2P0EA

Human nicotinamide riboside kinase 1 in complex with tiazofurin
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
193
structure length
190
Chain Sequence
VPRGSKTFIIGISGVTNSGKTTLAKNLQKHLPNCSVISQDDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAISCWMESARHSVVSTDQEEIPILIIEGFLLFNYKPLDTIWNRSYFLTIPYEECKRRRSTRVYQPPDSPGYFDGHVWPMYLKYRQEMQDITWEVVYLDGTKSEEDLFLQVYEDLIQEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Nicotinamide riboside kinase 1
publication title Nicotinamide Riboside Kinase Structures Reveal New Pathways to NAD(+).
pubmed doi rcsb
source organism Homo sapiens
total genus 56
structure length 190
sequence length 193
ec nomenclature ec 2.7.1.173: Nicotinate riboside kinase.
pdb deposition date 2007-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13238 AAA_18 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2p0eA00
1NIPA 3MMPA 4IDHA 4V03A 4DDVA 3FVQA 1E69A 5KNBA 4QM7A 4C0SA 1KO8A 2QNRA 2F3TA 1N6OA 5JEEA 3W6OA 3W8NA 3LV8A 1P9RA 1US8B 2GILA 4JBYA 2WKRA 3NXSA 2EFDB 2V4ZA 4DCNA 1NY5A 1AS2A 5TB5A 3I5YA 4KXFB 4DIDA 5KPJA 3KKNA 4KCGA 4FW9A 4LPKA 1NMXA 2H18A 4JVLA 3CIOA 2QZ4A 1F48A 3K0EA 1PV4A 4H9GA 2BMEA 4RFVA 4IEIA 2YKGA 1UDWA 3GLHB 1GSIA 2VL7A 1U9IC 4IOKA 4BZPA 4DCSA 3NBFA 3ZZ0A 4UNNA 2R65A 4JKIA 1Z3IX 4PSKA 3B1WA 3CR7A 4RSGA 2RKOA 5AJVB 2C95A 4TWZA 2Q0HA 4TT3D 4DB2A 5JBQA 2EFHB 3AV0B 1E3MA 2CCGA 1EESA 1N0WA 1J8YF 2OESA 4ASUD 3DL0A 2PZGA 4MKHA 5H68A 1DBSA 4LPSA 3RABA 3B1YA 4EQ6A 4WOPA 4B2LA 2WKQA 2NIPA 3WMEA 1H8HD 1GKYA 2YZ2A 4FCWA 1CRQA 2C78A 4PSAA 1G5TA 1B23P 3ONWA 4NE2A 1JR6A 1OFIA 4WAUA 1G3MA 2E87A 3VFDA 2WJJA 4OQXA 4JL6A 5KSPA 1R8SA 4LJ7A 4XOIA 421PA 4CDGA 2ZSDA 1IN7A 2W6JA 3J81k 1KJZA 3SC3A 2KSQA 2R6FA 4Q21A 4L5BA 2A9KA 4JLKA 5JRJA 3MLEA 2WZQA 4JMPA 2C98A 4OHYA 3O8CA 4ITRC 5IHPA 4E09A 4EPTA 1E99A 1J2JA 4UNQA 1XJCA 2C9CA 1FP6A 1ZVQA 2W0SA 4Q9KA 2PT5A 4AYWA 1VECA 4NCKA 4OQFA 1JAHA 1KMQA 4NONA 3K0SA 4RD2A 3QPWA 2ZJBA 3I32A 5CJPA 1DARA 3K9NA 1OXXK 2MMCA 4GBMA 1U98A 4KU4A 1E1QA 3R7WB 5FL7A 4HUTA 1PJRA 1A2KC 4NKRA 2NZ8A 3V4RA 3AKEA 3LXXA 3OAAA 4A15A 3CWZA 4X8OA 4DSOA 3SJZA 4PC3A 2G88A 4QHYA 2QI9C 3MJRA 1ZMXA 1OH6A 3EA5A 1D2NA 1W0JA 1BOFA 1RRFA 1XJ0A 1T0HB 3OZXA 5IT5A 1KI4A 3HWSA 1AZTA 1G20E 5AJZA 4CEJA 3ETLA 2ZXUA 2YINC 4Q66C 4GOXA 1HEIA 1DVRA 4UQOA 5K8TA 4URUR 1KYIA 1QVRA 3THOA 1YZKA 5DYGA 5C4MA 4M1SA 2ZRNA 3IIJA 4HLUA 3CW2A 4MITA 2IYYA 3QKSB 4Q47A 3K09C 4D25A 4E5UA 1WBDA 2ZRFA 3BFVA 3C41J 1XD2A 2ERXA 4DT1B 4N0EA 2B21A 4LZZA 3X1XA 1ZNYA 1CP2A 3LY5A 3SOPA 1M7GA 4CEIB 1KO4A 1OYWA 2XOKD 4BASA 3VKWA 1EFUA 5TY0A 1VG8A 3CNOA 4PHTA 4ZO4A 1Z06A 3WRYC 2P0EA 1XMVA 3L2OB 1Z22A 2X8AA 2ZRJA 1E9AA 3QBVA 4KSBA 5JMTA 3FFAA 2ZUBA 3P27A 1U94A 3D8BA 4O2LA 1B0UA 5EP1A 1XZQA 3KUDA 4GP6A 4B3FX 3QKUA 3SI7A 1CKEA 1XP8A 1GWNA 3OIUA 4AURA 5J4HA 5F9FA 1R5OA 2ODEA 4QGAA 2JJ2A 2DWOA 4GZMA 4DRZA 5F98A 3F0TA 1E2KA 3F3YA 1OB5A 3UG6A 1VMAA 2JATA 1OFUX 1JI0A 4GOKA 4M9SA 4RVCA 5EE0A 1VCMA 1AN0A 2ODWA 1M8PA 3MCAA 5G3YA 1KY3A 2AFIE 3LX5A 4E07A 2VRWA 4G3XA 4US1R 4C0BA 2GXUA 3OEHA 3TW4A 4TYWA 3U7HB 2C9OA 4EPXA 3RC8A 1EX6A 1NVUQ 1T9HA 1UBCA 2EWWA 2IHYA 2PX3A 2BOVA 4HAWA 4MRRA 4EKDA 4F38A 4CEHB 2B92A 1X8JA 3I5XA 1QHXA 3DEFA 5FI0B 2NO1A 1L4UA 3BGWA 3PIRA 4LJ5A 5FPTA 2I3BA 1ZM2A 1SQ5A 4PPGA 4BEJA 2XTNA 3A6PC 1DELA 1TU4A 2GBLC 2TMKA 4Q4JB 2J41A 2FN4A 2RGXA 2QGNA 2F6RA 1A4RA 2LKDA 2OV2A 4QJ3A 4TTQA 4DJTA 4URWR 3BORA 1JEDA 3AQ4A 2ZS7A 1P6XA 1FFHA 3C14C 1G6HA 1VIAA 2A3RA 1I4DD 4P4UA 4IKEA 3PEWA 2G77B 3HU1A 4TZ6A 3X1ZA 3LBHA 3PUWA 1SKYB 3DKPA 1D9XA 2CE7A 2FOLA 2WBLC 4JJZA 4TMXA 4D81A 2A2ZA 3B9PA 2OAP1 4O2RA 3CR8A 4RCYA 4Q9IA 2FV8A 2CE2X 4DZZA 4DEXA 1XEXA 1S3SA 4U7DA 4I1VA 3K1JA 1UM8A 2R6AA 2XZOA 1N5JA 4LHYA 2VHUA 4QGFA 1NN5A 2VYFA 3SJBA 3ZQ6A 1IQPA 4WBSA 3WNDA 3U3KA 3KJIA 5G40A 4Q03A 2QMEA 2WSSD 1C1YA 1J90A 2YWFA 1OIWA 1W46A 2L0XA 4TL7A 5AR1A 2OZEA 4TSFD 1TPZA 2IWHA 2ZR9A 5EZ6B 4LJYA 3MAAC 4OK3A 5EXTA 1HE8B 4ERNA 1X1RA 2ZJ8A 4TN1A 1CBUA 5TVKA 3GLHE 5KDDA 1E32A 4OK5A 3TQCA 1KDTA 2BJWA 1S4QA 5FOVA 2YHSA 1KKLA 1JECA 2WAYA 5FFMA 5FOUA 3T12A 4B74A 3IGFA 1E9DA 1CULC 4TL9A 1T3LA 3CUEF 4Z51A 4B47A 2BMDA 3TUJC 4C4PA 3QI2A 3B85A 4LHXA 2YJTD 3LNCA 4OK6A 4AI6A 1NG9A 1XEFA 1NY6A 2O8EB 3SQWA 1XMJA 4YXWD 5C46F 1U8ZA 3N2EA 2ZRIA 4URYR 5CM8B 4Q7KA 5G41A 4BGDA 4QL3A 4O0MA 3RS2A 2OLJA 1W0KD 2W2XA 2X19A 4LK2A 5FTMA 3ZH9B 2F3RA 1XBTA 2ATVA 3KFVA 1ZC3A 4HAVA 1JALA 4Q1AA 3GLIB 1VCOA 2AR7A 4AG6A 2EFCB 4Q7MB 2GRJA 1NNEA 1Q1EA 5K8UA 2GAOA 4YONB 1VYVA 3VTKA 4PC7A 5E7JA 1GZSA 3L0IB 3E70C 4GOJA 5BN5A 4NL4H 2RHMA 5DHFA 1DG3A 3A4LA 1E79A 1Z0AA 1RJ9A 4AYXA 4DIEA 3AH8A 3Q5DA 2QAGB 4EDHA 3TVDA 3AVYA 1RYFA 3VNVA 4M9QA 3LVRE 5AUOB 3LD9A 4O3MA 1TF7A 3BFKA 1XRJA 5DGXA 1Z47A 2CXXA 4S2EA 1UDXA 1EK0A 2ZYVX 3ASZA 2ZRKA 2ZSBA 2NG1A 2DFLA 4KHZA 4LJAA 3BFXA 2BJVA 5LPNA 1N6KA 3VX3A 5J47A 3NG1A 4P4TA 1VG1A 2Z43A 1XFAA 5J4KA 2Q6TA 5JHHB 4B71A 1PLJA 3GFTA 1CS4C 3BE4A 5DNYB 4A1FA 5FR1A 1W36C 3U61B 3FMOB 1P2SA 121PA 4FIDA 4LBYA 1L7VC 2JJ8A 2JJ1D 2NO7A 2IF2A 3E5HA 1RRCA 5HKKD 3SFVA 3TGPA 3U4QB 4DLZA 1SHZA 2YWEA 3LH5A 5FUWA 4LI0A 1R2QA 2GAAA 1DPFA 2OUKA 2OO7A 2ZI5A 4IOJA 5F9HA 5DSZA 4A0RA 2XEXA 1TU3A 4UNSA 1AM4D 1ZP6A 2NTYC 3CRW1 3QBTA 3CRRA 5GADl 2GNOA 2RGNA 5AJXA 4IW3B 3LRPA 4A8JB 2Z4RA 4QXAA 5DN6D 3HYTA 2ANBA 1SZPA 3TLXA 1DAEA 3OEEA 1YR9A 2ASEA 2ZRBA 4ZIRB 1AGRA 1DEKA 5HCIA 4RZXA 2GEUA 1KAOA 3DHWC 1E2QA 3BD9A 1ZRHA 4NZYA 1VHLA 3U3OA 2QL6A 1AKEA 3EXAA 3IHLA 2EU8A 4RZUA 4EJSB 2ZM5A 2YOFA 1E2IA 4PHFA 3B1ZA 2VHTA 2HXSA 4QGGA 1D5CA 1ZW6A 1Z8FA 1T4GA 2RCNA 5FOSA 4B33A 4QOSA 1ZD8A 3AGQA 3W9YA 4NCJA 2OXCA 5AUQA 2J87A 2B7CA 2F1RA 3EZ9A 1WP9A 2VIIA 2J3EA 4R2HA 3EIQA 4US2R 3N70A 2WWXA 2ZROA 2DB3A 2QMHA 2FSFA 2IF0A 4A36A 1OF1A 1W5SA 2JAQA 5JI3E 1XPUA 3P32A 4I1UA 3U6KA 2J0QA 1RFLA 4KVAA 2QRNA 4TLEA 5EE3A 4D80A 2MSEB 2ZE5A 2X1VA 2ZRDA 4KYIB 3SHWA 1X6VA 1WE2A 5FBWB 1IM2A 4HAZA 1UADA 4TMKA 3REGA 4AIIA 2REOA 1S9HA 4HLUC 2FF7A 1P60A 4LX0A 3L43A 3IKJA 3RLFA 1OFTA 3KFXA 1GTVA 4ZKDA 2A7QA 1OXUA 1SXJB 1R5NA 3GLHA 2OCYC 2QBYA 2ZRGA 3T1OA 3U5ZB 4XIGS 1BKDR 1VPLA 1AQUA 1MO3A 1GKUB 3EW9A 2GJ9A 4NYJR 1N6HA 4M21A 1NN3A 1XTIA 4M53A 3ADKA 2X77A 2O8FB 5K8LA 4ZDWA 1U99A 2BBOA 2HXYA 2WWHA 3GEIA 4BUJA 1GNQA 1YE8A 4XJXA 3H1TA 1GRQA 4HDQB 1BMFD 3EC1A 3W3ZB 4NHOA 4DSTA 1FPMA 4C0AC 2HCBA 4BFTA 2ZJ5A 4N0DA 3KXLA 1JJ7A 2KJQA 4XSHA 4DCVA 1W4AA 2BDTA 2HEIA 1LVGA 1LFDB 2QP3A 4MRNA 1NVXQ 3QPUA 2W6JD 3G82C 2BEJA 1Z07A 5GJWC 1TQDA 3W34A 1WBBA 1C4OA 4G5OA 2H57A 1EG7A 3EX7C 3CO5A 2IXEA 2XNSA 1KDRA 1KIMA 2G83A 1E2DA 2PJRA 2HT6A 1P72A 5JHGB 1LF5A 3MUFA 4DHEA 2ZUCA 1T6NA 4D4LA 1KI3A 2XXAA 1Q3HA 2BV3A 1R0ZA 4JT2A 4O25A 3H86A 4D2IA 4TMVA 2V3CC 2PCLA 4N1AA 4A9AA 4DC9A 4RFSB 1TUEA 1FX0A 1JB1A 2H16A 4DLVA 5CLLA 3BK7A 2D62A 4D82A 1ZUHA 3OFNA 2ORWA 2PCJA 3QUSA 1QG2A 2OT3B 3AF4A 3R8FA 3CB4A 4EPVA 3HJNA 5KHOC 2P6RA 1KK0A 3T5GA 2PL3A 4AYTA 2ZE8A 2NO9A 2ZSEA 1SULA 1FMLA 1DE0A 1W2GA 4YLGA 3EG5A 5EXSA 5JS8A 1GILA 2HJGA 2GTPA 4IXMA 1N6PA 2IT1A 2QSZA 2WICA 3QF4B 2OM2A 3U6BA 2O5VA 1HURA 1MRNA 1F2UB 3K0FB 4U02A 1G8FA 1IY1A 1VYTA 3KDSE 2G3YA 1SVLA 3LWNA 1ONBA 3QKRB 4K8OA 1TTTA 4KV9A 1Z0JA 4QHTA 2XSZD 5L3SA 1G3UA 4XWOA 1NF3A 1OH7A 4NCHA 3WXMA 4C7OA 2GETA 4U00A 3PFIA 3UMSA 5AJWA 5GJVC 1HT2E 2IS4A 4D0LB 2D74A 3PUZA 3THWA 4DCTA 4DDTA 2FH5B 1Q21A 1KI9A 4Z8XA 4LJ8A 4YQFA 2QG6A 4XTCS 2I1QA 1SVMA 5BYKA 3A58B 1QHNA 3SYNA 2VA8A 4UNRA 4MKGA 4LBWA 1KI6A 2Q21A 5TARA 3SU8A 3BB3A 4CVNA 1OH8A 2GJKA 5FBRB 4BFSA 2J0SA 1CJMA 1G3IA 4FMDF 2GCOB 5FOTA 1MT0A 1W1WA 5AUNB 3OHMA 2XNDA 4Q4HB 1JXOA 1GOTA 4OHWA 1NLFA 1OXVA 2DBYA 5CB8A 1SXJD 5GJBA 4XVQA 1GG2A 3M6AA 3Q8XB 3ADDA 3THXA 1G16A 3MSXA 1QHHA 4XD7A 5CDFE 4Q5IA 2EWVA 1U2RA 2BVNA 2WIAA 5G53C 1YJ5A 3T1TA 1IJEA 2N46A 2RGCA 2WTUA 2ERYA 3HPQA 2RGBA 4B3XA 2ONJA 4HB3A 1G7RA 3U44B 1C9KA 1A5TA 3QY0A 4BFWA 3K70C 2OBLA 2VF8A 4XH9B 1BS1A 1RYHA 3A1VA 1RRPA 1XCMA 1NBME 4WZAE 1CEEA 4KFSA 3D3QA 1KI7A 4CT4B 3OE7D 1G5PA 1M7BA 3VU9B 3WHLA 1AIPA 1EFCA 3LBIA 4CIDA 3TW8B 4BE7B 2J46A 1AZSC 5TDHA 3EWAA 3KL4A 4QBFA 3UG7A 3THYB 5HE8A 4FCTA 3I8SA 3F5FA 1WRBA 5CYPA 2FZLA 4ZCLA 3AUXA 4JL5A 1QHYA 1DAFA 2Z6VA 4ZPXA 4KFTA 1AQYA 1KO1A 2B8TA 4ARZB 5D3MA 2CLSA 4CGZA 5BN3A 3O47A 3KKQA 2EW1A 4JBWA 4WZBE 2EFGA 1NN0A 5AJYA 2YOHA 2XAUA 1H8EA 2OCAA 5GJCA 2O0HA 1MV5A 3QXXA 2BBSA 1Z2CA 5FPKA 4KAXA 1AS0A 4Q9HA 2IX3A 2Q3MA 4RD1A 5B2ZA 1CU1A 1NMYA 1RC8A 3OIYA 4R71A 4LBZA 4JBXA 4BLOA 5B57C 3U3MA 2PEZA 4LOAA 1M74A 2QA5A 4V02A 4YMUA 2YC4C 2A78A 1G8PA 4DLXA 3K9GA 5JFGA 4IEEA 4TZ0A 1MH1A 2FEOA 2ZITA 1QHGA 3GQBA 5DHAA 2J7PD 1U90A 2CHGA 4L9SA 2B8WA 3OIVA 4BFYA 4PXAA 2V6JA 5JCZA 1OJLA 1JXMA 4ZCIA 3C15C 2OCBA 4IDPA 5H8WA 2GESA 1Z08A 2DWPA 1IY2A 4HUQB 1J70A 2RGNC 2QT1A 2GF9A 2W58A 4KYUA 4YMSA 2EFEB 2PZFA 1XXHE 2XITA 4FN5A 3BS4A 3TNFA 3U7FB 3CF0A 2IEYA 1KZGB 5EQTA 2QORA 1KSGA 3CX7A 2R2AA 5E3HA 1DAIA 2CK3D 1T5IA 5KSOA 1E1RD 3GLGB 4AG5A 1KY2A 1D8TA 3WY9A 3ZVLA 1G1MA 1IXZA 1JBKA 1JPJA 2ODBA 3CWQA 5EJEA 2GEVA 5B30A 1R8QA 2IUSA 4BFXA 3NVAA 2IYTA 4URXR 4Q1FA 3R9WA 2PLRA 1I4LD 4LV8B 2ZJAA 3B1VA 2BM1A 3GJ6A 4QNMA 5H1YA 1GL7A 4Y0AA 1T3HA 5CB6A 2VF7A 2ZUDA 5DISB 1CJKC 2ECKA 4LHVA 3GJ3A 2IC5A 3AKDA 2OE2A 1UKZA 4JYBA 3VR2A 3CM0A 3SN6A 2O8CA 4HZUB 2F1IA 5BWMA 1TX4B 1P5ZB 1XU4A 2BEKA 4GDFA 4B3BA 3UWKA 1MO4A 3LXRA 4MGYR 5DE3A 1NVWQ 4JKYA 4DDUA 4AKIA 1SVWA 2CL0X 2FJUA 4PQYA 3SYLA 5KDLA 4AKHA 3W8RA 4Q02A 2WPDA 4HATA 4IFBA 4AC9A 2R9VA 2QTHA 4MYUA 1L4YA 1MABB 2CVFA 4HLDA 2JIZA 5C18A 3ZZUA 1DO2A 2UZIR 3FGNA 4ESVA 3RWOA 2ZE7A 3P4XA 4GT1A 4MH0R 1ODFA 1VKJA 1COWD 1KSHA 521PA 2JGNA 3EPJA 1ZM4A 3FKSA 1P4SA 4GP7A 3ZVRA 3IQWA 4NYIR 4V0ME 3R9IA 3IHWA 4Z8YA 2HYDA 3BB4A 1TAGA 1Z83A 2OILA 3S1AA 5HE9A 4C0HA 3LW7A 4LV5B 2H8KA 2J59A 2V7QA 2JDID 3U4QA 1Z28A 4PC1A 2BCJQ 4JVNA 2Q3HA 4ON9A 3JVUA 3LX8A 4PQFA 4TYPA 1N5IA 3BWDD 3Q9LA 5IK2A 1XB2A 2AFHE 4L8GA 3ND9A 1DADA 4V0KA 4JT4A 4RZ2A 2W6IA 5CDFA 1GRRA 3MWLA 2IS1A 2B6HA 1Z0IA 3AVQA 2P67A 1YZQA 1TEVA 3T5DA 1LF0A 4LYFA 2F55A 2XX3A 3HDTA 4R9UC 1V43A 1L2TA 3QXCA 1P2UA 2A5DA 4B43A 2GXSA 1DAKA 1W48A 1BO6A 4NYMR 1IN8A 2LCFA 1TMKA 1VCNA 3LAWA 4JIMA 4ZIRA 4W5WA 4JLBA 1NBMA 2IS2A 5FTLA 2AWNA 2OSBA 1R7RA 2MSDB 3KQHA 4ZI3A 4PAMA 1ZBDA 1ETUA 2AXPA 3CZQA 1ESNA 4LWZA 2IW3A 2NPIA 4YDSA 4B2IA 3FB4A 2BM0A 4M22A 1XDBA 2QPTA 1LTQA 3RAPR 1P7CA 1Q1ZA 5LB4A 2CNWA 1KTVA 5EUMA 2V1XA 1KOFA 3DM5A 4I1OA 3W6NA 2PMKA 1GKIA 2XJ4A 3K0AB 2ONKA 1Q0UA 3Q85A 5JRZA 5JSZB 1E2GA 4Q4AB 3H84A 3VHXA 3SS8A 2VLIA 3P26A 3VR3A 4OQMA 1FL9A 1P9WA 1FTSA 3PEUA 3L0OA 1DTSA 2BBTA 3JZAA 3V9PA 3EIHA 3IIKA 2GXAA 2G1JA 2O8DA 3EZFA 3AKYA 1O3YA 3L82B 1II8B 3QENA 1NSTA 3WP0A 3VHLB 4TTRA 1NJFA 1XTJA 4MQBA 2HLDA 1WQ1R 3ZS9A 4Q00A 3B1XA 2G0TA 4Q18A 4Z1MA 2LWIA 2IYSA 2OFOA 2P5SA 5JCPA 4MGZR 5EXPA 1JR3D 3BH0A 3EA0A 4XWAA 3W5JA 1M7HA 4GFDA 1FP7A 3K9HA 3L0SA 1XZPA 4MRPA 4FI3C 4KLZA 3G5UA 3I3SR 3T15A 4PTLA 2O8FA 5FTJA 1OT3A 4OQLA 2PH1A 3ZZTA 5C4GB 3PENA 1XXHA 1E2HA 4KBFA 1I2MA 4D4KA 4QKQA 4I99A 2R6CA 1GM5A 3N2IA 2ZRMA 3A4NA 1S3GA 1XNJA 2EVWX 5SZIA 4HEJA 1OHHA 2DPXA 3QSYA 3Q72A 1FMJA 1I4TD 3ZVNA 4BLRA 1OLOA 1ZINA 3RSLA 3GJ8A 3ZYCA 1U0LA 2F43A 4NU0A 1TQ6A 5HZHA 5TXGA 2O52A 2A5GA 4OJQA 1G64A 4JSTA 4XTRA 4MGIR 3AGPA 3B13B 2RHDA 2VP5A 4RD0A 4TLAA 5JEDA 1T0JB 2GF0A 3DDCA 3MWJA 2VBCA 1NVVR 1YZLA 1XTKA 2ZSFA 4PZYA 4L15A 3PV0A 2NQ2C 1Q3TA 5L3VA 1S2MA 4AK9A 5B64A 4P0TA 3T35A 3WNBA 2REXB 1D2MA 3MRSA 2ZTSA 5P21A 1G7CA 1OPXA 1P73A 1KGDA 1UKVY 2Z83A 4IDOA 2QAJA 3LLMA 1N5KA 5BYJA 3R9XA 3I73A 3CH4B 4Q1EA 2HF9A 3HU2A 4RJLA 4D4MA 3CX6A 4ZI2A 5ANRB 4A2PA 3TSOA 721PA 3KKPA 2AX4A 3RS7A 1HY3A 3DO6A 1YZUA 2VPPA 3GFOA 1CR1A 2BC9A 4EFNA 1ZM7A 2RH5A 1UKEA 3CF2A 2O8BA 4AWXA 2ZVPX 4DLUA 2G0NA 1IY0A 2FWRA 1Z29A 2RGEA 3AUYA 3I1FA 5FPSA 4M0LA 1ZUIA 2JLUA 2DWQA 1DOAA 2IXFA 1J99A 1V5WA 3K0FA 2QQ0A 2WSMA 3TSWA 3LDAA 3EIEA 1E0JA 2HJVA 5DIFA 4F7WA 3D31A 2JLYA 4TT3A 1VCIA 4PANA 3KTAA 1P9NA 2E1RA 1YZTA 4HB2A 4ASUA 1GL6A 5FUYA 4EQ6B 4M1MA 4C0KA 5KYKA 1LS6A 3W90A 1GRNA 1ZNZA 2OEPA 1H8HA 2AD1A 3O8DA 3ZIAD 3DOFA 3FHTA 3ZVMA 1U0HC 2VP6A 1WDTA 5EE5B 2A5JA 3U3JA 1QG4A 1II9A 3TJZA 1KAGA 1LNZA 1SHKA 1IXRC 3CNLA 1NJGA 2QPOA 1KMHA 3E2IA 1ESMA 1ZCAA 1TQ4A 2GCOA 3QE0A 4LRWA 3CRMA 3TUIC 1EFRD 4N3NA 2IEZA 3Q3JB 4Q4HA 3NEYA 4KJZA 4Q4LA 4Y0VA 5CK5A 4NYJQ 4HAYA 1Y63A 1K8RA 3GJ0A 1N6LA 3K0CC 3HU3A 4F4IA 2X2FA 1OIVA 3P1JA 1JQJC 1TEXA 1G7TA 1RKBA 2IYWA 2BIFA 2ZYTX 3BH6A 4HB4A 3B78A 4K81B 4DUGD 2FGKA 2V1UA 3T1VA 4JLDA 1TF5A 3C7KA 3OF5A 4H1VA 3UATA 4Q9JA 4LJ9A 1OKKD 2C03A 3MWYW 1G41A 2KWIA 1RIFA 1F60A 4IVRA 4M1YA 2Q9CA 1YHNA 3RVBA 3WHKA 3WNCA 4A2QA 2XB2A 3QXJA 3FMFA 4JLAA 3DZDA 3QF7A 3BH7A 1UAAA 3BJIC 1F2TA 5JWOA 4QBIA 1WB9A 2GZAA 1FW6A 1VTKA 3UANA 1BH2A 4F92B 1N2CE 3LBNA 3K9LA 2QM7A 3UPUA 4KFRA 1ZUNB 2ZPTX 3DM9B 4HAXA 5BQ5A 4CW7A 2PX0A 2FMXA 1LS1A 1KNQA 4DVGA 2YNMA 1XEWY 2QM8A 1PLLA 3EPHA 1W49A 3AF1A 3MD0A 2OXRA 4IHQA 2AKYA 4TQ9A 1FUUA 1PLKA 1XD2B 3U7EB 1Z0DA 2FE4A 2WWIA 1KK3A 2ZYUX 1YZNA 2CJWA 1E2PA 2QE7A 4ZDJA 1OE0A 3FYHA 4LHZA 3VX4A 4TL8A 1EWQA 2XOKA 4MDEA 1SKQA 1VG9B 2QROA 4Q1DA 4WZ6A 4A4DA 1P2TA 1S1CA 1JPNA 1HQCA 3QJYA 4G5SA 2NZJA 3CBQA 4LY6A 1US8A 3SQXA 2F7SA 2WV9A 3QVUA 2D3WA 4Q7JB 1U0JA 1SVKA 3WBJA 2GJ8A 3CZPA 1EXMA 3WYGA 1VIYA 2ZRPA 2P3SA 3UK6A 4KI0A 3FMIA 4PO1A 1E2NA 4WA7A 4DSUA 1CJVC 3VQTA 1QDEA 4D0GA 2J5XA 3KXIA 2W2TA 1K6MA 3NH6A 2VHJA 4UNPA 5FTNA 3TK1A 4UXIA 3VKGA 1KDPA 4PZZA 1W36D 1E98A 1LB1B 3AP2A 4W5HA 2MSCB 3E1SA 3IUYA 1SKYE 2AN9A 3CPHA 3PITA 4UKDA 3LVQE 1SGWA 2VSOA 4DLYA 2VSXA 3W3AA 4EIWA 4M9ZA 3EAQA 4EUNA 2MMGA 3CRQA 1KSFX 1OSNA 4EJSC 1GL9B 3I8XA 1E9BA 3VR5A 1AJEA 1F5NA 3PCRB 2J9RA 2OBMA 4FD2A 4FINA 1M2OB 4AY2A 4B48A 1CJTC 4NP6A 1CTQA 2FPKA 2WJGA 4PHGA 5ELXA 3FDIA 1WMSA 4V0OA 3D6TB 4FMCF 1EWRA 1J7KA 4GNKA 3VAAA 1S96A 1S0UA 3AVPA 2RB4A 3Q7QA 4X8LA 1T3SA 4MKIA 4AKGA 3KB2A 3NHAA 4FXPA 3M4YA 4Q19A 4RKEA 3U3RA 2V9PA 3TAHA 4OI2A 2QN6A 4MUAA 4PZLA 1Q1QA 1RE0A 3TBKA 1XEXB 3EASA 4L16A 1D6JA 1LV7A 1MABA 4YC7A 2W00A 3HR7A 4QFMA 1Q22A 5EP3A 5GVRA 1UBFA 1GP2A 5LD2C 4GL2A 3L8ZA 3C16C 4A92A 5JWRA 5FH9A 1NIJA 221PA 1W4CA 4F93B 1Z63A 1CJUC 1E1QD 4X8MA 5FL7D 3OIWA 5JJIA 2HCJB 3TE6A 4PPFA 2C8VA 3IPYA 1KI1A 2FSGA 2WSSA 3R7WA 3OAAD 1E9FA 2CL7X 4TSFA 3A1UA 1YVDA 1OXSC 3QXSA 1DO0A 2GK7A 1W0JD 2Q9BA 5E95A 1E96A 2WJYA 5J5CA 1E0SA 1Q1BA 2YC2C 1RW4A 3B9QA 4F4CA 5IF9A 2X2EA 3GLIE 1KHTA 2ZJOA 1DAHA 4PHHA 3QIAA 4PX9A 1FOEB 1KO5A 5FBQB 4WXRA 3X1DA 5DI3B 4JYCA 2RAPA 1A7JA 2PEYA 3TUZC 2EYQA 4LSGA 1DAMA 2DCUA 1NRJB 4RKFA 3TQFA 5LBIA 3QKSA 1E2EA 5CM9C 2FGJA 2G9NA 4DT1A 4YXWA 3RS0A 4LC1A 5KU1A 5KDOA 4QNRA 2XZLA 2IYUA 3FPAA 2PJZA 4CEIA 3A1SA 3B6EA 4XWKA 1W0KA 2GVZC 2D7CA 4HI0E 3CPEA 4BRUA 3EC2A 2RGDA 2VP0A 1G4AE 4DWJA 5JS7A 2ZR7A 3AVOA 5CLQA 3KX2A 4G1UC 4P3YA 1JJVA 4OL0A 3K70B 5JJLA 2VQSA 1G8YA 1MRSA 4M1KA 4M1OA 2JA1A 3QPVA 4PQRA 2WJHA 2AKAB 2FFHA 3KJGA 2B7BA 5C2JB 4FMDB 2JJ2D 3CONA 1ZIPA 3I92A 1X8LA 3M1IA 4LHWA 4AKEA 2ZS8A 3AVXA 2NO6A 4IXNA 2G6BA 4A6XA 1GNPA 2GJSA 5JSZA 1ZCBA 1P2VA 4M1WA 3NC1C 4QJ4A 3GJ4A 3KQKA 3DZ8A 1Q12A 3KUCA 1HA3A 3SNHA 1GVNB 3IEUA 3OEHD 1IXSB 3C4JA 2E9SA 5FOWA 4CF7A 1XF9A 1YU9A 4F4JA 2C2HA 4G5RA 2GJAA 2ZS9A 2HDNB 1S9DA 3NDBB 4D6PA 2WMNB 1NN1A 1U8AA 3HYRA 4IDNA 1XPOA 4OI4A 1ZJ6A 5KTYA 4PAOA 3REFA 3RS3A 2YVUA 4CEHA 4LYAA 5HTKA 5EZ5A 5G3ZA 3AVTA 3GEHA 4ZCMA 3PUYA 2QTVB 4A6PA 3KJHA 1S1MA 2JJ1A 3X1WA 5D3QA 1L8QA 2D06A 4GZLA 4Q4JA 1Z0FA 4V0LA 1NI3A 1HH4A 1FNMA 5F2EA 5HKKA 2J0UB 2WWWA 1CXZA 2A30A 4HDOB 4ESHA 1IN4A 4CRWB 3ECCA 3TR5A 1JQLB 2EYUA 2ZU6A 2H5EA 4B75A 3PXGA 2XTMA 5DYIA 1OW3B 2ZRLA 4PO8A 5FPHA 4C2UA 1OHHD 4P32A 4YDHB 2O0KA 2ZAMA 2BHRA 1FTNA 5J4YA 2ZE6A 3CKLA 3IILA 4GPTA 2FPLA 1X8KA 5DN6A 1SVSA 1N0VC 3C8UA 4KVGA 5HZKA 2JEOA 2PLFA 4ZDIA 4MYCA 3KQNA 1ZIOA 1TUIA 3C5HA 1E0KA 4D4JA 2OFWA 4OHZA 3JVVA 1ZD1A 4IVQA 5FTKA 3AVVA 4E03A 2IYXA 4BFVA 1XTRA 4CYMA 4BLSA 3PUXA 4DB4A 3NKVA 4X8HA 2HYIC 3GLFB 1E9RA 3W5IA 1FQKA 1SXJE 2AK3A 4G0NA 3ZGXA 1VG0B 1GIAA 4B73A 1TF2A 2DFNA 2D7DA 4OHXA 3FWYA 3AF2A 1W44A 4PC2A 4C0LA 1OB2A 2ZIAA 1N25A 2XTZA 1Z2AA 4MRSA 3SBDA 1A1VA 3ICEA 3GJ5A 5TMPA 3EPKA 2NO0A 4JSYA 4R7ZA 621PA 2O8EA 4NYMQ 1G7SA 1XWIA 1QHSA 3K0CA 4PC6A 2WHXA 1XTQA 1NL3A 2P6UA 4HDCA 5L8VA 3MWKA 1OH5A 2QBYB 1UJ2A 5K8IA 2DHRA 4YMWA 3SEAA 2IBMA 3TAUA 5DH9A 5GVSA 1HYQA 5LDDC 1DS6A 3AB3A 3W6PA 3WP1B 3GLIA 2Q3FA 3N5CA 4LJ6A 2VP9A 4S35A 3K70D 1OFHA 1E9EA 2P6NA 3IBYA 1W47A 3EZ7A 3CPJB 4QG7A 5LB2A 3I72A 1Z6TA 3CX8A 1K5GA 4EPWA 2ANCA 3SJCA 2FG5A 2R8RA 3RNLA 1T91A 1BMFA 1E79D 1CR4A 4BZXA 2QMOA 2HUPA 1W7AA 4IOLA 4JLPA 1EFTA 3IIMA 5EP2A 2QAGA 2ZANA 3GMTA 3RRYA 1G5RA 2RGGA 3SBEA 2CDNA 1W5TA 3QQ5A 3WRXC 1ANKA 5FUXA 3CLVA 5A4JA 1OYYA 4ABYA 2V54A 5BW8A 2BWJA 3DMNA 3IO5A 1E4VA 2KB0A 1CR2A 2DFKB 4URVR 4B3CA 2R44A 2A5FA 1G3RA 4W9MC 4XVRA 4M8NE 1TQ2A 2GDJA 1UBGA 3ZS8A 4WXPA 2DY1A 1E6CA 2XXAB 1H65A 1Z6GA 1WCV1 2VTKA 2ZETA 4LV6A 4PPNA 1UEIA 3LA6A 3BXZA 2K5UA 1YQTA 1FX0B 5JECA 6Q21A 4LDJA 2IYZA 3I62A 3T61A 3L8YA 2WKPA 3PR1A 4HZIA 1ZC4A 1ZNXA 3PG5A 3K53A 1A2BA 4ZDKA 4TLDA 4B2PA 2ZVQX 2ORIA 3FTQA 2D4HA 2FX3A 2QRZA 1JAIA 1RVDA 2IUTA 1EGAA 4I81A 3U7GA 3NDPA 3MG9A 5SZHB 4G01B 3LLUA 1X86B 2F9MA 4ILEA 2VP2A 1AK2A 2OCPA 2GEDA 2P5TB 2PT7A 4A8JA 1YRBA 2FSHA 2LKCA 3O8BA 1MO5A 4XSGA 2GZDA 5CJ2A 3RRMA 3EPLA 3OEED 3QEOA 4UXJA 3IBGA 3SYKA 2FU5C 2IA5A 2YOGA 1MR3F 4HB0A 1NVVQ 4TYQA 4LYJA 2ZYWX 4YMVA 4TTPA 3UMFA 2HT1A 4TYYA 1E2FA 2ZJYA 1U8YA 2ZJZA 3QKTA 4BFUA 4G5QA 1N0UA 2OG2A 3B2EA 5HR5A 1G6OA 1XD9A 3CNNA 1ZYUA 4A0GA 4EJSA 5KSZA 2A5YB 3KB1A 3UIEA 4CT5A 5L3SB 2QE7D 4LJ4A 2FPMA 2XSZA 1S8FA 4C7OB 4A0HA 4WW0A 3SJAA 1E2MA 4QJ5A 5SZJA 3ZLJA 3VKHA 1E9SA 4EPYA 3THWB 1ZAKA 2R6DA 4MGKR 3ADBA 4IVPA 2N1BA 4OHVA 4P4SB 2GWHA 2VEDA 1QRAA 821PA 3UKDA 4RD4A 1XTSA 2C99A 4Q9LA 3UWOA 3EARA 2ZRCA 5IDVA 3TKLA 4NCNA 3V00A 2WWGA 1NP6A 1G8GA 1KI6B 4IRUB 2OFXA 3WBKA 3RANA 5E7IA 3RS5A 2EQBA 1IONA 4D0NA 4POAA 4OI0A 3ZD7A 2CLDX 4TQUS 3GPLA 3KZ1E 2J1LA 1HQYE 2VHCA 4OKSA 3NTUA 4B44A 5JZVA 3RWMB 4OJKA 4BLTA 3ICQB 3AF0A 2BBWA 1SXJA 3BERA 3GP8A 3THXB 1QHHB 3AP1A 2KI5A 4GMXA 2PBRA 4ZV4A 2ZI4A 1QVAA 2JLXA 1XCGB 1XMIA 1P3JA 4LYHA 3DKVA 3EWSA 4BLQA 1N5LA 4XVUA 1II0A 2QT0A 5L3QB 2NOAA 3ZQJA 3PUVA 1XCPA 4RCZA 3DMDA 3OESA 1F3OA 4V0NA 3KQUA 2AL7A 5FPYA 3K8YA 4TL6A 3QEJA 5KO2A 3OE7A 2IK8A 1YR6A 1YR8A 4R98A 4TQAA 1LY1A 5FR2A 4DLWA 5AK0A 1KO7A 1FQJA 2JCSA 3GLFE 1WXQA 5EP4A 4DLSA 3ZD6A 2Q9AA 2FSIA 2W83A 1W4BA 1R0YA 4UJ5A 1FUKA 5D3MB 1VDZA 2IUUA 3VMFA 1M6NA 1ZU5A 1ZD9A 5CK4A 1Q57A 2ZQ5A 4GSYA 1BIFA 1CRPA 1NMZA 4QC2A 4MUBA 3QG1A 4NCIA 3SZRA 2YV5A 4JVMA 5EE9A 2QUZA 2D2FA 4RFSA 5TV2A 1Z6AA 1IJFA 3TVTA 4C2TA 2AXNA 4HYYA 1QZXA 2FFQA 2ZRAA 3FOZA 3OFND 1ZU4A 3GLGE 4DLTA 4EFLA 3QG5A 2GCNA 3UMRA 1KNXA 4A0FA 1DG1G 5JLJA 3EZ2A 2WWFA 2ORVA 5FOXA 4PSVA 1XJQA 3DVLA 1IAQA 1IOZA 3VR1A 2H92A 5HPYB 1Y3AA 1I2DA 4QGHA 1KDOA 4GRAA 2J7PA 4V0MA 4A2WA 5M04A 3VNUA 2O0JA 1E0AA 1JR3E 4JZKA 4HAUA 3BIFA 4B76A 1A82A 4EAQA 3QF4A 1P61B 4DKXA 2Y8EA 5DI3A 3TR0A 4GMDA 4QBHA 4JS0A 4JLOA 1W36B 3GJ7A 3AVWA 4QHSA 1F2UA 1KKMA 1YRAA 1ZM3A 3FHCB 3QKRA 3PEYA 2UVQA 5CYOA 4B35A 2CK3A 2HF8A 1E1RA 3M0EA 1G291 4FCVA 3B7GA 1X3SA 1Q20A 4F91B 2CCJA 5EXXA 4I4LA 3H4MA 4RZ3A 2NPFA 4KSCA 5IRCD 5JWHA 4ZKEA 2FFAA 4OQNA 2CVHA 4FWIB 4QM6A 3TRFA 2FNAA 4C30A 3B5JA 2Z5FA 2CBZA 2CMKA 3QVVA 1T8UA 2WOJA 3WMGA 4C3ZA 4HLQB 1CF4A 4JLJA 1Z6XA 2DR3A 4ACAA 2VO1A 1JEEA 5C1BA 1VHTA 4P31A 4D26A 3QXHA 2O8CB 4B6FA 4M4SA 2ODNA 1G9XA 4JJKA 4NDZA 1GDDA 1IN6A 1R10A 4A82A 2XNDD 4ACBA 3HPRA 2OHFA 1AGPA 3NBZC 1AS3A 3FHOA 3NBYC 4US0R 3B82A 1NG1A 3Q5EA 4BQSA 3A1WA 3P4YA 4R2IA 4W7SA 2IWRA 2UZ3A 4KODA 3GJXC 1F6BA 3IQXA 4OYHA 2ZEJA 1R4AA 2WM9B 4XD7D 2J7KA 1MO6A 5J40A 2ZI7A 2ZR0A 3MFYA 3HR8A 2IYLD 3SHFA 2F9LA 4UJ3A 2J0VA 3FFBA 1R0XA 1IN5A 1COWA 4KLNA 4U5XA 2UKDA 3DPUA 4BZQA 3U44A 1RRGA 3S1AB 4GI7A 2VSFA 3SFZA 1R5BA 3NC0C 2V8OA 3H0KA 5E7MA 4EPRA 1XPRA 1ZM9A 4PAQA 1YKSA 1WA5A 2R62A 3A8TA 4TLBA 2QU8A 4EFMA 2REBA 4Q01A 2FA9A 4CEJB 2JLWA 4MRVA 2P65A 3GD7A 2F1HA 3KKMA 1D2EA 2J0UA 3DOEA 2JDIA 3VU9A 2NMVA 1N6RA 3O8RA 2RMKA 5J4LA 3PVSA 2Z4SA 1E9CA 3BB1A 2QAGC 3AF3A 5CIQA 1MOZA 4TMWA 3THYA 2WJVA 1E2JA 4WIAA 1PZNA 2BKEA 2GXQA 3AEZA 2GK6A 2H17A 5DO9A 2C04A 3RYTC 4PFSA 3U2QA 1OIXA 3SDZA 5SZKB 4NBSA 4ARZA 1U9IA 1NSFA 2WVJA 5HCNA 3LQRA 1GFIA 1H8ED 5BXQC 2RGAA 2GKSA 2WAXA 4PO9A 3CH5A 2QSYA 1PUIA 1AKYA 2DYKA 4RD6A 2QEQA 1IHUA 2WWYA 2CEAA 4NTZA 4PR0A 4LC0A 1QF9A 2JASA 1N3BA 4DLRA 5KNDA 2AHOA 3X2SA 2WJIA 2C77A 1TL7C 2V55B 1BYUA 3F8TA 1OV4A 1LW7A 2I4IA 4LBVA 5L3RA 3LO5A 4MYTA 2G1KA 2QPAA 3GLFA 2QP9X 4IOMA 3T1QA 4QRHA 1X1SA 3LFUA 1KZ7B 5FL3A 5EUQB 2ATXA 5AUPB 5JJKA 3RC3A 4G5GA 3EZ6A 2AD5A 2R6GA 3ZDQA 4MDFA 4HUQA 1Q44A 2FZ4A 3I4LA 4A8JC 4DXAA 3FE2A 1UF9A 1R6BX 1T8TA 3BRWD 1HUQA 4JLNA 4BECA 2O8DB 1JNYA 2IYVA 1CIPA 2XJ9A 2GA8A 4Q1BA 3RS4A 4KITB 1DAGA 5FUVA 3GLGA 2CHQA 4AD8A 1NLZA 4P33A 4UXHA 2JLRA 1HTWA 3R8CA 4DCUA 5J4VA 5LD2B 4KFUA 3AM1A 5E4FA 1P75A 4MA4A 4KBGA 2PMDA 1M34E 4BWYA 5KNCA 3TH5A 3G0HA 4E22A 4MYHA 4FMBB 4YMTA 1CR0A 4C9BA 3WMFA 1JR3A 5A0FA 3KXKA 4FMCB 4M9XA 2XGJA 3NEJA 4OBEA 4C0JA 2ZRHA 2CCKA 3RRNA 4URZR 4B34A 1XXHB 4HZUA 2XB4A 3GFPA 1XEWX 5DLQC 4W5JA 2QENA 3D7MA 2JLVA 4PPQA 2VH5R 2H1LA 5CIWA 1G8HA 2OLKA 3SE0A 4FWTA 2ZJ2A 4HLCA 3A37A 2WPDD 2QMUA 2AK2A 2F43B 2I1VB 3H2YA 4JVSB 1HE1C 2Z0MA 3NIBA 3PJRA 2JIZD 2P2LA 2ZAOA 4WVFA 1YR7A 1OXTA 4NPHA 2KBFA 1P62B 3TIFA 4NH0A 3QOFA 4DDWA 2YWHA 3TSZA 1D9ZA 2CHVA 1U81A 3K09A 1XMSA 4IJMA 4NMMA 4DBLC 4DSNA 3C5CA 2W0MA 1E2LA 2WIBA 1SXJC 2CL6X 3FKSD 2NGRA 3ASYA 4TMTA 2VP4A 2J45A 3CRVA 1AA9A 1UFQA 2AWOA 3KQLA 2BMFA 2KE5A 4M1TA 1PVOA 3A4MA 1HV8A 2W2VA 4LGMA 2IL1A 3LW8A 3NBXX 1G17A 1GUAA 2V7QD 2IYQA 4RY2A 1CLUA 3TMKA 1NKTA 2ZI6A 5FI1B 5FBVB 4IDQA 1XX6A 3MJHA 5IK2D 1VYUA 4JL8A 1BYIA 2W6ID 1W2HA 2XZPA 1N6NA 3FMPB 4QBGB 1M1YE 2OBNA 2WMOB 3BAFA 4L4UA 5JI2E 4KO8A 1TNDA 2N42A 1G19A 3Q7PA 4J0QA 3RDPA 1K5DA 3NWJA 3BOSA 2GCPA 1XD8A 2SHKA 1KJYA 2O8BB 3P20A 4K46A 1J8MF 2ZREA 1FZQA 3T34A 2C96A 1T5LA 1NBMD 2CLCX 2VHQA 2C5LA 2YYZA 2ZI3A 4L9WA 4TMZA 1FNNA 1HT1E 4TYNA 1KI8A 4BLPA 2FFBA 4Q1CA 3IDQA 3B8HA 4II7A 8OHMA 3T06B 2QY9A 2FDCA 4Z54A 1UEJA 5H70A 2CNWD 1UKYA 2GBLA 2QP4A 3KTAB 1IBRA 2GZHA 4I1SA 1N6IA 3IO3A 3WYFA 1PUJA 4IFEA 2FEMA 1E4YA 4BRWA 5A5GA 1RJ9B 3K0AA 5KOYA 3VR6A 3BBPA 5B58C 3ND8A 3GEEA 4Q4AA 4DEYA 5KPDA 2BKUA 3QNUA 4P4SA 5KUTA 3ZIAA 5CITA 1GITA 1WF3A 1MKYA 4B3DA 2BMJA 2IS6A 3A1TA 1R0WA 3KKOA 3NHBA 2IHBA 2OAQ1 2GVDC 3A36A 1UBEA 5EE1A 1SVOA 1KK2A 1YZGA 3RSOA 3SR0A 3WYAA 1KMHB 3ZJYA 1II8A 3PQCA 2F1JA 4TLCA 2HLDD 1ELOA 2WOOA 4RD3A 4B3GA 1RZ3A 1ZNWA 3AKCA 4Z1MD 1EFRA 2BCGY 5UKDA 1QBKC 2HV8A 3UXMA 4H1UA 2V6IA 3ADCA 3R20A 1Z6YA 4LCBA 1G18A 2YWGA 4BEBA 1NLYA 5KSYA 5FBLB 3CF6R 3KJEA 3IEVA 2ZI9A 1QHIA 3IPXA 4B32A 1KJWA 1GNRA 2PZEA 4OI1A 1EFHA 5AWFC 2JLQA 1GAJA 1UPTA 1TADA 2ZU0C 4M2LA 3BC1A 1Z0KA 4DUGA 3GCGA 4Q7LA 2C9YA 4JLVA 5L3QA 3AP3A 4B6EA 3LQQA 1OKKA 2IXGA 1G21E 3FKQA 4HSEA 3MGCA 1G4UR 2QGZA 3V4FA 4MKFA 1KSJA 1F2TB 1O87A 2ZSAA 3U60B 1KI2A 3JZMA 1E94E 2JLZA 3RRZA 2D2EA 1SVIA 3L0PA 4NYIQ 4Q48A 3RHFA 1KK1A 2DFTA 4BFZA 4JLMA 3X1YA 5BN4A 4CZ2A 2JLSA 3NH9A 3HP1A 3I61A 1W4RA 2GHIA 5DI9A 2CJWB 1Z5ZA 3B60A 1NKSA 4BPBA 5F3WB 1RPZA 2H7VA 1EX7A 2IYRA 2QQEA 4C0QC 2QTFA 3AVUA 2KBEA 3VR4A 1G3QA 4LUCA 3PEVA
chains in the Genus database with same CATH superfamily
3MMPA 2QTWB 4IDHA 2OHOA 4TRMA 5CLGA 3AI3A 4EFMA 1OCEA 2AR9A 3FCEA 4AY3A 2VRCD 2EZUA 3FVQA 2HK6A 5EMNA 5A6VA 2F3TA 2WUGA 3W0LB 1TKCA 4YJKA 1U0EA 3W8NA 3LV8A 1P9RA 1QO7A 5JEEA 5JSUA 1FSSA 1ZD2P 2EFDB 2WP8J 3IMEA 3M6XA 3MT8A 4DCNA 1ETHA 5IZCC 1ZHFA 2XQKA 3ILSA 3H19A 4QXPA 5EMLA 2IDMA 3I5YA 4DIDA 5KPJA 2H07A 3T9EA 3W7VA 3KKNA 5LQUA 4FW9A 4HNAB 3TECE 1OXBB 1DX6A 1RXIA 2I2BA 4PRLA 1F48A 1TO1E 3K0EA 2H1IA 1X74A 2DUJA 1K6XA 3IEIA 4H9GA 2BMEA 3JQEA 3GF4A 3K2QA 4MS1B 4RFVA 1SU8A 3GLHB 4FGSA 1JEJA 1GSIA 1NULA 4GYJA 5F5NA 2WE8A 1T8YA 4BZPA 2FVYA 1NAHA 3GVPA 4D7AA 1X7WB 2R65A 3JATB 2VNKA 2PRSA 2QLLA 1Z3IX 2P3OA 4JKIA 2Y1EA 4B3TB 1EDZA 3SZMA 1JHVA 2FEPA 2YFKA 4O2AB 4TWZA 3BWXA 3ENNA 2BH9A 3RJ9A 2PUAA 1PJZA 1E3MA 1QCYA 4BNIA 3PS9A 4ZO6A 1N9KA 2OESA 2PVCA 3DL0A 3GW8A 1IWBB 1I9GA 4D57A 2EIHA 5CA1A 1YVPA 4BGEA 5HQ3B 1MC1A 2F1KA 4J94A 3UFXA 3V8RA 4A5OA 5EPUA 1GZ4A 2RH4A 2XT9A 3UH0A 3WMEA 5C31A 4EHJA 7GPBA 1BN7A 4FCWA 1YQWA 2YZ2A 3TCNA 3WJAA 4EUFA 2HTFA 3NWBA 2OYCA 4HX9A 4B5LA 2C3MA 3HWX1 2UZ4A 3W04A 1O1YA 1G3MA 2E87A 3FHJA 2FOIA 3ANNA 3HDQA 5CP8A 4BFCA 5KSPA 4LJ7A 3RYFB 3UGQA 2G09A 4F7DA 3MM4A 5IH3A 4QVKA 2M6KA 2JAOA 3J81k 1QZZA 3A1CA 4URFA 1M2FA 2A9KA 4FE3A 3MLEA 1X1TA 2GN2A 3S68A 5I7AA 5GWXA 1HDYA 5E0OA 3AKZA 2C98A 5EJFA 2PUEA 4DM7A 2HZ7A 4MMXB 3SHOA 5IHPA 3E7PA 1B6RA 3JQ6A 1Z6PA 4ODIA 5H16A 1QIIA 2H1OA 3IPAA 3MIZA 3D64A 3IOBA 1NXTA 3DPSA 3KRTA 2LE0A 1FP6A 1O9HA 4JT9A 2W0SA 1FYEA 2PT5A 4G0YA 4AYWA 4BFLA 1EUYA 1VECA 4CDMA 2W6CX 2X0FA 1QFYA 1XA0A 1R0LA 1I01A 2H9AA 3CLUC 4BYMA 2HADA 3QPWA 4RD2A 2ZJBA 3R6LA 2QTAA 1QWSA 3IRUA 1G42A 4CQMD 2QB5A 1ZNQO 4MUEA 1E1QA 3GN2A 4KDRA 3FSGA 4WK6A 1PJRA 4ZVKA 2R7KA 5C34B 3TXAA 5KNBH 4S04A 4NKRA 2NZ8A 4A15A 3VOAA 2JFWA 3PDIB 4IJ6A 2G88A 4QHYA 2P4SA 1L5SA 4QYSA 3PKZA 3UH1A 4RVGA 1H0HA 5H02A 2JARA 1AZTA 1DAPA 3HWSA 3PEFA 1PJ2A 4HQ0A 4M87A 1GT91 2C0QA 2J5BA 2YINC 2YWDA 3BXHA 3PRKE 3AT1A 4O6VA 5ALYA 4ZYVA 4YIHA 1DVRA 5K8TA 3EVCA 3P2KA 4LHSA 1QVRA 4EW3A 1PYOA 3UAVA 4CUKA 2GLXA 1PDWA 1Y4UA 1YZKA 4U2DA 5DYGA 1V3UA 2GPTA 1RWOA 3BJMA 4MQUA 4KR9A 1QBGA 3CW2A 3P9YA 3Q8WA 3G6WA 3QLVA 2IYYA 3UHPA 4R4JA 1DDOA 3UOWA 2R4TA 4M55A 5BR8B 2F90A 3R5KA 1MAWA 3C41J 4UW9A 2Y92A 4OMUA 2AOVA 3EQ7A 4P86A 4LZZA 4U7TB 4ZQFA 5T6BA 1M7GA 2FPPA 3G1WA 4M86A 3WE7A 2WTEA 5CFQA 5DHRA 1Y7PA 4MYRA 4B9EA 2NMVA 3A3OA 2EGUA 1YZFA 1Q6ZA 3CNOA 2YASA 2YX1A 2II6A 3WRYC 1XMVA 3KKLA 1Z22A 2X8AA 1XT6A 1BCSB 1P4JA 2ZRJA 1O95D 1N1MA 3BRSA 3FFAA 5F23A 4D97A 4KDFA 4KE7A 1W25A 2ZYRA 3EFOB 4PZUA 4TZTA 3VPXA 2HBZA 1TK9A 2ATIA 2WD8A 3OY2A 1HE3A 3HEAA 4JX8A 5AM5A 5TGTA 1H0RA 5U1PA 3PL1A 3KUDA 3CUKA 5DJ5A 4QXQA 3LUCA 4F12A 3ZBPA 1GG5A 3CUUA 5FAXA 4AURA 2AFVA 5J4HA 5F9FA 1ZG3A 1NDUA 1WUHS 2JJ2A 1QLHA 3FF4A 2JFUA 2JGMA 5FYDA 3HVRA 2DFVA 1E2KA 4R2XA 2P0YA 3INRA 3UG6A 3BDIA 2Q4TA 4M9SA 2R8EA 1JVSA 4CLOA 3FYUB 4RMHA 4RVCA 3RVNA 2Y1GA 1AN0A 3QE9Y 2HPAA 1YJAA 4EMSA 2AFIE 3PHLA 4E07A 4OGFA 3NJRA 5HWSA 1LBIA 3MJFA 3LO8A 4OGKA 4EPXA 1FLVA 1NVUQ 2CYBA 4MRRA 4C7JA 4E31A 1C4XA 1CQJB 1UC8A 2B92A 3C43A 4KDCA 4WNCA 1I7DA 5FI0B 1GCOA 5FPTA 1TXGA 3RD5A 4B6RA 3GDGA 4YRFA 3Q2IA 3UMJA 5JOQA 1J5XA 4FYXA 2RHRA 3GLSA 1TU4A 2VTVA 1ORVA 5E2BA 2J41A 4L4ZA 2AGVA 2G1UA 4G07A 5AVKA 3SBXA 4YRRA 5E6UA 4DJTA 4URWR 3BORA 4U7HA 3PJDA 4UREA 3AZPA 1UMKA 2IVZA 4B40A 1P6XA 3EPRA 1MOSA 1WB6A 2GZ3A 3CRZA 4I8XA 2NYRA 3A9VA 3TQIA 3SHQA 1KHHA 1SHLA 4I19A 4IGEA 1L5NA 2DU8A 3DEHA 2NU6A 3OURA 2AOTA 1GN8A 4OTZA 3DKPA 3VDQA 5GONF 4QT0A 1BCRA 2ENWA 4R9RA 4O2RA 3WGJA 1QFZA 2Z9BA 5JS1A 3HVHA 4BGIA 1XEXA 2Z6AA 4PLVA 1UM8A 2R6AA 5FADA 5D87A 1DXHA 4LHYA 4RXTA 2BFCB 2VHUA 1K97A 3DG9A 2XYGA 1NN5A 3GRCA 3WRWA 3IVMA 2QYTA 3OCZA 1FTGA 2BFWA 2NUTA 1LJUA 2G4LA 2WYHA 3KOXA 1VRVA 4WBSA 4RCVA 5I7OA 3JY6A 4R68A 1DQSA 4A5SA 2AE2A 5K09A 5BSEA 3EVDA 2X23A 4J0IA 1UKCA 2OZEA 4K7JA 1VSBA 2VDJA 4NR0A 1C4WA 3E84A 5LZ7A 4CXMA 2WJAA 5EXTA 4TVBA 1B41A 1HE8B 1X1RA 3O82A 4IZOA 2FPGB 1P1IA 2BDEA 2QVXX 2Z2JA 3MHTA 5KOHB 5KDDA 4MJ7A 1FTWA 1X42A 1Q1GA 1E32A 1UJNA 4IAOA 3IIEA 3ZY6A 1UZAA 2FF5A 4BQPA 2HK9A 5JD4A 4XZ3A 1TZJA 3PQEA 5FOVA 5GINE 2QNIA 1JECA 1LC3A 2WAYA 4BQNA 2BJHA 4B74A 1E9DA 5BNTA 1CULC 3BQNB 3HJHA 2BMDA 3DE3X 3EF1A 1YTLA 3QI2A 4LHXA 4PBTA 4W63A 3MHPA 4A7PA 3QPBA 1ILEA 1CPYA 1A7UA 1T9AA 1XOIA 3UTCA 3ZN2A 5H80A 1NY6A 1XC7A 3SQWA 4H4DA 1XMJA 4TWRA 3WGUA 4C01A 3VZBA 3IVXA 3RRJA 4RZSA 1WDLA 2ZRIA 4URYR 1AQNA 5G41A 4BGDA 3I42A 4YRTA 3DNMA 1OLXB 2X19A 3B1KA 4LI3X 4OHBA 1WLSA 4DJAA 1RKQA 2XUJA 3KFVA 2CDBA 1O7JA 1Z4QA 1JALA 3IH5A 4Q1AA 3ZUGA 2XA9A 5JJ5A 5FFFA 5BP7A 3GLIB 4CCYB 5K3CA 4AG6A 1RBQA 2C00A 5KVCA 1QLWA 1RLMA 2GRJA 2BMVA 3T7JA 1NNEA 4IHAA 3NKLA 1FBTA 4LSZA 2Q3BA 2NNLD 4HN4B 4EF5A 1XLTA 3PJFA 4PX2A 3TX6A 1BAPA 2IOFA 4RIIA 4PC7A 3HXOA 4RQUA 2JKVA 3BMOA 3QWAA 1Z68A 5BWCA 3IP8A 2FUG1 1QPZA 2Q41A 4X20B 4DIEA 4EMBA 1O97C 2G7ZA 2C42A 2JZCA 5JDIC 1A95A 1RYFA 1KMMA 4M9QA 2ILVA 1E92A 2IHJA 1JKJB 4CUZA 1DINA 2D1RA 3OCXA 4HK4A 3ZZ1A 3RKUA 2ZRKA 3HKCA 2DQSA 2GZ2A 5TNXA 2ZSBA 1PKXA 4A26A 3EQ8A 1F9AA 3VX3A 3PHCA 4OFXA 4PCAA 2Z43A 4QELA 3HVKA 3QOYA 5JHHB 3JWPA 4QBTA 2HEGA 2DWUA 3HCFA 1KVUA 1T4CA 2CLLB 3GFTA 1CS4C 4Z9XA 1R16A 5FR1A 4B17A 1W36C 4JI7B 3MK31 3DE0X 1P2SA 2XCQA 2RHJA 2YMLA 3ZJVA 121PA 4FIDA 1VE1A 4HDKA 1L7VC 1BFUA 2NO7A 2UYYA 1I7SB 3BL8A 3OJWA 2SECE 1ND5A 4GZ5A 4JUIA 4M60A 5A71A 3SFVA 4D4GA 4EBFA 3EUAA 4YH1A 1SXGA 1X3LA 2I6UA 1F06A 3G13A 4WBNA 2IH5A 2YHIB 3FX2A 5JY1A 4BQFA 4N6NA 4MLCA 2NO5A 1PGQA 2V7TA 1USKA 1ZGHA 1ZVKA 4R2MA 4F8YA 4Y1FA 5DSZA 5F9HA 2P9CA 3B2QA 2NT3A 4HO1X 3FRJA 5COQA 3SXUB 3TJRA 2WHEA 5IVIA 3TRIA 4UNSA 4ZTUB 1ZP6A 1Q0ZA 1Q7TA 4DHWA 1DJMA 2ZSJA 3SX2A 4O1HA 4ENPA 2PAFA 2RGNA 5TF0A 1FFGA 2E4AA 4OGWA 5AVJA 5AJXA 4R9VA 4XRGA 3ER8A 5JQWA 3N2ZB 4LRYA 1WSDA 3HYTA 1ISMA 1SZPA 2ANBA 1Q2UA 5F51A 5LYJA 3OEEA 1BVHA 4N82A 2ZRBA 4CM8A 3AHCA 3MJTA 1KAOA 2F4NA 2HA0A 1AUVA 1BGVA 1VI6A 4NZYA 2NADA 1MLDA 3IHLA 3DAOA 3PLRA 2CFRA 4RZUA 2JH3A 2OXIA 1CIJA 4WCDA 2HWKA 3KAPA 3B1ZA 3G2MA 2P4QA 5B1DA 4DE5A 3W4KA 3GLVA 1LWOA 5AVUA 1T4GA 3FN4A 2A1IA 4B33A 3RUIA 4BVEA 4W5RA 3MAJA 3AGQA 3IC5A 3OHSX 3W9YA 3WX0A 4RY0A 4AAYA 5BNFA 4C4XA 3PGA1 2OXCA 5HVNA 2J87A 4ZZIA 1SU4A 2YJ3A 3EZ9A 4FSDA 3EIQA 3IULA 5CU7A 5H9VA 1WXGA 1KS2A 4A8HA 1ZGAA 2FPRA 5CR9A 4Z0HO 5FWXB 4A36A 2QN2A 4TSRA 1NOIA 1OF1A 5E6RA 1GDTA 5KB3A 2WSIA 4R0VA 4I1UA 4F9EA 4MVJD 3KZVA 2J0QA 4KVAA 4EJ2A 3G7NA 1MIOB 4OQDA 3Q40A 4XDZA 1H4SA 4L3OA 5AK5A 4XJVA 3EMVA 3OPXA 4AQ7A 1R6XA 1R4MB 1WE2A 2JBWA 2WDZA 4GUAA 4ZU3A 4AIIA 4ATNA 4CJXA 1LW6E 4J9UE 4C03A 1AKVA 1P60A 2FF7A 1L9XA 3QW4B 3IKJA 4TV8B 1QO0D 4BNMA 1OFTA 2BEVB 3KSMA 2YBEA 3LPLA 1FYXA 4PZCA 3IL2A 2PRZA 4IJKA 2A7QA 3F71A 1SXJB 1R5NA 1Z2NX 4CN9A 2OCYC 2QBYA 3MT7A 3T1OA 2P4UA 1LX6A 3DAHA 1DX4A 4OB7A 4XIGS 5G0SA 4KQCA 1VPLA 2P7HA 5BQ3A 2DOKA 3AB8A 1AQUA 1SU7A 1MG0A 1MO3A 1GKUB 3G8DA 4J0FA 4PLGA 3UJHA 2X4LA 4HGRA 1A71A 4JQSA 1G6KA 3RS8A 4N12A 1DTEA 2UVPA 2CLKB 2O8FB 2OC9A 4ZDWA 2BBOA 3JQFC 2R4QA 3O2SB 4EL5A 1VB5A 1N2BA 1GNQA 2DTDA 4KYVA 3DTNA 3BE5A 4Z9AA 5JRDS 2FDRA 1X1AA 3DE5X 5KHAA 2IIPA 3QEAZ 2VOJA 4DV0B 1CD5A 1Y4DE 2D0PB 2DECA 2O59A 2D1TA 1YCFA 1TYEB 3A32A 5HKLA 2G17A 5ALDA 3OQIB 4NV0A 1I32A 1ZCFA 4C06A 2C57A 5CH5A 5A5EA 4NENA 4XSHA 5IM5A 2DBQA 5AW2A 5FLYA 2QP3A 1GA4A 4MRNA 2Y9MB 1BG6A 1HZZC 1K9VF 2W6JD 3DAYA 3UJ6A 1Z07A 4TV9A 4F4DA 1P1BA 4QASA 3SAJA 2F64A 4FKZA 1C0EA 1WB4A 1J00A 2IXEA 3TM5A 1S5PA 1KDRA 3A6ZA 3CISA 1SOVA 2I6SA 3DW1X 1P72A 1N9GB 5JHGB 1WHTA 2IXAA 3D59A 3BDVA 5HDQA 4EGCB 3ASVA 4AP5A 4D4LA 2XXAA 3UJAA 2UUBB 3Q2OA 1C1XA 3H86A 4O25A 1KF0A 3AEXA 1F20A 2JL1A 3GROA 2PCLA 4G0PA 4N1AA 4TMVA 5CH3A 5J5AA 2G4VA 4M7OA 3NP9A 1TUEA 3ONEA 1ULUA 3PDUA 2QW8A 3RYIB 4AS3A 4DLVA 3DBVO 3RFXA 3OE5A 1NKVA 1JQEA 2AZDA 2FMHA 4Z7QB 3OFNA 2YQZA 4A8TA 3L1KA 4BTVA 2ETVA 1A72A 2ORWA 2XRYA 1PIWA 4FZRA 1B26A 3PGLA 2LPMA 2IUEA 2WABA 4LJKA 3UQYS 4JYMA 4DOMA 1UP7A 3HJNA 2VN8A 3A06A 1IY9A 3A9WA 1IPFA 2PL3A 4LNHA 4AYTA 1IEWA 1DBWA 2NO9A 2R1ZA 1DE0A 2PS9A 5DLEA 1W88A 3SS7X 3VGPA 4XYMA 3W77A 5AVWA 5JS8A 2YZGA 3KWLA 3UB2A 1GILA 3V4PB 4MR7A 3L7KA 3UQZA 1VPDA 4ZPJA 3O74A 1XZAA 1N6PA 2WICA 3GDHA 3VSCA 1PUXA 1TCCA 3FCYA 4PNHA 1KKUA 3P0FA 5F7ZA 3ZDRA 1KXZA 4CR7A 4DCPA 4L3VA 3LGAA 3IP1A 5HZMA 2IZ0A 1CEXA 3K0FB 4MX8A 4R05A 2AVNA 3QVGA 1VYTA 1EGQA 2G3YA 2WFLB 4NBKA 5ICCA 3ZDDA 4IEFB 5KYYB 1BS2A 3LHDA 2OWDA 2BFPA 3JRNA 3VBCA 1CFZA 1GLNA 1XYGA 5FO0A 4AQDA 1NF3A 2XA1A 1OH7A 2QQ5A 4NCHA 1KQOA 2XOEA 5DU2A 1UT6A 3TSCA 3I9FA 4JP8A 1JDPA 3JYHA 4OEHA 5GJVC 3F98A 3FAZA 3K05A 3QU5A 1OMOA 3KSDO 3R5TA 3RTCA 4BP9A 3THWA 4C7XA 3K16A 3GFVA 1VLZA 4YRDA 5D51S 1KI9A 4M88A 4F2PA 4N6OA 2QG6A 1LQ2A 3SEFA 3X1JA 4BBJA 1NJ8A 1AF7A 2WZBA 1NI4B 4K9LA 1CHNA 3A58B 3V33A 5BYKA 2ZIVB 4M0UA 1BFDA 3Q41A 2QTNA 1GZHB 3KJZA 4DV2B 1NUTA 1TIPA 4CVNA 1OH8A 2GEFA 1H4TA 3EDMA 1CZKA 3EZXA 4XGQA 5FBRB 4BFSA 1XN4A 3B51X 4AX4A 4DR1B 5CDUA 1JLRA 2IOHA 5FOTA 4HRYA 1MT0A 5AUNB 1O9BA 2HNBA 3OHMA 3FZNA 3I4FA 1NQAO 5ILOA 1JXOA 4E5DA 4IUBS 4OHWA 4ZVOA 2DBYA 3I34X 4Y6RA 3UMYA 3MWGA 4RNDB 4MR8A 1GG2A 4FKBA 4BHTA 5J1TB 1PI3A 3WXBA 4CIVA 5CLHA 1RBMA 4IIHA 3ADDA 5EY5B 4HNHA 4LIPD 1ZVJA 2A33A 3PXXA 1VHDA 4G4GA 1KEWA 2EWVA 3PTZA 3WHPA 2R8YA 5K5EA 4P22A 4MVYA 2WTUA 3IR7A 3ZDCA 1HDGO 4P35A 2PL9A 1P80A 2IXTA 2OZLB 3HPQA 3N74A 4DY4A 1HT3A 2I4TA 4JXZA 2O57A 3GIWA 1CP3A 4K0RA 1GCUA 2I80A 4HB3A 1U2DC 5AQEA 2ONJA 1BDHA 1EXDA 2JKZA 3GWZA 1L5FA 2I2XB 5D85A 2P40A 1Y3DE 2BF7A 2OBLA 2VF8A 3GZ4A 2ZQZA 3KU4A 3QX7A 2MTBA 4FOOA 4XH9B 3A1VA 5JSKA 1XV5A 4CTOA 1ZOPA 4WZAE 3L8MA 4RLFA 4QYWA 4KFSA 4HAIA 1KI7A 1YOVA 2WAOA 3EZNA 4MV1A 4ZAYA 3PVZA 4B8YA 3CKMA 4BL5A 4L5YA 2K2WA 2OHGA 2FR0A 2J46A 3GJZA 3HKBA 1LI4A 3UG7A 1SBZA 5HE8A 5K0TA 4FCTA 1S7CA 2UZ1A 3F5FA 1WRBA 4ZCLA 4YJGB 3SVZA 4H35A 1YB2A 2BFFA 3P2EA 1L6IA 1DAFA 4TS4A 2HO5A 5EFOA 1K2WA 1IEVA 4AZWA 5MGBA 4H4EA 2B8TA 3JYNA 1XGKA 2AJTA 4B8ZA 2H7XA 2G6TA 1IIRA 3O47A 1ENZA 2EW1A 2JFXA 3KKQA 4HTFB 3ZE6A 4EG3A 1DG9A 5ICFA 5JFOA 4GI5A 3ZEIA 2AC4A 1MV5A 1FF9A 5LYJF 2GF2A 1Z2CA 1FFYA 5LLSA 5FPKA 3OE4A 2CD9A 3BN3A 1C9JA 3DNPA 4CMAA 3EXFA 2IX3A 5EIFA 3BA1A 1HDEA 1A8PA 1ZJ5A 4DC1A 5IP5A 5K6TA 4JOBA 5J2UB 2E5WA 1T5SA 5B2ZA 1NMYA 2EOAA 3U3MA 2NQTA 2XUFA 4PZDA 2OY0A 2QA5A 4V02A 5IKPA 3MJEA 3RYCB 3BKWA 4DLXA 2NPOA 1JIJA 3HB5X 2C1ZA 4P34A 2G67A 1U7XA 5ED4A 2W6ZA 4C07A 2JPDA 1D6NA 1QHGA 3GQBA 2C3OA 5DHAA 2CHGA 3D2AA 3DLHA 4D42A 2BE9A 2OL4A 1TW2A 1T9KA 1OJLA 4DV7B 1JXMA 2JFQA 1Q15A 1G8MA 5DWVA 2HCFA 1KORA 1IY2A 3D2CA 2QT1A 2RHOA 1XKQA 1C9EA 1ZK2A 4WNYA 3RV4A 3U7JA 5ESRA 2W58A 4ZOCA 4UU7A 1XXHE 3H1AA 4R1UA 2IEYA 3KM0A 3BRWA 1GZ7A 1KZGB 2LIVA 5EQTA 1KSGA 3GIDA 1L5WA 3T7RA 1Q6YA 2CK3D 1T5IA 4AZVA 5E3HA 4LF6B 3PNOA 3WY9A 1G1MA 3LSYA 1L7XA 3D0RA 4HWRA 1JPJA 3CWQA 3BA6A 1GRCA 5B30A 5C8VA 2QGFA 1BN6A 3IESA 4ETNA 4UM7A 2IV3A 1USWA 1ZZGA 5HZGA 3P52A 2PLRA 4XPIB 4HD8A 2OCXA 4IBOA 4MQ6A 2OZKA 1GTSA 4IS2A 4GRIA 1D04A 4GQIA 3KPVA 1GL7A 1D09A 4CTJA 3PDHA 1T3HA 1Z12A 2GA9A 4XLZA 5I7HA 5H0IA 2DTXA 4YJHA 4N76A 1CZRA 2Q4RA 4F4FA 1C3OA 2IC5A 1NUAA 1O6BA 4C4TA 4M89A 4POOA 1WDMA 1VHWA 1XCLA 3R8XA 4EHIA 3TAXA 2BEKA 4P38A 5T41A 4BN0A 3FF1A 4Y30A 1EFPA 1CUZA 2PRIA 3CQ9A 4JKYA 4YJDA 5DE3A 4EY5A 4DDUA 3IB3A 1FU8A 2AIRA 1K63A 2QRVB 1A27A 2V97A 3EIUA 5CJJA 3RV3A 2CL0X 3NM4A 4I08A 3VJMA 1EP9A 2CFCA 5EXDA 5I8ZA 4AKHA 3W8RA 1EK2A 4QDZA 2PKYX 2NZWA 5ALNA 4HVLA 4IFBA 1Z0ZA 1RABA 4Y3UA 5AHRA 4HLDA 5C18A 3JYQA 2D54A 3MUNA 1W4LA 4JROA 4LZNA 1DO2A 4ESVA 2VDLB 2ZWVA 4QJBA 4ZOEA 4TV9F 4HPXB 2H06A 1OWOA 4EATA 4BTEA 4GT1A 3LP6A 4D99A 5JASA 1VKJA 3BD6A 521PA 1PEKE 2EERA 2BGTA 3FKSA 1P4SA 2Q3JA 1YFZA 2YV4A 3OD5A 2GRUA 4IJUA 4JJAA 3DDSA 4NY1A 4NYIR 3C45A 5H7XA 4V0ME 4E4RA 5IZ4A 5AM1A 3R9IA 4RF3A 1M0SA 4TRNA 4DRYA 4KDEA 2AOUA 2GCEA 2OILA 2YFQA 1P5JA 1MB4A 4RKWA 3TMAA 5ALKA 1A0OA 2PYIA 2ZDQA 2GEBA 3CRNA 3LW7A 4QO8A 4G23A 1QK5A 2V7QA 2ORED 4PC1A 5K0EA 1K5PA 2BCJQ 3O94A 1C3XA 2ET6A 5CBPB 1WZUA 2C84A 3NCTA 4BC1A 4TYPA 1N5IA 3Q9LA 1BXRB 4R8MA 5HIAA 4N7RA 2O8VA 1YIAA 2OD2A 2A57A 3ZXIA 4B83A 6PFKA 1SNYA 1K2VN 3D9QX 5EIBD 3H4TA 3EXHA 1QCDA 2O8FA 4BNKA 4OP1A 2HJ9A 2XX3A 4GX0A 3QW2A 5LXTA 5FV4A 1XA3A 1OD6A 4YJFA 4ZV7A 2BEWB 1OVMA 4ZFNA 4CIAA 3NDRA 1DAKA 4W5QA 4HWPA 2I33A 1DQRA 3HO6A 3OOWA 4QPZA 3GRFA 4GM4A 3N8NA 3WK5A 5JANA 1W59A 2LCFA 1HDXA 4DA9A 4ZIRA 3O9VA 5JSHA 4ZAFA 4AMYA 1NBMA 2IS2A 4JJIA 3G68A 2OSBA 3QYJA 3KQHA 1EFVB 2ZWPA 4N9WA 1NV9A 5A62A 4RK4A 3V8EA 4IV0A 2NPIA 4D96A 3DDUA 3TLAA 2QPTA 2OHIA 2YV3A 2P35A 3DO8A 4CR8A 3RAPR 1P7CA 1Q1ZA 3H5OA 3NIDB 3TEMA 4B7CA 1QB8A 4XASA 5TPZD 1NLUA 3DM5A 4E3WA 1CUAA 3SP1A 3W6NA 1IUOA 1JWAB 3HUUA 4QEDA 3SF0A 3ND5A 2ONKA 3K5PA 1Q0UA 1CUYA 3CMCO 3Q85A 2I2WA 4ZMRA 2DERA 4A10A 3GARA 3RK0A 1W30A 1MAAA 5HFAA 3VHXA 5A1TA 4UE3S 2QD4A 1MC8A 2GUWA 2QVYX 4RKQA 3L0OA 1DTSA 5E8RA 5BSUA 3ML1A 4F6RB 3JZAA 2QG4A 3NBQA 3EIHA 4WXMA 2G1JA 2A5LA 2AEEA 4O2BA 2HQ1A 3R09A 4DWOA 1M54A 3QBEA 1V6CA 1ZD3A 2VK2A 1KQNA 4RTMA 2PK3A 3VHLB 2XGGA 1XTJA 4JWKA 2OCGA 1SCUB 1TB4A 1V5FA 1WQ1R 4KR0A 2BFAA 2BFNA 3ZS9A 5J43A 4QUAA 3CURA 3E18A 1V8FA 1R3UA 4DCOA 3CINA 5JADA 3BE8A 3ACDA 1RXVA 3O5AA 3Q9SA 5EXPA 4Z4EA 5EJ4A 3EA0A 2NP7A 1FW8A 3OH8A 4D9BA 1FP7A 4INAA 4BXOB 3LCJA 3IKMB 3AOEC 3H2IA 1IVNA 3MGBA 3R23A 4ZI5A 1P6UA 1H2WA 3T15A 3PX7A 1X7XA 4PTLA 1OT3A 4OQLA 3ETNA 3DL4A 3HSKA 3LGSA 3ZV7A 2RI1A 1ZSNA 2WTXA 1I2MA 4BMZA 2COKA 3NGXA 2QM0A 2R6CA 2YMPA 4I99A 1MW9X 1XNJA 5CB4B 2LZ0A 1GFWA 2DPXA 3O4RA 5FQOA 1LQUA 2OO5C 4M0FA 4NBWA 4P08A 1ZINA 3SM9A 2O7SA 1MH9A 2Y1XA 2ZP1A 3GJ8A 3UPTA 1U0LA 2E49A 2F43A 2JHAA 3JAKA 1CS0B 4XIFA 3VYSB 4BKPA 1UFKA 4AJ9A 2YXPX 1M75A 3W9UA 3C0KA 1ZH6A 4FS8A 2HIMA 2ROQA 3UJ7A 4A27A 2PKWA 3AGPA 3KLBA 4MGIR 1FFXB 2ZSHA 2RHDA 3B13B 3E05A 4HEA6 5JEDA 2DY0A 2JA2A 2IY9A 3DDCA 4MV4A 4BX8A 5DCWA 1GY8A 2V7BA 5BN4B 4L15A 5ALGA 1Q3TA 1W5FA 3HRHA 1TEZA 1EVQA 1S2MA 5ERGB 2Q5OA 4YCSA 2H1SA 4ALJA 1ADYA 1C9DB 4XYGA 4Q3KA 3UMVA 4UUOA 1X80A 2DG2A 2REXB 2ZTSA 3DEJA 3ICVA 4C6HA 5IJZA 5LVAA 1T2UA 3CC8A 4MMYB 3SYRA 5DM2A 4YUXA 3UXEA 1KGDA 5BQXA 4TS3A 1D4OA 3CLRD 3AUJB 4FE7A 3R7FA 1RPAA 5COBA 3ZU4A 3R9XA 1U3CA 3CTPA 5L9AA 3MWEB 2JI4A 1QIJA 4IL5A 5HW0A 3A7EA 5B53A 3G8YA 3IURA 2G9RA 4MVCA 3RVMA 5TGZA 3SMVA 3UEOA 3KSBC 1E63A 1BD4A 3W5AA 4B8WA 5IYZB 5BR1A 3KKPA 4KC0A 7MDHA 1SH7A 2P9EA 4TVKA 1AF4A 1JH8A 3IVRA 3DE6X 4TXHA 4MVJG 4RVOA 2Q45A 1CR1A 3GFOA 4PBSA 5KYUA 4Q3EA 3PQ2A 5CCDA 5C5DA 1DKQA 2V5AA 4D9KA 3S7TA 4AWXA 2HNKA 3O4VA 5D5QA 5A5VA 4Q6WA 4YGXB 5BN1A 3AUYA 5FPSA 2VHZA 1MIHA 1YD7A 2DWQA 2WG0A 1RMYA 2C4WA 2HRBA 3DCJA 3IOYA 2KYRA 1TJ3A 4GL4A 4MV3A 2WHYA 4R0NA 3HCNA 1QPGA 2J9YB 2XWBF 3OECA 1BRMA 3L5OA 4JV5B 3KLOA 3VZDA 1XEAA 2QQ0A 2WSMA 2ECQA 1K6IA 4EEKA 1DBQA 4DLLA 3E3NA 3IUPA 4TT3A 1BXKA 2ZBVA 1N1DA 1P9NA 3Q5GA 4M1MA 2BSQA 1XVAA 2XVZA 5AJUA 2C97A 2FUCA 2Y1LA 5KYKA 4AJ1A 1LS6A 2FDXA 3W90A 3RUDA 4G1VA 1GRNA 1H8HA 1JPVA 2ZYHA 3O8DA 5G4KA 3FHTA 3MN1A 2ZWAA 3F7OA 4DMMA 5EHZA 1ODKA 1H4QA 3D02A 3LLVA 2WKSA 3DONA 4PCUA 5EE5B 1E3LA 1KU0A 3WS7A 3NHWA 2Q29A 3KOZA 4ITUA 3WAGA 1WSBA 4FVTA 4XFKA 1II9A 3G0GA 2ONYA 3D4BA 4PM4A 1L5QA 3BREA 3EGEA 3ITDA 1USUA 3TB6A 2P79A 3MINB 3U1BA 1A76A 2HHCA 2JLCA 4RPHA 3ZCTA 3QGMA 1KMHA 1TLLA 2VDKB 4KQXA 4XR4A 5DX8A 1SBHA 3CNHA 3E81A 4OF4A 1FIUA 4BUZA 2GCOA 2UVDA 1CNEA 3QE0A 3CRMA 4LRWA 1EFRD 3TUIC 3Q3JB 4JYZA 4Q4HA 3GYGA 4O4HB 2JF0A 3GLQA 4Q4LA 4WRRA 1JS1X 4GI2A 3JQRA 3GJ0A 3EODA 4DDKA 3K0CC 1ZCZA 2AMYA 3HU3A 4CLXA 4FHCA 4F4IA 2D5LA 1WWKA 3Q9UA 2J9FA 2YXDA 3K6JA 1G7TA 4EHBA 4ZJYA 4GICA 4HB4A 4K81B 1KAHA 3SJ7A 3OMWA 4N8DA 2WFMA 1NW5A 3OQVA 1FFDA 2RAUA 4J16A 4KIGA 4YCJA 5AW9A 2FXIA 4WPGA 1KH2A 5K0CA 1RJDA 4F96A 3T1VA 3OF5A 4AF8A 3BK2A 4Q9JA 2WSYB 4KUHA 2JFGA 2PQ6A 4IVRA 3IP9A 4NG5A 5HMMA 2Q9CA 2CNDA 1VPVA 1TJ5A 2P4EA 2ZWIA 2W5UA 4TXLA 3CZ5A 3DZHA 4NJMB 3VNAA 5HRUA 2BZ0A 2IYNA 4ZOLA 1JDVA 3WNCA 1QHEA 4C6SA 2XB2A 2EBHX 3VPAA 4MCAA 2X15A 5JAQA 1IQ0A 3BJIC 4CHTA 1F2TA 4NAVA 1KZ1A 4ZYYA 1H3FA 1ZHHA 2GZAA 3F6RA 5LFAA 3UAYA 3KELA 2ISQA 3UOGA 4KFRA 1ZUNB 1RJGA 1ML4A 1KNQA 2YNMA 2VHXA 2PX2A 3N8DA 1PLLA 3CUTA 3EPHA 2P9FA 3IPLA 3MTAA 3OUUA 4IIXA 3GT3A 3EGVA 4P92A 5CXUA 1Z0DA 3UF0A 1PL8A 2ZYUX 1LI5A 3I6MA 4F0JA 1E2PA 1YR3A 2ZDHA 3TFWA 4CF4A 3JVIA 4X65B 1I5EA 4EK9A 1XZNA 4LHZA 5DV9A 2VHYA 4TL8A 1EWQA 2BSAA 2XOKA 1EG2A 3F3MA 2IJGX 1RWXA 4N8EA 5E7QA 5J59A 1BWRA 1H5NA 4PGMA 3R6GA 2JCVA 2GYWA 1P2TA 1ZL2A 2GHQA 1HNZB 1NMEA 2PYDA 3CBQA 3IAAA 3L1JA 3RIYA 3DMHA 4L76A 2C92A 1N8SA 2WV9A 3C6XA 2D3WA 3R1IA 4WLFA 1U0JA 5B3AA 4KPGA 3TIIA 1EXMA 5HGJA 4FT2A 4MP8A 1F2VA 3TOSA 1YBAA 2ZRPA 4K5QA 2XMDA 4EX6A 1XTTA 2NXEA 3UK6A 3GV0A 1OJ7A 5KS2A 1XO1A 3PXBA 1CUGA 1E2NA 1JIXA 4WA7A 4M0KA 1XZ8A 1SCQA 3F6SA 4FK8A 4MS1A 4IO1A 1L6RA 3U7QB 3VQTA 4BZWA 2J5XA 1OV6A 3ACCA 3W8DA 4KIFA 1R6AA 2BGUA 1YJBA 2R8OA 10MHA 3NVKI 1GQYA 3D43A 2G7MC 3RUHA 1GPYA 1MA3A 3AP2A 1EBUA 1X7WA 3E1SA 3JATA 1WW8A 4G5HA 4IUYA 4UMVA 3WIBA 5LSAA 3FYTA 5I7UA 2HFKA 4K26A 3LVQE 5FCDA 4O2AA 3FOAA 4LEIA 5T4EA 2JFZA 1V25A 4LVCA 5EAIA 1K27A 5KREA 1JEYB 4EIWA 16PKA 1Q11A 5D84A 1PSZA 1OC4A 4H77A 1NUUA 4QE3A 4OU4A 2MYNA 4ZAGA 2QYSA 1RAGA 1T13A 2CVPA 2M6LA 3D5TA 3I8XA 3IQIX 2J9GA 6REQA 1DLJA 2RARA 4CV0A 5JBIA 1YB7A 1PJAA 4FD2A 3U56A 1M2OB 4NZNA 2PUGA 2XB9A 4RJKA 4AO8A 4FLEA 3SWWA 3ZD9A 3DWEX 3B6KA 4Z4IA 3FBWA 4AZSA 2Q27A 1B0ZA 4DNPA 1U2TA 2B4KA 2IHZA 1AO0A 2WYVA 1ACMA 1WMSA 1X7HA 4DAEA 2DULA 3RYFA 1EWRA 4GNKA 4EHFA 3O91A 1YJCA 1S96A 1S0UA 2GUGA 4Z0NA 3U4CA 3UMMA 1CLEA 3Q7QA 4X8LA 1VPTA 3L4KA 4Y9RA 4BGUA 3QEMB 4AKGA 3O3OB 3FI9A 4WGFA 3M4YA 1SC6A 1FEZA 4Q19A 1ECLA 3JWHA 3TNLA 3OZAA 1D1PA 1XFDA 3RSZA 1GEGA 2DKOA 2NUBA 3I6IA 1K1EA 2QDXA 1WNTA 4DYVA 3TI9A 3FCCA 1M83A 3HL4A 3N2YA 3NGLA 3RKSA 3MQ2A 2ASVA 3D0KA 1MABA 5EP3A 2SKDA 4I3GA 4D0SA 3HBMA 2DR2A 2CHEA 1JR4A 2Y1WA 4XSVA 1LLQA 3KQWA 3T3NA 2XAAA 2KS6A 1UINA 1C5KA 4WNIA 4DMLA 4G0OA 1CJUC 1E1QD 4UU1A