2AC2A

Crystal structure of the tyr13phe mutant variant of bacillus subtilis ferrochelatase with zn(2+) bound at the active site
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
309
structure length
309
Chain Sequence
SRKKMGLLVMAFGTPYKEEDIERYYTHIRRGRKPEPEMLQDLKDRYEAIGGISPLAQITEQQAHNLEQHLNEIQDEITFKAYIGLKHIEPFIEDAVAEMHKDGITEAVSIVLAPHFSTFSVQSYNKRAKEEAEKLGGLTITSVESWYDEPKFVTYWVDRVKETYASMPEDERENAMLIVSAHSLPEKIKEFGDPYPDQLHESAKLIAEGAGVSEYAVGWQSEGNTPDPWLGPDVQDLTRDLFEQKGYQAFVYVPVGFVADHLEVLYDNDYECKVVTDDIGASYYRPEMPNAKPEFIDALATVVLKKLGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferrochelatase
publication title Metallation of the Transition-state Inhibitor N-methyl Mesoporphyrin by Ferrochelatase: Implications for the Catalytic Reaction Mechanism.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Lyase
total genus 119
structure length 309
sequence length 309
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 2005-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ac2A01
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ac2A02
2HRCA 2H1VA 2XWQA 3HCNA 1AK1A 1LD3A 1L8XA 1C1HA 1LBQA 1HRKA 2Q2NA 1TJNA 1DOZA 2C8JA 2JH3A 2QD1A 2XVZA 1QGOA 4KLAA 3W1WA 2AC2A 4CCSA 2XVYA 3M4ZA 2Q3JA 4F4DA 2XWPA 2DJ5A 1C9EA 1N0IA 2QD4A 2QD5A 3LYHA 2PNJA 2QD2A 3HCRA 4MK4A 2HK6A 2QD3A 4KMMA 2H1WA 2HREA 3HCOA 3GOQA 2Q2OA 4KLCA 2XWSA 3AQIA 2AC4A 2PO7A 2PO5A 3HCPA 2XVXA 4KLRA
chains in the Genus database with same CATH superfamily
1E2KA 1SCJA 2ZWIA 3GXOA 2C2OA 3MJ4A 4GHWA 1AK1A 4NY1A 3P8ZA 1EYZA 1F9AA 1IBKB 5E6RB 4WX2B 3VZDA 1L8AA 5KWIA 1W76A 3AHIA 3HDQA 1C3JA 1ML4A 1R8JA 3R24A 6AT1A 4DDUA 1F7VA 2W4QA 4XQ0A 4JMLA 2VK4A 2XWPA 2JLCA 2WHXA 1WD5A 2Y1EA 1ESNA 3GRVA 4RQTA 3RFVA 4C4YA 3QKSA 5ECDA 3JD0A 4YCBA 3H83A 1M54A 1ECJA 1USUA 4HXGA 1KAGA 1RRMA 3PQEA 4EUFA 3D3KA 2PX2A 3G8AA 4N0DA 1DU4A 3AF2A 4PFJA 1K7CA 1P31A 1Z82A 2GDZA 3H9CA 3TR6A 5KYYA 5K9ZA 1R4AA 1K5DA 4FGJA 4LPSA 1AS2A 2VKTA 1IOVA 4I0WB 1RBZA 3PNOA 3FDJA 4JJ8A 4ZEVA 2ZROA 1X7GA 5H80A 1W1IA 3JQAA 2OYCA 4GVXA 2W22A 2RGXA 1JJVA 3T1OA 1ZD5A 2JGMA 1L7NA 1O8BA 1VIDA 2JRLA 2ZSJA 3UOAB 1ULSA 4FPXA 4QICA 2I9PA 1O6BA 1GL6A 1X1EA 1TAQA 5FJIA 2RGGA 3AHDA 2Z9CA 4FIDA 1NVEA 1DX6A 1IIBA 3GFPA 4QXPA 5AVKA 5L51A 4Q1CA 1CUXA 1OASA 4FCCA 4B3TB 1BYIA 2Q28A 4YRKA 1I2AA 2J32A 4Z4IA 5H8WA 2Z2ZA 4UD6A 1V26A 4I1VA 4YCNA 1J8QA 4WK2B 4PXAA 3GJQA 3NBKA 4M86A 4UAGA 1JG6A 1AQYA 1BH6A 4AMGA 1A9RA 1QK5A 1U65A 3BWXA 4KUGA 4H6PA 1TUBB 2JFQA 4Y9DA 4HGZA 3AVOA 1LBSA 2GCNA 3UUGA 3ZZMA 4CLDA 3GVXA 3FGZA 1OYVA 2XWJI 3T1NA 1P7CA 5DHFA 4LYHA 1DX9A 4G1BA 5FNVA 4I4CA 3TIFA 4DILA 5TIIA 4CL0A 3O95A 2R44A 2FZEA 3GRKA 5EZYB 2YXLA 2E4AA 2ERYA 3PJEA 2ZBPA 5JVDF 1SBHA 3BRQA 1KEWA 3KLPX 2JC3A 3QOWA 1E98A 2WF8A 2C42A 4N4AA 3ZLUA 2O9JA 2XUQA 4QECA 2P3SA 1CEEA 5HUQA 1PR9A 4J1NA 1LQ2A 1SXJD 2B7CA 3PE3A 1Q0HA 3RGWS 2QJFA 2QG4A 3PR1A 2ZBVA 2OXFA 3NRBA 3T34A 3KUXA 4KR0A 4EYSA 1L7QA 2P9QA 1HEIA 4RPCA 3KETA 3HZHA 3KX2A 2ZT8A 1P3JA 1OBCA 3CLTD 2H2WA 4WFIA 4DDWA 5LUBA 2ZJBA 4JJEA 1ZUHA 2JS7A 4XWYA 4AT1A 3CVVA 1HOTA 4R54A 3FBTA 3U7FB 2R8EA 1TA4A 4KIFA 3WK7A 3GZNB 5GVSA 2DUWA 2W8ZA 1DKNA 3P94A 4WOCA 3WLPA 1LLCA 4YR7A 5BPFA 5AVXA 1LDEA 5FL7D 2QRVB 1F2DA 5AJYA 4YMHA 3MD0A 4N03A 3S7TA 4YCLA 1Q0TA 3OIVA 3ZDDA 3KB1A 1ZONA 3BDVA 1E89A 3ZIAA 3G8CA 3ZYCA 5J47A 2Z6UA 4HZUA 3SDSA 3CLKA 1N2GA 4MGYR 4KB5A 2VSXA 1G20A 1GL7A 1SVMA 2DHQA 4JY7A 4O4HF 2I3AA 5K51A 4CGZA 3IP7A 2OFFA 4TLDA 2QENA 3L8FA 2YQ5A 4UBJA 1RXWA 3GUCA 3IO5A 4UNNA 1U5BA 3IUQA 1I1HA 1AZLA 4Y2SA 4PHCA 3BGSA 2WUGA 5EIEA 3EN0A 4WECA 1ZPDA 2FPPB 2ALJA 4KNYA 1L5MA 3H04A 1A04A 5CM2Z 4S2EA 4JT2A 2Z09A 3RT9A 3C24A 1G5QA 1NP7A 2H2DA 3K20A 2GD6A 3L7NA 2OCPA 4P35A 4E2FA 4EW3A 5JY6A 3HVRA 1ZJWA 5KSYA 1AQUA 1VL8A 2P4UA 4QGFA 4E4YA 4YQYA 1UUFA 1KI6B 3DOEA 4RPKA 1E2BA 3FDXA 1DAGA 1AKMA 1AQIA 1GPWB 2ETVA 5BVGA 1Y3AA 4RY2A 1WXWA 4D0NA 1ITZA 3NO4A 2SCUA 3HNPA 4OBWA 2AHRA 4BJ6A 2WD7A 2AFVA 1OBOA 3KV1A 4F4FA 2H5LA 1RHUA 3CKLA 4UCQA 2VCYA 2IHZA 4N7MA 4RZIA 5LZ4A 3HDHA 1SCUB 3S8MA 5AVJA 4HN9A 5BYJA 4IZIA 4LOAA 5LZ2A 1EX9A 1HC7A 1XEXB 4JX9A 4P4NA 3N0XA 2IH5A 4ZZ3A 4NBNA 2VBIA 3RS3A 2Q8NA 5IDQA 3IC5A 2B20A 4F96A 3KYCB 4KN8A 1D7AA 5NULA 4UUBA 3KPWA 4BX3A 1WW8A 4EATA 1TVKB 3GLHE 1IONA 4IH1A 2YWRA 4DABA 5KX5A 3LVBA 1S3IA 2LKCA 2WF6A 4OJTA 5B6JA 1UQUA 4GWKA 4Y18A 4OQQA 1NN5A 1TU3A 5GY7A 1KE1A 3CURA 1B0UA 1TJ4A 1SELA 2FNAA 2OOKA 5F78A 1RM4A 4FJ0A 1FPMA 1K88A 2HMAA 3U9TA 5IVDA 4CDNA 1I8TA 2TYSB 3FZEA 4LC0A 2QRMA 4R2IA 1V7ZA 5G0TA 4DCTA 4CTOA 3QA3E 1H2HA 4R5HA 4BC1A 3COJA 1OR8A 5G1OA 3J81A 3R9IA 5JXGA 4ZQEA 5E7IA 1KE2A 5JPCA 3JW8A 3QG5A 4IJMA 4H7FA 4KQXA 4BFZA 5AVZA 4OV6B 1NRWA 4XX1A 2OCYC 1BCRA 1VKRA 3M4NA 2DXIA 3Q11A 3QX8A 3OEYA 4IIFA 5D1NA 1PZFA 5BW4A 2WIJA 1SVOA 1D4AA 2RGBA 1IB0A 2ZE6A 3PS9A 4KGDA 4UPVA 4EVQA 4U6SA 4RFSB 3FHJA 3GUYA 3KJGA 1PEAA 1EFRA 2YYZA 4LE1A 4UUPA 4C06A 3G2KA 4C0LA 3USES 3A25A 2R8OA 2NVBA 4LXXA 3UT6A 1TCUA 3FAZA 3OZEA 5DSTA 4MEAA 1AURA 1MDBA 1SGWA 3R1IA 5IEJA 4YUZA 2JLXA 2Q6VA 2GQ0A 2P91A 3ELUA 1AE1A 2PX6A 4Y2QA 3CUTA 4II2A 5DWDA 2INGX 1R6XA 2EF0A 3QTBA 1T6BY 4IEIA 5FPTA 4ZAWA 1VECA 2XJ9A 3INTA 1ZRMA 1W5BA 4DLPA 5AK6A 2CEKA 2BAGA 3QE0A 4Q7KA 4C7KA 4D98A 3THRA 4Q93A 2GJKA 1QP7A 4PWZA 3RG8A 4I1RA 2XZDA 1D1PA 3G0CA 3G9XA 4KC0A 3REOA 3T9FA 4BVAA 1HM5A 3IAXA 2EP7A 1DCFA 4KWHA 3OM0A 4X41A 5K6AA 5FR2A 3UGKA 3S55A 2FZ4A 1N78A 4K05A 3EXIB 1YDMA 3LZCA 1T9BA 2W2LA 4KMMA 4LSGA 1GPLA 4EUNA 5C5EA 3QYFA 3UCFA 4OMCA 4XGNA 5THXA 3W8NA 1G41A 2HV8A 1NT2A 1FP4B 1JAYA 2AZTA 3TS1A 1PR6A 1TFUA 2XGOA 3DHEA 3L93A 3L7IA 3ZI4A 1EFTA 2HPAA 2GHIA 4HXFB 3TLBA 2FOIA 4ALNA 4Q4AB 3WMFA 2ECPA 2FCRA 2WIFA 4G65A 4IUDS 4E70A 1RRFA 3HKEB 1ZINA 2FWIA 2P30A 3IQDB 4EY7A 1JEQA 4YQFA 3R74A 5BWCA 4GO1A 5ILOA 3TPCA 4DLZA 4NMWA 4FOTA 4Q3OA 3AK4A 1YB4A 2A9FA 2OY0A 1QO7A 3NUGA 1PZMA 4I3FA 5J59A 3W5VA 1HEYA 1GGVA 1UK7A 5ARBA 5IKPA 1ZIXA 2UVPA 1OXTA 3CUWA 3UWDA 1LPBB 1XRJA 4F06A 1VJCA 2O4UX 3L4BA 3USCS 3X0DA 4OF4A 1DRJA 5CB6A 3C6YA 3MN1A 3OTQA 2AXPA 4MCHA 1HTWA 3ZWKA 1CSEE 3GEMA 3O74A 3BMNA 2C2XA 3N8HA 4JI6B 1EP2B 1JSRA 3UMVA 1I3CA 3KIPA 2JLYA 4PO8A 3AEYA 4PNHA 5JRDS 4NSNA 4CKXA 5IU6A 3Q3IA 1ULBA 3TKLA 5P21A 1CUAA 2VUTA 3SR4A 5LZ9A 3IAAA 1NXWA 1W48A 4G5HA 1TAGA 4D9FA 2OG2A 2WV7A 5L8VA 1I94B 2WPDA 1FS5A 1HSZA 2GEDA 2WINI 3O9VA 4WUVA 3V4LA 4KPEC 5B53A 2B21A 2IY7A 4XI9A 1MX9A 3LHIA 4KK4A 1QORA 3A4LA 4UTXA 5FPHA 4CHTA 1Z13A 4DM3A 3OZTA 2NQ2C 2IPMA 3H75A 3P4UA 4HLDA 2O23A 3O4VA 3VR3A 1U8FO 2B78A 2Z6AA 2R7AA 1N33B 5H68A 1PW7A 1THZA 2R8BA 7MHTA 3P96A 4L50A 1NG9A 2FLWA 3EZLA 2A14A 2FKNA 1PZXA 3PFKA 4YPOA 1CDDA 1PQYA 1CR6A 4JOBA 3MAAC 5CURA 1PCXA 1TRKA 4HOYA 2GLTA 5F4BA 3VGJA 3IOEA 2P5SA 2O4CA 3BRSA 2QYTA 4Z0HO 1Z5ZA 4MQMA 1OBVA 1WXEA 1CERA 2C0PA 1RABA 4PSVA 1D2GA 4CIWA 2Q0SA 3BXPA 2HK9A 4QUGA 4MKRA 3ICWA 5H3HA 5KREA 1COWA 2OM6A 4HB0A 1Y8AA 2IW1A 3B6IA 2C1EA 3DEFA 4Q7QA 3ROTA 2DSNA 4O6VA 5J2UB 3GJ4A 2X0EA 1KFKB 4YY3B 4KRGA 2G70A 4KO1S 3U4QA 1OFTA 4L5AA 4FSDA 4TS1A 3WGQA 5A4DA 4I3GA 2Q2QA 4N65A 3NXKA 3PYMA 3K9WA 3KJXA 5C46F 1H2RS 3BGWA 3PGMA 1JIVA 1POXA 1RZVA 1WUYA 4AYXA 2GR9A 2QSZA 2P9JA 2VPYA 3FLBA 5JHGB 2LKDA 2WSSD 3RARA 2V8OA 2X9LA 1FNSA 1T9GS 3EW7A 4I9HA 5D2CA 3IXLA 3LGSA 1Z7YA 4WNAB 2BCJQ 3THYB 5KOJA 1J33A 1VCOA 1JGTA 2W6OA 2X41A 2ZYUX 3E5RA 2C7VA 3FYUA 3NXSA 3O3MB 2ZSKA 4TYMA 2JVJA 5D6NA 5AXBA 2QLTA 1JSCA 4Z4EA 2R6ZA 4MAAA 1DV1A 4D8YA 2XTJA 1KF0A 3HKCB 4PC2A 1ST2A 4DDTA 2BT4A 1YCHA 2XB2A 1DAIA 3RJ9A 4LBVA 4TTSA 3CXRA 1CUIA 3IPRA 1ETUA 3QU2A 1JDBB 1E77A 3HHEA 3NOVA 1TGVA 4UEKA 3OM8A 1L4LA 4FX2A 1QZUA 3CKKA 4YRDA 4DIMA 3ER8A 4A1FA 4AKSA 4ETNA 1CULC 3U56A 2FEAA 2Y2UA 4UVEA 3GA7A 1QH0A 1DJPA 3O8LA 1ESZA 1I10A 1QNLA 4ECEA 3IQHX 4L0CA 3HGTA 2AD1A 4E7OA 2Y9MB 3GHYA 4HWRA 1OE0A 4MX8A 4IUYA 3HCDA 1MC4A 1QZTA 2B8EA 3DAHA 3R8XA 2M6RA 2FW8A 2ZTUA 2PSSA 3TPFA 4E30A 4EB6A 4GXQA 3U2QA 4DAEA 4AYTA 2VCHA 5DK6A 4BQEA 4YMGA 2E89A 1L4YA 3DE4X 1TCCA 5FPYA 2Q5OA 4HG2A 4QDXA 3RK4A 4G8BA 3ZHRA 2FPXA 2C3MA 2V54A 4KPFC 4ANFA 3PNBA 5CG1A 2GJAA 3BILA 2IPXA 1H6AA 4UU0A 3Q10A 3KVRA 3ONNA 2DY0A 1Z8NA 3E2IA 5E1DA 1RAEA 4L1KA 1IVSA 4F2DA 2FEXA 3UGJA 5BV7A 5KJFA 4IZ6A 2CJYA 1Q95A 3M81A 3B52X 1ZVJA 4JHLA 4LOKA 2JZCA 1Q7RA 1V8OA 2GPSA 2OECA 2WVAA 4OEHA 2JZOA 1J24A 1S02A 1YZ3A 4MYSA 4IIBA 4UASA 4XOUA 3VPAA 2Q6KA 2PMWB 2ZJ1A 3B89A 5CA0F 1BGVA 3BRWA 1AKWA 2GZ3A 4IIXA 1E3MA 4RJKA 2YXPX 3EF1A 1L1RA 1H42A 2C4NA 3CCFA 4Q3BA 5IABA 2QP9X 2QVGA 4G4SO 2HIHA 4RE6A 2KMLA 3U1VA 1LKZA 1J2UA 3MILA 4YC7A 2XKAA 4TSFD 1AZTA 1CB0A 1CUBA 2ZITA 4PZUA 1OC2A 3IXMA 4GRDA 5JS7A 4HVTA 3DT6A 3E0QA 4EITA 1HNXB 3WRVA 4AQDA 2MSWA 5CDYA 3E5HA 4BS9A 4MKZA 1KR2A 2QAGA 3AERB 4QPJC 4RD3A 2IEZA 1NV8A 2YL2A 4RZXA 1KZYC 3ETEA 1ENOA 1HF3A 4FSHA 3SIRA 5E9JA 4MRMB 1CWUA 4CM7A 2I03A 4RPGA 4K0KB 1XEWY 4Q1FA 4PGGA 3GZ4A 4KE6A 3BXGA 2XUGA 2J3LA 1Z6QA 3E05A 3T7KA 1KTVA 5BW5A 3PNQA 2ATIA 1T3HA 3IUYA 4F2GA 2H57A 1I7QB 1N9GA 4AC9A 1N2HA 1ILWA 2BEWA 2HA2A 1LY1A 3OZFA 4EHJA 3U6BA 4IH9A 4FP9A 1LZLA 4JBYA 3IP9A 4ODIA 1FSSA 4DQVA 3T1TA 3HBAA 1BA2A 4LRQA 1IUPA 3UJBA 3IKLA 4EYOA 4WXHA 3WWCA 3FCUB 4AJIA 4W99A 3CLUD 4XM0A 1TI7A 3AGPA 5K4AA 3ZE6A 5JJCA 4PCAA 1PFWA 4CLOB 3R2JA 4PZYA 1U0NA 1RAHA 3FMFA 1HDCA 2Q6TA 1KA9H 2Y3IA 1JR3D 1JIXA 5LD2C 5JZVA 2P6RA 5GOZA 3WMXA 1GJRA 3UZUA 3B6ZA 3NZEA 3RSZA 3WNBA 3WLIA 2QT0A 1FU4A 3NOOA 3VNQA 4UPDA 4O2LA 5BV1A 3EEYA 2XRFA 2QE6A 2K4MA 2WM9B 3RUPA 3WBBA 4ZK6A 5FUWA 1NIJA 2GYUA 1X14A 3KQSA 1SIUA 2E4XA 4OP1A 1U0GA 1B3RA 2D2VA 1MCZA 1XTSA 1MC1A 4L27A 2DBYA 2HLHA 1V39A 4PLVA 2R5WA 3JQEA 4DXDA 4KYTA 1FBNA 1ECBA 2HTFA 2X7JA 2PZBA 3AVPA 4PY2A 3C3PA 3WS7A 3MBOA 1VJRA 2XHEA 3LDUA 4DLRA 1JB9A 1LW6E 1MNQA 3B5EA 3OT5A 3B1KA 2I9KA 3I61A 2VWPA 1BIFA 3EMKA 4ER0A 4E5NA 4RU1A 3FRHA 1JSXA 3AHJA 1UBNA 1OIVA 1UWLA 1P8AA 2FK7A 4QBIA 5FOQA 1XF9A 4G4IA 4L74A 5FBRB 2JEYA 4JNKA 1JHPA 4M8LA 4DSZA 1I6LA 3ME5A 2XDAA 2ET6A 3K0AA 3SEZA 1ZI8A 2WJIA 2CNKA 3OM1A 4GNRA 4OJKA 3U3JA 5HJ7A 3W05A 4DW8A 2ZJ3A 4DLSA 2Y1LA 1RJGA 5DM1A 3BB3A 3D2AA 4HNTA 4HH4A 4A8JC 2WHEA 3EUEA 2IITA 1PW5A 4A23A 1VPEA 1XROA 2JNWA 3PLRA 4QSHA 4A6PA 1SBCA 2PS3A 3L7LA 1YIAA 4KUHA 3ZGLA 1U5CA 4QVKA 2AX4A 2FK8A 3D4IA 3R6LA 4L3WA 1FMTA 1A97A 2R8XA 4RXMA 3JYLA 2QRHA 3X43A 5LL6P 1EG2A 4ZCMA 5ESRA 5FTLA 1EFPA 1P7YA 2I6SA 2O05A 1TB4A 2YN0A 4TSRA 3TL3A 3RKUA 3PDIB 1N5LA 1PT8A 3TVTA 5AVSA 1J39A 1K68A 4JSTA 4QUBA 1G55A 1TQ2A 2P6MA 2H65A 5IH7A 4IMPA 4TRJA 5J1TB 2R79A 3SFTA 2VZLA 1JXQA 1BC5A 4JCCA 4NL4H 2H7XA 3CB4A 4H7HA 1XKTA 3REQB 2ON6A 5LU8A 3OCCA 4IRUB 4GXRA 4ZYYA 1ZGZA 2G1JA 3EMVA 4M22A 4PPFA 4GDFA 5KWEA 5F3WB 1GL3A 4C7BA 1HOXA 2FSPA 1RC8A 1H4SA 1Y6QA 3I52A 2AUMA 3PQFA 4ERNA 3SEAA 2TS1A 4MZDA 4Z53A 2HA3A 1I6WA 5E3IA 2R62A 2DBRA 4KQMA 4OU5A 2IQ5A 2XUFA 1SHLA 3B3QA 2QUZA 4J03A 5FUMA 3E4CA 3G9QA 1JHZA 2V5VA 3ORFA 3RC7A 4HAZA 4DCUA 5BR7A 4D44A 1JT2A 1R8QA 3PTZA 4WY8A 3IBTA 3T1VA 3WRWA 5CDSA 2P2ZA 4IF6A 2H5IA 3U60B 2VHVA 1GZDA 1SCIA 2JFHA 1A76A 2IQIA 1P81A 5ALTA 4TKVA 4JJ7A 4NJEA 2C5LA 2O50A 2HC9A 4IIJF 2F4VB 4UTPA 1E96A 4G63A 1JR4A 1UKAA 3DVAB 1A9XB 1D6SA 2RG1A 1GGMA 3AF1A 3ZCQA 4EX7A 3K9HA 3FTEA 3O1HB 2CV1A 4ENUA 3UHJA 2GWRA 3H9QA 5EKDA 1J9ZA 1WUHS 1QV9A 4GMKA 1NULA 3EULA 2G9ZA 3MVEA 1N6NA 2ZT6A 3MXTA 3QUQA 3L1HA 5TDHA 2ATCA 1ICEA 3NOXA 2VHZA 5HM6A 2G5PA 1ZM9A 4OKSA 2BFAA 1L9KA 1T29A 3U5ZB 2JFWA 4FKBA 1JX6A 3SF0A 2Q7XA 1WPXA 1SBNE 4LJLA 5TVKA 2QV7A 2DGDA 4R8VA 1REQB 3LU1A 4HXEB 2RKBA 2V9CA 2VF2A 3KDPA 1A77A 3OEHA 4LDPA 5CA1F 4K7JA 1YI0A 1ULAA 2UV8A 3L77A 4EYQA 4OJMX 5HTOA 2QR2A 3F8WA 2DH5A 3JSXA 4BO2A 3GCXA 3ICPA 3UQYS 3G68A 2F8SA 4O0MA 4ASUD 1I7NA 1N8TA 1PP4A 2IIPA 3H1BA 3LBHA 4ZVNA 3R7SA 5B1EA 4PXYA 4NBVA 3RYHA 1SIBE 2J7PA 2FW0A 3COZA 3PC7A 4S1OA 4DIOA 3EIFA 1PFYA 1O94D 1BEUB 2CLMB 2WM3A 1BWPA 1J8DA 4PZLA 3UKJA 1AF4A 1ZAYA 2I1QA 1F8UA 4PAQA 3ESCA 4M1TA 2XCTB 4R16A 4TVSA 1Q20A 2FUCA 2JBWA 2PNFA 1WVIA 2Q0QA 5IC6A 3OBBA 4HFJA 1RBQA 5K0SA 1W36B 3CRVA 1LQUA 2XTNA 2RJ3A 3QHPA 5JXHA 4UVIA 4XB1A 4YRBA 4ZDWA 5DM70 1H0HA 5LWHA 1EX1A 2JJ1A 4PO3X 4HFMA 2GEBA 1G7RA 3RVDA 4PGMA 4DSAA 4RL4A 1QIJA 4JSRA 4ZQFA 3DYVA 5HJEA 1KJIA 1XDUA 3L6CA 2AZMA 3MHPA 4BNHA 1ZC4A 4L07A 1VCHA 4C0WA 1J7JA 2OCLA 4DC9A 4OB8A 3DQQA 4S1WA 5I7SA 2Y9PB 5JE8A 1DX4A 4KLNA 3CC8A 1Y1TA 3ZBUA 1QP4A 5JWRA 1X13A 1TYBE 2D8AA 2W2PA 3AOEC 4L7QA 1N5IA 3AY7A 4M87A 4ENVA 3TQOA 2W2TA 1Y3DE 2P2DA 5DNWA 1U7XA 3ZIDA 1PGOA 1WAMA 1FMFA 5AJXA 4BEWA 2VTVA 1T8PA 1V5FA 1GSIA 2WC1A 4CLRA 5KPJA 4JJIA 5DX8A 2F1OA 2PLFA 3JQ7B 4RVDA 4MAMA 4F2PA 3G6WA 1L8LA 3KALA 4AX4A 1F6BA 3TINA 4DYDA 3E3AA 2QMZA 1ZD1A 4EHAA 3F3YA 4JC4A 2JFNA 5CLFA 2B8NA 2BH2A 5CYPA 2JCVA 1IQRA 3WQHA 3IAS6 4OSOA 4C7OB 4QM6A 1IEQA 1F20A 1Z3CA 2C1XA 2C5BA 3KB8A 4LDNA 1E0AA 1A5TA 4AW9A 3TZBA 4FQ5A 4E5KA 1UWCA 3F96A 4HDCA 2E49A 3MQ4A 4DMRA 1ZBQA 3B8EA 5F51A 1ZR4A 3R5JA 3QYPA 4MULA 1F2UB 2GN1A 4ZDIA 4FDMA 1TCBA 3PIDA 4G8CA 4DUGA 1AUVA 1VBFA 3GJYA 3TRDA 1NDHA 1NM5C 1EXDA 1BEZA 4H7KA 3OIYA 1KVTA 2Z08A 2BP7A 3TQIA 1TM3E 3LT2A 2QQEA 3PSAA 4KO8A 4WK0B 4F93B 5GINE 3K30A 3DBLA 3SHFA 5I01A 3PT5A 3R3VA 4JLJA 3C98A 5F21A 4Q3EA 4BMNA 1Z4QA 4YJFA 3BTOA 3PQCA 4D9HA 1DP4A 1ZD8A 4NPHA 1PJQA 1ZGCA 1RWMA 3LHKA 3DZKA 3NM4A 3O3OB 3QMPA 3R76A 5K0CA 1LK7A 1RIIA 1T9AA 2HMWA 2QG6A 3ZE0B 4YUWA 3I9JA 2WQZA 1SJ9A 2H2HA 3ROEA 4P7JA 1TECE 1HE3A 3N5CA 5F7JA 1Z0ZA 3NBFA 1M1XB 4TXJA 3T9DA 4KVZA 5CB0A 1RWNA 1NT4A 1XQYA 1YHZA 1TAHA 2IPOA 2ZT7A 3O92A 3SSAA 4AS1A 3UENA 2BTQB 5DP2A 4TTIA 2EFJA 4L85A 1YU6A 2E3JA 1XK7A 4RZHA 4U4AA 4Q9IA 4M7WA 4ETIA 4INJA 2FW7A 1DGQA 1E2LA 4MPRA 4UUOA 5KEIA 3GPCA 4JYMA 3WLLA 1CLUA 1BKSB 3KC2A 4UHEA 1TYDE 2WJ4A 1DAEA 1FEZA 4RCVA 1RI3A 1Y4DE 1RM3A 1CG6A 4QU9A 1KQNA 3VNBA 1C7JA 4M9QA 3JZAA 4BQSA 3OT4A 3O8QB 3N8KA 1Q5PA 4MP6A 3RSHA 3P5SA 3WB1A 5HIMA 3DF7A 1H2WA 4R9VA 5KDLA 1IY1A 5HS4A 1HZZA 1M6VB 2FR0A 4L6CA 5TEWA 1KBOA 4G81A 3I37X 2YV5A 1T5TA 2IEGA 5CJ2A 5E3JA 3VX3A 4EGAA 1PR4A 1TA9A 4GMDA 5IVKA 4QYIB 2Q3JA 1NUAA 2JFPA 4RA9B 5IM4F 2JFBA 5IYZA 2YKGA 4PNZA 4BO4A 3Q85A 1HUQA 1WKBA 5JATA 3I9OA 2I99A 5FPKA 2GUGA 2XA9A 1UKEA 2DZDA 4QVGA 3S1AB 1E1KA 1XN1A 2X6RA 4LHWA 1WCXA 2C84A 5I7WA 5MGBA 3ZHCA 1YA6A 1YACA 1M1YE 5IAOA 3ROFA 3KLOA 3FSGA 1KAQA 4X9XA 5KTPA 1NTRA 2PD3A 4FUTA 2RHJA 1YVEI 1JB1A 3W3ZB 1TUGA 3T3OA 3TXAA 1MHTA 1R37A 1F2VA 2DHDA 3FOCA 3HEMA 8ADHA 1II8A 1UBGA 2WTUA 5KYNA 1QOPB 2Y66A 3TFQA 1Z3IX 2H4ZA 5K8VA 1XTRA 2GESA 1G1AA 1QE5A 3NYIA 1RWOA 4B84A 3FHTA 1IHDA 1GFZA 3LYHA 2VF7A 1LEHA 3K8OE 3SLGA 5LMNB 1RNLA 2IDKA 4B74A 2QI9C 2RHDA 5A06A 1WHSB 1VFNA 3SF8A 4AICA 4RSGA 2F7SA 2YIDA 2ZJAA 3BA1A 3HCBA 5JU6A 3L4EA 4F5ZA 1Y7IA 3K5WA 1JQ5A 1AXRA 2WA2A 3E9NA 1YZFA 1Z26A 1H3FA 3LMKA 2EW2A 2EZ8A 4TLAA 3SC3A 2AEEA 2GYWA 4U8GA 2JANA 1NNI1 2BE9A 4P82A 1V2GA 3U62A 4ARZB 4D8TA 4X1YA 2PPLA 2WKRA 3V4VB 4YGXB 2XMDA 3B1WA 5KNCH 5THKA 3GAFA 1JDPA 1TEVA 4H27A 2X1LA 4F7DA 4BTEA 3TOXA 1PKXA 4CR8A 1W2GA 3KZVA 2NSYA 3LP5A 3MNFA 2WAOA 3MTIA 3MT8A 3NTQA 1KPIA 4FFWA 3BULA 5H3LA 3QVVA 5ECGC 1HDGO 5CH3A 1ZKMA 5SV2A 1EVLA 3IDSA 1W0JD 2BHLA 2H7CA 3RS2A 5KC9A 5C31A 1E66A 5L53A 3PUIA 3QG1A 4ITRC 4PTZA 3TRJA 5JNRA 2C57A 3TMAA 4BVJA 2AJBA 4X84A 2ZIWB 3X1YA 5HKKD 4BV2A 2G1PA 5IUJC 3FW1A 2ID9A 4E13A 4Z6KA 1KDTA 3PLAE 2CEAA 5EXSA 1NW5A 2ZU6A 1Y33E 5JNSA 2FFBA 4JV5B 4BV3A 4IXNA 1M7GA 3OAAA 2CCGA 4RF4A 1C3VA 2QTWB 3RIGA 4MITA 4CF6A 1AK9A 1Y8RB 4G1CA 3BFKA 4EI8A 1HE1C 3DWEX 4BMDA 4FN5A 1EJ0A 4DBZA 2HSJA 1FDUA 2YQ4A 3OUUA 2GBGA 4PLGA 5CA1A 1GKKA 2HIMA 3FE2A 1WQ3A 5EZYF 2VPWA 3N70A 2HUPA 4FR0A 3RVBA 2W48A 2AG0A 4W82A 1QTNA 5DRYA 3WISA 2XDQA 4YDQA 4RTMA 4L8WB 4C6RA 3CNHA 4IQ8A 1G3IA 1FB5A 3P5BA 3B5JA 1PBTA 2W4IA 1JKMA 2GPAA 1TVEA 4E51A 3FWZA 5TV2A 7REQB 2A94A 1X3LA 4KI7A 3KYDA 4MR9B 4H7EA 5J9FA 1Z22A 2VYNA 3O8BA 3K0CA 3KB6A 3AY3A 4YMVA 3ND9A 5EI5A 3THWA 4Q12A 2WWIA 2Z5VA 3FYHA 2I2CA 4PYKA 5SZIA 3DDNA 4EEZA 621PA 4BNTA 5BR8B 3KBBA 1GT6A 3M6LA 3QKRA 3ZG6A 1HLFA 1WMFA 4Q1BA 4D9MA 1MOQA 2G9RA 2P0EA 4UOEA 1SIWA 3EVFA 4GUAA 4JITA 1DI0A 1BXGA 2R4QA 5IJAA 3B51X 5JDCC 3TMYA 3GEEA 4TVOA 1Q1EA 1MFPA 2X0JA 2Z5FA 3FFTA 3LDGA 3MM4A 3QHAA 4MLCA 4P0TA 2HF8A 1ZI9A 2BGWA 2UU9B 1SZCA 1D5WA 2OORC 4TS9A 1M1NB 1LVHA 3D6HA 4RM2A 4RLQA 1KSGA 1AK2A 2O8EB 2FPOA 3W4KA 2WIKA 4OM8A 4JEMA 4C6TA 3EZ7A 4HWSA 4D9EA 1P5FA 2GETA 1MO6A 3GF4A 3PWZA 4DBLC 3TOZA 2E5LB 2IIBA 3MPUA 1T5SA 3F9RA 4TLCA 4P2GA 1KC3A 1KDOA 3JALB 3O4RA 4HDRA 3ELBA 4BQQA 5C5CA 1KHTA 1QYDA 2IWRA 4XWOA 4WA8A 4JWTA 1ZK2A 2A84A 3I12A 4OO3A 4UDYX 1Y63A 2OVBA 3FWPA 3QFHA 4AXBA 3L4KA 4OJNA 1RFGE 3QLEA 4RD4A 4MA4A 5LZ8A 3V2GA 5FT9A 3E9YA 4PZPA 4Z99A 1U9IA 1C29B 4HVLA 3KVNA 3HP4A 4X8HA 1IAVA 3DP7A 4CNBA 3WL3A 1D1QA 1X6VA 2EBWA 3AF4A 2HLDA 3C3YA 3E7PA 2WVGA 4HPXB 1Z6YA 4RGQA 1Q77A 5LXTF 3E9QA 5BVHB 2VP4A 1MB3A 1X7DA 2PZFA 3QVXA 4Z4QA 2FGJA 3C5WP 3H42B 3TZCA 3IERA 5HZHA 3KQNA 4X6YA 1DQNA 1QH9A 4KR3A 4XIFA 2X5KO 1NQAO 2Y92A 4LWQA 5HE8A 3C6MA 4WXYB 1ZD3A 3A26A 4BNGA 4M0FA 3BORA 1YR3A 1U99A 4OX9B 2BI7A 2PRSA 4MI6A 2VAXA 4BB9A 1E8NA 1DNPA 1OKKD 3I32A 4GSKA 3SX0A 3ZWPA 1U28C 2C5HA 3A9UA 4NE7A 2CCKA 4BVKA 1MTOA 4QQFA 2XXAB 1DWUA 2WF5A 3TNDA 3VAYA 1GQOA 2XVMA 4A6DA 4PXSA 2Z9BA 4YQEA 5JAHA 2AOXA 1FP6A 1ZMXA 2W7TA 3A1FA 3WYEA 2ID7A 1NXSA 1TFRA 3NRJA 4DRYA 4UQLA 1MD9A 5LKAA 1V8FA 2ZSDA 3W3AH 1K86A 2H1WA 4BMPB 5JRJA 5CYOA 2A9JA 2IEIA 2ZJ8A 4B85A 3GLIA 2JK1A 2CDRA 1DFIA 2GPBA 2SICE 2YMMA 4MSUA 4HMOA 4B79A 3K4PA 3CUUA 1YB2A 2AMLA 1ZJ4A 3NNSA 3OZSA 4OU4A 1Q3HA 4WGFA 1A4RA 4HX2A 3F7TA 3VFDA 3X2FA 4ZGWA 3HB7A 2W83A 1CDZA 1EHIA 1C81A 4J1QA 4FXOA 1EG7A 1UP6A 4J1SA 1TM2A 1N5DA 3ESRA 3UXHA 4CEIB 2QTVB 2FDXA 1CNFA 2FR8A 4US1R 4RKEA 4IFIA 5M5BA 4JI5B 1GZVA 2IKQA 1E3SA 1Z6XA 1YI1A 2HHHB 4JL8A 5FORA 2EZ4A 3QGMA 3W5UA 3WWZA 2DQZA 3PQ2A 3AF5A 2QTBA 4JUDX 4CG2A 5CCEA 1OX6A 1YB1A 3ITDA 4GOOD 2DHEA 1A7UA 1RS0A 4H0CA 4ZHQB 3HV0A 1A9QA 4Y1GA 2Y4OA 4K28A 5MFPA 4ZVTA 1X7YB 3TRIA 2Y6VA 4AG5A 2OBYA 3NTUA 1M2VB 5FEMA 1GG5A 3CPJB 3GEIA 4CDGA 1M8GA 1T8SA 3A58B 3Q5GA 3VPDA 3L8MA 3I1FA 4MDHA 3ZE1B 3ZS8A 1GZ5A 4GZ3A 1T2VA 2VA9A 3OEWA 3N8GA 3I6MA 4KPYA 4U9HS 1RXSA 1S3FA 4UBIA 2BFBB 1JQEA 4P4SA 4EKNB 3JRNA 3GLSA 3OQIA 4MPTA 3DXYA 1A5BB 1OZFA 1FXWF 1WMAA 4X7PA 3WQQA 2GK3A 1XZDA 4L73A 4RMHA 4GPBA 4C2UA 1XVTA 2GKSA 2FSUA 3L9XA 3R6DA 4OSPA 3SKVA 4BIIA 4DLKA 1GQRA 4OA5A 3LQYA 1CY6A 3BWBA 4XGQA 3GLFB 1Y3HA 4U7WA 2AC4A 1TLFA 3GBVA 1KU6A 3BJIC 1G6KA 5KQPA 4GL2A 2FOXA 4RFLA 5IBCA 2BL4A 2FN8A 3NAGA 4HVCA 3NATA 1G6Q1 4Y2VA 3TSYA 2G06A 3DCNA 1VGQA 2AEJA 3DMGA 2EDCA 5JQGA 3RT7A 4ALJA 4YRIA 1NVGA 4OHWA 4FI3F 2CFRA 1XP8A 2AEFA 2R47A 3DXFA 4P4LA 2FPIB 3DLAA 5EG5A 4B9AA 5CJJA 2G6BA 2VT6A 2O2HA 3UOWA 2W6JA 2QTZA 3FPKA 2OENG 2QRJA 3OCJA 3Q7SA 4L28A 3B1VA 3E9CA 3VXKA 2QX8A 3CB2A 2AA3A 1DKUA 3LBIA 3NC1C 1H65A 2HWWA 2QA5A 1P73A 3KLNA 4PLCA 4M0DA 3FMPB 2D2IA 4V2IA 3ZHUA 4ESEA 3AONB 3K8QA 8MHTA 9ABPA 1WKCA 1IBMB 1L3CA 2CVQA 4D1YA 2VNHA 1NW9B 4GAEA 2QTTA 2J0UA 4CRWB 1U3VA 4J4TA 2FQQA 3NIWA 3PNVA 4WY2A 1JNYA 4GQAA 5HJ2A 1N6KA 3UK6A 5JSFA 1GEEA 2PUVA 3U7JA 5TC4A 3IB3A 3HKBB 4IOMA 3LPNA 1O96B 5KTSA 3LCVB 2YMQA 1ORTA 4GZ5A 3OFJA 2AWOA 2GZDA 2AXEA 4QSMA 1YZQA 4QOIA 1IFXA 1AKUA 3TLGA 4ZKDA 4BP9A 2FQWA 1PR1A 2HMUA 4GXNA 3H6HA 5IJ9B 3FMOB 3ON5A 2OTCA 4QFMA 3TLYA 1V47A 4LQ4A 1D1SA 1TOAA 2XGMA 2A5GA 3OPXA 4MEJA 1OAOA 3IEXA 1TD9A 3DAFA 4LYFA 4R2WA 3MWEB 4R0VA 1L5NA 1N1MA 2VP6A 1DFHA 1JIUA 1T3TA 4MQFB 2CDAA 4K9LA 3REGA 2PL1A 3VZQA 1Y6FA 4RNDB 2FQYA 5A0VA 3H8SA 3AUYA 4RS4A 3JYOA 4KOAA 1EVKA 2EU8A 3CISA 4IH4A 4FR2A 1GPH1 1WXFA 1BRMA 1GVHA 5EIBC 3QPDA 4HTFA 2ZVJA 5AI6A 2F9FA 2G0TA 2G1AA 3OKAA 3Q3HA 3AM4A 3DTVB 2I6QA 1SBZA 3OP4A 4RVCA 4ERXA 1LU9A 2H08A 2RIRA 4X24A 1FFXA 2CBZA 1G8YA 3GVPA 3AT1A 2O5RA 2VDWA 4O63O 5J2TA 5K0LA 4REOA 2PKWA 3EWIA 4HYQA 3C8DA 1AQ6A 1NOKA 1SN7A 5FL7A 3S4YA 1OAKA 2J46A 3ZGXA 4FU0A 1APBA 1XNRB 1JHDA 2VYQA 3OOWA 3R5XA 2A5FA 2G08A 4IYJA 1NG1A 1V48A 2FW1A 2DAPA 3NYRA 4JR1A 4UC0A 4CF5A 4D26A 1NJ1A 4ARSA 2F90A 1F0YA 2EKBA 2JA2A 5DXJA 1JE0A 2ZATA 3KPUA 1PJ8A 3AFHA 2RK4A 5ELLA 3TIIA 5KYTA 2R751 3B9RA 3QJYA 3HDTA 4YJ3B 3RRMA 2DE0X 3F9IA 4DARA 2GN2A 2JARA 1Z0SA 2HCFA 1MVOA 1SVLA 2A5LA 4NNOA 3COWA 4E6PA 5JI2E 4PAOA 2P78A 3MCTA 4IDNA 1IDOA 4L95C 1JDNA 1YE5A 3V1YA 4FNOA 2P62A 2PBRA 3O94A 4PBSA 5A7FA 1N5MA 2EAUA 2ZZNA 1XTJA 1O6ZA 3I04M 4YP7A 4M0UA 4LWOA 5JSKA 4AMVA 1M8PA 1W6UA 1FX0A 4QQKA 4Z7JA 4ZOEA 3U81A 4MCIA 2BDTA 4O5OA 2PVSA 1HYGA 3ZHOA 1C0EA 2AN4A 4HB4A 1P5HA 3DE6X 3COPA 3A6JA 1P4RA 3PUJA 4O59O 4P3YA 5A1TA 4BNXA 3I9KA 3OLVA 1VDZA 1CQJB 1DUSA 1UCFA 4BDTA 1VYHA 5LXTA 2VATA 2YIMA 1SUIA 2O0LA 2HMYB 2I6UA 2OUKA 2VBCA 2VXBA 3L41A 5EXXA 4B9EA 2UZ1B 1T35A 4LVOA 4NU5A 3QWHA 5HG0A 1NVTA 1SUEA 3CS3A 3FSRA 1L5KA 3UK7A 1P3Y1 1G8HA 1XLTA 3CRQA 1EJBA 2VQSA 5DM2A 4PC6A 2FPRA 3AC0A 3B85A 4KPGA 5DXAA 2YFYA 3W6PA 2PTGA 1BOFA 1DE0A 3WBKA 5DM60 2O8CA 2XVZA 2BI4A 2Z5GA 5AK3A 2C7QA 2JFVA 4K9DA 3UXYA 5EE9A 2FFRA 4MV4A 5H81A 1R0YA 2B4QA 3FWHA 4RTSA 3MYRA 1QYVA 4QO7A 3FWKA 2BHRA 4BYMA 4AXXA 1EFDN 1VKOA 1K5GA 1YA4A 1Z12A 3QJ5A 4XWTA 1Z56C 2P9YA 2QZSA 4Z7OB 4P54A 2C7PA 1JVBA 4LGVA 1GNQA 2BYTA 3BH0A 4IDDA 1NX9A 2GD0A 3D8NA 3W06A 3KVOA 1NKSA 3ZCSA 1W46A 1WDLA 4IGIA 1MG5A 2QT9A 2G72A 4PPNA 3WI7A 3OH8A 3PEVA 5LNK6 2CXOA 1QS0B 3BPSA 1KH2A 3LWBA 5LB4A 4BQNA 3AX6A 2PL5A 1M7BA 1QH1B 1Z68A 2XIJA 2NV2B 1L4BA 4XD2A 2HR1A 3ZY2A 1USVA 2IOFK 4FYJA 3H7IA 2GA9A 1NAIA 1P9WA 2VDQB 5FBQB 3B1XA 3IKTA 3Q7PA 3TNJA 3AGQA 3ZDRA 1J90A 3MTAA 5I7OA 1QHIA 1TGYA 3ZJVA 1M8FA 5A9SA 5AW1A 1OXMA 1K06A 3A4VA 3ECSA 3V97A 4CQNA 1DWQA 2AW3A 4GWGA 3MWDA 1JNXX 3UH1A 2ZDGA 2VUUA 3I83A 2PXAA 3GA0A 8AT1A 3CCBA 1OTHA 2VHJA 1MC5A 3BE4A 3EISA 3QE4A 3F73A 1WUKS 2D13A 1DXQA 1SHKA 1EUDB 4JYCA 1K4MA 2ZTHA 5FO0A 3ITNA 1MEOA 2J3DA 1FXUA 2QPLA 5M04A 1CRWG 1JBEA 3IAS1 2JI9A 2WJVA 2E37A 4ALLA 1TZJA 1XAJA 5C32A 1XXHB 2VUSA 4DCCA 1FLAA 3DW1X 1W581 1W85A 3UBMA 1UT5A 1RQGA 4RORA 3C97A 5JIBA 3T5MA 1YMVA 3ZTTA 3Q98A 3B20A 1QANA 4F3RA 4DWVA 4G1UC 4EPVA 3RFFA 1TVCA 4OH1A 3R75A 5F2EA 3ZHZA 4YXFA 2H0AA 5AKZA 4S1PA 4KJZA 1LLUA 3N9IA 2IELA 1W0KD 3NHJA 4J1TA 1VTKA 4UEOA 5ERGB 3K1JA 3C8MA 3HU5A 5BOVA 5SZHB 2DH6A 4MS1B 3SQDA 4WESA 3TZEA 4DCMA 1OV4A 1Z7WA 5KO2A 5E6UB 3ZDQA 3GV0A 4LY0A 1KDVA 4BFLA 2UYYA 3PXEA 3ZVMA 2W2OA 1Y3CE 1Z07A 3JQ8B 2R6JA 4Q05A 5CU7A 4CUZA 3ZH9B 2C07A 1E7SA 3OZ7A 4EO4A 3HL0A 3KTFA 3QNMA 1ZVMA 1VIMA 3ZCVA 4JIMA 5CT5A 1WPQA 3PB3A 1GPNA 2XF2A 2IYLD 4W9NC 4GQBA 3T5DA 2JKZA 3HA7A 1YQUA 3KJZA 1YB5A 2ORED 3GFGA 5AKEA 4YAIA 1QHFA 2ACKA 2E6UX 2ZUFA 1JG2A 3GLHA 4DRXB 2J0VA 1WZCA 2R6AA 2BEUB 2OBMA 3M2PA 2J5BA 1C8BA 4GX2A 4MA0A 4MLDA 1ZGHA 3PT9A 2YVKA 4G0XA 4WH0A 2TMYA 1ZWKA 1C4OA 4UVDA 3ZOKA 1WNTA 2P5YA 4GPAA 5IWCA 1K8RA 1GZSA 1MUUA 4OK6A 2ZYIA 1LDYA 4PQRA 5FX2A 1JDSA 1QZ3A 4B44A 3EOAI 4RDCA 4OUDA 4YO7A 2CMGA 3CG4A 1EM8B 4LVNA 2YYAA 3JQFC 4NQZA 1XA3A 4V03A 2EEPA 1TK3A 3PC8C 2JBAA 2D1QA 2RGUA 1LVUA 1CZHA 2RB4A 3PQ5A 1MQ8B 4XLLA 4YRZA 1FP2A 5DZSA 3B6JA 2WAAA 3OMLA 3TGWA 2AMYA 3WNVA 1L5YA 1VPWA 4Q15A 1OLUB 1ZHHA 4CKZA 4YAKA 5EJ4A 3H3JA 1J5PA 2YZGA 4JLMA 3EEQA 2HI0A 2OXRA 3BK7A 2LBPA 4MB0A 3FYDA 4H0NA 2QZZA 4FZ3A 4YDSA 3BRCA 2G9QA 4HYYA 5KJEA 1SZDA 2NYVA 4EA8A 3EQ9A 1P9RA 3O2JA 3DPIA 4Y2YA 2VNIA 2W11A 3IVMA 4LDJA 5ES3A 4JA0A 4KTTE 3CZ9A 3PC4A 4RMGA 4DV4B 1IAQA 5CFQA 3FPJA 4B3GA 4AF7A 4AY3A 2WJYA 5CLHA 4YK7A 1N2IA 7YASA 1C4KA 1FFSA 2GFIA 1TJ5A 1VGVA 1ZI6A 1YMQA 1YRWA 3DD1A 3W6UA 1ZGBA 5A03A 1R74A 1MT3A 1E60A 4ZPJA 1QB8A 5E7QA 4HL6A 1ZN9A 1ZCJA 2F43A 3W7AA 1T2AA 2EGUA 4C3UA 4JI8B 4BGUA 1MEEA 2BFCB 1IOWA 3GOHA 3LWZA 5CXSA 3LXRA 1ES9A 1RRVA 3A31A 3E61A 2RGAA 4MA5A 4JL5A 3EG9B 1HORA 3NCHA 1N6RA 4IQ0A 2C92A 3HJAA 4ZI7B 1M67A 1NMEA 5AW0A 2NV0A 1OOEA 3TQSA 4EQZA 2XCSB 4CM8B 1O3YA 2ZXUA 2WMYA 3H8JA 4B31A 1O6FA 3AEXA 4Y1FA 4ZEWA 2J5XA 4RC9A 1BGXT 1NR7A 2O54A 1E1RD 1E2UA 2BFDB 2QS9A 1ND5A 3ORRA 1UBFA 4N3NA 3VKGA 3K1AB 1RWWA 1ZNXA 4IG9A 1E6LA 4RHCA 2FWPA 3BQMB 2WSSA 5JXWA 2CUZA 1Q2UA 1UMCB 3DCYA 4MS3A 1Y34E 4JI7B 2XR1A 4FYPA 3H5IA 2J5QA 5AMXA 5A4JA 4PYRA 4GG1A 5LYJB 2AL7A 5EMHA 2QLLA 4F9TA 1RHMA 5EWJA 4QTTB 4X7MA 3VH2A 2GXUA 1YWGO 3PI6A 2IZOA 3TRFA 5HR5A 2EFHB 3IAHA 2DKFA 3D6NB 4X71A 4CEJB 3QZUA 3IA7A 3NQ41 3EIUA 2B99A 2YR0A 4CE6A 1E64A 1Y9ZA 3ZQJA 1JV2B 3Q9SA 4IMIB 4F4DA 1VJTA 4PN7A 1AKEA 5HFAA 3ZV6A 4I08A 4GP7A 5EWMA 3EUFA 1VSTA 2BMJA 5GIPE 1WA5A 2VQ3A 5AVTA 3QF4B 5FWDA 1RRGA 4LY9A 1XD2A 3QEMB 4NYMQ 5IS2A 5AW2A 1PT7A 1FU7A 1ZFNA 3V4ZA 1G0OA 1XYVA 3KUCA 3E9RA 4BNVA 5BNIA 3T99A 4G09A 4XVRA 1ZR2A 4F5DA 1SFRA 5ALYA 2HW8A 1U80A 5BOSA 3KZKA 3EVCA 1BXZA 5AVQA 1U3GA 3H2JA 4A92A 5CLIA 1GGFA 4CKCB 4OXNA 3ZU4A 2FX3A 4QL3A 4WZBB 4CKEA 1R12A 2RGNC 3RC3A 3AYXB 2R00C 4YRCA 3A10A 4U9IS 2YZ7A 4LJ9A 2FB9A 3EHEA 3BD6A 1DLIA 4AKTA 1IBRA 1OU4A 1Z5UA 3IA2A 2W2QA 3DPSA 4OQDA 4A5SA 3GMIA 5GGXA 2YZMA 2XNJA 5TT0A 4BBPA 2X13A 1Q2XA 1XGKA 2HSDA 3PX7A 1GNSA 2YWJA 1Q15A 2NPFA 3VKVA 4D6YA 3K6SA 3ZLBA 4GIBA 2O2DA 4JKOA 1B42A 1CFZA 5FUQA 5CIYA 2DERA 1P6QA 4JJGA 2CWDA 4O2AB 3MRTA 5AHKA 1HTTA 4FCWA 3WLFA 3DBRB 1E3DA 2H9YA 1FTYA 1US8B 4GEKA 4GR5A 3TI7A 1B6SA 4AZ3A 4YX9A 2ZBUA 4EO7A 4C4PA 1YRHA 5SICE 4EG0A 3NBYC 2IOHA 3N39C 1FFBA 1NYTA 2AOWA 2JI6A 4DF3A 3ZCPA 1GSOA 1AMUA 1L3BA 1VL6A 2IC5A 3HUEA 3JQCA 4IIGA 2I6GA 1B14A 1ZNZA 2PX8A 4C6SA 2CKMA 3L79A 4JLPA 4IGFA 1TUEA 4JT4A 4TSFA 4X3CA 3DOFA 4YCDA 5J43A 1J2EA 1DIRA 3PKJA 3HQ4O 3N6RA 1P60A 1CUZA 4BVHA 2VC2B 2HH9A 2I71A 1NVKA 2HA6A 2Z3WA 3S2IA 3TZLA 1DOZA 2IYUA 1R10A 4K3VA 3RHTA 2E1PA 2YINC 1O5TA 1ZD4A 3C4VA 4BFYA 1Z5WA 3SS7X 2L18A 3NHLA 4EW6A 2QZ4A 5E2BA 1KXJA 2L2QA 2V58A 3VH1A 3OE4A 2VHYA 5JCZA 2XNDD 3DOCA 4NBTA 3GRCA 4UHDA 4RD6A 2VAWA 4MKFA 5EE0A 3S27A 4V1CB 2C9OA 1XMPA 1HL3A 4MXDA 1XV5A 3T38A 3C14C 1M5TA 4RIHA 1GV1A 3CJTA 2ZP1A 4B4UA 1Y89A 4A6EA 4HAYA 4M6WB 4LOLA 4WN9B 4C4OA 2OMKA 1E61A 1WDWB 2Y0PA 2I1WA 1B1CA 3ISTA 1WS6A 5DCLA 2ZIFA 2YBDA 3ET5A 1U2PA 4RTJA 3FUXA 4FEEA 4J43A 2EKDA 2NTYC 2W6MA 4W1RA 2AQIA 1BVYF 2FE4A 3SQWA 2XMPA 4FX5A 4GMXA 1JR3A 4C1NA 4CM4B 3AR5A 5BN5A 3FF1A 4U8HA 1DIHA 2FFJA 4QTZA 3FKJA 4AIIA 1PS8A 4FC6A 5GP1A 1L7VC 3NPAA 5BXQC 3ZJTA 4GI2A 5NLLA 4GDMA 4P7BA 2BKEA 3FTNA 3DHNA 5F98A 2XGJA 1T2CA 1NYQA 3JPYA 4FHCA 4GE0A 3U3ZA 5DO9A 4S05A 4C5BA 1QIDA 4GKVA 3IVRA 4KAXA 2VSYA 3ZWYA 3QELA 4WOPA 1NXXA 4J7XA 1D6JA 1DLJA 1IQUA 1NJ6A 3HP7A 2XCOA 4S2UA 5DVZA 4TLLB 1NU8A 2E4UA 5DGHA 3PTAA 3KR9A 2SKCA 2TRSB 1BE8A 1EZ4A 2GBLA 4MV3A 3RU9A 4YACA 1UF9A 1K3UB 2WJJA 2WFZA 4KIJA 4E31A 4GRAA 4HKTA 1XJCA 2XA1A 4K3UA 3O9MA 5EGSA 4F8YA 1X92A 4HI0E 1NVAA 1CKEA 2FPGB 4Q21A 2O3SA 4R69A 4TL8A 4DT1B 1K7XB 4BCBA 4TKZA 1P9LA 2WWHA 3RV3A 3CW9A 2W6ZA 2VTBB 3EDMA 2H2FA 3ND5A 1SZJG 4IHJB 4EPRA 2GEKA 2IEDA 3D0RA 2DWUA 1C80A 2P4QA 4RE5A 2GGSA 1Z83A 2WU4A 2XEXA 2Z30A 3O0TA 4LYJA 4TMKA 2XVAA 3ETCA 3FCSB 1D7OA 1KYQA 1R6BX 2CGEA 2H4YA 2JFOA 1EGVB 3LBFA 1AMNA 4LFAB 2J0SA 3GNQA 5LA6B 4F91B 4F60A 1C1XB 1VBMA 1BDHA 3TM5A 2QB5A 3VJMA 1FQOA 1FVXA 1PLJA 1SKYB 5UKDA 3EMBA 3L8YA 1XE3A 3N53A 4P8RA 2I78A 4JFRA 4PE5B 3EOBI 5H83A 4WXPA 3WLRA 4DA9A 1HZJA 2DBQA 4DIUA 4BEVA 2JCBA 1Q0UA 1MRSA 2A5YB 4YCJA 5DM4A 5E2IA 1YDWA 2M98A 2O3UA 3FSJX 4IIEA 2ZVPX 1YRAA 3VUFA 4RVNA 2QL6A 4IWNA 2QQ5A 3X1JA 3V1NA 2YY7A 1O95C 1VCIA 4TUYA 4YAWA 1W8DA 1ISMA 1WKVA 3IJRA 4PTLA 4QLAA 3TWOA 5K0JA 2I0FA 3AR9A 3VR4D 5F9HA 4UXHA 3ET4A 1WCYA 4BUJA 4Q9HA 2PM8A 1AKYA 2CXSA 5EPUA 2AG1A 2B6HA 3CE9A 3UB3A 2WEKA 4B2PA 4B2YA 3C6ZA 1TCAA 4Y7CA 1WVMA 3OZXA 3DUWA 4DLNA 5J58A 4B7CA 1BS1A 4ZVKA 1P7PA 2J3IA 4IS3A 1VHJA 4IXDA 3C3XA 2VA8A 1W5AA 1O6CA 1VLLA 2WW8A 4HY3A 4U7HA 4WKNA 3JV7A 1YUMA 2WZQA 1BYUA 2Z2XA 3FUWA 3VGPA 3KVVA 3VZSA 1KERA 5HF6A 1GUBA 1HKUA 2H9IA 1IC6A 3DEIA 3NDJA 4EMSA 2Q41A 3G0DA 4DLVA 3F6YA 1RPJA 2VAMA 1BZYA 3KNZA 1XZFA 2XMSA 2XCLA 3GFVA 4W5HA 4IM7A 2J3KA 2WZDA 2YOFA 1OZHA 4N5DA 1PVVA 2MWMA 4WL0A 5LC1A 4P4GA 5AM5A 3MCAA 1K7EB 4C14A 1P2UA 1E2PA 1CVIA 3F0TA 5TNXA 2NMVA 3ZCUA 4R8RA 1DCMA 4XIGS 4CT4B 4EX6A 3OC6A 1K8ZB 5HIKA 3EIEA 2I2DA 4CETA 5EY5B 2FMIA 4AJNA 3OZCA 3WLHA 1OX5A 1EEXB 1G21B 5K6AC 1AT1A 2MU1A 4J6FA 4DKJA 2EXXA 1YQGA 5B58C 4NU0A 2FXIA 2VK1A 4RK7A 1N77A 1XFDA 3ZDYB 4ASUA 2H4WA 2HRQA 1PL6A 1V7QA 2JRCA 4W6ZA 3J80A 1DTSA 3O91A 3P9CA 3CRMA 1WEKA 1O94A 2WYHA 3ONDA 3OZWA 1OXUA 3FJYA 4HF7A 3L1KA 4WKPA 4DWWA 1LJUA 4EG1A 4K6MA 4L5IA 2I4LA 1GNVA 2WR8A 4L8YA 4TKUB 2MR5A 2MINB 3WYNA 1YOBA 3OM9A 4KMRA 1DMRA 4Y9RA 4RHYA 4UUAA 4LF7B 1UBSB 1NBOA 2VJAA 3CE6A 4RLFA 2IXDA 2C0CA 2N1MA 3QFCA 4M54A 3RANA 4EENA 2Y1DA 4ER6A 3ZVKA 3ROMA 4Q0MA 3SNKA 3OPVA 3QLJA 4QEDA 4C05A 3MGBA 4LGYA 4KLRA 3OKFA 4Z1MD 3WGZA 2M1ZA 4FHFA 3R3ZA 4C2AA 3MGKA 4UTRA 3SVTA 5CFZA 3Q9NA 2CF6A 3UGTA 1GUYA 3MMSA 4PYMA 3WRXA 1JKFA 2BY4A 2GEFA 2W2XA 5CEJA 1T4BA 2EKQA 1AB5A 5KNCD 3TF5A 1G5HA 3L4BC 1S89A 1T5DX 4AX8A 1JALA 2PR7A 2OHJA 2Z1DA 1IHYA 3U7QA 5JFOA 4KQEA 3DZBA 4LJRA 4L9AA 4GR4A 1DJMA 2QM3A 5BWMA 3OKPA 4NBLA 3RTCA 4URWR 4YI5A 4Q4CA 2V59A 1Z0AA 4JC5A 3ZZUA 2CE2X 3RFTA 1K89A 5F64A 5JZ9A 2HYDA 3V55A 4BZZA 4ACAA 3EZXA 4ESOA 3HBNA 3UOGA 4K81B 4J3FA 4CIVA 6Q21A 2BCEA 2Y1FA 3FF4A 2ZUSA 4E5VA 2HRRA 5G02A 3ZBTA 1SEPA 2XNCA 2PVPA 2B5WA 3AKCA 4E11A 3LC1O 3QFTA 2W6NA 4NKRA 3K9GA 1OF1A 1V4BA 3M3DA 1W59A 3X1ZA 3NMUF 1O1YA 2QN6A 2YV2A 2V7VA 3RYIA 3F74A 2NZ2A 2Z2JA 3KG2A 5ALJA 2NU9B 4EW2A 4L75A 4RDHA 3VSDA 2ZS9A 4MR7A 2UZIR 2WUEA 3P9RA 4LQCA 3C6QA 1CR1A 3DZFA 2YYSA 2WDZA 1O8CA 1PFKA 2RC5A 3PHJA 4RKFA 1E3EA 4H1HA 2Q5IA 2Z95A 1X80A 1Z39A 2P2YA 2BFFB 5LLDA 4BNUA 4DUZB 3M9LA 1G3QA 4M98A 1Q50A 2OXEA 5GJBA 3FY4A 1DC5A 2JJ8A 3WSWA 4BWFB 3RC1A 2OHVA 4MUKA 2XEDA 2VSQA 2F64A 4A16A 1QOQB 4ID3A 5KWJA 3M4ZA 3R40A 3PGKA 1JSLA 2G5GX 1DJLA 3VHLB 5DKFA 5A1JA 1K3FA 3SN6A 1EBBA 1Z33A 2JVIA 2YX1A 2H1LA 1CCWA 2H51A 1DWOA 4J4HA 2QMOA 2NAPA 2O2GA 2Y1GA 1TW3A 3GRAA 4GI5A 1PZNA 1Y4AE 1X77A 3K0SA 521PA 3TR5A 5PGMA 4L08A 4OQPA 2O3JA 3D3QA 4N8EA 3KV3O 4YFYA 1EGMB 1YC5A 2YS6A 2D5AA 3FYUC 4MJ3A 5AT1A 3AI1A 2ZJ0A 5FBWB 5KNDH 2OZLA 4V2UA 1CIPA 4AQ7A 1KMNA 2Z3VA 3LX6A 2FRVA 2COKA 5LNK1 3KSAC 3KL2A 1L7RA 5J1SB 1Z4PX 3ABOB 4KSCA 1E2QA 1OBHA 5KWSA 3BFPA 4UBNA 1JR6A 3DZJA 2QVXX 3ESDA 2G9UA 3IQXA 4IUCS 5EIBD 1T8TA 3V7NA 4CIXA 4M9CA 4HATA 4S1NA 3RYFA 1E59A 1NN0A 4OSEA 1H2YA 1GQFA 5IJWA 5C52B 1G60A 2B25A 1BCSA 1Q0RA 1VJDA 3KQWA 3OF3A 5CUQA 1MJFA 2ANCA 3GGCA 4ZHQF 2DF8A 4PV7A 2OZPA 2PT6A 4EARA 3Q8WA 3HJNA 5L3QA 3BJRA 2FZWA 4FYYA 1KMCA 3NV9A 3ZW8A 4TS3A 5KNLA 2E18A 5G1NA 4NABA 2EZTA 3UT5A 3OX2A 4N3GA 3WHKA 1RHKA 4B45A 4CPDA 5FLKA 2EFEB 3PPWA 4C29A 3EMDA 1CNMA 3ZQ6A 1ICIA 4NMXB 1AMOA 3PC2A 3QENA 1T25A 4MWOA 5JV5A 3AR7A 3TSZA 1VQ1A 3BOSA 1R5OA 1XBTA 4UHJA 4EMBA 2A9OA 1J9GA 1MAHA 3CTMA 5DCYA 3W8FA 3CUSA 1IZ0A 4V0ME 1ZCAA 4BTVA 4EFNA 2WABA 3QX3A 4RK5A 2ZRFA 5KKAA 3ZUPA 4IJKA 3VTAA 3CPHA 3Q7RA 3VBCA 1COZA 1U9YA 1XDGA 4UZEA 3P45A 3ICVA 2IJGX 1E2FA 2CZCA 1Q0QA 3HU2A 2CVFA 2FCAA 3ZKWB 2K2WA 3GQBA 4F1WA 3OI7A 1FVOA 2QJWA 1Z38A 2R8YA 4RGBA 5CFLA 4H3KB 3KM0A 5C35A 1BMFD 3V1TC 5D3KA 4QUAA 5A3QA 1YRQA 1W4LA 2QRZA 4UOZA 4X97A 3FCEA 2J4FA 2HXGA 2PTHA 4KV7A 3NAQA 4IDOA 3ZIUA 1NP3A 2XMRA 3WBJA 1CPYA 1T0HB 1KEZA 1OXKB 1P72A 4QBKA 4C0JA 4EZBA 1GNRA 4M9XA 1KDYA 4KO3S 3Q0IA 2X2PA 2F67A 2FWMX 3Q1LA 3BMQB 2Q62A 2B5OA 5D5QA 2DUUA 3JY6A 3RNLA 4PS1A 3QVGA 2ZDQA 3TG2A 1QOZA 3OQPA 1PL8A 1V41E 4KQIA 1O03A 2YY5A 3IEUA 2R60A 4H31A 4MRPA 4RLSA 5DHTA 5E2AA 2J85A 2R5NA 4DANA 2XQIA 3AG6A 3IIEA 1WY7A 1CXZA 1ODKA 4R2MA 5JJLA 3BIXA 1W0JA 3EZ6A 3T1YB 3WYGA 3STWA 4R05A 1XJ0A 2QLNA 4A82A 3HB9A 4BEJA 3A3NA 3W4IA 3AM1A 1LWOA 1XZHA 5HKKA 3SJAA 2PIAA 1UMBB 3OHPA 3QPVA 4UXIA 3G5LA 3LNTA 1XNGA 3EDYA 1TKBA 3P9NA 4X6XA 2O59A 3U0BA 1P29A 3KXLA 3KHTA 3KL4A 4BMCA 3GEGA 4B4KA 2J30A 3G8YA 1H2ZA 4KYIB 4P5DA 4A73A 1ZZGA 2GFHA 5B3LA 2GRAA 1EVYA 4DV6B 3LQRA 1T8UA 1XEFA 2A2ZA 1M8KA 1W47A 3ELWA 5TGZA 2K7FA 4FIZA 3WADA 5CTJA 4ZOLF 2Q50A 1WF6A 2XCRB 2FKAA 3EGIA 4Y2XA 4YXWD 1GDDA 1KMHB 2P6OA 4H15A 3QY0A 4PZ0A 1MV5A 3EEIA 1KOJA 4RAOA 5IKOA 1HEUA 3BXHA 3H2GA 1ZYUA 1R00A 2ZYGA 4JHXA 4PPGA 4WV3A 4Y0VA 3SJCA 1PGJA 5ICMA 1RE0A 5CNMA 4TYPA 3JYNA 1KIFA 2A59A 4WRRA 3FLMA 4HX9A 2VS1A 1GUAA 1THMA 2Z8ZA 3OJLA 3DQPA 4FC7A 4OXIA 1L7BA 2PSFA 3MAGA 4RANA 4LVUA 4R1MA 3WSTA 4ZMRA 1PS0A 2OV3A 4AUNA 1M1YA 2A5DA 4IINA 5HA5A 3VMMA 1A8SA 1ONNA 5KMGB 2Z5LA 4MDYA 5CX1A 3ZOZA 2FSSA 3FCOA 1DIAA 3I9FA 4ALKA 2JLVA 1UPBA 1K8QA 1V1JA 3PXGA 4IX9A 1YKFA 4AZ0A 5KVCA 3N7TA 2B8WA 2PSJA 3HJHA 4KQ1A 2CLOB 3AOGA 2GASA 1GPKA 1KQOA 4LDRA 5IF3A 4CEHA 3BXEA 3PUWA 3HB5X 2HCBA 4JX8A 1W4RA 2A0XA 3OLCX 1D0SA 3A3PA 3WY9A 2B4YA 1SPBS 2QE7D 2B2XA 2AG8A 4UE2A 3RSSA 4LV5B 4GYYA 4WLOA 3GWGA 1JL3A 3EVAA 4YJ3F 5IK2A 2IHUA 4B7UA 5AM1A 1HMPA 3RAJA 5JAZA 2ZPAA 5FV7A 2NU8A 3IAM6 1P2SA 1B2RA 2BHNA 2BDEA 3VTKA 3FVVA 4WK4B 3G17A 3OFKA 3KSMA 1KZ1A 1UFKA 4RETA 5DULA 1MIOA 1USKA 1X7XA 2ORVA 1RC1A 5L6MB 5EP1A 3QY9A 2B1GA 1GXSB 4NCXA 4GBGA 4XKJA 5I6DA 4AK9A 2QNBA 3V3KA 2I76A 2OCXA 2OQRA 5C34B 3W9SA 2WMNB 1K6EA 1SUBA 2RFLA 2FXVA 4MV6A 5KKNB 5H4HA 1Z6GA 1JHRA 1Y4ZA 1P45A 3FVTA 3TKAA 3AEUB 3N2KB 1ZLYA 3EXHB 3P19A 5B4TA 3QOYA 3PEUA 4FBMA 1MRZA 1C1DB 2Z4SA 5L7YA 3R7WB 3WGYA 2QU7A 3BE5A 4QXOA 4JP5A 1ZWLA 4OX9Y 4C2TA 3ZN2A 4FHEA 4N6OA 2GBPA 1A7JA 1GWNA 1ZOSA 3QOFA 3UA4A 4D8XA 1E4OA 2HCJB 2WMDA 4RSRA 3HNOA 3SQLA 4Q9DA 4EUKA 2ZQ5A 3FYTA 1JHYA 4P36A 3TECE 3CF4G 5J40A 2CW5A 4GRIA 1LK0A 1TMGE 4EOGA 4V3CA 2D7DA 1DADA 3SXJA 1NW8A 3F5QA 4HN2A 1MPTA 1TM4E 4IQ4A 3Q7TA 2IY8A 3D2LA 3EXFB 3VVBA 2VYFA 1JLRA 3LRPA 1K98A 5KYUA 9GPBA 3VC3A 3O1IC 3VZPA 2QM0A 1PIWA 1RTTA 4O4JF 5KINB 4PM4A 1OKKA 3PPVA 5TF4A 1CFJA 3IOBA 4J3JA 2VSFA 5T6MA 3S81A 3HZZA 3U09A 4WDQA 4F21A 1J09A 2BJWA 2H6EA 2CWWA 1E2EA 5IT4A 3UPUA 2XMZA 2ZI7A 5LR6A 1ZO8A 4YUVA 4N9QA 3V1UA 4HBZA 1W5SA 1VMEA 1CF2O 2C03A 3BQ9A 3MWGA 3CPSA 3EUWA 1VP3A 3AW9A 4X1OA 5F12A 4BFTA 2Y1KA 4KTVE 4F3KA 2P0AA 4EECA 2AQKA 4MV1A 1EE9A 5HYVA 3FOFC 2AT1A 3I58A 3SR0A 2OHFA 3WL7A 4HDMA 1GTSA 3O38A 3PHHA 3F1LA 1L6IA 1YIOA 4N7RA 2O7RA 3ZH2A 1DBQA 4ILEA 1DINA 3L92A 4RY9A 3VO9A 1BKYA 1GV0A 1N8NA 4WFQA 5F5LA 4CKWA 4KP7A 2N46A 2WUDA 2VZ8A 2XD9A 1VDMA 4WEQA 4OHZA 4C3VA 2C82A 4NULA 4C7MA 2IYYA 5FLYA 2P4EA 3SKYA 4AYWA 3BCSA 4UTOA 1TQDA 4TOIA 1SWWA 4HNQA 1L5HB 1VHQA 1USGA 2J41A 3IXQA 3TZHA 2BONA 1CJKC 4XPIB 5EPEA 2XA2A 3L7DA 3AEKA 4IL5A 1Q1ZA 2WY2D 2EBUA 2FHPA 5CLQA 5CGZA 1SBIA 2OC9A 2PWZA 3WWOA 4Y6OA 1D2CA 1KMMA 1R4MB 2A7XA 2NZUG 4PGHA 3RT1A 1NJ2A 3SYRA 4FLMA 1WXQA 3P0IA 1ZL0A 2PLAA 1FYVA 3PJRA 2OZKA 2YH2A 4IW3B 2FJUA 3H2IA 4N3BA 4F6RB 4OHVA 1U63A 4P58A 4QNMA 1G8PA 5JHHB 4WNCA 4CKBB 1XG5A 1RTKA 4B7ZA 4CDMA 2PO5A 1KNXA 1R8SA 3T4UA 1M2JA 2ZRBA 3L5KA 1HE2A 5DISB 1LRKA 3WIVA 1UWVA 1P5ZB 3DE7X 4I4IA 4OYYA 3N8IA 1C3OA 1EIZA 4QX6A 2CXQA 3WMRA 3SHWA 1ND6A 3CU5A 3GGPA 4R71A 3DE2X 1S9HA 4J0FA 1GGJA 3W9UA 3RPEA 2PKEA 4G5YA 1F17A 1GADO 1EDZA 1SHTX 2IX3A 1E2NA 1U2EA 3R9KA 1P1BA 5SYNA 4KXXA 1RJ9A 2W9XA 4XQCA 2A9VA 1PNTA 2NV6A 5KSPA 1FA9A 5EJEA 2PH5A 2Q49A 2BMEA 4M1EA 1HFWA 1G8MA 4RLHA 4QVIA 1QFYA 3UJNA 3KWLA 4NYJQ 4LYYA 3DWFA 3O75A 4EPXA 4ZARA 3OUZA 2V7EA 4BBZA 2CLHB 1OFUX 4II7A 5CHEA 5TPWA 4ZHSA 1FDVA 4Z9XA 3X1KA 3IHTA 2QPTA 1IPEA 1N4DA 3ABSB 3WRYC 3ABRB 2REOA 3DC2A 4L9RA 1KH1A 4FFNA 4M0EA 5LQNA 5JSYA 2ZPUA 5L45A 4LXIA 5HTKA 1N3LA 3A7DA 4MYCA 2WWVD 3SYKA 4F4JA 2DR3A 4I3HA 1S3SA 3GLKA 1J5XA 2F8MA 4K6CA 5FNZA 3WL8A 4BATA 2WNSA 2ZTLA 3HV2A 3PI7A 3V46A 2UYGA 3JU3A 2Z1NA 5LN1A 1BNCA 3NT4A 4HGOA 4M1QA 1VL1A 4DG8A 2GN6A 4YVFA 2J08A 4H7PA 1I6MA 3EGDA 4BLVA 1WX1A 1UDAA 2VEOA 3JQAB 2ECQA 4IP0A 3LS2A 2A1TR 4KKVA 4BECA 2QAJA 3SHOA 2BFNA 2JGRA 1KDPA 5IANA 5KZMB 3PPXA 1RLOA 5I47A 3K6JA 2JIDA 3FR8A 4ZOLA 3U4MA 5DNCA 4IV0A 5GOTA 4F72A 1ZMOA 1F8XA 2FRDA 3PQDA 5A7GA 1KO4A 3DFUA 4K9QA 4XDGA 4BZQA 3BTSA 2C2YA 3MWFA 5KKCA 5AQEA 3MCUA 3H2ZA 4EI9A 2NPIA 4FHZA 1QCDA 1WSBA 3ENQA 1XRNA 2GZ1A 1NRJB 3UICA 1MMFB 1NMYA 1PQPA 4LF6B 5AVUA 2OO3A 2WYOA 2PUCA 3I3SR 1AQNA 1E4EA 1OU0A 2RAFA 4LTNA 4JELA 5LZ5A 1NFFA 3V8PA 4OAPA 1KEEA 1RQNA 3U39A 4DFDA 1J49A 4NI5A 4UATA 5TARA 1CUHA 1N3YA 3DD5A 3KLBA 2B35A 4BV8A 4JEHA 4ZI7F 3ID6C 5DSZA 1KKMA 5FOTA 3GPBA 3VU9A 3GLFE 4LYAA 4QEKA 3KCNA 2CXUA 1RACA 2PMDA 3E70C 4FGWA 1AKVA 3DDWA 1MGPA 3B7WA 1ZU4A 5K3SA 5LOVB 3PZBA 1H69A 1Q6YA 2YMPA 4HAOA 3OQNA 2V1XA 3HJUA 2ST1A 5BQFA 4DQ0A 4O2BA 3UV3A 3EVZA 4IVNA 1XKQA 3UB4A 3HCAA 5HXAA 3UG6A 3NH9A 1AUOA 2IOFA 4PLHA 4TMFA 5A5DA 5EQFA 1YQQA 4WCDA 4HDKA 3HVIA 1XNHA 2OPBA 1Y82A 5HEKA 3PKZA 3AHCA 3R3XA 4QGHA 4QOSA 2BRUA 3AIOA 1SUDA 4JODA 4OM7A 4WINA 4D9BA 5KQLA 5D85A 5LP6C 4RK1A 4CL3A 3C74A 3OJCA 2PX5A 3D3NA 1U2RA 1ZL2A 2F8LA 5C7OO 4NARA 3GT0A 3FYCA 4NDAA 2RG7A 1PFGA 4X7RA 3KQTA 4LHVA 4M1KA 3PEYA 3B82A 3K6RA 3M33A 2F9MA 5JAPA 1E79D 1QGDA 2Q4OA 1G8JA 2REXB 3DLBA 3N6VA 5BP7A 3OIDA 3PD1A 3B6KA 4YRLA 1ZOIA 2H92A 2XKJE 4ZGBA 1UFQA 3MT9A 4C9BA 2GAIA 5AIBA 4GVLA 1CJUC 3V80A 1JPVA 1W2WB 2QR3A 3HABA 4O4IA 1V96A 4M9RA 4GICA 4LGCA 1GO2A 2F2TA 3SBXA 1TEXA 4AKIA 3FFAA 2EJVA 2OGUA 3HUTA 1YRLA 2ZBQA 1U5BB 1L9XA 3BA6A 1M2WA 3OZAA 4NJOA 5KYWA 1JZSA 4EG6A 2QSJA 4INOA 1IBSA 1TMYA 5DI9A 3WGHA 2ZR8A 2GZMA 2OLKA 2B82A 1G18A 2PGAA 3LDFA 1VSUA 1V6CA 2G9VA 1BDBA 1GZHB 3JXEA 3LJKA 4IEEA 2O0KA 5K8CA 1K4YA 3AL2A 3EXAA 3IKVA 1X1SA 5ESWA 1A5SB 5GQSA 1WLSA 5L3ZA 3W78A 4B87A 3WKAA 1JEEA 2AEMA 5CDUA 5BVGB 2ZSUA 4ZV4A 2V7GA 3RI3A 3ZXSA 3QEBZ 4LNUA 2SCUB 2A1IA 1TIPA 2IUSA 4OP3A 2WD7B 5AVYA 1XVIA 3BE8A 2BZGA 4DVGA 1GHTA 3QM1A 2XPCA 4A8JA 5B4UA 1YNSA 2J59A 1DMSA 2O19A 2IHKA 2MJLA 3WV4A 2QPOA 2R7LA 1PSWA 3R6GA 1I2CA 1VGRA 2NNLD 2H63A 3LE8A 5JSUA 3LP6A 2RJOA 2RGCA 2WE8A 4L02A 3PXCX 3EASA 4O2AF 4U5XA 5TVGA 3TBHA 1OA0A 5GPBA 4I1IA 1V2HE 1KYIA 3PC3A 3DAGA 1IMJA 1HMYA 4W8HA 3IOCA 4E32A 1GARA 1VG8A 3A6KA 5KX5B 3EPJA 2EYQA 4Q37A 1ZXLA 3TE7A 3KSBC 3AY0A 3CO5A 4UNSA 4M38A 5G0UA 1K66A 1TZMA 2LCIA 1OFHA 1UJ5A 4B3MB 2FTKE 1ZIPA 2P4SA 3AQIA 1F51E 4FS3A 4E7PA 1EHCA 3K09A 1ODSA 1ONBA 3N7UA 4OFWA 1FRNA 1MB2A 2V7BA 5J5CA 4CQMD 5K8JB 3SLKA 2DLDA 4KN5A 1YA8A 4MJLA 4TTPA 4Q9JA 2VKQA 2XQKA 2O1XA 1IM5A 1Q57A 1PGPA 3DULA 3DG9A 3JWEA 4OQLA 1I3NA 5CCXA 1XTZA 4AZSA 1O95D 1KK1A 3R41A 2D5LA 4O2RA 1KI3A 4ENWA 1KZHA 2V55B 3SZUA 3KU4A 4C3OB 1W96A 2ISQA 2DTDA 5BSKA 4PHHA 4XM1A 4NRDA 1O87A 3AZQA 1E20A 2O2YA 3OX4A 4O4LA 1XALA 4RFVA 1WPRA 3ANNA 1IN7A 1JE1A 1MAVA 3EG5A 3TNLA 1VSBA 4Y9TA 5DNAA 4G97A 1ZW1A 4Z9FA 3DDUA 3GU3A 4GPD1 2PMEA 1ISGA 1J0CA 4J0GA 3GCWA 3GCGA 2C4VA 4S3MA 2CVOA 1ZU5A 2X0RA 3NV7A 3TQCA 1D0IA 4AROA 5T4EA 4ZYVA 1ULZA 3EK2A 1IE3A 2WNIA 1ESCA 3LC7O 4NCIA 5CM8B 5LU9A 3KXIA 4JH0A 4OG2A 1K7YA 3A37A 1RAFA 4C7VA 4MI9A 1W0KA 4JJ4A 1QBKC 4DJ5X 1DXOA 1EDOA 4HH3C 2CFSA 3ZQ4A 4F6LA 3S44A 5JD6A 3SMVA 3I0NA 4G4JA 1AV7A 1YZGA 4P4TA 5BSTA 4MGHA 4ZAFA 2IGBA 3A1UA 5EHXA 3A6LA 4CODB 4EJMA 1Z08A 1GG8A 4Y2GA 1O5IA 3L40A 3NW9A 5ALWA 2ZFUA 3GLGA 1RZ3A 2GUWA 3M1IA 2E82A 3K92A 3NOQA 4X66B 4ZKEA 4Y8VA 4JXXA 1MO3A 1UEXC 3AUAA 3PSHA 3HACA 4HWTA 4PAWA 3NPMA 1EVIA 4D8VA 4GXTA 4PX3A 2DFPA 1CUUA 4MUAA 1NXQA 3RWOA 1JHOA 1Q44A 4DR2B 3EZGA 2ZRHA 4D4MA 4CG1A 5DBFA 4B48A 1NPYA 1H9CA 3EZNA 4GGOA 3HADA 5BNWA 2NP6A 5AI5A 4KMOA 1CQIA 2E5WA 4ZVRA 1F48A 3U48A 3VPXA 5HWSA 5J3JA 4H2DA 1RQ2A 1ZRHA 3PNLA 3KP1A 4JBLA 4KIGA 1AGYA 2B1JA 1BDIA 4MUXA 2R11A 2G8LA 2ZUCA 1G3UA 2XUDA 4IJWA 4Q9KA 1XZJA 2YY6A 2OAQ1 1WBBA 1TLTA 4ZJPA 2LUOA 1RRCA 3FG9A 5AK5A 4AJ9A 3OP1A 3NI2A 3OQ1A 1JI3A 5JT1A 1QUFA 8LDHA 1LZKA 3I3OA 4LJ4A 4NZ9A 4CDRA 3RS5A 3RVLA 4INAA 4D3YA 4IHJF 1MAAA 5AJTA 5HKAA 3UAXA 5C8YA 1TTTA 1JEQB 3KEGA 1D2RA 3KCQA 4NICA 3LFHA 2ACVA 4KXMA 5K0ZA 3EBLA 4IVPA 5BWLA 1QRDA 2XOEA 1JAXA 5LA6F 2RHOA 2AUNA 3O73A 1D8TA 5WRFA 1Q11A 2H8KA 1Q1NA 3EH1A 1GKIA 4IJQA 1VZ3A 1JU9A 1BWQA 1QMGA 2Q8PA 4NEHB 1U1CA 1SU4A 2UVPB 3L3BA 1HYBA 3MCVA 2WF7A 5FR1A 1VHTA 2FPPA 2J1LA 2PGDA 5EHGA 3PUZA 2HA5A 3EQZA 1XCMA 1XXHE 3AOEA 3L1JA 3LA8A 4BMXA 1EGHA 1YQTA 3BMNB 3U0VA 1UXGA 3AMVA 3HN2A 5B58T 4L72A 2BLNA 2C4MA 3CINA 1G5PA 4FEYA 1KJ9A 1RLUA 5DCUA 5K6TA 1MZPA 1UMDA 1RT9A 4LNAA 1J22A 5ITSA 1A8IA 1KI4A 2CLKB 4F3NA 5IWAB 5BRAA 4JVNA 1NVBA 3E0XA 2D7CA 5KIAA 2V3WA 5C8XA 2QTLA 3GEDA 1SOUA 2FVXA 3G2OA 4L4SA 1VXRA 1JF8A 3G59A 4RIEA 3QVMA 5K3CA 1DWPA 4RGVA 1P61B 1SCUA 1WMSA 2ZSIA 3ABZA 3MT7A 1IK6A 3LUHA 4KV9A 3R0ZA 3NASA 5JS2A 4Z3KA 1QRSA 1Z2NX 1XEXA 2I33A 1SRQA 2J6IA 4Z4FA 1FSFA 1E1RA 1N6OA 4YROA 1UKVY 2WUFA 3L06A 1C9MA 4JU8A 3VR5H 1R6VA 3FMVA 3GBPA 3DS8A 4NYMR 1XRPA 3UJAA 1DQYA 4AKGA 5ALUA 3KYCA 5FBZA 2WSMA 2PH3A 5CW2A 1X3SA 2BIFA 2DWPA 2XCIA 1J1ZA 1ATZA 1CVLA 1TVKA 5L3RA 1J0XO 4X3OA 1GLGA 2RGDA 3R5SA 5CFMA 1JQLB 3IYLW 4OHYA 4XIJA 3JWGA 5DXFA 2P6UA 3TDMA 1P4AA 4NENA 4I9UA 1XN4A 2AI3A 4M8IA 1VB5A 1C30B 4GOKA 4WCFA 3EBOA 1BTOA 3HU3A 3WTCA 3U4QB 2HU2A 3RTGA 2HA4A 3BH7A 1SOAA 1A71A 3O5AA 1GCUA 3E82A 2YDXA 4UBMA 1F8FA 4XXHA 2O52A 4I66A 3HCPA 1AHHA 2R6GA 3L7CA 1N5JA 5JMTA 3O8CA 2NPOA 4QDOA 1QGZA 4C3ZA 4JASB 2Z56A 4OLBA 4QNNA 1QC5A 4LXTA 4BE9A 1J42A 3EE6A 4XRRA 5FA6A 1V6SA 1QR6A 5DBIA 3RHZA 4BASA 1JFRA 4B7AA 3FI9A 3R7FA 5KOJB 1P0QA 4ZTBA 2DQSA 2G1KA 1XQVA 3L0CA 1Q17A 1VBNA 1XX6A 3M6VA 4PVDA 3U3OA 3TJZA 3PDUA 4DCSA 3NDRA 1TU4A 3DMFA 2YJGA 2EJBA 3FM9A 3OZGA 2VBGA 2CBXA 4V39A 4UAVA 2ZCVA 3SYTA 3U9LA 4B3XA 1H0RA 1KHHA 3U1TA 2FJPA 1Z8DA 3KHSA 3S5JA 2CL7X 3BMCA 4IR7A 1SG9A 2YN4A 4RIIA 4QAJA 5FUYA 4B3HA 1OXSC 1WMBA 4FT4A 2UYCA 4GYKA 2EERA 3IIIA 3K15A 3HLTA 3RQIA 4AZVA 1PV4A 2W98A 4RTKA 1C1HA 1YI8A 4NCBA 1JLKA 5CT9A 1JILA 1E1CA 2WTEA 2OP0A 4NF2A 3VKHA 2ZI9A 2PZJA 4EB3A 2CUNA 3FVQA 4J07A 5FLXA 4BBJA 3D2BA 3BWEA 1HA3A 2DR0A 1QYCA 2ZWOA 2XUPA 3EYWA 4MVJE</