1ES9A

X-ray crystal structure of r22k mutant of the mammalian brain platelet-activating factor acetylhydrolases (paf-ah)
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
212
structure length
212
Chain Sequence
ENPASKPTPVQDVQGDGKWMSLHHRFVADSKDKEPEVVFIGDSLVQLMHQCEIWRELFSPLHALNFGIGGDSTQHVLWRLENGELEHIRPKIVVVWVGTNNHGHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLPRGQHPNPLREKNRRVNELVRAALAGHPRAHFLDADPGFVHSDGTISHHDMYDYLHLSRLGYTPVCRALHSLLLRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PLATELET-ACTIVATING FACTOR ACETYLHYDROLASE IB GAMMA SUBUNIT
publication title The functional implications of the dimerization of the catalytic subunits of the mammalian brain platelet-activating factor acetylhydrolase (Ib).
pubmed doi rcsb
molecule tags Hydrolase
total genus 77
structure length 212
sequence length 212
ec nomenclature ec 3.1.1.47: 1-alkyl-2-acetylglycerophosphocholine esterase.
pdb deposition date 2000-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13472 Lipase_GDSL_2 GDSL-like Lipase/Acylhydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 1es9A00
4JGGA 3DT9A 3DT8A 3MILA 5HOEA 4K9SA 1PP4A 4IYJA 4NRDA 4RW0A 4Q9AA 1Z8HA 4RSHA 2WABA 3BZWA 4I8IA 4K7JA 4M8KA 1ESEA 1FXWA 4PPYA 1YZFA 2O14A 1J00A 4DEVA 1VJGA 2APJA 5JD3A 1VYHA 2Q0SA 3SLRA 1ZMBA 3DCIA 2WAOA 2HSJA 5CD9A 3SKVA 5BN1A 1DEXA 4LHSA 1DEOA 4TX1A 3P94A 4Q7QA 4OAOA 3DC7A 4H08A 3RJTA 1U8UA 4K3UA 4JJ4A 1ESDA 3HP4A 5B5SA 1BWQA 4K40A 1IVNA 3KVNA 1ES9A 1K7CA 4JJ6A 4XVHA 1BWRA 1JRLA 3PT5A 1ESCA 4HYQA 2VPTA 4JHLA 1BWPA 1V2GA 2W9XA 4OAPA 5A4AA 1WABA 3C1UA 3DT6A 4HF7A 4S1PA 2WAAA 2Q0QA 3U37A 4JKOA 1FXWF 3W7VA
chains in the Genus database with same CATH superfamily
3THXB 3Q3HA 2OZKA 4NQZA 1XEXB 4IQ4A 4DREA 4UKDA 3K9GA 1XBTA 3I04A 3QBDA 4G41A 5EJ4A 1Z18A 4JBHA 2XIQA 2VAXA 1IBRA 4KPUB 3TZKA 4RMIA 1QVWA 1L7NA 2FW9A 3RIYA 2AF4C 3COWA 3L46A 3TAXA 3LUPA 2QN8A 1YGPA 2R84A 5DF1A 4OHVA 2XVMA 3CKKA 3UHFA 3EQ9A 1I6LA 1LVUA 2WYWA 1ZIOA 1X74A 1X7XA 1P0QA 1M1XB 4GEGA 5CTAA 2Q3LA 2Q5LA 3L93A 2WA1A 2IEBA 3VR4H 4HT3B 5JYCA 3AEQB 3WS7A 1AQNA 1QB7A 1AIPA 3GCXA 1H5NA 2RFLA 4COKA 1Q16A 4ZJYA 4XWWA 1GA1A 2OFFA 3S29A 3VX3A 1JKMA 4MNTA 4NNOA 2CF6A 2AR7A 5GZ1A 3C45A 1EFVB 1VYHA 1RI5A 3EYAA 4PWZA 4EFLA 3VGPA 4MDYA 4EF6A 4YR9A 4RACA 2F1IA 2QTWB 5I7OA 3C74A 3QFHA 1D1PA 3LKZA 2FEOA 1GKIA 3UUGA 4QYTA 2WHXA 3HWSA 4ZAYA 4YRKA 4J3JA 2NXCA 4D57A 3OI7A 1IPFA 4HYTA 1OXKB 3VOTA 1Z17A 1LA2A 2ZTVA 4PXSA 1OI7A 3IA2A 3IAS1 3ZPXA 2PZJA 1JT2A 3UT5A 2FRVA 1SZCA 2QRLA 4RV4A 2RJOA 3QPDA 4DSNA 5B1EA 2FEXA 3FTEA 3CSSA 1ZW1A 2OP0A 4DANA 4YJFA 1I3OA 4BQPA 3DOIA 4YPOA 3PPXA 1PFGA 4PG7A 1PV2A 4AJNA 4N6OA 3QLJA 4HAVA 1QGED 3H2ZA 3V4FA 3ASUA 5ALNA 4YRFA 1KGDA 2FUKA 4UEKA 3V3KA 4QBTA 2OLKA 2JCYA 3REQA 2AHRA 1SN7A 1XDGA 1HKHA 2QLFA 2ZRHA 1C2YA 3FKJA 2QUKA 2IOFA 4DCGA 4L3WA 4P0PB 1CDOA 3I0MA 4QPPA 4RKFA 3MJDA 1OFTA 2A9KA 4EGSA 4LRQA 4CEJB 2ZJBA 1EGVB 1RLTA 1G60A 2ZM5A 3O2JA 4JGBA 5JSFA 3D1LA 3I52A 1CZNA 2GZ1A 2GAJA 4CR7A 2FGKA 3BMNA 1ZJYA 3I5YA 3GGDA 3FNRA 4URUR 3KQNA 1H6CA 3EUAA 3WYNA 1T0BA 3HI4A 5A6SA 5I7RA 1SEVA 1I24A 2WNSA 3ZV6A 3IUMA 2NUTA 1CRLA 1M1NB 1PUXA 2HZBA 1PL7A 2JKVA 4KH1A 1QM5A 2A3RA 4WRRA 1E2JA 3CLTC 3L0YA 5ERGB 2X19A 2ZSDA 3NVAA 4ESVA 4C04A 2Y1OA 3NHWA 1F8GA 5JCOC 2YW2A 5LBUA 3HB1A 4PAQA 2CHFA 1C1HA 1WABA 5ANRB 4YIHA 3CH4B 1O94C 1QO0D 3R3ZA 5DISB 4BMSA 4LJKA 1TX4B 2RHGB 2ZUVA 4L4YA 2GD6A 5BN4B 3N3BC 3TZHA 2AWOA 3U3DA 4BV2A 5HFAA 4F5DA 2BFCB 2ZRMA 3W2FA 1B8NA 1A7KA 2NTJA 2XXAA 3GUUA 1ZJ4A 3HYCA 2ZIXA 2E9SA 3KIPA 4FBLA 4N01A 5CNMA 1W49A 2PX0A 1QPGA 4YRTA 4DT1B 2VHCA 1GNQA 2MYNA 4NFHA 3RYHB 2GPSA 4OI2A 4OHMA 3WXBA 2E37A 1ODTC 3RC2A 5A1JA 2ZBFA 2XE6A 2ACWA 1CTQA 1FMLA 1D2AA 1EK1A 1YZHA 2IT1A 3L6EA 3NPMA 3KSDO 4HQLA 5H70A 4JLPA 4ZAWA 2XNHA 3EPPA 2Y71A 3IEUA 2QUIA 1TEXA 1VP3A 3FSRA 4KQHA 5JSYA 3P96A 3V4RA 3W1EA 3JZAA 3F3YA 2ZT6A 4QA9A 3AESB 1XRMA 1TW3A 3UNXA 2QYTA 1RYHA 2G80A 3KEFA 4OU4A 5DKFA 1R4NA 2GYYA 1BJTA 2CUTA 3IALA 1U81A 4ZU3A 5IAJA 3S7TA 3URKA 4CDNA 4MPDA 3KPJA 3DE4X 4X84A 3DTVB 1SO8A 1UC8A 3IQXA 2OGSA 3B3AA 1G6OA 2VDKB 3KALA 4MQFA 3OJEA 4PBTA 3FHJA 3OF5A 4DRZA 1OI4A 3EF1A 3IV6A 1EP1B 1JIQA 3VJKA 1X87A 4RDCA 2AZDA 1NLYA 5CIQA 3T95A 2GRJA 4GOLD 4GX0A 2R5FA 4YASA 3FW1A 2GBLA 1PJTA 4J4HA 1NP6A 4RGBA 2WILA 4M98A 3HB4X 1PG0A 2PMFA 3E4CA 1I7LA 2GWRA 4QSHA 4TN1A 2QM7A 1W85A 4MW2A 2LD4A 2DSTA 4I4TB 4YB8A 3NTRA 1RRVA 3ML1A 3L7KA 4RVOA 5DE3A 2VYCA 4O8ZA 1KI7A 3IQWA 3KB2A 4M87A 1SCUB 1C1DB 5DOZA 3WRVA 1LEHA 2P9CA 4NDZA 5KJFA 2V1UA 5I4KA 1T0UA 1KP2A 3K94A 3PFNA 4OHKA 1X0VA 3UA4A 4KAJA 2WWRA 3EBLA 5DTIA 5IYZF 2Q5IA 4F7DA 3AYZB 3GD5A 5DI3A 3O9MA 3RS5A 1UJCA 1CF2O 1QVAA 1V5WA 2W48A 3DBVO 1XOIA 4JJ4A 4M22A 4OHCA 4H1UA 4RABA 5H02A 1ZR2A 2V0CA 4HVLA 1T5IA 4RKRA 1TK2A 3BCRA 3GLGE 1J8VA 1ZCBA 2QTBA 5F2EA 1LPNA 2FYTA 4LOJA 2WMYA 4WOCA 2PSEA 4MA0A 3N7UA 1ZNQO 1MQSA 2K6GA 3HCPA 4LV5B 4MYTA 4Q9IA 2NGRA 4GM0A 3R9XA 1A77A 1LTKA 1V3UA 1XDUA 2VQDA 4K87A 1BWRA 4O1HA 1GLVA 2IYLD 4KVAA 4BQRA 3DLCA 3SNKA 5K3EA 1F3LA 1FQWA 1Z4OA 4YRPA 1VC2A 1PZNA 4C4TA 4Y1FA 5D5PA 3VO8A 3R7BA 3V2HA 5C8XA 3T1NA 3M49A 2Q9BA 2OCAA 3RRZA 3W4KA 4EG5A 5JMWA 4CKEA 1T2VA 2BR3A 3FFXA 2VCYA 1KZHA 1CF4A 3E3AA 3A36A 1QHSA 1YDEA 3GT7A 1CY7A 3TXXA 3REGA 3GGJA 1V8DA 3EZGA 1JEDA 5EMJA 4F2WA 4PW0A 1RQPA 2ECKA 2IXAA 4DADA 5KQLA 1RWKA 4K9OA 2ZSHA 1G19A 2LZ0A 1ZGAA 2YFHA 2C7BA 1GPNA 2ZSAA 1OC2A 4EKYA 1B8PA 5A4DA 1OXVA 2P4UA 2JFYA 1ZESA 4JZKA 2O2ZA 1YB7A 3ZG6A 4GP6A 3SS9X 1E2DA 3FDJA 1I2DA 3IR6A 4Q1CA 4GGMX 3VZCA 3W6ZA 1NP7A 4HWOA 2QSJA 3AETB 4XJSA 4L9SA 3MQ2A 1ZNZA 3RRFA 2QTAA 3CRRA 4OHBA 9GPBA 2RH9B 3CX4A 4KIGA 4P08A 5FL7A 5FKJA 2GRUA 4PX9A 3ER6A 2H2DA 3OE7A 1L5VA 2IYQA 4KNYA 2QZSA 2ABWA 3G9UA 1U2SA 1NJ6A 3K1AA 2WI8A 4TSFD 1USKA 3QKWA 2A14A 3R0ZA 4CCYA 1DOHA 3SN6A 1E2UA 1JN0A 2O5VA 3EXIA 3G9ZA 5CURA 5GV7A 4ALMA 1NJFA 2P9JA 2D0OB 3F97A 3QITA 4GW3A 4DRXA 1GDDA 5F2KA 1OHHD 3BWVA 2NTEA 3ASZA 4C0AC 1YQTA 3RT1A 4YRBA 4YV1A 3VHXB 3MTBA 2PNJA 4UCFA 2QTGA 2O8CB 5IK2A 1EUDB 1IM8A 2Y0PA 3KAJA 2J4CA 3OT4A 3QYAA 4G07A 4PC1A 3UN1A 3EIXA 3NETA 2J07A 3LUFA 2P5UA 4HAWA 3QVOA 5DCLA 2XYHA 2Y3IA 1VBMA 2HH9A 3KLMX 5WRFA 2QG4A 5IBRA 1VMKA 1Z28A 1DQPA 3AVXA 5E0KB 3WK8A 2C4NA 3L01A 1F2DA 4BC1A 2Z04A 3VC7A 3FM9A 1L7VC 1XEXA 4PNEA 2WPNA 4URFA 1AH2A 1UEJA 3L1IA 3DB2A 1X7WB 3Q72A 1VL6A 5ES3A 3I05A 3VTKA 2QJOA 2Q3MA 3CZ4A 3HN6A 2GBFA 3Q8KA 1XQXA 1PJAA 1RZVA 4KPUA 2KPOA 4Z3DA 4P8RA 4Q21A 4GP7A 1K3FA 2YCBA 2F7SA 5FPSA 4DWVA 4GXQA 2C5EA 2ILTA 2WVAA 4RDXA 4CG2A 4JT9A 1G8HA 1U8XX 4CLOB 2XWSA 1EXVA 1VCOA 2BEWA 1KVRA 3NTUA 2GYUA 4LOKA 5E2BA 5HW0A 3OTOB 3NM5A 3MRVA 1OZ0A 2WU0A 2DUUA 3AEQA 1TJ5A 4HWPA 4NCHA 3BJRA 5LMNB 4FXOA 1SC3A 2GFIA 3IFSA 2EDCA 2HPVA 3ZZTA 5B3KA 1PJLA 1FFSA 4BNWA 1NBEA 1IY1A 1U6JA 2SCUB 4JYMA 1PZFA 3C7AA 4Q4HB 1EFVA 1JHRA 2P77A 5TE9A 1SQFA 4KHPB 2IKQA 2L69A 4ZI5A 5TMBA 4DHEA 2OHXA 2QLBA 2VHQA 4P80A 4AJJA 4C5CA 2HCJB 4P7GA 3CX7A 3T7AA 1ZD8A 2F1KA 1SD2A 2BGRA 4EUSA 1UBMS 2C07A 2QX4A 1AV7A 3MBOA 3PP8A 2V4UA 1K92A 4Q3KA 4RVHA 5I7VA 2AWNA 2C3UA 2HRBA 1A72A 3MMNA 3NUQA 1FSPA 2Q4OA 2PKCA 3K8ZA 5L4NA 2J3MA 4PSVA 3WIBA 1JEQA 1VPLA 3L18A 1G8KA 4B5KA 4YRGA 5C5IA 1ID1A 1LV8A 3PCTA 5EL0A 1QYCA 2KS6A 4UE3S 1NJSA 3ZDFA 1BWPA 1CR6A 2X58A 1GNLA 3QOYA 4EG6A 1QF7A 4D9GA 3TZEA 5ALGA 3ESYA 2RARA 3DBRB 4EY5A 2C54A 3NIDB 3U7HB 4NWIA 1DE0A 1IDN1 3FZYA 5BV2P 4WNYA 1U2DA 3RFVA 3T3EA 1VLJA 5IAOA 4ZEOA 1PS8A 4TYQA 3PFHA 1X1RA 4PSCA 5JSKA 4CEJA 2NQTA 1C9EA 1UC4B 3JQBC 3MAAC 3R5KA 3C5HA 3WIUA 1XJWA 3IGFA 1IHYA 3UOWA 1DBSA 4DG8A 2FGJA 2DFTA 2E89A 4QYMA 3WYDA 4Q6WA 3OCWA 4BQEA 2BFFB 3NNSA 4P32A 5EIXA 2NAPA 5KOJA 3DL0A 2A35A 4IHKA 2P1ZA 4OQLA 1Z8DA 2VUSA 1E1KA 3S55A 3A2NA 2D0IA 4Y9DA 3EXAA 3IOEA 3TEMA 3KR1A 3HJUA 3IVCA 4UPVA 3T6KA 3ZCSA 4BQFA 4ECEA 5AUOB 3E8XA 3K7EA 4YMWA 2EFGA 1F7UA 1OWLA 4QPNA 1VJTA 1BYIA 3QF7A 1RJWA 2EL7A 1Y5IA 2Z09A 3KKEA 3QKRB 1HXHA 1XXLA 7REQB 4BO3A 1TO6A 4AWAA 3PFWO 3LUAA 4UUOA 3B8EA 1DS6A 1N3BA 3EODA 3RB8A 2EWMA 2P9ZA 2JFQA 3DXFA 3GJXC 4Q3LA 2BFCA 2Z30A 1WUHS 3IJRA 4CQMA 1ECPA 2J7PD 1MVNA 1L5WA 4RWEA 1EFUA 3AR8A 4IJVA 4KQFA 4MGHA 1T36B 5JS7A 3UMCA 4DT1A 5E9AA 3NGXA 4BO4A 1QS0A 1O9GA 4MLZA 1DEXA 1OBCA 3RYHA 2YRWA 5EHZA 1JT9A 3RC7A 4IJMA 2MTBA 3BORA 1S2IA 3S0JA 2B94A 4BY9E 1BGVA 2W2LD 4PS1A 4RULA 1JMYA 1II8B 2IYPA 2IEIA 4UVGA 4G1VA 5D3KA 3GJ3A 3ZKWB 4LFAB 2HK8A 2G82A 4JUCA 4JR1A 3VDXA 1HOXA 5KU1A 1V1RB 4LOHA 2ZBPA 4I81A 3ZWQA 4BV9A 4JJZA 4CQNA 1LNSA 3OY7A 3IP8A 2A7QA 2WWWA 3UHOA 3EFOB 3MCVA 2OSVA 2WVHA 1DJQA 3CJRA 3OO1A 2BKEA 4XEHA 5GV8A 3TTXA 5IYZB 1UFOA 1KNXA 2C9CA 1E1NA 1R1DA 1THTA 2B1GA 1BVRA 4L9RA 3IILA 5E38A 3E70C 3ZVRA 5KJ6A 1RYBA 2FH5B 2QX8A 2P9GA 1TM7E 4WUTA 5LP6C 5BQFA 4DV1B 3EPLA 2CCKA 2XKKA 2WFZA 4PZYA 3ZWAA 3I62A 1M7HA 4QYXA 1GFSA 5EE3A 3UGKA 2X0FA 3H2HA 1PLLA 5BQ5A 4ZZ1A 4AVYA 2C78A 3T1VA 4C05A 4FN5A 2HR1A 1SA0B 3LSTA 2X23A 3FIJA 3IQZA 4KAXA 3SI7A 4WCVA 3L84A 4ENPA 3OJXA 1I1OA 1RQ7A 4Z1MA 5NULA 3DKKA 1CV2A 1Z68A 4BX3A 9MHTA 3EPHA 1C1DA 1L3CA 5IVIA 5JISA 5A4KA 3KSRA 1TUEA 3BHMA 3A9WA 1F2TB 2QL6A 1NUQA 3JQAB 4BEVA 3A3YA 1WW8A 1AUOA 1EWQA 3OIWA 2GQ0A 1SBHA 2PH7A 3L4SO 1R0YA 2CNLA 3OJOA 1CDZA 3DMRA 3G8YA 1E7SA 1IRIA 2WG1A 4G5OA 3DR3A 4TLLB 2P90A 3DZBA 4YQYA 3RKUA 1DCTA 2BI7A 4KLNA 1LB1B 4J9UE 1YHZA 4KQGA 2IXGA 2NXEA 4LQCA 4PG6A 1E3QA 5ULLA 1KPHA 1TA0A 4PPFA 1QGDA 4TYPA 5K0BA 4JKOA 3A3NA 1I36A 2PSHA 4FE3A 4BCBA 2R62A 2WUWE 1CUSA 1GAJA 2COUA 1AO0A 1I94B 2HA5A 2HDWA 3E3OA 3L49A 2G8LA 2QD1A 4RL4A 5JAUA 3LAWA 2FZVA 1RHKA 4RF2A 1A9XB 5KC8A 1RC1A 5BSTA 5ENZA 1ZHFA 2ADOA 2V58A 2FZWA 1RJGA 2RGXA 2G5GX 4ZVPA 4A36A 3UV7A 3KKZA 4LHWA 1XN1A 4PQYA 5I01A 3HFJA 3QXGA 4KVZA 3DMYA 4DV7B 2WPDA 3VZBA 1XYYA 5EMMA 3F73A 2PEZA 1KSGA 3G2QA 3FSGD 1ZN2A 3SJ7A 3KYCB 3OQNA 2OCGA 2VATA 4BCDA 3KDPA 3RABA 2Z5GA 4TKLA 4DL9A 4RH1A 4BNHA 1E79D 4HB2A 2V98A 4ZOBA 3K1TA 1SCAA 4IWNA 1ORRA 1C50A 4Y2HA 4BTVA 5IPFA 2UZ0A 4E2ZA 3PQ8A 3ILYA 3LQFA 2V7XA 3UBMA 1HFEL 5ALDA 2PV0A 1FRNA 5AW6A 1RYFA 1UMBA 1B6GA 1NQAO 4DDWA 1T8UA 13PKA 2FRDA 1IL0A 1YS4A 2YN0A 1XNHA 3GBSA 2EL9A 4RTJA 2YR0A 2WFMA 2X0RA 3Q7TA 1B73A 1NLZA 2QM3A 3L1UA 4GKAA 4IEFB 4LZJA 5ALEA 8AT1A 1V45E 3LC7O 3W5SA 1K89A 2PRKA 3ZWMA 4G4SO 3QPVA 2BUCA 2BHTA 3CUSA 1VBFA 4DC1A 1JFFB 3CKMA 3CY6A 3Q7IA 5KYYB 4LJSA 1ZR4A 4GBGA 2UUBB 1N6RA 4R2LA 1PW7A 4LSGA 3NDPA 4N3GA 4BZXA 4D4JA 4XYLA 2YN2A 1KI8A 2FWRA 1UKEA 4JWTA 4NATA 1XR3A 2J30A 2D5IA 2RHHA 4P1ZA 3PD0A 5SICE 1IYZA 5KTYA 5LZ4A 1NP3A 2XE4A 1AZLA 2EBWA 3OZBA 2L82A 3DDHA 1T2DA 3LLMA 1GQFA 1Q0UA 2OG1A 2XUIA 4OGKA 3IPYA 1KIAA 2Q27A 1HFKA 3OEHD 1QYWA 3JWPA 3GHHA 2FMUA 1X7WA 3I83A 3I39X 3ZDEA 1U0RA 3AR3A 1XRJA 1P44A 2L18A 1G8MA 2EATA 3LUCA 4XUEA 2O7QA 4C0BA 3KWJA 1Z5UA 2QV0A 1AMUA 1F4VA 1EINA 4B0OA 4CIWA 3LO5A 4G0WA 3ROMA 3T3PB 1RACA 4ZP1A 3DCNA 3TZLA 1AD2A 2DY1A 4CLOA 5FAKA 4NOLA 5C52B 1PT8A 2HU8A 2IZ1A 2DTXA 3KTOA 2ZRQA 3D7LA 2FSVA 4IFBA 4K6KA 1RLUA 3BIWA 2CBXA 3GQBB 5JC8A 4H3SA 5C7IO 1YV9A 3D8HA 1E3WA 2NQ8A 1N2CB 2RC5A 3EVDA 1RHRA 1T9BA 1A8SA 1I5EA 5EP4A 1QRTA 4TMYA 5JMPA 2SCUA 4FYPA 4EHNA 4HX9A 1NYTA 4MZXA 4Q4HA 5CLLA 3NOVA 4PZ0A 5TQJA 4TV9F 1T25A 3TNFA 2HSGA 4YBRA 4KB5A 1PJ3A 3T7EA 3DE7X 1DFGA 4M1EA 4MGZR 3T7RA 1QCYA 2JJYA 1NVBA 3HC7A 4C07A 3FZQA 3O8NA 2R2GA 1KVSA 2XUJA 5IDWA 2OCIA 2JPDA 3TYXA 3A8TA 3WLAA 1FDUA 4F6RB 2CJYA 1U7OA 4UFNA 3FSEA 1K98A 3HUTA 3UGJA 1JEYB 3BFKA 3NYQA 3E2MA 4Z4QA 2BKVA 1JG2A 5HX7A 1EUCB 4YCCA 4IJ5A 3DBRA 5T4FA 4LYGA 3V1KA 3ZU6A 3R0IA 3FR7A 1QHIA 2ZAOA 3DR5A 1JDPA 1F1BA 4CI0B 1U5BA 2Y76A 2ZYWX 3BH6A 3ELDA 4XDYA 5AJZA 4RE5A 1H9CA 3UM9A 1KZ9A 1JP7A 5FWNA 2XDAA 4EGCB 5SY6A 2PDAA 1H2WA 1H8EA 2H2AA 3WYCA 5AW1A 2A0YA 3ETNA 2AE2A 1E5XA 1SK8A 3PRHA 4BL5A 4AU1A 2HI0A 3MGKA 5CJPA 4QASA 3GRZA 1IULA 5DOVA 4EJ6A 5J1SB 1IJFA 1NFRA 1UDBA 1MIHA 1CY2A 1XEFA 1T2EA 2BFFA 1TEHA 3AFHA 3NAGA 4EW6A 2ZK7A 1CUAA 5E7JA 3FZGA 5IVKA 1P2UA 3IQDB 3PXDA 3RVRA 4WT7A 4B3SB 2IYZA 4YJ2F 2WK1A 4R2JA 3U26A 121PA 3ZY3A 4RFLA 2O7VA 4ND4A 1NKVA 5FUYA 3AOEC 3KQWA 3EGDB 2WWIA 4LQLA 1ANKA 1OIWA 3GDOA 4J1QA 3U9TA 5KYKA 1UFRA 4DKJA 5GP1A 1G8GA 1YAHA 2VDJA 5HRCA 4LJRA 1OBFO 1FVFA 3D7SA 5SY4A 3SBEA 3OHMA 3GDWA 5JATA 1JQDA 3QKRA 3F8TA 3SEQA 3INRA 1NW7A 7REQA 3B1FA 2X3YA 1QB8A 4UCQA 2DPHA 4POOA 3FUCA 3HCRA 1N5IA 1P81A 3C5WP 1BD3A 2WF9A 1YOVB 3EEYA 3VO2A 3P5SA 1Z2AA 3KUKA 3IUNA 3B6KA 3KELA 1YVPA 1T36A 3EA4A 3VR4A 1G20B 2JHPA 3IV7A 5AM0A 1JRLA 2EEPA 1C3LA 2FFQA 3KWFA 1P45A 4XLZA 5TNXA 1LPSA 4Z8YA 3BD9A 3ZLJA 4MUAA 3OQMA 4E08A 2VJKA 4Q4CA 1II8A 1MCZA 1UUFA 2X4DA 3MJHA 4LVCA 4N5LA 3ZKWA 1T4CB 5J47A 2V5UA 3JALB 1V2GA 3L0ZA 4JR2A 4UD2A 4YCDA 1BMQA 1V35A 5GIPE 4Y6GB 1V1RA 3S2EA 3N8IA 4M0LA 5L4SA 1E6WA 1WKCA 4L50A 3EFOA 4U7GA 3RUCA 3Q5EA 5COAA 3KQOA 2XRYA 2ZJYA 3P0RA 3C5CA 4YMSA 2P3SA 3P26A 3RRBA 4BUJA 5JCPA 2Q0QA 4UAUA 4DM3A 3PNYA 4ZZ2A 2VSNA 4YDRA 3I8XA 1W88B 4TL9A 2QWXA 1B26A 2PGDA 4Y6OA 4BO5A 4YX9A 1CZKA 3MILA 3KQKA 3VKUA 1FF9A 1ADCA 1JG6A 1NPDA 2Q4BA 4GD3Q 2ZXEA 2Q9AA 5JLAA 1EVJA 4HNUA 4FQ5A 1H6BA 1R6AA 3GDGA 2PBRA 1TF5A 1CXZA 2PT9A 1RLMA 1CBUA 1HZZC 1H5UA 4I3HA 3HP7A 2ZJ6A 2EP7A 4Z0HO 3WRXA 1SA0A 2WD8A 1JJ7A 3F0TA 4MW7A 4QECA 5F78A 1HDOA 2QUHA 4FC7A 1SZDA 4QJIA 1UADA 1ESEA 2ES4A 2ZRPA 2G07A 3M3DA 2GNPA 4BATA 3LS2A 1XZHA 4D9JA 1MJNA 2I7TA 2GVDC 1YCHA 1NFFA 3JQAA 4Z0NA 5FLEX 4I5FA 1M2OB 2D7CA 1OFVA 1AK1A 3HY6A 5DYNA 4AZTA 1CIJA 3AF6A 2Z95A 4K9PA 4S2EA 5DX0A 4C7KA 3FPEA 1ZHHA 3MQFA 3NTLA 5EN4A 4BLWA 4WZAB 4I7EA 2DT5A 4DIDA 1U1FA 3IO3A 1XWFA 3F5QA 5FUVA 2IEGA 5A5FA 3D8SA 4MW0A 4D8XA 2DLCX 3N2LA 5KOYA 2RH4A 4UBMA 2YXNA 4LOLA 3VNBA 1VJ0A 1JHQA 1IWOA 2I55A 2QQGA 2WNIA 3CLSC 1MX1A 3K0HA 2Z2IA 1A9XA 1SXQA 1JFVA 1F3OA 5LQUA 1DKRA 1LZLA 1N3IA 1DAOA 3P0EA 4HH0A 1BS9A 1Y80A 2HHJA 1V95A 2ODTX 2CHVA 4YH1A 5E6RB 3PWSA 5BVHA 5I9NA 3KOOA 3KJFA 1FP4A 4CL8A 4PVCA 4ARSA 1ONOA 4MEAA 3EG5A 1MUUA 2BZ0A 1GQQA 3KYCA 2AVDA 2XUPA 1DKLA 2RI1A 3H9JA 2B4QA 3LWBA 3LX5A 4S05A 3HRKA 2VAMA 3CNQS 3O9ZA 5A02A 1SVLA 2PJDA 2VTKA 3M6WA 5HCNA 2FAXA 3WQBA 2EKQA 2QN7A 1O9HA 4HEQA 4XB6B 3HJAA 4K6CA 5AM4A 3WMWA 4L8VA 2OVFA 1N2SA 1O0CA 3L02A 4D9IA 3BF8A 1ZGZA 5CB6A 4NI5A 5B1SA 3U16A 1G59A 2PKEA 1L5SA 1P0CA 2G0AA 3ROZA 3FTQA 3AKCA 1P29A 3G88A 4HLUC 3TJZA 4G4GA 4ALNA 4YUZA 4XSVA 1VMDA 3KOUA 3LJKA 1T3ZA 4FFMA 1B8UA 5LQJA 4GM4A 2DHEA 4WMLA 4EVIA 3LKDA 1QONA 3VPFA 4M53A 3C8ZA 1BFDA 1BX0A 4KU4A 3R5SA 2C4WA 2VWHA 3C7DB 3N75A 4OKNA 4B35A 4RVCA 1JNYA 1YTLA 2I4TA 2JARA 3WK9A 1JFFA 2QQ5A 4LXTA 4OVKA 3VPGA 1GUZA 1NQUA 5KYYA 4DV4B 4IV0A 1GL7A 2ZB7A 3N7TA 1EDBA 1JR3D 4OBXA 1RYMA 1GNTA 4K5QA 2X1MA 2PH3A 4NP6A 4PZCA 3D8TA 4AG3A 3E7FA 3KNZA 4QBKA 4S1WA 2HJ9A 3PHGA 4ZI3A 2VP4A 1LTHR 2ESRA 1NJ8A 2FG5A 1Q0ZA 1KYTA 2QX7A 2VK1A 3T41A 4A9AA 1GQRA 1BQ3A 4DNOA 4E4TA 3K73O 4MJLA 1P4RA 1V37A 1M6EX 2JC3A 2W22A 2OL4A 3DPUA 1N2ZA 1SM4A 3MB8A 4BZZA 3WKAA 5B3JC 2WJAA 3RRMA 2GSWA 3LT2A 3DBHB 2DQYA 2N9UA 2A30A 3CN9A 3CNOA 4TV9B 5AW9A 1KETA 2BGUA 2NQ2C 2VJNA 4HTFA 4M9CA 4R9RA 3TRFA 1ZFNA 3PC8A 5TC4A 1CVRA 1EVLA 2GKOA 4MWOA 2X6QA 5IEBA 4YT8A 1ZGBA 4U1RA 1K06A 4E5VA 3L05A 4G1CA 3OZIA 1MXFA 3DYBA 4WCFC 1ZCFA 1FDTA 3I73A 5EWLB 4H7IA 1FS5A 4X66B 1B8OA 5HRUA 1YFLA 1GSHA 5ETJA 3WWEA 2ENUA 2H31A 2GM9A 1NNEA 1AXGA 2ZEJA 1T0HB 4RVFA 4NMXB 4MI6A 5EE1A 3GQBA 1DC5A 1RXSA 2Q41A 3WYAA 4N5MA 3ZV7A 1TB4A 5LQDA 2WHQA 2JLXA 2Y0EA 4WAUA 1N2CA 3X1ZA 4UCXA 1UCFA 1Q20A 1I10A 2HSJA 3A1VA 3GLHA 2AK2A 4LGCA 5G4LA 3RPEA 4HDMB 4LXYA 4NLLA 4YACA 2KWIA 4GZLA 4FWTA 5AI6A 4F3RA 1KEPA 1LU9A 1N2OA 4BNNA 1QO0A 4E11A 3HVRA 4DMLA 5C7LO 4V39A 5LMZA 1H4TA 4RHYA 3EIOA 1J0EA 5JIBA 3DLAA 4FFOA 4IBOA 2J0EA 4DXDA 1NX6A 3S40A 2ACVA 1JQ3A 2F59A 4QGFA 4F4HA 5AVWA 4Q4JB 1J2EA 3H9BA 3LA8A 3M89A 1NSYA 3NT5A 4R1NA 1VXOA 2OECA 3GAMA 4F6RA 3RT9A 5ALYA 4LHZA 2OM2A 4YJ2B 4GAEA 4Y6SA 5IHPA 2TSYB 1JEYA 4PHHA 1N33B 2UXCB 3RCBA 1EUCA 3EGEA 5ALPA 4CV1A 4LXIA 2BONA 3CV3A 3WZLA 3WYFA 4F3KA 2NUPA 4IWXA 3ENWA 3SZUA 1NM5C 5DT2A 4LKOA 4XEUA 2CBZA 2FLKA 3RVPA 4WLOA 4XB1A 1U28C 3B6JA 2QI9F 4N6NA 2KB0A 2YHAA 4PSUA 4UARA 1O54A 2BMJA 3BMXA 2ZSIA 5TVGA 4EL0A 1RPJA 3UJ8A 4DVJA 2A6PA 1F2VA 4DQDA 1X6VA 3MVEA 2BFWA 4MPPA 4ZYZA 2EZUA 3PQ7A 1NXWA 4CIAA 1OREA 2O52A 3H8JA 3NG1A 5FP0A 3T0GA 4ERNA 2Q6OA 3CNHA 2B8EA 1W2WB 2H5JA 2ZTUA 3VPCA 4LWZA 3P2IA 5FJJA 3CISA 2NYVA 4IV8A 4HZGA 3PC2A 2XY4A 2G5PA 3GK3A 3M6AA 4I3FA 1D0IA 4W7IA 1T8PA 2CFOA 1U9YA 2XEXA 2X13A 2B3TA 2IPNA 1DTSA 2VWQA 2Z0MA 2ZRCA 4R7GA 2JI9A 1IJBA 4BO6A 5J63A 4CGZA 1T4MA 5EJGA 1I5RA 4ARZB 4HEA6 1EVZA 2HB6A 3OG9A 3DVLA 4GQAA 4B3IA 1U2ZA 3BRCA 2NP6A 3TXYA 1P77A 1VRVA 4BE7B 3TUZC 1KI4A 3R20A 3UANA 4UXJA 2C03A 3WL8A 3DBIA 1PWHA 1WPRA 1NHGA 1YOVA 3G2NA 4M46A 4D0LB 3T5AA 3W5BA 4IMRA 3CX6A 4IIBA 4NHEA 1FDOA 3DZGA 3NI2A 4Z4EA 1UKZA 1X39A 1G20A 3K8YA 5JWRA 5FIUA 3LQYA 2B4TO 3C3BA 5BR7A 5EFOA 1PKXA 4E12A 2NP7A 3DJFA 2JCBA 3H9QA 3P71T 4UDNA 4UQLA 4LNUB 5HBGA 5P21A 5LU8A 1UPAA 3ACBA 4XUDA 1MENA 3MLBA 2PFGA 2LKCA 3MERA 3LHDA 1T4CA 4RD4A 4EENA 3V5NA 4G86A 1PO7A 2F4VB 5BQOA 1KY4A 4ITRC 5F1YA 3GA5A 3HCAA 3V4LA 4OGGA 3ODGA 4EY6A 4GYWA 1QP7A 2PL3A 4ESOA 2YZMA 3R4VA 2AT1A 2X77A 4H15A 1YU9A 1IPHA 1E4OA 3TS1A 1ILEA 1BA3A 2DJIA 4KBYA 4QPDA 5CT4A 5ELLA 4CZ2A 4K28A 1TE2A 3LOPA 5GAJA 2ERYA 2O4CA 3GJSA 2VP6A 3OJFA 3FMOB 3ZQ6A 3OECA 4AMYA 1W88A 1NDHA 2Y99A 1E2NA 4L5IA 4JFRA 3T3MB 5KO2A 1DRUA 2EU8A 1J23A 4EBFA 3SR0A 2AG0A 3EUWA 3AUAA 1DXOA 1FE8A 1U0OC 2C2BA 3D7NA 3FUTA 2HYDA 5CT5A 1WP4A 4AL4A 1NW3A 3WGLA 3EFEA 5BMOA 5CPFA 3JWIA 4KRGA 3IVAA 4JENA 3BVPA 2O0HA 4JBWA 4X7BA 2I78A 4QDXA 5BUCA 4TRRA 5DHAA 1JXAA 1Q7GA 5B7PA 3N86A 4RHCA 3LBNA 4HO1X 4V38A 1YB5A 4YP7A 3UOGA 4QNMA 5H3HA 1AVTA 3NDJA 3GX1A 2JIZD 5CVDA 1X1SA 8ABPA 1LBEA 4ZMBA 4RD1A 4E5KA 1M2OA 5A9SB 4YLGA 2XBUA 2AD5A 1G2OA 1Q5PA 3HWRA 5JHHB 1P1JA 1G21A 5DO9A 1QZZA 4JN6B 1PLKA 4U3JA 4TSFA 4KREA 1RDFA 1H0HA 1X1CA 1IM2A 4KQJA 4WZAA 3RTDA 3WLFA 3O3CA 1NW5A 4PSAA 5DHSA 2IZ0A 1AK9A 4QRIA 1MPXA 2YBDA 2GPTA 1JIIA 2HEIA 2PT5A 2FPMA 1OHHA 3RUAA 2QVGA 2DFVA 3UY4A 5IJXA 5A4MS 2QGZA 5KCMA 1I6MA 1WCIA 1ENZA 1W52X 3LXRA 1Z0AA 3WDLA 3WGMA 2XV1A 5ALRA 2QZJA 3HHPA 3KBOA 5JSQA 1K4YA 3I04M 5T3UA 1M6YA 2GPWA 4IIUA 1T2NA 4OQXA 1QE5A 2RIPA 1SY7A 4EEXA 5FFFA 3ND5A 5E6RA 1O5IA 1W96A 4AN0A 2P2LA 5M5BA 2EC5A 4O4LF 5LQSA 3TNJA 1TIBA 1FVOA 5DGXA 4A03A 4GPAA 2AG5A 2G04A 3LHKA 4JT2A 4IZ6A 2SKEA 4XIGS 4MR7A 5EWJB 1ORHA 5AVXA 3K6KA 5HDQA 1NSFA 1XEWY 2E3JA 2SKCA 1SNYA 1P7CA 1HMYA 4Z9AA 5KQGA 1NIPA 1W30A 2FG7C 1IHDA 1W5BA 2QN3A 1U8ZA 4R0NA 3D0KA 1L5LA 3R7SA 1CY1A 4AJ2A 1T5BA 5BUQA 5GADl 1T9GR 4H7EA 5K8JB 3E9ZA 1DBQA 2Y8EA 1CS4C 2P11A 4LIPD 4ISCA 3RK0A 1YIDA 2XA9A 2EG9A 3R3WA 3USES 2XPCA 1P4JA 2Y0CA 3JWGA 3LG2A 2R6JA 3AY0A 4S1VA 4A92A 1EAYA 1K66A 5I47A 1RT9A 3RBAA 2AN5A 3RSGA 2BUAA 4ZV4A 3GOHA 4FVTA 1A2OA 1KERA 3PKZA 4RSHA 5FD8A 2ATIA 1RPZA 2OMEA 3MWDB 2FFHA 3FPBA 5JAPA 2R4TA 1RBMA 1MOSA 3OQJA 3OIGA 4JZYA 4MVCA 3TRJA 3ULKA 4DDMA 2IU3A 3K1JA 4JR0A 4BKRA 3GZTB 2A0XA 4QBFA 4MQ5A 2ZS7A 4DMMA 1TVCA 1JMKC 3PNSA 4WGGA 1MIOA 1NE7A 1GZUA 5ITZB 1ZK0A 2YHIB 1E7YA 1DZ3A 3TSOA 3KVYA 2IEDA 3SSOA 1US8B 1IN1A 3DO5A 3CJQA 2QRQA 4OMDA 3OM0A 3OICA 2WAOA 3ROXA 1XLTA 1GILA 4G0XA 4L8FA 4YC7A 5T64A 5CG2A 4DLXA 1CQXA 4DVGA 3SCZA 4I1PA 3B5IA 3EZ6A 1QRUA 2AUTA 3C8DA 4C76A 3R3UA 4PO9A 3PQFA 4HQKA 4RPKA 5DSTA 1R6BX 5B6PA 1WUKS 5FWXB 1K3UB 2VRCD 3B60A 4B7AA 4DCVA 5T7BA 4RZSA 2R6CA 1JEOA 4A91A 2G71A 4QPZA 6PFKA 1OH5A 3UWPA 4RV9A 2H7XA 3KB8A 4TV9A 3X1WA 3ZY2A 4E1AA 2G09A 1BMFD 5CEJA 1ZY2A 1JILA 3A9VA 1D2GA 1DX4A 3A2MA 3GUCA 3KPUA 5BYJA 4Q7QA 5AVTA 1AV6A 3R8CA 2GJKA 2WR8A 3I1FA 5CUQA 4RZQA 4QQKA 4RJKA 2CL5A 1OFHA 3OCJA 2HNKA 3ZLVA 2IVZA 2QYOA 2FWAA 4QM6A 3LC0A 4EUEA 2CL6X 1XU7A 1CQJB 1EXMA 3BBPA 4OB8A 1E1RD 1SUFA 2TMGA 3HM2A 3K8OE 4PFJA 1Y6JA 3IVGA 5AKEA 3WIVA 5FUWA 3UJ6A 2PR2A 3DOCA 5EGSA 2XGOA 2YC4C 3IP6A 3R75A 2UZ3A 2HV8A 2C2MA 2IHYA 4I14A 4M88A 4PHFA 1DX6A 3T5PA 3AF0A 2MOKA 1N7GA 3R3YA 1GQYA 1B00A 1ITZA 1MJFA 3IUBA 2AZTA 2DTDA 4HDMA 4PBRA 4GL2A 1JEJA 4Z49A 1O96A 3T7CA 5K0TA 3B89A 4Z99A 4WECA 2VH2A 4JLBA 2BKLA 1OILA 1ZZGA 4MVJD 4ZCMA 1WBJB 4E70A 3NBAA 1XC7A 3LCCA 4OQFA 2YV5A 3D7RA 3UGQA 3LBHA 1ZQ1A 3GEDA 1F8XA 4US0R 3QKSB 3QU9A 2J7PA 2GF9A 2PAFA 2F8SA 4TL6A 1O77A 2RHDA 1QFMA 4JLDA 4MULA 4L5AA 4PTLA 1UZNA 5AJXA 3PC3A 4S1PA 1JBQA 1EHIA 1F8FA 4F6LA 3HL0A 3L3BA 2DHRA 1G64A 4ILEA 4YPVA 4KWTA 1ZM7A 3V7WA 2QD3A 3BMQB 4RF4A 2W2LA 1E7MA 2WB4A 4PQGA 4YAIA 1AMNA 1QDEA 1HLGA 2BGWA 1IQPA 1ZOSA 1JUDA 3JVVA 3TGPA 3FOZA 1J0CA 4A8JB 4E31A 1M2WA 1NX9A 4YBZA 4RAQA 4O2AF 1VPTA 2V1XA 4LCJA 4URHA 2GPYA 1OAOC 2O0KA 3FGNA 4JJ8A 1JSZA 1KOFA 3GMTA 1EDOA 3A4MA 4QVKA 4R51A 2IE8A 4WSOA 5DYYA 1WB6A 2XWJI 5CT9A 3UCEA 1O7JA 1WEKA 4GX2A 4EI9A 5FOSA 4R2WA 3C3DA 2JGDB 4OLBA 1W6UA 2RHCA 4TXJA 3RFTA 2A9VA 1DMSA 1UKAA 4XM2A 4JU8A 9LDTA 3ZU2A 4X0EA 3VISA 5B2FA 1J09A 2ZR0A 3Q3GE 1E5TA 1U5CA 2EOAA 4RE6A 3TPFA 3PDWA 1ZGHA 4QTZA 4Q24A 1ID8A 4NMWA 4JSTA 3VC1A 1ZI9A 3OOJA 4YAFA 4B0PA 1SUSA 4DLNA 4UM7A 2ZRGA 2GD0A 3TMYA 1Q3TA 2Y27A 4MQBA 3ZYCA 3E53A 3X43A 3U5TA 1AUVA 4FGUA 4M1KA 4JKYA 2WHPB 1KR2A 1KJNA 2W71A 1S4MA 4OFBA 2KSQA 3QUCA 5ALFA 1RHMA 4PZLA 4ZC1A 4FHDA 1BVHA 4RSMA 1NMQA 1WRBA 3F6EX 5I3CA 4BX8A 1DQZA 3UCXA 3LLVA 2GNOA 1TW2A 3DAHA 2QYSA 3DP9A 3II6X 2OCKA 3IMGA 5LOVF 2C04A 2YWCA 3BFPA 4AJIA 4Q7KA 2XCRB 5BN3B 2EKPA 5JO0A 4GMXA 5DXFA 3C5VA 2VDLB 3JS5A 1FFYA 1NQWA 2VP0A 3M5DA 1RVV1 5J4HA 4DR3B 1SQGA 4ZZ0A 3U17A 1JLLB 3A4YA 4X1KA 3EQ7A 2VUUA 4BBAA 4Q1EA 3TFOA 1Q0LA 1Z36A 2FDRA 5AH0A 1V1JA 1Y4ZA 2QAJA 3H1GA 3ANSA 3KUDA 3MCTA 2WV9A 4HTAA 4WEOA 3OPYB 1LS1A 1MOZA 1P9OA 2WZDA 5HCUA 3U3JA 4MOWA 4M6WB 1S7CA 5DRTA 1SG6A 1AHPA 1MO2A 4B5LA 5G0WA 1IY0A 1Z5GA 4OFXA 1Z75A 4TKUB 4OOFA 2VJYA 1LY1A 5BV7A 2PX3A 5IH7A 5MDHA 4HQ0A 4WXHA 1EPUA 2IL1A 1QG4A 3AEXA 2QXTA 2XB9A 3KFXA 2AFHA 3ANMA 4QBHA 3UB4A 1JA0A 3K09A 2OBMA 3GC6A 3PQ6A 4MP6A 4BDTA 4DQ0A 5AVKA 3FSGA 2ZUSA 5FV7A 4E14A 2XDYA 5E2IA 4F84A 2P40A 4QO7A 3NXKA 4YRCA 2V54A 3MPUA 5KNBD 4YGXB 1K9VF 2BD0A 5DIZA 5F64A 2W0MA 1E79A 3D6HA 4MYCA 4CKWB 4F8JA 4UREA 2AOVA 2BH2A 4IINA 2XGJA 1U0TA 3RBVA 5PNTA 3OUUA 1QIMA 1OT3A 1XB2A 3LZ6A 1OMOA 1QHGA 1OYWA 3O2QB 1KKUA 2GN4A 3SDSA 3TOVA 3EJ6A 2ZBQA 3KL4A 2O8VA 4KLRA 4MV5A 4JJKA 3UB3A 1X8JA 5A9SA 2PIDA 1N2GA 4O4LB 4B3XA 4UAJA 4RV5A 1DQYA 2JS7A 2WP0A 3AX6A 4X45A 3GFQA 1GYPA 2Q1XA 4GKVA 1VPDA 3NHZA 3NLLA 1ZXBA 4O8CA 1Y82A 1PSWA 3GRFA 5GWXA 1L0BA 1O5TA 2FTKE 3NHKA 1QWOA 2VNHA 3BFVA 4RZ3A 4TXNA 2FW6A 4IHJB 1RYEA 5ALHA 3L6UA 4LMPA 3NDIA 3O38A 3CWZA 4JOCA 1K27A 3IULA 2G76A 2KMLA 1I4TD 4U0KA 2DXIA 4LWQA 4RIIA 2IV3A 2HAEA 2C9DA 4G0ZA 4EF4A 1AC5A 3ECSA 3T5CA 2G5TA 1SKQA 2J6IA 3CIFA 5A4FS 5I3ZA 4A7PA 2GTHA 5FTWA 1DKQA 2HHHB 4ACBA 3NJRA 3UG6A 2P6RA 4W5RA 3CW8X 1UDAA 2FUNB 2F17A 3AJ8A 1Q84A 1JKJB 1V9LA 2E4AA 5A7HA 3WHLA 3PEWA 4Q39A 1Y1TA 2CVOA 2RAUA 4RQTA 5DTRA 4C4AA 3OEHA 4I1SA 2NO0A 5EWJA 4CIXA 5B64A 3AJDA 4J94A 1KNQA 1RYZA 2OBXA 2Z1MA 1UBHS 4DMUB 2OGZA 4RHUA 5L45A 1T4DA 1KSFX 3ID6C 1TA4A 2ZWAA 1T9ZA 4QDTA 3DL2A 3LCUA 2I76A 1S3SA 2PGLA 3DFFA 3SZGA 3PTZA 4BO0A 3IP3A 3W2GA 3FTDA 1QVVA 2B99A 2X76A 2EBFX 3AL3A 4AROA 4DCSA 4DC9A 5K4GA 2BSXA 5LUAA 4UMDA 4WFKA 3CH7A 3HA5A 4JJGA 5JJIA 5E8JA 1L4BA 3RK1A 1V9SA 5AM2A 1WXHA 4TZ0A 2O5CA 3ITKA 3SBOA 2VK8A 2CXTA 1NZDA 3MWDA 2A67A 3THSA 4BLUA 4X54A 5F51A 2B0JA 4IF6A 1GTG1 5A03A 4ZEMA 4IVPA 2Y1EA 3KUCA 4J03A 5KHLB 5L3SB 4BE4A 3NGMA 3I6ZA 2EFYA 2ZSFA 3C7CB 3T7TA 4OY3A 4ZOLF 4GXRA 3VU0A 3U4DA 5KMGB 5ITZA 3PE4A 1QIKA 1I9CA 2XGMA 2BMEA 4PXAA 2YHIA 2NTVA 5CLQA 4ZVNA 5KTPA 4CI9A 1FP1D 2UKDA 1MFZA 1FX0A 1Y7LA 1S7GA 1US8A 3F6BX 4QDUA 3NEJA 1I7DA 1J24A 4HWTA 1IMJA 1MAUA 3G5LA 3ZV4A 4HY3A 5GPBA 1L7AA 5H59A 3VZQA 1N5LA 4RZHA 4F5YA 4EPWA 2O2JA 3NRJA 2H85A 2WTXA 3NUGA 1EG2A 5HEKA 3GIDA 2MSCB 1KZ4A 1I14A 2REBA 2VJLA 1CE8A 2RI0A 3IAFA 5FWXA 2O8DB 3N2KB 4DSOA 1PG5A 1E6CA 4B1FA 3KVVA 4B7CA 1HTTA 2X1LA 5AVSA 2Q6TA 1X1TA 4XX0A 1YR9A 1QQAA 2AOUA 3AYXB 2EKZA 3NTVA 2HQOA 1ABFA 3I30X 2OMKA 3N6VA 3AWDA 3D0OA 1CU1A 4C01A 1LDGA 1T8YA 5A4AA 1SUCA 4MVJF 3WIEA 4JQOA 1O0SA 5A7GA 1I4EB 1YZQA 3WRWA 3ZBPA 3QE0A 4IXWA 1AA6A 3RVKA 3GGOA 2VHJA 4GI7A 4EVRA 2Q6VA 2O8FB 2PANA 4HAUA 5FBLB 4FNGA 1PNTA 5F1KA 3T52A 1CQJA 2RB5A 2FMKA 3SQOA 1E2LA 1UKYA 3AEUB 3A2LA 3BE8A 3N07A 2GO1A 1XZFA 3DHYA 3H2YA 4KBFA 5ARDA 2C5GA 3BSWA 5H1YA 5L7YA 5JSZB 3MGCA 3PTAA 2QT0A 2QM8A 1NKTA 2FUG6 5IC5A 4M36A 3IAHA 4O2AB 3ZUPA 3C4QA 4I4NA 4EY8A 4LZPA 2ZPAA 3H2BA 3EX7C 2B25A 1YA6A 1E77A 2UAGA 4E51A 3RU3A 4RVDA 4URXR 1P7PA 1UWVA 4MKRA 3L8FA 3SHQA 1IN4A 4B71A 1K88A 3AIIA 4M7PA 1XMSA 2B1RA 2PLWA 3GMIA 4G56A 4LF8B 2APJA 2CYCA 2ONCA 1OV4A 3D3QA 4KAAA 1WA5A 4DF3A 4Q3NA 4BXOB 3I0ZA 4OYYA 4BNGA 4QU5A 4Y1RB 1ADBA 1ZEJA 1T6NA 3EA5A 3GGCA 3HN7A 3K9HA 4Y2SA 5T3YA 4I8DA 1NMXA 1T4GA 2W8ZA 1H93A 3DGFC 5CNKA 3K70C 2C5BA 4HYEA 3YASA 1P2DA 2QRPA 5AW3A 4KE7A 5IFKA 4A8JA 3MUNA 4CTNA 1N0HA 1NZFA 1PTJC 3D4IA 5AXCA 4ZPJA 1NHWA 1T3GA 4WEQA 4LXGA 4C6SA 4OM8A 4NOMA 4A15A 4KO8A 3PV0A 4DB4A 5LOVB 3EQ2A 3A6GA 3QKIA 4QFDA 3WTBA 2EFJA 1DC3A 2JGDA 2IYWA 1WG8A 3FWZA 3OX1A 1GAWA 4D0RA 1HF3A 1USIA 3KJQA 4RC9A 3E3NA 1YBFA 4L7VA 5JHGB 4NEQA 2C61A 5AJTA 1AZWA 2RGYA 3F2IA 4OD0A 1Y6GA 4JYAB 3QPAA 3ZY5A 1C4KA 5CJJA 1UK9A 4CV2A 4QUDA 1WLYA 4NECA 1HYGA 4DCCA 4QHSA 2X3UA 3HY4A 5EQFA 1CJTC 1D8TA 2ASVA 2WUEA 1TYCA 1UP7A 4WJZA 4C5AA 1HSZA 1L7PA 2ZQ5A 1P3DA 3ZC3A 3WLSA 3HYTA 7GPBA 3BF7A 1XTQA 1TYZA 2OKCA 3LECA 5SYMA 3ZZ0A 2XRZA 2BTEA 4RZUA 4BTLA 1WSBA 2WHPA 4KO4S 3AR7A 3F90A 2R6GA 3B78A 2XEDA 3BHNA 3JRNA 4GL4A 4UULA 4EO9A 5F76A 3V8QA 4F2GA 3J81k 1Z0JA 2A1TR 1NV9A 2GPNA 3D2BA 3I6MA 3LFUA 3A26A 1VCIA 3LVFO 4FGZA 4HEA1 5KNCD 2ANBA 3TQCA 2H0AA 4HYYA 4TTVA 5BN3A 3PC7A 1QPZA 1E94E 3QLUA 4KPGA 3KAQA 2W0SA 2W2OA 2ZYIA 3E1GA 3AIKA 4KQ1A 3SQDA 3E7WA 3PSAA 2QTNA 5FOXA 1NNI1 2XKAA 4L76A 4M0FA 1JLLA 2I2FA 3E48A 1ZD2P 4L22A 3I34X 4GR5A 2IPOA 3EEBA 3IELA 2RONA 2FN7A 3G0BA 4Y9SA 1COWD 1PZXA 1A4RA 3BOSA 1DUSA 4GEKA 5DM1A 5IH3A 5KSYA 4JUDX 3OPYA 4N54A 2X86A 1DT3A 3V42A 3HYSA 4IICA 1FW6A 4RIEA 4M6WA 1V7PC 4EPRA 3A4LA 3QH4A 5BT8A 2EJTA 1C7FA 1NAHA 2WV7A 2J48A 4M0UA 3Q88A 5CIWA 3QYFA 5AHOA 2HDHA 3W7BA 4TKUA 4AECA 3H7AA 2F55A 1XK6A 5IAAA 1XTBA 3QELA 3HYRA 3RR2A 3HVUA 2B4KA 4FONA 3BPSA 4FFPA 2GA8A 5IAKA 1A7UA 1J90A 4WXMA 1OWMA 5ISMA 3PXUA 1U4NA 5CH5A 2M6LA 2Q2WA 2JA2A 1T5HX 3CUYA 4JLOA 3CNLA 4DPKA 4LYEA 2TS1A 4AIIA 4YMTA 3MCAA 3W79A 4D56A 2GZAA 4GRDA 4HLQB 4F9TA 1TYEB 4L8GA 5IVDA 2VWGA 4CKWA 5DN6A 5CJ2A 5ESWA 3HU2A 2C3OA 4NV1A 2G9QA 2HU2A 1CS0B 4GE3A 1BYUA 1HETA 1ZGGA 1BSVA 1F2UA 2P9YA 3IMFA 3VDQA 4U7HA 4EDFA 1EUZA 2B8WA 4QLOA 2WF5A 3PLAE 2NSDA 1MTOA 2H1SA 2CEKA 2R86A 3DOHA 3NRCA 2HA0A 4YAJA 2J3QA 1WSWA 1NXQA 4JS0A 1WDWB 4CPDA 3FWPA 4BVHA 1NOJA 1H5QA 2J0QA 1NMYA 1DBPA 3ZV3A 4O4LA 4FU0A 3QJ5A 1JDTA 5JJKA 2C3MA 4N7JA 2G6TA 4IDGA 2QTFA 3L8MA 4N82A 4BO1A 2A1UA 1IZ0A 3NDRA 3SQMA 3E7XA 1GGNA 1JKIA 3WMRA 3HUEA 2FKNA 1X0XA 2RCNA 3QF4A 3I4CA 4IHJA 2OWDA 2HFKA 3DZCA 3WLNA 2JI8A 1LRLA 1JR3A 1RQNA 1YA8A 2WKRA 3ZE7A 4E7OA 3CM0A 1SBIA 4R8SA 2GZ3A 2HIGA 4N0EA 4HXFB 2YNMD 5FQNA 1M5UA 4FOPA 1L1FA 5FA5A 1CY4A 1P0MA 4GZ3A 3LWZA 3DXZA 3S7ZA 3ZJUA 1ZDMA 1E61A 5EZ5A 5ICFA 4QJ3A 1XGKA 4NPAA 3STYA 3JVUA 4LPSA 2OPHA 4HRAA 3PC4A 5DYIA 5CBKA 4XCVA 2PPVA 5F23A 3UAVA 4CMIA 2ZYGA 1KQOA 1W34A 3NYRA 5KNDH 1E0DA 1JKJA 3OJLA 2VPQA 4CCAA 2FWJA 4DILA 2OXRA 3QVJA 2NZJA 5ECWA 1LBSA 4ZOLB 4RTLA 1IHPA 1ADYA 1PS9A 3W3AH 4DG9A 1XTRA 2ROQA 5D86A 1TVEA 1U7TA 3W5HA 1TC2A 1TYBE 2QZ9A 3BC1A 4N76A 1USGA 3DC2A 3U6KA 4DJAA 3BX1A 2GFQA 3BDVA 1QF9A 1ARZA 2JB9A 4MV1A 3DM5A 4E88A 1VIMA 3GPBA 2AEEA 4ITUA 4WBXC 4ZDWA 4CKBA 4KDRA 3VNSA 2R8RA 2ZWVA 3C2QA 5B7NA 4DLZA 4QXQA 4X71A 2PKQP 2WBLC 1BH6A 4H18A 3BZUA 4Q3CA 5HR5A 3QSYA 4FLEA 3EMDA 4HVTA 1RAEA 4LE2A 3PWKA 3TLZA 4KMSA 2CMHA 4C0SA 3E22B 5CFPA 1SBNE 1TJYA 1W2GA 2QUJA 1K6XA 3EXG2 3RK4A 3G0CA 5KMGA 3CUKA 5JO9A 1XJCA 2WQ6A 1M74A 5JJBA 2LWIA 2BZ1A 2GI4A 4Z4FA 1F48A 1KAQA 2XF2A 3HJFA 4NBSA 3EGVA 1XEAA 4HFNA 4RYDA 4ECAA 2QXUA 3HU3A 1QFXA 2QVCA 2WE7A 2PS0A 3HYLA 3F4BA 4WHMA 3TM5A 1BDJA 4IYJA 4RBNA 2RD2A 4KR3A 1S2MA 4S12A 4M0KA 1KU6A 1G3UA 1A8QA 3ZTYA 6ADHA 4HPWA 4CDGA 2DUWA 2IYOA 3L5OA 3CVXA 1MB9A 3EXHB 4FOTA 4DXHA 1N2EA 3VAYA 4ZKEA 3K3PA 1LSJA 2A7XA 2PMDA 3C87A 4JIGA 2ZJ4A 3P52A 4QGAA 2HMYB 3FBTA 3VI3B 3X1XA 2O8DA 4C0XA 2C8KA 2PRYA 1JEAA 3VPHA 2IYEA 3LHIA 5GM1A 2LPMA 1ZA2A 2IYNA 1QOQB 3ZGYA 4RK4A 3IEVA 3NH9A 4CIVA 2O8EB 4URZR 3HXKA 4H0NA 4KWEA 4ALIA 2P0YA 3TQOA 3NX4A 1E0SA 2R47A 4IGKA 4PQFA 1OX5A 2YY6A 1BNCA 4KVFA 1J20A 4L0QA 3WIOA 1RXEA 2J5BA 4KV9A 2X2EA 4BJ3A 1EVQA 1PNVA 2ZE7A 1GTZA 3K32A 2DBQA 2O3JA 1MX5A 2PRZA 5TT0A 2AEMA 1CUEA 1KEUA 2CZGA 2WVJA 5IABA 1A7AA 4TLDA 5HKKD 1SELA 1URPA 1XUOA 3AEUA 3OZTA 4TTIA 5JSZA 4WXPA 2E18A 5CM9C 5AMXA 3SS8A 1EK6A 4RCVA 5HIJA 1IG3A 2WHRA 2IHJA 1P9RA 2AXPA 3LVQE 5JS8A 2I4RA 2OXEA 3R41A 1KY2A 1X1DA 3MYRA 3TEFA 1J6UA 4AJPA 3GRCA 4O2AA 4RSRA 1M34E 3EARA 4D9HA 3RV4A 1KO4A 1BG6A 1MQ8B 4LJ5A 5E7IA 3DAFA 3F7MA 3SIWA 3TEJA 1A9TA 2B0CA 1E3EA 3RUFA 2F1OA 1I0ZA 4F46A 2NSHA 4XYMA 2W6MA 2XMDA 4PYOA 4QPCA 4LZNA 3WGYA 4CNBA 5EUBA 1W8DA 2GDZA 4PCLA 3HABA 2I54A 4LVOA 5D51S 5HTKA 1IN5A 2R6R1 3H1TA 4DV0B 2HO5A 4BXOA 4Y1RA 4JBLA 4CMCA 1U8AA 3E9YA 1HTBA 3JZDA 4QBGB 5J43A 3P4YA 4E2XA 1UIMA 2AC2A 1LBIA 3Q12A 4TTQA 4AS1A 1VXRA 2CSXA 4RJLA 2Q4RA 3H18A 4LRSB 3ZHYA 4H4EA 2FXIA 4JQZA 5BPHA 1P39A 4CDRA 3OOHA 3DVQX 4U7FA 3U4GA 1JWLA 5AK6A 1I7QB 3S8EA 1SJ9A 2PUDA 3I76A 4HUTA 4Z0PA 3BE5A 5HFNA 3ADCA 1HI9A 3U7GA 1FTWA 4ZAGA 4OL9A 1QUFA 2ZWIA 5C1IA 5LOVA 1HZJA 2WFLB 2NVWA 4YDQA 2AYYA 3WB9A 3QFSA 1UPCA 4AQ7A 4FWIB 4N0MA 3PEUA 3EPKA 1NG1A 1G7SA 2HNBA 5A0TA 1ZJJA 4J2OA 1T5DX 4KLCA 4RGVA 3D2AA 4FZVA 4IDQA 5HF8A 3P4XA 4W5WA 3B9PA 1V4BA 4D4HA 1ELOA 4H7DA 3I4LA 4ZK2A 1P0IA 4I9GA 2CNWD 4FK8A 4XTCS 1JU4A 2JASA 1X9HA 3M5WA 3OZFA 4P4UA 4P7KA 5AQEA 5KWJA 3UW3A 4AUNA 4F1KA 1RXVA 2AW5A 4LF6B 1SC4A 3KZ1E 3UJBA 3MIIA 4F60A 2P62A 3W6PA 4WI1A 3WP0A 2IUTA 3ABZA 3V6LA 1UKVY 1TJ3A 1P18A 2JIZA 3UBTA 3VYSB 3C3YA 1ECGA 4TMTA 2R6AA 3WICA 4D45A 1PYDA 4Z4CA 3IBSA 5BOSB 2XUAA 3IJEB 3URMA 3M33A 3T54A 2CFIA 3LTEA 1FYFA 1OTXA 1ZN7A 2YWFA 1PNRA 1BW9A 4J7CA 3AY7A 1I51A 3OE5A 3ZVNA 2CZQA 1E2GA 1SCBA 1CZLA 3IRVA 4MKZA 4O3MA 1AQ6A 3AM3A 3E27A 2OFOA 3I64A 3WGJA 4G0QA 1RP1A 4MV9A 3S8MA 4AIRA 5IVPA 1NVWQ 1L9XA 1BJKA 1NU6A 2JIMA 1I4OA 3ZBTA 3L6DA 3QW2A 2N0SA 2HUPA 1O8CA 4JROA 3K5PA 2GT1A 4F2HA 4TSKA 1QMPA 3QM1A 4XFKA 4YAEA 1QK3A 3B1VA 3M82A 5JNSA 1IUNA 4NBTA 2IGBA 1KZ1A 3DYVA 4J3FA 3W1WA 3SLRA 5KTTA 1C4WA 4BGIA 1LK0A 4CTKA 2FR8A 3PBKA 1CUZA 3ASYA 2OB1A 1P4HA 3DQQA 3RIMA 3DE6X 3I01M 5JTUA 2YOHA 3IDAA 1L4FA 4OQQA 2KM1A 3D6UA 4LHXA 2FFBA 4WL0A 3ORSA 4XQEA 2IZ6A 3CIOA 5K8LA 1OGYA 2Q6IA 2P9HA 2VK4A 3ETEA 3AV3A 2P7HA 3H5RA 3I6IA 3QX9A 4B81A 3ZDAA 1G3RA 3ONEA 4D9KA 2CY0A 2C31A 2EARA 3MA0A 3QMMA 5BNWA 3LBFA 4IOKA 3WV5A 1FFWA 4HKTA 1Q77A 4DBVO 5TLSA 1C7RA 1FFBA 4GPIB 2O1XA 3QIVA 1HE4A 1CS0A 3EZ7A 1F9EA 3KQYA 2Q6KA 1DKOA 3O47A 4QUHA 2JJQA 1KXJA 4UTOA 3ZHUA 3NBFA 4CRWB 4C14A 4QVIA 3HB0A 2CNNA 3LLCA 5CT6A 1EM8B 3NWJA 3LBYA 1M2FA 2J41A 5ALWA 5K20A 3RAJA 5C5CA 1MX9A 1KI6B 1DAIA 1EI9A 1RKUA 5EG5A 4PBSA 3EIQA 4JI6B 3OBIA 1U8TA 3W2HA 4QDOA 2AMLA 1IBSA 1L4KA 2DB3A 5ALZA 1KO5A 4MWTA 4TTAA 2NMVA 4EHKA 4L0CA 3OPXA 4MROA 3BFXA 1GVNB 2G9ZA 2GYWA 5K8TA 3R0JA 1GWNA 4QATA 1N7JA 5JV5A 1ZQ9A 5E2AA 5CXQA 4FQ8A 1MJGA 5I9LA 2BM9A 5JI3E 4Q4AB 3P9QA 3LPLA 1HT3A 3IIEA 4QEZA 2OKGA 4J8PA 2R1VB 3ZGZA 4ALKA 3AFNA 1JDVA 3FKQA 4FJ2A 4HD8A 4N41A 4IZOA 5JWHA 3SF0A 1JDSA 1JS1X 1QSGA 4FMBB 2P9BA 3QTTA 2J0SA 1CY0A 2JIOA 4ND5A 4P4TA 3RHFA 1KDZA 2QE7D 1UIRA 1E0KA 2CXUA 4OJQA 2VBCA 3HXPA 4X6XA 3V8VA 1DRJA 3GEHA 4JP1A 2O0JA 1DEKA 2A1TS 5JY6A 3T3NA 1G8PA 1H8HD 3EGCA 2O7RA 1W5FA 3D6AA 5K3AA 4LDRA 1HA3A 2VYQA 1BMFA 3E2IA 4OFWA 1DWUA 4F04A 4XUGB 1U80A 2AR0A 2XXJA 3KVRA 3N74A 5H68A 3RE1A 2I1LA 1ZRMA 4YAKA 1PWYE 5EHXA 5DNUA 3OPYI 4BFVA 2YZKA 2WHEA 4KO1S 2NZUG 3QEOA 3VPSA 4D3XA 4WINA 2YY5A 4P3PA 5F7JA 3VDRA 4CF3A 4O2RA 2FOIA 2FR0A 1ZD3A 3TL6A 3UOAB 4B3DA 1E1RA 2ZE6A 1U1CA 2GVZC 2OTCA 3ZGLA 1EWVA 3EY4A 2XUFA 3B7WA 3IE2A 3V7UA 2Z1NA 1B41A 1ETUA 4Y98A 4JELA 2NYAA 5EKTA 1ESMA 1O8BA 2DWUA 1SXJD 1FK8A 3R5TA 3ZY6A 3TW0A 2VYND 3R6GA 2QVZX 4H77A 5IJ0A 3E22A 3N8HA 1Z06A 2B34A 1WXDA 2OO5A 1J8DA 3GLQA 1HEYA 3KZNA 1MNQA 3B9BA 2O50A 3NPAA 4IF4A 4IXNA 2I3ZA 4PLCA 4Q9NA 3T7SA 3TLEA 4JEHA 4KPYA 1PWXA 3DL7A 4LMAA 4CTMA 1JSRA 2QQFA 2I6SA 2YQ5A 4JU9A 4W1PA 1U3WA 3GR6A 4FINA 1R64A 4PO8A 2IEZA 4R41A 5CLGA 3SM9A 3QX3A 3RU2A 1OPRA 4O6VA 2QN1A 3SKVA 4ZYYA 1I32A 2YWRA 1X9IA 3KZOA 3RH0A 1Z62A 1C81A 1WJGA 3UKOA 5EZ6B 3UMRA 1SB8A 3ACCA 2B8JA 4FKBA 3DZKA 4DIKA 3UH1A 1QKJA 1U11A 3EXHA 5BR8B 1M8PA 1WB5A 4NNPA 3KBBA 3N0VA 4GHWA 4HWGA 4DCTA 2JIDA 1NBMD 4B6EA 3U60B 4KC0A 1LPMA 4TM8A 3V33A 1NBWB 1AF7A 3A3OA 4ZRNA 3WNDA 4OJMX 4QEDA 3WA6A 5JVDF 4P34A 2LTAA 1EVYA 3M6IA 3P9NA 4JT8A 5KHOC 1FLAA 4HNVA 4R9SA 4DDTA 4YREA 2BAGA 2HKIA 4B79A 4X3OA 1IXKA 1MA3A 2HGSA 2PXXA 4E5UA 1GU0A 1TU4A 5F4ZA 4BAUA 3U19A 1QZXA 2V7QD 3A0UA 4OMCA 1WS6A 1W5SA 4QPJC 4ZVTA 4CKXA 1TZKA 1IXSB 2A5FA 3QOFA 3UAOA 5H9VA 4DCPA 4EW1A 1Y37A 1U0JA 2IXTA 2YIVX 4Z4GA 2CXHA 1EFCA 4EA6A 3HN2A 1I4LD 1W46A 3CKLA 2WYOA 3LW7A 2ZRLA 3AU8A 5ALVA 4HYQA 4MWZA 4RF5A 4EHIA 4TYNA 4XGQA 5AXBA 4DWWA 4R1SA 5CLFA 3VPDA 1B0UA 1MX3A 1WU8A 4YI3A 3RF7A 2XNKA 2YWGA 3TMAA 4D81A 4JJEA 4QJBA 4ZV9A 2FUG1 2J3IA 4EJFA 3OQPA 1IXRC 1E6KA 1GSOA 2Y05A 5DX8A 4PM4A 2AX4A 3RTBA 3OOSA 3HO8A 3KR2A 3QI7A 2VNKA 3ZWXA 2W37A 2J09A 1GY8A 3TNYA 4J2HA 4IIDA 1J7KA 1SBYA 3W8DA 1SKAA 1LVHA 3ORFA 3EA0A 5CNIA 1Z33A 4V1CB 2GM5A 1U98A 1XU9A 4GO1A 1P7ZA 4ML3A 4R3WA 1LF0A 1NVAA 4RANA 3OOEA 3V8EA 3ZE8A 5ALXA 2R7AA 4M8NE 3RS2A 1FLNA 1OSNA 2B2NA 4OREX 4JITA 4HXEB 4U9HS 4CM4B 4ABTA 4HP8A 1CETA 4J91A 1T6XA 3WDSA 1PJCA 1O6GA 2WM3A 1VQ1A 5EQJB 2D4AA 4IJUA 2K7FA 1GVHA 1E6MA 2J85A 3BEDA 1P80A 4EFKA 4EI2A 4B3JA 2Z8ZA 2ZRFA 1UC5B 3L8DA 1JALA 4CLDA 2JLRA 3AUSA 4IW3B 4D74A 2ZIUB 2GD1O 3I12A 1O58A 4PTZA 2HX1A 1TRKA 1E20A 4LXQA 4KUGA 1JAIA 5BV0A 2O5EA 1SU8A 1XIVA 3ZCRA 4GR9A 3TVDA 1PFYA 2PD3A 4EB3A 4Y9UA 5LU9A 1DARA 1TUBA 4Q18A 1E7RA 2OHIA 3G0DA 3SHFA 2XSZD 3TRHA 3JX9A 3ZWYA 3NC1C 4G5HA 1ZM4A 4KX5A 4WE3A 3W8FA 3WLHA 4DLLA 4TYWA 3HZHA 5L3QB 3C24A 3THYB 3IPAA 5K6AC 1M2NA 5B12A 1FNDA 4MGKR 2Q29A 2PUTA 4G01B 5DM2A 2M1ZA 1M66A 2IQIA 2WA2A 3MT9A 4G5GA 3R76A 3D1VA 4QZVA 2BP7B 5C31A 1RMTA 3NGLA 4EO7A 4LJ6A 1DBIA 4HATA 1RPAA 1SVSA 3IVRA 2I3GA 4FMDF 4LGMA 4UFOA 4XOUA 2CVZA 3COVA 4J0DA 2VPWA 1TD9A 1CRQA 3IDSA 3L8YA 4IP0A 3CVOA 3FPCA 7MHTA 4PLVA 4N12A 4DDVA 4CVNA 4B73A 5L9AA 2VOJA 3TZBA 5F3RA 3RSQA 4Y6PA 3A6DA 2DUMA 3IXLA 2F67A 3K0BA 4Q82A 5CGQB 3C97A 4QOEA 4QXMA 3ECAA 2PSJA 4HDRB 4F91B 1KDTA 1I7PA 1CQPA 3HMKA 4BNYA 2IXDA 1AJEA 5FEMA 5AW4A 1LLQA 3VR0A 2XTZA 2FSIA 1FS6A 2P68A 1Q50A 3DLPX 3QXSA 5B5SA 3GB9A 3A27A 5DB4A 3U4AA 4NZZA 5JAOA 1XFDA 2QRZA 1ZYUA 3CC8A 1E18A 1MZVA 1IIBA 1PDVA 3C6YA 2D8AA 3GLKA 4L27A 4RHFA 4UASA 3FCSB 5FT9A 3ZWVA 1MG5A 2XQVA 1FLVA 1X9GA 2NO7A 4M0CA 3B20A 3EK2A 4HJXA 4BKUA 4OLHA 2WWXA 4CBVA 2Q5HA 2VP9A 2XLBA 2PZ8A 4MQ6A 1T0PA 2Z5FA 3PXAA 1E5QA 1CQWA 1AN9A 3N70A 2WTNA 1QJCA 4KX3A 2EP8A 2W6NA 4C6TA 3KCNA 5JH7F 1PL0A 4D6YA 4Z7OB 1WOYA 4ZA2A 2V7BA 2HJWA 1E8DA 3TTTA 2PGNA 1A2BA 1D1SA 1KMQA 1SD5A 2H7CA 3BSYA 2EKDA 1FTQA 2EKBA 3DWIA 3QVGB 5GINE 3ESQA 3PR2B 1VHTA 3INYA 2P9FA 2AN1A 3B53X 1ADJA 2AOXA 4OJYA 5AUQA 2H48A 3TFQA 5B1YA 1UXKA 2E4ZA 5LM3A 3HO1A 3IE0A 1KJQA 3PHCA 4DQUA 3EBOA 5HILA 1I2AA 4PQEA 1GLNA 1W9MA 2D06A 2YV4A 3FPLA 2OV3A 3IH5A 4MB2A 4F1WA 3KQUA 2H4FA 2JLBA 1NULA 5U4XA 3JQGA 2R5NA 4MVYA 5GOTA 4IMJB 3ZHCA 1D3AA 3FJOA 4EJ2A 2OGUA 1KI6A 1Z9BA 4KXYA 3KQTA 2VSQA 2QTVB 2XTAA 4A8HA 3QKTA 4NZMA 4WZ6A 4MYSA 2BHLA 3JWJA 1MEJA 1TK3A 3OY2A 3C6QA 2J46A 1Q3HA 2YMPA 2Q4TA 3ICVA 2MSNA 4JXKA 3JQ6A 1DVRA 3G5AA 2FSVC 2PPLA 2UUOA 3GT3A 2CHQA 2VZEA 1I7NA 4B3CA 3EVBA 4CCSA 1M72A 3O4RA 4Q4AA 1LRKA 1PS0A 2ZQZA 1KI9A 2ZJ2A 4FHZA 3NWBA 4XASA 4Q16A 3EF0A 3IBFA 2R1VA 3IJPA 1OGJA 2H1VA 4FIZA 4PLGA 4YI5A 1MBZA 2PUCA 4CKCB 2DLDA 2G36A 4G0UA 1P8JA 4IS2A 1Y63A 1OROA 1POWA 1ZP6A 1JLHA 3E9EA 4FNAA 3TLGB 1LFDB 1UJ2A 5IX8A 5MN4A 2JZNA 3KU1A 3CLTD 4IYRA 3DBOB 3GRPA 4I1OA 3DWEX 3EIUA 4HWRA 4IUDS 4KQ2A 5DNVA 1AOXA 3O92A 1U3DA 4WASA 4ENVA 1T34A 3U1BA 3A6PC 2NUBA 1KYXA 2CE7A 5JC1A 1CRPA 1WBDA 1P4GA 3N59A 4GZ6A 1VE9A 2XNSA 2B37A 3B8HA 3R8XA 4YXWD 3ZCUA 2PLNA 4BB5A 3G9QA 2J7KA 3VKVA 4X6LA 5HQ3A 3ZD7A 1K8ZB 2NO1A 2QVBA 3Q9UA 3HHEA 2YICA 3WGUA 4BV8A 1YB6A 1SZJG 4NDAA 1PJ4A 4OEHA 2IELA 5IW8A 3QEAZ 1I13A 4LHYA 3M4ZA 3EEQA 4RQUA 5C3MA 3DF9A 2JGIA 4A0QA 2FNAA 1DWPA 3KTAB 3PA6A 3D7MA 3ED5A 2R8XA 2VJOA 4JNKA 3IKLA 3TAHA 5FR1A 1RKVA 1QV7A 1MB0A 2RGUA 4QAJA 3PB3A 1OXXK 1PI3A 4MGYR 4TL8A 1DU4A 5LFAA 2BPOA 3RSHA 3HBJA 1FEZA 2VPXA 4UPEA 5LZ2A 5K99A 2PLFA 4LI3X 1PX2A 5JVDB 2H57A 1JPUA 5M2QA 3CO0S 5A3JA 5LVAA 1NDQA 2OHHA 2PEYA 4MGEA 5JG7A 4DQKA 1NR5A 1UM8A 2L0XA 3GUHA 4EEKA 5A06A 4GMHA 1WXGA 3L8GA 4F3NA 3M1YA 2J9FA 1CT9A 2Z8YA 3N87A 3GFFA 2BGKA 3N8GA 4TVOA 3N39C 4Y2GA 4UNIA 1HLDA 3OU2A 2RIRA 4ENTA 2UV8A 3CCBA 5FADA 4HGOA 3DF7A 1U9ZA 4YPFA 2ICAA 2ZUTA 1FB5A 3UK2A 2RG7A 3TL3A 3N2GB 2FJUA 5JSUA 4BMPB 4BB0A 2ECPA 4PIVA 3RAFC 1BRMA 4MSUA 3FDIA 1JHYA 2GZMA 1GRCA 5LD2B 2X2FA 3R5FA 3GJYA 4QUGA 2G17A 4UD6A 2EQ5A 3ZXUB 1S9HA 1GDHA 2G1AA 3QSGA 2O23A 4XD7D 1ZRNA 3MN1A 1Y1SA 4RA9B 4ZU6X 2BRUA 1FXWF 4F96A 3W7VA 5KSWB 2ZT7A 3V1UA 4DA7A 3MBIA 3U4CA 4RA6B 1FFEA 4JXZA 4RNCA 3OAAD 3TLCA 2AKYA 4DMKA 3OHPA 3FGZA 4DBLC 3O8DA 4UOQA 2W83A 3G6KA 3SYLA 1B1CA 3KDSE 3SX4A 3TLAA 1NVKA 2IZZA 4OHXA 3QMPA 3PPYA 4NBUA 1GPAA 5EEHA 3Q1KA 4QEKA 2FR1A 5TQ0B 2BW0A 2CJWB 3NHSA 4FFRA 4WNCA 4AJ1A 4D79A 3GV0A 4DR1B 3INNA 4NV3A 4DB2A 1SXGA 2G0TA 5K8VA 1TPYA 2Q1TA 4NE9A 4WFJA 4KLZA 3ANYB 1INLA 5KNCA 1QTQA 2ZG6A 2XTJA 1VJGA 4I1YA 4AS3A 4MDFA 3QA9A 1NBIA 3TLKA 3L40A 1TTQB 3ZI7A 4JYBA 4GX5A 3DQPA 5KEIA 2X1HA 3V00A 3RU7A 5DCUA 4HC4A 3WRXC 3WGTA 2A9FA 5I7AA 3DLTA 3WRYA 5DM0A 3PX2A 3QHPA 4KQKA 4N0QA 1YRLA 5DNEA 2MSKA 1O95D 5G0TA 3BAFA 4FZ3A 5J4LA 1GZ6A 3A7EA 4B84A 4MVJI 3MBKA 3O3OB 2IW1A 2FP3A 1KDPA 3AKYA 4AM8A 5G0SA 1SURA 3DE2X 4FMDB 1Q19A 3GH3A 4MLPA 4M99A 3IAEA 2FEWB 5REQB 3OJCA 4QXRA 4O25A 1VE3A 5DEIA 5F33A 4DUZB 3PE6A 4IQ0A 3EDOA 3L5KA 4CMKA 4RKEA 5A5GA 1LBQA 4EHFA 5IANA 3IKTA 5EPOA 4FBGA 5B1IA 5LQCA 2Q5QA 2ET6A 5CTJA 2QD2A 2GJ4A 3JSAA 3I9MA 1L8XA 1SBCA 2C7OA 2B36A 2VA9A 2BCGY 2ZANA 3AFGA 4QELA 4BMZA 3PRYA 1J22A 2ZRJA 4OXIA 3E1SA 5L3QA 5F2NA 3WB0A 3VNQA 4HX2A 4UTPA 3KJIA 3SQXA 3BD6A 1TLFA 3MOGA 5IAEA 4P5DA 5E9WA 3RBZA 4BEWA 1Q1AA 1N3YA 3PRJA 4KJZA 1TQ8A 5DMHA 4LV6A 3IBTA 4G1FA 2ZAIA 5JLJA 1NXXA 1U7DA 1WUTA 3HDQA 3UMJA 5B57C 3O21A 1H0SA 3OIVA 4WNIA 3GJZA 1IZ8A 4L95C 4RK1A 5JXGA 1K68A 4PICA 1C2TA 1DEHA 1WDMA 4QAQA 5SZIA 5T4HA 2WIJA 3IO5A 4NIMA 2W6ZA 1NXOA 3LP5A 4JSYA 4P5EA 5E4YA 1F4PA 1G4HA 3QX8A 1WUJS 3OPNA 5JH7B 1SKUA 1UOEA 4DUGD 2NU7A 3DMNA 3FYDA 4HDRA 3SP1A 5FI0B 1P3JA 2VDUE 1KK2A 3B5EA 3I2IA 4U7TB 4EFDA 1QX3A 2BDTA 4L9WA 1C0PA 3LRPA 2QQEA 5ENDA 2C7VA 4OXQA 2IIBA 5KOHB 2JDID 3P45A 4II3A 2NYRA 5NLLA 1V96A 1JR4A 2YNMA 2OCBA 3AHIA 2FHPA 2KJQA 3V7NA 2GTPA 3HZZA 1RWOA 3OTQA 2XD9A 2W4MA 621PA 1ADFA 4CKYA 1QK5A 4IQGA 3GJ7A 4N3AA 3ZVLA 2E4VA 5CA1B 3EIHA 4PYKA 4UHFA 5KTKA 3O4JA 4OHRA 3S2UA 1J0BA 3FD8A 2WIAA 4FFBA 2FJ0A 4MS4B 2WWGA 4KR2A 2CVPA 3K8QA 3DO8A 2F9MA 4KQ9A 5JR3A 4DUYB 3F1LA 3DZHA 2X3FA 3CB2A 4Q03A 2GWHA 1ND5A 3KPWA 3DWFA 3WWDA 4QODA 2CUNA 2BTQA 2Q3EA 4L5JA 1IRXA 4RF3A 1Z6ZA 4CXMA 3E35A 2YBEA 4CCWA 4ZO9A 3L7IA 5DM4A 2BE9A 3QVGA 5T6BA 5BRJA 1MB3A 4L4UA 3SJCA 2R8PA 3BGOS 3A6ZA 3KP1A 2H18A 1QOPB 2QSUA 4AUMA 2D6FA 4S3MA 4Y0VA 2XADA 1E9CA 3QJGA 3U3ZA 2XH8A 1VL1A 1KMHA 1R88A 3HMQA 3QNUA 4I8XA 1WMSA 1GL6A 3G2HA 4CF7A 2X7HA 4DDKA 2GEJA 2QT9A 2I87A 1MNAA 2LRHA 3DQZA 1OB5A 3SDZA 4Z4IA 4GNRA 3T3OA 5E3JA 3MSCA 2R6FA 1SXJB 2PHZA 4WJKB 1HYHA 4HFRA 3MC1A 4BJ1A 4LF9B 3PC8C 4X1IB 1Q92A 2GESA 1J70A 2IP1A 4UDYX 1XRSB 5G4KB 2P6PA 5J5AA 4U9IS 4GPZA 1QMGA 4L8LA 4CIYA 1KWGA 2B6NA 4KQIA 3IPRA 3H8SA 4N7MA 4BVLA 4KXLA 4FCCA 3PGLA 4YRNA 1RIIA 1NLMA 3L41A 3W05A 2FXVA 4OAOA 1GNSA 2Y1KA 2ZYDA 4MRPA 2RGBA 2EW8A 3AJAA 4JKIA 2CFSA 1R2QA 4KFSA 1NWCA 1TOAA 4A5OA 1J1IA 4K3UA 2HSDA 1ST3A 2Q28A 3GRUA 4K9LA 4MB6A 4PZEA 4Q5IA 3AI1A 5AOAA 1QRDA 4CKCA 2OORC 2OHJA 1UQUA 1CQIB 2WJIA 2HWUA 3IDOA 1J2RA 2YYZA 3TLGA 2HGZA 3E82A 2JRLA 3VU8A 5EZQA 1UQRA 4LS3A 4R5MA 2JFUA 1YZYA 3CZRA 4D0NA 1EESA 2D54A 4E5SA 3EDYA 1GGEA 3KQMA 3TCXB 3H5VA 3E3LA 3KO8A 1NRXA 5FBHA 2FFAA 2OLEA 2XCQA 3B2NA 3NFYA 2CUZA 1HEIA 2R4QA 3QV2A 5CT8A 1KMCA 4EITA 4RTQA 1TQDA 3W8RA 3ZCPA 2SECE 1IJKA 3E05A 1H05A 4LXHA 3D4PA 2VZLA 5DDIP 2VTBB 5LZ7A 3D6FA 4F11A 1GQ2A 3D31A 1XELA 4JHLA 3HWX1 4L8WB 1LDMA 4IUCS 2COKA 5AKLA 5A7FA 2P0AA 1ZINA 4FW9A 4Q00A 3VYWA 5HKKA 3HBNA 4IUYA 5ILOA 4Q1FA 1LPAB 3KTAA 2HJGA 3WFJA 3U09A 1MEEA 3KE9A 2PKWA 3LC2O 5IFLA 1ODFA 2FZKA 3QXJA 1J8MF 3QLVA 3KD3A 5CX1B 5EMHA 3SDBA 4JP8A 2C0QA 3ZU5A 3F6SA 5BSEA 2FX5A 3CZ9A 1NNLA 1X3LA 4BVAA 3K16A 1E6LA 4MUNA 4BEBA 1JFSA 4DV2B 3EY9A 1CUXA 5JVDA 3ROEA 5L7WA 3GFVA 1EK5A 2QRJA 4OSEA 5JI2E 1E63A 3ZXXA 1V11B 1QORA 2MSLA 4OBEA 3RJZA 4NZ9A 2WLTA 5LQAA 4BASA 1O4WA 2A5JA 4OYRA 5ED4A 2ZIWB 1WB4A 4AF6A 4BVEA 1GTL1 3TOCA 1DCKA 2VIIA 2DUNA 5F1OA 4A73A 1T15A 1V71A 2QROA 1RBZA 3E1KA 2G83A 3IMCA 1OKKD 2FPXA 5C9ZA 1MB4A 2D2VA 4INJA 3W2EA 1KC1A 1F6WA 2QJWA 4LNAA 4RMGA 5B58T 5I9BA 1KP9A 1WM1A 2VBIA 5COQA 4HVCA 2ORED 1N6NA 4PLPA 5TF0A 4TL7A 5JYEA 3OE1A 4H7JA 1DAFA 1G38A 2BIFA