2P0EA

Human nicotinamide riboside kinase 1 in complex with tiazofurin
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
193
structure length
190
Chain Sequence
VPRGSKTFIIGISGVTNSGKTTLAKNLQKHLPNCSVISQDDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAISCWMESARHSVVSTDQEEIPILIIEGFLLFNYKPLDTIWNRSYFLTIPYEECKRRRSTRVYQPPDSPGYFDGHVWPMYLKYRQEMQDITWEVVYLDGTKSEEDLFLQVYEDLIQEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nicotinamide riboside kinase 1
publication title Nicotinamide Riboside Kinase Structures Reveal New Pathways to NAD(+).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 56
structure length 190
sequence length 193
ec nomenclature ec 2.7.1.173: Nicotinate riboside kinase.
pdb deposition date 2007-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13238 AAA_18 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2p0eA00
4IXMA 2QMHA 2YWHA 1VCOA 5JZVA 4FW9A 5JS8A 3U4QA 3PJRA 2V3CC 1SXJC 1T3HA 4K81B 3WMEA 1Q3TA 2QGNA 5FUVA 1D2EA 2ZI4A 4AG5A 2YYZA 3AV0B 1JQJC 3NH9A 1NLYA 2HJVA 2QPAA 1TEVA 4WW0A 1HEIA 3SC3A 3VX4A 4GMDA 5E3HA 4YONB 2VP9A 1UADA 5D3MA 3P32A 4A0FA 1E79D 3EIHA 2WJYA 3VNVA 2CBZA 5FTMA 3CPHA 3GD7A 4W5HA 2A2ZA 5J5CA 5CLQA 5GJWC 4EPXA 4Q4HA 1AIPA 2JLUA 2J0VA 2JLQA 4F93B 5FBLB 2AHOA 4B76A 5BN5A 4PC2A 1DAGA 1T8TA 4GDFA 2XEXA 1KO1A 2JIZD 3CNOA 1R10A 2O0KA 4G3XA 3TR5A 1NG9A 4A2QA 2ZM5A 1JPNA 1NKSA 2ZQ5A 4Q18A 2N42A 4YMWA 2NO6A 3NVAA 1GP2A 1JJVA 3TK1A 1TUIA 3CF2A 1ONBA 3MD0A 2H18A 4H9GA 1CR1A 4H1VA 2RGBA 4LJ4A 2F1HA 4LYFA 2AN9A 4KFRA 3FVQA 2WJJA 1E2LA 4JVNA 2R65A 4B34A 2W6JD 3ZZUA 3FMPB 1W2GA 1H8HA 5AUPB 3U3MA 4QRHA 4U02A 3NDPA 1VG0B 2ZAOA 1V43A 1NBME 2C5LA 4PO8A 4ZCMA 4N0DA 1OT3A 4BE7B 4HB3A 3V4RA 4M8NE 1UDXA 1LS1A 3GLIB 3TKLA 3AVYA 1HA3A 4DSTA 1KHTA 4P4SB 3U3KA 2FG5A 1VKJA 2LKCA 2ORVA 5KTYA 2ATVA 4R71A 4B3BA 1YR9A 2IYZA 1F2UB 2R2AA 4HSEA 5GVSA 3PR1A 5DN6D 1Q0UA 1YZLA 5UKDA 3W5JA 2F43A 2IX3A 1SKYE 4M1OA 3PUZA 1A82A 2FOLA 1ODFA 1E9FA 2JLYA 2RH5A 4LOAA 2OUKA 5LD2C 3EXAA 4F4JA 2RHMA 3BORA 3GQBA 3Q9LA 1TF5A 2RB4A 3K9LA 2FA9A 4TZ6A 1D9ZA 5BYJA 1QVRA 2ZRNA 4QKQA 1LS6A 1UEJA 1OH8A 3L0SA 2GF9A 3CB4A 1FOEB 1YZNA 2WSSA 1G16A 1QBKC 1VHLA 3AKCA 3SJBA 3U61B 5KSPA 2Q6TA 4NPHA 2ASEA 421PA 4IHQA 4EPTA 1U8ZA 4PZZA 1F5NA 4BLRA 2ZJAA 1P2SA 2BBWA 3UWOA 1L8QA 2G1KA 3OESA 2IHYA 1JBKA 2QZ4A 2VYFA 4IVRA 3CWQA 2QBYB 2FH5B 3B8HA 3JVVA 5L3QA 2X8AA 4JL8A 1E0JA 3TBKA 2ZJ8A 2D7DA 3VFDA 2VHUA 1RRCA 1SVLA 3I5XA 2P6UA 3K09A 1DBSA 4Q00A 3L2OB 2XXAB 4JZKA 3MSXA 1KO5A 1IN6A 1NL3A 1ZAKA 1OH7A 1XMSA 4XVUA 3GJ4A 3RRMA 4I1UA 3X1WA 1K6MA 1FUKA 5JWRA 1FW6A 3GJ3A 4CEIB 4MITA 4XWKA 2G0NA 3QXCA 4Q21A 3ZS8A 4LV8B 2J0UB 3LY5A 1W4RA 4TTQA 2RKOA 3DMNA 3AVXA 4R2IA 2XNDD 2C9CA 2AR7A 3P26A 3DOEA 2CHGA 3ZIAD 1OFHA 2GK7A 3IDQA 1OXTA 4Q1BA 8OHMA 2QTVB 4G5OA 4HYYA 1VHTA 3KKNA 2AKYA 4RKFA 3W9YA 2GK6A 1MO6A 1ZINA 2OXCA 2QSYA 4MRVA 4C0AC 1TQ6A 4LZZA 1Q1EA 1XZPA 4IKEA 5H8WA 1JNYA 2FFAA 3AKDA 4IEIA 4AC9A 1VG9B 2A5DA 3K09C 3TVDA 5JEDA 5C2JB 2PX0A 1WF3A 4FMDB 4NONA 1Z0KA 3U5ZB 1OXUA 5FOUA 2F1JA 2IF0A 4RD2A 3CWZA 2ZSFA 4Q4AB 4E5UA 1XEXA 4NP6A 3GCGA 4B74A 2ZEJA 4IRUB 1MRNA 1YJ5A 5EZ6B 1UBFA 4OQLA 2ZE6A 4MH0R 5FH9A 4DBLC 1Z3IX 4BLPA 5DI9A 1W4CA 4TL7A 1SQ5A 4CT4B 4RFVA 2OM2A 3CF6R 2OESA 2G0TA 1HUQA 2XZOA 2VHCA 3B7GA 4BLSA 2PCJA 1Q20A 1IXSB 4AKGA 4MGKR 3F0TA 3N2EA 4GSYA 2DFKB 1VG8A 3C8UA 1OFUX 1XXHE 2BJWA 1D5CA 2QTHA 1LW7A 2BDTA 4ZKDA 2GJSA 1RJ9A 3UG7A 3QY0A 4E07A 1SKYB 2PMDA 3ADKA 3E1SA 1GNPA 2OFWA 3Q85A 3SQWA 4H1UA 3PUXA 1Q3HA 1N6LA 4C0HA 4G0NA 4ZIRA 4GI7A 1W36C 1BYIA 3GFPA 4LBZA 3EPJA 1CKEA 4R9UC 4OHXA 4RKEA 3QPVA 5CDFA 3W5IA 2W6IA 1A2BA 4HZIA 1AQUA 5FPSA 1YR6A 4PHGA 2WJVA 3CPJB 4I1OA 2J5XA 3LNCA 1ZM9A 1XX6A 5FOSA 1LNZA 5LB4A 2BKEA 2IYSA 5KDOA 2QL6A 1IM2A 1ZD8A 4O2RA 1FFHA 3KQLA 4JLBA 5C4GB 4TZ0A 4UXIA 1MOZA 1S8FA 4QGHA 1SVOA 5AUNB 1O3YA 2PX3A 2VRWA 2O8EB 1ZM2A 1GL6A 4BZPA 3QXJA 4P33A 3PXGA 1Z2CA 5FL7D 2V7QD 1G20E 5SZHB 5J4VA 1EFHA 1I4TD 3UMSA 4FD2A 4M22A 1KNQA 1Z0DA 1E96A 5DLQC 1OXVA 2H92A 3FMFA 4JLDA 2WOOA 2WWIA 4PC3A 3NBZC 4Q1FA 2WTUA 2VSXA 4RZ3A 2D3WA 2V54A 1KDRA 1QHHA 3KL4A 5BYKA 1Z06A 3FMOB 2QA5A 4OHZA 2BMDA 3BK7A 1TQ4A 1EX6A 4NCJA 1II9A 3I61A 4I81A 1XBTA 4QGAA 2J41A 4KU4A 1ZYUA 1EFUA 1XU4A 2XZLA 2CVHA 2E87A 4MRSA 5JSZA 4O0MA 1OIXA 2ZI5A 4LX0A 3KB1A 1EFTA 1XMIA 5AR1A 2IC5A 2ZE7A 1OB2A 1KDTA 3AP1A 3GFTA 3U3RA 4QJ3A 3H84A 4G1UC 4P3YA 2IF2A 4GZLA 4LYHA 2WKRA 1KI2A 4XTCS 2VBCA 3R8CA 3KKPA 5E7JA 3MWLA 4CZ2A 2UVQA 4HLDA 4TQ9A 4EDHA 3RWMB 1II0A 3VKHA 2XITA 3K9NA 1Z29A 1GRRA 4UXHA 2BIFA 3KUDA 3NC1C 2CJWB 2GZDA 4OBEA 2GJAA 3BE4A 3U44B 3I8SA 4RZXA 1G5PA 4FIDA 4QHYA 1HH4A 2NOAA 2QU8A 4NCKA 3OIWA 4TTPA 4G01B 3VR3A 4BFXA 4DB4A 2HCJB 3PUYA 3U7HB 4RD1A 3AF4A 3RAPR 3QENA 1Z28A 5F98A 4US1R 4DIDA 3ICQB 4TMVA 4O2LA 4DWJA 4XVQA 1D2NA 4PC1A 4BECA 5DH9A 3UK6A 2F9MA 3TQFA 4EQ6A 1SXJE 3EPKA 3DZ8A 3R7WA 4TT3D 3SYNA 5C46F 1S0UA 5TARA 3A4LA 1SVSA 3K9HA 4NCNA 2EFDB 1P61B 4F4CA 3LBIA 5E7IA 4LJ6A 2QQ0A 3BRWD 4F7WA 1Z0FA 2AK2A 3QBTA 1NMXA 5EUQB 2YWFA 4BRUA 3KQNA 2BMEA 1R5BA 5IK2A 5SZIA 4Z8YA 2JJ2A 2RGCA 3Q5EA 1KO4A 1IQPA 1KNXA 3KDSE 5DE3A 6Q21A 1Q1ZA 4DLTA 1ZCBA 4A6XA 1JB1A 2ZRPA 3A1TA 4ITRC 4V0OA 1YE8A 3ZD6A 4ERNA 1EX7A 2CL7X 2EWVA 1OYYA 3QXHA 5IF9A 3GLFA 4JKYA 5A5GA 1OSNA 3U3OA 3B1VA 1OIWA 3GEHA 2NO7A 5JS7A 3VX3A 2FX3A 1DARA 1W0JD 4KAXA 5EZ5A 2QNRA 4KYIB 1KAGA 2QY9A 2X77A 5JRJA 1DG3A 1W48A 2LCFA 1SVMA 1XCPA 2AXNA 2F6RA 3THOA 3THXA 4Q4JA 4X8MA 2LWIA 2Z5FA 2GILA 1TU4A 2C04A 1R8SA 1BIFA 3IIKA 1G18A 2ZSAA 4B35A 1M34E 3ADCA 2ZI3A 3J81k 2G9NA 5DHFA 3SEAA 3ZVLA 3R9WA 1TL7C 3IQWA 4BWYA 1E9AA 3B1WA 4MGZR 1DAIA 4X8LA 5HKKA 2WWWA 1AN0A 4YXWA 4JIMA 4NMMA 2D7CA 3OE7A 4YMSA 3TAHA 3CNNA 4PQFA 4HAWA 2CCGA 1Q44A 4B3XA 4G5RA 5E95A 2ZS8A 1J90A 3RC3A 4ACBA 4B44A 2QAGB 2X19A 1GKUB 2OHFA 1ZMXA 4DIEA 3OEHA 2VTKA 1F2TA 1XDBA 5DIFA 1LTQA 3CH5A 3FKQA 4UJ3A 3FFAA 3QPWA 2BBOA 1OXSC 2CMKA 3VR2A 4LHXA 5DNYB 4F92B 3TVTA 4L9WA 4TMTA 4D4JA 1GAJA 1NVWQ 1P75A 1WBBA 1NBMD 1XD9A 1VG1A 1F6BA 3L0IB 4A2WA 2J0SA 3UIEA 3JZMA 4BFZA 2LKDA 4NCHA 1E1RD 5FTNA 4FWTA 3LX5A 2XOKD 4YLGA 3WNCA 1ZNWA 2P2LA 3A1VA 2MSCB 2WJIA 3UANA 4UNRA 2QT0A 1SXJB 4TLBA 1XZQA 2FFBA 1AZSC 3AF2A 4GOKA 1YR7A 3EZ6A 3FTQA 2D62A 4HZUA 4XD7D 1W1WA 2VF8A 1CR0A 2GDJA 4OJKA 3FOZA 1JEDA 2R6DA 4Q9HA 1JXMA 1AKYA 3RVBA 3PUVA 4JBXA 4NYMR 1HE1C 1G7SA 4ZDIA 1OFTA 4TTRA 1Z6TA 1TAGA 2ONKA 3X1DA 3PITA 1K5DA 2ZI9A 5FPYA 4GMXA 3RSOA 4HLUA 4MUAA 4NYJR 2CLSA 3CRMA 2GJKA 3C14C 1UBEA 4D4LA 2FPMA 2YINC 3U4QB 4OHYA 2ZSEA 2CLCX 2E1RA 4MGIR 4CVNA 2QG6A 1I2MA 3EPHA 2FSHA 3RSLA 1YHNA 4IDHA 4CYMA 3Q5DA 2CEAA 1ZM7A 3EASA 1WQ1R 3M1IA 3EA0A 2W0MA 1IN5A 2AXPA 1P3JA 1P60A 2WBLC 3A1SA 4DVGA 5D3MB 2IYLD 3GJ6A 1UJ2A 1RPZA 3HU1A 2C99A 2ZS9A 3KKOA 4Q48A 4YXWD 1KMHA 1LF5A 2C9YA 4Q4HB 1COWA 3K0EA 5DGXA 5B57C 3NTUA 4HAXA 4KFTA 2PL3A 4HLUC 721PA 4DCVA 1JAHA 3PIRA 3NG1A 3CX7A 1B0UA 2IK8A 3DVLA 3UMRA 4HB0A 5EP2A 3OEHD 3LLMA 1U99A 2UZIR 3ASYA 1LV7A 2D74A 4L16A 5KDLA 4ZKEA 1E1QD 2QORA 3D3QA 4CT5A 3KJHA 2OG2A 2ORIA 3QQ5A 4LPKA 3QVUA 4EUNA 2NO0A 2O0HA 1EESA 1E79A 4HI0E 4ARZA 4OI0A 1P73A 4FMCF 2FFQA 3QVVA 5KHOC 5KYKA 1PJRA 3AVQA 1H65A 3RANA 3KJGA 4M1MA 2WOJA 3GLGA 5LD2B 4OI2A 3UMFA 3KQKA 2OO7A 3NKVA 2EQBA 2JIZA 4FXPA 1MRSA 2ORWA 4WXRA 3IO5A 5FUXA 3FYHA 2PEYA 3IEVA 1W0KD 3PFIA 3WY9A 3B1XA 3DOFA 5GADl 2PJRA 5FPTA 1UEIA 1E2PA 2O8CA 3HJNA 2QE7D 5FPHA 1PUIA 1M6NA 3SI7A 5FFMA 1Z0AA 2XTMA 1IOZA 4LHWA 4QJ4A 3NWJA 1HQCA 4RY2A 4LPSA 1YZGA 1KI4A 3SU8A 4JT2A 2CL6X 1HE8B 2F43B 3W90A 3NXSA 2O8DA 1BO6A 3W3AA 2DFTA 3T5GA 3WXMA 2H57A 4Z54A 5J4YA 4LK2A 4MDFA 1XJQA 2W6JA 2WKPA 2XAUA 3LFUA 3QF4A 3OFNA 3RS7A 3IBGA 2FDCA 3IEUA 4YQFA 5EUMA 2OZEA 4C7OA 4G5QA 4D80A 4EKDA 5CDFE 2ZYTX 1XTRA 3BERA 3VKWA 2RGAA 3OIYA 4YMTA 2EFCB 4WZ6A 1HYQA 5DISB 1N6RA 1DAMA 1Z0JA 3I1FA 2V1XA 4DLSA 1ZRHA 2V6JA 4O3MA 5G41A 4DEXA 1GNQA 4CDGA 1U2RA 2GVDC 4QNRA 4N1AA 2AK3A 3O8DA 3GJ8A 2HV8A 2XJ4A 5DN6A 1OHHD 1G3UA 4X8HA 2NZJA 3NBFA 1U98A 3SDZA 1RYFA 1B23P 4BQSA 1E9BA 5L3QB 4WZBE 1F60A 4OI4A 2CXXA 1DAHA 2C95A 3CRVA 3AUXA 3BH0A 3MWYW 4M4SA 1N5JA 4QBGB 1PUJA 4LCBA 1X8KA 4DXAA 3VR5A 4BLOA 3DHWC 2QPOA 4MYUA 2HT1A 1FX0A 4FCWA 1ZNZA 3CZPA 3AQ4A 1G1MA 221PA 1RRGA 4TLEA 3W8NA 1QHXA 2GTPA 2W2XA 3ND8A 4B3DA 2CE2X 5EXPA 3F8TA 4B2PA 2FMXA 1X1RA 3UPUA 1G19A 1G6OA 4Q1EA 5G3YA 2RHDA 2QN6A 3IKJA 2JLSA 4HDOB 2ZANA 2OEPA 3P4XA 4B33A 1UKYA 4C0SA 3NDBB 2FSFA 4A6PA 1KDPA 1ZUHA 1AGPA 1R5NA 1CJVC 1N6NA 3EG5A 4PHTA 5JHHB 3U3JA 2REOA 4UNSA 3BJIC 3C16C 5FOWA 4URZR 1YQTA 4HUQA 4A0GA 4BASA 1M7GA 4AKEA 1E4YA 4ASUD 3EZ9A 3KXLA 3IHWA 1XEXB 3KUCA 4NCIA 5HZKA 2VF7A 4URYR 5KO2A 3CRW1 1N6IA 3KJIA 1IJEA 3KFXA 4Q19A 3U7EB 4BPBA 2BOVA 3S1AA 2ATXA 1TF7A 5FI0B 1W36B 1EFRD 2VP2A 1KK1A 2VSOA 2XNDA 4FN5A 4GFDA 4UNPA 3ZIAA 1BYUA 4Q03A 1JI0A 4M1YA 5CYOA 3MMPA 3LH5A 2R62A 3LO5A 1A2KC 4PSVA 4W9MC 3AVTA 3OFND 3OAAD 1NJFA 1ESMA 1W4AA 5IDVA 2FNAA 2PLRA 4JLPA 3LQQA 2EFGA 2OAQ1 4P4TA 4Q7JB 1RJ9B 1ZM3A 2B7BA 2WWXA 1SVWA 5TDHA 4GBMA 2ZRBA 4OYHA 1XMJA 4AWXA 5CB8A 5H1YA 2DHRA 3IHLA 2ZR0A 2Z4SA 4HLQB 2NZ8A 4PC7A 1OLOA 1D2MA 1KJYA 1OXXK 1R2QA 3RS0A 2WJHA 3WRXC 4ZIRB 3W6PA 1PLKA 3A8TA 4EFMA 4TMXA 2Q9CA 1NLFA 2HT6A 1U8YA 4LUCA 4GOXA 4EAQA 2E9SA 3AH8A 4BZQA 5JCPA 2A5FA 1WBDA 3SJZA 2XGJA 1C9KA 2B6HA 1Q12A 2ZRJA 2Y8EA 2WWGA 4JYBA 3ICEA 1KI8A 4BFVA 2AFIE 3ZVNA 5DYIA 2ZR9A 4Q47A 2OT3B 1KI1A 4IW3B 5FUWA 4QFMA 5JEEA 1XB2A 5AUQA 3K70C 2PEZA 2HXYA 3K0AA 4JYCA 4S2EA 3SYLA 3TUIC 1DE0A 3FFBA 2J9RA 3TE6A 4YMVA 1IY2A 3AB3A 3P27A 4XJXA 5HE9A 1BS1A 3QXSA 5AJZA 4JLNA 3Q7QA 2ZROA 3AF3A 3GLFE 3QSYA 4Z51A 2C96A 4TL6A 5SZKB 3GLHA 1R4AA 2AFHE 1Z08A 2NTYC 4M0LA 3THWA 4B3GA 4WOPA 3H4MA 3IPYA 4M9ZA 3WNDA 4QNMA 1E0SA 1T9HA 1QHHB 4D82A 2IYVA 1SVKA 3KKMA 3NC0C 1CR2A 4IVPA 1CBUA 2EYUA 3SHWA 1GSIA 2JLZA 1YZQA 3WMFA 5JSZB 1X8LA 2VO1A 4F4IA 4QG7A 1U94A 4QGGA 5FL7A 2V7QA 3MJRA 1H8ED 3TSOA 1Z6XA 1AGRA 1JJ7A 2J1LA 4LBWA 5G53C 4A9AA 3AF1A 3U6KA 3KXKA 4C2TA 3LVRE 4DDUA 2GXUA 4LV5B 1U90A 4MUBA 3AVOA 4EIWA 3L0PA 4AYTA 1EK0A 3TUZC 4KV9A 1NKTA 3EC2A 3NHBA 1IHUA 1AZTA 2BM1A 2VH5R 4PAMA 3T1OA 3WP0A 4DLUA 621PA 2GZAA 3NBYC 3T06B 1Q57A 2GXQA 4DLVA 4W7SA 3I32A 3VMFA 3K70D 2KJQA 3ZQJA 5IHPA 3U2QA 1G7CA 1XPUA 3LD9A 3QKTA 4OK3A 3BB1A 3GEEA 2O5VA 5FOTA 4OK5A 1U0LA 4RSGA 1LFDB 2WAYA 4NKRA 5TY0A 4FI3C 2IYQA 1T8UA 2H1LA 3IUYA 4JVLA 2ZJBA 4F38A 1KTVA 2Q21A 4V03A 3LLUA 3RHFA 2IXGA 2P65A 5EXSA 1J99A 1G8PA 2UKDA 2FEOA 2J59A 3BOSA 1ZU5A 1FUUA 4UXJA 3VHXA 3BH6A 3M0EA 4D0LB 4EFLA 1DTSA 1VPLA 1ZJ6A 5TV2A 1DOAA 1E2JA 4A4DA 4EQ6B 1Z6AA 1Y63A 4A0HA 4ZO4A 3DM9B 3GJXC 4LC0A 3R7WB 1ZC4A 3B9PA 1DO0A 4TLAA 5ELXA 3B82A 4TMZA 4F91B 1R8QA 2O8FB 2I4IA 3KXIA 3NIBA 3WYGA 1OB5A 121PA 4DHEA 4P32A 3C4JA 1G8YA 4IOLA 1Z6GA 3AGQA 4C4PA 2KB0A 2ZITA 3V00A 3PV0A 4DCNA 4OHVA 4KLNA 2EU8A 5HTKA 1SZPA 1KGDA 3DMDA 3BBPA 4C9BA 3REFA 1Z83A 3EARA 5AJVB 1Z5ZA 3KJEA 3AF0A 3NEYA 5FPKA 1S9HA 3O8BA 1YU9A 2ERYA 1AK2A 2WWHA 2FE4A 3MWJA 4RD3A 4HUTA 1KJWA 1M74A 2FWRA 3IBYA 3TIFA 2OFOA 1NF3A 5DYGA 4TT3A 1DEKA 3WHKA 1D6JA 2Z43A 3GLFB 1Y3AA 2VIIA 3MAAC 1KAOA 1KIMA 4FINA 2JDID 4NHOA 5E7MA 3ND9A 4WZAE 2ZRLA 2W00A 3R8FA 2ZUBA 1EG7A 1I2DA 2ZU6A 4KO8A 5FBRB 3A6PC 3WBJA 3P20A 2IYWA 5ANRB 3PEVA 5K8UA 2WPDA 5BWMA 3A1WA 4Q4JB 1M7BA 3G82C 3LBHA 2W2TA 2G88A 1E69A 2JATA 1HY3A 2EW1A 2REBA 2WKQA 3SN6A 3EX7C 5F9FA 3LW8A 4ZI2A 3C5CA 2H7VA 3B9QA 5JLJA 4B48A 1PVOA 3QI2A 4DDWA 1WA5A 3UG6A 4C0JA 1L2TA 4CEJA 2B8TA 1UKEA 1SVIA 3LX8A 1CXZA 4TYYA 4B75A 2NO9A 4A8JA 2Q0HA 4TL8A 3TQCA 2YNMA 1W0JA 1DS6A 3W34A 3AUYA 1G5RA 4OL0A 5FI1B 3ZH9B 1KI6A 3O8RA 1U0HC 4JL6A 4PPQA 3X1ZA 1JR3D 5HCIA 4C0BA 4DC9A 3FE2A 1MO3A 3I8XA 3MG9A 2XXAA 1IXRC 2WVJA 2QMUA 4LBVA 4EPYA 4WIAA 3GLGE 1RKBA 1KKLA 2HCBA 4LI0A 4MRRA 3T1VA 3EPLA 1XPOA 2IEZA 1HV8A 4AIIA 1IY0A 4DCTA 3KB2A 3PENA 3SFZA 2JA1A 1K8RA 2R8RA 4IEEA 4BFYA 2BBTA 1L4YA 1VCIA 2JEOA 3FHOA 4LJAA 4C0KA 3GFOA 4ZCIA 2PCLA 2GETA 4KCGA 4A8JC 4B2IA 3QUSA 4D2IA 1X1SA 1OYWA 4IOMA 3H86A 4Q7MB 2YOHA 3H1TA 1XCMA 3KQHA 3QOFA 4PZLA 4B3FX 4V02A 2P3SA 4JBWA 2KI5A 1NVVR 2I3BA 2OV2A 2QUZA 1NY5A 2YHSA 1Z0IA 3H0KA 3EZFA 4GL2A 3K0CA 4HZUB 4DT1B 3PQCA 4PO1A 5HPYB 2QQEA 3K53A 4JMPA 4NBSA 4BZXA 1GTVA 4AY2A 1UDWA 2R6GA 1CJTC 4ZCLA 4K46A 3TRFA 1M1YE 3SOPA 3KKQA 4Q1AA 5CK5A 3CR7A 3TH5A 1NBMA 1A5TA 4FMDF 521PA 1E9SA 1E1RA 3OEED 4XSGA 3HR8A 2XOKA 1W44A 1VYUA 2BV3A 3AP3A 2YOGA 1JXOA 4KVGA 3N2IA 4O25A 1Z8FA 1X3SA 1P7CA 2WPDD 1W49A 3TW8B 3SQXA 3HU2A 4B6FA 4BLTA 2YV5A 4RZUA 2G6BA 1GILA 4Q7LA 1UFQA 4XD7A 3K0CC 3EIEA 4OQXA 4M2LA 5BN3A 1DELA 2CK3D 2JJ1D 2OAP1 2V4ZA 1DAFA 4PHFA 2OCYC 2D2EA 1KOFA 2G3YA 2AKAB 3V9PA 4TWZA 3EWSA 5BW8A 2YOFA 3WHLA 1KMHB 1KK3A 2PBRA 3X1XA 1RE0A 3WBKA 2BKUA 2J3EA 1HQYE 1W2HA 2IBMA 1US8A 2OCAA 5LPNA 5D3QA 5CM9C 1TF2A 4CGZA 3AGPA 3BIFA 2H16A 1YRAA 4Q9IA 3KTAA 2PZFA 2RGXA 2WAXA 2DFLA 3CUEF 5HE8A 1T0HB 2VP0A 2XSZD 5FUYA 3X2SA 2OCPA 1QG4A 1ETUA 4RCZA 2JLXA 2ZRDA 1E2IA 4NYMQ 1MV5A 1NIPA 1XTSA 2J87A 2TMKA 4RD0A 1S3GA 1U0JA 1UM8A 3U60B 4IDQA 1DAKA 3K9GA 4ARZB 2C2HA 4PC6A 1SULA 3A58B 5AJWA 4NYJQ 2CHVA 3RWOA 2Z83A 2DB3A 4OQMA 3GLGB 1GM5A 1AKEA 1TNDA 1UPTA 4NZYA 3DKVA 1KSHA 4QOSA 4DLZA 1G3IA 1Q22A 1V5WA 3BH7A 2IA5A 3CKLA 4L5BA 1XJ0A 3CZQA 1TTTA 3PEWA 3AEZA 2P5SA 4BFUA 2CNWD 4QM7A 1E1QA 2OCBA 2YWGA 1HTWA 2FU5C 1ESNA 1MH1A 4GZMA 2O8CB 4M1KA 4AI6A 1QHSA 1DPFA 4KJZA 3PUWA 3ZZ0A 2WMOB 3VTKA 4IVQA 2VHJA 3THYA 4PAOA 1XPRA 1A4RA 1FQJA 3T61A 5DI3A 2O8DB 4Q9LA 2QENA 2KWIA 4DUGD 2IXEA 3QF4B 1E2GA 3MWKA 1HURA 4CEHA 1JECA 3ZYCA 1G5TA 1J8MF 1N6OA 1T3LA 4I1SA 4C7OB 2D06A 4B71A 3K1JA 3CNLA 1J2JA 1RRPA 2BVNA 3BFXA 1EWQA 4E22A 1W0KA 1TMKA 2NO1A 2CJWA 5AK0A 3SE0A 1VYTA 3HWSA 4QJ5A 2RGDA 4YMUA 5GVRA 1FTSA 3DL0A 1RW4A 4KLZA 3ZS9A 5M04A 2QE7A 3Q7PA 2D2FA 1OIVA 1KK0A 1MO4A 2B8WA 3CM0A 4B3CA 2KE5A 5JECA 1FNNA 2C98A 3RS5A 4Q02A 2CVFA 1WE2A 4EPWA 3LXRA 4RVCA 4Y0VA 1XXHA 5LB2A 2IYXA 5JJLA 4DLYA 1AA9A 4FCTA 2HUPA 4PO9A 4RFSA 4L15A 1S4QA 5EP1A 4EJSA 1NN1A 1W5TA 1XCGB 1VDZA 3UATA 2QPTA 3RC8A 2IWRA 5JI2E 5E4FA 1OJLA 2ZRIA 4JKIA 3GLHE 3WMGA 4LC1A 4GPTA 1FX0B 2OLJA 2ZETA 3P4YA 1KSFX 4IXNA 1XEFA 4HDCA 1Q21A 4PANA 2GNOA 4Z8XA 5P21A 3W8RA 3BWDD 4Z1MD 1NN3A 2X1VA 4UNNA 3U6BA 5L8VA 4JVSB 3WRYC 2IHBA 1KO8A 3CX6A 3QG5A 3VAAA 1IJFA 1R0YA 3ONWA 2O8BA 4M21A 1OHHA 1T6NA 4D6PA 2ZSDA 3ADBA 2V55B 1R0ZA 1E9EA 4W5WA 2VA8A 4ZDKA 1IBRA 3CLVA 1KY3A 2GCNA 5GJCA 3QEOA 3NBXX 5G3ZA 3OZXA 2A3RA 2OSBA 4EJSC 2EVWX 2Z0MA 2BC9A 4HUQB 2IEYA 1X6VA 2JCSA 2OBMA 2Q9BA 4P0TA 4WVFA 2ZXUA 4X8OA 5KDDA 4EFNA 5EJEA 2XTZA 4DDTA 4HLCA 4M1TA 4NTZA 5JBQA 2HDNB 3TW4A 4IFEA 4AKHA 5K8TA 1AS3A 3B85A 1FP7A 5CK4A 2BCGY 5CIWA 3QG1A 4ON9A 4UKDA 3S1AB 4BFWA 1XP8A 4QXAA 4TYWA 3G5UA 5A4JA 2G77B 2ZSBA 3EWAA 1MO5A 3B5JA 4NU0A 1OW3B 3GEIA 5EXXA 3Q72A 1KZGB 3MGCA 1DG1G 2GKSA 3REGA 5B30A 1IXZA 1CIPA 4QBIA 4E03A 4GP7A 1G8FA 1LY1A 3QJYA 2GF0A 3QPUA 4LHZA 4NYIR 1GITA 4R2HA 1UKZA 4ASUA 1R0WA 821PA 3X1YA 4M53A 2NGRA 4R7ZA 2WV9A 1RVDA 3RRZA 1ZCAA 4D25A 3FMIA 1AS2A 2O0JA 4PSKA 4M1SA 3TMKA 3IPXA 2CHQA 1SHKA 3CX8A 2ECKA 1J8YF 1EFRA 1NRJB 1MABA 2EFHB 3CRQA 4BUJA 4NE2A 4DCSA 4XH9B 4OQFA 4ACAA 5KNBA 1NMZA 3LVQE 4LYAA 2A5YB 3OAAA 2BM0A 4JL5A 2ZPTX 3K8YA 4L8GA 4DCUA 2QM8A 3GMTA 3KZ1E 5F2EA 2K5UA 4IJMA 4WA7A 2IUTA 4JLAA 4AK9A 3ZGXA 1TADA 2A78A 5CJPA 1VTKA 1I4LD 4W5JA 3T15A 3I4LA 4MA4A 5GJVC 3A4MA 3AKEA 1WRBA 3K0AB 2O52A 3ADDA 1YRBA 4TSFD 1G6HA 5FTJA 1LVGA 2FFHA 1IONA 3EAQA 1RRFA 3GLHB 2VP4A 3THWB 1QF9A 1G3QA 1KSGA 2FGKA 1SHZA 2QI9C 1NLZA 3E5HA 3QF7A 4GP6A 3SBDA 4A0RA 2N46A 3T34A 3LV8A 5TXGA 2IS1A 3QBVA 5DHAA 4TYPA 1II8A 3GJ5A 3I73A 4M9SA 2XZPA 3W6NA 1N6KA 3HYTA 1UBCA 5B2ZA 2CE7A 2FJUA 2AWOA 1MR3F 5J47A 1VECA 5JI3E 3QKRA 4JSYA 2GZHA 4A15A 2Q3MA 1FQKA 1KSJA 3LAWA 3TGPA 1G291 1UAAA 3GJ7A 1K5GA 4MGYR 2J46A 2HLDD 2G1JA 5CLLA 1XD8A 1W5SA 4MQBA 1NG1A 2R9VA 2C9OA 1NJGA 1EGAA 4G5GA 1J7KA 1XFAA 4PHHA 1L4UA 2H17A 1CU1A 1ANKA 4C3ZA 3RLFA 5K8LA 1P2TA 2ZJOA 1CP2A 2BMFA 2IS6A 3CO5A 1GKIA 3BFVA 4OK6A 1RYHA 3FWYA 1D8TA 1P9WA 3PG5A 3SZRA 2NPFA 4DJTA 1FL9A 3RABA 4JBYA 4POAA 1E3MA 1TPZA 4MKGA 4V0MA 2QP4A 3MFYA 4JT4A 2IYUA 1OH5A 4Q4LA 1FZQA 4L9SA 2YC4C 3W3ZB 1ZM4A 2QTFA 1EWRA 1D9XA 1H8EA 1YZKA 2ZI6A 1IN7A 2ZRGA 2REXB 1N25A 3IO3A 3QKUA 4TYQA 1F48A 2ZREA 3E70C 2ANCA 2R6FA 4KBGA 4GT1A 3ECCA 3B1YA 5TVKA 1FTNA 2BEKA 2EFEB 1E99A 1QHGA 1XEWX 3MCAA 4PZYA 1M8PA 2GAAA 2F1RA 3FPAA 4B73A 3TR0A 4E09A 2AL7A 2FSGA 3RS4A 2J7PD 2HF8A 3TJZA 1GL9B 4PFSA 3CF0A 1DAEA 5HR5A 3BB4A 3HR7A 4NDZA 4Q1CA 5L3SA 1BOFA 2FZ4A 4B32A 1OKKD 3ZJYA 1UBGA 2HJGA 1MT0A 3C41J 2GEVA 4KBFA 5AUOB 1S1CA 3PCRB 2DBYA 4FWIB 4ZPXA 2JJ8A 3QEJA 1U8AA 1PLJA 1R7RA 1GDDA 1YZUA 3MUFA 2QROA 3UWKA 1SXJD 1XD2A 1BMFD 1FNMA 4XOIA 3D31A 4BLQA 3A36A 2FEMA 3FKSD 1E9CA 2FSIA 1NN0A 3BAFA 4LJ9A 2DFNA 2V8OA 1WCV1 2FGJA 4PQYA 2CCJA 1OE0A 4DLXA 2WWFA 1CJUC 4IOJA 2ODBA 5C18A 1E4VA 1G41A 2ZJYA 2ODEA 1E94E 3N70A 1KZ7B 1VCNA 4PPGA 1ZNYA 1QZXA 5B58C 2ZI7A 4XWAA 1C1YA 1GZSA 1F3OA 2RMKA 3LXXA 5DSZA 2C03A 1N5KA 1YVDA 4Q7KA 2ZRKA 1N0VC 4II7A 2YWEA 4TN1A 2BHRA 3CH4B 1R6BX 3DKPA 2C77A 2Z6VA 2GCOA 1NVUQ 2MSEB 2HEIA 5JWOA 3I72A 3DEFA 1E2EA 4JS0A 1GRNA 3ZLJA 1G3RA 1M2OB 3L82B 3IGFA 3QKSA 2V1UA 4V0KA 1DO2A 5J4HA 5BXQC 1XTQA 1W4BA 1G4AE 1G7RA 2DCUA 3A1UA 3NEJA 2CDNA 3TLXA 3BB3A 1E9RA 1L7VC 5BN4A 1RC8A 4CEJB 3K0FA 4G5SA 2QP3A 5SZJA 1GIAA 3L0OA 4LJ7A 1U81A 2ZJZA 4A8JB 4C0LA 2BWJA 2JDIA 3B2EA 4QC2A 2ZAMA 3VU9A 1QHYA 2QP9X 2PMKA 2VPPA 1KI6B 5KSYA 1FMLA 1E2MA 4PSAA 1ZNXA 2P6NA 1KI7A 1A1VA 3AP2A 3VR1A 4RJLA 2FV8A 4YC7A 3CR8A 3D7MA 4JLJA 5B64A 3FHCB 1KJZA 5JHGB 1KY2A 4KXFB 2IXFA 1OV4A 5JMTA 4US0R 3L8YA 1KI9A 3BXZA 1CLUA 2CL0X 1JR6A 1UF9A 2GXAA 2F3RA 2V9PA 3BC1A 2OE2A 2ZE5A 4LJ8A 1S2MA 1GUAA 5DO9A 5CITA 4J0QA 2CLDX 5FBVB 4URXR 4M1WA 3BD9A 1AM4D 3IIJA 1AJEA 4LHVA 1KDOA 1H8HD 2IYYA 4DSUA 3I92A 5EE3A 3B60A 1JR3A 4ZDJA 3GJ0A 4D4MA 5H68A 1ZP6A 1G4UR 1KK2A 3CBQA 3KFVA 4KI0A 4BGDA 2DWQA 3NH6A 4TLCA 4D26A 1OF1A 4PXAA 4FMBB 1ZD9A 4AYXA 2ZTSA 2ZU0C 1JPJA 1QVAA 5A0FA 4DSNA 3DZDA 3M4YA 5JJIA 3O8CA 1P4SA 3MLEA 1SKQA 1M7HA 5BQ5A 4XWOA 1Z22A 1VIYA 2J7KA 5AJXA 3UKDA 4LGMA 2VQSA 1BKDR 3AVVA 5KSZA 2GESA 4TQUS 3ZVRA 3LQRA 1DVRA 4TYNA 3VQTA 1YKSA 1P2VA 2YJTD 4LHYA 1ZW6A 2ZRMA 4Y0AA 1NIJA 4TMKA 1Z07A 3GLIA 2WSSD 3IILA 4CRWB 4UJ5A 3BS4A 3A37A 4RZ2A 5C1BA 4P4SA 1XEWY 1EXMA 4GOJA 1MKYA 2G83A 4IOKA 4P4UA 3DPUA 1F2UA 4URWR 5HCNA 4PTLA 3SNHA 4JJZA 4A82A 2PZEA 3N5CA 2F1IA 2ZYUX 1E2QA 2UZ3A 5FL3A 2HXSA 3OEEA 1T0JB 1X8JA 2IL1A 2P5TB 4M9XA 5L3RA 1US8B 1LB1B 2A5GA 5TB5A 3SJCA 4QM6A 1J70A 5AWFC 1NVVQ 4KSBA 3T12A 2DPXA 2OILA 4OI1A 2GWHA 3THXB 5FTLA 1OPXA 3KTAB 2PLFA 5CB6A 2PH1A 4LDJA 3CONA 4B6EA 1CRPA 1U9IA 1C4OA 3PVSA 2FZLA 4KYUA 4BFSA 1TEXA 2BJVA 2IYRA 3RS2A 4GRAA 2GJ9A 2BMJA 3KQUA 1N5LA 1S96A 1X86B 2CK3A 2JJ1A 2WIAA 5KPJA 4FCVA 2FF7A 1KO7A 2JGNA 2GBLA 1NN5A 2AX4A 3LRPA 3BFKA 4NL4H 1BH2A 4P31A 1XF9A 4MYTA 2GRJA 1SGWA 3QNUA 3DM5A 2QBYA 1CS4C 4V0NA 4XVRA 2ZE8A 1ZC3A 2QT1A 4JJKA 4TQAA 1GRQA 2Z4RA 5FR1A 4Q9JA 3B6EA 2QEQA 3I62A 3BGWA 2F7SA 4MRPA 1XTKA 2RGGA 4KSCA 2H8KA 4BEJA 4ESVA 2NMVA 2Q9AA 2BEJA 1F2TB 1U9IC 2ANBA 1XRJA 2QAJA 4LSGA 4QL3A 1Z63A 2XSZA 4L4UA 2GAOA 2OXRA 1UKVY 1QG2A 4CEIA 4CIDA 1EFCA 2B7CA 2ODNA 4MYCA 4JVMA 1Z2AA 3F5FA 4WAUA 3QE0A 3OIVA 2IUUA 5J40A 4LJ5A 1P9RA 4HEJA 4QHSA 2J0UA 2GBLC 3OF5A 3THYB 2VLIA 2ZRFA 4ZDWA 1VYVA 1W36D 5EE5B 5DI3B 5AJYA 2GVZC 2PZGA 2WHXA 4A36A 4MKIA 1TQDA 3CPEA 3EC1A 2EWWA 3VKGA 3SR0A 1S1MA 3OHMA 1G21E 3SBEA 1WB9A 4CEHB 2ONJA 2X2FA 3EZ7A 2MSDB 5C4MA 4MYHA 3ZQ6A 1AS0A 4YDSA 2GA8A 2CNWA 3SHFA 1GL7A 3LWNA 4Q4AA 4UQOA 2X2EA 4S35A 2C78A 2WJGA 1DADA 2ZVQX 5J4KA 2HF9A 4AURA 3ZZTA 2P6RA 3RYTC 3V4FA 2NIPA 2YC2C 2IS2A 4URUR 1XTIA 4RD4A 4N3NA 5EE9A 1ZUIA 1KKMA 1S3SA 4LY6A 1N2CE 3EW9A 4PPFA 3PEYA 1XXHB 3RRYA 3WNBA 2F3TA 2Q3HA 2RAPA 5KPDA 1WDTA 5FTKA 2W6ID 4DUGA 2ERXA 2A7QA 2WM9B 3MRSA 4A1FA 2B21A 4RFSB 3D8BA 1GFIA 4M9QA 4EJSB 3HPRA 2AD5A 2QM7A 2XB4A 4HAVA 2Q3FA 1ZBDA 1P62B 3W6OA 4AYWA 2IYTA 1T5IA 4MRNA 1W46A 3SS8A 4CF7A 5KOYA 2GXSA 2QMEA 2HYDA 2J45A 1E6CA 1E98A 4HDQB 2R44A 1GNRA 2O8FA 1ELOA 4QBFA 3EA5A 3KX2A 5FBQB 3AM1A 4B43A 4AKIA 4BRWA 2AD1A 4LBYA 3K0SA 2R6CA 2O8BB 1WMSA 1ZIPA 4Q9KA 3P1JA 3TNFA 4IDNA 4BFTA 2ZRAA 3SYKA 3SJAA 1E2FA 1QHNA 4HB2A 1G8GA 1LF0A 3FDIA 1E32A 2ZIAA 1JAIA 5JCZA 4MKFA 1N5IA 4FMCB 4Q5IA 4DSOA 1RIFA 2QGZA 4N0EA 4PQRA 1T91A 2VHQA 4LV6A 4TMWA 2RGNA 1CR4A 1VCMA 4LJYA 4EPRA 3AVPA 1N3BA 5EP3A 3DDCA 1N6HA 4Z1MA 4LYJA 2B92A 1WP9A 5EE1A 2O8EA 1E9DA 1HT2E 1XWIA 2QRZA 3LW7A 2FPLA 1RZ3A 4DDVA 5J4LA 4KFUA 2JAQA 2OBLA 4V0ME 4D0NA 3I5YA 1QDEA 4U00A 2WICA 3L43A 2DWPA 4PX9A 5HZHA 3B78A 1QHIA 2VHTA 1CF4A 1IAQA 2AWNA 4D4KA 1Q1BA 4ILEA 5JRZA 3H2YA 2QRNA 1Q1QA 2V6IA 2GEDA 4D81A 4MKHA 3C5HA 3VR6A 1P72A 1GG2A 2RGNC 2I1QA 4HAZA 5FR2A 3TUJC 3ZDQA 3T1TA 4R98A 3RRNA 1XMVA 2ZRHA 1W47A 2DWOA 2IW3A 3CIOA 1CJMA 2VSFA 1CRQA 1G8HA 4KHZA 3NHAA 4XIGS 1P6XA 3VNUA 1G7TA 4U5XA 3RDPA 3TSWA 2MMCA 1FP6A 2ZR7A 3T5DA 3CW2A 3IIMA 2WMNB 4ZI3A 1O87A 1MABB 2XB2A 2C8VA 1GKYA 5CJ2A 2RGEA 1G17A 1G64A 1YZTA 1Z6YA 3FHTA 5GJBA 4WXPA 4IDPA 5KSOA 3AVUA 4HAUA 3SFVA 1JQLB 3UXMA 3L8ZA 3PEUA 2IT1A 3M6AA 4IDOA 2YZ2A 2P0EA 2YVUA 3OIUA 4DLWA 2IS4A 4KVAA 3DO6A 2F9LA 1TX4B 5CYPA 5FBWB 3U44A 3QIAA 2GEUA 3ZVMA 5CM8B 5G40A 1YR8A 4AD8A 5KNCA 2BCJQ 2I1VB 3O47A 4Q01A 3EZ2A 2WSMA 4C2UA 1P5ZB 2P67A 4PPNA 4KODA 3RS3A 5KU1A 1P2UA 2A5JA 4B47A 4EPVA 4A2PA 5CIQA 4DEYA 4NH0A 2H5EA 2WZQA 3HDTA 5IK2D 4KITB 2JJ2D 1IY1A 1HT1E 3HU3A 3IQXA 1NMYA 4NYIQ 3D6TB 4DT1A 1NP6A 3TAUA 1OH6A 1CJKC 4C30A 1VIAA 1II8B 3ZD7A 2ZYVX 4JLVA 3WYAA 4OQNA 5LBIA 3RNLA 1A7JA 1W7AA 1E2DA 4Q1DA 2DYKA 1Z47A 4JSTA 1GOTA 5EP4A 2PT5A 3HYRA 1WXQA 2JLVA 5KUTA 3R9XA 3QKRB 1JEEA 3CRRA 1S9DA 5L3VA 3FB4A 4YDHB 4KFSA 4CW7A 3C15C 4TSFA 1ZIOA 3U7FB 3U7GA 4GNKA 3C7KA 5JWHA 2QSZA 4ZV4A 1CTQA 5H70A 1T3SA 1N0UA 2VP5A 2JASA 3WP1B 1PZNA 2CCKA 1FPMA 1E2HA 1OFIA 4Q66C 3ETLA 2ZS7A 3VHLB 4A92A 5JFGA 2IUSA 5IRCD 3E2IA 1XJCA 2R6AA 2W83A 2MMGA 4K8OA 4QHTA 2DR3A 1TU3A 1QRAA 4MDEA 4ABYA 2D4HA 2WIBA 5F3WB 2GHIA 1KI3A 2KBEA 1NY6A 2A9KA 5HKKD 2RCNA 3LA6A 2JLWA 1N0WA 2DY1A 2PT7A 5FOXA 1RFLA 1PV4A 2KBFA 3OE7D 5K8IA 1R5OA 2GJ8A 2HLDA 2VL7A 4JLOA 1KYIA 4QBHA 3B1ZA 1T4GA 2OBNA 2ZYWX 4WBSA 4I1VA 5EXTA 2W0SA 3EIQA 4PR0A 4D0GA 1AQYA 2WWYA 3F3YA 3Q3JB 2EYQA 4JLMA 1IN8A 2XNSA 1JALA 2FN4A 2ZRCA 3G0HA 1JR3E 3JVUA 1N6PA 4OKSA 2ZUDA 2ZVPX 3HPQA 4DKXA 1ZUNB 2SHKA 2HYIC 1XTJA 5L3SB 4OJQA 3K70B 1P9NA 4OHWA 1T5LA 2J0QA 2ZJ5A 2GCPA 1NNEA 4U7DA 1XNJA 4DB2A 1PLLA 5JJKA 4TL9A 3I3SR 4HATA 4B2LA 3T35A 4DLRA 1FMJA 3A4NA 4RD6A 4BEBA 2BBSA 3LBNA 5FOVA 3AVWA 5KNDA 4DRZA 2ODWA 1E2KA 2NQ2C 4ESHA 1XD2B 2QAGA 3T1QA 2W58A 2XJ9A 3R20A 1E2NA 1ZU4A 5EQTA 3AKYA 3ASZA 5F9HA 4C0QC 4RCYA 4DZZA 2F55A 1GVNB 4PAQA 1CEEA 2XX3A 2J7PA 2A30A 4XTRA 4UNQA 3GP8A 2QMOA 4V0LA 3GLIE 2XTNA 3B13B 1OKKA 2PJZA 3MJHA 2NG1A 4QGFA 2W2VA 1NI3A 2OLKA 1ZD1A 1KMQA 3HP1A 2OFXA 3TSZA 2IWHA 3VR4A 2VP6A 5LDDC 4AG6A 1R0XA 5EE0A 5TMPA 1IN4A 1TQ2A 1SXJA 2GCOB 3WYFA 1BMFA 4I99A 1TUEA 1GWNA 2L0XA 2QAGC 1NSFA 2ZUCA 4IFBA 3FKSA 1ZVQA 2FPKA 4HB4A 4US2R 3QKSB 2ZJ2A 2KSQA 3QXXA 4URVR 3GPLA 2JLRA 2VEDA 5IT5A 2YKGA 4TLDA 4JLKA 1G9XA 1VMAA 3K0FB 4LRWA 1E0KA 3FGNA 3R9IA 1NVXQ 3LDAA 4HAYA 4LWZA 1CULC 3JZAA 4I4LA 2N1BA 2NPIA 1NSTA 1I4DD 1E0AA 4XSHA 3VU9B 1G3MA 1COWD 3Q8XB
chains in the Genus database with same CATH superfamily
2VDUE 3UKOA 1YWGO 1UBJS 4FGUA 4RANA 3DBVO 5JZVA 2OXFA 1CUYA 4R41A 3P9KA 1JI3A 1LJ8A 4X6YA 2Z8YM 1T3HA 4K81B 4NAHA 4X3PA 4ZAZA 2QGNA 3AF6A 1A3CA 1P9LA 1D2EA 2GLXA 4AG5A 2VG8A 1KOJA 4JEMA 2JCBA 4LWQA 4O2BA 5DOVA 4U9UA 3NH9A 2J3QA 4G85A 1TEVA 3H4VA 4WW0A 1HG1A 4CCWA 4WNAA 1UXGA 2AC2A 2D2XA 4KQEA 2ET6A 2B4YA 4NQRA 5E3HA 1WXIA 4X65B 2QN1A 1SCIA 2OP0A 5D3MA 4A03A 2GM4A 2WKSA 2JGIA 3HYLA 4D97A 1MGOA 4F4HA 3E3MA 2G04A 5K4GA 3ANSA 1YAJA 3EZLA 5EZSA 1N5MA 5J5CA 1TKRA 5GJWC 4RSHA 1M1ZA 2OHJA 1AIPA 3EIOA 2J0VA 2JLQA 3NM5A 1GAEO 3GLVA 2AGVA 4Q4HA 2FWJA 4D79A 2JKYA 2SBTA 3EQ6A 1N2IA 1Y8RA 4GR4A 5B3AA 1T8TA 2XB8A 1NNLA 4BXOB 1KO1A 1VP9A 1P0QA 2JIZD 4GDFA 4G3XA 1C80A 1U9CA 4A2QA 4GKJB 4DNOA 1X0XA 5KYUA 3TDMA 1HDCA 1JPNA 1NKSA 2EIXA 2H7CA 3V2HA 1SRQA 2N42A 4YMWA 4F2WA 3K71B 1XZNA 1AXGA 1NQ5A 3GRPA 4P34A 1RPZA 3VZQA 3NVAA 4MQ6A 5A3JA 1RQGA 3JD1A 4BMXA 4BWGA 1VC2A 1TUIA 3HFSA 4YRBA 5BSWA 1FXUA 1P2GA 2CNKA 2H18A 3JQBA 2BFDB 3MNFA 4BE4A 3SM3A 4JBGA 4DMFA 5BR1A 4L2IB 1YFLA 4K86A 4HO1X 5B7QA 4KFRA 1RWVA 3L7IA 1A8UA 1OX4A 4ZAGA 3SC2B 2Z2XA 4EHKA 5CG2A 1K2VN 2OZLA 2JH8A 5DTEA 4DPMA 1NX6A 1G9TA 1E2LA 1U65A 1YS2X 3NTVA 4JVNA 3VNSA 3AR5A 4CM7A 4B34A 5I7VA 3UUFA 3ZZUA 2WP0A 4C2AA 4NARA 2P2CA 5AUPB 3VPHA 4RTLA 2QG4A 1TEHA 4RPHA 4M0MA 4DV2B 3H1GA 3A14A 1VG0B 2ZAOA 3FVRA 1NBME 3OCWA 4PO8A 3ZG6A 2VTEA 1HETA 2PM8A 4BE7B 4KQJA 1ATZA 3LQFA 4MS3A 1Q6YA 2Q1SA 1ODCA 1DC7A 3OIFA 1ZLXA 3L8HA 3NTOA 4DSTA 3OWHA 4FR0A 5ADHA 4K87A 1AKQA 1Z33A 4P4SB 3MJTA 2ZTUA 1XLUA 3U4CA 3BGOS 2LKCA 1MBZA 2RK3A 1F51E 3LXMA 4B3BA 3DMHA 4D8UA 1GEEA 1F2UB 3E82A 4J1TA 1JS1X 3PR1A 4AX4A 4CMGA 2QLTA 3W5JA 1EZZA 5LA6A 3WIDA 1A82A 2FOLA 2PUHA 4DMMA 1WV0A 1YB1A 1U4NA 2IZ5A 3SF8A 3W1VA 2JLYA 3IQHX 4LOAA 1U1CA 1H6DA 4NZ9A 1BDJA 4IEFB 4C3UA 1TUGA 2HA2A 3TOXA 3UK0A 3BORA 3QJGA 3GNSA 1RZRA 5EIAA 3ICCA 4TZ6A 1BNCA 1D9ZA 5F3DA 1DIHA 4QKQA 1X80A 1D04A 3HGMA 1XK7A 3CB4A 2P2YA 1QBKC 3AKCA 1XMPA 3NP9A 3SC6A 2IU4A 4E08A 5KSPA 3THRA 1I3NA 421PA 1HT3A 2ACVA 3KTFA 4EPTA 1MT3A 2P1RA 4WASA 2C5AA 2NZ2A 4C21A 4WZBB 3ELWA 3OCYA 2GEFA 2BBWA 3BA1A 5FNVA 1F0YA 3OESA 4AM8A 4W5NA 1X42A 1JBKA 1T29A 2IHYA 2VYFA 3HC7A 3TZCA 3OC6A 1K3TA 4HMPA 1DBVO 5CEJA 1LPSA 2ATEA 4NCBA 2GX6A 1Z6QA 5IUKC 4KGZA 3JVVA 4ZV7A 3L4JA 4ZXFA 5EIEA 5I7AA 2NTVA 1T8YA 2BGGA 1PL8A 4KTVE 4R1PA 7ABPA 3AJ9A 2JGFA 3DXZA 3H18A 3ZZMA 3BWMA 1RRCA 2GMWA 2P6UA 3K09A 3VC2A 1P4GA 5ITWA 1IUKA 4OSEA 2XXAB 4HV4A 2ZR8A 1IG3A 4JZKA 3B89A 3U9TA 4YR9A 4YCSA 1XMSA 3N0TA 4XVUA 5I5EA 3GJ4A 1KMCA 2I3GA 5C7OO 3G9XA 3X1WA 1K6MA 1WXEA 2CJYA 5HKLA 2QJRA 3SQDA 4CEIB 2LNDA 3TNLA 1XNHA 2I4OA 3D43A 5HS6A 3W3AH 4MITA 4BV3A 4OHMA 1FXWA 2A6PA 4LV8B 2J0UB 1Z37A 1VHQA 1V26A 2ID9A 3GIWA 5AKZA 4TTQA 1Y3FE 4S1OA 1V96A 1OGYA 1A5ZA 2SECE 3P26A 2OWEA 1PX0A 5T6MA 2GK7A 1LLCA 1YE3A 3IDQA 1OXTA 3ZXSA 8OHMA 4FEYA 4FE4A 3KKNA 3KQNA 1JW9B 4YAEA 2GK6A 4C0AC 1EGHA 1UK9A 3UT5B 3KWJA 3WSWA 4YRIA 5H8WA 2C2GA 1JNYA 1R6TA 1VG9B 1RP1A 1FRQA 3B12A 3K3PA 3FWKA 4NONA 2XD4A 2QRVA 1RYNA 2HA0A 2E4AA 3BWCA 3BULA 2O7VA 1FSSA 3JYPA 4LEIA 2OCLA 3VOSA 2IF0A 2Q5FA 2ZSFA 1Z6ZA 2OC4A 3SR3A 4C4TA 2FRDA 3WA6A 4NP6A 1T4BA 3D1LA 4B74A 3FUVA 1KVRA 4IRUB 5I9BA 4EKYA 1F20A 2BKVA 2Q99A 4BNTA 1U3VA 4XIIA 4EARA 4LMAA 2VPIA 4EYEA 2IUEA 5DI9A 1UFRA 4TL7A 4PINA 4EY7A 5EIBC 4OXRA 4E5YA 1SQ5A 3WAKA 4EP1A 2OM2A 1WCWA 4DMLA 1LLDA 3IP6A 1AMOA 3FLEA 3KJXA 1QTNA 2IZZA 5LP1A 4CCYB 3ZE9A 5JAZA 2ST1A 3ZCSA 4MGKR 1NUAA 5EI5A 3WX0A 4PPYA 1I51A 1KVSA 1M9NA 4LCJA 2O3QA 1HDXA 2BJWA 2O1EA 4G6ZA 2KYRA 1VI5A 3AINA 1E3LA 2X0IA 2C2OA 3KWMA 1J4AA 3P0JA 4Y2VA 5DB4A 1M76A 3UG7A 1PSDA 4RK4A 3GRKA 3QY0A 2P0AA 4J1NA 1YR3A 3RHZA 5L4LA 1X7ZB 4AP5A 1JEYA 4L8YA 1I0ZA 1RYDA 1I2AA 4NJEA 4DMRA 3LQ2A 4FN4A 4GI1A 4BGVA 4G0NA 4DG5A 4GI7A 1CLEA 4D74A 1KRXA 4GG1A 4ROSA 1IPEA 4YJ3F 4R9UC 5EN4A 5BWNA 1Y3CE 3QPVA 4RKEA 4NOKA 3W5IA 1BCRA 1A2BA 3EJ6A 4OBWA 3TBFA 2BMVA 3ZYZA 5FPSA 4DGQA 5JAHA 1SC9A 3CPJB 1ZM9A 4DRYA 4QSHA 2R5WA 1LNZA 2A9FA 2BKEA 4GOMD 2AZXA 2QL6A 1IM2A 3A2NA 3NRJA 1F2DA 4LOHA 4RHCA 5KEIA 4V2IA 2IXDA 5AI6A 1NW8A 3A6LA 3DNMA 2NLOA 3OUZA 1K89A 1SUCA 1YCFA 4OXIA 4MROA 3AETA 5C4GB 4G0YA 2UZ4A 3DONA 4TWAA 2Y0BA 1MOZA 4DC1A 1UBSB 5AUNB 3VYTB 1WABA 4H6WA 1O3YA 3VJKA 4CIYA 4EO9A 2DY0A 3FSEA 2VRWA 4JELA 4MR9A 2O8EB 3U62A 3PXGA 4PM4A 4JK3A 5EIBD 3E35A 4TT8A 3OQVA 1I4TD 2Z57A 1GZVA 1Z2EA 3CKMA 3D2AA 4OU5A 3EJWA 5A6VA 3S1LA 5K2MA 1KNQA 1T35A 5TT0A 1EEHA 3FMFA 4JLDA 5F9MA 5CB4B 4PC3A 2NV6A 8MHTA 4Q1FA 3BCUA 2OWDA 2CMFA 3OURA 1KDRA 1TLLA 1ES9A 2GYYA 3UC5A 1OTHA 2SCUA 3A9SA 3EHEA 3ELBA 2BI8A 3CC8A 3KL4A 3L04A 4L5JA 4FYPA 3DHYA 4L7QA 1RI5A 3FNBA 3DPIA 4N82A 2WU8A 4GDMA 4OHZA 1H22A 2G17A 1OAAA 2C4WA 2VHEA 3BK7A 1O9BA 1Z5UA 3B9RA 3EVFA 1II9A 1ZAYA 3TNDA 1XBTA 1MEOA 2J41A 4KU4A 1ZYUA 1EFUA 1Z4PX 3STHA 3HFGA 1OWOA 1U3CA 2JAUA 1OIXA 2ZI5A 3BTOA 1A5SB 1MPXA 2D0DA 1ABFA 3KB1A 1JDNA 4JEIA 2Q2QA 3E3OA 5FHQA 1XMIA 2ZW9A 2IC5A 4LXHA 4D3YA 1U8FO 2AN3A 1RAFA 4GXNA 2AH5A 3CVJA 4UUMA 5ALPA 4G1UC 1TZJA 3JQGA 2IXTA 3T94A 3ED5A 4LYHA 3NYIA 4XTCS 3R8CA 3MWLA 3LDUA 4RAQA 2X0NA 1C7IA 4M8IA 2XMRA 1H9AA 4LIPD 1U3UA 2PKQO 3SDSA 2PUFA 1Z29A 3HL4A 1LFAA 3ENVA 3VKHA 1R0SA 4TGLA 2BIFA 2XXBA 2JHCA 3TDKA 1N4DA 1XLTA 2CJWB 2FSUA 3ORFA 5C8YF 2B36A 4E51A 5JZSA 4RZXA 4FT2A 4QYTA 1E4OA 1Y5NA 4ZAFA 4E1AA 2Q45A 5E8JA 2QU8A 2QD3A 5CNJA 4ZAWA 3V1YA 5IJAA 1XDSA 3SX4A 3O3OB 3SKVA 4DWWA 2HCJB 2I4LA 7MDHA 2ZCVA 1DB3A 5BMOA 2YY6A 2Q0QA 4FC6A 1QP7A 1GT91 1PG5A 3P8ZA 1PJCA 3Q3CA 4HDMB 5L4NA 5J43A 2XWQA 4L5YA 5E1DA 3ZX5A 1M10A 1ORVA 4IRXA 4Y0NA 4CODB 1ZG3A 2CUKA 2Z5LA 1P7VA 4DIDA 4DCMA 4RTKA 1DG9A 3PNYA 4BECA 2Z5GA 1AX9A 1RD4A 3LGSA 3FPKA 3UK6A 2WA1A 3TQFA 5HJ5A 3DZ8A 3DMTC 4XLTA 1C9NA 3NWBA 1HRKA 3R7WA 2Y76A 4KRYA 2YIDA 3H1EA 3MWEA 5EESA 4Q24A 5TJ9A 4BNLA 1N3IA 1X14A 5AXCA 2EFDB 1MF7A 1E89A 5AVXA 4R5MA 3R9XB 4XSVA 1P61B 4N0PA 3DDOA 3BG5A 3Q7EA 2FJPA 4LJ6A 4XCXA 1JEOA 2RB5A 4J0KA 4Y2TA 5K6AA 3HSSA 1TRHA 1WZCA 4RUKA 4AIRA 4F4DA 1YASA 4M7PA 2PVPA 3MMZA 2QLMA 4UBNA 2A7XA 4X63A 3A11A 5E6RB 1RNLA 3LK6A 4O02B 5IK2A 4Z8YA 2WYVA 4U63A 4WNYA 4D3XA 2RGCA 5CH3A 1KO4A 5T41A 4D9EA 4GGMX 1A7UA 1V4NA 3KDSE 2ICAA 1BA3A 4CM3A 5LFAA 4UATA 1ZCBA 4DR7B 3UMJA 1JB1A 4NXMB 2ZRPA 3ROXA 2O1SA 1I9CA 3ESXA 4ITRC 4WERA 2BUAA 1ZI6A 3GP5A 5CD9A 3TTTA 4J94A 2QD1A 2EATA 2GFIA 2CL7X 2PD3A 2X2PA 3O9ZA 4KVFA 4PCLA 3WGLA 4JKYA 3GLFA 3A2KA 3GHYA 1JRLA 3RVSA 5A5GA 1HFJA 1SD1A 4N9WA 4H0FA 1S4MA 5LYJA 5B1HA 3GEHA 1IHDA 4CIXA 1LSJA 3OA0A 2YNMD 4G97A 2FX3A 1DARA 1PGJA 3LNTA 5ECWA 3HXPA 5EZ5A 2X77A 5HYVA 3GFFA 2QLJA 2C2YA 1W48A 2IU6A 4NECA 1SVMA 2ZIGA 4RK7A 2F6RA 3NATA 3THOA 3THXA 2YY7A 1H42A 1GNVA 1L5ZA 5JCOC 5G0UA 5A0TA 4X8MA 4ZI7A 1P8AA 1F8XA 1JVSA 3OTGA 3U40A 1TU4A 2FWPA 3IIKA 4PXSA 4QUKA 3TLKA 2H7XA 2Z1DA 3DL2A 4LXTA 2A88A 4QTTB 1RI1A 4U2KA 5HM6A 3KQTA 1Y1LA 3ADCA 2JHFA 2PQ0A 2PSFA 1NUUA 4HDKB 1V25A 2WSIA 3ZVLA 4F9GA 1MB4A 5ISMA 1E9AA 2W48A 4MWSA 1DAIA 2WWWA 4DZTA 4WKNA 4YXWA 4BDTA 2O2XA 3PFWO 1ESZA 4RHEA 4YMSA 1I5RA 3ZPXA 2FVXA 3OZGA 2I2BA 1WKBA 5ICFA 1XL1A 1RBZA 5DBEX 3PRYA 4XDYA 5A5VA 4KX3A 2X1LA 2HFJA 5CHEA 3KJFA 3AO0B 5E2BA 4DGSA 2X19A 2OHFA 4F9FA 1ZMXA 2NYUA 4V3BA 2EF0A 1NW7A 1YOVA 4RADA 3ESCA 3OZTA 1CY8A 3IURA 3ZBUA 3MHPA 1JFLA 1HK7A 4PYNA 5DIFA 1YDWA 5EHZA 5IVPA 3CH5A 4HMQA 4UJ3A 5JYBA 2HHAA 3FFAA 3QPWA 3F3KA 3V7NA 3VU8A 2Q1XA 3VR2A 2HPZA 4G26A 2NU7B 3LY7A 5FI5A 1U4OA 3BHMA 1XELA 1TIPA 4FGJA 1M1NB 5JZOA 2G5TA 4D4JA 2UUCB 4FDTA 3PRKE 1DMSA 2H00A 3NT2A 3BDIA 1K8ZB 4BKQA 4LF6B 4BTVA 1VG1A 1UXHA 3ID6C 2A3NA 3K5HA 2VYCA 5EZYA 4NCHA 4Q1VA 5E3JA 2AG1A 2NZYA 5AI9A 4BO3A 1FFSA 4BO2A 2X3FA 3JQ9A 1RJFA 3QFHA 1YJCA 4HEA6 4XWGA 2VJBA 4JT9A 4N9QA 4X54A 3TZBA 5BV7A 3L9XA 4D8VA 3HM2A 1SUWA 1O03A 5KWSA 1XTUA 2R97A 1PR1A 4I4TA 5AXDA 1FQOA 3ZWDA 1LPOA 1LPAB 4OYRA 4TLBA 4J0JA 1XZQA 1UMDA 3EEIA 1RSZA 2C7GA 3AF2A 1OLSA 2P41A 9MHTA 5DXAA 4MW2A 1MAHA 3V4VB 4NDNE 4QNNA 1ZWKA 2CXTA 4UMFA 4XD7D 3IAXA 3WGZA 3G59A 3L1UA 2VF8A 3PNBA 2ODAA 4ZJUA 2FPIA 5AIAA 1RIIA 1ZMTA 2X5XA 4X1IA 5IDWA 1YZ3A 4OU4A 1OYVA 4H27A 1QGUB 4O3FA 4ZOLF 3SY8A 2EDCA 4QFDA 4PZ9A 1SXGA 4K9KA 4JBXA 4OREX 3OM8A 4DADA 3C85A 2O0MA 1R18A 1BEEA 3IR7A 4ZDIA 3R3ZA 4TTRA 5I47A 2J0EA 1TAGA 1FK8A 3ZDFA 1QBGA 2PA3A 2A8YA 4Q16A 2J67A 2ZI9A 3DYBA 4GMXA 2EZTA 2QN9A 1KY4A 3NOXA 2CLSA 1Z45A 3CRMA 3LKDA 1EYZA 3DT9A 3QGMA 5IPFA 4D4LA 3IEMA 2FPMA 2O3TA 3PQEA 2FQXA 4MVJP 1EWTA 2ZSEA 4KIJA 2CLCX 4Q7QA 5ED4A 5CX4A 4NU6A 3EPHA 1QO7A 3LYLA 1R74A 5J2TA 4HH0A 2IY8A 2JCVA 3D8RA 2APJA 1TW2A 3GGPA 3P7MA 4IDHA 4O2BB 3V1TC 5F35A 1IC6A 4HWKA 1NQUA 2H2WA 3FWNA 4M46A 1IN5A 4WZAA 1P3JA 4EB0A 3R5JA 5D3MB 1GSOA 5F7ZA 3TFWA 3KLOA 1UJ2A 2H9AA 4FCCA 1P19A 2PYZA 1QYXA 1WXGA 3KKOA 4LJKA 5A9TA 3W7AA 2ZCJA 2EG5A 2F1KA 1LF5A 4UQPA 1NYRA 1S2GA 1JIQA 1YUNA 4J03A 4Q4HB 1COWA 1XT6A 4I4NA 4KXXA 3PXDA 1JDSA 1Y8RB 3EXG1 5IVIA 3RYHA 3BSSA 3HV0A 3ND5A 1JAHA 4EI2A 3Q41A 3ZNOA 1B0UA 3V3TA 1Z2DA 1GY8A 5KYUB 1JQEA 1PFGA 5E2IA 1GSHA 4JA2A 4QJIA 3GDWA 2GERA 2PUAA 5IEJA 4DV1B 1NAHA 1HDEA 1E1QD 3BGDA 2V7BA 1JLKA 3IBCA 2KW5A 1VPVA 4FYJA 1MQ8B 4EUNA 3K1YA 4EZIA 2WG1A 3KHUA 5BT9A 2O0HA 2Z08A 5IANA 5CA1A 3EQ9A 3HCWA 3Q7TA 1OX4B 4J49A 4RA9B 4GW3A 3P0HA 1U7WA 3RU9A 3KB8A 1RAIA 1P73A 5D7NA 4F4FA 1TU0A 2OZLB 4BGUA 3I04M 2QTWB 4RABA 3GEMA 1GHTA 1N5OX 4DWVA 1CRZA 3RANA 3KJGA 2FW6A 3GLGA 1QTIA 5LD2B 2YJ3A 4PU0A 3UMFA 1UFOA 1BTOA 3HR4A 2JIZA 3MRXA 2VVTA 1BX0A 3IEPA 3RIEA 3V7UA 3SXJA 2Y0EA 3E9NA 3IO5A 4MA0A 5B58T 1SKMA 3IEVA 3MAJA 4MS3B 4D6YA 3KELA 4XGRA 2D1FA 2GH1A 3WY9A 4D9NA 1DXOA 3B1XA 4H2DA 3L0ZA 1JFVA 4AO8A 2FPUA 2JNWA 4MJ3A 5LMZA 3UHJA 1KZ6A 2BGTA 4EB8A 1E6KA 3NQ41 2XTMA 5C1PA 1IOZA 1NATA 4D6XA 5K0EA 1YF3A 2HQSA 1AUPA 1NWCA 1UQRA 1YZGA 3JPWA 4H60A 3SU8A 4PZCA 3W90A 5LA6B 1BO6A 1TJ5A 1JX6A 2DFTA 5AM0A 3R5KA 2XIQA 1T2AA 4F0JA 2ENWA 2QQGA 3SF8B 5C34B 2WKPA 4TVSA 3IS3A 3QF4A 4WFQA 3OFNA 1TUBA 4YQFA 3ZHVA 3PC2A 4WPGA 2OZEA 4RMHA 2O4CA 2BSXA 2G8NA 3H97A 1LRLA 1X80B 1JHPA 4QPJC 3VKWA 4LQDA 1T34A 2DH6A 2EFCB 2VK1A 4MV8A 4WZ6A 5BSVA 4BNVA 1DAMA 4D8TA 4DLSA 2I2FA 2WU0A 3ABRB 4IIFA 1BHJA 3KLPX 4LA4A 4QNRA 4JV5B 3O83A 4XW2A 5TPWA 2AG0A 2AK3A 5K8CA 5FNVB 1Q74A 3WLAA 2XLCA 2XJ4A 2JIMA 3WGJA 1OHHD 3N2YA 3V6MA 3T8YA 2ISCA 2C84A 1BWQA 4Y6PA 3M6IA 4RAOA 2G7ZA 2Y4OA 1Z9BA 1U0TA 1YA6A 4DDHA 1XNGA 3BH0A 3GEDA 5GQSA 3UXEA 5BSFA 1VJ1A 2PXAA 1UT5A 1P81A 3LSYA 1X8KA 4W8HA 3UWPA 4BLOA 4CETA 4BCCA 3O38A 4ZGGA 4J4HA 1ZNZA 4MWDA 5DNDA 5DV9A 4AB1A 3AQ4A 3DMGA 1Y6QA 3W8NA 2W2XA 3ND8A 3NKFA 4RE5A 1GRCA 4B3DA 2HEGA 2FMXA 2ZPAA 1NASA 3UPUA 1G19A 1UC4B 4WLVA 5G3YA 1YRHA 3EYAA 4LJRA 4C87A 1F0NA 2GPWA 3DLHA 1T4CB 4M88A 2ZRQA 4YIKA 1WZEA 2ONYA 5FXMA 2MDTA 4NQZA 4D9JA 4A6PA 1CJVC 2YHUA 2H8GA 4LTNA 5FWDA 4RL4A 2PE5A 2PAAA 1V16A 1RM0A 4HRXA 1N0IA 2ACWA 4FC7A 4HRVA 1CUSA 5DKFA 1YQTA 1V8BA 4HUQA 3TCNA 1N1GA 3G13A 3B48A 4AKEA 3D5QA 3LL4A 3IJ5A 2QTTA 3G9TA 2BJHA 5K0LA 2F8TA 5JDIA 4B4WA 2G7MC 1EHYA 4KE9A 1YQEA 2J9FA 4IS2A 4R40A 1MN6A 5KO2A 2EX4A 3G1WA 3LC0A 3HZOA 1X39A 4DJ5X 2ZXEA 3KJIA 5ALJA 3AIOA 4RIHA 4BLVA 3U4MA 1C81A 4EGCB 4GZ6A 2BOVA 2A9VA 3S1AA 4LXYA 4Y2GA 2ROQA 1EFDN 5CLJA 4RW0A 2VP2A 3WDKA 1KK1A 1XQ9A 1YA8A 2FWIA 2R8XA 2XF8A 5TVGA 1PJ8A 2XRZA 1TO1E 1JI0A 3C7TA 1YH3A 4M1YA 5CYOA 2F8MA 4CV2A 1A2KC 3L6EA 4BJHB 2PKQP 4ZREA 1B3RA 3U4IA 3R09A 2WTMA 1A98A 1ESMA 1U6JA 2AN1A 3D8UA 4BE9A 4D7AA 3ZHQA 4D96A 2BFAA 4GC5A 5LXTF 1QJ4A 4EFDA 3RQSA 2ZOSA 3KOZA 3GO4A 1H9BA 3BMQA 1RRVA 4X7PA 3UCEA 1RI3A 1SVWA 5LOVF 2D5AA 4GBMA 1P0IA 2CXOA 5LQRA 5CB8A 4AWXA 4AO6A 1JEYB 3I5UA 1FJGB 1M54A 2I6TA 2F8LA 5DHQA 2O06A 4N47A 4HLQB 4PC7A 4NJEB 3VO2A 2OGWA 1R2QA 3DFKA 4W7IA 4B6GA 2H2IA 3CTMA 5DK6A 2HNBA 2Z98A 2HSEA 3VSBA 4AZWA 1X94A 2JIOA 3A8TA 3Q9UA 1JF8A 4EFMA 2PIDA 3NWOA 4TMXA 1ZY2A 4LUCA 1BCRB 2IU3A 3I4FA 1XVLA 2HU7A 2NVOA 3P9CA 4S0XA 1X2EA 3CRZA 5U4XA 3BX1A 1WBDA 3E15A 1BHSA 4GO1A 4QX6A 3N86A 1ZRMA 5LLTA 3UUWA 4MV9A 1SEPA 4BFVA 1SQ6A 1KHHA 5JZBA 3AETB 4QASA 3ZTTA 3SM9A 3CZMA 3EBOA 2ZIWB 1CVLA 3RUHA 1WZ2A 2J3KA 2PEZA 1RTKA 3HDGA 3NETA 4JYCA 3GAMA 4S2EA 2QLFA 4MR9B 1LNQA 3FFBA 1XLVA 4HQKA 2BHSA 1IY2A 4HGOA 4XJXA 1SWWA 3AX6A 1TECE 3HDQA 2PUGA 4JLNA 5CBPA 3GLFE 1TW3A 3QSYA 1GQSA 4H7EA 1GRVA 4OMCA 5DGTA 3LHIA 2QHXA 1SWVA 4TL6A 5EJAA 4PYJA 2CJPA 2VXCA 1FP2A 5ESRA 1R4AA 1RT9A 4LHSA 4N54A 4WOCA 2DX7A 2FCAA 2V5AA 4FUQA 2QJWA 1JIKA 3TRHA 5KX5A 1IFXA 3STWA 1PNRA 3UICA 3PUKA 3RK0A 4AECA 3H4MA 3NNSA 2XZDA 2G72A 3J81A 1KOLA 2OHGA 4QNMA 1E0SA 3HB5X 2SCUB 3DCJA 5DSXA 4A91A 4AP9A 5IFLA 5JBIA 3KKMA 1OT5A 4WKOA 4DG9A 3NC0C 4IDCA 1VJRA 5CA0A 1SBCA 2AOXA 4HVAA 4I8DA 1K75A 1CVIA 5FJJA 4F1JA 2Y92A 1R8JA 2YCLA 1Y48E 4KX5A 3NC4A 3CH6A 1SHTX 4KPFC 3URKA 5AK6A 4AG3A 4PLGA 3X2FA 3WGIA 1FZTA 3LBAA 4GVLA 3ML1A 1YZQA 1QFYA 1PT8A 5EIWA 1EXDA 4GS5A 3U4GA 2JB9A 1QLJA 4JJEA 1P0PA 5BVHB 4QGGA 5I8WA 4P86A 1JEAA 1WB6A 4X45A 4ECEA 1T1IA 3JQ7A 4NK5A 5DWDA 1Z6XA 1WCIA 1QO9A 5B4UA 4LBWA 2VH1A 3JQGB 1L5OA 1EAMA 1M6VA 2AOUA 4A9AA 1ECJA 1JJFA 3BDVA 4P3OA 4XUGB 4C2TA 3RC2A 2WAMA 2GXUA 4UMDA 1S3FA 2B30A 3R6WA 4MUBA 2QJOA 4KAFA 1SURA 4QOGA 1IK6A 4AJHA 5C8DA 1EK0A 3NHBA 4C78A 1T1EA 621PA 1MUUA 2GZAA 3NBYC 4QULA 1HDOA 1Q57A 5BRNA 1WW3A 3AJDA 3DV2A 4S1TA 4W7SA 5EZQA 3OF3A 5EFZA 2B2XA 3U3XA 3VMFA 4B2YA 1N57A 2KJQA 1XCLA 3ZQJA 2UZ0A 4JHXA 3U2QA 1G7CA 3VH2A 1G2IA 4W1PA 3W78A 5AKYA 2O5VA 5J63A 4OK5A 2R4TA 1SQ0A 1U0LA 3JASA 2B1QA 5CURA 3H9JA 4MW1A 4CE6A 4NKRA 1UK6A 4HS4A 4IQGA 5TY0A 3IUYA 2H1LA 2V96A 1VPTA 3CLSD 3E4CA 4S12A 3U48A 3CV3A 4I5IA 2OR3A 2VRCD 1G8PA 4IFIA 4UD2A 5I7HA 1AKVA 4D0LB 1ZU5A 2JZOA 1K6XA 2VZ0A 3UGKA 1TQ8A 3M0EA 1F5SA 4UTOA 3HE3A 1TCUA 1NBEA 1ZJ6A 1MC4A 1LTKA 2R1UA 2XADA 4KO3S 5TV2A 1DOAA 2CZGA 2W6OA 1O54A 3L77A 2SKCA 3WBBA 1Y63A 4A0HA 1RZUA 4ZO4A 3R7WB 4LE0A 5AOVA 3IMEA 5BV0A 1VA5A 1ZC4A 1SHLA 2Q8QA 3B9PA 3OVMA 4YWJA 3UBTA 4TLAA 2P77A 2YQ4A 3QLTA 3PWZA 3NIBA 1I7SB 2TRSB 121PA 4P32A 4HN9A 4IOLA 3QV1A 1C3EA 1NWHA 5EKSA 5C5DA 2X5OA 1PR4A 1TZKA 4UM9B 1F17A 3PV0A 4XGIA 3S2IA 2C83A 5FA5A 3N7TA 1NXQA 1KGDA 4HH3C 2VWPA 3REFA 3EARA 1HNNA 5EKUA 4ER7A 3LDHA 4R8LA 4XUCA 4YCJA 3ESBA 3OPYB 3U7RA 1YU9A 3SHVA 2FFJA 2ERYA 1TCAA 2Q0SA 3IPCA 3MWJA 4RD3A 4XQ0A 5DTIA 2JLUA 3TIFA 2C0PA 1MQ9A 2RHGB 3LCMA 2VH2A 3ETCA 5K05A 2PS1A 4AJOA 3GLFB 3FZNA 3OZDA 5BQPA 2VIIA 1R9MA 2O9JA 5I4BA 3MAAC 2RGYA 4GR5A 3WTBA 5LYJB 1N0HA 4EJMA 2G25A 1Y9DA 3MTIA 4FUTA 4LDAA 3JD2A 4WZAE 1N4AA 3DXFA 3G8DA 2ZUBA 5FBRB 1HTBA 1K9VF 1NXTA 3VAYA 3W5VA 4FMPA 3TLJA 1FU4A 4FLEA 3INRA 3PEVA 2DJ5A 2OCKA 4MUIA 3VH3A 1DQNA 4DPKA 1SCAA 4HDAA 2VPQA 1EUZA 4GD3Q 4BNFA 3DCNA 4ZI7B 1ORHA 7REQA 4PG6A 4JI5B 3CG0A 3ZNNA 1WMAA 2W2TA 2VSQA 2V03A 1ABEA 1PEDA 1U2ZA 2I2DA 4ZI2A 4I50A 3RRXA 5JLJA 4N01A 4B48A 3LCVB 3VRHA 3UG6A 1NT2A 2ZWOA 3T0GA 1VMDA 3DHEA 3EK2A 2B8TA 3LC2O 3QKIA 5J5VA 1SVIA 3CTPA 4OMUA 2HRRA 3V7YA 3LX8A 1TKBA 4M9CA 3ZDRA 2YQZA 4UUNA 5KZMB 3ROGA 1QF6A 5E4YA 4JXZA 1KS2A 5E4JA 5ADVA 3P0FA 1EG2A 4TL8A 2IHUA 3HU5A 5B1IA 3TQCA 2YNMA 1HYBA 2PUCA 4BO8A 5F5XA 3AUYA 1G5RA 4OL0A 5FI1B 2G08A 3KQVA 7GPBA 2XR1A 4EPYA 4X71A 4ZJPA 2YVKA 1KBOA 2NXWA 1XDZA 2NAPA 2PXCA 3C3MA 1XYGA 3IUMA 3LOPA 3ZWMA 2J6HA 4WK2B 2NV0A 4MPJA 4WNIA 4XPZA 1MO3A 1NVTA 2GZ1A 2M9MA 2OHOA 2R11A 1IXRC 3I8XA 1YOVB 3P0RA 2OBBA 3OJ0A 5B1DA 3AM4A 3VBCA 3GLGE 2HCBA 4YMGA 3TYXA 1A4XA 3I8OA 3N6VA 4H16A 3OC0A 4BU1A 3SXUA 4N7BA 1A27A 2RONA 4H77A 1BHQ1 3OMXA 4MMYB 3S0JA 2W4IA 2YN2A 5AW2A 1P45A 3DTTA 4EHNA 2XRYA 4RTJA 2W2LD 1OLUA 1M67A 4R84A 5IU6A 2NADA 1VCIA 2JEOA 4IIUA 3UT0A 2BFFA 1LK0A 1DKMA 1HE2A 4C0KA 4KCGA 4ZCIA 1KH2A 2YS7A 2HX1A 5L7WA 2NT4A 4A8JC 3QUSA 4K7JA 5EZYB 3ZJYA 4D2IA 1WXDA 1ZL2A 3ABIA 3N0VA 3M5PA 4IOMA 4EENA 3TMAA 4Q7MB 3H1TA 4N48A 1CEYA 3A1FA 3KQHA 4BMSA 3E9DA 1QORA 2PD4A 4O2AF 3WLMA 2P2SA 4I4TB 3GNLA 1NXSA 3WGTA 4R8MA 2VOEA 3N6XA 1QF7A 1UMDB 1I3MA 1Y34E 2JFPA 2QUZA 1OLSB 4K9LA 1DLIA 2DFVA 2NQ8A 2O6HA 1J24A 2AW5A 2GN2A 3U09A 3K0CA 3QVJA 3PGLA 4PO1A 2PV7A 1QG6A 3TAXA 3RSGA 3ZWBA 5HPYB 2QQEA 5HVNA 1IXKA 2FPIB 4G5HA 1BDHA 3NM6B 1E64A 1UDWA 4KDRA 1JPUA 2R6GA 4Q3DA 4BNXA 2CV0A 1E20A 3FSRA 4WHMA 4PYRA 3KKQA 4IJ6A 5FYQA 5BPHA 3AB8A 4Q1AA 5CK5A 3FCAA 3FCXA 1BA2A 1FS5A 4MW0A 3BQ9A 1K8QA 1JKXA 2I3AA 4V2UA 521PA 5IZCA 1U7DA 4EA9A 1XJWA 2D5IA 2J9YB 3UJ9A 3TQHA 1W44A 4GPEA 5MDHA 4HNVA 3OMLA 3SIWA 3SSOA 4OM7A 1O4WA 2Q4BA 3T5AA 5EPUA 1D4AA 3M4NA 3FF4A 4ZODA 1FS6A 1P1CA 3NIWA 3DUFA 4B6FA 2J07A 2Q5HA 5J2TB 1GILA 1Q2UA 3AMVA 4N6GA 1OQAA 1ZOSA 1UFQA 3FYTA 3JSAA 4Q7LA 4XD7A 4IUBS 3UF0A 1UDRA 4BVHA 1CCWA 1V4VA 4D8YA 3E9MA 1DELA 4RLHA 2JJ1D 3MAGA 4NAUA 1DUIA 1P44A 2Q49A 2OCYC 1I10A 4WZAB 3FOFC 2D2EA 3GK3A 3VO9A 1KOFA 1ZBQA 2DH5A 4QYMA 2G3YA 5EG5A 4UEQA 4ALKA 4MEJA 1KBQA 4TWZA 4J16A 5F1KA 1VKRA 4QE3A 4A3SA 3U19A 1P4HA 3LZ6A 4BNMA 1Q3KA 4XX0A 5HJ2A 3LUKA 3BXEA 3QOWA 2J3EA 4GPIB 2XYRA 2BFOA 5K3SA 2C7VA 3I23A 5D3QA 5KHAA 3RYHB 1AKRA 1GZ4A 3MTEA 3BIFA 4R1TA 2H16A 1NONA 1WKVA 1JHUA 2WB4A 2R8ZA 2OGZA 1JSXA 2HA5A 1Q16A 2E4XA 5HE8A 3SZGA 3PRJA 4M0PA 3HBNA 2GLTA 2R6HA 3NAZA 3T1HB 4RCZA 1H2HA 2GBGA 2PKEA 3BXXA 1E2IA 1UBKS 4HXEB 4QT0A 2PWPA 1NIPA 3EODA 1QQTA 3I1YA 3G2OA 4BNUA 3KKLA 1GKKA 1T43A 1ZLYA 4N8DA 4RD0A 5CA1B 3U60B 1ST2A 3C1AA 2PPVA 5G4LA 3SE7A 3K9GA 4BYGA 2C2HA 3BGVA 4N6OA 2ENUA 1HPLA 2GZRA 4N3GA 4PC6A 5T8KC 4EKEA 2E4ZA 1EIWA 3WZLA 3A58B 3IOYA 1Z18A 4NYJQ 4OMDA 5AJWA 4CL3A 1DDGA 4QSMA 2UYOA 1ID8A 3MTBA 1X1TA 1K7YA 6REQA 3GLGB 1GM5A 3A3NA 4UDNA 4NZYA 2X86A 2HUNA 4AZ0A 1SIBE 3E2MA 3UJ7A 3LIPA 1AUVA 2IA5A 1TTTA 1L8OA 4I3FA 1PYOA 1POXA 3PEWA 2P5SA 1NVGA 4R81A 3A26A 4JGGA 1FQWA 5DXJA 5JD4A 1E1QA 3BK1A 5FP0A 5JAMA 5LUBA 4MARA 5DNAA 3NBAA 4ZU6X 2JJYA 4M1KA 5A9RA 4KFCA 5ER6A 1ZQ9A 1ENPA 2MOKA 3PUWA 4BC0A 2WYIA 2H0RA 3OE1A 5DHUA 3S7TA 1QQAA 2J48A 2R7LA 1XPRA 1UJBA 4IIVA 1A4RA 3T52A 3T61A 5DI3A 2AG8A 5JBNA 3VZBA 3OOWA 2EJTA 3IODA 1J2YA 3BREA 4LQCA 4DUGD 1PWHA 2Q8PA 2XRFA 5JPCA 3UMMA 1BS2A 3QF4B 3SZOA