1ES9A

X-ray crystal structure of r22k mutant of the mammalian brain platelet-activating factor acetylhydrolases (paf-ah)
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
212
structure length
212
Chain Sequence
ENPASKPTPVQDVQGDGKWMSLHHRFVADSKDKEPEVVFIGDSLVQLMHQCEIWRELFSPLHALNFGIGGDSTQHVLWRLENGELEHIRPKIVVVWVGTNNHGHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLPRGQHPNPLREKNRRVNELVRAALAGHPRAHFLDADPGFVHSDGTISHHDMYDYLHLSRLGYTPVCRALHSLLLRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The functional implications of the dimerization of the catalytic subunits of the mammalian brain platelet-activating factor acetylhydrolase (Ib).
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords PLATELET-ACTIVATING FACTOR ACETYLHYDROLASE IB GAMMA SUBUNIT
total genus 77
structure length 212
sequence length 212
ec nomenclature ec 3.1.1.47: 1-alkyl-2-acetylglycerophosphocholine esterase.
pdb deposition date 2000-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13472 Lipase_GDSL_2 GDSL-like Lipase/Acylhydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 1es9A00
3MILA 1ESEA 3KVNA 3P94A 4S1PA 3DCIA 1PP4A 1BWRA 4OAOA 3BZWA 3PT5A 2Q0QA 1U8UA 1ZMBA 1K7CA 2WABA 4K40A 1YZFA 1WABA 4IYJA 2APJA 5BN1A 2O14A 5HOEA 2Q0SA 3RJTA 4JGGA 5B5SA 3DT9A 4DEVA 4JHLA 1V2GA 1J00A 3DT8A 2VPTA 5CD9A 1DEOA 3DC7A 5A4AA 4TX1A 1ES9A 4HF7A 1JRLA 4JKOA 4K3UA 2W9XA 1ESCA 1VYHA 4PPYA 4M8KA 2WAAA 1BWQA 1Z8HA 3SLRA 4NRDA 4K9SA 3DT6A 2WAOA 3HP4A 4I8IA 3C1UA 4OAPA 1VJGA 4RSHA 4RW0A 1BWPA 1FXWF 4LHSA 4H08A 4HYQA 1IVNA 4K7JA 2HSJA 5JD3A 1DEXA 3U37A 1FXWA 1ESDA 3W7VA 4Q7QA 4JJ6A 3SKVA 4JJ4A 4Q9AA 4XVHA
chains in the Genus database with same CATH superfamily
3CVWA 3PDUA 4ZO9A 1JHDA 1TMYA 4ED9A 3EZYA 4JXZA 4B71A 2ZWVA 4U6NA 2PA3A 4E1BA 1Z62A 5KTKA 2VF4X 2FEMA 3NASA 3DO6A 1SC6A 1D4AA 3F8SA 3H83A 4GE0A 4P4TA 3KVYA 2PO7A 3JATB 4GOMD 4LQ4A 3FHOA 4OOFA 4YJ2F 1XPOA 3BGDA 2DG2A 1MNAA 2EZ4A 2HFKA 3M7IA 4XX0B 3HSKA 1XDZA 1E1CB 1OFVA 1XRSB 3LL7A 4HAUA 4M76B 4ZEWA 2NUTA 1G0NA 3WG9A 3AR7A 2CBGA 3QWAA 1YMUA 3O8DA 7YASA 3EBOA 1K5DA 4OY3A 2I29A 1Z2AA 2CDNA 2EAUA 4DYHA 4OHZA 2FZCA 3FPAA 5A1JA 2Q5IA 2XEDA 3CCBA 1N9GB 2FX2A 4GPTA 4H7PA 1UWLA 3ET4A 1U7PA 3GO4A 3G0IA 3PDJA 5HQJA 4MV4A 3R7NA 2GKSA 2ZJ4A 5B2ZA 5JU6A 2Q1WA 4K1LA 4TTIA 3IMCA 3VNSA 4PXSA 4BP1A 5FULA 3DXXA 3KPUA 4IJUA 3K6SA 5MHTA 2P6NA 5ILGA 1BD4A 4HDRA 2IUTA 1AUOA 4TUYB 4IZ6A 1FUUA 1KVTA 2AFIE 3N7UA 3TSAA 2Q6LA 5E3JA 2QENA 1RRCA 2EEZA 3D4IA 1W87A 3I62A 1KPIA 1E98A 1GARA 1T6BY 3GFGA 2QSJA 2PAAA 3GP3A 2O50A 1AMNA 5D3QA 1G3UA 2AE1A 1IZ0A 1SXIA 2I33A 2NZYA 3ICCA 3WL6A 5HIKA 5H9VA 2DFTA 4YN3A 3U9LA 3BB4A 4BMZA 1J24A 1QZZA 2QS9A 4HXYA 4B17A 4DCMA 1I10A 5A7GA 3UV3A 3AI1A 4WNIA 1EJ6A 1FMTA 4HQ6A 3QVOA 4LJ6A 5DHAA 5FTMA 4LFCB 3L40A 4K9PA 4N7BA 4XJTA 3F74A 1D3AA 1X1BA 1GG5A 5BNWA 1M1YA 1V8ZA 4Q00A 1L5LA 3HB7A 4C7OB 2PUHA 1ABFA 4M89A 2XAAA 1YZVA 2JFWA 3F8WA 3PC8C 1YH3A 3ZV3A 1JSLA 1XZLA 2H48A 3N0XA 4CR8A 2D1RA 1XTPA 1KK2A 2WIJA 1EK2A 4F71A 3ROZA 4M2LA 3A6JA 2G28A 4TV9B 4OU4A 3LX5A 3FCEA 5HIIA 3VC3A 3W78A 4S35A 2PU5A 5KDLA 2WHXA 2FPPA 3C1TA 1PWEA 1L5WA 1U28A 4V3CA 5CB6A 3ZJTA 5COAA 4IXTA 3E03A 4ND1A 1RC8A 5I7UA 4J7XA 2ZRPA 2A9PA 4HFRA 3E23A 4Y6PA 5FIUA 4YUAA 3I64A 5CT4A 1B93A 2PUJA 5EJFA 4AF6A 4NZOA 3TXXA 4BQNA 1QV7A 5B30A 1LPPA 1WNTA 5A71A 1NUQA 4XARA 1VMDA 1CP3A 2NN3C 1NBMD 4WD3A 2ZFUA 3UHAA 1NW3A 5BRNA 5K0JA 1U0HC 4JR0A 5ELMA 3DL4A 3S5UA 3PEWA 3NBXX 2WSMA 3GJ6A 5F3WB 1H2HA 1W44A 2CXSA 1MVNA 3MILA 4HGZA 4DA6A 5KJCA 4NENA 1AK2A 4QUIA 4YLGA 2W37A 3M2PA 1X38A 5CU7A 3X2FA 4BV8A 5AHRA 5IJXA 3G79A 1AG9A 5ICMA 1XZAA 3MT9A 2DT8A 3PIIA 3IQFA 4KLZA 1USVA 1TM7E 4ZEVA 1FX0B 2CNWD 2CJYA 1OY1A 2W6OA 4J0QA 1TYZA 1ZGZA 2L82A 1KJ8A 4J1TA 4X6UA 4A27A 1F4LA 2YWFA 5JZSA 2XGJA 3RYIB 2WWTA 1ZIXA 3ZLBA 2J0QA 3M6FA 1NVWQ 3E05A 1YZNA 3A4MA 3DLAA 3LUPA 2Y1GA 3NCHA 16PKA 4IHJA 4RSRA 5K0BA 2JHGA 2DY1A 1IN8A 3A9SA 5KZMB 4QBGB 1RC1A 4D8YA 3T9BA 4FYJA 4WECA 2W2NA 1SCUA 4HDKA 3QVWA 4AP6A 4UAVA 1E0JA 2EC5A 1SKMA 2Y68A 4RKYA 2PZKA 4CQLB 1W85B 3KYBA 2ZJYA 3AHDA 4MH0R 4OYYA 4Y0NA 3TLEA 5CDFE 3BHIA 2OB1A 1W9HA 3BB3A 3HR4A 3HXTA 4IFEA 3QKIA 4U3JA 2CEKA 2QX4A 3B6EA 1J8QA 1WXXA 4MDYA 3T4XA 4WBXC 3L4BC 5AW5A 1VLJA 1NJ6A 1CD5A 5LYYA 1QH8B 1M1ZA 3SQLA 4ZAWA 4BFZA 3EA4A 4Q4CA 4K9DA 2QVCA 1M2GA 2ZG6A 3K09C 4II2A 4FJ2A 3WHIA 2QSYA 3E22A 3A1UA 4WY8A 3GLTA 1XXLA 2ZSEA 4TX1A 3O74A 4G4SO 4ZVMA 2QAGC 3RRNA 1BJTA 1RS0A 2OK7A 1M76A 3PC7A 3QW4B 3CONA 5E7IA 4ALLA 5FJIA 4D97A 5I4BA 2ZRBA 4DMKA 4PYJA 4R01A 3WOHA 5C53B 3RYFB 2IOYA 4TLMB 2XCLA 4C0KA 2I1LA 1RKQA 4QXMA 2AXQA 4XD7A 1FS6A 4XX1A 1K8ZB 1NW5A 2Y6UA 3BTOA 3NONA 4ZC1A 5L8VA 4QBFA 3AUXA 4O4IF 1L5OA 3HA2A 3BH7A 4YFVA 3T5DA 1PK7A 4BNFA 3RE1A 4AZWA 2XYQA 4FYXA 3W5IA 1S2GA 5KWEA 3AR3A 3GZNA 1HDYA 4I5EA 3TFOA 1F38A 4NDZA 1ATIA 1ID1A 3IKJA 1NKVA 3D02A 4I81A 1UOEA 4RCVA 3IUPA 4U2CA 2QJWA 3URMA 2XKKA 3AF4A 2M6KA 3Q6NA 4KLCA 4PQRA 1XZ8A 2P3LA 2I1WA 1IWPB 1PQUA 5JWRA 2CLEB 4E7OA 1LV8A 1VPEA 4JHXA 4DBZA 5I7OA 2AN4A 2ZI6A 1UK9A 2QA5A 3BTVA 1LTQA 3HWX1 4NX2A 3TPFA 5CLJA 4G9GA 2XNDA 4OF4A 1NI4A 4CMJA 4D3YA 5A3SA 4WCVA 4JI2B 1RHKA 3ZPXA 4MIOA 4OLJA 4PAWA 1P44A 5KC9A 2Y1CA 3OQPA 1J22A 3UJHA 3O38A 1UKCA 2QD4A 4QDTA 1CBUA 4YGXB 3L8FA 1T0PA 2XADA 3D2AA 3F6SA 2KSQA 1UXOA 2VZLA 3LPDA 4Y2PA 1W8DA 2BT4A 2F1RA 2VTVA 3ZHTA 3D7LA 5MDHA 2K4MA 2ZRCA 3DUFB 1BDBA 4FCWA 2VDVE 4QUAA 5L6MB 4KHZA 2BBOA 2YN2A 2W4IA 3S29A 1EXDA 2XDQA 4MULA 2OCAA 4JV5B 1R4ZA 3ORRA 1C4KA 4GGMX 2B8WA 4QGFA 2Q8NA 4US0R 3C3JA 1FDIA 2BFBB 3SR4A 4ZFNA 4FFNA 4NHOA 4DL9A 3C6MA 4PCUA 4OB7A 4E88A 3O3MB 4BNZA 4UTVA 2P2ZA 1A04A 1CJMA 2A35A 3CKYA 3HCWA 4LMRA 3UICA 2ZU0C 1GNTA 3LYHA 3QE0A 1PJQA 4M0EA 1J0AA 1FFDA 2IYPA 1RYHA 3OEHD 2DBVO 2QP4A 3ANLA 3FVRA 1Q11A 4CU5A 3AR5A 5BQ3A 2P5TB 2W2OA 1KAOA 5DGXA 3B6MA 4JT8A 1PL6A 3ZUGA 1F9EA 1MRSA 2GYVA 4XIIA 1R5NA 2FSSA 3UGTA 4LXIA 3HDQA 4LE1A 3A9CA 3PUZA 5AR1A 4EHKA 1B8OA 3X0DA 3C3KA 3V4RA 3DOCA 3KUDA 5JHHB 4MV3A 4RV9A 1P4GA 3PUVA 5E6RB 4Q1AA 3MLAA 1AT1A 5BQ5A 3RS7A 1FUYB 1PJTA 1T8RA 2W58A 3LYLA 2R9VA 3M49A 2HPAA 4MUAA 3ZHCA 4D8WA 1UBKS 5F4ZA 3MS2A 1Y6GA 2W0MA 2DWOA 3WMRA 5LQAA 3VISA 2HMVA 1FVXA 1UZLA 2DFLA 1Y7PA 3QUCA 4PCVA 4EIWA 1UPTA 4JODA 3UNXA 2GXQA 4H15A 5ED4A 4R6XA 4IXMA 1NJFA 4HZGA 1NT2A 4MVYA 4BMDA 4D4JA 2OFXA 4B6FA 4CGYA 2OR3A 4J0HA 4EPXA 3THWA 1EWYA 4I4TF 2RHHA 3NIBA 5AH0A 4K5QA 5TS2A 3ONDA 3QHQA 4PBRA 4MS3A 1W6RA 3G8CA 4LK2A 4XIYA 5EUCA 2X15A 3W6UA 1JEYB 4LF5B 1OFUX 5L7WA 3SZRA 3SEQA 1E1RD 4NPHA 1XN1A 3G9QA 3ZD9A 2DHEA 2QT9A 1R6UA 2FPGB 2J67A 3TL2A 3RWMB 1XK6A 2OBXA 2YYZA 2IYUA 2Z83A 4D41A 5EJ5A 1HYGA 1T9BA 4QBIA 5LB2A 5DKFA 1QMGA 3KAQA 5LLSA 3RC1A 3VUFA 3D54D 4MTCA 3VV3A 4U2KA 5LWHA 4KIJA 3JQDA 2QGZA 3ZLVA 4HLDA 1FB5A 1MB3A 1P1CA 1XJCA 2AK3A 2QTNA 1Y3DE 2XYPA 3IP8A 3M1LA 1SBTA 4KVAA 1MH1A 1T35A 3BFVA 3SMVA 1EGHA 4NP6A 3PXXA 4EDHA 2W22A 2W4MA 1DTWA 3T15A 5DSZA 2M1XA 4WMLA 4EYOA 5BSFA 4ADSG 1J07A 2REOA 2I4MA 3ONNA 5A5FA 1O1YA 3LX4A 4D9IA 4UCFA 4ZANA 3S5JA 4ARVA 1SZJG 5BSKA 1L7MA 4H59A 2QTRA 3K0EA 2XMPA 4E5DA 2X2FA 5EIEA 2J0VA 3LF1A 4I1OA 4N5MA 1WXDA 3I09A 2AWNA 2IW1A 2GJAA 3UUFA 4MIYA 4BPRA 1WCYA 3RTEA 4J4BA 1NBMA 3DW3X 5DV9A 3H9BA 1E2QA 3P96A 4L7VA 1TTHA 3T9CA 2N3ZA 5AYVA 3BMQA 4TT3A 2XUGA 4WJKB 5F52A 5GMOA 4BVFA 4DGSA 2JFVA 2JGKA 3Q8WA 4OQLA 1NZFA 3L6UA 1YS1X 1MXFA 5C3MA 3WZMA 3OMXA 1NNEA 1M0WA 4KI7A 1CUUA 1JIJA 3VNUA 5BSGA 1N6PA 4Q4HA 3U13A 1HLDA 4A5SA 3PJFA 1DAKA 3QBJA 3X3HA 2QLLA 2V55B 2XGOA 3EIOA 2YHBA 3SQNA 3UAZA 4HLUA 5SZKB 1X7DA 3X1YA 4FMCF 1ZONA 2D0PB 3JZDA 4DOMA 5C5EA 1LF5A 3PA6A 1UFQA 2QN8A 3DMFA 3GFFA 5HF6A 1EX7A 1V39A 4GRAA 4CCYB 3HADA 1N5MA 1MXHA 4MICA 4C20A 4TT3D 1FJGB 3QXXA 3B9RA 3RK4A 5ICEA 1SU7A 4ZVTA 4GC9A 5EHIA 4CIBA 3E35A 3L18A 1JT9A 1IFXA 1O96B 2OYSA 4W9RA 3JYNA 1S2NA 3G5MA 3OO0A 3L06A 1SFRA 4DDHA 4CTNA 5LQDA 2PGAA 4N7RA 2J1LA 2J9GA 1EDEA 4EJ0A 1W88A 4Y6GB 1P31A 2YIJA 1CG6A 1GGVA 2G88A 1AQNA 3CF4G 1NUAA 1Q1BA 2R8EA 2X0FA 4DA7A 9MHTA 4EY6A 3AFNA 3EGDA 3RJTA 4AG3A 3W5UA 2RGXA 1H8HD 3H9UA 3N28A 4Q02A 4ZT5A 2IPNA 3K6RA 5JWHA 1QCYA 3A6LA 3RBVA 3V7YA 3ZUPA 3CUWA 4B5KA 3DPUA 3U3XA 3N2KB 3RVNA 1UKZA 1Z8FA 5FOSA 4NXNB 1E3SA 1J8MF 1I7LA 3IQDB 3EUFA 2ZS9A 4P36A 2XVMA 2X7JA 1PTJC 2RHBA 3UJAA 5K8UA 3NM4A 1TUBB 4C5BA 3R6LA 2LCIA 2PQ6A 4DV4B 4S1TA 4HG2A 4J0FA 3ZHYA 4BVLA 1QP4A 2PMDA 3KXIA 4MWEA 1I7DA 5HKKD 1CUZA 4H7IA 2OD9A 4HWPA 2Y9PB 2V74B 4YJFA 5HUQA 2JD1A 3QRWA 1P2FA 2C4NA 3C41J 5BYBA 2IPOA 4J0IA 3DFKA 2AG1A 4BKPA 2ILTA 2Y76A 1ZD2P 1SVOA 1B2RA 2GEJA 4AMVA 5DNVA 1W4ZA 3O75A 1YDHA 5G40A 2KBEA 1YR1A 2Z3VA 2ABWA 4QU5A 4JJKA 3SXUA 3KFVA 4NZNA 5FUQA 1NJ8A 2FOIA 2WAAA 5H16A 3TAUA 3THOA 1SOWA 4Q05A 1K86A 4D9KA 4IFTA 4JEMA 4JP1A 1E2KA 1Y7TA 1GTG1 3RSFA 3ONEA 1YE8A 3TIGA 3OEED 2JFYA 4L73A 5TQJA 3LOUA 4IIBA 3UW1A 1JWLA 3FUVA 1UFKA 1YNOA 3Q10A 4L22A 4D8UA 2EQAA 3F9CA 3GYBA 3QJYA 4OHKA 3I9OA 3H5LA 2PVPA 2J3HA 4RZHA 1NG1A 4ZQCB 3D8TA 4RACA 3DGEC 4C2UA 2UZ0A 3EDMA 4R8VA 4IMJB 3TZEA 3ICEA 1P1KA 2PCJA 1DG9A 3HFRA 4DA9A 3ROQA 4QTUB 1O94A 1ZVJA 1YFZA 3R3HA 4KE7A 4R68A 4ZAVA 5ICFA 1E6CA 4C4RA 3I73A 5H70A 4HN4B 2OAP1 3ND7A 5EUQB 4GLJA 1OC2A 1TQHA 1WB5A 1MOZA 3ZJ4A 3PXAA 5ALNA 5ENZA 2HRRA 3FRIA 3WK7A 1CF4A 2H92A 1DWPA 1JJVA 3KT3A 5CK4A 1YACA 1Y8ZA 3IA2A 1I14A 4FGLA 4TZTA 2HF2A 2YFKA 4FIZA 3ZG6A 3GZ4A 3HVHA 5FWYB 1BQ3A 2PJDA 2QX8A 2VBGA 2Z95A 4JOBA 3T12A 1JHUA 1Y1SA 1WUTA 1FX0A 1KJQA 2DVMA 4XLTA 2GBGA 3IOCA 2EXXA 3KHTA 1W85A 2OA0A 3HHPA 4QRIA 4FGSA 3L8CA 5AW3A 3DE3X 3C8MA 3QBVA 2QV0A 4EJSB 2O8EA 4A0SA 5CJJA 3D8SA 4AQDA 2ZBEA 3V6MA 4TVBA 5TS3A 3R6WA 4O4HB 4PPQA 1MRZA 1BE6A 1I0IA 3NWPA 3GLRA 5GTDA 1TUEA 1XMOB 5T4FA 2P6RA 2C2BA 1L7BA 2PWPA 2H16A 4AG6A 1QANA 4GXQA 3RUHA 2XODA 4LBVA 4EEZA 1QV9A 1EB8A 4NZMA 4OSEA 5CT9A 5CX1A 1QJ4A 4GR9A 4DAEA 1X13A 1PZMA 3AERA 3LIIA 4B7ZA 3ZYZA 3KOMA 4AO6A 5ILQA 4KMRA 2O2GA 5IFLA 3F3KA 2VHYA 3CLHA 4QARA 4ZOLF 5H4GA 1ZESA 1R74A 1BJKA 1B3RA 1UK7A 3GCGA 3IUMA 4HRVA 2WAYA 3NHJA 4JLVA 4WLOA 4JBGA 4X92A 2X5NA 3UXMA 5I9IA 4R83A 4FC7A 4Z4FA 1KKMA 1T9AA 2XE4A 2OHXA 2ZSAA 3IQXA 3WBBA 4OX9Y 2GPNA 1KIFA 2V9ZA 4RTLA 2I4LA 5HIJA 3WGLA 3TTWA 4DYVA 2QM0A 5FT9A 1E1NA 5FTWA 2QUIA 2VSOA 4EO9A 4LFAB 3FMPB 3NKVA 2QRVA 2B1IA 4HDNB 1SXGA 2EFHB 1C3XA 3PDIA 3ZNNA 2P79A 2Q1SA 2ES4A 4IHJB 2OHFA 4L57A 3WNDA 4IF4A 1I5EA 2EV9A 3OZSA 3QJGA 1R6TA 1E1MA 4JI6B 1H2AS 1P0QA 4EKNB 5BRJA 2O8NA 2NVUA 4F8EA 1G42A 2GZ1A 2RIRA 1PS9A 2MYPA 2QN2A 3TDKA 5C5IA 4QBHA 2JH3A 4L0QA 1JSCA 1N6NA 2V4UA 3K3PA 4RQTA 4X6LA 1A9YA 3O8RA 2XSZD 2X7HA 4XYMA 1C8BA 1JJAA 2I1VB 1UJCA 5CX4A 2ZYTX 5JJ5A 2WPDA 3X1ZA 3NHYA 1BWQA 4TSFA 4LY0A 1XNHA 3BWCA 2CFOA 2RARA 4UREA 4D9HA 5KYUA 3NAMA 4RTSA 1KS2A 3TZHA 3EISA 3M1IA 4LXTA 2AEEA 3B6IA 4FQ7A 4MGYR 4P81A 1HYHA 2ODEA 2RB4A 3AK4A 3H1EA 2EL9A 3LBYA 3TJMA 4B4WA 4EW3A 2WM3A 4KVFA 4KLRA 4X6YA 3RVLA 1TKAA 3TUJC 1YB6A 4MWSA 4L9SA 2Z8YA 4AJOA 4QAQA 1E7RA 3CEMA 2EWWA 1WX1A 2RK4A 2K6GA 3IILA 1SA0B 5JAMA 1QZUA 2V7QA 4HBGA 1D9ZA 1E3WB 1KZ7B 4EF4A 1DPFA 1U0TA 2CNNA 3QUTA 2GFIA 2BEUA 2J4FA 4P93A 4Z8YA 2B1QA 4XEUA 5H81A 4AXXA 1BKDR 1E2JA 2CFRA 4B2IA 3GD7A 3PGJA 1O4VA 3VHXB 2FPPB 1K75A 1Q95A 3WGOA 3TTYA 4FZVA 5FF9A 3OF3A 4YR7A 4M7OA 2D1TA 4OQQA 4Z0HO 2H59A 1EAYA 5KSZA 2I6SA 3Q7EA 1CZOA 4TTVA 1KE1A 3TS1A 1G6HA 1Q1GA 3E8SA 4B2LA 4IOMA 4E3WA 1QK4A 3AVPA 3TINA 4DLKA 3BKWA 4IQ4A 1PL0A 4DDWA 3VR4H 4LBZA 4RK0A 2NU9B 3GUVA 3WZ2A 1M1YE 1M73E 3R7DA 4NE7A 1DC8A 4FWIB 2X19A 1H85A 4JP2A 1E0SA 4RETA 3PUHA 4NOKA 3IP7A 1JH9A 3WWOA 3D3WA 2RD2A 1CZKA 2DPYA 2AWOA 2O0KA 4X85A 2GD2A 1LS6A 4GZ6A 5E95A 3DBVO 1CY4A 1M6YA 4TV8B 3RVDA 1R16A 1OT5A 5J2TF 4EPRA 1P9NA 4YROA 4RFVA 1VPWA 2D7CA 2HPZA 3G2KA 3O6VA 1RBQA 4UARA 2BEVB 5F2KA 1UQRA 4PZLA 3L4KA 1PL7A 4PCLA 2Y0CA 4LSWA 5CDGA 1Z39A 2AGVA 1L7EA 2CKMA 4UVDA 1GRRA 1HZZA 3VPSA 1UJBA 3GMSA 4XJVA 3SEAA 3T0GA 5K7SA 2VQDA 3MMNA 4HLUC 4EZEA 4UHKA 1EFTA 4RQUA 4L6IA 2BR4A 3C6KA 4PG4A 1UBFA 3WLFA 3PZBA 3PIDA 5CYGA 5JS8A 1RI2A 1ZLXA 2HX1A 3EK2A 5AD1A 1KJJA 4JSTA 4RIEA 4DHEA 2XQJA 1EHYA 3ZQKA 5DXFA 3ELYA 2YICA 2ZJ7A 2BDTA 3MB5A 4HK4A 1ODFA 1YJCA 2EJUA 4KQEA 1XYGA 2QD3A 2LGJA 3F7MA 4D42A 4OO3A 1JLLB 2FEAA 2YIVX 1IHXA 4OMDA 4X1OA 1N9GA 4WBSA 4KYIB 3ADCA 2XYVA 4YQYA 5EJ8A 1UDWA 2FGJA 4OYHA 4PNEA 4IIJB 5D00A 2EWVA 1Y3HA 4LDNA 2JFBA 1Y33E 2YVAA 2EKQA 4GZ3A 5GGXA 5JMTA 1PSZA 1S8FA 1CRQA 1TK9A 3FZEA 1KDPA 1QIMA 4HDRB 4UCXA 3A6KA 1DUSA 5LCXA 3SDSA 3HNPA 3HB1A 1U0GA 3T9DA 1U6JA 3W6OA 4EYQA 2HV8A 1I3CA 3TCKA 2GTPA 3HCDA 4WTOA 4TMFA 2BISA 1Y1KE 1BSVA 1XEXB 1US8B 1ZCAA 2BEJA 2H1IA 2WHPA 3QWFA 4ESVA 1ZGBA 4LISA 3C1AA 5D7NA 2HJWA 3V1TC 4JFAA 4EPVA 2QRZA 1WCIA 4R2IA 4B9EA 2A9QA 3AXSA 1F6WA 3FI9A 5D5QA 5IF9A 5JATA 2E5LB 3C6QA 4DRZA 3ADKA 4AJ4A 2ZR7A 4PLGA 3SF0A 4I8IA 3T3IA 3WY9A 4CXMA 2AG0A 1VLMA 2AK2A 1ONOA 2QD5A 2XNKA 4F5YA 4ZRMA 3H4TA 4N0QA 3C5CA 3DAFA 4KK4A 1TMKA 1VFPA 4IOJA 4WCDA 4Q9HA 2GK7A 9ABPA 5K6AA 3V7FA 4C6SA 4DRXB 1HBJA 1IAVA 2FH5B 4YX9A 3K53A 3R5KA 4HTFA 3W8NA 4R81A 1XPJA 3G2QA 5B6IA 4FHDA 1M5TA 4HYQA 1DNPA 4JMLA 3CEJA 4Q4JA 3E84A 4M7RA 1NR7A 1RLJA 2QP3A 5E9QA 2FE4A 3TEJA 4KACA 4YT4A 4YV1A 1JDPA 3MJVA 5K01A 4POOA 4PLPA 1FXWA 4BHTA 2QMEA 3BPSA 2MYTA 1U90A 4JBLA 4D3FA 1NNUA 1ZKDA 2C4HA 2JIOA 2R1UA 1SH7A 3NYQA 1OHHA 2D0IA 5DEIA 1PT6A 1DGQA 4L8VA 3QNMA 1RJFA 3LHKA 2UKDA 2NZWA 2VRBA 2A9JA 3LWZA 1T5OA 1YD7A 1Z38A 3FNQA 1XJQA 3EN0A 3GC6A 4Z0NA 1RM3A 2F3UA 5ALPA 1LPBB 4Z9AA 3WGQA 2F8SA 3VGJA 1GZDA 2BCJQ 4H3SA 3MM4A 5F1OA 3B7GA 4IIVA 4MR9A 4TYYA 2B5VA 3GGPA 1M8JA 3ZDBA 4CEHA 1E1LA 1ZNWA 5DMXA 2AUMA 1T2CA 1R4AA 1V25A 3CSUA 4QXRA 1UIMA 3PI7A 4QPCA 5K3OA 4PM4A 1LDNA 3E9DA 3Q41A 4H0FA 4F60A 2V59A 1O97D 4Y1GA 1KYZA 4KXVA 4AKSA 4LPSA 4WV3A 1LQTA 2APJA 3PP8A 3DVLA 5J4VA 2ZANA 1WUJS 5DM2A 3HJGA 1H0RA 3FNIA 2PLRA 2CHEA 3QX7A 4Q3OA 3OLWA 2Q0SA 3PYXA 3OJLA 2VYFA 4YRJA 2GN9A 2JIDA 1P8AA 3G5AA 1KYTA 3R4CA 4NU5A 4R54A 1XAIA 1WD7A 3FTQA 2Y3IA 1GTVA 2V6MA 4OHOA 2A4MA 3UW3A 4BCBA 1XXHE 2HRQA 2ZKLA 2V0CA 4O4LF 2X13A 2ZE8A 5TMEA 2C3YA 1NVUQ 5NLLA 3S8MA 3TD6A 4JI5B 4LWPA 3BCSA 4JLSA 2YOHA 2B8JA 3NWBA 1M83A 4FLEA 2X5XA 3RTDA 5D86A 2OZEA 3BMNA 1SXJB 2GD0A 4BMSA 4ND4A 1A7UA 4FOTA 3ZX5A 2B8EA 3PE6A 2B4RO 3CWQA 5A4AA 5GZ3A 4EGAA 1S6YA 4NJEB 1ZGCA 2VUSA 3EXIB 5IZ4A 1KDOA 3UGJA 2WLSA 1OFIA 2DLNA 2FZKA 2KBFA 4P7JA 1GPYA 2MSKA 2VK4A 4GBGA 5E2AA 3GLHB 1ZWKA 1A4UA 4M1YA 5LOVF 3FF1A 3SQMA 2I6GA 3VMFA 2HEIA 5EL0A 5KYWB 2BD0A 2ODTX 1CR6A 4URFA 2OO5A 3D6MA 1N2CA 4MVCA 2J9YB 3C3MA 3BEDA 1EVZA 2SKEA 2XGSA 1WSDA 3D8NA 3WV5A 1UDAA 2WYIA 3O21A 1A8HA 2NSLA 4FONA 3T52A 3V1YA 1M5UA 3PFNA 2XI4A 4GKVA 2HXGA 2HYIC 1E5VA 2BCGY 4JLWA 1DFIA 5SY4A 5K3BA 3MGKA 1L3CA 3HU5A 3O1LA 4M3NA 1RXWA 4Z0TA 2JFFA 3OCVA 4HSEA 3OICA 4E2FA 2GN6A 3GPIA 4P84A 3SZLA 5BSMA 3BAFA 2NO0A 2XR1A 2ZB4A 4HS9A 1SUDA 2IEGA 2VCYA 2OXEA 1K1EA 4TTTS 4ZMBA 3WLEA 1U6IA 2GQ0A 3WBFA 4WKNA 3EZLA 5KQLA 3ZS9A 2EIXA 3CX4A 2GZMA 1DAMA 3LSTA 3QLUA 4QQNA 1TAQA 3TLAA 1YZUA 2DHDA 4C88A 3GLFE 1CHDA 4ERXA 1JKMA 1SHZA 4W5RA 3NGMA 1PLKA 2JCBA 4RADA 3QK7A 3QLVA 4Y9DA 5H7XA 3AINA 1R8YA 1QPBA 1VSBA 4JLOA 3A6PC 3TQRA 3FX2A 3NTRA 3V8MA 3ADBA 1EFVB 2AJBA 3EFOA 1YIAA 2HCFA 1OW3B 2ZIFA 3CH4B 3IQEA 4XSVA 4YNBA 5IBPA 5CAEA 3U60B 3D8BA 4M1QA 1NWCA 1LNZA 4ER0A 2IYTA 4WKBA 5EIWA 4RZ2A 1COZA 4IDEA 3LRPA 4OP2A 2VJQA 4U5QA 3ZCXA 5BXQC 2WDPA 2CL6X 4DLRA 2GDJA 3WBKA 2HR1A 1LX6A 2DWUA 2I8CA 1YQEA 2Z2ZA 3EFEA 4KLAA 4KR0A 1JLRA 2FLWA 2QYOA 3HSSA 3PQ3A 3CRZA 4XDYA 3ZWQA 1EUYA 3KFXA 2EBFX 2PGDA 2ZIAA 1OFHA 1W35A 1B8PA 3HCNA 1TUGA 1JLHA 5HE9A 2AMFA 2RGAA 2I2DA 3ZE0B 5K8CA 3IAXA 4GQIA 2IHBA 3K9BA 1M0EA 5LQMA 1ICEA 2J5XA 1OUMA 1EBBA 2ON6A 1ZK0A 3UAVA 3SDZA 3H9QA 3N2YA 3KSMA 2VJDA 3HKEA 1MC8A 3VDQA 1F2UB 1KZYC 3N53A 1KE2A 1P61B 3HC7A 2HCRA 3A1DA 3E9MA 3LYUA 1RM5A 3HDJA 4DIUA 1ZD8A 1Z4JA 2PM8A 7MDHA 3VR5A 4W5QA 1HDRA 1GAWA 1SB8A 2PT9A 3MUNA 3OPYI 3AL0C 1NATA 3QY9A 5K45A 1MIHA 2O3RA 3OFKA 4MYUA 1TE2A 3MRSA 1E3IA 3C87A 3PNBA 1L3IA 1ULHA 1OGIA 2P67A 3FFBA 5LD2B 1V1JA 2ORIA 3KJFA 2C7OA 2C99A 1RJWA 1SA0A 1VKNA 2VQEB 1VSUA 3L7NA 5AOAA 1QNFA 1ZC3A 1TEXA 3I9NA 5BW6B 3VU8A 1PR6A 5LP6A 2QRLA 2ZIXA 3VTFA 4B79A 2WJPA 3I52A 3IMEA 1JQ5A 3EGEA 3RUIA 5HRAA 3RU7A 5JCXA 3TNLA 4BJ3A 3B7PA 1KPHA 3U4AA 5JCOA 3N58A 3PC6A 4M9XA 2BFDA 4F3YA 3KJZA 2HMYB 2XUPA 2A5FA 4IM7A 1JVSA 1CHNA 5L4SA 4MVJG 3IJRA 1OH7A 4K6OA 4F2PA 4U8GA 4J0EA 3N8KA 1NZJA 1SHTX 4TTRA 3QELA 5FV4A 1POWA 1S2MA 3A26A 4G1CA 1RRFA 1RLTA 2O2JA 1UF9A 3TAHA 1T2AA 5B4TA 4HVTA 3NM5A 1AS0A 1MR3F 1JHMA 1KEWA 1ZVKA 2ARKA 4LVOA 4ZO4A 1L5QA 4K05A 4ZVPA 1KR5A 3DEKA 3AUJB 4ROSA 5HMMA 5JAUA 4RD1A 3ZLJA 2C9ZA 3HXMA 1DIAA 5DYGA 4PSAA 1UPUA 3ISVA 4PZDA 5IUNC 3AM5A 3D6AA 4HNAB 4BFUA 2JH9A 3SIWA 2L42A 1VHQA 1W48A 3R3JA 3WLQA 3OFJA 2I34A 3DZJA 5KOYA 3VNVA 1MTOA 3WA7A 4RD4A 4IIGA 3KNZA 4MXDA 3BCRA 4ETWA 3KALA 1CU1A 3UOGA 1U7DA 1M2KA 1YUMA 4QYWA 2QTGA 4TLLB 3DKRA 4EY4A 4RD2A 1VKOA 4EB0A 2HBRA 4ENUA 4DB4A 3P9YA 1C1YA 3N7AA 2FR8A 2ZWOA 4JD5A 4QU0A 5CG1A 5EWLB 1F2VA 4Q9LA 4P4GA 1HT1E 1GUBA 2RK3A 4BO6A 1SY7A 2XECA 2Y0DA 3PNPA 3Q4GA 2ADFA 4O2AB 4EBFA 2FZGA 3CTMA 3HACA 3O4HA 1WCXA 4JLNA 4L1KA 3GT4A 4R1OA 4EYKA 3R9XB 1H3FA 1EE1A 5BN3B 4MQ6A 4RANA 1Z6XA 2BONA 5FBLB 3IC5A 1D9XA 3EA0A 1TM5E 2AIRA 2H17A 1JDZA 4XGNA 1ODKA 2OGTA 3EGCA 2P40A 2PZAA 3D5QA 3LUBA 1WP4A 1ISFA 2WFAA 4OI4A 1MJFA 1U8UA 1ZMBA 5CEEA 5KKAA 4FZRA 3M6WA 4PYRA 1YK1A 4XYEA 2EFGA 1K2VN 1AKUA 1E4YA 3UJCA 4CF6A 4CU2A 4F7WA 2VYND 3T6KA 3IOEA 4J3NA 4MQBA 1Y9ZA 1KDZA 4DJJA 3FSGA 3PXGA 2W6MA 3Q6MA 4JJEA 2DWQA 3UQZA 2IEZA 3CCCA 3HVIA 1Q20A 4J9VA 2RE8A 2XHZA 1SBNE 4F3KA 5J4KA 2O7SA 2GAFA 5LUBA 5TSDA 3S7ZA 4PLVA 3DPSA 1A27A 1K6MA 4W8HA 2F4VB 5JCOC 1RDFA 4JBNA 4NCBA 1UJ2A 4GI5A 1PNOA 3SPXA 3EEYA 1QG0A 4XVQA 1NOIA 4ZQGA 3CA8A 1HEIA 3RREA 4NECA 4KTVE 4XZ3A 5FUWA 4R8LA 2NO4A 3X2SA 1U2TA 3W2HA 3PNQA 2XB9A 4IXDA 3JVUA 3NXKA 1P2GA 2R6ZA 1WZ2A 2L2QA 1G19A 2R47A 4CEIB 3FRHA 1TZ2A 3LCCA 4AKTA 1BA3A 4GECA 1J2YA 1PLJA 4ZTUB 2VK8A 4B4KA 1CIJA 4YJ3B 4CM3A 1MAUA 3D3EA 3NUQA 5LMNB 2Q8QA 2QAJA 3CT4A 2W6PA 3TZCA 1GYQA 1JVNA 1UWKA 3HBMA 4L6AA 2X8JB 3DOEA 1XD2B 3RRMA 3D0OA 3HFSA 4WW0A 4DREA 3EBPA 2WM2A 3ZXSA 4G0WA 5HMLA 3UWSA 1FZTA 3A1FA 4G0OA 4PPNA 1FFGA 5AOBA 5K51A 2RBEA 1WMEA 4J3JA 3WLMA 4FVTA 3ZHRA 1HX7A 4WX2B 4BO4A 1T4BA 4F9EA 4FQ8A 2ZCJA 3GJXC 3I6BA 2W2XA 4RGQA 3DEZA 1ZM3A 3VPCA 2ZAOA 4D0NA 3EARA 4D8VA 4CMHA 2Y27A 3H2SA 2GTHA 3DMTC 4W7HA 1NVXQ 4WXRA 3EDCA 3NGXA 4IIHA 3JCZA 4FD2A 4Q66C 2JHFA 5P21A 4ZJUA 4XM0A 1X80B 2B82A 5EWMB 3Q3JB 1MW9X 1GA1A 4RHXA 4NKRA 3P0FA 3QTLA 4RVOA 1DLJA 2QZZA 1M8FA 3GJ4A 2ZJ6A 4H1UA 1V7ZA 4I7EA 2C94A 3A7EA 4G81A 2I8LA 4RJKA 3L07A 4TQ9A 1CVRA 4RA9A 3CZMA 2R6R1 2EX4A 5FFNA 4Z7OB 1F2UA 3MIIA 2IS2A 2E5FA 4V0ME 3KQUA 1XP8A 2KS6A 2BHTA 4JLAA 1LLUA 3AESB 1DJOA 4POAA 4F85A 3V4PB 3LA8A 4JJ8A 1EE2A 4HFJA 3SYKA 2DCUA 1M7GA 4UEOA 1XD9A 3NETA 1YHNA 1XPUA 5GPBA 2QRVB 1RIFA 4AJ9A 4ZEXA 1PNQA 4LZZA 3DM9B 2CB0A 3SJAA 3I8SA 3I61A 3QLUC 3BREA 3DBHB 2QXYA 5LLDA 3K0CC 3DNMA 5JY6A 5G02A 5JXIA 1RXUA 4LDAA 1WVIA 4IAOA 4NBUA 3CJQA 1PFGA 2GFQA 2RH9B 4DN6A 1GPDG 1GNLA 2DYKA 2ICAA 1CYDA 3KO8A 4AECA 1NVKA 2GS9A 1U7UA 4MOWA 3AM3A 4V1CA 1YGPA 4RA9B 3OZVA 3MTEA 5KU1A 3LXMA 1V8BA 2PUDA 4U02A 3C3BA 4YCMA 1SXJD 3OEYA 4XIJA 5CIYA 1U9IC 5IX8A 1D4OA 2BI7A 4JGGA 4O5OA 2EW1A 3MPOA 1K4YA 1A5TA 1EQUA 4NH4A 5JJCA 2E4WA 1AV7A 4KB5A 2JIPA 3SNKA 3WKDA 4O29A 3RI3A 1X1SA 1S89A 1ZN2A 2J5BA 2PS9A 3LX8A 2G76A 2B98A 3C5HA 1XA3A 2HWYA 2RGNA 3FCYA 4RLSA 4RSMA 3ZGLA 1SOAA 4UTXA 4BWFB 3QKRB 4D5EA 1UMBA 3JD1A 3EZ6A 3FAZA 3R5HA 5AWFC 5IYZF 5KSOA 5FWNA 4XIFA 1OFGA 3ABZA 4YQFA 5CFZA 3RKUA 2NQ2C 4O1MA 5DLPA 1XKXA 3RARA 2ZXFA 5T4EA 1Q2XA 3SY8A 3ZCTA 1SC3A 3BH6A 1GILA 2G9QA 1KYYA 4LKRA 2ZI5A 3KYDB 3G8AA 4LBWA 3F49S 1BX1A 3QFFA 4LI0A 4F8YA 4UQLA 1R4NB 3BHNA 1FLVA 1VBFA 5G2OA 2OD2A 3FVTA 4FWTA 1W94A 3KP1A 3RBZA 2XB4A 3I72A 2ORED 3U26A 5B58C 3RIXA 2Y1WA 4JP5A 4TKUA 4MWZA 3BZUA 4D8XA 3GDHA 3VR4A 5M04A 4OH1A 4ZDJA 1R10A 2RH4A 3GPLA 4A0QA 3U7HB 1KI8A 3CR8A 5C18A 5JXWA 3MW8A 2UYCA 5DWDA 1NSTA 1KSFX 2R1VB 4XUCA 5DMHA 1WCWA 3DR3A 3CRW1 2B6NA 3Q2KA 5IWCA 2FSVC 2VSFA 3FPBA 4MDHA 4BLOA 4DIKA 2CHVA 2FYTA 3NHKA 4IINA 1HE4A 2R2AA 2J07A 3CZ4A 3I6MA 1Z0SA 3I37X 2VTEA 3IUBA 1I4WA 5FOVA 1MO4A 4PG8A 4O3MA 1Z28A 3AKYA 5T8KC 3GARA 4RSHA 4TV8A 4BGIA 4IJQA 2VQ6A 4O63O 3EXIA 4MUYA 2FPMA 4MYSA 1OA1A 1FMCA 1TT7A 4JASB 4UATA 1O77A 5HCNA 1WWKA 5F1KA 3QHAA 4TKZA 1Y6JA 4LJ8A 1IUKA 4KNWA 1VFNA 1T5IA 3JY6A 4EB6B 4QBTA 1YB7A 4F7DA 3T06B 4TZKA 3VO9A 1JR6A 1RCTE 1TMGE 3DVAA 2VTDA 1ICIA 1UKEA 3B1KA 4AN1A 3AHCA 1Z56C 1Y6FA 1GZ6A 2M6RA 4FEEA 4G3XA 4TKUB 7GPBA 3GLGE 2QJOA 3ISTA 4F3NA 5AJZA 4XFKA 2OBFA 4KQCA 2XWJI 4Q4AB 1PUXA 3I9JA 2GWHA 1SBQA 4KPEC 2Z6VA 3C6XA 3OD1A 3CX8A 1P75A 4KQIA 1NMQA 1ZHHA 2B8TA 3TW6A 1K92A 2XE7A 5FA5A 3HCFA 1G98A 1LWNA 2N75A 3KVNA 3L6BA 2I2FA 3NTUA 3FHCB 4OOEA 1O9BA 3AHJA 4A26A 1EFDN 2IUFA 2PT7A 1TM2A 3FB1A 4JSYA 5EHNA 4EHLA 3USCS 3KQYA 3Q3GE 5FWDA 2NUPA 1EFUA 4JQYA 4DJ5X 1AB5A 2ACEA 5LB4A 1NURA 1GDDA 1UJ5A 4RTJA 1VECA 3LU1A 4O4IB 3AW8A 3EG9B 4JB2A 3ONWA 2OZKA 1IBRA 3U9TA 4E7PA 5JT1A 1RAGA 1T6YA 2QTCA 5AK6A 3LPAA 4IMPA 2IHUA 1TA4A 2ZTLA 3QVLA 1E79D 2ZYVX 3PHGA 4MPJA 5DHRA 1UKYA 3CLTC 1NQOA 1SVIA 1Z2OX 3QFHA 3PD7A 4H1WA 4TZ6A 4OEHA 13PKA 4CKXA 2ECPA 3MJTA 5B5SA 3NAQA 3OZFA 1EKXA 4PR0A 1EXVA 1DTWB 2PUEA 1VJ5A 5CH3A 1H2XA 3HNOA 3BIXA 1ZL2A 2HMTA 4KPGA 1R8SA 3RKSA 4BXOB 4JELA 1A9OA 2WNSA 4KX3A 5TIIA 4YAJA 2CFCA 4YWJA 4RFSB 4HH4A 1TTQB 5AVTA 1B7GO 4JXJA 4Q1CA 4TMYA 3WKBA 5EHXA 4MMYB 4JC4A 1ZRMA 5AI8A 1BO6A 1SC1A 4BX3A 1M2OA 1E2EA 3LDHA 1S2DA 3HUUA 3JQ6A 5K0CA 4P6VF 2Q2WA 3GEHA 3SJCA 1FLDA 1NYTA 2Q41A 1X6VA 3LSYA 1LY1A 1M9NA 5TMDA 1X3SA 1U7WA 4PV7A 1WXIA 4LE0A 5JBNA 2R1VA 3AIMA 4RMHA 3WIEA 4ENTA 4ZVSA 5HHTA 2ZUFA 1ES9A 2WZCA 1FW6A 2BFDB 2J5RA 5ALKA 1WXFA 3DZKA 4XTRA 3RJ5A 5TT0A 3ZY4A 3ACDA 5TMPA 3MHPA 4BC1A 3RJMA 1F0YA 2OMEA 1U9CA 4ZJPA 4E5PA 1C9MA 1W34A 5KNBD 5B2FA 1PKXA 3KOZA 4WOBA 1CXZA 5AUPB 2JFOA 3UXEA 1IU9A 3QW2A 3B1ZA 1MEJA 4WGGA 3PNYA 2PFGA 4PONA 3BICA 3PC3A 3DBRB 1SG9A 1SZPA 2KPOA 1T36B 2VUTA 3BRWD 3DDNA 3PGXA 4HX9A 4BCCA 3DT6A 1B6TA 1ZU5A 1ZD5A 4XQ0A 4HQOA 4DLPA 4D9CA 3FTFA 1N2CB 2F3PA 1YDMA 2Q5CA 1NVMB 1GADO 1J97A 2PLFA 4GDMA 4U9UA 5I4KA 4PYMA 4AICA 2VPIA 2PKRA 3PFKA 2X8WA 2XDWA 4IX1A 4WLVA 4DJTA 1H2ZA 3IEIA 3E9EA 1E1RA 2B83A 3AJAA 3AUFA 3FDJA 3TQTA 1V5EA 5FO0A 3N8GA 3ZDDA 1SC4A 2IDJA 3KG2A 2F8MA 2IRWA 3T41A 4QOSA 3LPMA 1Z4NA 4F4CA 5ENVA 4CMBA 2QKYA 4H17A 3GUYA 4B34A 1U1CA 1ZIYA 4LMPA 3MRXA 1RZRD 1VE5A 4ESEA 4Q0MA 4X8MA 4EA9A 3ITEA 4AP9A 4W4TA 1J21A 4ZHQB 3E2IA 4G5OA 4HPJB 4NFYA 1TTTA 1CUDA 1BXKA 5EXPA 4CDNA 4KQHA 3SZUA 2VNJA 5JD5A 1W96A 1W2WB 1XF9A 2OG2A 1ZSVA 1D4FA 1ONBA 4JBWA 4ZOAA 3TLGA 2J0SA 3NYWA 3C8UA 4N48A 4X8HA 4E22A 2DECA 1VCHA 2PZJA 2N47A 2QW1A 2QN1A 3O0DA 4M53A 1MAWA 2G1JA 2FMKA 3CZPA 3OKAA 4YRDA 4PZ9A 3TW4A 3SR3A 3B51X 3M4ZA 2GLUA 4D44A 6AT1A 1P9WA 3WSVA 5J47A 4PYNA 4UMEA 2P9JA 1BEEA 1W76A 521PA 4I5FA 2RHJA 3PDHA 4BE4A 4L5BA 4JWKA 4HEJA 2O20A 2O14A 3NXSA 4KFUA 4RK5A 2GBCA 4OTZA 4FYMA 4PYIA 4XUGB 5IRCD 4IG4A 2BGNA 4R1NA 3IJEB 3ZW7A 4MWOA 2NUAA 2GJ9A 2O1XA 3UGQA 1YFKA 1OOEA 1E3LA 5CFLA 1KO5A 1A72A 4DKJA 4HYTA 1GP2A 2HSWA 2P5YA 5A5GA 4Y1EA 4MEJA 4KQ1A 3IIEA 1H2YA 5B64A 2RHOA 4ZZ2A 3B8EA 3GOQA 4PNPA 4QYSA 3F6CA 2FEWB 2D2EA 2OHVA 1VPDA 5AJHA 4WESB 4RVNA 5KTTA 4LYDA 4JLUA 2H2GA 4DJEC 3DC7A 1L5ZA 3CW2A 2YDXA 4NICA 1CSEE 2GAAA 3MAJA 4S24A 5CVDA 4JYZA 4KWCA 4WPGA 2P2LA 3FUCA 5EPOA 5IUKC 3GLGB 2FQQA 5ESWA 4B3HA 4PFSA 1RQ7A 2JKVA 4RESA 2R8YA 2P2CA 4WUTA 1R3DA 4BGUA 1VLZA 4ZAXA 4DXHA 2HJSA 5AVRA 3LHDA 4D0RA 2DZDA 4YQZA 1T2NA 5KYKA 3AI2A 4PYOA 4X44A 3IXLA 5EQFA 4Q7KA 4NDNE 1YOBA 1HYQA 2CLMB 5DGTA 4X1IB 1IRIA 1Y5NA 3GF4A 2FWNA 5G0UA 1KA9H 2H2IA 2I4NA 3A32A 2IWRA 3S6JA 3UJ9A 1UAAA 1AO0A 2ZJ2A 2YL2A 3NC1C 4KUHA 1KTVA 5I9MA 3HCRA 2WIAA 4WOJA 4H16A 1W1IA 3UK7A 1KJ9A 4GM4A 3WLIA 4BZQA 4EKEA 3UFXA 5CM9C 1KNXA 4OK3A 3UG7A 1PWXA 3K5IA 3CCFA 4G23A 4I0WB 1Z5OA 1GGKA 2BE9A 1S02A 3FTEA 3EY4A 2WFZA 5FORA 3UJ6A 4ZIRB 3L7DA 2KI5A 4LXXA 1Z3CA 5FWYA 1JDNA 3OOHA 2OGSA 2H57A 2GLXA 1K7YA 2B34A 1Y7LA 4LA4A 5EMLA 3S7TA 1E59A 1ZXXA 2JAHA 3BIWA 4HXFB 5TDHA 1U8XX 3DVRX 4AKEA 2V1UA 3W79A 3W5DA 1IBCA 1IONA 2OT3B 5GONF 4NJMB 4D3SA 1Q3HA 4H3HB 4LJ9A 3U7RA 2Q4EA 4NYJQ 2VA9A 1BQ4A 2OCGA 3NBQA 3HU2A 1J5XA 3H1FA 3I5XA 1IB6A 1BCRB 1NX6A 1OR8A 4ZAFA 1BEZA 3TE7A 4R71A 3DMHA 4M0DA 3F7TA 3RJZA 4DQUA 1A1SA 5T7BA 4YO7A 1SM4A 2W2LD 1HNXB 3WL5A 3QTBA 2ZKIA 5CIQA 5TEWA 4BU0A 1K89A 4J4HA 4O2BB 4XASA 4H31A 2EJTA 4UDXX 4Y2UA 1U8ZA 2ZR0A 2GTIA 4DQDA 3FBWA 1PRYA 2H4XA 3SJ7A 2Q3DA 2ZIUB 3PRKE 4BKOA 3G1WA 4L78A 5JZ9A 2H5IA 3IEXA 1PP4A 3O5AA 3UJDA 4OAOA 1N77A 1IY2A 3LLVA 4QJIA 5I8PA 2UUBB 2FPSA 3O8QA 1FDWA 6LDHA 1FFYA 2I67A 1XU4A 4K03A 5F1YA 1M34B 2HYDA 4GLFA 4FBLA 3SAJA 2WU0A 4CTOA 1SXJE 3HGMA 1OASA 4JC0A 5BUCA 3RO7A 1G59A 7REQB 4FFPA 4LC1A 3WGMA 1A9XA 2DFVA 2W6CX 1GL9B 1M2VB 3UJ8A 1OLSA 5DN9A 1QX4A 1KRWA 2WKPA 8AT1A 1KI6A 3B3AA 4M46A 3CVVA 3RAEC 3COWA 2BJWA 3TKYA 2TMDA 3BXZA 1PUIA 1OXKB 2CSXA 3DLTA 5J5AA 1TUBA 1CUCA 3H1BA 2BGJA 1N8KA 1IZ7A 3CGWA 2Q5JA 1O3YA 3CE9A 3L7AA 3BFJA 1KR2A 4ZOBA 2WWVD 1U0RA 4IQGA 2O52A 5DCWA 4C4YA 4EKYA 4CKZA 3N8NA 3CXUA 3TMYA 4IGFA 3AR6A 3CIOA 3RCBA 1ZAYA 4BQRA 3H5NA 2O7RA 3VBCA 5LMUB 4Y1FA 3RFVA 4B75A 2Z4TA 1YZGA 4DFDA 3UA3A 1G1AA 2UZ1A 3FCSB 3LWDA 3Q87B 3TUZC 1LNSA 4Z9FA 4Z4GA 1PFUA 1IXSB 2I71A 4Y9UA 4BMPB 1TNDA 5JS2A 3R2JA 2HUPA 2NIPA 3RHFA 1Z35A 1SK9A 4MCJA 1Z9BA 5HIAA 2AOTA 5KX5F 1UH5A 5EEGA 4Y0VA 5SY9A 4WEOA 1RM0A 2F3QA 2WB4A 3EGXA 1BOOA 3B1JA 4M8KA 4BVJA 5EZSA 3SWWA 3AV3A 1VBNA 2NXWA 1WA5A 4DMRA 4D45A 1Z0ZA 3H7IA 4BNWA 1FCJA 4CLRA 3I01M 3KC2A 3NBKA 1V3VA 3ZCVA 3DMNA 4L02A 1QF9A 2J32A 1EESA 1FDTA 2IH5A 1ZOLA 3VO8A 4FMPA 1KK1A 3TQSA 3LQ1A 3ZTWA 1S2LA 2IXFA 3WLRA 3A9UA 5A02A 3MGBA 1LBEA 2C3UA 5FTNA 3RIYA 5KSYA 3GNLA 4G5XA 5EMMA 1D6NA 2W0SA 3DBIA 1BRTA 3M6IA 3P45A 1Y3IA 2Z1NA 3OE5A 2BGUA 1DADA 5F21A 1FFXB 2XD4A 1O8BA 2COEA 2V7PA 4H6WA 1RVV1 2JGIA 1NNI1 4E70A 5BN4B 5IJ0B 3QVUA 2NUTB 4YYZA 5B7PA 3VU1A 1FSSA 3LW8A 1QLWA 1RXEA 2EKZA 3Q9SA 4QFMA 3NLLA 2ZTSA 4F97A 4XDGA 2K2WA 1LPAB 1WDKA 3AIKA 3GJYA 3P27A 2OD7A 4JB8A 5JSYA 5T4BA 3W05A 4Q4JB 4C89A 1POXA 2WWFA 1YZLA 4NE9A 3ZNPA 4IGAA 1F12A 1TU4A 4XWYA 4LHWA 5EWJA 4CCAA 2ZSHA 4AY3A 4FE3A 5F4BA 1DWOA 4JQOA 3IHTA 2EFYA 1TIBA 1Z68A 2ZQ5A 1RYBA 3DYVA 4N4AA 4QT0A 3PVSA 1UP6A 2BM1A 2UYOA 5L3SB 4EUFA 3G1UA 3HDTA 3IE0A 2AQKA 1XRRA 2NU8B 4G0PA 4J07A 2UXBB 1T15A 2PMKA 2XT0A 3OQNA 5C4GB 2CUNA 1EXWA 2C2OA 2C00A 4OLFA 2OBBA 4L72A 1Z4PX 3AP2A 3GEMA 1W2GA 3ZZTA 1I2DA 2CT8A 5CB8A 5K1ZA 1UKBA 4ARIA 1KAEA 3OU2A 1PSDA 1NGSA 3LH5A 2YASA 2FWRA 4A8HA 2P9HA 3K94A 4F3TA 2DHRA 3I6ZA 1GLNA 1AXRA 2OCKA 5K3SA 4HDSB 4CR6A 2HJVA 4GP9A 4R8MA 1UC9A 3CLVA 4C22A 3ED1A 3V7UA 4JI3B 4MA4A 4ECEA 1M54A 3QXCA 2G06A 1DBRA 4NAUA 5B57C 5AOVA 3URKA 1GR0A 2KMLA 2BGIA 5AI9A 2CYAA 3BSFA 4DE5A 4URXR 1D8AA 4HGRA 2J4CA 5J23A 3R76A 3EVDA 3WLAA 5A2QA 1EXNA 4I6EA 4WZBA 2ZT6A 4EKIA 2QT0A 3HWSA 1CLEA 1RLOA 2HHHB 4Q4LA 4XX0A 4OMFG 4ZQIA 3NEPX 2IHZA 2V5AA 1Q1QA 1WF6A 1Z0UA 2WJYA 4FOOA 1ZMOA 3OTOB 1U94A 2FG7C 2FVXA 2PRZA 2C5BA 4Y6SA 1DJMA 4CLOB 1AQJA 2VH1A 2F4NA 2NZ8A 4DNQA 4JLMA 5C1BA 1N3BA 4WJLA 1C2YA 3WIUA 2JBWA 3K9CA 1QGOA 3K5HA 4K6KA 4AXBA 1PFKA 3V1LA 4BBAA 3ZGNA 4HN2A 3AW9A 2IEBA 3ZGZA 4LZOA 2FZVA 4LJLA 3N7TA 3LBNA 1PFVA 1NV8A 1FYDA 2OILA 3BN3A 1QP7A 3K20A 1BTOA 3PPVA 1ZUNA 3EWAA 5E3HA 3K8ZA 4F2DA 3GDFA 1YMQA 3TQFA 5BV0A 3ZGYA 5JJBA 4PSCA 2DFPA 4I5IA 4P5EA 3RVBA 4CV1A 4GEKA 4KQMA 4JJGA 2E49A 1DARA 4JC5A 1GCIA 2PWYA 4P7GA 2YMMA 2D7JA 4CT5A 4J03A 1P7VA 4BO8A 2PFSA 4Z3DA 4UZFA 5EHGA 3VR6H 4EI9A 1QS0A 4AUKA 3DMRA 2JHPA 1R0ZA 1QIHA 5EYPA 1MO3A 2W2PA 1FFAA 3ZY2A 4J8PA 1NP6A 1GRCA 3NH6A 2D1SA 2EW8A 3A1TA 4GX5A 2OBYA 4X63A 5CLQA 5BUQA 4PXYA 5FLEX 3TI9A 1C4OA 1MABA 1YJBA 1GCOA 2PUVA 3V32A 3UMYA 3CKKA 1S1MA 3RIGA 1OHHD 3LK7A 3BH0A 2QN3A 2A67A 1ULUA 1O95C 1T9DA 1W8IA 2WMYA 3AETA 4IJ5A 8OHMA 2AVNA 2LD4A 3F3YA 5DW0A 5AM3A 2OZVA 3PXUA 5C52B 2YWRA 1XLVA 3K09A 5ALVA 2W71A 3PQ6A 4R7ZA 1QXSA 3RYIA 1Z13A 1OX4A 1UQTA 2J48A 6PFKA 2YXLA 3KHKA 3ORSA 4BVEA 1U4NA 1TL7C 1ZA1A 1U2QA 2OHIA 2TMGA 1M2NA 2FUG1 2ID8A 4H27A 4RQBA 3BE8A 3ESRA 1HRDA 4NFLA 5EESA 3VVCA 1ZWLA 2I0FA 2QLBA 4HNVA 4N3AA 3QPVA 2YHUA 1NJSA 5ARDA 4KDEA 4C29A 2GZAA 4CZ2A 2EOAA 2WP8J 3R5FA 5G53C 3AVUA 2ZWPA 1UEIA 4RNCA 1ZRNA 4RK7A 1HDXA 4MP6A 1T8YA 1TYCA 1Q57A 1XQWA 5BVGA 3IEMA 3OT1B 5CP8A 4AL4A 4CLHA 1Q21A 3S1LA 4EY8A 1E9CA 1X9IA 4GOND 5EE3A 3BTSA 3BILA 1LPSA 3SLGA 2DBRA 2XNDD 3IA7A 4YRMA 1X7GA 4H35A 3Q8LA 3TYXA 3VJMA 3IIIA 4M7WA 2WKWA 2YHSA 3OCWA 3UB4A 1NXPA 2BTOA 3QUSA 1K6IA 1M1NA 1U1DA 2JARA 4TT8A 3R7FA 4EJSC 3IULA 2VF2A 2OCXA 4UJ3A 5K6TA 2X3YA 3K1ZA 3GLUA 1YI1A 3IP3A 4Q5IA 2P3QA 1H4VB 3GNQA 3RUCA 1JLLA 1V7QA 4S2UA 4F5ZA 1TZBA 3WHLA 3DT9A 1V8DA 2XOEA 3GG2A 1A4XA 3L6RA 4KE8A 1H66A 3KKLA 4HQKA 5FWXA 3V80A 1BQEA 3Q6IA 3ASUA 1Z29A 2QF7A 3EVAA 3UMCA 1Q7RA 1TK2A 2AFHE 4YUXA 2H63A 3HTXA 4DEYA 2OGZA 1J8FA 2V9CA 5D1HA 4RTMA 4L8LA 2N1BA 1I2ZA 1QUEA 1F1BA 3K0AA 4XD7D 3W0LB 1I7QB 4AJJA 1QGYA 2DERA 3P52A 4CLDA 3GMDA 1QZXA 2VCEA 1XMXA 2FCAA 4EA8A 4X65B 5KVSA 1R37A 1NW8A 3B1YA 5KIAA 1WXWA 3VJLA 1XJ5A 421PA 2V54A 4WEQA 1C41A 4G25A 3F3SA 3OCYA 1IHOA 1U2EA 2QY9A 3T7EA 3SK0A 3G2MA 1Z08A 4J43A 5CNKA 1DTEA 1UPFA 2YHAA 1LC0A 1IBLB 5ESRA 1YZHA 5DT9A 1F51E 2DQ4A 2IDKA 2XVZA 4FSDA 3G2JA 3BXPA 4BLVA 1M8GA 1JB9A 1NFRA 1TLTA 3DTYA 2YHIB 1YNSA 2NSYA 4X3OA 2FDXA 3JRXA 2AC2A 2ET6A 2WU3A 3JWHA 1U2DA 1QTRA 4WOKA 1FEZA 2QZSA 3ZVMA 4QECA 2LKCA 4LHVA 4Y2HA 4M4SA 5DXJA 1UFVA 2JCGA 3CFYA 3OOSA 4R84A 1CDDA 2QVYX 1U7XA 4K9SA 4UBLA 2F6RA 2WUGA 1SKQA 1P74A 5KWJA 3IKMB 2YH2A 1LH0A 3VGPA 1M2EA 3QWIA 3WMGA 2GXAA 1RZVA 4H18A 3A6ZA 3DYIA 3WKCA 4DLSA 3A36A 1G9XA 2O8VA 4GUAA 4H7KA 4IJVA 4FM9A 1AZWA 3EG9A 1GOTA 1ZM7A 3EVNA 3VU0A 5I7HA 1BS1A 1O08A 3IP1A 2J7PA 3HL4A 2X40A 3PICA 1JXQA 2IX9A 2CNBA 3FNBA 4MLPA 4CYMA 2P4UA 4EA7A 5CB4B 5E4JA 3RV4A 2VNAA 5FHQA 3M33A 4LNHA 1C4XA 4JVNA 1M72A 1PHPA 1XZNA 3HBLA 3L0SA 1IDN1 3LQ4A 3AY6A 1GT91 4W1SA 3VSEA 3P2EA 1K8YB 1YQUA 2XIJA 1BX0A 3L7OA 3N6RA 3SJBA 3T1TA 4DNOA 1LQ2A 4HQRA 4HY3A 4EI7A 1E9SA 2XUKA 1Q7GA 3H87A 5KX5B 3QUQA 4B3MB 4LRYA 3BIFA 2B21A 1A9QA 2D1FA 5DRYA 3VXKA 4ZTBA 4F2GA 4QGSA 1CZUA 4Y2GA 1ACMA 3PJEA 4Q3LA 1V3TA 1WS6A 3ROPA 2Q3JA 4N01A 1RHUA 1KXJA 4LMBA 1U8YA 4W9MC 5IDWA 4NL4H 3AVVA 3EZGA 5HQ3B 3OY7A 1PGJA 5CA0A 1GQOA 4BO0A 2QPTA 2RH5A 4UJ5A 4CTMA 1NU6A 1YJAA 3PPIA 1IVSA 3TLBA 4XPIA 4LGMA 2CKDA 2GI4A 1D2HA 3VPBA 5A4KA 5FAKA 2YNMD 4P83A 2ZM6B 1YFLA 4N12A 3UWPA 3VZSA 3STWA 1QVRA 4NF2A 5HOEA 3G6WA 2RKOA 4RV5A 2CE7A 4UTPA 3G89A 1S01A 1MOSA 5GIOE 3GGGA 1KY4A 5E6UA 3G5TA 3NUZA 4EAQA 5KVAA 1JG6A 2GNPA 1BFKA 1BX3A 4OP3A 2PXXA 1EX6A 3QOYA 1GRQA 1QS0B 4OAQA 5IBRA 1L5YA 2QNBA 3JWPA 3FOEC 1CP2A 4ZYVA 3VC7A 1IBSA 3I0ZA 2ERXA 3JU3A 1LLQA 4ZPJA 3VA7A 1KMQA 1AQLA 4OFWA 1KRHA 1MG5A 2CBXA 3JVDA 2DXIA 1DEOA 1VIMA 2G72A 1RI4A 1SURA 2ZRKA 1T4CB 4TQUS 4OSPA 5CGQB 3C7DB 3ICOA 3ZU2A 4ABTA 1XXHA 3CBGA 2XWSA 1LQUA 2H9YA 2I99A 2WWHA 1VJDA 3U6BA 3T4PA 4RSGA 3IBCA 1YR7A 1JDJA 2LV8A 3HU3A 2NXCA 4J29A 3PGMA 1RP1A 5E3IA 4BWYA 2JGRA 4NV0A 1CQJA 2BH2A 1JHYA 2RHCA 3ENQA 1UKVY 1B16A 5ADVA 2WQZA 1XYYA 1F14A 1S7CA 1CY1A 3H65A 3PGLA 3DH0A 4JC8A 4MJ3A 2AF4C 1TM3E 3CSDA 3FZNA 3UK0A 3WL4A 2DR2A 3E15A 1U0FA 4KKXB 1G9TA 2JGLA 2FUNB 2O19A 3OY2A 4MLCA 4GKAA 4CI9A 2G09A 2IYXA 3PR1A 3LQQA 1T9CA 2VK1A 2HPVA 4DM7A 5CFNA 4AQ7A 2YN4A 2YINC 1CUWA 2B35A 1JIXA 3I92A 3HCAA 2JB9A 1IPFA 3MUOA 1VRVA 4F12A 2REQA 4G0QA 1USKA 1OXSC 2NU7A 3IAUA 4OAPA 3NYRA 1PE0A 4IILA 4EHFA 4JQZA 4W5NA 2ZYDA 2X1VA 1E63A 3U7JA 3PF9A 4UNSA 5HF5A 2JBAB 5KTPA 2C98A 1Q7CA 1R6VA 3DAHA 3L0ZA 2Z2JA 1DC4A 3EWSA 1AQIA 1JHRA 4HH1A 3UTDA 4M1ZA 4FJ1A 4WFJA 4R7TA 1JL3A 5KNCD 3R9XA 1GFWA 4N7MA 4IVQA 1WU7A 3G0DA 4CNBA 1U98A 3MJSA 4YJDA 4KREA 2HCTA 1JIVA 3KVOA 1KORA 4KNVA 4P5DA 2GESA 3UN1A 4CF3A 3N2NA 1YJ5A 1NP7A 5DHSA 4RVFA 2V9PA 2VP5A 2RGRA 4QQRA 1L4EA 4O59O 3KQKA 2XMZA 2Q07A 3L43A 1QX3A 3VNAA 1AS3A 5F9FA 2P41A 3ICVA 4MX8A 1UBHS 3GD5A 1SCBA 5EZQA 4PZYA 1VL6A 2PR7A 4MO9A 3ZDRA 4CIVA 1T26A 1A0OA 3ENVA 4E2WA 2GF9A 2A9VA 3QPUA 2DUUA 1UBJS 1K27A 2AHOA 3IAAA 1FJHA 2JZCA 4IS3A 2W6JA 3CO0S 2HOQA 3TX6A 3BK2A 1TA0A 4MMZB 2QROA 4GBJA 4PX2A 1O6CA 4TXMA 3X1WA 3QKUA 1JPNA 4PN3A 1GGEA 1WXEA 1Z2NX 2EW2A 3LT2A 3RBXA 1FMFA 2G4CA 1FP1D 1CT9A 1GKKA 2C4UA 2HDHA 4M88A 3RC2A 2BSQA 1OBFO 4GDFA 2AYXA 4LFBB 2TYSB 4FXOA 5JLAA 3UB3A 3FGPA 3K9LA 1TT5B 3LC2O 3LMKA 5H3HA 1XG5A 3G9XA 2CDCA 1IIBA 1I1OA 4NG5A 1MJGM 4JWTA 2VDRB 4BGEA 2Y6VA 1ZM2A 4QPZA 1P91A 3VAYA 4F91B 5CNJA 5CLGA 5I01A 1LLFA 4IW3B 3JVIA 2SKDA 1AMUA 5IDXA 4U0KA 4G65A 2VTBB 3D7KA 2FR0A 4AKIA 3LLSA 3GA7A 5L7YA 2Z2XA 4TLAA 1EYZA 5IDVA 1OZHA 1OWPA 3DT8A 3Q11A 4PWYA 3BE5A 4XCVA 2RMKA 3UUWA 1ITZA 3E0QA 3H2YA 1Y7IA 1VJCA 2RDMA 3ZQ6A 4NLLA 3LY9A 4N47A 2HU8A 2Z8YM 4CJXA 1X1QA 2QN7A 5H9WA 1JJIA 2FLVA 5CH8A 1D2GA 2F55A 4GLOA 5BWLA 3JWGA 2RB5A 2C7RA 2QXTA 4ODIA 3LO5A 3JPWA 1OAOC 1UT6A 3EQ8A 4Q6WA 4HRAA 1RXSA 1PDWA 2AN5A 2C20A 3KFLA 3W06A 1U0BB 3D7MA 5FI3A 1PD1A 3A10A 3V1KA 2VJMB 621PA 5KNCH 3C8ZA 1X19A 3OU6A 1XE3A 4S2EA 5FOUA 4W9NC 5EXTA 2B78A 2OFFA 2BHLA 3U3KA 1XHFA 1EVLA 4AWBA 2O8FB 4MQMA 1OIWA 5BSTA 3TD2A 3Q5DA 5L3VA 2NP6A 3RVOA 1K5HA 4JT2A 3ER6A 2O1SA 4KYUA 4RF3A 5FOTA 2VF8A 2I2XB 4HWRA 4IIFA 5E1BA 1DIOB 1N3YA 2QLFA 3RSOA 1NDHA 3ZHOA 4MW5A 4B76A 1FDRA 3BMNB 5BV1A 5HSGA 2O2CA 2Y2UA 5A9RA 3A58B 2V3CC 2OV3A 4MVJF 4N1AA 4P4SA 3WGIA 5IT9A 1DBPA 1YXMA 3FTNA 3OHPA 4PHHA 3KWLA 2VS1A 4YQEA 3P4YA 5EHQA 3SQDA 3EXAA 1HE8B 1HQKA 2FTKE 3F71A 5EMKA 3OUUA 2G1UA 5A06A 4J2TA 1W581 2OO5C 4QO8A 1C30B 5EFOA 2HU7A 3KXDA 1DELA 2DX7A 3D8UA 3G2LA 2J3EA 3R3VA 1Z0JA 2FSVA 4ANFA 3FNEA 1N5RA 1V5IA 4YFYA 2GRAA 1QQ5A 3JQGA 4DA4A 1QKJA 5CIWA 2FJUA 4KUGA 2Q1TA 3UMFA 2NYUA 2VPXA 4YMTA 2TS1A 1IZZA 4Q37A 3EVFA 4LDJA 3RH0A 2XKBA 3U39A 3UT6A 4ZU6X 4I1UA 2V3WA 1D2RA 1VMAA 1GSHA 1MV5A 3FSRA 1D6JA 3QQ5A 2NUAB 4E32A 3CR7A 4TL9A 2Y1DA 2X6TA 2AFIB 2DQKA 5JXJA 1SUFA 3JASB 2CXUA 5DJ5A 1TJNA 2PX3A 1CF9A 3QPBA 5IKOA 3I5YA 4NMMA 5CBPB 5A5VA 1NVVQ 4NQZA 4YXWA 1Y9EA 1GKUB 4YJKA 5FH9A 2ZT7A 4Y2XA 1MQ8B 3EHDA 4IEIA 2B92A 3ND5A 4FDLA 1CQPA 4K28A 5CA1B 5HNKA 2ZSJA 1CY7A 2JJ8A 3PI6A 1PG0A 4HQNA 3I1YA 1ECFA 5K4HA 5F2EA 2W2TA 3A3KA 3BZBA 4ZAZA 3M5WA 3W3ZB 1VKZA 3F98A 2N42A 3BGOS 1MT3A 1T5HX 2QUAA 4NR0A 2E82A 1G3IA 4RX1A 4I55B 5TV2A 4KR9A 3RPEA 3S8YA 2I91A 1T8TA 3B38A 4X00A 5CVCA 4H0NA 3WGYA 4B8ZA 1C1DA 5IEJA 2QU8A 5FNVF 1IMJA 5H82A 2BWJA 4KMOA 3SS9X 3VU3A 2DWPA 3AFMA 4XFDA 5GGYA 4DQVA 5J2TA 4DILA 1KH2A 2D2FA 3GXOA 1GPLA 4GPZA 4RPHA 5DWQA 5A4FS 2GJ4A 4B7XA 2GB4A 1JW9B 1Y98A 2Y2VA 3F67A 3FKSA 1CR4A 3OF5A 3IESA 2WSLA 3Q9NA 3Q7PA 1PT8A 4CV0A 1DC5A 1ZIDA 3CF4A 1WO8A 3ECSA 4MNTA 1JAIA 2NU7B 3FCXA 4OXRA 3DOFA 5K3FB 1DQYA 4HFNA 1HL3A 1JEAA 3K0FB 4GM1A 4I46A 2Z8XA 4MV7A 1U4SA 5FBHA 4BXOA 3P9PA 4PLWA 1TB4A 5A04A 4ENWA 3DGFC 3Q85A 1G21B 3JYLA 4UM5A 2HXSA 4YREA 3NMUF 1OE0A 1ST2A 1EVKA 3U09A 1AURA 2J6BA 2PIAA 3PXBA 1D2EA 1ZI8A 3CGGA 2WC1A 1VBMA 2G70A 4CLOA 3JZMA 3WIDA 4Z86A 4ZI7B 2ZQYA 3H97A 4HQFA 2C1ZA 1UXKA 1WY7A 2C2KA 2IYVA 3DV0B 4H7EA 4MQEB 5GINE 4RMNA 5KUTA 1L3BA 1UADA 1Z4IA 3QITA 4INPA 5CLFA 1M2VA 1OKKD 3PEUA 4IKPA 3TKAA 1B73A 4FGZA 4CM6A 1EJ0A 4D3DA 2PJRA 2LXNA 2GJSA 5FI5A 2PV7A 3AGPA 4J0CA 2EQ5A 4Y7DA 3BT7A 1F0PA 1PYGA 5SV2A 4U5XA 3SN6A 2C2WA 4ZO7A 4JT9A 1C8LA 2C2ZA 1E79A 1N2SA 2AKYA 3TDNA 2Y1LA 3NALA 5JG7A 5DZSA 4PHGA 5E6SA 5IVIA 1QPZA 2R8ZA 4UASA 5B4VA 1ISSA 2VDLB 5EJ4A 4PLFA 3TSWA 1JGTA 3UMRA 4FLMA 3C3EA 3OWHA 4U7HA 3KWFA 3MK31 5JD4A 1X92A 2QVLA 2M98A 4GBED 2C3PA 3JD3A 4MIKA 5EJ7A 3IQHX 4FDVA 3FDZB 5JQGB 3IBFA 4C2BA 4IDCA 3LC0A 5H80A 3CN9A 3HVJA 1B26A 1FSPA 1NI5A 5IPFA 4GWLA 1BGVA 1U2GA 2JAOA 3V2UA 3ON5A 4JBXA 2OCIA 3FAKA 4W7SA 4KAJA 5BSWA 2NM0A 4QEKA 3MOGA 2V7EA 4E12A 4MHSA 1CUJA 2IKQA 2WQ7A 1M67A 1RJ9B 3TSYA 3MIZA 1XAHA 1RBMA 4TMTA 3GFQA 3IP9A 4WNYA 3JQBC 3AM1A 2OUIA 2ZUBA 3DZCA 2ONCA 3FY4A 2JRLA 2XNHA 1Q74A 1VG1A 3QIVA 1HT3A 5H5JA 3ZK7A 3BL5A 1YBVA 1LU9A 4L75A 4DLAA 2CW5A 3W2TA 4BMOB 2CL5A 3B5IA 3UH1A 4AM8A 2XCQA 3M3PA 3UG6A 1EPUA 1MN6A 2B25A 3REFA 1II8A 2I6FA 2DE0X 2ZJBA 1WAMA 3ZI7A 2AE2A 2GM5A 3NTQA 1KMIY 4NPAA 3WWZA 3ZE9A 2ODNA 4CIXA 5CYPA 2I22A 3CWZA 2D5BA 4EX6A 2KW5A 4N7JA 4ZYUA 1C9EA 3HS3A 3OPQA 1PZNA 1F8FA 2JAPA 3DHNA 3QWHA 4QRHA 7MHTA 4IV8A 3OQMA 4OL9A 4TS4A 2X5OA 4B85A 2GM3A 2C2HA 5K20A 3QU2A 1WBBA 3ANSA 3OJWA 3TVDA 4LF4B 4NEQA 2FG6C 5E8RA 4QIHA 2ZUEA 1JBQA 3DE4X 2JHCA 4ZVOA 4AWXA 4CWAA 2IV3A 1P2TA 1T3LA 4YMUA 5FPHA 4HRYA 1OI4A 5ED0A 1NN5A 2CK3A 5EJGA 4KMSA 3ZHXA 5C35A 1KOJA 7ABPA 5F98A 2XW6A 3AF3A 4M1OA 4DW8A 2D4HA 4L8WB 3VZBA 2HY7A 3EXG2 5FA8A 3KV3O 4OH7A 1B15A 2DHCA 2G0NA 2P9GA 3USES 3LE8A 3UWKA 5HM8A 3FPKA 4ZOQI 4X3CA 1J00A 1XZMA 5AIBA 4MVWA 1KXZA 2H65A 1OTYA 4WNCA 1KVUA 4UE3S 4YRTA 4AYXA 1ECJA 2FHSA 5I51A 1YK0A 4E2YA 2P4EA 5ADUS 1N2OA 2BFEA 3CNBA 2VO1A 4C30A 1YRWA 1O0SA 4DCUA 2LDXA 2QN9A 3DOHA 2VBCA 3GZNB 4HRXA 4S1NA 3GCZA 3TIIA 3GLIE 5K2OA 1I4EB 1BN7A 2R6AA 1WHTA 3K16A 4I3HA 4RYDA 5K6RA 4EF5A 4R2XA 3L4BA 2WD8A 3OAAD 1AE1A 4M7PA 4BC0A 4E15A 3L9XA 2Y4NA 3N3BC 1ZDMA 4FYIA 1QKIA 2BLLA 4GXTA 2FZ5A 4CKWB 3BXGA 2IJGX 1P2BA 3OJFA 3RS4A 3T5BA 2B9EA 3MPUA 2XH8A 5JY1A 1EGQA 1B1CA 5FL3A 4I50A 1T0HB 1Y7HA 2EQBA 1ODTC 3BIJA 3T7RA 3V48A 3PFFA 5U1PA 3F0TA 3BCHA 2RG7A 4NMLA 1N33B 2VT6A 2Q4OA 4V2UA 4FYHA 3BA6A 2VNHA 1VJTA 3H5AA 2BBSA 5J59A 4W6QA 4OQMA 4W1RA 4P7KA 4U0JA 4Z7JA 2W2QA 5LDHA 1REQA 5HK8A 3HGTA 3OWXA 4OIMA 5LXTF 4RTKA 4UU1A 1G8HA 2Z98A 3GROA 4UCQA 5DBOA 3TQCA 3NAGA 2Y1OA 2WVGA 3TPCA 3UATA 4XYBA 1FYWA 2AR7A 4M6WB 3TRFA 4KRFA 3ZK8A 4GOXA 4OHCA 3FSEA 4IDOA 4LXHA 1KZGB 2WIGA 2W70A 2DEUA 1NJGA 1RWMA 2D3TA 4X93A 2OAEA 1XMVA 3GHYA 1F8XA 2XPCA 3AWIA 1MJNA 1D8TA 1PT9A 2YIDA 3IEUA 3L7CA 2QMHA 4KN8A 1ZUD1 5EYPB 3AJEA 1Y6ZA 2P8JA 3Q7RA 4UE6A 5ALUA 1ZOSA 3NORA 3G5LA 2HNBA 1R0KA 5AK4A 3OM8A 4V0SA 3ZN2A 3RAFC 1P1IA 3DFUA 5GOTA 3OP1A 3ETJA 3EX7C 1GL6A 1QV6A 1KP2A 1QH9A 3OIDA 4LOKA 3HM2A 4PFKA 3R23A 5EZ5A 5BSUA 1VC2A 2P4HX 4Y18A 3VYSB 5LZ5A 4B7AA 4ZCLA 1IATA 1ARZA 2JAXA 2NU6B 3CG0A 4AJPA 4ND7A 4W7IA 2XBUA 3STYA 4S1PA 4I1VA 1V16A 3NIGB 3U0BA 3PRJA 5HKLA 1PWZA 1I6KA 1RWWA 3LPCA 5KWSA 1IXYA 4NK5A 3ZD6A 3AEUA 4E08A 1JECA 4DT1B 4MO2A 5HQTA 2LRHA 1KZHA 1V5WA 4OXKA 3W6PA 4B3SB 1TPZA 3CH7A 4Q7EA 2XZLA 4P4UA 5F5XA 3R6GA 1FYFA 3DBHA 1H2FA 1FP2A 5AW9A 3LKBA 1PJAA 3S55A 1R9GA 2JEZA 4EFNA 3HJCA 4M0UA 2OBLA 3GAAA 4UMFA 4BJ5A 5LC1A 3KIPA 4GHWA 1OX4B 4NS1A 1N6LA 2HGZA 2WRZA 2XKJE 3OE1A 4CR7A 1W2HA 2AYYA 4GR4A 2FPUA 3CLTD 1SEVA 1VMKA 4FPXA 2MR6A 4JDPA 1XN4A 1R18A 3N0VA 1G20E 3WMFA 4OMCA 2FF5A 1DEAA 1TEHA 4CTJA 1IK4A 3EGVA 3L1HA 4FDMA 2RAPA 4LRXA 4MV1A 1KC3A 3HKDB 3TTVA 2MYUA 4TYNA 1EHIA 1LBHA 5AJUA 3JVVA 4EP1A 5K8VA 4LHXA 4DDVA 3L6CA 3RRXA 3GRAA 2Q1UA 4Q19A 3SM3A 1L9XA 3SX4A 1S0UA 1FU8A 4RGYA 1QIGA 5DXAA 3FMGA 2H7CA 3EJWA 3MQ2A 4RL4A 4TMVA 4E33A 3IL2A 4MQFB 5GAJA 4OHXA 2QTMA 2XYGA 5LA6B 3STVA 3WIVA 4C78A 4KRXA 4IJ6A 4LY3A 8LDHA 5GV7A 2UXCB 3NKLA 4B73A 1P2UA 4RTQA 3PEYA 2OWDA 2BBWA 2V3VA 2IS6A 2CV1A 1ISPA 3GEDA 1J9EA 3JQ9A 1QF6A 1VJ0A 3I1IA 3RC7A 1I3NA 3QG1A 5SYNA 3EEIA 1RI5A 2O2XA 2QPAA 4DARA 3KD2A 3ZWPA 3KLNA 1I94B 1IYZA 3TEFA 4PAQA 3OZCA 4MEBA 1QHIA 3ETDA 3DKIA 4PYKA 1CQJB 4X94A 4FNAA 5EMJA 2GCPA 1JQAA 4RE6A 3QUAA 1EX1A 1WRBA 2R7LA 3FD8A 3ZWCA 4G67A 5AVUA 3VH2A 3ROXA 4FB4A 3B3QA 2ZAYA 1X74A 4L2IA 4K9NA 4NRDA 4D4IA 3QVKA 1C9JA 1YIOA 4KWHA 4MW7A 4NI5A 3FNHA 2CMDA 1NUHA 3H6GA 2FMUA 1CC1S 5SYMA 4B4OA 2WP0A 2YWJA 1ADFA 4IQ0A 3ZDXB 4C0QC 1W36C 1R0SA 3N3AC 2P68A 1V5FA 3IPCA 5BVHB 1YI0A 5E1MA 4CM5A 1XD8A 5IABA 1QTIA 1B14A 2PH1A 1R4NA 1H22A 5FUYA 1UDXA 5CM2Z 1RJDA 2JZOA 1R5JA 2PLAA 5IVDA 1MC5A 1SQGA 3HY6A 3OCJA 4NTZA 1EFHA 1R9NA 1YZQA 3JVEA 3GP5A 4XWAA 1YRQA 5EIOA 3RYHA 3LP8A 1DCMA 2X58A 5KI6A 1XVAA 2OV6A 3GPDG 2ANCA 2XOKD 4EECA 1KYVA 2Z4SA 1I2CA 4WZBE 1N92A 3C8DA 2WUFA 1IOZA 5AKGA 2RJNA 3S44A 1GWNA 1WVGA 4Z53A 4Q3BA 4HOYA 3L1UA 4ECAA 1EK6A 2Y1FA 1Q0SA 1YI8A 1T91A 2AX3A 2ROQA 4JYBA 1LA2A 3MERA 2CDBA 3IBSA 4XCXA 4Y8VA 1FSZA 1ADJA 2H7YA 4QHSA 5FHRA 4Z8XA 3BBPA 5B2EA 4MS3B 1MBZA 4OD0A 5IJAA 4BYMA 1XZFA 4LC9A 1AU9A 4ZMSA 2QY6A 3BD7A 4KQKA 5J5CA 2B6HA 2FN7A 2OYCA 3H84A 5B3KA 1NYLA 2R2GA 2FPKA 1L4KA 5G3YA 4DUZB 2FP4B 2IZ6A 4L4RA 1OT3A 5EZ6B 2BEKA 2XNSA 3QNWA 1Z4OA 4JUAA 3W5CA 4EB8A 4DEXA 5LYJA 1DWUA 2HMUA 3TNDA 3NWOA 1XBTA 3Q7QA 1SHUX 1MOPA 1LDBA 2Y9MB 3WHPA 4HAOA 5AM5A 2Q50A 2XTJA 5BOSA 5GJCA 2O7NA 4EGCB 1EVIA 4GICA 1E0KA 1V37A 2H1FA 4AFNA 3AHEA 3KEMA 1XLUA 3BXXA 2WHYA 1IQUA 4Y2YA 4YAIA 1V9SA 3U44A 1YVPA 3GYGA 2WUEA 3EE6A 3K0FA 4UEWA 3PQ8A 3FWKA 3WDMA 2PYDA 3B85A 5JS6A 5A3QA 2GASA 2AUNA 2VH5R 4N5NA 5KO2A 5B3AA 2VHJA 1EBFA 1ZJYA 3OOYA 4LUCA 4N0MA 1GU1A 3VPGA 2EBWA 2HLDA 2PKQP 3AG5A 3V2HA 2HU2A 2BGLA 2WIKA 1NPDA 3VOBA 1PIWA 5A0FA 3FGOA 1NIJA 4Y2QA 1AO3A 4G37A 4ESHA 1GTL1 4ZU1X 1IN1A 3GRCA 3K4QA 1T9GS 4M9RA 4RXTA 3TCXB 2ZB7A 1HTBA 4YAUA 3SIXA 3CNNA 3WNZA 5SYAA 4TXNA 3P4UA 3R5JA 4KXNA 2NWQA 3NU1A 721PA 1NQTA 2PYZA 2Q45A 2ZOSA 3A0RB 3OD5A 4MR8B 2GH1A 4NEGA 5KMGB 5IT4A 5JHGB 2VWPA 3CZAA 1SUWA 3KPJA 4RKWA 4J7UA 2IH4A 1LW6E 1OLSB 5EJ2A 1GGMA 4BRUA 3WQRA 2AN3A 2AEFA 2ZRQA 3SMQA 3T7TA 2W2KB 1Z8HA 3HB5X 1NXSA 3GWGA 3OC6A 5DP1A 1MJHA 2MMGA 2AUTA 5G1PA 4YY3B 1ZO8A 1BGWA 2YZNA 2IHNA 1ZD3A 4Z4CA 5KPDA 3JSAA 3TMAA 5F23A 3UAXA 1XK7A 5TGDA 2FPOA 2XNCA 1JG3A 1JNYA 4JN6B 1HG0A