2WB 1ZIOA 3LFHA 3VC7A 2HJWA 5JLAA 3FSGD 1C1DB 5EE1A 3MTBA 4UOEA 4S2EA 1H8EA 1L5ZA 2JJMA 4LBWA 4I50F 4K6GA 2Q5FA 4EPWA 4X92A 4LGYA 3RLFA 1KP3A 5JWRA 4KN9S 2IHTA 2IHUA 2BGTA 2O5VA 1RCTE 2XZTA 1XJ5A 2YWHA 3FUCA 2D13A 4O4IB 4KW7A 3HXKA 3WA7A 3VO9A 5FI0B 1GGNA 3AEQA 4V3CA 2WUGA 4X65B 1NIJA 3QP9A 3DOOA 4MK4A 3VC1A 2H8KA 5EP1A 4G5FA 1QH1A 2I3GA 3OE4A 1RJWA 1T0PA 1QP4A 5EYPA 2DR2A 4LAFA 3UIEA 3VKVA 1IC6A 3H1PA 2VXCA 1SCIA 4IDQA 3Q40A 1GGMA 2A88A 1P91A 1O97D 1XWWA 1Z2CA 3Q5DA 4A27A 5B1YA 4HGOA 5HUQA 5GOTA 1DOAA 2FGJA 3BGIA 2LKCA 3L7MA 2Q4EA 1GYQA 1KQGA 2QX8A 4D3YA 3VSAA 3EY4A 1M0EA 2VSFA 1XRPA 4H1TA 2CEAA 2DBYA 4R1NA 4KE9A 2A30A 3PIIA 4K0KB 2ZYAA 3CGGA 3AVPA 1U6JA 4CMIB 2ZRKA 4YCJA 2TMDA 3EWSA 3GD5A 3KLMX 3EH2A 5B37A 5JSUA 1JHXA 2P2LA 4FR0A 3I6IA 5BRNA 3I5AA 1VHJA 4RSMA 3C7CB 2MHCA 3M5CA 4X1YA 4RVOA 3OICA 1VL1A 9ABPA 5EN4A 5TQ2B 5F73A 4H59A 2W2TA 4DCSA 1IG3A 4XQGA 1V11B 1XCPA 3NC0C 4C0KA 3V8EA 2L0XA 1ZRNA 2CUTA 1NUQA 1W59A 1XTUA 3NHUA 2D5CA 3O95A 4IS2A 4TLCA 4GL2A 1LZLA 3O3OB 3SR0A 1H4TA 4J1SA 2JI6A 5HOQA 4I1PA 5IJ0B 3H65A 4MUEA 1OI4A 4HS4A 3DHNA 4KWCA 3HM9A 5H4GA 4OU5A 4XX0B 1BH6A 1B74A 4F3YA 1J9EA 3I01M 4RFVA 5JSZB 2IH4A 1D9XA 5I45A 2Q5JA 4F72A 4Y0AA 1GJRA 1WUYA 3E22A 2A9RA 5M3BA 4N9WA 3P27A 1YVUA 3A2KA 5E4YA 4YUVA 3TLGB 1JA0A 3COYA 4E4TA 4HDMA 1XD2A 2DHRA 4LJ5A 1D07A 2R86A 5IM5A 3CTMA 4O2AF 3DKPA 3T5BA 1MT0A 3BRCA 3GC6A 3N05A 2Q7XA 3NC4A 1E66A 1B8UA 1DKMA 3PUYA 3R6DA 4EB8A 2J9YB 4DG8A 3BSWA 3DT8A 1SXJB 2GVDC 3N2IA 2VHWA 1VZ3A 4OM8A 3BL5A 2A1UA 4QJBA 4GVXA 3TOXA 3V3KA 4GWGA 4XA8A 2ZRMA 4YONB 3YASA 3OTQA 1NL3A 4DEYA 2H06A 1IY0A 3L1HA 4OGKA 5FADA 1OBCA 2RBKA 3IULA 2GHIA 2NU8B 5JIBA 3GF4A 2O0MA 3GV0A 5JDCA 1UKZA 3UJ6A 1QYIA 2FMKA 5A7FA 1BROA 4B8YA 2HWUA 4WZBB 4M36A 1P8JA 3ZOKA 1E7YA 2C92A 3RAEC 3ZJ4A 1Z5ZA 3M4ZA 4WCFA 2G9QA 1Y7IA 3LPMA 1CS0B 1MTZA 5IYZB 3IALA 3L7LA 1J42A 2Q6LA 1FSSA 4TROA 1QAOA 2BKVA 1SHZA 4URUR 4EG0A 5KEIA 3LPDA 1UC9A 5JALA 2PAFA 1WKCA 1X2EA 1KO1A 3G9XA 4N5NA 1E1RD 1WCIA 1RRKA 3EGWA 3BQMB 3ELBA 1SNYA 3I9OA 2A5JA 3B7PA 5KI6A 3TLZA 2FF7A 2PD6A 3BERA 1F2TA 2FPWA 3GH1A 3IPRA 4UBMA 5B1HA 4EG4A 4TL7A 3K32A 1AKQA 4K9NA 2QN9A 4QWMA 4S1VA 5GVSA 2D1FA 4RF4A 1KVUA 1U0EA 2AGVA 2XT0A 3Q9NA 2QZ4A 3MJSA 3QPBA 3D1JA 4NPAA 3F6RA 4OU4A 5ECYA 1DQPA 1KJ9A 3EG9A 4Q7LA 4Q66C 1OKKD 1UP7A 2NZYA 4WZBE 3RC1A 4ABYA 2J07A 3SM3A 3ELDA 3WMFA 4LF7B 1VI5A 2RHGB 4TRNA 3OPMA 4M0UA 3UWKA 3BZBA 3BXGA 2D0OB 3CRQA 1NM5A 3ICWA 1FJHA 3M4JA 1THZA 4RY8A 3SR3A 1C4XA 4U9HS 4IRXA 1JR3E 1DJNA 1AQJA 2ZM6B 2GXSA 5FPYA 2AXQA 2GPBA 3OIUA 4CV1A 4BV8A 1V71A 3V2GA 3EBOA 4ZMRA 1DFIA 4NFHA 4KR3A 2HBYA 4M2LA 2PLAA 1MIOA 5CFRA 4GWKA 3BF7A 1L6IA 3O84A 2PZKA 5I7AA 3DXYA 2IYUA 3OO1A 1YFJA 3UPDA 3A70A 2ZRLA 3N6RA 3H99A 3SHQA 5JECA 3TFWA 1D9ZA 5F78A 4RMGA 4RD4A 3NT4A 2W2VA 4FZRA 2WIJA 2OXCA 5JQWA 2YV3A 3GEGA 1T2CA 3UYKA 4PFKA 1VE7A 3KE9A 4K6OA 5CVVA 1Q44A 2QVXX 4I2NA 3UA3A 5ELLA 1O1YA 1T2NA 3OM8A 2ORWA 2ACWA 3QENA 4KAFA 3VYVA 4DNXA 1V8PA 2R3SA 3H42B 4DG9A 4L7VA 4WBSA 2CE2X 4G0MA 3UBTA 4YHHB 4BLRA 1SCKA 4Y2JA 1AUVA 1QKJA 3RIYA 1C30B 1SCUA 4I99A 5LQMA 4ERNA 2G09A 3STWA 5JC8A 4GKVA 1RI1A 3SLGA 3H9BA 4JLBA 3E3LA 4ZDJA 3R3JA 2JARA 4CMAA 3ZI7A 2H0RA 1FPMA 1VHDA 3KUDA 4M9XA 4KMSA 4PXAA 3RPEA 3NM4A 1YZNA 5A4FS 3NR2A 1AQYA 5B64A 4QTZA 5JNUA 4XIGS 1FZTA 5AKEA 2AV6A 4AXXA 1P5FA 4KVZA 1O2DA 3DD1A 5AKIA 1LEHA 1QF9A 3QBJA 2V3WA 2X7XA 3BHIA 3PQ3A 1XTZA 2OFOA 4HOYA 1K3FA 1BS1A 4L1KA 1H85A 3IP7A 4AMUA 2HK8A 2FEWB 2WG1A 3GP3A 4GVPA 4IZHA 4BZZA 1WXQA 4UUNA 1LTKA 3KB2A 2X1VA 3N8IA 2BHSA 3H2HA 3HC7A 3OHMA 2BE7A 1EXMA 5BV2P 1Q7EA 2V58A 2Y4NA 4MI6A 1AB5A 4GU5A 1Y8RA 4MGZR 3H87A 3NWOA 1V26A 4MVJD 1H1LB 4C4RA 4HNVA 1JB1A 3FPEA 4FE4A 3E8SA 1ADBA 2LR0A 4Q05A 2P3SA 3IKVA 2GD1O 3MXOA 4BJ6A 3KKMA 4INOA 3E82A 2IE8A 3B60A 2X14A 2X0JA 4DWOA 3NUZA 3HI4A 4ZT5A 2WJAA 3RV3A 4KR0A 4DKXA 1HQKA 1A4XA 1UKVY 3HCEA 2A78A 3KYIB 5D51S 2VS1A 5CG2A 2QX6A 3JQCA 2P5TB 3ZW9A 1S8OA 4FX2A 4D45A 2YZMA 2V7EA 4MRAA 1Z62A 1KAOA 2C2YA 1ORIA 1L3CA 3O82A 1DIHA 4MR9A 5F77A 4D4GA 4P58A 2E89A 3DHWC 3EZ9A 3AJ9A 3TW4A 3QPUA 4XWYA 5EKTA 3RTDA 5ALOA 4ZREA 5JNVA 2G1UA 3KXPA 3FZEA 1QYWA 1G7RA 1XMXA 3PKJA 1VC2A 2HA6A 1ZNZA 3H18A 2BMJA 5JVDF 5CM9C 1L4KA 1GQSA 1QB8A 1K88A 5EKUA 4ITVA 3D0KA 1OVMA 3ZWPA 1AQUA 1FS5A 5DXAA 1TAHA 1XCGB 4M3NA 5P21A 4Q9NA 1CF2O 4NY1A 3GRYA 3RI3A 1ZM7A 1U7UA 2JJ8A 3L4BC 4ZODA 4B80A 2VUSA 3C1TA 1DWPA 2OO3A 2PKQO 3K9CA 3QVKA 3QXGA 4F2HA 4KIJA 5CA0A 5KSYA 1N0UA 1SBNE 3FDZA 3OESA 3V8RA 2IHNA 3LBIA 2PUWA 3F74A 4JLMA 2GAJA 2VC2B 5JRZA 4D9EA 1FTGA 3I92A 2DUWA 1BJRE 3IIEA 4PO8A 2NVUB 5B4TA 1Z39A 3ZDEA 2AL7A 2VSXA 2QTBA 3LKBA 4GOND 4HGYA 2C8LA 5DNAA 1RBQA 3EUFA 4MA0A 4OI2A 4QTTB 4A73A 2UVPB 1KR5A 4MQ5A 4EMBA 2I9KA 3ISTA 1QOQB 1BVUA 1UBSB 2ISSD 4J6FA 1C9MA 3E9YA 1BWPA 3OTWA 4IDAA 3ANNA 1CY0A 4N01A 5DBGA 3BUSA 1ZOPA 2G07A 3V4PB 1IHYA 2YWCA 1AO3A 2O2XA 4D3FA 2BF7A 5ALPA 5F64A 1LX7A 4YIHA 1PD1A 4GOMD 4RGVA 5J2UA 2O0HA 1K5DA 3KAKA 1X1TA 3AEKA 4EHDA 1PT9A 4NE7A 4FOOA 4DJFC 3LWBA 3RF7A 4EG3A 1S6YA 3DCYA 3UG7A 2RKOA 1SULA 2VQFB 3NO4A 1J70A 4NQRA 3C3BA 4TWBA 4Y2SA 5M7EA 4DRZA 3I3OA 3IB6A 1GZ4A 4R51A 1N2ZA 2OWEA 3EVEA 2FHPA 1L7EA 2XZOA 2P2CA 4M89A 1IIBA 5KSOA 1HEIA 3CPEA 4RKWA 3O4IA 5KTRA 2H5LA 4MA5A 4Y1GA 4OM7A 3B1XA 1D3AA 3WY9A 1YR1A 1AQ6A 3FNRA 1E96A 3JQ7B 4B8ZA 4EFDA 1W30A 2W2QA 3KR9A 4IH9A 1M6WA 2PSEA 4I7EA 3T8YA 3JY6A 2AX4A 5FB3A 4ZAYA 3HXOA 3D6VA 4D43A 1LSJA 3CBQA 1RRPA 5HBGA 3B5JA 1KTIA 1MRZA 3E5NA 3W5HA 2C31A 1J49A 5ABPA 2Z30A 5CXUA 4AZ3B 1ZUHA 5C9ZA 4NARA 4Z7QB 1ZD4A 3GUZA 4O08A 5BUCA 3PSAA 5IDYA 5JAMA 1HEYA 4N1AA 4Q47A 3SDBA 4Z4QA 3ONNA 5J63A 4M1TA 3TSWA 1Z38A 1B8PA 2NYAA 1EA5A 3NGXA 3PQ2A 3LXXA 5E4JA 3WJ7A 5AVQA 1T3SA 1P33A 4HDSA 2WA2A 2QTVA 2QZPA 1L5LA 4RULA 4I50A 1N5KA 4FFMA 1CJBA 1P18A 5IANA 1PZHA 3DZGA 4RANA 4QOSA 3A4TA 4U7HA 1PD0A 4GP6A 1J0XO 5LZ8A 2PM8A 1ZLYA 3C1UA 2COEA 4FB4A 1D03A 1NY5A 4HEA6 4DS3A 1M9NA 3QBDA 3N7UA 2BFPA 2JS7A 3FOWA 4C0SA 5K0SA 4U2GA 3I9JA 2FX2A 1DOZA 4ETWA 3VXKA 1QTIA 2BW0A 4HLDA 5AOVA 4RF2A 3F3MA 3BH7A 4X6YA 3AHCA 1R0KA 3ZWYA 4YAEA 1MW9X 4TKVA 3NFRA 4H6XA 2H59A 1FYXA 1WG8A 1X1DA 5HCIA 2V7XA 4YFYA 4IINA 1U90A 4MRRA 3MZ0A 2QUAA 2PUBA 4C4SA 1NU6A 3V9AA 4ZOAA 2AZXA 1U7OA 1MPXA 2EKLA 1P31A 1XDSA 1XFAA 2OZVA 1R00A 3O8QB 3B2QA 2C00A 3ICOA 4V0NA 1NW4A 4RYLA 3HKEA 1E1KA 1B4DA 2VRCA 1ETHA 1M5RA 1RBZA 5CR9A 3SEZA 3IBSA 3EE6A 2OG2A 2XQJA 1Z2OX 4IDNA 1ES9A 5DB4A 3VKWA 4FFDA 3C45A 2ZBPA 2QTLA 3X2FA 5GTDA 4YV7A 3Q9UA 4COKA 5C1BA 3FH0A 1SUEA 4QBKA 1XMIA 3R3ZA 2EBFX 2NV6A 2EFHB 3U3DA 4YMUA 3A9CA 3GLFA 4FCTA 2ST1A 3NCTA 2P9CA 3WSWA 3ZK7A 1Y9JA 2BFOA 5BWCA 4LOJA 4NS4A 3S3TA 2HIHA 1QG6A 4JGBA 4IGFA 3QE3A 4D9FA 1A69A 4MO9A 5DXFA 4J49A 3RRBA 1Y8QB 3D43A 1W4BA 3UANA 3UXMA 3THYB 3GHHA 3BIFA 2FB9A 2D7DA 3VMFA 3NH9A 2M6KA 3K2BA 3PWTA 5BQPA 4UJ3A 3PCRB 4OI1A 3EXG2 1BHJA 1EFKA 2UYGA 4BKOA 2EAUA 2O7NA 3A25A 3CC8A 3JQPA 4YMIA 5EIHA 3G2QA 1RYDA 2HR1A 3W6PA 1GDHA 1O5IA 4IV8A 5K51A 3VZPA 2ZYWX 2BBSA 2JI7A 4PNHA 5DIFA 1P44A 5EJEA 5DXJA 2QRVB 4BMNA 4BB6A 1VYUA 1MB4A 4KV9A 1GU1A 2QN2A 3DOEA 2VJCA 3WS7A 5FWXA 4MLPA 3CVYA 1EJ6A 1CP3A 2QQGA 1E3WA 3AVOA 4GLBA 4PLWA 5CA1A 2XB9A 2W4IA 4LC9A 4TL8A 1THGA 5DTMA 4I66A 2ZI5A 1WHSA 3CR7A 1O6BA 3NYQA 1PR4A 3WWYA 3A32A 1Y3DE 3GJ6A 3LLMA 2FSHA 1GDTA 2PXCA 4YDSA 2RHTA 4PAWA 1BMFA 2BT4A 1UDCA 3L8ZA 1N32B 4TOIA 1OQAA 4R1SA 1FJ2A 1AK1A 2ZTHA 4QDUA 4YROA 1LW7A 1KQ3A 2WD9A 4QFDA 2OSBA 4B5LA 3OPVA 4OGLA 5IK2D 2DFLA 4JROA 4RAQA 3ZGZA 3D1LA 3GUHA 1ZN2A 4HUQB 1F2UA 1VCIA 1P7CA 3N8NA 3E6AA 4PQYA 4OHRA 4GVLA 4YAOA 5BYAA 3II6X 2HHJA 5LOVB 1KZHA 4RA6B 1F2VA 3WB2A 1XT6A 2ZXUA 3W1VA 4IPTA 2RIPA 1FTSA 1VIMA 5LBIA 3ZVNA 2I99A 3A4NA 3PQ4A 3OJLA 3OQNA 2XD9A 4G4IA 2Q4BA 3B3JA 2X7HA 5KJ1A 1II8A 1M1NA 2NPFA 2PS9A 4J1TC 4HXGA 5FUYA 4DC9A 5L45A 2IEGA 1JAYA 2AC2A 4OJKA 4DWVA 5I7SA 1YVPA 4NR0A 1WIWA 2XTZA 2E4UA 4M4SA 4XYBA 4OBEA 1Y6QA 4XM2A 3ZD9A 3JQ8A 4FMCB 2Y4OA 3UT5B 1QCYA 1RE1A 3EVNA 1TMYA 4Z1MA 4JSRA 3IODA 3UICA 3VNAA 4MI3A 2FN3A 3G0BA 1E2EA 2YXDA 4EMUA 4WRRA 5ALWA 1OGIA 5FI5A 4EKDA 4UPVA 1DKRA 3KXLA 1PX0A 2OENG 1RXIA 3OTIA 4XAQA 1DTWA 3IP3A 2YIMA 1E3EA 5JJ5A 3DMYA 2XQIA 3PFGA 5PGMA 4BEVA 5DYWA 5G4KA 5JW6A 4LF9B 3AY0A 1V8ZA 3CURA 1FOEB 2A9OA 2VTKA 3PNVA 3O94A 4QREA 3G9TA 4Q1EA 3RUEA 1PT8A 4MZDA 5H83A 2GZ1A 2ZKLA 3DTTA 3KX2A 5DRTA 1OTHA 1IDOA 2GXAA 2OLJA 1Q74A 1M5UA 4TSKA 1JLHA 1NVWQ 3DOJA 1RPZA 3RRXA 4XWWA 1XK7A 3WLRA 1UP4A 1K5PA 5K6TA 3K9GA 3CUSA 2BFEA 1YS6A 2FYTA 3ORQA 1O9GA 3PXEA 3U7HB 5BT8A 3WR5A 2BJVA 4Z9YA 1GFIA 3CLTC 3RAPR 4O3MA 1U0LA 4LN1A 3G0IA 3MRVA 1CRLA 3T5DA 2DE0X 4C05A 4U2KA 3BMCA 4YB8A 4QFCA 3TW0A 2YIVX 4LXHA 1BCRB 1RLTA 1F4VA 2ZJYA 4QGBA 1IG0A 4AT1A 5AI0A 1RQLA 2JFHA 4MP6A 5C7OO 4EDHA 2G88A 4FEEA 3E8XA 3QI2A 4O4LB 4Q4LA 3UT0A 1IOZA 2PSFA 3E9ZA 1ZITA 2HLPA 1GU7A 2ZJ0A 3O8NA 4C06A 5CFMA 3MJCA 4KPUA 3C1AA 2P6OA 4MRMB 4IGKA 2VHEA 3TUIC 5A04A 3IIKA 1SC9A 5CNIA 4WCDA 4YYZA 1ZG3A 4JBXA 2R8OA 1KJQA 2WYWA 3C6QA 3IAM1 3IEXA 1MGPA 3SM9A 1KVRA 4GRAA 4Q4HB 1KPIA 3TJZA 3B13B 2Q1WA 3ASZA 4Z51A 2IP4A 3EGVA 2PXAA 1Z34A 3E81A 3FJOA 4ZKDA 4YRSA 5FV4A 2WNSA 1AXGA 3DKIA 5I9BA 2XCOA 2QDXA 2CDBA 4W7HA 4ZI7F 5JISA 1A8HA 3OCVA 2P4EA 2WF5A 4KMRA 2IOYA 5JPCA 3PPYA 3HKCA 5EGSA 2QX9A 3SY8A 3VR4A 2JH9A 3PC4A 4EH1A 5HUJA 3D7LA 1U1CA 2BTQA 1AS3A 4M21A 5IDWA 4A5OA 5EHNA 3BILA 4Q21A 3CH5A 2GGSA 4D0GA 1ESEA 1UWLA 2Y76A 4KSYA 3LG2A 1L7RA 2EDAA 1U98A 1KK0A 4B85A 5L3QA 3ROZA 5KC9A 1AK2A 1P7WA 2GJKA 4N8EA 3EYWA 1P4JA 2PWZA 3OUTA 4W82A 4ZTBA 1L8XA 1M8JA 1PO7A 1BQ3A 2NIPA 4LJKA 3MMPA 5BY2A 2WJ3A 4FFBA 1TIKA 2O7RA 2ZZMA 3C97A 2RHCA 4ND7A 1ZYUA 4YP1A 3SZMA 4JJ4A 3A6KA 1F9EA 3TEFA 3K0FA 4L7QA 4FJ0A 1ODLA 4YX9A 1GCGA 1VL5A 4JVOA 3I04A 1T2FA 1AGPA 2DWUA 3NHSA 4HEJA 3KAJA 2ZIAA 4WOCA 5CX4A 4G5XA 5JVDA 2BI4A 1NQVA 4EYKA 4KPYA 3OPQA 1G4AE 5ERXA 3L7OA 1H9CA 3ZD8A 1QZTA 2R1TA 4FZJA 1JBQA 4XDYA 4YCSA 1H23A 3SYMA 1EGQA 4RA9B 4W5QA 1JQ5A 3DYBA 4JOQA 2PE5A 2K7FA 3DBVO 1U1DA 3R3HA 4FIZA 4GSLA 1W5AA 4M46A 4TKUB 5IAJA 1NIPA 1X8XA 3K6RA 3QEBZ 4YGYA 5CUQA 3FB4A 4BIIA 5E3IA 1HLFA 1CUAA 1R4AA 4ZAVA 3KUUA 2Z9DA 4EHLA