2P0EA

Human nicotinamide riboside kinase 1 in complex with tiazofurin
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
193
structure length
190
Chain Sequence
b'VPRGSKTFIIGISGVTNSGKTTLAKNLQKHLPNCSVISQDDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAISCWMESARHSVVSTDQEEIPILIIEGFLLFNYKPLDTIWNRSYFLTIPYEECKRRRSTRVYQPPDSPGYFDGHVWPMYLKYRQEMQDITWEVVYLDGTKSEEDLFLQVYEDLIQEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nicotinamide riboside kinase 1
publication title Nicotinamide Riboside Kinase Structures Reveal New Pathways to NAD(+).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 56
structure length 190
sequence length 193
ec nomenclature ec 2.7.1.173: Nicotinate riboside kinase.
pdb deposition date 2007-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13238 AAA_18 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2p0eA00
4D2IA 1WRBA 2HXYA 2XZOA 4ABYA 1D8TA 2NZJA 4GOXA 2VF8A 4HEJA 2IT1A 1LFDB 2A9KA 3L8ZA 2V6JA 2BBOA 4GFDA 5K8UA 2VHCA 1UBGA 3AP3A 3VMFA 2MMCA 5JSZB 4BFVA 1EESA 1J8YF 1F48A 2IEZA 5AUPB 2EW1A 3CH4B 1NSFA 4B44A 1R8SA 4X8MA 4ACBA 1G3MA 3NEYA 2WWYA 3TUJC 3PUWA 3B8HA 1JAIA 1KY3A 3VR4A 3VX3A 2ODWA 3BFVA 4DKXA 3CM0A 4EFMA 4CEIA 4QOSA 3KB1A 4OHWA 1N6HA 1OFTA 3OEED 4YMWA 3KKQA 2ZI4A 3VR3A 3QSYA 3P26A 4LBVA 4TSFA 4PX9A 3AVXA 2E1RA 2QGZA 3ZVNA 4O3MA 4B3GA 3LAWA 1E2GA 4P4SB 4HUTA 4FMBB 1GDDA 4KFTA 4Q21A 4MRSA 4P4TA 3I72A 2B7CA 4TQ9A 1SVOA 2GVDC 2IF0A 1W4BA 3CNOA 1RJ9B 4G5SA 3KZ1E 5SZHB 1XCPA 4GNKA 2QMHA 1U8AA 4Q1AA 1PZNA 4N3NA 1AIPA 2WJJA 2WSSA 4Q4HA 2IYQA 4LUCA 1XPOA 1XRJA 4R71A 5HE9A 4F7WA 2BMDA 1OFIA 1GKYA 3KB2A 4TLCA 4NZYA 1RW4A 1G291 2ZJ8A 3RRMA 4HB3A 4Q4AB 2JIZD 3EZ9A 2G88A 2OSBA 2ZRMA 3ONWA 1QF9A 4UXIA 2O8BB 3B9PA 1DAFA 5HZKA 1W36B 3ZDQA 1NBME 4YONB 3NHBA 4A6XA 4HZUA 3GJXC 1H65A 1VHTA 3AF1A 1LVGA 4MGYR 1LF5A 3NWJA 5JWHA 5FBVB 2ATVA 5FUVA 1TADA 3DOEA 3R7WB 4F4IA 4FINA 4V0LA 2YKGA 4LGMA 2LKCA 3SBDA 2IEYA 4W5HA 2BM1A 5H1YA 2OCAA 2FGKA 2G3YA 2OFOA 4DJTA 2FWRA 2IK8A 1FP7A 3ZH9B 1Z6GA 1G6HA 4NU0A 3C5CA 1E9CA 2F9MA 3QENA 4RFSB 2WJIA 3GLFB 2PJZA 3RWMB 1Q1EA 1IY0A 1CR0A 3HYTA 1AGPA 1DO0A 2ZJOA 3THYA 1W46A 3H4MA 4MUBA 4TMKA 4KITB 2QQ0A 5IRCD 2CL7X 4PHHA 2X1VA 2ZUBA 2W6IA 1SKQA 1U99A 3WHLA 2LKDA 1ESNA 1IQPA 2VP4A 2R62A 4TQUS 2IHBA 3RABA 3WXMA 1G4AE 1NVVR 3EZ2A 1TF2A 1UBEA 1XEXB 2QPOA 3TH5A 1G16A 4G1UC 1SVKA 2Z0MA 4L16A 1OIXA 2FN4A 2HF8A 4R2HA 1IN8A 4PC6A 2BDTA 2BEKA 5GJCA 4QHSA 1GNQA 3AVQA 3ZVMA 4B3FX 2P3SA 3M4YA 1OH8A 3DM5A 2C99A 3ADKA 5KU1A 3DMDA 1E2LA 2NQ2C 1VIYA 4MKGA 1X86B 4V0KA 5FBRB 2ZEJA 2EWWA 4HAZA 4RY2A 4CIDA 1GTVA 4IHQA 1FP6A 3KJIA 3MWKA 3UWOA 2FPKA 3I4LA 4FWIB 4V0ME 3R9IA 1Z6TA 5KDLA 4QBHA 3B7GA 1RFLA 4LHYA 4TQAA 2F1JA 3Q7PA 4IEEA 4LSGA 1MOZA 2O8CA 1C9KA 3BFXA 2GK6A 4HAXA 1P4SA 2DFKB 1HQYE 2YWGA 3FKSA 3QG5A 3SQXA 4POAA 2QN6A 2REOA 2J5XA 2DFTA 4FMCF 2WKRA 2ZYTX 5CYPA 1E0AA 4Q01A 4IJMA 3LLMA 1E2PA 4NCHA 5AUQA 4EIWA 1TF5A 4L4UA 1T9HA 2MSEB 4M1MA 4BZQA 4XWOA 5ANRB 1G7RA 1OF1A 2OXCA 5FUYA 3T61A 2JLSA 2NZ8A 3QKTA 3W6NA 2JLWA 1Z0AA 4LX0A 3WNDA 3OHMA 2NO9A 4PHFA 5E7IA 1CXZA 1HT1E 2G83A 1W7AA 3NC0C 3IHWA 2FFAA 2JDIA 5EE5B 3SJCA 1RZ3A 3QOFA 3W5IA 2C96A 5AWFC 1TEXA 4LI0A 3U7GA 1Y3AA 3BOSA 3I8XA 2CLSA 4A0RA 3RS4A 3G0HA 5DI3B 2KI5A 5DNYB 1B23P 3GLHA 2YWHA 5TV2A 1FMLA 1RYHA 4LJYA 2OUKA 4Q1DA 1FUKA 3TAHA 4KO8A 1FQKA 1GL7A 2QMEA 4URWR 1E2HA 3WMFA 4G01B 2WWWA 4LBZA 5DYIA 2IYXA 5CDFE 4LV6A 4BFUA 2WJGA 5D3MA 3B78A 4RZ2A 1KYIA 1KGDA 2BBWA 4NP6A 1KI1A 3LW8A 4GT1A 1JR3D 1XNJA 1Z2CA 4S35A 3NDBB 5DLQC 4Q7KA 4M1WA 1KO7A 1KY2A 4HATA 3K70B 4FCTA 2WIAA 2NTYC 5FOUA 2YC2C 4XVUA 4BQSA 4HLUA 4CDGA 4YDHB 1R0WA 1AZTA 2H18A 1CULC 4LY6A 4D0NA 3IEUA 2CDNA 3IO5A 2B6HA 4IOLA 4TTQA 3GMTA 4KLNA 4MGIR 1DELA 4B74A 1E98A 3GLGE 5AJZA 2FSHA 3NH9A 5AJVB 4LC1A 4RVCA 2YZ2A 4TZ0A 1DPFA 1O87A 1OH7A 2FFHA 2QTVB 2VHUA 3LH5A 5DI9A 1Q3TA 3D7MA 4NL4H 1ZNYA 1EFHA 1GOTA 1YR6A 3TUIC 1Q22A 2X2EA 3SC3A 2XTNA 5IHPA 1P2UA 2D06A 4UNNA 5FTMA 1TNDA 1NLFA 5JSZA 1EX6A 2HJGA 2JJ2D 2O8DB 2XXAB 1OXTA 4W5WA 4PQYA 1NVXQ 1KAGA 1QHNA 2BIFA 4NYIR 3W34A 2JJ1A 4YXWD 1G1MA 4ILEA 2Y8EA 1H8ED 3QKUA 1HA3A 4MRNA 4D6PA 2QAGC 2XZLA 2RMKA 1UDXA 1D2EA 4DHEA 2GZAA 1EFTA 3DOFA 3NVAA 3TR5A 3HR8A 1CLUA 3DVLA 2O0HA 3PENA 4TT3D 1Z5ZA 2IWHA 1NIPA 1YZTA 2FE4A 4P4SA 1JJVA 1YZKA 1M6NA 4LJ5A 4LYHA 1A5TA 1SXJB 1ZW6A 2GZDA 5CJ2A 1RJ9A 3N70A 4I1OA 3WYGA 2F7SA 2QE7D 5HKKD 3B1VA 4KVAA 4OQNA 3BH7A 2GCOB 1KTVA 1UM8A 3BS4A 1Q12A 1SVWA 1VG0B 1QHIA 1UEJA 2GXAA 3N2IA 4DCUA 2GF0A 3KKMA 2XNSA 4K81B 4E09A 4WA7A 1JJ7A 1IJFA 2LWIA 1G8PA 4UNPA 1U8ZA 3B82A 1XTRA 2ORWA 1T0HB 2ERYA 2NOAA 2WAYA 4Q4AA 4EQ6B 5BYKA 4I99A 1KNQA 1FMJA 1LV7A 5FBQB 821PA 2O8BA 2XNDD 2Q3FA 3K0CA 1ZCAA 5FL3A 4DUGD 2CL6X 3QXJA 5FPTA 3MSXA 1WXQA 2WJHA 3LQQA 3AVTA 4P3YA 1YQTA 3R7WA 3A1UA 3WRYC 5L3SB 5LPNA 2GK7A 4GBMA 4Q7MB 2QM8A 1Z08A 4DB2A 1LNZA 1AN0A 1E32A 4EFNA 5BXQC 4IFBA 1P2SA 2BM0A 5DH9A 1S0UA 3OAAD 4F93B 4D0LB 4RFSA 4DZZA 1R10A 2ZRCA 1OW3B 3C8UA 3AF0A 2CK3D 1OH6A 2P67A 2PT7A 2JATA 2XTMA 2ZR9A 3AKYA 3CX6A 4BGDA 3F8TA 4M22A 2DBYA 1J2JA 3QIAA 5SZJA 4BEJA 1UKZA 4U7DA 3TE6A 1ZUNB 4M1SA 3EX7C 1R0YA 4Q47A 2WOJA 3A8TA 1HT2E 2ZU6A 5IF9A 1NKTA 1W48A 1NIJA 3EPKA 1G20E 4KJZA 4LC0A 3X2SA 2YOFA 3B13B 4ON9A 4F91B 2CL0X 3SJZA 1XEXA 1Q0UA 2FJUA 3AF3A 2IYWA 3RS7A 1N6LA 3ZZTA 1N5JA 1MH1A 4DLXA 3AKEA 4DVGA 4CYMA 1AGRA 3O8CA 1ZC3A 1JXMA 4PXAA 4LHXA 4TMVA 5EXTA 4OHVA 3EASA 2FX3A 3LWNA 2CCKA 4E07A 3B1YA 4RCZA 2EFGA 1H8HA 1IXSB 2YYZA 4XVRA 2VSOA 4OJKA 3EWAA 4KFRA 4Q03A 1JR6A 4I4LA 5SZIA 4JVSB 3D3QA 4UQOA 1JBKA 3C14C 2GJAA 1MRSA 3LXXA 3ND9A 3BBPA 4RD6A 4DCVA 3NHAA 1X6VA 4WW0A 3UIEA 1Q1BA 2RGNC 2DR3A 3GPLA 4XD7A 4LV5B 4AG6A 221PA 1TUEA 5E7MA 2FSFA 2H5EA 3IO3A 2FEMA 3M0EA 1SGWA 3FTQA 1TX4B 2JLUA 2MSDB 2VP5A 3AKCA 1RRPA 3BK7A 3LX8A 3B5JA 4DXAA 3JZMA 4KXFB 3NIBA 3QKSB 4A4DA 4PC3A 3DDCA 5TVKA 5IK2D 3OZXA 2FF7A 2A5YB 2XAUA 5J4HA 3IQWA 3LVRE 2J3EA 1IAQA 5TARA 3R20A 4ITRC 2QM7A 5FPKA 1SKYB 1VG8A 4TYYA 2WZQA 4NPHA 2CHQA 1EFCA 2C03A 2VRWA 4QL3A 2PMDA 4D81A 1NF3A 4Q1EA 1GL6A 1N6IA 1E2DA 1VCOA 3QXHA 3EIQA 4G3XA 4L15A 4W9MC 2BBSA 1CRPA 4HYYA 3DO6A 1AZSC 1TQ4A 2C9YA 3FFBA 3FB4A 1KSFX 2OZEA 3AVVA 5DN6A 3EC2A 2HDNB 5DI3A 4EJSC 4A8JB 2CNWD 2QROA 4A0HA 3CWZA 4YMVA 2IYZA 2GWHA 1E69A 4YMSA 3CKLA 4IDHA 3I92A 1I2MA 3V4FA 1KI2A 3TR0A 1V43A 2CHGA 1BH2A 1IM2A 4JLKA 1HV8A 1M7GA 4NBSA 3TSZA 1G41A 3QPUA 3OESA 3FOZA 3T5DA 2AXNA 2R6DA 3VNVA 1OKKA 1W49A 5JS7A 4BFYA 5H68A 2W2VA 5FUXA 4EPRA 4GL2A 2ODEA 2ZE7A 1Z07A 3PUVA 4NYIQ 5LD2C 3M1IA 1IY2A 1T8UA 4HUQB 5HR5A 2ANCA 4IDOA 1E1QD 1C1YA 3KQNA 3ADDA 2G1JA 2QNRA 1F3OA 4I1VA 1D2NA 1J99A 2BCJQ 2ZYVX 3NBZC 3VR6A 4OK5A 4R2IA 3CPEA 1XMVA 2DPXA 4XTRA 1XXHB 3QXSA 2FFBA 1U9IA 1KZGB 2CVFA 1MV5A 2ZS9A 3KUDA 4IEIA 3KQUA 1GP2A 3RNLA 5IT5A 1G3IA 1R6BX 5FBWB 3EXAA 3LBNA 1Z22A 1Z28A 2QRZA 1OXSC 4BE7B 3T1TA 4PHTA 4B3DA 4ZDWA 3THXB 4P32A 5HPYB 2BV3A 1ZRHA 3MD0A 2WSMA 4A15A 1PLLA 2WPDA 3IIMA 5AK0A 1A2KC 4QBFA 1DAKA 2PJRA 3RLFA 2O8DA 5AUOB 2XXAA 3U3OA 3A1TA 1JQJC 3L8YA 1E9SA 5FOTA 2R2AA 1IN6A 3CNLA 4LHWA 1YHNA 4NH0A 5CB8A 3SDZA 4B71A 1N6KA 2Z43A 4HAYA 4RD4A 2PCJA 1E0JA 2G1KA 3KXLA 1II0A 4OQFA 1W5TA 3QF4B 4Z1MA 4M9XA 2RGCA 2WMNB 4ZV4A 1UBFA 2Q0HA 4KSCA 5P21A 1E9DA 1YZUA 2ZANA 2WBLC 4GPTA 4KBGA 3SHWA 3IIJA 3ZZUA 4JYCA 4HAVA 4MRRA 3OE7A 1SXJA 1DVRA 1E79D 4UXJA 5EUQB 2HJVA 1HUQA 1ZD9A 3EIHA 2GCOA 5HCIA 1EFUA 1Z3IX 2RGAA 1S1MA 2F9LA 4OHXA 1FPMA 3NKVA 4DEXA 2Z6VA 4II7A 2A5DA 1OYYA 2ZRNA 5JWOA 1OJLA 2KJQA 2ZSEA 4TL8A 4MYTA 5GJBA 1QVAA 5JHGB 5JJIA 1ZIPA 3D31A 4FI3C 1BMFA 3ZD6A 2YOHA 2WAXA 5KPDA 3F3YA 4O2LA 3QUSA 4UKDA 2JLRA 4B48A 4EQ6A 5JZVA 4R9UC 5FUWA 4L8GA 2C2HA 2D4HA 3Q9LA 2NPIA 3MWLA 1I2DA 4LJ7A 4UNSA 5DO9A 2MSCB 4ZCLA 5DHFA 1KDRA 3BXZA 2QUZA 2D7DA 2ZJBA 1IN4A 4GDFA 5GJWC 5JI2E 3J81k 3L2OB 5L3SA 2PLFA 1KJYA 2DWPA 4JT2A 3CX8A 4PAQA 3UG6A 1BS1A 1M34E 1T4GA 3KJHA 2C04A 2R8RA 2DWQA 3OEHA 5LDDC 3ADBA 3CB4A 4PSAA 2AFIE 1CS4C 3IBGA 4D82A 4FWTA 1NMXA 4MH0R 1W47A 3P27A 4EUNA 2FFQA 2XOKA 3K53A 3VR2A 3R9XA 1VMAA 1NMYA 4QXAA 1I4DD 1ELOA 3QKRB 4EPWA 5B58C 3KJGA 2BVNA 2C98A 1CJUC 5BN3A 1XFAA 1SHZA 2XB4A 2OG2A 1N6OA 4RZUA 3CF0A 1KDPA 3T1OA 4A82A 4BLQA 3HR7A 1I4LD 1OHHA 1RRCA 3ECCA 4OHYA 1KO4A 1S4QA 2IBMA 1G19A 4DT1B 5KO2A 4MDFA 2WOOA 4GOJA 3UMSA 5KDOA 2C77A 1R5OA 3FVQA 4NTZA 3AQ4A 2VBCA 3QPVA 3FWYA 4LBWA 1YZGA 3RRZA 3KQHA 3RS5A 2ZRJA 1KAOA 3GEHA 2IXEA 4TL9A 5AR1A 1FOEB 3ZIAA 3LNCA 3HP1A 1UPTA 4KVGA 4OBEA 3SFZA 1XTJA 5J4KA 2QU8A 3PIRA 2GESA 3LLUA 1F6BA 1QHGA 4JYBA 1EFRD 1ZD8A 4LJ4A 4UXHA 4OI1A 4D0GA 3A6PC 3VKHA 3G5UA 1WA5A 1SQ5A 5CYOA 3AVUA 1UDWA 1F2TA 4NE2A 4DC9A 2OCBA 3VNUA 1KO1A 2IF2A 3DZ8A 1U8YA 1IONA 1VCIA 1IXRC 3QKSA 4PC2A 3AGPA 4JL6A 2F3TA 3SEAA 1GILA 1QDEA 2YC4C 1DOAA 2Q9AA 3VAAA 1GKUB 4EKDA 2QP4A 5DISB 3GLGB 1NJFA 2D74A 1CJMA 4DB4A 1L2TA 1T3HA 2GCPA 5IDVA 4IOJA 5KSPA 3K0EA 1RRFA 1GWNA 1GRQA 3KX2A 1XEFA 1E1RD 2WVJA 4RKEA 3R8FA 2H7VA 5B64A 4C3ZA 5KNCA 3BB4A 2C9OA 4WXPA 2J87A 2ONKA 2W58A 2BKEA 3MGCA 1TQ6A 2Z4SA 1ZUIA 2GETA 3SJBA 3SJAA 1S9DA 5KSZA 3OFND 1G5RA 5KSYA 1UAAA 4C7OB 1GNPA 4AYWA 2EFCB 1F2UB 3F0TA 3VR5A 1AS3A 3SFVA 4A8JA 4ZIRB 3K9LA 1I4TD 1LF0A 5JCZA 1KI3A 2ZI3A 3B1WA 5LB4A 1IBRA 1NN5A 4LRWA 4RD2A 3U3JA 4XTCS 2JGNA 2QBYB 5SZKB 1YE8A 3Q3JB 2WWHA 1G9XA 4M1YA 2FU5C 4LWZA 2HF9A 2FMXA 2ZI9A 1CJKC 1VG9B 1E2NA 3U44A 5J5CA 1CP2A 5FL7D 3EZ7A 1KMQA 1ZM4A 1Z47A 2ORIA 4AY2A 3X1XA 4HUQA 3S1AB 3A4MA 2Q3MA 3Q85A 1BOFA 5FH9A 2P0EA 1S2MA 3RC8A 3P32A 3AV0B 4QNRA 2IYTA 2P2LA 1BIFA 4C30A 1KKMA 1E99A 2KBFA 5BW8A 1XXHA 1G7CA 1Z29A 5JS8A 2P6RA 1WQ1R 1RYFA 2ZJ5A 3MRSA 1S3SA 2HLDD 2DFLA 2ZITA 3AH8A 5G40A 3GJ6A 2FA9A 4DDVA 3THXA 4YDSA 1Z6AA 4ZDKA 2J7PA 1MABB 1R0XA 3UANA 4ESHA 1MO3A 1NN1A 1PV4A 1C4OA 1D9XA 2O8FB 4FCWA 1DBSA 4IW3B 5KNDA 3R8CA 3TVTA 2IXGA 1JALA 1NN0A 1US8A 2K5UA 3CRW1 3UMRA 3LV8A 4QG7A 2QP9X 4BUJA 1AKEA 1N2CE 2GJ8A 3GJ8A 1JEEA 4F4JA 3CRQA 1E94E 5EP4A 4C2UA 3NBFA 1VPLA 3KTAB 2F3RA 4HB2A 2H16A 2GJSA 3I62A 3CRVA 3QF4A 1G8GA 2G77B 2AXPA 2WM9B 5CK5A 3NXSA 3AVOA 5B30A 3BH0A 1FX0B 1QZXA 3AVPA 4FN5A 4HLQB 5G41A 1RIFA 2ZI5A 1G17A 4US0R 3CIOA 2QORA 2YHSA 2QENA 1CU1A 1F60A 1OPXA 4HDOB 3TW4A 4M8NE 4LJ6A 1TL7C 2NGRA 1YU9A 3FMFA 3TRFA 2VHQA 2H8KA 5C18A 4YC7A 2GBLC 3WNBA 2RGDA 1TU4A 3BH6A 4HI0E 4IDPA 4AWXA 1P62B 1WMSA 2YWFA 3KL4A 5FR2A 2IL1A 4KODA 3JZAA 1W5SA 4ZDJA 1U0LA 1S8FA 5GADl 4U00A 5JEEA 3O8BA 1JEDA 2BKUA 3O47A 5BWMA 3Q5EA 5M04A 5B2ZA 1ZCBA 2F1IA 4MYCA 4X8HA 3WBJA 3TGPA 4ARZB 4JVMA 4BZXA 3AKDA 4Q18A 1TF7A 5KOYA 5H8WA 4MYHA 1E2FA 4K46A 1UF9A 1RRGA 2ANBA 2IHYA 2HXSA 1A1VA 3W3AA 3WY9A 3IEVA 4PPGA 1E2MA 1G64A 3RAPR 3IIKA 1EX7A 3VQTA 1GFIA 4LYFA 2ZROA 3FMOB 3LDAA 4TMTA 4DDWA 4PZLA 2QMOA 2VP6A 3K0AB 3ND8A 2IYSA 2V3CC 2HYIC 1VYUA 3U60B 3HJNA 3HPRA 3CZPA 4JLVA 3GFTA 2PEYA 3L0PA 2OILA 4Z8YA 2ZXUA 2IC5A 4QC2A 5AJXA 2UZIR 3ZVLA 4AYTA 3MMPA 2OAP1 1GAJA 1KJWA 1QRAA 1VDZA 3AP1A 3IQXA 3V9PA 4PO1A 5JMTA 3QKRA 4XSGA 4DRZA 5CLQA 2HT6A 5FOSA 1W2HA 5DN6D 4HDCA 2D2EA 4JLAA 1D9ZA 1Y63A 2GEVA 2XSZD 2ZETA 3THWB 4JLJA 4OKSA 3UKDA 2ZSBA 3I1FA 2XX3A 4QGFA 4WZAE 5KTYA 1KK2A 4JZKA 4JLOA 2R9VA 1JNYA 521PA 3PR1A 2A2ZA 2ZAMA 2ZSAA 1NVWQ 3BJIC 4BLRA 4DT1A 3Q5DA 3VKWA 3IPXA 2RGGA 121PA 3OEEA 4ERNA 1YZQA 2GEUA 4C0LA 2YOGA 4Q1FA 2ZRPA 5HCNA 4AD8A 3SYKA 4IOKA 4ZCMA 3RRNA 4C9BA 4A92A 2GXQA 4ASUD 4DCNA 5LB2A 3UWKA 3VU9A 5FTKA 3LVQE 4C0AC 5E3HA 5KSOA 2ZRKA 4GZMA 2BMJA 2VL7A 2QAGB 5CDFA 1RVDA 3K09C 4ZKDA 4OQXA 2IYUA 3E70C 1QHSA 2BCGY 1M7HA 1SZPA 1YR8A 1JI0A 2EU8A 1U94A 2X77A 4JVLA 2AD1A 4CEHB 1Z0IA 2NO1A 3CRRA 2A7QA 2B8WA 1RE0A 2J46A 1DARA 1Q57A 3B1ZA 4PC7A 1E3MA 1OYWA 2QG6A 1GRRA 5JI3E 2ZRIA 3DPUA 2FGJA 4TMWA 2JIZA 4YMTA 2C9CA 2O8EB 2J0UB 3PXGA 3VX4A 4PQRA 2H1LA 1ZMXA 2QY9A 4AC9A 4B35A 4ZI2A 1P5ZB 3GLGA 3KJEA 3GLFE 4TYPA 3X1YA 1ZINA 3IHLA 1II9A 4JKIA 2AK2A 2V7QD 3TJZA 5FTNA 2HCBA 2A30A 4RD1A 4NHOA 1HE1C 1GZSA 3WYAA 1LB1B 1L8QA 2D2FA 2G0NA 3GEEA 3V00A 1XBTA 4PSKA 4DWJA 1KNXA 2EFHB 1G5TA 4TL6A 1NVVQ 4DIEA 4MUAA 3I5XA 2FEOA 4AG5A 2XB2A 3RHFA 3FKQA 4J0QA 1E2JA 3U7EB 4H9GA 4D25A 4C7OA 2A3RA 1OFHA 2YNMA 1F2UA 4ZIRA 5L8VA 3VHXA 2IS1A 3FE2A 3L0SA 1MO4A 1DEKA 4JLPA 4PAMA 2ZSFA 3MCAA 5F3WB 1B0UA 2DFNA 1W0KD 2D3WA 4M4SA 4Q7LA 4CZ2A 2IA5A 1PJRA 1Z0FA 4WZ6A 1W2GA 4DCTA 3U4QB 4MQBA 5J4YA 2QBYA 2ZE6A 4B3BA 5JHHB 4WZBE 3T06B 1T91A 5KHOC 1KOFA 5A0FA 3RS2A 3SI7A 4WXRA 1P9NA 4M1TA 1E9BA 2EYUA 3X1WA 4B2IA 1RPZA 5TDHA 2CMKA 1KMHB 3EPLA 3R9WA 1KZ7B 3HPQA 4M9QA 2DY1A 2FV8A 1E2IA 2Q9CA 3CR7A 3P4XA 3S1AA 3THOA 2B92A 1COWD 4MKFA 2W6JD 3SBEA 4AKEA 2AL7A 2CHVA 1E4YA 4H1VA 2J0SA 1G8FA 3K8YA 1N5KA 5JCPA 1PLJA 1VIAA 2C8VA 2ZVPX 3NBXX 4URUR 2QPTA 3U5ZB 2H92A 1XJ0A 2W2XA 1XTQA 3H86A 5FBLB 1IXZA 2ASEA 1TEVA 2WWGA 2F6RA 1ZNZA 1QG2A 2ZJZA 2ZRFA 1MABA 1WP9A 1S3GA 1TUIA 1II8B 5GJVC 3I73A 4BLSA 2OESA 4G5GA 2O8FA 1JB1A 2OEPA 1ZM2A 3AF2A 3ICEA 4JJKA 2GAAA 2CE2X 3EPJA 3KDSE 5EE0A 3PJRA 1FZQA 3FGNA 2IYRA 2QEQA 5K8IA 3I8SA 5KNBA 4IXMA 4KSBA 1F2TB 1S1CA 4KFUA 5FI1B 4YQFA 1XPUA 1TU3A 3PITA 4Q00A 3M6AA 1GITA 1W0JD 1CR4A 4NONA 4BFWA 2ZU0C 3KTAA 4BFZA 1NI3A 1G3QA 3RRYA 5EXPA 5EJEA 3NH6A 5FPYA 4MGKR 5JFGA 3T34A 3GJ3A 1FX0A 3MWYW 1G7SA 2OFXA 4L9SA 4PO9A 2IXFA 1A4RA 3OF5A 4HLCA 4Q9HA 3OIYA 4KBFA 1KSHA 4TZ6A 4GP7A 4C2TA 4EPYA 3KXIA 5K8LA 1NSTA 1LS6A 4QRHA 721PA 3ASYA 1PLKA 2RGEA 4PPQA 3JVUA 2OT3B 4BLOA 3WYFA 3PEYA 1DAIA 4QHYA 4JBWA 2JEOA 1GM5A 1PUIA 1SVSA 2JAQA 3A4NA 2WTUA 3RSOA 5C1BA 1YZNA 4NYMR 1X8KA 1SULA 4UJ3A 3K9HA 1WE2A 4GP6A 4CGZA 3PVSA 4D4KA 5F9HA 5FOXA 5FOVA 2FDCA 3I3SR 4TMZA 1T5IA 4TSFD 3TQCA 4JMPA 2UKDA 3W9YA 2V55B 3B9QA 1JR3A 3BORA 4EJSB 5EQTA 2ZJ2A 2AN9A 2IX3A 3U3RA 1XMSA 3TIFA 4QFMA 2P6UA 3QF7A 2NIPA 1KK0A 2CE7A 4ARZA 3L0OA 3GP8A 5BQ5A 4D4MA 1HEIA 3EA0A 3HU3A 5DYGA 1T8TA 3GLIE 1ZM3A 2PT5A 3IILA 1EK0A 3DZDA 2WSSD 2RCNA 4M2LA 3LW7A 4ZPXA 4IVPA 2QL6A 4NCIA 4LPKA 4DBLC 3U44B 1IN7A 1YVDA 5L3QB 2R65A 3K0AA 4E03A 1E9FA 1U98A 3WHKA 2I1VB 1XMIA 3SNHA 1XD9A 4KFSA 5FTLA 3VTKA 1LTQA 1CR1A 1CRQA 3B85A 5K8TA 5LD2B 1OV4A 6Q21A 1EXMA 3QI2A 1ANKA 3ZZ0A 1GUAA 2ZI7A 2VEDA 2ZR7A 4RCYA 2AWNA 1OH5A 4Q5IA 1E0SA 3HYRA 2FNAA 2RGBA 1P60A 2QMUA 3U7FB 1Z0JA 1XTIA 2RKOA 2NPFA 2JJ2A 4EDHA 1P61B 2HEIA 1IHUA 1XF9A 2BWJA 3THWA 3CNNA 4YXWA 4A2PA 2VP0A 1H8EA 1AJEA 4OJQA 2F43A 3EA5A 3KFVA 5GVSA 2ZIAA 1VYVA 2IYLD 1MKYA 4HLDA 1R7RA 2FPLA 2QA5A 3QBVA 5KPJA 3DKVA 1NMZA 3QG1A 3V4RA 2KE5A 4TT3A 1QHYA 1ODFA 4KCGA 4D4LA 2R44A 2CJWB 1E6CA 1US8B 3UMFA 2RAPA 5LBIA 1NRJB 2YWEA 2W6ID 4LOAA 3AM1A 3MFYA 2V4ZA 3KQLA 2EWVA 1UADA 1ZNXA 4Y0AA 3BFKA 1KK3A 4KYUA 4BFSA 2ZRBA 2QT1A 2QAGA 1XCGB 2QE7A 4MRPA 1FUUA 5HKKA 4D26A 3EARA 1VCNA 2BMFA 1KO8A 4IXNA 1D6JA 1XWIA 5DGXA 1UJ2A 4PANA 4CEHA 4HAUA 4Y0VA 2PBRA 3SR0A 2JLQA 1GVNB 4CW7A 1VHLA 1XU4A 2BJWA 2J9RA 4TYQA 4TLDA 4WBSA 2IS6A 3PFIA 4QJ5A 4XVQA 4DLVA 2J0UA 1SHKA 2BOVA 5EXSA 2VO1A 2O8EA 2XNDA 1AS2A 4S2EA 4V02A 3FHOA 5CK4A 4KHZA 4DUGA 1G3UA 2W2TA 4LYJA 4Q4LA 1X8JA 2J0VA 1A7JA 2VA8A 1V5WA 1PVOA 3ZGXA 1JPJA 2KSQA 4HAWA 2FZ4A 4JVNA 1P3JA 3EZ6A 1XTKA 1Z83A 3EWSA 4FMDF 2C78A 2QAJA 2J7KA 1XZQA 3FKSD 2FSGA 5FFMA 3OAAA 4B3CA 1ZIOA 2W00A 2XEXA 2P5SA 1M74A 3AEZA 3ZLJA 2CK3A 3RYTC 1TPZA 1GIAA 4M1KA 3TUZC 3U7HB 1ZJ6A 4HDQB 3TVDA 3P4YA 4JIMA 1IJEA 5CM9C 5FPHA 5G3ZA 3ZVRA 1XEWX 1P7CA 4DLZA 4Q1CA 1Z8FA 3PEVA 1X1RA 4B6FA 3LRPA 4JS0A 3TK1A 3CW2A 3U4QA 1G8HA 1LY1A 2NO0A 3NDPA 5HTKA 3T15A 3W3ZB 3WNCA 1KI9A 1WDTA 4Q4JB 4OQMA 3NBYC 4GRAA 1CKEA 2ERXA 2GJ9A 3QQ5A 2VHJA 2JDID 1N3BA 1NY5A 2ONJA 1R5NA 4HB4A 4DSOA 1ESMA 1XP8A 2PZGA 3SQWA 3PUXA 4O0MA 3CF6R 1KMHA 4IRUB 1OXUA 5FPSA 1K5GA 4CVNA 2QRNA 3WMGA 2CVHA 4QM7A 1M7BA 3B60A 1XCMA 1A2BA 4HZIA 1DAHA 3AP2A 4Q66C 4HLUC 5AJWA 3EZFA 4ZDIA 3K1JA 3HWSA 5C4MA 3W6PA 4P0TA 1R8QA 2AKYA 4AYXA 1OXXK 2PCLA 1QBKC 3WRXC 4QM6A 2ZRHA 3L43A 1SKYE 3PG5A 3VU9B 3RDPA 3DHWC 1ZC4A 2W0MA 1DAGA 2JLZA 3LD9A 1II8A 3PCRB 1XB2A 3C16C 3IUYA 2V1XA 4AKHA 2H57A 2HYDA 1OT3A 2VP9A 5IK2A 3PUZA 4V03A 1KJZA 1XDBA 4NYMQ 3GJ0A 4RSGA 1Z06A 4CEJB 4ACAA 2RGNA 4PZZA 4XIGS 2AD5A 1P2TA 2BMEA 2NMVA 1E2KA 1JQLB 3EC1A 3N5CA 3ZD7A 2G6BA 3EG5A 1E4VA 1XTSA 5FOWA 2N1BA 3CPHA 1KIMA 1GSIA 1VYTA 1WF3A 3PEUA 2GXSA 2QQEA 2CLCX 3CRMA 1EG7A 4IFEA 2YV5A 1AKYA 3E1SA 3VKGA 3T12A 2ZRLA 4L5BA 1SVIA 2QTHA 1G7TA 3K9GA 4QJ4A 2W0SA 5JLJA 4PO8A 2RGXA 3BIFA 4GMXA 3ZS8A 2JLYA 5C2JB 2CNWA 2GAOA 3EIEA 3LQRA 1GNRA 2JJ1D 2GDJA 2B7BA 3A4LA 4A1FA 4B43A 1E9EA 2XTZA 3GEIA 1P9WA 3A58B 3CO5A 4GMDA 1GRNA 4RD0A 5EP1A 4M53A 1GG2A 4DSUA 3QNUA 4JT4A 3CF2A 1W4CA 4KU4A 3I61A 1E0KA 3KQKA 1QVRA 1JAHA 2ZJAA 2BBTA 2FH5B 2PLRA 3K0SA 4EJSA 1QHHB 2VSXA 1XXHE 4Z54A 4C4PA 3A37A 5DIFA 1UKEA 1E1QA 2XJ9A 3GD7A 2QTFA 1W36C 2ZE8A 4MKHA 3K0CC 4N0EA 2ZS7A 4A6PA 2B21A 2ODNA 2Q3HA 1HH4A 2WWXA 4O2RA 3RANA 2VQSA 3IKJA 4PPFA 5L3QA 5BN5A 1S9HA 3BRWD 1G4UR 1ZD1A 2ZRGA 3RS3A 2BC9A 5HZHA 2JLVA 1DG3A 1ZUHA 3C5HA 2BHRA 2FG5A 2GJKA 3IGFA 3MJHA 4LV8B 1Z6YA 3SYLA 1Z63A 1XX6A 2OAQ1 2Z83A 8OHMA 2GNOA 4TYWA 1W36D 3TSWA 4QBGB 3RS0A 5J47A 3VHLB 3QVUA 3LBHA 2ECKA 2GF9A 2OFWA 4I1SA 1K5DA 2OLJA 4AKGA 2IUTA 5EXXA 3O8DA 2J41A 2AK3A 1Z0KA 2OBMA 1IY1A 3PQCA 2B8TA 5JRZA 4EFLA 1NBMA 1WB9A 1EWQA 2ZTSA 2QPAA 3DM9B 3ZQJA 2IS4A 4IVRA 3IPYA 4N0DA 5JECA 1NY6A 3CZQA 1XZPA 3C7KA 4DEYA 2WV9A 3TKLA 3DKPA 1DO2A 1G3RA 2CJWA 2CBZA 3CH5A 4UNQA 5UKDA 4DLRA 2AX4A 4ZO4A 1CTQA 2DWOA 2ZAOA 5JWRA 2GTPA 1GL9B 1E79A 4F92B 1G6OA 3GLHE 4JLMA 3P20A 3CWQA 4C0BA 1FFHA 5L3RA 3LBIA 2G9NA 2ZREA 4B47A 5JEDA 1MO5A 421PA 4QBIA 2ODBA 2KWIA 2CXXA 4EPVA 4M9ZA 2I1QA 4E5UA 4E22A 4IOMA 1YJ5A 3ZYCA 1DTSA 4B3XA 4Q9KA 1OIWA 2O52A 1JPNA 1P73A 1H8HD 2VP2A 3B6EA 1KI7A 2V8OA 3LO5A 2QSYA 4FCVA 1X1SA 3E5HA 1K8RA 5FR1A 1G8YA 2ZRDA 1KDOA 2BJVA 1G5PA 2XJ4A 3QXCA 5CIWA 4A9AA 4BZPA 3LY5A 3SYNA 4QKQA 1XEWY 2XGJA 1JXOA 4Q48A 1N6PA 1YKSA 4XD7D 1NNEA 4BASA 2V54A 3HU2A 1AQYA 3ASZA 3U2QA 2VF7A 1XJCA 3BGWA 1YZLA 1XD8A 2F55A 3W8NA 5EE1A 4DIDA 4US2R 1KDTA 4I1UA 2P5TB 1NJGA 4P31A 4V0MA 2QP3A 4A0FA 3MLEA 3RWOA 4LJ8A 3EW9A 2IWRA 3KKNA 2R6CA 2WJVA 3T35A 1U0JA 4M0LA 4BFXA 1N25A 2ZM5A 4BRWA 4JSTA 4NCKA 3D6TB 4RZ3A 1UEIA 2FPMA 1WCV1 1NN3A 1ZP6A 4TTPA 3ICQB 5EZ6B 4A0GA 5JJKA 1NLYA 5D3QA 1E2QA 3GFOA 1Q20A 2OHFA 4IKEA 4LDJA 4FMDB 4OYHA 1OSNA 4KV9A 3TBKA 4PZYA 4RFVA 1P9RA 4CT4B 2N46A 4Q4JA 1KI8A 2VTKA 4M1OA 1LW7A 1Q3HA 3DL0A 4GOKA 4H1UA 2NO7A 5EZ5A 3U3MA 1FW6A 3FMIA 2WWIA 4IDNA 1U0HC 4PFSA 1IOZA 1ZM7A 5KUTA 4MDEA 3MAAC 3QY0A 4CRWB 3OIWA 1KI6A 2JJ8A 1W4AA 1TQDA 1YRAA 4O25A 4ZCIA 3O8RA 3CBQA 3IBYA 3K70C 3SN6A 4NCJA 4ZI3A 2DHRA 2GVZC 1VKJA 3A1SA 1Q21A 2A78A 2F43B 2A5JA 5EE3A 2ZQ5A 2Q21A 1XD2B 3RSLA 1NG1A 2JLXA 4D80A 2I3BA 1U81A 3BERA 4NYJR 2IW3A 4AURA 4G0NA 4L9WA 4A2WA 2V9PA 2OXRA 2CCJA 3FDIA 2JA1A 2PZFA 4C0SA 2PX3A 2WWFA 2QSZA 1U9IC 3VFDA 1EFRA 1OKKD 3QVVA 1IN5A 3UATA 3U61B 4HB0A 1NP6A 1ZVQA 2FZLA 1MRNA 4BECA 3K70D 4TN1A 4JL8A 3GLIB 2RH5A 3WP1B 1L7VC 2H17A 2WMOB 3GJ4A 5CITA 4PPNA 1K6MA 4LJAA 4XH9B 2VIIA 2GXUA 2UZ3A 2V6IA 4CEJA 4DLTA 2FOLA 3TMKA 3RVBA 1N6RA 3H2YA 4LZZA 4GSYA 1AK2A 1AM4D 3IDQA 1E1RA 3SS8A 2RHDA 4C0QC 1TMKA 2VH5R 4B6EA 1AQUA 2F1RA 2PX0A 2AKAB 1AS0A 4C0HA 1DAMA 3K0FB 1OIVA 1T0JB 3X1ZA 4FXPA 2CCGA 2WPDD 3AF4A 2IYVA 2O0KA 4P33A 3OFNA 1BYUA 2EFEB 2GRJA 5CIQA 5KDDA 2GKSA 4CT5A 4C0KA 2C95A 1NL3A 4DSTA 2V1UA 1SXJC 1GKIA 3WP0A 1ZAKA 5DE3A 2W83A 1J7KA 1TQ2A 1UKVY 5G53C 3REFA 4B2PA 1WBBA 1TAGA 5CM8B 2RHMA 1DG1G 1M8PA 2XITA 2AWOA 3C15C 3H0KA 4EPXA 4Q9JA 1U2RA 4Z1MD 5FL7A 2OE2A 4DLYA 3WMEA 1ZU5A 2E9SA 1M2OB 1QHHA 4NCNA 3T5GA 3JVVA 3C4JA 5DSZA 4URYR 4OI2A 4UNRA 1Z2AA 5KYKA 4OI0A 5DHAA 2REXB 3OE7D 1SXJD 3GFPA 1SVMA 5CB6A 4KLZA 4TLEA 2ZUCA 2JCSA 4JLNA 4V0NA 3RC3A 2Q9BA 4Z8XA 2X19A 4URVR 3BC1A 4EPTA 3FPAA 1NG9A 4PC1A 4IDQA 3DEFA 4G5QA 2X2FA 2ZVQX 4TL7A 2C5LA 4CF7A 2MMGA 2R6AA 2EQBA 2KB0A 1OB5A 3FYHA 2HLDA 2JASA 3Q7QA 1BMFD 5TMPA 1CEEA 2HCJB 3N2EA 1YR7A 1R5BA 4MRVA 1KSGA 4I81A 4NMMA 1CR2A 2F1HA 1BYIA 1FTNA 3AUXA 4A36A 1NVUQ 2YJTD 3SHFA 3AVYA 1N5LA 4PAOA 5FTJA 4G5OA 1HE8B 4RKFA 5JBQA 3GLFA 4B2LA 3E2IA 4DDUA 2UVQA 4RZXA 4B33A 4PQFA 4M21A 2P65A 5AUNB 1N6NA 4D4JA 3DMNA 5EUMA 5TXGA 1W44A 1G21E 2I4IA 3SU8A 4MYUA 5TY0A 3AB3A 1Q1ZA 1OXVA 3OIUA 3OEHD 2AHOA 5JRJA 3D8BA 3A1WA 2O5VA 2OM2A 2ZI6A 3BAFA 1OB2A 2PMKA 2PL3A 1DS6A 4U5XA 1TTTA 1HQCA 4MGZR 3GJ5A 4PHGA 1OLOA 4U02A 5E7JA 1HY3A 3BWDD 4LYAA 3ADCA 4TLBA 3GCGA 3GJ7A 4Q9IA 4URXR 2XOKD 3TSOA 3NTUA 3K9NA 4GI7A 2Q6TA 4XWAA 2GHIA 2EFDB 1RC8A 2QI9C 3PEWA 4V0OA 2J1LA 3U6BA 2GCNA 2PZEA 1D5CA 1JR3E 5EP3A 4BFTA 2VHTA 1R4AA 1F5NA 4JL5A 2KBEA 1XMJA 3G82C 4KAXA 1OHHD 5BYJA 2YINC 4LK2A 4RD3A 1FQJA 4CEIB 5J4LA 4Q9LA 1KHTA 1E2EA 2HUPA 5FI0B 1E9RA 1CJTC 4X8LA 4YLGA 2ZSDA 2GEDA 2J45A 1QHXA 2ZUDA 3Q8XB 4LHZA 1ZBDA 4LBYA 3QJYA 2WHXA 1D2MA 1EWRA 2VPPA 4FD2A 1L4YA 3FHTA 5J4VA 3L0IB 3QPWA 5CJPA 5C46F 4HSEA 4MA4A 2WICA 1KI4A 4QGAA 3TLXA 4Q7JB 2OLKA 3ZIAD 2GBLA 1Q44A 4Q4HB 1FTSA 3KKOA 3REGA 4P4UA 4FW9A 5E4FA 1FNNA 1J90A 1VTKA 2VLIA 3X1DA 1G18A 4B75A 1N5IA 2OCYC 3H84A 1CJVC 3UG7A 2NG1A 2FSIA 1KK1A 3UXMA 4NKRA 3I5YA 2BEJA 3QEOA 1UBCA 4R98A 1VG1A 4PR0A 3FMPB 1J8MF 3H1TA 3LFUA 1Z0DA 2WKQA 1ZU4A 3MG9A 4DLUA 4FMCB 4NYJQ 1T3LA 4HZUB 1CIPA 3CX7A 1LS1A 1RKBA 3A1VA 3T1VA 1ZM9A 2HT1A 4AKIA 4OHZA 1FL9A 3W5JA 3MJRA 1ETUA 2CLDX 3BB3A 4UJ5A 4A8JC 1QG4A 2QZ4A 3PUYA 2XSZA 5TB5A 2ZS8A 3ZS9A 3U3KA 4JLBA 2QT0A 4JBYA 5F2EA 4TYNA 4OQLA 1FNMA 1CBUA 2AR7A 4DLWA 4N1AA 1KKLA 4G5RA 1E9AA 1W1WA 2WKPA 2REBA 3THYB 2GILA 4LHVA 1O3YA 3TAUA 1UFQA 1HTWA 3HDTA 2N42A 3B1XA 1XPRA 3SE0A 4Q19A 1UKYA 3CUEF 4XOIA 2PEZA 4ESVA 4B32A 4TTRA 4ASUA 4MITA 2ZRAA 2ZR0A 3CLVA 2ZYUX 3KFXA 1JECA 1MO6A 4URZR 1BKDR 1XJQA 2DB3A 4DDTA 2TMKA 3KXKA 1XD2A 3T1QA 3W90A 1X8LA 1P75A 5H70A 4OI4A 2D7CA 1SXJE 3BD9A 1ZYUA 1T5LA 1VECA 4XSHA 4JBXA 3QXXA 4C0JA 5F9FA 3I32A 1VCMA 621PA 1EGAA 4LJ9A 2O0JA 5EP2A 2VSFA 4TWZA 2R6FA 4WAUA 4W7SA 3GLIA 1T3SA 2ZJYA 3EAQA 4DLSA 5JJLA 1N0UA 4B34A 1Z6XA 4B76A 3B2EA 5A4JA 2XZPA 4US1R 4AK9A 2ATXA 3K09A 3L82B 4EAQA 1OFUX 3A36A 3AVWA 4XWKA 1T6NA 4OK3A 2ZPTX 3ZJYA 1PUJA 3UPUA 4XJXA 2R6GA 3OIVA 4TMXA 3VR1A 2V7QA 2ORVA 1OE0A 2O8CB 4A2QA 4QNMA 3LA6A 4KI0A 2IS2A 3P1JA 2SHKA 2WIBA 3MUFA 4BRUA 1ZNWA 2G0TA 2EYQA 1NBMD 2IYYA 4BEBA 1CF4A 3LXRA 4Q1BA 3K0FA 2J7PD 1MR3F 2OCPA 1J70A 3W6OA 3EPHA 2OBNA 2A5GA 5A5GA 3CONA 1NKSA 3GQBA 4FIDA 3FFAA 3AUYA 2A5FA 4QGGA 5HE8A 1M1YE 3QE0A 3PV0A 3NC1C 4TLAA 4NDZA 4ZKEA 3U6KA 2P6NA 3WBKA 5C4GB 5E95A 5EE9A 5AJYA 4QJ3A 4JLDA 2LCFA 1MT0A 4B73A 2E87A 4Z51A 1W0KA 1Q1QA 4F4CA 2CEAA 1HYQA 4QGHA 4JKYA 5L3VA 3F5FA 1DADA 2DYKA 3C41J 2YVUA 3FHCB 3Q72A 1WBDA 4Q02A 1R0ZA 3LX5A 2VYFA 4OK6A 1L4UA 4BLTA 3KKPA 1BO6A 3KUCA 1YRBA 1SVLA 2DCUA 2X8AA 4BLPA 1ONBA 3SZRA 4IVQA 1AA9A 3GLHB 5F98A 3NG1A 1DE0A 4R7ZA 3MWJA 1A82A 2AFHE 2GZHA 2NO6A 1COWA 1X3SA 2Z4RA 2D62A 2W6JA 3W8RA 4DSNA 1NLZA 4OL0A 2IUUA 1DAEA 1KO5A 4LCBA 5J40A 1N0VC 4LPSA 1E96A 4AI6A 4K8OA 5G3YA 5ELXA 1P72A 1KI6B 5D3MB 4YMUA 4WOPA 4W5JA 1YR9A 4PSVA 3BB1A 1U90A 2J0QA 3AGQA 5CLLA 3TW8B 2EVWX 5GVRA 1P6XA 1HURA 2L0XA 3CPJB 4M9SA 1S96A 2OBLA 4BWYA 4GZLA 4X8OA 5B57C 3QEJA 2WJYA 2Z5FA 2IUSA 3ETLA 2ZYWX 3TNFA 5BN4A 4WVFA 4JSYA 4MKIA 2PH1A 4KYIB 2OV2A 2OO7A 1KSJA 2GA8A 4RJLA 4F38A 1P2VA 4BPBA 4AIIA 2J59A 4WIAA 4QHTA 3HU1A 4DCSA 3ZQ6A 2HV8A 2RB4A 1N0WA 3BE4A 3SOPA 3QBTA 1R2QA 3CR8A 4JJZA 4PTLA 3TQFA 1W4RA 2QGNA 2ZE5A 3NEJA 3UK6A 1W0JA
chains in the Genus database with same CATH superfamily
3JQ6A 3D0QA 4D2IA 3CLSD 2XZOA 2O2CA 3IXMA 3L0DA 3IDFA 3SBXA 4GOXA 4L6IA 1SOAA 2IT1A 4RGBA 3LT2A 3TQHA 2V97A 5K8UA 2DM6A 1QOQB 4LVOA 4MLPA 4CR6A 3AP3A 3VMFA 3H4VA 1R27A 4R9RA 5FAXA 1ZOSA 3W2GA 4DJFC 2HRRA 5AUPB 1E3WA 1DJQA 2R86A 1R50A 3HRIA 2MYNA 3ZDDA 2HMVA 4PFJA 1RLMA 1R8SA 1WPQA 4D3XA 1ULAA 4G4JA 2VS1A 4X8MA 2E4ZA 4CN9A 1G3MA 3NEYA 2WWYA 3TJRA 4C14A 3AEQA 3S99A 3TUJC 3UWPA 1DKOA 2J30A 3UF0A 2B1QA 5HM6A 1JAIA 4U4AA 3GG2A 5EXDA 1B00A 3WLHA 1FB5A 2X7HA 3EZGA 1MCZA 2PD3A 2OZPA 2Q5LA 3O8NA 2XMDA 3Q9SA 1N6HA 4XYEA 3F78A 2EL7A 1BS9A 2EXXA 1NX6A 2XQVA 3F2VA 4LBVA 1PHRA 5FADA 1SB9A 2XE6A 5H81A 2QGZA 4X24A 3TEMA 4O3MA 1E2GA 1WUHS 2PT6A 2QB5A 2IJGX 1P45A 3OETA 3QUQA 3GLUA 5IX8A 2WU0A 1X7WA 2HSEA 2IF0A 5EHNA 3GDWA 1EGHA 2VYNA 4MCIA 5SZHB 3CNOA 3PTAA 3KSBC 1XCPA 2YHAA 1JZQA 1RMYA 5DU2A 3OZGA 2P9CA 3IEIA 3ESRA 1J09A 3IVAA 4LOJA 1G98A 3G2QA 4BVEA 4EI2A 5TF0A 1IM8A 1XPUA 1Y34E 2Q5OA 2XXBA 5IAEA 2W90A 2CJXA 2KMLA 4G8DA 2R5NA 3F8WA 1XTUA 3SVTA 1QO9A 4FKZA 3TTYA 2JZNA 3UV7A 4MKRA 2AF3C 2R1ZA 1DX6A 1GKYA 1XZ8A 3BWBA 2WFAA 3KB2A 5A9SA 5AW3A 4JJ6A 3HTXA 4NCXA 3RRMA 3AFMA 3WGJA 1VLMA 3JQRA 3MCVA 1NYRA 4NICA 1TM1E 4OXRA 3ONWA 1QF9A 1VL5A 5L53A 2O8BB 3AY3A 3B9PA 5HZKA 4F5ZA 3ZDQA 2EJTA 5LYJF 1YCGA 2P4EA 3CSUA 4YONB 3GK3A 3S5UA 4HZUA 3GJXC 3ULKA 1H65A 5FYQA 2D4AA 3DHYA 4EITA 5FBVB 1L8OA 1UXIA 1WR8A 2G5CA 4OQ4A 4M83A 4NEHB 4V0LA 4YMIA 4DA0A 4J6EA 2ADMA 1UQUA 4HQ6A 3M3PA 1ZK3A 3GCDA 4R3NA 2BH2A 3HDJA 3KLMX 4MWZA 4RJKA 1YFKA 1EK6A 2FGKA 1ILWA 1T9AA 2G3YA 3FSRA 3NNNA 5ELMA 5F2OA 4BN5A 3I42A 3ZH9B 4CI9A 5HKOA 4YY3B 4RHXA 1G6HA 4NU0A 1ULSA 3GLFB 1F6DA 3H3XA 3NBQA 4M0MA 4HTFA 1Q1EA 4KQIA 2HJRA 4KLAA 3THYA 4RHFA 1W46A 1ITZA 3IJRA 2JHAA 3EXEB 3SJ7A 3ZWVA 3UWSA 5C52B 3TLCA 2HBZA 4NAUA 3VH3A 3RVSA 1XAGA 2CL7X 5G1NA 1LV8A 1XZFA 3BXFA 4Z4HA 4YVFA 3RBAA 2JLXA 3OQOA 1P77A 3AINA 3BGSA 1U99A 3NTOA 3WHLA 4AX8A 2LKDA 1UOOA 2XE4A 3D8SA 4Y6PA 4ILKA 2ECPA 2H3HA 1PT8A 4ZCSA 4D8UA 2UZ4A 1XVAA 3RABA 1Z8DA 1G8JA 1NVVR 2A9QA 2B6NA 3SKYA 5BP7A 4UARA 5I4KA 4IIYA 4GM4A 3KYCB 1UBEA 1PDVA 2QPOA 2JIRA 3PGJA 3TH5A 1U3WA 4MAFA 3TSAA 1OIXA 1X9GA 2FN4A 3IALA 4R2HA 4RIIA 4XM1A 3VUFA 5CX1B 1R6UA 1TVMA 2PKXA 4WXMA 4WHMA 2O50A 1OH8A 2COKA 5ETJA 1Z34A 2C99A 3ZGLA 2VJAA 3SCZA 2NQ2C 1XTZA 2DVMA 1AO3A 1GPDG 1RBQA 2OSVA 2P3LA 4V0KA 2ZEJA 1QJCA 2EWWA 2I8AA 4F96A 2I71A 1UM9A 1GTVA 4IHQA 4JJ4A 4R1NA 5LQAA 3N8GA 1KBZA 3KLOA 3UWOA 4K9PA 5AP9A 1I2CA 1PYGA 4WNAA 3R9IA 4K6MA 1LZLA 1YHYA 4CEHB 5TR9A 1Z6TA 3LVBA 3AHDA 4TWBA 5AKJA 1N8SA 5KDLA 1RFLA 3GP5A 3SXUA 3QVTA 1QLWA 2R8BA 3LWDA 3PPYA 2F1JA 3Q7PA 1EP1B 1UINA 5ALMA 4X00A 3IPRA 4NE7A 4YUAA 3KWMA 5F23A 4TVOA 1GTJ1 4WBNF 4D42A 1U5CA 4IJKA 2JLCA 4FYIA 4EHJA 3E9EA 2IEIA 3FKSA 4NX2A 5B3AA 2WF5A 5E2BA 3IOMA 3M33A 3QG5A 3QWFA 1VLJA 3PR2B 4CUKA 5KWEA 1E8DA 1QV6A 3L3BA 4KGXA 4NG5A 5EAIA 1ZH0A 2WKRA 2NTEA 1X94A 2ORYA 4IJMA 4Q01A 1E2PA 1EM8A 3RLIA 1KERA 2V5UA 1XAHA 3A0RB 2Y77A 1UMBA 3R5HA 1T9HA 4LWPA 5D8DA 4I4CA 1ZR4A 1RXWA 1QKIA 3BXPA 5BR1A 3ENKA 1GLNA 1O6GA 3CEHA 1QO7A 3DCIA 3I2FA 4JXZA 1NNUA 1OF1A 2QSUA 2JLSA 3W6NA 1CF2O 3AIOA 4JC8A 1Z0AA 4LX0A 5BO5A 3OHMA 5E7IA 1KYQA 3GRUA 2IGBA 5FXMA 2NU8B 3C3KA 3JD2A 2ODPA 1YS9A 5KCMA 3CUYA 3ITEA 1QZTA 2XGGA 2C96A 1EZZA 4NBVA 1CIJA 1TEXA 2X7JA 1MF7A 3CNEA 2BI8A 3ND7A 4OLAA 4Y2VA 4NXNB 4LHSA 4LKOA 4A0RA 1F1BA 2VT6A 1PI3A 1JKFA 3F1LA 2IYNA 3B36A 5CVUA 3RS4A 3S8MA 1CRWG 3ZY2A 5TV2A 3KT6A 1NULA 1PF7E 5CFNA 1BTOA 3U4GA 4M9UA 3PJGA 4HVAA 2WKSA 1C8LA 1C1DB 1FQKA 2Q50A 4HT3B 5TIIA 1LW6E 3KP1A 1UC9A 4UUAA 5F7JA 4AMUA 4BY9E 4MUJA 1E2HA 3IBSA 1XV5A 2JD1A 1Y1PA 1O96A 3PF8A 2WWWA 1UZMA 4PCLA 3GA7A 3R2JA 4I4TB 3KOYA 4JT9A 3E9QA 1FVOA 1MENA 4UMVA 3B78A 2C7RA 1ZRSA 4NP6A 2BBWA 3GT0A 1OQAA 3Q3VA 3LW8A 1JT9A 3R3JA 4GT1A 1I36A 4S05A 3O26A 1NPYA 3C8ZA 1NXOA 4Q7KA 5HILA 3TW8A 1KO7A 1KY2A 1TTQB 2WIAA 5CDUA 5JAOA 2UXCB 1D1TA 1QYCA 3BJEA 3GRFA 5BMVF 4JXXA 1T24A 1UBLS 5T4HA 2XRZA 1P8JA 2VEOA 3ETJA 1Z2NX 1CULC 1YXMA 4KVZA 3IEUA 3OJEA 2CUZA 5LL6P 4IJ5A 1DDIA 4BRZA 3N28A 3DYIA 4TTQA 2Z6QA 3QKIA 3SZ3A 1E98A 3GLGE 2E0IA 1V1RB 5LCXA 3T9BA 1FFXB 4RVCA 1PWHA 3H5AA 3REOA 1O87A 3BSYA 1OH7A 2Z30A 2F17A 3C87A 4YCNA 3UM9A 2DH6A 1VJ0A 1HDOA 1PK7A 3CZCA 4J07A 5DSXA 5T57A 5BY2A 1TYCA 1Q3TA 2VAVA 5F5LA 2HWXA 2VTDA 4JB2A 4GLOA 3EUEA 2X2EA 3SC3A 2XTNA 5JYBA 2RHOA 3B52X 4EK9A 5IHPA 2Q6KA 5E4JA 4I2VA 5JSZA 1LDEA 2A9PA 1EX6A 4M76B 4QXQA 4ZMRA 3WFZA 2F8TA 1YB7A 4HJRA 3SICE 1OXTA 4W5WA 2VDUE 1KMCA 1CB7A 1VHDA 1QHNA 4A7PA 3W34A 4FYVA 2JJ1A 5J5VA 3ZNNA 1WL8A 2YASA 3QKUA 3DKKA 2BELA 1HA3A 3TGLA 1VOTA 1DTWA 1M5RA 2HMTA 2VVTA 4D6PA 1ZJJA 5HUJA 3FA2A 2RMKA 3NBKA 4HQOA 4XCXA 5A6VA 4UNIA 1D2EA 1BQEA 4DHEA 2GZAA 1EFTA 3DOFA 3TR5A 2FFJA 4JB0A 2Z56A 3DVLA 4RHCA 4YAFA 4TT3D 4UOQA 4HHEA 3OMXA 1A8QA 2AJBA 1Z5ZA 2FZGA 1OGYA 1YZTA 2FE4A 3DR3A 3IAS6 1PVDA 4IXTA 4MV5A 3UW1A 1MC1A 3FCAA 1RHQA 1JJVA 1RR6A 1YZKA 3D8NA 4ZXFA 4JC0A 3UOAB 4LYHA 2XDQA 4CV3A 1YDEA 4N0PA 1ZW6A 2GZDA 1VJDA 5CJ2A 1CNMA 1SKMA 4MVJH 1SUEA 2WD7A 3MERA 3P9KA 1DQZA 4IR7A 2OQ2A 4ALIA 4FP9A 3C1OA 1JDZA 1UM8A 3OX1A 3R3XA 3W5VA 1DWOA 2XKJE 4O2BF 5EC8A 3C3YA 4J90A 1KAHA 1LPNA 3SQLA 2L42A 3VH4A 3OCUA 4IIGA 3KYDB 1UEJA 4QFBA 1G8KA 1SG6A 3N2IA 4WUVA 2GF0A 4DCUA 1PJ4A 2H63A 2FMKA 5AKYA 2Y93A 4QTXA 2Z3WA 1P4AA 4ND8A 3D3EA 4UMDA 4YWJA 3B82A 3RASA 3WB2A 1WPGA 3PHCA 3OPYB 4M6WA 1MW8X 2EX1A 2ORWA 1BW9B 1T2NA 4LXGA 4LZAA 2CDRA 2AX3A 2P7IA 1E7SA 3CUWA 1LV7A 5GM2A 2K7ZA 3GAFA 1G8MA 3OMWA 2OVBA 5F1KA 4QOGA 3USES 4CM4A 3BHNA 1QNLA 1KETA 5FL3A 3PE4A 4B09A 3FCYA 4HBGA 4QDOA 1MB2A 4YPOA 4HNAA 3LQQA 3R3VA 5E7QA 2G5GX 3A1UA 3ZZMA 2YWBA 5LPNA 3CZMA 4NENA 3REQB 4FILA 3AERB 4YHHB 2WYIA 1I5OA 4RLSA 3M5WA 3KHSA 1JPUA 1AN0A 1HQKA 4EFNA 3LGXA 5REQA 1GADO 5AM2A 1P2SA 2BM0A 2GN2A 3AG5A 3GGDA 3LCCA 1FRVA 3TECE 1JLMA 1I0LA 4D0LB 2ADOA 5KQMA 1LPMA 3GV0A 1M54A 4BQPA 5I9LA 5IUKC 3EPPA 2VUTA 4MGEA 4MUFA 3SC2B 1AXRA 4EAAA 2DERA 2CK3D 1YONA 2J9XB 2PT7A 4QA9A 1YJAA 1R15A 3AKYA 3GMIA 3L92A 3M82A 2VZ0A 1Z35A 4O5AA 2FQWA 1UKZA 3ELYA 1CWUA 1EVIA 1JZTA 1K8QA 2I2DA 1R0YA 3NCHA 4M1SA 4OV6B 3TE6A 4PX3A 3ZR4B 3A8TA 3NVKI 1HT2E 4A1OA 1Z2DA 1RJFA 3HFRA 3G7SA 4IH9A 1MIOB 1MPXA 3UO8B 1TT5A 2ZIEA 3AFIA 1NIJA 1JJIA 2C2GA 3TKYA 4KJZA 2QD4A 4TROA 5KKCA 2IGTA 4EWLA 2CL0X 3SJZA 4XUEA 1Y6RA 4Z7JA 4OXQA 1OTHA 1W1UA 3AF3A 2IYWA 4PG4A 1N6LA 3ZJUA 4YMGA 4LE0A 3CINA 3VTZA 1AGRA 4FYWA 3UW3A 1ZC3A 1JXMA 2PS3A 5FO1A 3DWIA 1Y4AE 2O2YA 2FSVA 5JXJA 3JQ7A 4RJJA 3LWNA 5FOQA 3B1YA 4RCZA 2LE0A 3RUDA 2IIBA 1P1CA 1ORVA 4M36A 4K9KA 1DJPA 3KL2A 2VSOA 4J16A 4JITA 3EWAA 4KFRA 1OI3A 1FUEA 4OJKA 3SF8A 4D9EA 4IDDA 4JB3A 1WUIS 2NXNA 3D3QA 3KQOA 3GUVA 3NBUA 3ECAA 3P96A 4FGZA 4RMNA 2QYOA 3P9PA 3C1TA 4RVDA 1CUUA 1Q16A 2J5KA 3ND9A 3BBPA 2AG6A 4RD6A 3NHAA 3ZDYB 3Q0EA 1UPCA 1RM3A 3CVUA 1T35A 2E4XA 2MYPA 4HRAA 4NK5A 3W04A 4KQJA 4EG0A 4EHBA 1CHDA 4LV5B 4DR2B 1XHEA 1Z4QA 2H5EA 2V59A 2X0KA 3GJZA 4N5IX 1ZIYA 2FEMA 3FTQA 4FFOA 1TX4B 4HYEA 4KXXA 4F12A 3PNMA 3I30X 3OCCA 3O1LA 4DXAA 4BNNA 1T0BA 3NIBA 1ZCJA 3TM4A 5I01A 1U0BB 1JX6A 4WJKB 3DDCA 4QREA 2OZLB 3OZXA 3R09A 3MTQA 5B4VA 1H0SA 2BFBA 5F52A 3FNFA 3B8EA 3FNBA 3IQWA 4L8WB 1Z26A 3DW1X 4ITRC 5EWJA 2H1RA 2IPLA 3H1EA 1YC5A 3JYPA 2H9YA 4ZQHA 4LK3A 4PVDA 2OCLA 1EVLA 4BO8A 2WZQA 1R9MA 5EIHA 2C03A 3WB9A 4CM8A 5CDSA 3K5PA 5FUQA 1R66A 5CHEA 4E5SA 4Z99A 1CFJA 3DTVA 3D7RA 5F1PA 1N6IA 3N0VA 5F78A 1Z0ZA 3ZI0A 2NU9B 4G3XA 1QB7A 1E1MA 2WSIA 3KVRA 1ECGA 5LQMA 4HEA6 2GN1A 3RF6A 3S2SA 1N36B 3BTUA 4WCVA 3IODA 1BE8A 1T9GR 1TQ4A 2H1WA 4ZAWA 4BMSA 5CFOA 3ZWBA 3ETNA 2HDNB 2DEUA 4UVDA 5DI3A 3M6IA 3STHA 2CNWD 5EJ6A 4ZT4A 3TRHA 3CWZA 2GWHA 1E69A 1X80B 3UUEA 3CKLA 3ZXIA 5L4SA 4E94A 3V4FA 4RKWA 4Z49A 4LF4B 1Z18A 1KI2A 4CV0A 1PS0A 2DT5A 1QFZA 3CISA 4JLKA 1IM2A 1JG4A 1M7GA 3B5IA 1YBMA 3G85A 4HN9A 2JK0A 1G41A 3FSGA 3O84A 3QPUA 1ENZA 2WM8A 3NM6B 2OQVA 2WK1A 4MROA 4J1QA 2FQXA 1PQPA 1LSOA 4G1VA 3G5MA 4B6RA 1W49A 1FFGA 2NNWB 5EIAA 5H02A 1EB8A 4EPRA 1C3XA 3GH3A 2YFKA 3ICCA 3M1IA 3PGKA 4GI1A 1CEQA 4TUYA 4CNBA 4F5EA 5CEJA 3SQMA 4F56A 4U8HA 1E63A 3GJQA 4IDOA 4F4UA 1DUIA 2A59A 2BPOA 2QG4A 4E4TA 3NDIA 1L5WA 4RJTA 3KQNA 3UB3A 2RGWA 4F4DA 5MF6A 4JC5A 3ZE9A 2QVBA 4MS3A 4R2IA 5DK6A 4QZVA 1XMVA 4BB5A 4U5QA 4MWGA 2OK8A 3QXSA 4FNOA 1FMCA 1XLWA 1OI7A 1LRKA 1H0HA 1BXZA 1ZMBA 1GUDA 4CLRA 1PS8A 3KQUA 1LLDA 1TAHA 3SS9X 3RNLA 4PZ9A 4Z6KA 3WKDA 4EUEA 4GZ3A 5JYEA 2NADA 1OXSC 4EY5A 5KYNA 4YACA 4P32A 3N8IA 4TRJA 1WDLA 1OAOC 5DTIA 3WOVA 2BV3A 3MD0A 1NURA 3ESAA 3HL0A 2WPDA 1B0ZA 3KJXA 4I36A 4AP6A 5IN5A 1I9CA 1RIIA 1BNCA 2V7PA 4HXEB 4EFDA 1SCUB 1IUPA 3HDHA 2WNSA 5K3BA 5CX4A 4HGQA 3RLFA 5AUOB 2XXAA 5HFJA 5TS3A 3PLRA 1A71A 1JQJC 4RKYA 1YNOA 5FOTA 3S2EA 3KSRA 1RXVA 4WX2B 1E2BA 1NRWA 3L18A 3OZBA 3Q4GA 1BA3A 1ODIA 5ERXA 5JZSA 2BR4A 4RO0A 4NIMA 1CDOA 3EDYA 2PFGA 3J7TA 7AT1A 4R51A 1HDYA 1NUSA 3A6LA 3BG5A 2HO4A 1QWOA 3H99A 4TLLB 5CU7A 4B71A 2EL9A 2PCJA 2V98A 3CGWA 2GPBA 1II0A 3KXLA 2PH7A 3NR2A 3G8CA 2WP0A 4C4OA 1NAHA 3QF4B 3EOAI 4E5KA 3AFHA 3U09A 4M9XA 2IPMA 2P9TA 5H4GA 2I2WA 4ZV4A 4C05A 4HRYA 3R5JA 4KE6A 3S55A 4QGBA 2X76A 3BKXA 1YZUA 2ZANA 3EZYA 2WBLC 4D9KA 4DF3A 5KQSA 3IIJA 4JYCA 2PR2A 2PTHA 4HAVA 1CF9A 1FIUA 3S68A 1E79D 3TZHA 3B1KA 4UXJA 4GBJA 2HJVA 4LDAA 1ZD9A 5DNWA 4TM7A 3UB4A 3EXG1 2GO1A 1S1MA 2MR6A 3O95A 4GWGA 4QUKA 3TOXA 1TAQA 3N53A 3NKVA 3Q98A 3QITA 1B93A 2ZT7A 4PLFA 3LTNC 1KAMA 4II7A 4UHHA 3HJRA 4NI5A 1OJLA 2PLWA 2ACKA 3TLAA 4XYBA 5TMDA 3HP4A 2B35A 2DBQA 1NF9A 1ZIPA 3IQEA 4FI3C 2AYYA 4WD3A 3ZD6A 13PKA 2V4MA 5K01A 4AQDA 5KPDA 2PZMA 3F3YA 3DQQA 3K8QA 2BEWB 4B48A 1TGVA 4EQ6A 4RHTA 5FUWA 4L8GA 1U5BA 4MJ3A 4YJ3B 1CYEA 3KG2A 3Q9LA 1DJNA 4WINA 2NPIA 4X93A 1I2DA 4LJ7A 4YCJA 2X0RA 2BFNA 4GDFA 1X7YB 3PX3A 4LRQA 5GIOE 3J81k 1QTRA 1RYDA 4NEQA 2XB8A 2V6GA 4GPBA 1BRTA 1GGNA 4ZVPA 4IDAA 4N5NA 4KVFA 4PAQA 1UBTS 2BF4A 2EJWA 1T4GA 1WZIA 3KAKA 3KJHA 3JALA 3NHPA 3QA3E 1XNGA 1EUYA 3GNTA 2YV1A 5IW8A 4B83A 3S28A 3AEKA 4PSAA 1F4LA 2AFIE 1CS4C 3KLPX 5ICFA 4FN4A 5LYJA 5U4QA 1M1YA 1JDSA 1P33A 3D3KA 2BFFB 2PWBA 2OBFA 3VR2A 2CNLA 4K9NA 3DPSA 4QXAA 3V1KA 1SUIA 1UXHA 1Z82A 1I2AA 1ZK0A 2FLWA 3T5MA 2C98A 1GUZA 2NZVG 4GPIB 4MI9A 4X6LA 3JWHA 5LA6B 3EDCA 3GLKA 5EQDA 1KE2A 4NVRA 1U7TA 1A8PA 2OG2A 2CW5A 1T0IA 2JAHA 1I24A 3CF0A 4JXKA 1N1MA 4A82A 3EN0A 2C3MA 5DP1A 3ZNOA 5B53A 1WM1A 1GA1A 2IZ6A 1S4QA 4IZIA 2QRKA 4OHYA 1PZMA 5JG7A 3UTCA 3WLOA 3AUJB 1DKNA 4DT1B 3J81A 1U0EA 2AS0A 4GOJA 5KDOA 1POWA 3QV2A 3COSA 4U2BA 2Y71A 3ICVA 3PGXA 3DE2X 1V9LA 3QU7A 4KIUA 3TI7A 1X7XA 2B4RO 2C54A 3IFSA 4LBWA 3RRZA 5CT9A 4HGOA 2XTAA 1F8GA 1JKIA 2JIDA 4RIFA 2VHVA 3SEFA 3GEHA 4ZZ3A 5JQGA 1PFGA 4TL9A 1LPOA 1OTXA 4DAOA 4RVSA 2VJYA 4IIVA 3AR3A 5A9RA 3JRXA 4KRGA 3WIEA 2XR1A 1LTKA 3OH8A 3ROZA 2FWPA 2R66A 3P7MA 4OBXA 3V4ZA 3L5KA 3GELA 4H08A 3PS9A 1IZ8A 1QHGA 4OI1A 3A4IA 4D0GA 5ESDA 1LWNA 5DDIP 1IPHA 3L7DA 2V6MA 1JFVA 4NATA 1F2TA 4KV7A 3VNUA 4FBLA 3WE7A 1MB0A 5AKGA 5FEMA 4Z4EA 1IXRC 4P38A 3QKSA 2GN0A 3PHIA 1QR2A 2PNJA 1OBCA 2QIOA 4JL6A 1RHJA 2R1VA 3TPCA 2C5HA 5IN4A 1QDEA 2YC4C 2B25A 1DOAA 1CUDA 3DBIA 1GKUB 1FP1D 3KPVA 5B7QA 1Z33A 1Z68A 2D74A 2QMZA 1YVPA 5HIAA 4B7AA 4K5QA 4IOJA 1WCYA 5KSPA 2DXIA 3DFMA 3H9QA 4G5FA 1GWNA 2R11A 2ZJ4A 1XEFA 3KX2A 4ZREA 2HB6A 4LZJA 4WBNA 1C3JA 4RPJA 4YEDA 1Q6YA 5HIMA 2H7VA 4F8JA 1SR8A 3PLAE 2B7LA 5EWLA 4FOTA 4PQEA 2D2VA 4D5EA 3R7NA 1U6IA 3QBEA 1KH3A 2BKEA 4JJGA 4HADA 1TQ6A 1TJPB 5JNLA 4N7BA 1BJTA 3T3HA 5FP0A 2O2DA 2P8JA 4JMLA 3VOBA 4UM5A 1S9DA 3O4RA 5KSZA 1UMDA 2FP4B 4FEAA 5LFAA 3FPJA 3BD6A 1J22A 1PJ8A 5LLSA 4M7WA 1F2UB 4ZIRB 4BN4A 1TKAA 1FRFS 3K9LA 1JKJA 1NP7A 3PGLA 4C3UA 1TB4A 1ZUWA 3BL8A 3UVEA 4XTCS 3AEYA 3BXOA 2JGNA 4JEIA 4LOKA 1FJHA 2BEVA 1B2RA 4GC5A 3JAWB 3OA2A 2GMWA 3USCS 3ABOB 1D3AA 3K3PA 4KLCA 1G9XA 4EZIA 2FU5C 2NUBA 4XUDA 5DM2A 1VG9B 4CM9A 1U8UA 2PZJA 3T4XA 1PJBA 2I4LA 1RLTA 5J5CA 3WSWA 1R1DA 3ISVA 1YIDA 4EGJA 2P3OA 2ORIA 4M87A 1WVIA 3H9UA 3FFWA 1RLUA 3A25A 4AY2A 3A4MA 3PNKA 3PYXA 3Q85A 1BOFA 2ZUSA 4OTZA 1V8BA 2P0EA 1UKAA 5LDHA 2MIIA 4ZZ1A 3HJHA 1FNBA 4S04A 4TXMA 5KB3A 5LNK6 1NVBA 5J2UB 1F4PA 4JI4B 5EJ2A 5BW8A 3NYQA 1PNOA 1Z29A 1DEAA 3OU2A 4HNGA 5YASA 1RYFA 2ZJ5A 3MB8A 4N8DA 4EG3A 3ET5A 2DFLA 4OG2A 3UV3A 4RW0A 2J9FA 1MQ9A 1WMBA 5G40A 1YDWA 3EH1A 4FFDA 2FA9A 3Q1KA 4BATA 5I4BA 1GTL1 2CMGA 1HE3A 1ONNA 2GHTA 4YDSA 5L3ZA 5A5DA 5CDGA 1QP8A 4AY3A 1QPGA 5BMVA 3EDQA 2YHIB 2J7PA 3R0IA 3PFHA 1DQSA 1RP7A 4QOHA 4TXNA 1BROA 4AWBA 1GAXA 4J0DA 3IR7A 4YRAA 1D9XA 1QMGA 2F8MA 1G2IA 2GEFA 4NY1A 2O8FB 1RQ7A 3FM9A 3VH1A 4DGSA 1N8TA 5HIIA 4MEAA 4WA8A 2H3EA 3ZHUA 1SZJG 2JCXA 1JHQA 2QSJA 1GYPA 1JALA 1NN0A 3GJTA 2K5UA 2WIGA 2WSBA 3QLUA 1CUSA 3UMRA 3NM4A 1XP5A 1PQYA 4QG7A 4YV2A 4HNTA 3U80A 4HDNB 3IL2A 1YASA 2M6LA 3SLGA 2GJ8A 1JEEA 3DTNA 3AMVA 1EGVB 1DXOA 1YVEI 3C3EA 2MINB 3BF7A 3Q3CA 4RQAA 2R1TA 5ERYA 5CLFA 4BQNA 2ZG6A 3KTAB 4HB2A 2VDOB 1PU2A 3VSEA 2AXPA 4GPZA 2EW2A 3OCYA 5IF3A 3NXSA 5B30A 2PYZA 2NSYA 3ZY4A 5G41A 3VZCA 4XYGA 3JQ8A 5AVJA 1OLSA 1SZCA 3EG9B 3VKVA 2QORA 2YHSA 2QENA 1UT5A 2O1WA 1M2GA 2G72A 4HDOB 4MB0A 1XRPA 4LJ6A 4M8NE 4J29A 2C31A 3K35A 1YU9A 2XNJA 3FMFA 2POCA 3A2NA 2VHQA 3EWNA 3OP1A 2RKWA 4PWYA 5JY1A 1T2AA 2NXJA 1A9XA 4L4SA 1Q15A 5C18A 2CFSA 3O8OA 2VXCA 2GBLC 2UV8A 3NDRA 3WNBA 1UMCA 3KV3O 2P4SA 5FA6A 2Q4BA 1Y3CE 4HI0E 3S1LA 2YWFA 1O7JA 2ZTHA 2YZMA 4BBPA 2IL1A 1W5SA 1ES9A 2Y1CA 4DKJA 3PDCA 1C3OB 3NGMA 3UICA 1F8FA 1LSUA 2VTBB 5JEEA 3DT8A 3FSEA 3UGJA 1XLVA 1E5XA 3O47A 1IEXA 1SQ6A 2WSLA 5BWMA 3IESA 5B2ZA 2CXHA 3ZU2A 1TIKA 4MYCA 4JOCA 2CYAA 4H60A 3WBJA 1F7UA 3A9WA 4JVMA 4BZXA 3D7NA 3ZYZA 4P0PB 2F4NA 3K6SB 3E7WA 1NBEA 2C42A 4MYHA 4O2BA 3TF5A 4R3UC 3M5CA 3G8AA 1GSAA 1C5KA 1E2MA 1E5TA 4MUXA 3IIKA 5K0LA 1GFIA 1X70A 1G8SA 1YMQA 2ZOSA 4H1TA 4DDWA 2QMOA 2R00C 1YDMA 2IYSA 2BSQA 4I55B 2V7EA 5P8WA 4C21A 1A9SA 2BFEA 3G2IA 3DSRA 4TKUB 4XDGA 4RENA 1P19A 1B41A 3CZPA 3QSGA 1SXHA 4Q24A 2OILA 4MDEA 2NAPA 4S3MA 1I10A 2VXYA 5K3OA 2XD9A 2OZVA 2VNKA 2IC5A 1T2UA 3PSAA 3ENNA 5AJXA 3V7YA 1TT7A 2OAP1 3DVAB 1BKYA 5JMTA 4JI7B 3DE3X 2DETA 4R1TA 4DRZA 3H5IA 4FR2A 1Z39A 2HT6A 1W2HA 5IYZF 4CIXA 2D2EA 1V1JA 1D9ZA 2RBEA 4YUVA 2FPOA 2W2KB 3K4QA 4OKSA 3UKDA 4A27A 4D96A 4WZAE 5GIPE 1KK2A 1M8KA 4ZANA 3DAFA 4NOKA 2O07A 4EEKA 1JNYA 3PR1A 2HFJA 2ZSAA 4NBNA 1NVWQ 4EHFA 4EB0A 1DZIA 1Y82A 3IPXA 3K73O 3Q5DA 121PA 3JAKB 1E4EB 2PMWB 4AP9A 4ERNA 3MWEB 3O4IA 4EKGA 1YCDA 3ITDA 3BCUA 3SYKA 2DGDA 2O3JA 2ZT5A 4IOKA 3RSZA 5JZ9A 2G63A 2GXQA 5LB2A 3UWKA 3VU9A 1SC3A 1GRCA 5FTKA 4EB8A 1N1GA 3T95A 3WLPA 1VJGA 2FN9A 5CW2A 2Y67A 5SYAA 4IZHA 5E3HA 5KSOA 4GZMA 4Y2PA 2BMJA 1TUGA 1JA1A 3K30A 3L7KA 4HDSB 4BMCA 5JARA 1JQAA 4PWZA 1FFEA 4OQXA 5JXHA 1E0DA 3EW7A 4BNDA 4JR0A 3N87A 3L0YA 1IXYA 4Z7NB 1FC0A 2A7QA 2BFPA 1RE0A 2A35A 4WKBA 7MDHA 4GF5A 4NMLA 5AKEA 3R3YA 1QIJA 2XY4A 3N5KA 5JI3E 1HT3A 1FQWA 1NBOA 2FGJA 1UP4A 2C9CA 2O8EB 4OLFA 2WF8A 3VX4A 3RAFC 1O57A 2ZJ1A 2VJCA 2ZB4A 1CG6A 3HVIA 3PGMA 3UJHA 4PXYA 4B87A 2W93A 3COZA 4FOSA 3NHSA 4MTCA 4X9XA 4B35A 4V1CA 5JVDF 2X6QA 3GLGA 3ZGNA 1E8NA 2J32A 3MQFA 5B6JA 3NPMA 4JQCA 5EL0A 4RA6B 2WUEA 3IHLA 2AK2A 1BDJA 5FTNA 1ILEA 2FUNB 3WYAA 3HDYA 1UPAA 1BGXT 4MEJA 3ZK8A 2G0NA 4OA8A 2GYWA 2X5JO 3F9IA 3V00A 2BFAA 1S2DA 3L8CA 4Z9YA 4A16A 1OI2A 2ONCA 3K4PA 1Y80A 4HNRA 1LRLA 2H2IA 2B99A 3OWXA 2RGYA 4QPJC 3DO5A 1VMDA 1VRCA 2A57A 3LCUA 4D3FA 2ZZNA 2XB2A 4O33A 5I9MA 4J0QA 4RIGA 3OU7A 3SSMA 3V46A 4AX4A 5IJ0B 2PUCA 2GSDA 2YNMA 2VUIB 3JQBC 3MJVA 4FR0A 3LHSA 3U4CA 5EPOA 2C9ZA 3VHXA 3L0SA 1MO4A 1DEKA 2CWWA 3P0FA 5DTMA 4EKIA 2ZSFA 4I6JA 2FRVA 5ENZA 4A10A 4CZ2A 4M4SA 5FLYA 1GZHB 1Z0FA 1QCZA 4RU1A 4WZ6A 4C22A 3U4QB 1CP3A 4NBWA 4ARIA 5DX1A 3I6QA 4YRRA 5AD1A 1PR3A 4B3BA 1SBTA 2O7NA 4WZBE 5DCWA 4ITVA 3T06B 4O2AA 1AOXA 5JCXA 4QDUA 1P9NA 3FUTA 4L1KA 4PG6A 4IHKA 4BDTA 2GTIA 2R6JA 3QHAA 3R9XB 5EHXA 5FKJA 4O08A 2Q2OA 4PHCA 2PKQP 2VJLA 5TDHA 1P0CA 3WSVA 1UK6A 1ZFNA 2H06A 1N92A 3RJ5A 1H5QA 5GV7A 2DY1A 3BL5A 2NT3A 3P2MA 4JV5B 2GAJA 4IMPA 5ERGB 2DKFA 3L8EA 3OPXA 4WWHA 4ZAFA 1E7QA 3UYKA 3WICA 5TS2A 4BKMA 4QYWA 1CJSA 3QUCA 2A0XA 3OTQA 4EHKA 1IQ0A 1E4YA 2XVZA 3GFVA 1XKLA 5CCDA 3V2UA 3KT8A 5E0OA 4F2WA 1VYHA 1L4EA 4ND5A 3O4VA 3HXQA 2Q4OA 3QW2A 4JXJA 2WDZA 4JDPA 4KWEA 5LJLA 1JYFA 3K8YA 4RELA 4LE1A 5IKXA 1DIHA 4LF5B 1J07A 2ATIA 1OR8A 4F04A 2EQAA 2Q5EA 2AFHB 2P9BA 2ZVPX 2QPTA 3KOWA 4MS4B 2P3QA 4MW2A 1XJ0A 3U5ZB 2XNKA 4DN6A 1XTQA 1NT4A 1IXZA 4B8YA 3S2IA 1DHRA 1LGYA 2ZFUA 4XLZA 1SJ9A 2WWGA 3MT7A 1XRLA 4BNUA 3T54A 2ZJZA 3K1AB 3ZDZB 1R37A 4BJ6A 1II8B 3I73A 5BVGA 2XA9A 3IJ5A 4AL4A 1B8VA 1R64A 3ZXUB 1UZAA 2VRCA 1OBHA 1ZM2A 4CKEB 1K4KA 4EL0A 1EFAA 1M34B 4JJKA 2GAAA 3DD5A 3T1YB 1U5AA 3PJRA 4E6EA 3LPCA 4LNUB 1TK2A 2C5EA 5KNBA 1NVKA 4KSBA 1OASA 1S1CA 4HAOA 5E8JA 3S2ZA 1TU3A 2VRNA 4OKNA 3I52A 1KR2A 2FDRA 4LXTA 4UOZA 1GA4A 4C01A 3EQ6A 3W4KA 2HJSA 2ZU0C 4R2JA 3BFPA 3I1JA 3RTGA 1NI3A 1G3QA 1V6AA 5EXPA 2I67A 3ZI4A 5EJEA 1MNQA 5FPYA 1RPTA 4Q9HA 1N2IA 3VPCA 3W77A 1UL1X 4BNYA 3KR9A 4ZHQA 4YNBA 1KSHA 1BJKA 2X9LA 3EUFA 4FGUA 4BQIA 1LS6A 4TRRA 1VB3A 1PLKA 1ECPA 1DT3A 3JVUA 4HFJA 1EFKA 4CUZA 2OWEA 1T5OA 5BR4A 3PEYA 4Y9UA 3L8HA 1ZH6A 1W0CA 2Y1FA 1Q3KA 2JEOA 1EK5A 2XE7A 1QGDA 1GRVA 4V3BA 1GM5A 3EY4A 2WTUA 1H4SA 3ELDA 2Y2VA 4DSZA 4RPIA 5C1BA 3TZEA 3ETHA 1WE2A 3GARA 5F9HA 1WUTA 2FDCA 4L8VA 4OF4A 2BFMA 1PR4A 1T5IA 2GLTA 3P0HA 4TSFD 1MC5A 4JMPA 2CHFA 1QGZA 2CFCA 3W9YA 4M7RA 3BORA 4PRLA 3ZBTA 5A3JA 5B3KA 2ZJ2A 3G49A 1UAGA 4HUJA 1KJIA 2J6IA 1I0IA 2JI6A 4MHSA 4XM0A 1XRRA 5KYUA 1CFZA 1DQNA 1NVDA 2P6UA 3IDZA 4RYLA 4YO7A 3IOCA 3RYIA 1HEIA 1T8TA 1JDJA 4TTIA 3U81A 4OH1A 1EK0A 3DZDA 1TDJA 3LRTA 2P2CA 2WSSD 2NW6A 3NJ8A 4IMRA 5C34B 1B26A 2XB9A 2AJLI 5L3QB 1K9SA 2JFXA 2R65A 2BRUC 1QH0A 2PWPA 3DLCA 4X44A 4BMZA 1L7XA 2XUQA 4DIUA 1U98A 5FTLA 5KWJA 3ZTTA 3SNHA 1XD9A 4KFSA 4M8KA 3ZWYA 1K6XA 3FYCA 3UJ3X 3B85A 2FZWA 1MEEA 5FI3A 3ROMA 3PVCA 1EXMA 3QI2A 4CE6A 4G97A 3TX2A 3D8RA 1BVYF 1NVTA 2WIDA