1JG6A

T4 phage bgt in complex with udp
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
351
structure length
351
Chain Sequence
MKIAIINMGNNVINFKTVPSSETIYLFKVISEMGLNVDIISLKNGVYTKSFDEVDVNDYDRLIVVNSSINFFGGKPNLAILSAQKFMAKYKSKIYYLFTDIRLPFSQSWPNVKNRPWAYLYTEEELLIKSPIKVISQGINLDIAKAAHKKVDNVIEFEYFPIEQYKIHMNDFQLSKPTKKTLDVIYGGSFRSGQRESKMVEFLFDTGLNIEFFGNAREKQFKNPKYPWTKAPVFTGKIPMNMVSEKNSQAIAALIIGDKNYNDNFITLRVWETMASDAVMLIDEEFDTKHRIINDARFYVNNRAELIDRVNELKHSDVLRKEMLSIQHDILNKTRAKKAEWQDAFKKAIDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA BETA-GLUCOSYLTRANSFERASE
publication title High resolution crystal structures of T4 phage beta-glucosyltransferase: induced fit and effect of substrate and metal binding.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Transferase
total genus 137
structure length 351
sequence length 351
ec nomenclature ec 2.4.1.27: DNA beta-glucosyltransferase.
pdb deposition date 2001-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09198 T4-Gluco-transf Bacteriophage T4 beta-glucosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 1jg6A01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 1jg6A02
2VSYA 1QKJA 3DZCA 2VCEA 2Q6VA 3DDSA 4PQGA 4RIGA 3FROA 4AY6A 4BQIA 2PYIA 1XL1A 2OFFA 1L5SA 4NC9A 3OTGA 5JTUA 4CDRA 3H4IA 4REMA 3QHPA 3CUTA 3T3GA 4M83A 2ATIA 2F9FA 1Z6PA 4X7RA 3Q3IA 3MQFA 4RBNA 1P2DA 4GZ5A 2ACVA 3VDNB 2R60A 2X0FA 3E3LA 3NC4A 4GYYA 2IEGA 4M7PA 4CTMA 2C9ZA 2SKEA 3D0QA 3CEJA 5GPBA 3BDAA 5LQDA 1RZUA 3MSCA 2QRQA 1HLFA 4RELA 4BQFA 5D00A 4L22A 2R4UA 1JG7A 1L6IA 2GM9A 2XA1A 5TVGA 1C50A 4W6QA 1EM6A 2G9QA 4MI6A 2G9VA 1H5UA 1BX3A 2QNBA 2P6PA 3S29A 3NAZA 1Z62A 5HXAA 3HBNA 3OTHA 3ZCVA 2FFRA 1KTIA 1XKXA 2HY7A 1XC7A 2IYFA 2X0EA 2PYDA 3MTAA 2IV7A 3ZCQA 4RIHA 3UYLA 1A8IA 3D0RA 2ZB2A 2IYAA 1F6DA 1J39A 1F0KA 4EL5A 2XA2A 2H1HA 2QN9A 4XI9A 1UZUA 2XGSA 1GPBA 3MRVA 3BD7A 3DD1A 3UYKA 1YA6A 4BFCA 3E3OA 1NVKA 3C48A 2JZCA 3ZCRA 2BISA 2VG8A 1C8LA 3WC4A 3MS7A 3O3CA 2FETA 4EKYA 4LEIA 2G9RA 3S0JA 4LDPA 3T3IA 1AHPA 1JIUA 2X0DA 3VUEA 3BEOA 5TMEA 1GGNA 4RIEA 3MS2A 1ABBA 3BCSA 4WACA 3G2JA 1Y8ZA 4RENA 5DU2A 3CEHA 1V4VA 3BCUA 1QM5A 1L5RA 3RSZA 5I45A 3WAGA 3WADA 2XCUA 3S2UA 1VGVA 1XOIA 1RRVA 2XMPA 3H4TA 3OTIA 1FU8A 4G2TA 3G2KA 8GPBA 1XV5A 1AXRA 4EJ2A 1P4HA 2QRPA 2GT1A 3HBFA 1PNVA 3IAAA 3CV3A 1JG6A 3EBOA 1PYGA 1FA9A 4F96A 4Z5XA 2GEJA 1FC0A 4N3CA 2YJNA 1Y6FA 1LWNA 2QRHA 1NOJA 2ECPA 3COPA 2AMVA 3ZCUA 3GUHA 1NZFA 4MI3A 2X6RA 5TMDA 4QLBA 3ZCTA 1FTQA 2QN1A 4GYWA 3T3HA 4MI9A 4WHMA 3OY2A 2QRMA 2F3UA 3QKWA 3RT1A 5DLDA 3G2HA 1JIXA 6GPBA 3C4QA 3L79A 2FF5A 3PE3A 2H1FA 3AMVA 1Z8DA 2BFWA 4RIIA 5IKPA 1RZVA 1FTWA 4RIFA 2AZDA 3D1JA 1O6CA 1L5VA 2WTXA 2AW3A 1E1YA 3BD6A 3E3NA 3CEMA 1UQTA 2F3PA 4YI5A 2GEKA 1WV1A 2X6QA 2QLMA 2C1ZA 1B4DA 2IW1A 5JTTA 3L7DA 1P4GA 4EKEA 3TOVA 3NP9A 3OY7A 3G2LA 4AN4A 1FU7A 4M60A 4AMGA 3T5TA 3MTBA 2PRIA 5IKOA 3GPBA 1WUYA 3MBOA 2SKCA 2C1XA 1L5WA 3T7DA 1WW3A 2R68A 1WV0A 1C8KA 2ASVA 4KQ1A 4YI3A 2F3SA 2QRGA 4F97A 4MICA 3PE4A 3OKAA 4N3BA 3RSCA 1K08A 4FKZA 3TAXA 1FU4A 4WADA 2GPAA 1K06A 3OT5A 1M5RA 3OKCA 2QLNA 3NPAA 3L7BA 3MT9A 3HBJA 5TMBA 2BGTA 4MRAA 4F9FA 2QZSA 4X6LA 1GPYA 4HWGA 4KQ2A 1WW2A 2KS6A 4N39A 1GFZA 1Y6GA 2PRJA 1L7XA 4GZ3A 2JLBA 4N9WA 3G2IA 2GJ4A 1SXQA 4N3AA 3BCRA 5DXFA 2G9UA 2IV3A 2GPNA 3Q3EA 5BNWA 5C1DA 3MRXA 4MHSA 2QN2A 1NLMA 3MT8A 3BD8A 3T3DA 1JEJA 1NZDA 5D01A 3MS4A 3Q3HA 1FTYA 3MT7A 3TSAA 3L01A 1P29A 3G2NA 1IIRA 3HBMA 1UQUA 2PQ6A 4GZ6A 3NP7A 3L7AA 2XGOA 3CUUA 3S28A 1C3JA 1JIVA 1FS4A 2C4MA 4NESA 1L5QA 1YGPA 4FZRA 3VUFA 4MHOA 4GPBA 2QN3A 4KQMA 3CUYA 4CTNA 4X7PA 3C4VA 1PN3A 2R4TA 4XIFA 4X7MA 4NEQA 3CUWA 9GPBA 1GPAA 3CUVA 1GG8A 3ZCSA 1XL0A 3SYMA 3T3EA 4EL0A 2VSNA 2QN8A 2R66A 2JJMA 3EBPA 4AMBA 3MRTA 1NOIA 1GZ5A 1P2GA 1PSWA 5ENZA 1P2BA 3NCHA 3L7CA 3ZCPA 1LWOA 1Z6QA 2VCHA 3CX4A 2SKDA 3DDWA 3S27A 2AV6A 2GPBA 4BQEA 3NB0A 3MTDA 1IXYA 3OKPA 1E4OA 2ACWA 1NOKA 1SXPA 1EXVA 2BGUA 2QLLA 3SYRA 2IUYA 2QN7A 2XA9A 3VDMA 7GPBA 1WUTA 1P4JA 4HLNA 2O6LA 2IEIA 3RHZA 4AY5A 2F3QA 4CTOA 3IA7A 2XCIA 4YUAA 2XGMA
chains in the Genus database with same CATH superfamily
1BFUA 1JJBA 1SOWA 2CNWD 4ZRNA 5SYNA 1ZSYA 4DLAA 3FCAA 1JFLA 3HDJA 4M1WA 3SP1A 4ZI5A 4C0BA 1W1WA 4RIGA 2DR3A 4PBTA 1B0PA 4QUKA 5EHGA 3D0OA 4DDHA 4M86A 2H2FA 5EP3A 3FVTA 1IB6A 4YRSA 2GN6A 3GQBB 1VLHA 3CNLA 4BGEA 1CF4A 1U2RA 3TMAA 2JLXA 1JFTA 3PJGA 1GV0A 1CG6A 5D84A 1E5LA 1MKYA 4HHEA 4RKFA 1JJ7A 4W5JA 4AF6A 1JG4A 4CNQA 3QWIA 4K0RA 3KOUA 2F4NA 2OFFA 5CLQA 4YS6A 5EMJA 2XJ4A 3ITEA 2NACA 2R65A 1H0KA 3GOHA 1YRQA 1ADYA 4EB6A 3GUYA 1NMXA 2WU4A 2XIJA 5C52B 3X2EA 2OXIA 3H4IA 3OE4A 3QHPA 4AZWA 4N48A 4CV1A 3EIEA 5B12A 1F0YA 5CVEA 3LD9A 1ENYA 2Q7XA 2O4UX 2ZI7A 2XE8A 3JY6A 2Q3CA 2UV8A 4NFLA 4OYHA 1ORIA 4C4PA 1RKVA 1CT9A 2QBYA 1RYYA 2X1LA 2EFHB 1T9AA 3HJAA 2C54A 1IG3A 1V8PA 4DT1B 4X62B 3NC4A 1IEVA 4KBFA 4PSDA 3O1LA 5IBPA 1U8AA 4BU0A 1YR6A 1Q0RA 4B34A 5F77A 5ELLA 3UT5A 4NCAA 3IIMA 1MC4A 2XI4A 3AEKB 3GVHA 1H2ZA 5LXTA 1JR3A 3NYWA 4IZHA 4PCVA 4KSCA 1SVLA 2ZRCA 3MCWA 2XBUA 4FIDA 3QLVC 4CM9D 5ETJA 3N2KA 1FUUA 2XKAA 4J7AA 4YMLA 2R8XA 1N4DA 3NHKA 3WYFA 5CB4F 4OY3A 3C45A 5HDQA 3PGA1 3W34A 2J0QA 1G6KA 1NBMA 5HBRA 3QJGA 1ZSNA 1KERA 1XHLA 1QANA 1YJXA 4BNMA 5BR8B 2QT9A 2WUDA 4E5YA 1DRKA 4I8DA 2KLHA 3GRPA 4EUFA 5MGNA 3GNLA 4HWPA 1NNEA 1KVQA 1JH9A 4U2EA 1K5GA 4CEIA 2Q46A 2VUUA 4Y0AA 2JNWA 5FPYA 3UPTA 2O5RA 1FNMA 2JJQA 3AM4A 4OJKA 5I3CA 3H5RA 2Z4SA 2DFLA 3BB4A 4HN9A 2BAGA 2P0AA 2FZVA 4B7ZA 4E5MA 2G9QA 1C8VB 5CFNA 3B3FA 5HKLA 2ZJ0A 4HDKA 1LJUA 2Q5FA 3KQSA 1Y3HA 2FSGA 1SUEA 1SC9A 2GHQA 3TGWA 1T9GS 4TTQA 1I7NA 2P6OA 2AYXA 4RYLA 3WYDA 1FYFA 3THYA 2J30A 4NATA 3PEVA 4KXQA 4Z3DA 4AP5A 1ECGA 4YAWA 1JHRA 4QVKA 3A6GA 3HVRA 2Y9PB 3WQBA 1Z0SA 5D3MB 4U7TB 1YJQA 1UT6A 5CIYA 1R6BX 1T4GA 3QX3A 1VM6A 4WVLA 2IYFA 3HS3A 3QGMA 4OMFG 5F5LA 3ZQ4A 1U0NA 4BTVA 1NVMB 5K0TA 5CLIA 3GW8A 2P91A 2QL6A 1NAHA 4IMIB 3VDQA 2AKEA 2V59A 3AFIA 3FCSB 4FQ8A 1YBHA 1M2OB 2XKBA 3DQQA 1SY7A 3N3AC 5ICMA 3ILHA 1GTJ1 2XQFA 4PIPA 5EZYA 2P3SA 1YO6A 2IZ0A 2VHXA 2W6ID 3SLGA 1AUOA 2CB0A 1OUMA 2R25B 2Y68A 4Q1AA 5FPTA 5FEMA 3WYEA 3CF4A 3FSGA 4P3OA 5LDGA 4NCJA 1UKYA 4OKSA 4D4JA 1MO2A 3JQFA 3CXUA 3LGSA 2FW9A 3VVBA 2V74B 1JTFA 1NYTA 2LCQA 3RT7A 4V39A 3R74A 1NFRA 1ONNA 1U3CA 3L7NA 2ECOA 2H9YA 2XGSA 2OCDA 3K30A 3VO8A 3AF5A 3ZE7A 2R8PA 1BMDA 4QXQA 5DYNA 4YAGA 5IXSA 1XP8A 2WSSA 3UT0A 1EUDA 1BHQ1 3M33A 5JAZA 4EZBA 2ZE6A 2HBYA 3BRQA 3FSJX 3VR5A 4CIBA 3IIKA 3IVMA 2QMOA 4ZDWA 2Q2QA 5SY9A 3V8PA 2VTVA 1RXUA 4TV9A 1R9MA 2UYQA 3PNYA 3C48A 5DBEX 5GONB 4I50A 3IUSA 4G4GA 1W0KD 4O3MA 4GKVA 2JJ1D 2QVZX 4BKUA 1HNZB 1FMTA 2OHIA 3L8HA 1JKJB 4JP3A 2WKPA 3K8ZA 5CJJA 3ZY2A 1NC3A 1SEVA 5JW6A 1IHDA 2Y0EA 1RW4A 1UBHS 3G2PA 2O2GA 2EQAA 2BI4A 2WT9A 4IIVA 5EKTA 5KVQA 3T7TA 4LEIA 5B4UA 4US2R 3E22A 5BWMA 3LXUX 3FMGA 2OMEA 4Z0NA 1ZGAA 1HWYA 3IFSA 3M82A 4OJNA 5CLLA 4B3XA 3D8NA 2NP7A 5AHRA 4M6WB 1H4VB 2NSLA 4OU4A 4V3CA 1XZEA 4BUJA 3DZJA 1JECA 3MTIA 4PSKA 4RFSB 1QYDA 3ZWQA 5F76A 2Z6QA 4G1MB 4O0LA 4QGBA 2ZSIA 1NJFA 2WFLB 2WU0A 5DK4A 3U4AA 4J0CA 3H5WA 4K9QA 1H2YA 2W2LD 2Y1FA 2Z08A 3OZDA 3OX1A 3Q2KA 4RADA 4ZU3A 3CEPB 2ONZA 2PGXA 3FB1A 4L08A 4N3NA 4BV3A 4PLZA 3TPFA 5KOJA 5DNUA 1D04A 4HAZA 1Y3FE 4D4HA 5CDGA 1UOOA 4TKVB 3N7TA 3P2JA 1PV4A 5I4KA 4H7HA 4C2BA 1DKLA 2JCYA 3L7OA 3MTQA 5FOWA 2C5HA 1LH0A 1T25A 1FUEA 1L5MA 2H17A 4LYJA 2WMNB 3SU8A 1RLMA 3EGVA 3FZQA 2C1EA 4IYJA 4BNZA 4YRZA 2G0TA 1GLVA 3R6DA 2PEYA 1X80A 2WWFA 1DO0A 2MU1A 3EFHA 3K4PA 3N6VA 2PFGA 3HB7A 2B9VA 1NE2A 5ES4B 4DBVO 4I1YA 5AW8A 3NJ4A 2PXCA 3JZMA 1FA9A 3WFZA 3ZOZA 4CL8A 2PTGA 1Z28A 3HSKA 4ND7A 4ZRMA 3AJAA 3NXSA 2X42A 5LCXA 2RB4A 2CYBA 4Z1MD 3NHWA 3AOEA 3MFQA 5DH9A 1KORA 2ZE8A 2CDRA 3TNLA 2WJGA 2PKRA 4OPMA 1C9KA 2HQBA 2C9CA 2QRHA 1CUAA 2QMYA 4FFWA 3SFVA 3VHXA 1NASA 4KXMA 4ZEXA 5EPOA 4R8MA 3GRVA 3DJYA 2C2BA 2AFIA 1UJNA 5K3FB 4MB2A 3I2YX 1K2VN 1M5TA 1I6MA 4P2GA 4N41A 4KPUA 3ZCUA 5HIAA 2OFOA 2YC2C 4RACA 4WRRA 1M6HA 3IV9A 4PSAA 5JWHA 2Q4TA 5BQOA 3GY0A 4PC6A 1IPHA 2XWPA 3EVAA 2D2FA 3HVIA 4B3DA 4ZJUA 2HSJA 4AQYB 1ZUHA 3NIGB 2J31A 4QUHA 1QF7A 4YRRA 4X65B 5DNCA 5ICEA 2Y77A 2COKA 4MVJM 2OORC 5DLDA 1JB1A 3QPCA 5AKIA 2VDUE 3PHGA 3UW3A 3GK3A 1KR5A 2BHNA 1NYLA 5F64A 5JO0A 1N3BA 1O9BA 3NOXA 1VJCA 4UNSA 1Z0IA 3LUDA 3P2YA 2QD1A 1V96A 5CBPA 1OFVA 2X15A 5JAQA 4LECA 3JSAA 4Q9LA 4EJ0A 1ZM4A 4PCUA 4O4LB 3V48A 1Q44A 1W5EA 1SD5A 2QD3A 4LNHA 2TECE 3DUWA 3O90A 4TQAA 1UJ4A 5TPWB 2DSNA 5C46F 4DJFC 2Z8YM 1UKVY 4AS1A 5KTNA 1ESDA 1OXUA 1P1KA 1UMBA 1YS6A 2PN1A 1KFJB 4RF5A 5AI4A 5LMZA 3C5EA 3IEUA 2I2XB 4OAOA 2DXIA 1OHHA 5EOVA 1NHWA 1MNAA 2DHQA 4RSGA 1ODFA 1I32A 1PR4A 3BMOB 3OJWA 4H59A 5AI9A 3A6JA 1NUUA 2JGLA 3ZQJA 2AFHE 1V8FA 3JTMA 2XF8A 5J5AA 1GCGA 2GN0A 2GEKA 1NW5A 1YR9A 2ZBPA 3V1TC 2WZBA 3ZDYB 1FSSA 2H85A 4EHNA 1B4DA 1PV1A 3Q5GA 5IX8A 2X3FA 5C2JB 2YXNA 4EK9A 5KTOA 2RHGB 2RGWA 3B5EA 4S0ZA 1GUZA 1GDTA 2DFNA 4ZANA 4J0DA 2AZXA 4UUMA 1EU1A 4MQ6A 3HKCA 2TMDA 5B3KA 3DLCA 3OC0A 4FSDA 1SIOA 3WI7A 1SM4A 4E32A 2PKQO 4J0FA 4C01A 4FP9A 2A5DA 1AC5A 3L18A 3LT0A 2IH5A 4PNEA 4HH4A 5JC1A 1II8A 4C0KA 4IIJA 5IJ0A 2FP3A 3Q0IA 1PQYA 3MBOA 2HLHA 3PDCA 5CYGA 3M2PA 1US8A 3IS3A 1V4BA 3V8VA 3HO1A 3C7KA 5KHAA 4GHWA 3UFBA 5C8ZA 2WG1A 4TVBA 5IT4A 1C8KA 1K9VF 3WAKA 1JS1X 4OHZA 3BMCA 4LC0A 4F97A 3D3WA 4MICA 1V26A 3LO5A 2W2PA 3TTSA 2DBQA 1FMCA 1XZ8A 4MKFA 3N9IA 4DKJA 4Y7CA 4YP7A 1Y1PA 3F5MA 1QAQA 1LPAB 2OMKA 1E6CA 5JCOC 2Q1YA 3O4HA 3CWZA 3BFVA 3OT5A 4AQ7A 3H8WA 1IJEA 1X3SA 3QY9A 4H7PA 1HTBA 3OKCA 2HA2A 4FMDF 3RNLA 1FPQA 5I8WA 2OSBA 2GAOA 4QOIA 5M04A 4JKYA 1GDHA 2NZXA 1M83A 4JDPA 3NBAA 1GG9A 4NYMR 1B6RA 5AKKA 5BSRA 3MJTA 2BGTA 2FG7C 3N1UA 4PHFA 2ZYUX 3PX3A 4PX9A 3D31A 4U6NA 4OOFA 2ES4A 3GJ6A 2BZGA 2ORED 1ECJA 4GO1A 3GCDA 1CB0A 1KJNA 1XRSB 3HRHA 4YJHB 3LLMA 1SD1A 1GZUA 2PJDA 1XDSA 1UEXC 3FWNA 4US1R 4A8JC 3SYLA 4EHAA 5ALIA 1H94A 1N9ZA 3RUDA 1L7XA 4NCNA 1WHTA 2VPQA 2PU5A 3RYHA 3ZHQA 4P4UA 2JLBA 1LLUA 3RS4A 4YJ2B 3KALA 1L8AA 2NT4A 1YS2X 3FCEA 3PNLA 4RD0A 4YPVA 3F9RA 4KQ9A 4Q21A 1DMSA 1OBOA 3H4MA 4JYCA 4LA4A 1T0BA 3TL2A 1VZ3A 4PG7A 3LDHA 2GPNA 4O4HF 4P8RA 2BF4A 3QTTA 4TROA 2JJ2A 2XAAA 4TSRA 4OQMA 4MRPA 5H81A 2HJGA 3PXUA 4NMLA 5AKXA 1CR4A 1CYDA 4WPGA 1TUBA 2PTHA 1A9XB 2JARA 2PXAA 2BSAA 3FFAA 1YZQA 4F3RA 4MKZA 1KDTA 5HW0A 3LCVB 2O8FA 3B5IA 3G5MA 5SZIA 3UHPA 1MJGM 4D7AA 3REGA 2XMGA 4RSRA 1XFDA 4EELA 4LGCA 4LWOA 1IATA 1JXQA 2R6R1 3OF2A 5HQTA 3OCUA 4OHBA 4Z3OA 5HM8A 1R4NB 4NARA 1JEJA 3CH7A 2I3ZA 3Q2OA 2D2VA 2WUEA 4XWKA 2VATA 2XCSB 3HFJA 1K8RA 1QKIA 2G80A 3TOXA 1ULAA 3NANA 5F98A 2PA3A 3QXXA 2CFCA 2CLLB 4KH0A 4DLZA 5EKSA 2WYIA 1I4TD 2BEVB 2XITA 1GZSA 1VQ1A 2Q9AA 2XT6A 1XI2A 3I42A 1HPLA 3II6X 2OCIA 4IKPA 2PGJA 3MF4A 2VEOA 4XIYA 1LZLA 2JLAA 3NV9A 1IXKA 4LTMA 1ZA1A 2H2HA 4X41A 2OAGA 1WCIA 1G19A 3PNBA 3JQDA 4RTRA 2CLFB 3QA9A 1KARA 5JFOA 5JAIA 4KPEC 4Y2JA 3G7UA 4GI5A 1GKLA 2BCEA 5AKYA 2PS9A 4BHTA 3MTJA 4K3VA 2ETVA 2V9PA 3WGGA 3LYUA 3VU8A 4UCQA 2ACKA 3MNFA 4QEDA 2E37A 3NRJA 2JGDA 4QT0A 1U1DA 1VSTA 2VDVE 1EDZA 4WZ6A 2OFWA 2ZB7A 3RI3A 1LPNA 3E2MA 2O8DA 2O3QA 2ZIAA 4JJ6A 1V43A 1IOZA 4WECA 5ENDA 2IODA 2SCUA 4ASUA 2C3UA 3ULKA 4DDMA 4EL0A 2F9MA 4INAA 1UOQA 1HZZC 1WXFA 1ZJWA 1JDTA 3INRA 3S1AA 3HYCA 2NVBA 2LVBA 4Q6BA 5CBKA 2IDMA 1QFYA 2QENA 4M1TA 6AT1A 2QOEA 1BDMA 1P2BA 2AJLI 4QBKA 3JAKA 4ISBA 1Z6QA 3EARA 1WXWA 1SIUA 2WM9B 1OW3B 3FZEA 4LQCA 3N28A 1V3VA 2FZWA 5IKEA 1LBHA 2FFQA 4C7VA 1G16A 4ND4A 3R3HA 1EHCA 2ONCA 1Z4OA 3C8MA 3O21A 4HQ0A 4JL5A 4L5BA 2H1WA 4QTZA 2ZTHA 3W9BA 3WLAA 2VQFB 5A02A 3CZPA 2CY0A 4Q4AA 3JQ7A 5EE1A 3NOOA 3WLSA 3NOQA 5DBOA 3OJCA 4I81A 3USZA 1RAGA 3FUTA 1N0WA 1PHPA 1T3ZA 4LJ9A 1TU4A 2C5AA 4H3SA 3AFHA 3BXPA 1ZHOA 1E7YA 3HB5X 3CA8A 2UKDA 1NFFA 4K9LA 3CLSC 2FX2A 3OX4A 3C3JA 3DFIA 3O74A 3PWTA 1XDZA 4CCAA 1U0TA 5IBRA 3IDAA 4EZEA 5ILOA 4Z9FA 1EFUA 3WGHA 1KSHA 2HADA 3A31A 4KLZA 1ID1A 1P4JA 2V4UA 4QUIA 1BA2A 1Y5IA 3CR8A 3K9CA 5C34B 3T15A 3IPAA 4BMYA 5FNVA 3WKEA 3TDKA 3N53A 4C1BA 4YCBA 5EFZA 4EGFA 1VE1A 4MKGA 5TSDA 4ARAA 4YT4A 5JNVA 1D8TA 4LHWA 2JW5A 3TL3A 2B5VA 3ZHTA 4L8WB 2WVGA 3ESYA 3JWJA 1EFRA 4H6XA 2BFEA 1DKMA 2H5JA 3VI4B 4MSUA 4RA6A 4RK7A 5CEFA 2XGMA 2NMVA 4BAZA 4O33A 3V4OA 4D8XA 1NURA 1J1UA 3GVIA 5I47A 4DNXA 4RSHA 2H4WA 3CSUA 2ZBFA 5DGDA 3DEKA 1KE2A 1CUYA 1T26A 2E55A 2C07A 1I6LA 3QTLA 5JJBA 4X1YA 3AG6A 5KVAA 4RJKA 4EYSA 4X8MA 1J70A 1QP0A 1NVTA 4EI8A 1XVAA 2I62A 2GHIA 2GJSA 3ECCA 3U0BA 2QZ4A 1G21B 3VJLA 3NVKI 2J3DA 4LJYA 1YCHA 2XT9A 3UF0A 4RZUA 3WGNA 4EPVA 2JI7A 3CPEA 2PZBA 3DNPA 1XNGA 2G7MC 2IYNA 1Z38A 1CW2B 2I71A 1BWQA 1J8YF 1NQWA 5H7XA 5H4GA 3BH7A 2IYTA 5JDIC 2EVWX 1D1SA 5E6SA 4YJFB 4D26A 3PYXA 4Y8VA 1ZCAA 1JR3D 1XRJA 3OHPA 1UBUS 3Q9UA 2H2AA 2CXHA 2BV3A 3UAOA 2VJLA 1Y7HA 1EFKA 2CHUA 5J9FA 1P2FA 4Z8XA 5CLFA 2D2EA 5E3IA 2GZDA 1AQLA 1NR1A 4FJ0A 5BWCA 5CDSA 4MQEB 3B1ZA 3E3LA 1J2UA 3EZGA 5FV4A 4JJ4A 2X0IA 721PA 1E3JA 4ZIRB 3PRHA 3WG9A 5A7HA 3S40A 1PFVA 2HLPA 4HAYA 4B2PA 5EJ7A 2VYQA 2WM2A 2O19A 4K2AA 4MPPA 1HNNA 1KMIY 1JLRA 3DYIA 1K6EA 2X2EA 2VHWA 2GCOB 3LX4A 1EG7A 2I6FA 3E4DA 4TMWA 5HS6A 1PQ4A 1PT6A 1UT5A 2I76A 5H3LA 2IYSA 3TW4A 2YXLA 1L5KA 2A5GA 4PO9A 1VBFA 3KJEA 1HLFA 4P3PA 5LP6A 5AJTA 1ATIA 1EGQA 4XVHA 1PJBA 2HF8A 3E5NA 2HV9A 3Q6MA 4EUSA 2QX9A 1RWMA 1L6IA 2IF2A 2WHRA 5GM1A 4F7WA 3R3VA 2OD2A 3EHEA 1CJUC 1KMCA 4RY9A 3K71B 2WWTA 1EZ4A 1C50A 3DMDA 4ZOEA 2PD6A 1U2DC 1BJRE 1QWSA 2QIPA 2JLRA 3W3AA 4MUIA 2FP4B 1KOFA 1NULA 1ODJA 2QL7A 3F9CA 4PZZA 5CFQA 2UU9B 3LTEA 3U3ZA 2HA4A 1A8UA 5J3JA 3DEIA 4C5BA 4MVYA 2GZSA 3M1IA 4KDFA 3T5BA 1E9SA 3KKMA 3VPBA 2O1SA 4O3FA 1V9LA 1X7WA 3O73A 4LCBA 1PGQA 3C5VA 1JHMA 4OA8A 1JWLA 4S35A 1E3WB 1NVBA 5A9SB 3S81A 2NQ2C 1TVMA 4B5LA 2X8AA 5AVXA 3NUQA 4IO0A 1IJKA 2QTAA 3ZZ0A 4BZPA 1NSYA 1XTVA 5K2MA 4CR8A 2IA5A 1NXXA 1W5BA 5EZ5A 1W46A 2HMYB 3L7KA 2E82A 2VQ6A 3KSUA 1SKUA 1T3LA 2YFYA 3K1AB 4YP6A 1RQLA 1BW9A 2BH2A 1W4LA 3VR5D 4B1FA 2AK3A 1GNTA 3RODA 1M7HA 4BN0A 1CUEA 1SGWA 1G5PA 1OC4A 1FJGB 2ZDHA 4MO9A 3TX6A 3EAFA 2GSWA 4MRMB 3TZCA 3EC2A 1CNMA 2H54A 3ONWA 3O82A 1DAOA 3IO5A 3VYSB 2WUVA 3ER8A 2VNSA 2A84A 5KWJA 2WAMA 4R68A 1DX4A 4X1OA 2ZIVB 3OX3A 2RCYA 2BOVA 3EMDA 4C0JA 3LA8A 2ZSEA 1PT5A 1I1HA 2PH7A 3K0FA 1QF6A 2BGKA 3U40A 4DE5A 4R54A 5AVTA 3O8CA 5TXGA 4PQFA 3CPSA 4KO8A 3QLTA 2F1JA 2KI5A 2QS9A 2XH8A 2VF2A 621PA 2R1ZA 1MXHA 1UDAA 2QB5A 3SQLA 2B21A 5GJWC 4LHEA 2Z2ZA 3VYVA 1U1EA 1JFFA 4IDDA 4LV5B 3ZK9A 2PUBA 1J0DA 1WUHS 4YCDA 4E5PA 2WQ7A 1BVUA 1BIFA 4L6AA 4HWKA 4JLUA 3I5UA 5DE3A 2V4ZA 4UMDA 4R2LA 5F21A 4EKYA 5J2TB 4A5SA 1RKQA 4XWWA 2R44A 3CONA 1I5EA 3D5QA 1Q0ZA 2RGEA 4OHUA 4PO8A 1Q1AA 5GOTA 4CKXA 1P39A 1UJBA 1AHPA 1TZCA 3HUEA 2GPWA 2LP4Y 2ZAOA 3JQBA 2P2ZA 1DCTA 3QKRB 2VNIA 4XIJA 1VHDA 3RRBA 4ANFA 4WBSA 3DHYA 4DWJA 1ZXLA 3TRKA 4A73A 1IQPA 4R3NA 3ZE6A 2EFGA 1GZDA 4INZA 2WNHA 3K9BA 2NO4A 2W22A 4WK2B 5TGTA 2BGMA 3PPWA 3UQZA 4DRXB 2RJ3A 1D6JA 1I7LA 1XQ9A 2NU6A 3RFCA 1QGAA 3BCUA 3LYHA 3BMNA 4TT8A 1QYCA 5CITA 4U3JB 1Z39A 5DN6D 3PVZA 1TJPB 2WYOA 4DHWA 5AVRA 1OFIA 5AW7A 1AVTA 2PDAA 1EP2B 3QQPA 1CRQA 1IB0A 2XCUA 5CIWA 2X76A 1Z7BA 1XEWX 4OHVA 2V65A 1S3FA 5EN4A 3H4TA 3LOQA 3EG5A 2IPLA 1I2BA 3LQYA 1N6LA 3VPHA 1L5OA 1ZI9A 1EEHA 4EI7A 5A4IS 2O7VA 4D41A 2W98A 1OLSA 2FPKA 1NP3A 2FI1A 3EPLA 3THYB 3HXPA 4LXHA 1Z22A 3C16C 4BBAA 3E7WA 3SF8A 2XTJA 3PG5A 4JX9A 3A3OA 5HQJA 1MQAA 4LJ7A 4E22A 1KGDA 2IKQA 1G63A 2I7CA 1FW8A 3HBFA 4ICIA 4DN6A 1KRXA 4EG4A 2PSDA 2P40A 4G4JA 1PVDA 1ODKA 2C4WA 4MWBA 2HJHA 3FUUA 4ALLA 4F8EA 6NULA 3GLGA 1GADO 2G4CA 3GDFA 4HNHA 1DAFA 5KPJA 4C7OB 1NNSA 2JIOA 4OB8A 3DV9A 3F6RA 5KINB 2KB0A 3IKJA 4U1RA 2YJNA 3CISA 1K2WA 3R0IA 3TMYA 3WLQA 1O9HA 3G3EA 1NMEA 1Q2XA 2NPOA 3F7MA 1G6Q1 4URYR 8OHMA 4Q3BA 2HK8A 2YYAA 2JDIA 4P08A 4AZ3A 1JEAA 3QU4A 1TCVA 3OA0A 2BM0A 4CEJB 2JEOA 1ODSA 1ZGJA 2WDZA 2IYZA 3BXOA 3N0RA 1Z18A 3GUHA 2QT0A 5ARDA 4D4MA 1P1HA 4A8JB 5BWBA 1KO1A 1ISMA 1KY4A 2Z5LA 4I5GA 5JPCA 2DEUA 2QK4A 5L7TA 4ZMBA 3T12A 2O50A 3THSA 4EJSC 2EYQA 3KCQA 4OBEA 2G09A 2J3HA 3B8HA 3DMFA 2OV2A 3I01A 5BMVA 1R6DA 3EZ2A 5F1OA 3T41A 3PWSA 3DZBA 4ZVOA 4XASA 1W96A 2ZTMA 4IINA 3DC7A 5E2BA 1F3LA 5EL0A 3RK0A 3QX9A 3WY9A 3LBAA 3H1PA 3GJ7A 2YTZA 1CLEA 1QO7A 2JVIA 2PZFA 1WCXA 2FF5A 1WZUA 4ZQHA 2P2YA 5IP5A 1N33B 4TPKA 5A5DA 3N59A 2WPNA 2AX3A 2AOUA 3DAYA 1RC8A 5BN4B 2HRCA 3PL5A 1KEPA 4HR7A 1CQIA 3OVMA 3PVCA 3VC3A 1EX6A 3D0KA 3ASUA 1QGYA 2B30A 3MCAA 3P0FA 5FRDA 1I94B 3QXCA 4K81B 2BVNA 4Q4CA 1RMYA 5IW8A 3KPJA 4RMGA 1DTEA 3FRJA 4NU8X 4B7CA 3RSOA 3QEJA 3F8TA 4P0TA 5F3DA 3TM4A 3QELA 5K5EA 3FA2A 1EVKA 5SZJA 2YWBA 2XHZA 2P4SA 3IVCA 4ER0A 1RYEA 3TH5A 4QU9A 2Q0XA 5YASA 4AC9A 4M98A 1UXJA 1HT3A 1XRLA 5MFZA 5A0FA 4TM7A 2W6QA 3L7LA 1JLKA 3TLZA 3FNEA 2D0PB 3I34X 3TI7A 4GLBA 4WWHA 4BB0A 3KHSA 2X7XA 4K8RB 1C30A 1OIWA 1AF4A 3A2LA 2DKNA 1OZGA 1W4CA 4ZARA 1W0CA 4AMGA 4LN1A 4J7XA 1YZNA 3T5TA 4O63O 1RABA 1OH6A 4JI4B 2J87A 5GGYA 3BIWA 2G5TA 3W5JA 4NCIA 1ECFA 1N5OX 2QTVA 2V5UA 3GLKA 1WW3A 2BELA 4QDTA 2IX9A 2CFOA 3LGXA 3OD1A 3CNOA 2WE7A 3UMRA 1H65A 5EIAA 1PR1A 2W6JA 4TXMA 1YRBA 3K9GA 3Q98A 4FYWA 1GYRA 2C96A 3PGJA 5EE3A 1SC4A 4R2MA 4YRBA 2ZJ7A 4B3SB 3BVPA 4MPDA 1WSAA 4FKZA 1N2HA 4WFQA 3ENKA 3R24A 3V1NA 3QEAZ 5K9ZA 2AVDA 2LW7A 5FUYA 5IARA 1SVIA 2C3MA 2QLNA 2X9GA 2HLDA 4OLFA 4HNTA 4MJXA 4ALNA 3GN1A 3MT9A 1YDFA 3K6SB 3QX8A 4E33A 3CRW1 2Y9MB 4O25A 3R5KA 4B17A 1K4YA 4WA8A 4TRNA 4PY2A 3SJZA 2JGIA 2QNRA 3LLCA 4HQNA 1IBSA 1VG1A 1YIDA 3ABIA 4PM4A 4CR7A 4DGQA 4MR9A 4QHTA 3B20A 2YNMC 1XT6A 3JASB 4HOYA 4N39A 2CEAA 1ZQ1A 2XRYA 3HVHA 4R1TA 3SR4A 2HM7A 4GDMA 4TRRA 1X14A 3OZ7A 1KI8A 4J9VA 4KAAA 4GI1A 4UE3S 1F5NA 5C4GB 4B44A 2Q8QA 1SOAA 1PR9A 1N2GA 1ONPA 1N0UA 1Q2UA 4IJ6A 4P80A 1F48A 4G6ZA 4U2BA 2ZI4A 2ZYSA 4Z51A 2J6HA 2XD4A 3ZGYA 5DDIP 5DXFA 3DZ8A 3HYSA 5ITVA 2IV3A 1IL0A 2Q4OA 2K4MA 3IPXA 2E4ZA 4L4ZA 4ADSG 5IAOA 1E2DA 3W8EA 3O9ZA 2RBGA 1ENZA 3P52A 4XWOA 1IFXA 2JFOA 1C2TA 1Y1SA 1T6BY 4FXPA 1YIOA 5TLSA 1KH3A 1XSEA 2E1PA 2IBSA 1CUVA 3T35A 4WX2B 4I9FA 1PGOA 3BF8A 2FSIA 1HE4A 4J2TA 4XX0A 3RQIA 3VGPA 3VMFA 2H2WA 2PLNA 1VPDA 3G02A 4F45A 4UM9B 2TMGA 5IG2A 3UH1A 4BN5A 4TWJA 5D01A 5C8YA 1MV8A 1VHTA 1LNSA 3FPEA 2DFPA 2R87A 1VCHA 5AXBA 4DDUA 1DQPA 3I61A 3D8HA 3IP5A 2BHSA 3B53X 3GJYA 1MAVA 5HE8A 4LHSA 4KVZA 1WE2A 1NU8A 1SVWA 3HYLA 1XU9A 2QXUA 4YJ2F 5J59A 1FXWA 1F1JA 3EOBI 3JQCA 4GXNA 4HD8A 5D7NA 2QSUA 3L82B 4PHCA 1FS4A 2RDMA 3DHEA 3SXJA 5C3UA 5A2QA 1QLWA 1OVGA 3NHSA 4LUCA 1JDPA 3LT4A 2R1VB 1CUJA 3RGGA 4EAQA 3O4JA 3A9CA 2JBHA 4AK9A 1RI3A 1RLTA 5C8VA 4QWWA 3EAGA 5T4FA 1GPNA 1BS1A 4DVJA 1FNSA 3LIIA 3GLFB 4OV6B 1K8ZB 5H59A 4LYEA 3FOAA 3C5HA 1X1CA 1E8NA 3R0VA 3P2KA 4C4TA 3GQVA 3FNRA 4A0QA 4BLWA 1GXSA 1TD1A 3NBFA 4MP3A 1RXIA 1HRDA 1PDVA 2AWNA 4BWVA 1U2TA 2ZBEA 3GVXA 4LMBA 1RLIA 1XZAA 2F8SA 5K8TA 2HBQA 5DLEA 4MW1A 1VIAA 4BPRA 2NVUA 1WIWA 1XL0A 3LY9A 3FBTA 4UUPA 4Z0HO 2C2KA 4BEJA 4F7DA 4BE9A 3R7DA 1U0SY 4IO1A 1V8OA 2GAIA 2R66A 5L4NA 3EUAA 4KH1A 3GRRA 3EXIB 1IN6A 5FTJA 4Y2PA 4Y6RA 3R40A 1NOIA 3TMKA 4KREA 1MIOA 4FYPA 1L2TA 4HEQA 3VJKA 4QKQA 1JV2B 5CFLA 3BSSA 4J1SA 4NBSA 1MJFA 3HPRA 1E5DA 3L7CA 3V1YA 4MJ7A 5LR6A 3ZUGA 5AHOA 3TF5A 3EWAA 4CE6A 1NRIA 3ID6C 1JSCA 2HSEA 5FT9A 2PFSA 1J97A 2F2TA 2FW7A 5BMOA 1P74A 4TLEA 4EHJA 1RQPA 3COZA 3DTVD 2RKWA 3WP1B 4HUTA 4EENA 4MVXA 3L4KA 3R9XB 3T9EA 2XWJI 4LOLA 3CLHA 2EKPA 4KRGA 2X3UA 4ZAYA 3NO4A 3FFBA 2B4AA 2VP0A 3WGOA 4CM8A 3NG1A 3GRAA 2AZMA 3AY6A 1RJ9B 1N2JA 2BKEA 1OB2A 2R751 2HOQA 2VIIA 4K5QA 1HL7A 3BWCA 4RH0A 1B23P 2BGUA 4JXXA 8LDHA 3A3YA 4N6OA 3KEMA 3MAGA 4H0FA 4XR9A 1FJ2A 1F7UA 4UVGA 3BEDA 3CUSA 4L3VA 4IIXA 3OF3A 2AG0A 2PD4A 3OT4A 5AXDA 3OMLA 5DF1A 5JAOA 1KMQA 1NKTA 3G5TA 2F8TA 2R96A 1HH4A 1GP2A 5CAEB 2ZJ5A 4AN0A 4ZO6A 4E03A 3JQ6A 1WNTA 3MJFA 3WA6A 4B73A 4U7DA 3I9LA 4MZXA 2W2KA 1IBMB 2G07A 2IIVA 4GLOA 1XXHB 4KN5A 5LU9A 4E5VA 3U3RA 2ROQA 3V9PA 2WIKA 4GKJB 1BO6A 1GAQA 1IAQA 3GN2A 1O7JA 1QZZA 3E1SA 3NM5A 2Q3HA 3K73O 1DUVG 3UT6A 1V7ZA 2Y6UA 4WGGA 3U7QB 3O4IA 3U4HA 1YR8A 4E12A 1KJWA 1WKVA 1TA9A 3CQ9A 2V0CA 4XD2A 5D6NA 5UKDA 2V8BA 4BQIA 4FLFA 4AY6A 3G0DA 3X1XA 4XM2A 2LCFA 3N8HA 1VJ5A 4LIPD 2NSHA 5EFOA 4M9SA 2FVYA 3WWEA 2IFTA 2I4NA 3SGLA 1OJ7A 4Q37A 4EGCB 3G8CA 2JI6A 3OCVA 1CJCA 1VZ2A 2X9LA 3HNRA 3QBEA 3VXKA 5FBKA 5INTA 1JKMA 2NZJA 3KOYA 1L3BA 1AURA 1YOVB 4ZEVA 2EATA 2F9FA 2LD4A 3DH0A 1Z6PA 1CE8A 3LG2A 3QV1A 4YIKA 2X2FA 1EFAA 3BHIA 4B4UA 1N8KA 4YRLA 4AG3A 4PLGA 2RGCA 1NVDA 1M2EA 3UICA 3U4QA 2P9GA 3T7JA 4E14A 2IS1A 1QFZA 4U9UA 2GDZA 5GY7A 3V4RA 4UMFA 2L0XA 4W5WA 4Q24A 1P7VA 2J0UB 3UZUA 2VF4X 4KNVA 4Z0PA 1RI2A 3TB4A 3AR4A 1UXIA 2I67A 1VPTA 3LUCA 3OICA 4MVJF 2SKEA 3OQIB 2GDJA 4OJTA 1VGRA 5JAMA 4B6OA 5FUBA 4EFKA 1KI9A 2BBWA 3HLTA 4UBLA 2HA6A 4QFDA 3GNSA 2HRBA 1Z0UA 4UNRA 4Q4JA 2Q5EA 4KBGA 5HK9A 4C14A 1PJ4A 4ZCTA 1KFEB 1CUCA 4BQFA 4RPLA 1KDRA 3JWEA 4FFBB 1H6AA 5L53A 5ENVA 4RPCA 1V16A 3BXGA 4RDCA 1OAOA 3ZD8A 1ZI6A 3P45A 3I1YA 4U7WA 3HDTA 5AM5A 1NY5A 4B0OA 2DU8A 2YV4A 5DCWA 5TVGA 2AN1A 5K1ZA 2EFCB 1LSUA 1Q21A 3SJUA 1JZQA 4F6CA 1ISIA 2C2YA 4KUEA 1J2YA 2WC1A 3ER9A 1S8OA 1TZMA 4I55B 3F8WA 4R2JA 2C2WA 3B5JA 1B6SA 3NIDB 3UGQA 4BMNA 1CZOA 3TR0A 3GUZA 3PXBA 2WEKA 3QTBA 4KQ6A 2GWRA 3SHFA 1ZMXA 4I8XA 5IWCA 5LUAA 3KUKA 3PPVA 4W1PA 1JAIA 1W36B 2P6PA 5FHRA 1PK7A 2LKCA 3H5VA 1FTGA 2O2EA 3IILA 1H85A 1WEKA 2PKCA 3D7LA 4AF7A 3E6AA 3RYFA 1V8ZA 1Z6YA 1EJBA 1YVRA 2RH5A 4CKCB 2RHBA 3WHIA 1NXVA 4JDUA 1ZICA 2EX1A 3EJWA 1TO1E 4AW9A 3KZNA 1KI1A 1M3SA 2JH9A 3MLBA 3QJYA 3KRTA 2MTBA 1YQDA 5K3SA 4KLRA 1GCAA 3U56A 3AOEC 1OTHA 2PY6A 1PP4A 4B3RB 4XB2A 1X9HA 2I4OA 4FYIA 1F3OA 1EXNA 1OREA 1OILA 4HQRA 4L4SA 3QKIA 1I3OA 2NTVA 4MYHA 2F43B 3LC0A 1ZD5A 1GN9A 2DPXA 4QXMA 4OTZA 4N54A 2BUAA 3PLRA 4PANA 1JT2A 4W99A 3V7WA 1F7VA 4F85A 3M7IA 2AG1A 2XNSA 1UIMA 3NONA 3Q6NA 5JJCA 2DCMA 4OYYA 1DQZA 1NG1A 3K53A 2I3BA 4ZXFA 4EJSB 3MRVA 4CT4B 5I7RA 3BD7A 1KOJA 3CZCA 3WGJA 1WY5A 3DPIA 3LBYA 4KN8A 4QUGA 3ZX5A 4BLOA 2MSKA 5M34A 1EVJA 1XNJA 2DP4E 3GBPA 1TMKA 3F9IA 1U0RA 4QICA 1UFOA 3QEMB 4E2ZA 3T0GA 3D8RA 3OU7A 4IBOA 2Q49A 2AQ8A 4JYZA 4FEAA 2FUEA 1YB1A 2B0JA 3SAJA 1PG2A 3H6GA 3UAVA 2QR5A 2OOSA 4R0MA 3KT8A 3CZAA 2HFJA 4EYEA 1OKKA 2WU3A 4JT2A 1FS6A 1N1EA 3BJEA 3PHCA 4IS2A 4KIJA 4ZPXA 5THQA 4EIWA 4BFXA 2HV8A 4BEWA 1OY1A 3IAS1 4UQPA 3D54D 4MHTA 3H8SA 2K5UA 4YAKA 1K6MA 5EJFA 3AVOA 3RDPA 4OGFA 3SG0A 2IEYA 1CR0A 2HK6A 1GQRA 5ICSA 3CNHA 5JZ9A 3T7EA 3C3MA 4XSGA 2R5FA 4M2LA 4WACA 5I7HA 4YK7A 2WP8J 3PC2A 2H1CA 2E21A 3HWRA 3AJRA 2QRKA 2A7QA 1KO7A 1YK0A 5L4LA 1SD2A 3BTVA 1DC4A 4UM5A 2A9OA 3CXRA 3EA5A 2VT2A 3R41A 1H6DA 4RF4A 3U7IA 5CYPA 1JNXX 2Y1KA 2WUFA 1L4GA 4AO7A 3NBYC 3QVGB 3U09A 2VZ0A 5K4AA 1JQKA 4TL6A 1Z56C 1KJYA 4BBPA 1JLLA 4G85A 1GNQA 1ISJA 4YMUA 3EIFA 1KXJA 1V5FA 1PWXA 1JU3A 4WASA 2E85A 5TQVA 1SCBA 1U8CB 3ZK8A 1M0TA 8GPBA 2C9BA 1Z26A 4MUMA 1SHJA 1IPEA 4S3MA 3JWIA 3AESA 1H0HA 3WIBA 2ODQA 2W2TA 2BI8A 4LXYA 3H5OA 4MQ5A 5ER6A 5EJ4A 2FPIB 2IYWA 4K2HA 4K1XA 1EA7A 1HE8B 3CEAA 3IP3A 2GXQA 5TQ0A 1MH9A 4YQFA 1FMFA 1A9PA 3KQQA 2J4DA 4H18A 3UK0A 1VJGA 3KPUA 1KYQA 2QROA 1LK0A 2Y05A 2GHRA 1KI4A 3KZ1E 4AJ1A 5IDQA 1C1YA 1GZ7A 3VO2A 2IX3A 3T5PA 1KY2A 3MT0A 4UU7A 3PXDA 4AWXA 1S9HA 1JVNA 4PPFA 4CMCA 1LPMA 4D0LB 1C0KA 3NHZA 1DC3A 1UK7A 4JJ7A 3S2GA 1JDSA 2XYRA 3ZDEA 4BBJA 2IS4A 2VDQB 1T8RA 1WDWB 1NX9A 2DLCX 2VRBA 1DP4A 3PNSA 4QQFA 3SBXA 4CU2A 5IZCC 2AI1A 1Y1LA 4FR0A 1UWCA 4MUKA 3CT4A 2WF6A 3ZU4A 2ZS7A 2H5IA 3KEQA 4AX8A 1E6WA 4IDHA 1O95D 1LI7A 1F4PA 3I52A 4BZWA 4RXTA 4KMRA 1C1XB 2VN8A 2P65A 5JYDA 1U3GA 4BWYA 2EL7A 4WHMA 1BXRB 2IPOA 4HZUA 1UJ5A 4IDAA 2VSFA 2V7QA 2XTMA 3OY2A 1UBMS 2F3UA 4NYJQ 5T67A 4GX0A 3A3NA 2Q07A 5TQ2B 2PAAA 3EVTA 1OFUX 2ESRA 2HA5A 2UYCA 3BZUA 4CQLB 3MVEA 2YR0A 1NVUQ 4ZOBA 4LYGA 4FI3F 4NAHA 3AMVA 3RS3A 3O8QB 4S24A 3EJ6A 3VR6A 5CW2A 2QTRA 2IE8A 3LY5A 1MC1A 3SC4A 2XUIA 2REXB 2VXYA 3SLRA 4HNUA 1YZKA 5KOHA 1A3CA 1O5IA 1CXZA 3I6QA 1NF8A 3TOZA 5JXGA 5L8VA 2W42A 1R12A 1Y4DE 2EW8A 3HU1A 3IVXA 2BM8A 2D0OB 5CVCA 5F12A 5H70A 1JYSA 1OZAA 1QVZA 4A0RA 1KZ6A 3F96A 3ZZ1A 1FDVA 1Z6TA 4CLRA 1V11A 3E3NA 4FEYA 1QFMA 2EQ5A 4XYGA 3BL6A 6YASA 4HP8A 3LHDA 1MFZA 4MQBA 1KQNA 1I8TA 2PZJA 1ENOA 1VOTA 1YZFA 3CF2A 4WKNA 2YWXA 4YAFA 4RPKA 3UWKA 4EDHA 8MHTA 1ISPA 1G8SA 1QQ5A 3I5MA 3OP1A 5CFMA 4V2UA 4Q1EA 3GGCA 3D3JA 3GLUA 3EF0A 4PO1A 1BH6A 1ODTC 2W6JD 3PX7A 3EXAA 3IQIX 1CR6A 2J85A 3KSDO 1BS2A 1M1YA 3AO0B 4B4WA 4EB6B 1FLAA 1SVOA 2RBEA 3GJZA 4JH0A 4OIFA 5FQNA 4RETA 3T7RA 3DV2A 5DYGA 3H86A 3LGAA 3EXEB 1ST2A 1WDMA 1Y3IA 1W9HA 1ZD4A 3FJ1A 3K94A 3M8KA 4UXIA 4BKRA 2HLDD 1SKMA 2HMTA 2ZWIA 5IH7A 2J5BA 1OXSC 1OZ0A 3D7NA 1PQWA 3I2FA 2QBYB 1SG6A 2ONKA 3GIWA 1EWRA 4CL0A 4D4KA 4EMSA 5KOIA 3MD0A 5BPHA 4DMGA 4KXWA 4W82A 2NO6A 4DQLA 1FVOA 3FBGA 3WNBA 3TZKA 5AKGA 2H1SA 2YMQA 4XGRA 5J5CA 4AMVA 1V25A 3JZAA 1JAZA 2D3TA 2XSZA 2Z9CA 3R3SA 3ZEAA 4B0PA 1SVSA 4X3CA 3TZLA 3UT5B 1O8CA 3ETJA 5LXTB 1B76A 4X6XA 4DTIA 1COWD 3KUUA 3M1LA 1RR6A 3Q3GE 1XRQA 2AIRA 2G5PA 3NTUA 4J7CA 3N2KB 1X77A 1YZHA 3TCNA 4QSMA 1U8XX 3N2GA 2ZRIA 1UK8A 3QW2A 4EY3A 2IYLD 5CX1B 5A05A 1QVRA 3EQ2A 4XJXA 2QJFA 3NI2A 4OP3A 2WJWA 1H4TA 4LX8A 4XYEA 5A5FA 4JYAB 2XXJA 4E2WA 1RHJA 4IMPA 4CEIB 4KNYA 2PKWA 4J4BA 3A2MA 2C5SA 3PQEA 1WU7A 5AHWA 1C14A 4LRXA 2UXDB 4GZ3A 2QUZA 4AZTA 3RFUA 3RROA 3AFGA 4FOPA 2XMZA 2Q5QA 1MW8X 3ZVKA 3U7FB 1V48A 2WOOA 1UDXA 1HZJA 4W9NC 4HDKB 1L9KA 3WDMA 1E98A 4MV9A 5JEDA 2EP5A 4CMIA 2D4HA 2N9UA 3GGPA 3ROZA 3VA7A 4FYMA 2A0YA 4KWHA 1Z5VA 3HWSA 4XB1A 5ER9A 3CY6A 2QORA 3ZXXA 4BO7A 5B7QA 3NYIA 4PZYA 3AF0A 4P4GA 1NLMA 2A1TS 1L1QA 3I8SA 4PSVA 3WDKA 1KYYA 3GEHA 2Y1DA 4CV3A 1ZCZA 3WZ2A 4A23A 5FCDA 3KDPA 3P94A 4PRKA 2XCTB 5HCUA 4OK3A 1RPTA 5B7PA 4QGSA 2QXTA 3FHTA 4YUZA 2EBHX 3LS2A 3ETEA 1E2EA 1WS6A 2XTNA 2GVZC 2V9CA 3AC0A 5EZYB 3DLAA 4F21A 1Q0SA 1IIRA 1JU9A 4Q02A 1U1CA 1BHO1 1JH8A 3NP7A 2J9FA 4HQKA 1POXA 1H9BA 2GBLA 3HUUA 3KQUA 1E61A 1SUFA 2BCJQ 1Q7GA 4OUKX 4OMCA 2VS1A 3WXMA 1EVQA 1ONSA 2DY0A 4YRTA 1H4QA 2L69A 2HRQA 2JGMA 1L5QA 4XA8A 2PUDA 1X9IA 4Y6GB 3B6KA 4PS1A 4CQJA 1QS0B 3TKLA 1YL5A 2GUWA 4GE3A 1NRXA 2JI9A 3ZE8A 4TV9B 4TVKA 3ANNA 4I50B 1QGZA 1CUSA 3HJTA 1YJ5A 2W6PA 2Z1NA 2Z2YA 3PC4A 1W30A 4MUEA 2AD1A 4QBTA 4WGFA 1IH8A 5CNIA 4ZVRA 1PN3A 4WEOA 4ZVUA 1QJCA 1XZMA 5BQXA 2LCIA 1RRPA 4HPJB 4OJYA 4BQRA 1SKYB 3CUWA 4KITB 2JCSA 3GCWA 2WTMA 3IR7A 3ORQA 4OUDA 3U9TA 4P32A 2PGNA 4ETMA 2IQIA 3D5EA 4IIDA 4YCAA 1Z0ZA 3EE6A 3K1TA 1OVMA 3K31A 4JUAA 1SUPA 4XVQA 1DIAA 2DWUA 3EBPA 4HPWA 3ZLBA 2IF0A 4AMYA 5EMMA 3WNDA 3K70D 5K6AA 2UZAA 5BV1A 3IESA 5ALEA 3ED1A 2BC9A 4L76A 4L51A 5LA6A 3TZBA 4D5GA 1T2NA 2XUJA 4JGGA 1LZKA 1E3MA 5LP6C 2NUBA 4KNWA 5JS8A 3ESQA 3NC1C 5CNMA 5DNWA 3OPNA 4DLWA 2VR1A 5K3OA 4GX2A 3UA4A 2VDPB 1TJ5A 3AR5A 5KOJB 1RFLA 3W8FA 4PX5A 2CCJA 1XF1A 1QIEA 4J3FA 1H2HA 4B3JA 5IRCD 3KP1A 1I0ZA 1WY7A 1KEWA 2C95A 2VYNA 3H4VA 4DJEC 1GIAA 2PKEA 5HNKA 1KU0A 3GDWA 4TT3D 2QSJA 1RCFA 5ALXA 2DETA 1UWKA 1HRKA 1N6RA 3SX2A 3I3OA 3QF7A 5I51A 4GQAA 4ZPJA 2I9PA 1GAEO 4WBNA 2ZSBA 3SEZA 1JQDA 2OQIA 1SKBA 4IVRA 4ZT7A 1J56A 2IXTA 2R6GA 3CX3A 1X80B 1NP7A 2P9HA 2Q1XA 4H7EA 4LC1A 3IQDB 1OX5A 5CH5A 1XD8A 1SXJA 1ZNWA 2QPLA 2R7NA 3FBWA 4K6MA 3SYNA 4QFMA 2VUHB 2WI8A 2WAAA 3MJHA 2HMWA 1KHTA 1Q57A 1U94A 2RK6A 4X44A 4CUJA 1Z5OA 3PKZA 4HZIA 4ZJPA 1ZDMA 3CJTA 4BZQA 1VSVA 4FIZA 4JU8A 1N92A 4N7JA 1NTOA 2Q2NA 4FONA 4CN9A 3MUNA 1YAJA 4RTJA 1RM3A 3ICPA 4YFYA 2R6CA 1TCBA 4I6GA 2NZYA 4Z54A 1S7CA 3VHXB 1N5LA 1IY2A 2VF5X 5DCUA 2JC3A 3FOCA 5BWLA 5ICCA 2FOIA 2NNLD 4OXNA 3UTDA 2AFIB 3OEHA 3SMQA 5HWSA 2L17A 2ZREA 4M0FA 4CL2A 1VL2A 2EXXA 4F04A 1ISFA 1JF8A 3IVRA 3QM1A 5HBGA 3JZIA 3LDFA 5REQA 1CZNA 2NXJA 3ESDA 2X40A 3NEJA 2CMHA 4BLUA 3TQHA 3KKNA 2XUDA 4DC9A 3IEXA 1DEHA 5CH3A 1GTRA 3THRA 3HFSA 3CINA 1JJVA 4WXPA 3CU5A 3EEIA 3KUXA 2DT8A 2EV9A 2X3YA 2UUOA 2FUG6 3B3AA 1CIPA 3CUTA 4P36A 4HNVA 4EOGA 2QEQA 1E1KA 3R1IA 4JQYA 4LF9B 1JBQA 3T5AA 3VYWA 4JOBA 5CBPB 3ELWA 1R8JA 4TVSA 3DB1A 3FNFA 3GAZA 5CTJA 5FBZA 1POWA 3EULA 1U9IA 4QWMA 1QU2A 1FQKA 5HOEA 1HFKA 2NXCA 2ZBDA 1BRMA 1LW7A 1U4OA 1H2WA 3ZV6A 3KS9A 3AL2A 2EZ4A 1UMBB 2B4QA 3AHCA 3ETGA 3W7AA 3G9TA 2VDOB 3IEVA 3CEJA 3QXHA 1RTKA 4MV0A 2BFNA 1C7QA 3RS9A 1MB3A 1R6UA 2HWXA 3IJPA 4RY2A 4EF6A 4UBJA 1Y7IA 3KKOA 2YXEA 2XZDA 3MSCA 2WSIA 2W2QA 4NCXA 3IV7A 4ODIA 4QU0A 1T8YA 1YMQA 1PDWA 4X20A 5EJ2A 4ZAXA 4EWLA 5BRAA 3VV3A 3NFRA 1ESNA 5HMLA 4YAOA 4AY3A 2PUEA 1CQJA 3VTAA 4PNHA 5HF6A 1QIIA 4JUBA 1TFRA 1UBJS 2GKOA 1YRYE 3GZ4A 4UTPA 4KDEA 1DJMA 2A5JA 4ZOQI 2AEJA 3HKCB 3OIUA 5LZ2A 2AG5A 4DJ5X 4JKOA 2XA1A 3N0VA 4DIFA 5EJ6A 4XUCA 3GDHA 1NBEA 3IMFA 4KO2S 3O2SB 3VZDA 5LU8A 1P3Y1 3ZWPA 5E7MA 2FN3A 2Z0MA 2OVFA 4ZV9A 2QVGA 3G0CA 2GRUA 5J47A 1NLZA 3PUXA 1II8B 3JQRA 4IQ0A 5EQDA 1ND6A 5ILGA 5L7WA 3OLQA 3KQOA 1US8B 1Y1QA 1YB2A 4MVWA 3HJUA 4FYJA 3IULA 4PSUA 4E31A 1ENPA 1XCLA 2ADFA 1ECCA 1MB2A 3FYCA 1T9GR 3BMCB 2HH9A 3D3WB 1E6EA 4OHPA 4F12A 1EYZA 2ZRBA 4MUJA 2ZRLA 2BDEA 1U0HC 5HXAA 4Q9NA 5JAHA 2O48X 4DDWA 4WZAA 3FM9A 1XN4A 4L85A 4D9IA 4JT8A 4UU0A 4CEJA 4EG1A 3ONDA 3FZGA 3L4BA 3RUEA 2G1AA 1L4BA 2BHLA 2H5EA 3E2PA 3ELDA 1AZSC 2IHTA 1E9RA 2O57A 4ER5A 4ZZ0A 5B30A 2ZJZA 1TKRA 5C35A 4JLSA 3G5AA 3H6HA 1GCOA 2X86A 5H80A 2IBTA 3UYLA 1FZTA 2P68A 2OQVA 1JA9A 1YJ8A 2RGAA 5K0JA 3ZVMA 3N7AA 1SRRA 2F8MA 1PFWA 1QPZA 1W93A 3KQLA 5GADl 1H8EA 4WJZA 1PJTA 4TKUA 3ZDDA 1IM5A 1M76A 2Q29A 3I9NA 3R3XA 2OHHA 4QODA 1L4NA 1SH7A 2MSNA 1A4RA 4IY1A 1FFHA 1FLNA 1VBKA 1EIWA 2I29A 3ABRB 4ENPA 1E8DA 1BDJA 3JCZA 4UC0A 1WHTB 4OHOA 5L4SA 2B83A 5AKEA 2X9VA 1O5OA 4A15A 1GA4A 4GLLA 2DCUA 4KFTA 1TUIA 2OAP1 2N47A 5T41A 4DYDA 4JK3A 3MUOA 1D7AA 2QX4A 4I4LA 1MTOA 1GRRA 2GLTA 2GRJA 4UEQA 1USWA 3E1GA 3RV3A 3VTKA 4AKEA 4BAUA 4D8WA 3RS2A 5THKA 3DDHA 5CXUA 4M87A 1E18A 2JZCA 2YRXA 3QMMA 3ICCA 3AINA 3E7FA 4KZPA 3ROPA 4O1IA 2B61A 1P73A 2YIMA 1TUBB 3RC7A 4EATA 3RAEC 1O95C 1N0VC 5CX4A 3LUAA 2O8FB 1ZK3A 1W87A 2PXXA 3AR9A 3DE2X 4HH1A 4NP6A 1Q7TA 2HU2A 2WMOB 3OQHA 4BJHB 1JIKA 5AOVA 1I4DD 1BWRA 1F2UA 3H8VA 1C4XA 5KJEA 2OUIA 5FWXB 2Q3BA 3DOCA 3VPSA 1MTZA 1SELA 2HRDA 1YDEA 5BSMA 5TT1A 1N2CA 4RQAA 4BIIA 1VLJA 3B6EA 3PITA 4EF4A 2EFEB 1PSDA 2P9QA 5JY6A 3G2JA 4MA5A 1YL7A 1RRMA 4B31A 2I2BA 4GP7A 3WRYA 3MLAA 4PXYA 1RLJA 5JSKA 5CB0A 1VFNA 2Y93A 4P7KA 3TR6A 5C37A 4XYLA 5DO9A 1O96A 2Q50A 5DBIA 3LZCA 4R84A 1PZMA 2QSYA 3O1JC 1V71A 1WCIB 5E0OA 3RJTA 3WADA 2UZ1A 2WIJA 5A6SB 3S2UA 2VJMA 4JLVA 4GVPA 3IA2A 3LBIA 2GEUA 2V98A 1BRTA 2XMPA 4G5FA 1R15A 3LQFA 1L5LA 3BWXA 4LY3A 2OFPA 3UFXA 5C31A 2DBRA 3GB9A 4UDYX 1A8SA 1HE3A 3PEFA 2HA3A 4B3HA 3NUZA 3EY4A 1PIWA 4N0MA 4TMVA 5DHAA 3FLAA 1XCBA 1PD0A 2H2DA 2JGDB 3LOUA 3PCXA 4NOKA 3HG7A 1JJAA 3OMWA 5HTKA 4O1HA 4B6GA 1TC2A 1XE3A 4PZLA 2B8TA 5KTKA 4UBIA 2GCIA 2XB4A 4GX5A 1SVKA 2SCUB 1E2NA 4UBOA 1AK2A 3OOSA 3S1AB 3ZN2A 3QBTA 1U2EA 1R3DA 4FFOA 1QZXA 1Y7TA 4MW4A 4LBWA 4AB1A 4RLHA 4LE1A 4B74A 2Z2XA 1JQBA 4Z5XA 1HEYA 1YSCA 4HDMA 4HVTA 1H69A 1PVOA 1T5BA 5IBQA 3WLHA 1P2SA 4LXGA 1LWNA 2R2AA 2PLFA 1GFSA 1U28A 4FU0A 4AYWA 4G2NA 1KJ8A 5E0KB 1XIVA 5T3YA 1T8TA 4O2BA 3COPA 4NTZA 4CLOA 1D0IA 2P4HX 4RS4A 5JCPA 1KAHA 4ZHQF 1NQAO 2P2DA 2YY6A 1ESCA 1YS9A 3EDCA 1U7TA 3GLHE 4PQYA 4Q4AB 3K2BA 5DBHX 3SEAA 4FDAA 4EG5A 2J46A 2OB1A 2P3QA 2VAXA 4Q34A 1Q22A 3VR6D 1IDOA 1JJFA 4WH0A 3TQOA 3ZW7A 5LVAA 3LWZA 3E23A 1VG9B 2X4LA 4G9GA 1G7RA 4WXHA 1C9DB 3AIOA 1DAHA 1W2GA 4ZTUB 1CRLA 3AOGA 3EISA 3VBCA 2AXPA 1A7UA 4A2CA 3ZJYA 2ZDQA 3OZAA 3UK6A 1EFTA 4WT7A 1KK1A 5FNVB 5C8DA 5LQMA 1FNCA 4JL8A 2ETXA 1ORVA 3AVPA 3I01M 4HWSA 4KACA 5HKOA 1G59A 3I09A 2WSMA 2XD9A 5C18A 2BFEB 3RADC 1O87A 1X2EA 2ZYIA 4IZ6A 3L0CA 4RA6B 2J4CA 3TUIC 1MXFA 2IV2X 1Y0BA 3KXIA 3MXTA 5J2UF 4QXRA 1VPWA 3FW1A 3PDUA 5D1NA 2GCPA 3IUMA 1CKEA 1H93A 2Q1TA 2HTEA 2Y2UA 3MYRA 3TW0A 2HQ1A 4YO8A 3FPAA 5A4AA 1L4LA 2ARKA 3I5AA 4X1YB 3VVLA 3H42B 5JZMA 1ONBA 1VPLA 2CNNA 2WF9A 2WR8A 2YZMA 1XAJA 4MUXA 4DJJA 3A9UA 1CFZA 3P8ZA 4RVDA 1XDUA 2DQ4A 5CXXA 1MG5A 3VZCA 3U5TA 1M2KA 4MJ3A 3U3OA 3CRQA 5BV8A 4IHQA 1TU3A 2QZPA 1RM4A 2NYAA 3HP1A 1RKBA 2C99A 2XYVA 4R31A 1G20A 1F2TA 4JVLA 1V3QE 1CUBA 5EMKA 3BYZA 4PG8A 1RQ2A 4LOAA 4I08A 5E6SB 3GAAA 5IABA 1EQ2A 1UMCA 2SKCA 4KHZA 3IKLA 1G66A 4GUDA 4K6GA 4KSYA 4YJGA 3W4IA 2FFJA 2FPMA 2C9MA 3A58B 5KU1A 4BB5A 3LFUA 1X1AA 2IRWA 3A1SA 4A2QA 3L1JA 1E2QA 1LQTA 2GPTA 1P3JA 5EKXA 3WWZA 1YXMA 2RGUA 4OP2A 1EX7A 3H84A 1L0BA 3LL7A 4DMFA 2QIOA 1N32B 2VXCA 3ASZA 3K1JA 1PL6A 2J6CA 2GJ8A 3L40A 3F46A 4DZTA 2GPYA 4FTWA 3DO6A 4S1WA 3RS0A 2B2XA 3LHSA 2QMHA 3GD7A 4IHAA 4ZCLA 4PG4A 3RVBA 3E7PA 4CDGA 1M54A 1H66A 2P9CA 1SVMA 4TV8F 3HEAA 3UCEA 4DA8A 5LP6B 1HLGA 1QMGA 3NS7A 3QXGA 3P2OA 2ZRQA 4DNPA 1ESZA 3SYKA 4EYKA 3EYWA 3PI7A 1WCYA 5IYZB 3AHFA 1U63A 4QD3A 1Z4QA 1LI4A 4OHXA 3KE8A 1JE1A 3RU3A 4ND5A 3ZWDA 3WYCA 2CYCA 2NOAA 3K70C 3FHLA 3Q8LA 3NUGA 2MJLA 1RWKA 5T7BA 1UDRA 4GBED 1QMPA 3GJ4A 1NBIA 3AERA 3R20A 1U3VA 4D4GA 2CSXA 3D6JA 4IS3A 1HTWA 4TMZA 2G9UA 1GUBA 1W2WB 1P2VA 2BKXA 2OC4A 3PC7A 16PKA 2FCAA 4H1VA 4K6HA 4L4YA 1ADCA 3IE2A 1KK3A 2OILA 3QYAA 2PMDA 4NJOA 3RTBA 2DHCA 1X7WB 4FYHA 1YAHA 4TYQA 5DPMA 2HXSA 2ZT6A 3HJHA 1K5PA 1MRZA 3LZ6A 1D9ZA 3T0IA 3FMIA 4FQ7A 1ZD1A 4Q7EA 2JLYA 3CVYA 1FJXA 1E6UA 3EHDA 4XUEA 3UC5A 4D74A 3LCUA 4QDJA 1Y9AA 1X92A 1M1NA 1KEEA 2L42A 1G2IA 2FG6C 3SVTA 1M2NA 3RSSA 4YCCA 2WJZB 4TLBA 4UAGA 3L0PA 5D85A 5ALFA 1B16A 3PDIA 5FIUA 1LBQA 4QOHA 1BW9B 3L01A 5MN6A 1JDVA 1UK9A 5EUQB 1BX0A 1E63A 1MBZA 3PTAA 3LHKA 2PEZA 3EQZA 4BVKA 2JG3A 3OHSX 5CCBA 3BC1A 1FBTA 2J7PD 4M7WA 4UDXX 5G0VA 2D2XA 2O0JA 4BLVA 4WOJA 2HJWA 2AGVA 4BNDA 4JIMA 3DDOA 3QVTA 4LJSA 3DT6A 2Y71A 3U0VA 1YDWA 1Z0JA 2B99A 3GA5A 5BSKA 1GTSA 3AH8A 5DBFA 4Q00A 1SCUA 1O3YA 1PQUA 3C7DB 1M2FA 2HF9A 1NUPA 4TMXA 1MMFB 4U7GA 3D4OA 3TE7A 4CTNA 4IDFA 5IFKA 3LM8A 5FBHA 2G67A 1E2KA 4CCSA 1JFFB 1GM5A 1QK3A 1AKUA 4O6VA 3LH5A 1T1EA 2FCRA 3TE6A 4AY4A 4P0QB 2NXEA 4C29A 2O8VA 4X7MA 3Q9SA 1E2UA 3IAUA 1QK4A 2GJKA 9GPBA 1LDNA 1QGDA 2V58A 3RG2A 4DILA 3H16A 4K87A 4Q1CA 4XRRA 3WLJA 1RE0A 3T3EA 1HR0B 4EY8A 5IN4A 2O0MA 5EHIA 3WKBA 5BQPA 4AMBA 3C7AA 1GQFA 1ZWKA 3G0GA 2ID8A 3EZ6A 2VZ8A 4RXMA 4BB6A 5F52A 2I1LA 3T94A 4BDSA 4UTOA 3HL0A 2DBYA 4ZCIA 5ENZA 3TXYA 5KDOA 3UK7A 2ODEA 3ETNA 3E9QA 3TIXB 2PJRA 3T9AA 3V33A 3C15C 3A26A 2C2HA 2NU6B 2HYIC 4NONA 4BO6A 3OI7A 3BMNB 3MN1A 1O94A 2VXOA 2ZCUA 2ZQYA 1XLTC 2BHTA 2GEDA 2H3EA 4IOKA 1ORHA 2I9KA 4TV9F 2ZTVA 7MHTA 3LVRE 1NUHA 1T3GA 1W0JA 2BMVA 1CPYA 3DE7X 4FGUA 4JQCA 2ICAA 3AR7A 3IBTA 5A5EA 2XEDA 3EC7A 2IQ5A 3ANXA 1IXYA 4L9RA 1L4MA 4XIIA 4BZZA 4WZBE 2DUMA 2EGGA 4U5QA 5HJ5A 2XXAB 4CNBA 5IVPA 1OLSB 3IL2A 4QNNA 3G49A 1FNBA 2ORIA 4G1FA 2QV7A 1QZ3A 3QG5A 2AOVA 2ZUFA 2FSHA 4TWRA 1P0IA 3ESXA 1HE1C 1KAGA 1W2HA 4HB2A 4BV2A 1U6IA 3EN0A 3Q9NA 1QOPB 2EKZA 3A4VA 1KI2A 5JFGA 3DPUA 1Z0DA 4JXKA 4XJSA 3GLGB 1AJEA 4INPA 1ZOIA 3MELA 3OAAA 3TJZA 4D0GA 4CTOA 4E1VA 1JFSA 1B2LA 1KK2A 3E81A 4O59O 1XLUA 1QYRA 4ZGWA 2R8RA 1MB0A 3RFXA 5AD1A 5JD4A 2EBWA 1YFLA 3FLMA 1ZBQA 1QKJA 4QPPA 1QF9A 1ID8A 2ZCVA 3U7JA 1XHFA 2HN9A 1A95A 1QDEA 3TDNA 4PN7A 4AZ3B 4HTAA 5BN4A 5BUQA 4J6EA 2OBYA 1V8BA 3ORHA 1A0OA 2C9YA 3KJXA 2MSLA 4HUJA 3HU3A 4YUVA 3TSOA 4F92B 4FW9A 2ON6A 4OK6A 4UHHA 2DGDA 2NT3A 1LVGA 4UBKA 1WZNA 3H1AA 2R97A 4H7IA 1BG6A 2HIHA 4D8VA 4JLPA 4JBHA 2XPCA 4GPD1 4YMIA 5ES3A 1VHLA 4RZIA 1GV1A 5IAEA 1OT5A 3C0KA 1HKHA 1Q92A 1V6AA 4JFRA 1ESEA 4P31A 3R44A 5ADWA 3DTYA 5CK5A 1AU9A 4GPAA 5BO5A 1NJ1A 3VOAA 1I24A 3DKVA 4ZI7A 1RHMA 3IGFA 4NAUA 3PEWA 5E2AA 2O6HA 3UENA 4Y1RA 1E1CB 4RD1A 4DJDC 3BAFA 3PFFA 3PQDA 4ZYVA 2AOUB 1RWVA 1NYRA 2ZAMA 2G8LA 2OCGA 3GELA 3EQ9A 4QAJA 2XZLA 1IBKB 2Q8NA 1AQUA 2FLWA 1XRNA 5IS2A 3RCBA 1ORTA 4ZT5A 3C6KA 3FPFA 2HQOA 1M67A 2HMUA 5JIBA 4TS3A 3C6QA 3QEKA 1CHDA 2A9RA 3TXXA 2IUSA 3UKDA 3D5TA 4JJZA 3D0QA 4PTYA 1JHDA 5M5BA 3WDLA 2VH5R 4IIFA 1HGXA 3QELB 3UKOA 3BPSA 4M0MA 4RTOA 3GH1A 1ACJA 3EVGA 1Q17A 3KJZA 5HILA 1I36A 1ZRMA 3D3EA 1DDOA 2KYRA 3N8GA 5JXWA 4J94A 5ESRA 2WK1A 4LSWA 1ZQ9A 2VA9A 2G9NA 1SA0A 2F90A 1WMDA 2I34A 2QJRA 3N58A 1YT5A 5EPUA 4YUXA 2QPAA 1GSOA 4P4LA 3M6AA 4PHGA 3DZFA 3H11A 4YRFA 3MC1A 1C30B 5FI5A 3VU1A 3WBJA 3E35A 4MGYR 3TCXB 3MRSA 2Z9DA 5AVZA 5K6TA 3QVJA 3W1EA 3IUBA 1I51A 3H97A 4MJLA 5CA1F 4CKYA 1QB7A 2QTVB 1LPOA 3KYCB 1QIMA 2COEA 1FP6A 2GFQA 2YYSA 3NPMA 4RD3A 3R0XA 4RWEA 5FLEX 1XGKA 2LDXA 4EEZA 3G17A 4GI7A 3G13A 2JIBA 3RBVA 2PWZA 1WVGA 3E5MA 1D4ZA 1YVEI 3RYIA 2O1XA 4JB8A 4R1SA 3UMSA 4MKXA 4K9DA 2A94A 2FFRA 1KTIA 3VV2A 1RJEA 2HY7A 4D79A 3SI7A 4LI3X 3N8DA 2GM5A 3AZQA 3PBKA 4NSNA 4JB2A 4DDVA 5AO9A 2YOHA 3WGMA 4Z1OA 2RBKA 2IV7A 1ZS9A 2OHFA 3ZCQA 2IZZA 1B6TA 2QNIA 2XMCA 3DG9A 4YJ3A 4Y2XA 5BW6B 1YUMA 1DARA 4ABYA 5JY1A 2H2IA 3M3DA 4KQHA 3GLIE 3C7CB 4ZXPA 4MR8A 3R6GA 3HKDB 1T3HA 1P0PA 2NAFA 2ZRDA 3D43A 3N8IA 4MR9B 3VYTB 5H8WA 4UBMA 2FPGA 3CTMA 3HHPA 1QQTA 3AEZA 4IIJF 3TLMA 2Y99A 2JFNA 4EMUA 4PVCA 4YC7A 1R6VA 3G59A 2GD1O 1THGA 3KXPA 4XI9A 1L7OA 4GVLA 3IO3A 3C3BA 4GS5A 2QUAA 4HNAB 1JKIA 1XJ5A 3I0NA 5DEIA 3TAUA 3WIDA 4A16A 2RG7A 4BO5A 3OETA 4OQFA 2GYYA 3B3GA 4H6PA 4IGAA 1KDZA 3KPVA 1YA6A 1IG0A 1R88A 1JEOA 4JOSA 4BFCA 3KBOA 2XUKA 1N0IA 2YRFA 1XDWA 2LBPA 3CW8X 3GU3A 4FR2A 3IOYA 2CL0X 4IJ5A 3AHEA 3CE9A 4ZAFA 3JQEA 3DOUA 4ZT6A 3LVFO 4GOXA 3L1UA 4W7IA 3WK9A 3J81A 3JRNA 1SHKA 4WOCA 5DLQC 3R23A 4XX0B 1SN7A 2BFDA 3S0JA 1PS9A 3T3IA 4BNXA 2ENWA 3HADA 1QHFA 2WSBA 4RY0A 3K0SA 3T7KA 5C8YB 2QL5A 5JH7A 4O4JA 3SSMA 1GGNA 1YZYA 4G26A 4BFTA 3A05A 4WW0A 2YQZA 2Z3ZA 2YS7A 2DH5A 3DOJA 4MGIR 3W5HA 2O8BA 2JIZA 3ASYA 4IMRA 1SK8A 1IN4A 2DTDA 2C4KA 1Y8ZA 4FX5A 1KVSA 5AVWA 5LZ9A 2FUG1 2BFPA 1V4VA 5BSFA 1GGJA 4EW1A 2R85A 1VTKA 3O4GA 1DG1G 3LQ4A 4BVBA 1JWBB 2P2NA 3MWKA 3EVDA 4HAOA 4F9EA 4KV7A 1GL3A 2Y3IA 4MW6A 1ZLYA 1J07A 1CR1A 1E1LA 1VLLA 2XBLA 4Y2GA 3REQA 1L4EA 2NO5A 2WA2A 5KYVA 4B9EA 4DQDA 3UUGA 3B9PA 2OOKA 4Z4GA 1J20A 2XQJA 3Q1KA 4MARA 4CM6A 3LZDA 1TAGA 4OLHA 3CX7A 3CVOA 2WG0A 3I2IA 2ZEJA 4KP7A 4R9RA 4R9UC 4O2AA 4F2DA 3DL2A 3I05A 1P5JA 3P2MA 3H3FA 3HEMA 2Y0PA 4ZALA 4EA9A 2NVWA 2E6KA 2QQEA 3QU7A 2YJ3A 3QKUA 2EOAA 1DG9A 2PZMA 4L6IA 2C83A 3UMYA 4WOPA 2QRPA 2RIPA 2OV1A 4RK6A 2X5KO 3CCCA 4UUOA 2Q21A 5LLSA 1P1CA 4OGWA 1F0NA 4RGBA 2NVUB 5BV2P 3K72B 4HDRA 2AE2A 3IERA 4QQNA 4L9WA 2R8ZA 1JZTA 4EKDA 3RYCA 1AGNA 4WNYA 2MT9A 1YMUA 2CN1A 4DANA 1MIOB 4MRSA 4IV8A 1FC0A 3NEYA 3W5SA 1WB5A 4GICA 5TE9A 3LQ1A 1N78A 1GFIA 3KVYA 4CRWB 1XPOA 3HXKA 3OFVA 3Q2IA 1NOJA 3ASVA 1EINA 4M6WA 1OI3A 2VYVA 3LNTA 2CJYA 4D81A 3F0TA 1B3BA 1CU1A 3N0TA 2F00A 2FSVA 2X22A 4RFSA 1O54A 4DSZA 1NT2A 2RAUA 3M83A 4DXDA 4L0QA 3WNVA 1E5XA 4LKOA 3HDHA 4RVFA 5DM4A 4CM8B 3FKQA 4QLBA 2ZI3A 3SZ3A 1R27A 1GO2A 4IDBA 1LF0A 2YCLA 4RM3A 1IRXA 1S3SA 4LOHA 3A9WA 3HRIA 3QFTA 4QLAA 4KGVA 2NPFA 1MO3A 4EFLA 5D6OA 4GR9A 3V7FA 5KCMA 2R0QC 2HUPA 1JSRA 2ISCA 1OH7A 3MIIA 4Y6OA 1MQ8B 2OB2A 1V1JA 4FFLA 4U8GA 5SZHB 1SR8A 2CEKA 1LNZA 4P6VF 5LKRA 3ITKA 4TQUS 4J0QA 2IEBA 3P9RA 2IPMA 4NL4H 4BXOA 1XEAA 1PRYA 1WD7A 4DLSA 3DFZA 2W2KB 3JD1A 2VL7A 3CIFA 2NTNA 4Y18A 1N3IA 2FDXA 2FLVA 2FN7A 3FVRA 1B8OA 3O2NA 5E7IA 3QITA 1PJSA 3G9ZA 1DT5A 3OQNA 1NJSA 4HC4A 3WDSA 4BEBA 1E66A 4GP9A 3ZWOA 4GX1A 3JR3A 1QHIA 5IT5A 1ZUWA 4L50A 4WN3A 1JZSA 2OENG 3O1IC 1QIHA 3PUZA 2BR3A 4Y30A 1K8YB 2IKSA 1OYYA 1U7OA 4P2BA 3SZLA 5JRJA 1UQTA 3UKJA 5LLTA 2AJBA 4XPIA 5MGBA 2FSUA 4LRTB 2R11A 2VFAA 4HO1X 4TWAA 5J40A 1RHUA 3ERCA 4MUNA 4ZDKA 1IVYA 3U6BA 3LQ2A 3DAGA 4KE7A 1JQAA 1E0JA 2Q3EA 1WBJB 1SKAA 2CLKB 3ZCXA 4EMTA 1F9AA 2AWOA 2ZE7A 2DKFA 4LV6A 2APJA 1NGSA 3ZNQA 2XNDA 1L9XA 3A4TA 4F5YA 4C6TA 4JELA 3O0DA 4E08A 1S6YA 2QRNA 1W19A 2JIMA 3Q7IA 3D1VA 4GSYA 1CE8B 4N7BA 5IK2A 3SBEA 4U7FA 3JD0A 4WVFA 2PMBA 4EUNA 3T61A 2YVUA 3LNCA 3U4QB 4J49A 4NU5A 3T7SA 3G23A 3PE4A 4WCFC 4H7FA 4N3BA 1CUZA 5C80A 2E89A 2X0NA 2IUFA 5ADUS 3L07A 2AMYA 1EPUA 4AG6A 1FU4A 2FR8C 4IWNA 3KVRA 4WIAA 3D02A 3LLSA 2JVJA 3DSRA 1TUEA 4QG7A 3X1ZA 5K6AC 1ZK2A 4ZT4A 2XB6A 1KJJA 1KZYC 2CHQA 2BDTA 3FF1A 3VMMA 1EE9A 1C9EA 3WJ1A 5BSEA 4U6SA 2ECFA 3AB8A 5HKAA 5HKKD 3OD5A 1I7DA 4YQEA 4Q4JB 4W9MC 1ZGBA 4OM7A 1UPBA 2V03A 1SB9A 1TM1E 2IXAA 4Z7NB 3AF3A 2ADMA 3KEOA 4R69A 3U49A 6ABPA 1TVCA 4Y9DA 2ERCA 3LW7A 1FUKA 3PQ3A 4GL4A 1N4AA 1P1JA 1GG2A 1XG5A 1P62B 3WFJA 3IQHX 4LKRA 3WSWA 4TUYA 2PUJA 3PCRB 4L4XA 2Z4RA 1KZ7B 1C3EA 1FTNA 2HC9A 1D7OA 3QOFA 4Z7QB 2OKGA 3ZPXA 4TXJA 3QJ5A 4HYYA 3CX6A 2WAYA 2PWPA 3I39X 1VJRA 3LUFA 4N3AA 3V1MA 4YRCA 3B12A 1U2GC 2NADA 2ZYVX 1ZK1A 1EHYA 2G82A 3B2NA 3F8SA 1TM3E 2AKAB 3LK6A 4HX9A 3E61A 4MEAA 5DGHA 1X1SA 4Y1GA 1S8NA 3KOMA 5JR3A 2FGKA 3EPPA 1RTTA 3O91A 3RYFB 5FPQA 1GEGA 1D2AA 3CM0A 2ZRFA 4MHSA 4RXUA 3RVQA 2YJ4A 5TV2A 2EFYA 3PQ6A 4YV1A 4BJ3A 1O57A 3BWDD 3N07A 4URZR 4LQ4A 5AW5A 1OZFA 5LN1A 4KR3A 1Y63A 2PX3A 3HEBA 2P9ZA 1BYIA 1UEJA 2VDMB 5LQNA 2G25A 1GGVA 1NZDA 1IMOA 2KW5A 4D99A 4RJTA 1X1BA 5DX8A 4RHCA 2ZQ5A 3OIGA 2W93A 3C41J 5K51A 3C85A 3NJ8A 3ZJVA 4B7AA 4RC9A 3OFSA 5H16A 3ZDXB 4DNFA 1DBWA 5BSVA 1JHQA 3SE0A 1G5QA 2I6SA 3JQGA 1NSFA 2GXUA 4L72A 3QE9Y 4IRUB 4HEA6 3UIEA 4H0NA 5EI5A 4LDNA 3PR3A 3LMKA 4DCCA 1IY8A 1NV8A 2H7VA 3RTCA 2XKKA 3N2NA 3V7UA 4D6YA 4UZSA 1SUSA 4WEQA 4GPBA 4RE6A 2ZATA 3OO1A 1II9A 3IAM6 4LYDA 3WMFA 2PRKA 1V5WA 1XKTA 4M1OA 4YJHA 3P0JA 2O2IA 4YCMA 2M32A 1J09A 5F7ZA 2JIDA 1BJTA 3L7IA 4X84A 4F71A 2PVPA 5K6RA 4DL9A 2IEZA 1YI8A 4KCGA 2IWRA 2CLOB 2C2XA 1UINA 1N7HA 2WV9A 4DV0B 1AB6A 1U9IC 3MM4A 1T15A 1XWWA 1YIAA 2VHEA 4ZRDA 1ZHFA 1I9GA 4YRAA 3B1YA 4TL8A 3FOBA 4PEVA 5BT9A 2VSNA 4WLOA 2PGDA 5B53A 4KLCA 3G89A 5MFPA 3RAGA 2NVOA 1M75A 1QTRA 2IYVA 2G0NA 4M1EA 3E18A 4NXMB 1QPBA 2IYPA 3ER6A 4MLPA 3A14A 3WGTA 2PZAA 4CTMA 4DCGA 1A96A 3S7TA 4JVOA 3NCHA 3FGPA 3ND8A 3I1FA 4ZAZA 1YE8A 1IN7A 2VDRB 1ZZGA 2Q1SA 4QFBA 2YDXA 4F1WA 4ZYWA 3TM5A 2RD2A 1JDBC 5F1KA 3KETA