2AC2A

Crystal structure of the tyr13phe mutant variant of bacillus subtilis ferrochelatase with zn(2+) bound at the active site
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
309
structure length
309
Chain Sequence
SRKKMGLLVMAFGTPYKEEDIERYYTHIRRGRKPEPEMLQDLKDRYEAIGGISPLAQITEQQAHNLEQHLNEIQDEITFKAYIGLKHIEPFIEDAVAEMHKDGITEAVSIVLAPHFSTFSVQSYNKRAKEEAEKLGGLTITSVESWYDEPKFVTYWVDRVKETYASMPEDERENAMLIVSAHSLPEKIKEFGDPYPDQLHESAKLIAEGAGVSEYAVGWQSEGNTPDPWLGPDVQDLTRDLFEQKGYQAFVYVPVGFVADHLEVLYDNDYECKVVTDDIGASYYRPEMPNAKPEFIDALATVVLKKLGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Ferrochelatase
publication title Metallation of the Transition-state Inhibitor N-methyl Mesoporphyrin by Ferrochelatase: Implications for the Catalytic Reaction Mechanism.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 119
structure length 309
sequence length 309
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 2005-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ac2A01
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ac2A02
3M4ZA 2DJ5A 2HK6A 4KLRA 1TJNA 3HCNA 3HCOA 2XVYA 2Q2NA 3GOQA 2HRCA 2QD3A 2XVXA 3HCRA 2XVZA 4KLAA 1C1HA 2C8JA 2PO7A 2XWPA 2H1VA 2PO5A 2HREA 1N0IA 1L8XA 2QD5A 2QD4A 2Q2OA 4CCSA 2XWQA 2H1WA 2QD2A 1QGOA 3LYHA 2AC4A 2AC2A 2QD1A 1C9EA 1DOZA 3AQIA 1LD3A 1LBQA 2XWSA 2Q3JA 4KLCA 4KMMA 1HRKA 3HCPA 4F4DA 1AK1A 2JH3A 2PNJA 4MK4A 3W1WA
chains in the Genus database with same CATH superfamily
4HZUB 1QIJA 1VPLA 5K8CA 1ARZA 3A36A 4D3ZA 1B2LA 2HEGA 1YDWA 5DJ5A 2D0PB 3W5HA 4D0GA 1J06A 2HMTA 3KAJA 3KXPA 5G3ZA 1Q7CA 4IY1A 3OVMA 2W58A 4ND7A 4YHBA 4DIKA 3IR7A 2IEAA 2AT1A 2QP4A 2QUJA 1BS1A 2FW7A 3NOXA 1ZEMA 1RIIA 1K0UA 5B1DA 1RYFA 1ULBA 4PLTA 1UUFA 5AKKA 4MGEA 4O4LB 2D0DA 5JDIA 2BF7A 1NMEA 1W93A 1HKUA 1X2EA 3IP1A 7GPBA 4N9WA 4BTVA 3CPEA 4XLZA 5HKLA 1F4LA 4NDAA 4PZYA 5CH8A 3LC0A 1KFKB 1TIKA 4I6EA 3EH2A 3N9IA 1GSHA 5A71A 1VJRA 5GJVC 1TKBA 4GX1A 1JHRA 3LXMA 2XUAA 4JP8A 3E35A 4ZT5A 2RDMA 1ADFA 1P2FA 1YZ3A 1GPWB 1UDXA 2P30A 1E61A 1SXJD 2VRCA 3NOVA 3SJCA 1LV8A 1KARA 1Q2XA 2OBNA 2Q6KA 5JXJA 3ZUPA 2CNWA 1XA4A 3SFVA 4Z7QB 2ZREA 4HMPA 4NYJQ 5HKBA 2BP7B 2UZAA 2H6EA 4DTIA 1TRHA 1ZWLA 4U0JA 3IEMA 1GPMA 1T13A 5IT0A 4YEDA 1UZNA 4H7KA 4EEZA 1YDGA 3HXOA 3QFCA 1J8MF 1L5LA 1AMNA 2FOIA 1DRJA 1S6YA 2J9ZB 2OAQ1 1PSZA 4ARVA 4IR7A 4TKUA 2BSQA 4I2VA 3EOZA 2AEMA 3OAAD 2EWWA 3R5TA 4EY5A 4PGGA 1DKUA 3GC6A 4GEGA 3UAVA 3PFGA 4H0NA 2X5OA 3M9WA 5K8VA 3PRJA 3RYTC 3C14C 2W48A 4V0ME 2XR1A 4HJRA 2C9YA 2O20A 2DPLA 3QFTA 1GPJA 1CQWA 2CUZA 4OX9Y 4O0LA 4EG3A 3GFVA 3DTVA 4EGAA 1MAVA 2FJUA 3DZBA 1KBZA 2X8BA 4JWTA 1X1SA 3GPBA 1SUIA 1YZFA 2Z2JA 1T34A 5KX5A 2HJWA 1UPXA 4DLXA 1N8SA 5IXSA 1SVWA 2V1XA 3IVXA 1U11A 3WL4A 5BR4A 1NIPA 2FSSA 1SEPA 2VXOA 2CD7A 1O95A 3AY0A 3Q3JB 4RPCA 4EG7A 4WFJA 2CYAA 2GEDA 3L5OA 1JQAA 3MUEA 2FPIA 1E8DA 1P72A 2JH9A 4YUYA 3HFSA 4TKLA 1GRQA 2VWQA 1N1DA 1EP1B 1NMXA 3WXBA 3HB9A 5EZ5A 7YASA 3Q3IA 3LW7A 1R8SA 3N2KA 4KJZA 3MUFA 3GAAA 5FTNA 1PJCA 4QPDA 1C2TA 1ECLA 3C1TA 5LMNB 3SC4A 2IIQA 2OHHA 2EERA 2YNMA 3KV3O 5EG5A 5GQSA 2P0EA 2FJPA 1RWOA 3VU0A 5K8UA 1A2OA 5ULLA 3VV3A 3NAQA 4FCVA 3VDNB 3WNCA 5C5IA 1P2GA 4ZYXA 3AHJA 4IDNA 1A9SA 5ALDA 3BD8A 1NI5A 3OUUA 3ZN2A 1I7NA 4Y2SA 4M6WB 1KO5A 2VPQA 4QULA 1RR6A 2VUTA 4TZ6A 1ORHA 2AWNA 2XADA 3U60B 1BDMA 1QVZA 1PW5A 4FMPA 3UHAA 3MWEA 1H22A 3FGPA 4NCXA 4CJXA 3NC0C 4TL6A 1U2PA 1N0IA 3BWMA 3LUBA 1FRFS 2CL7X 3GI1A 5I7HA 3EODA 4OHVA 5DZSA 2X2OA 4KO2S 4XIGS 4C21A 4GZ5A 1MABB 1WZ2A 2X40A 3HNRA 3LLSA 1WOMA 4EYEA 1SG9A 5KYNA 1H6CA 2C8KA 1TKRA 4H17A 4CU5A 5B12A 5JYEA 5IMSA 4AWAA 1RFLA 3SAJA 3IJRA 3SJAA 5HDBB 2F90A 1YQXA 3OM1A 1KI2A 2PEYA 3QXJA 4LW8A 1ORTA 2B1QA 4DA6A 5KSWB 1HDEA 2PLFA 1IRIA 3LDHA 4KXQA 3TQFA 5KQRA 2YMPA 3U3DA 5BSGA 1TA9A 4D1YA 2P4HX 4R7ZA 1B16A 3JQQA 4AZSA 5AW8A 4IJUA 3AKCA 1RIFA 3TMYA 3ZWKA 4YO7A 5GM1A 4F7WA 2AOUA 4IH9A 2NU8B 3PUHA 5K7SA 5LR6A 5LMUB 1A97A 3B1YA 3MGGA 3QIAA 2XUFA 4XGKA 3K9NA 4OJTA 3WIVA 5FWXB 3LOQA 2FMTA 4E07A 4Q7EA 4FU0A 2PS1A 2OCKA 2AZ4A 1ORIA 3I39X 4LWPA 2FPGB 3QLTA 1R6TA 2VDVE 3I01A 1NF8A 1WSDA 4M53A 4IDGA 3PK0A 1GN9A 1P5JA 3FZQA 3T3EA 1OKKD 4RPGA 1UMBB 3VV2A 4F9TA 4RQBA 5DYYA 2NVWA 1R0WA 1LDBA 2P75A 4A0RA 4LNAA 4ZKEA 2IQIA 5TB5A 1KNQA 5HPYB 3T7KA 5JNVA 3H8JA 2O3RA 2W2LD 1Q0RA 1IOVA 3DGEC 4B7ZA 1XYGA 3EAGA 2HBZA 4M0DA 5HBGA 3OTGA 2ZUTA 1BMFD 4ND8A 2BT4A 4GFDA 3ZIUA 9LDTA 2EZ9A 2FX3A 3NEYA 3AOGA 3ANNA 4I36A 5KCMA 2WIDA 4JCCA 5EL0A 2HRQA 1F1JA 3CVJA 2VSXA 5EE1A 4A6EA 5I7VA 2CXOA 3SSOA 4DOMA 1U98A 4HXEB 3R8FA 1OR8A 2JI7A 4BLUA 4JC4A 1PJ2A 2O5VA 2V98A 1GCIA 3F67A 2QRLA 1LLDA 3RTAA 4ACBA 1KH1A 2YW9A 3AHDA 3QFFA 3L5KA 1H8HD 2LP4Y 1ZNYA 2QI9F 3UHJA 1Z4LA 3ZXSA 4CMAA 1BIFA 1G4UR 5JUWA 3SQXA 1CS0B 3JQGA 2Q29A 2Z8ZA 3QPAA 4RZIA 2R87A 2NSDA 1H66A 3DZKA 4QO7A 3FPHA 5DHTA 2FY8A 1HZJA 3U7GA 1WABA 5HWSA 2DPMA 4S04A 1G41A 4KNYA 4OHCA 5C37A 4PV7A 3G7UA 4HV4A 4RY0A 2J0VA 2GR9A 1PX0A 3JQBC 1R6UA 4Q3BA 4TROA 5LA6A 5ILGA 1UKVY 1ORWA 2V5VA 4H6XA 2ZSFA 4DNXA 1JH9A 4PYRA 9LDBA 4QWMA 1HX7A 3O94A 5ECWA 1AKWA 4LBYA 1QFXA 3JQEA 4AO8A 2L17A 5TSDA 2BCGY 5E0KB 1Z5UA 4HUJA 4J0DA 3TTYA 1IQUA 2BAGA 3JPWA 4FXOA 1HMYA 4IIVA 4N7JA 3WK6A 3QYJA 3W8DA 1FQJA 5DWDA 3QPCA 2I55A 1MGOA 1U31A 2XVZA 4D43A 4ZT7A 3PRKE 2P62A 3DCYA 1DJNA 3WL3A 2VH5R 3MRVA 5AM4A 2WPDA 5E4TA 3RGGA 3HU5A 3E9DA 1GAEO 3MM4A 4JJ4A 5G0SA 3KT8A 4BMOB 1RQNA 3ND7A 3OPYA 3GLHB 1SKMA 3EQ2A 3GBPA 4N0MA 3Q9LA 1JWBB 1I2DA 3I72A 3KB8A 4I55F 4YJ2F 4A92A 1N2CB 3W5JA 4L50A 2ID8A 1QCYA 2P91A 2WAXA 3H2GA 3KTAA 4JVNA 3RJ9A 4E2ZA 3S4YA 3KCNA 4R69A 2IP1A 4AECA 4DCVA 5H9WA 2O8FA 4K3UA 1N2EA 4KO1S 4D9EA 2BSXA 1TQ8A 2ZUDA 4U00A 5JSFA 2Q4BA 3JAKB 3PWSA 5FWNA 2CNOA 4F96A 1OOEA 5EHQA 1SVLA 1T24A 2XWPA 3DFFA 2YR0A 4L4UA 1ZZEA 2DXIA 3HEAA 2EP7A 1VGQA 1DJPA 3LUDA 4G4GA 3DBRB 4UHDA 3NB0A 4HQ6A 3ECAA 2E48A 4V0SA 3ZQ6A 1TYCA 1PS9A 2ILTA 1HNZB 3SR3A 4KZPA 2IHNA 2XEXA 3HBMA 2OCAA 3IO5A 4YJKA 4PG6A 3EISA 4TTIA 5A1JA 4UEOA 2XZOA 3FBWA 2VR1A 1GG9A 1N6IA 3AYZB 1BCSA 1JR3E 2IOQA 3CCFA 3CXUA 4LJ5A 4Q4LA 2BVNA 3WGOA 4AY6A 1OHHD 4F6CA 3A9UA 2WY2D 1ZBQA 1RAGA 3AFOA 4WVFA 2W2NA 2IHVA 3GHHA 3U3JA 2CK3D 2GJ4A 4FDTA 4XEUA 3UH1A 4BP8A 4R16A 3VSCA 3SBOA 5BQFA 2C07A 2QRMA 3C6KA 2G9QA 1Z88A 4BKRA 3QYAA 4RABA 4CLRB 3QFHA 4M9RA 4R5HA 3BFXA 2J5XA 1KXZA 1GPH1 2QF7A 3MCWA 4GPIB 4MUGA 5KDLA 1JFRA 2FMKA 2GF2A 4DT1A 1ST2A 3SOPA 2G7ZA 5JO0A 3BXOA 1OREA 3DL4A 1T15A 5K3AA 4IDDA 5BNIA 1PJAA 3G17A 2G1AA 2QTHA 2NUPB 3A9SA 4RAOA 4E3WA 1OB5A 4Q3CA 2Q1WA 2YMLA 4LVUA 1XEWY 1KETA 4CM5A 3RTBA 1LD3A 5IZCC 5A5DA 3SP1A 5DASA 4F12A 2I7VA 1V45E 4B3GA 3OTHA 3BYZA 3Q2OA 3OKPA 1HH4A 2NO6A 1TVEA 1I4EB 2Z3WA 4IICA 1PDVA 3PYMA 1FUEA 3C74A 4OLAA 2HPVA 3FX2A 1TEVA 2IS2A 4MO2A 2IUUA 1JPVA 5U1PA 1TO6A 3OU6A 3KSBC 1V26A 3U44B 1QP8A 3MHPA 3EPKA 1JT2A 1RXCA 3FB1A 2QIPA 4MCAA 4P0PB 3JAWA 1JLMA 1LBTA 2JIZD 4XSGA 1HFEL 1XNJA 1V11B 1S3GA 1RP7A 2B3TA 3EA4A 3RBZA 1BROA 1F2UA 1X15A 3B6IA 3SEZA 3V6MA 4S3MA 4CNBA 4K88A 2VNSA 4XUCA 5JNLA 4OI4A 3Q7IA 4X8LA 1PUXA 1NHWA 2AHOA 5L3QA 5GIPE 3G9QA 4H6WA 4P0QB 3F1LA 2IY8A 1JA0A 2OQRA 2GBPA 3ADDA 4QDTA 3AFNA 4L73A 4LKRA 3W1WA 4CMJA 5C1BA 3ABSB 1NPTO 2ZOSA 1VIMA 1Y1KE 3GZNB 5DHPA 3SHVA 4EITA 2C92A 1V4NA 4BTEA 1ZHOA 4EYKA 2PD4A 2Q46A 3Q1KA 3AEKA 5K6TA 5IVHA 4B4DA 5CFQA 2VTBB 3NM4A 1W19A 4MGZR 4HDRB 2J9XB 4XX0B 4CKWA 4LF9B 4J4HA 1CY0A 3CMMA 5K0GA 3A6FA 5EMMA 5FPQA 2W2OA 1D0IA 1HTTA 2VHQA 4ZAVA 1E0JA 1N6RA 4JQYA 4PN7A 3GLFA 5JSUA 4G1UC 2DWPA 3LWBA 3T15A 1NC1A 1PLJA 4P7JA 3SNKA 3OBBA 4Z9XA 3UMVA 2BM9A 2FCRA 2HU8A 3M5WA 4XR4A 1X1BA 4GNRA 3T5BA 2EGGA 4IG9A 3IUBA 5J2UB 1D5CA 3PNVA 1M6VA 1I4OA 4U6QA 2GPAA 3D6UA 4JQCA 2OD2A 4H7DA 5DO9A 2H9YA 4RHTA 1SZPA 3REOA 5HKAA 3MGCA 4AP6A 2RH4A 2Y1FA 4CKYA 3G0OA 2ZRQA 2ON6A 3C3YA 3I9MA 3TINA 5BR7A 5L3VA 3GGPA 1ATIA 2HF2A 3EXHB 1ZK2A 4RLFA 2XCTB 2UZ1A 2HF7A 3QWFA 5JZVA 1E2UA 3NS7A 1B0AA 3ZGOA 1CB7A 1RWNA 3S7TA 2DFNA 4MI1A 4TWBA 2CYBA 5LNK1 1FSSA 3MK31 3TQSA 2RHCA 2G9UA 1QOZA 4HGZA 1FE8A 1F8XA 5CHEA 1WY5A 5KWJA 1S8AA 2DBRA 2RARA 1KPHA 3C5HA 5DT2A 1JIQA 3QKUA 5AHKA 4F21A 3B60A 1QYDA 2MSNA 1G9TA 2P2LA 3O3OB 4MZXA 2QL6A 4OIMA 5CM2Z 2RKOA 1CDOA 4GR9A 5H16A 1SOAA 3VZPA 4CDRA 4D57A 2BGNA 3GP8A 3ZHYA 2WJJA 2WF7A 2Y99A 1CP3A 1JLRA 3DC7A 4G0MA 4JQZA 2AMJA 5E1DA 1S4QA 4KE9A 3Q88A 3FWYA 4FYXA 2OENG 4PLPA 4RENA 1K9VF 4FN5A 5IKXA 1JTFA 2PS0A 5LDGA 1S9HA 4EY6A 4U3JA 2NZYA 2GHQA 2QD5A 3FROA 3NBYC 1K75A 2PUBA 2JA1A 3Q12A 3P2MA 1PWEA 5JY6A 3EYAA 1WUKS 2JGEA 3E2MA 5HGJA 5CBPB 4A8JA 2IEZA 2OSBA 1ODJA 2OBBA 3GUHA 2CF6A 4NH0A 1YC2A 3N87A 4Z3DA 3UMCA 1FYWA 2GLTA 1E77A 1EM8A 4X85A 2SHKA 2ZI6A 2RHBA 4MRMA 1RXVA 3VBCA 1KPIA 1O4WA 2ZIXB 4XGNA 3VPHA 5L7WA 4UTXA 4LZOA 5K0LA 3L05A 4OSEA 2G3YA 4M36A 4PBSA 1TGVA 3VR2D 4GKAA 1LV7A 1XPOA 1LQTA 3J7AC 5AYVA 1BMDA 3H5AA 1RLIA 2J3DA 3GELA 2ZJ1A 2V7EA 2YN4A 4DV4B 3SJZA 2BHSA 2GZRA 2IU4A 4X1IB 5AHOA 1VMDA 1KZHA 3EGIA 3CB2A 2AMFA 5C8VA 1Y1PA 4Q5IA 1OGYA 3ZHVA 5LJLA 4HDMB 4KREA 1G7CA 1QTQA 1AZTA 2BD0A 3BA1A 5EWJB 4B6QA 1M76A 3X2FA 3KQHA 4B6GA 4YO8A 3VVMA 3FR8A 4GXQA 5FCDA 3ROXA 2XOKD 3R3XA 4L7QA 2H7XA 3LWZA 4MITA 4ZRMA 4C20A 3WVNA 1IEWA 2W6CX 3LZCA 1KMQA 4Y0AA 3SIPA 5ALFA 1U63A 1TLLA 1GEGA 1Z62A 4JVSB 4DV5B 4QARA 3I92A 3HKDB 4E4TA 5BSEA 1IN7A 3I9FA 3F0TA 3FVVA 4B1FA 3QWBA 3CLVA 5AJYA 1T3SA 1OWOA 2NQTA 3E15A 4KK3A 5HG0A 4IDAA 3V7FA 4CIBA 4RJJA 5JG7A 2JGMA 2EHJA 3H87A 4A03A 2W2VA 1U8XX 2AX4A 1LI7A 2PH5A 3JTEA 4E70A 4MS4B 4DDVA 1STOA 3FFAA 3KJHA 4KHZA 2O0MA 5BSKA 1G6Q1 2X4DA 2OGZA 1DQNA 3N7TA 2GETA 1XI2A 1IOLA 2OUIA 4RCYA 3SYMA 2PMFA 1GWNA 1OQAA 4ZOLF 1Z6XA 3A37A 3UV7A 1N2SA 4NBSA 2ZT8A 5D84A 5JJLA 1G2OA 2G7MC 1HTBA 2O07A 2YV4A 1A8SA 3FHLA 1A9ZA 3AJ9A 3O95A 2XQIA 3RODA 3ZNPA 1DBWA 2C7OA 4AMUA 3AV3A 4BP1A 4NICA 1Z6TA 4RY2A 4QASA 4PYLA 1AKNA 4YCAA 5AI5A 1DJQA 1B8VA 1OUMA 4UE3S 4TV8F 2KBFA 4Z8YA 1OFUA 3Q9SA 5C0OE 1HNNA 4DEXA 5EP2A 3HJGA 3PXBA 3C6QA 3S70A 4V1CB 3LBHA 3FOFC 4PBRA 3HVJA 4OI0A 1Z6ZA 4OBBA 2FTKE 3WWPA 1ZRNA 4XOUA 3NALA 3STXA 3D8HA 4CFSA 2G67A 1O3YA 3UC5A 2ZIGA 3H2JA 2GOYA 1XMVA 3MXTA 5JAHA 1ULUA 3D2BA 3QWIA 3T7IA 3IQEA 4I1OA 1FFXB 4KV7A 4XD2A 4U7HA 3NUGA 2G76A 1W6UA 1H5UA 1Q74A 3LUJA 3O8OA 3LT1A 5B7NA 2BEKA 3EGXB 3MSXA 3N0VA 2ARKA 2P5TB 3RYFB 3CVUA 1VYHA 2H11A 1ZMBA 2XTJA 1WZIA 3I45A 4MV5A 1ZM4A 2OK8A 3CEPB 2PYDA 3WHPA 3A0UA 1O5OA 4TTRA 3UTCA 4JLKA 4EGJA 2RHWA 3DL7A 3GUYA 3PTAA 3OFJA 4JYCA 3RCBA 2GX6A 4CI0B 2P5YA 3ERCA 5I9MA 1XRSB 1EHCA 4W9NA 1GIAA 1GZ3A 1YQUA 1SD1A 2CEAA 5FOTA 3KX2A 4E21A 5JEDA 2IY9A 1FNBA 2MYUA 3GDOA 2WFLB 4G56A 4R83A 5CLLA 5JBNA 3HDTA 3KJGA 3K0SA 3O93A 3FI9A 5TQ2B 2ZAGA 3GY0A 4QYIB 3UK0A 1UFRA 1A9RA 3ILVA 4YP1A 3SQDA 1DBVO 1WDTA 2CKDA 3UXYA 3WLTA 1KZ4A 4EO9A 2FUG6 2WWTA 3FNQA 5LCXA 1FXWA 2B1JA 3BJRA 2J0EA 4P86A 3ZWPA 2XQJA 2IZZA 2QAGC 3AEZA 4M9XA 1WEKA 2FSVC 1ZSVA 2XUDA 2XBMA 1XKTA 4ZCPA 4CHGA 4FNMA 1GAWA 1PK8A 2KPOA 1X94A 3HWWA 3VO1A 3MNFA 4AW9A 1ZGZA 3V8VA 3SQOA 5CFRA 3FETA 4F4DA 1Y9ZA 3EXFA 4UDNA 5HTOA 2O2HA 2XX3A 3N2NA 3DR5A 5EWLA 4LTDA 1Y48E 5IDVA 1SVKA 1CX9B 4R1QA 4BFSA 3DFZA 2BGMA 1IXRC 2PL1A 2YCLA 4RVNA 2ACWA 5E1OA 3Q8XB 2JIDA 2FLKA 3C3MA 4YV7A 4QXPA 4XRGA 2QT9A 3AOEC 3D2CA 3BIWA 3CLRC 3P0RA 4MW4A 3DDNA 3UO8B 4DIUA 2IZOA 2FWRA 4RHEA 1T29A 4LHSA 4BYGA 4UTPA 1L4UA 1MB9A 4RYLA 2NU6B 2JGAA 5BSMA 5DN9A 2GO7A 3ONNA 5I7UA 4UAJA 1Q5PA 3K3PA 5JNTA 4DV3B 2G25A 3DTVD 4ZYUA 1QAOA 2I67A 1VJCA 3ZHSA 3FWKA 2V4UA 5AHWA 2RHRA 1ZNXA 4DLNA 1L8QA 4XB2A 1RLMA 2XNKA 4NCKA 4JDUA 5HZMA 5COBA 3PC2A 3PQDA 3GVPA 1N6HA 2YXDA 1ODCA 2WT4A 1D09A 1O95D 4MAAA 4P3PA 2R44A 1AKTA 4M1QA 3L7MA 3VZBA 2G06A 2VWPA 3FWPA 3UM9A 1RZVA 4OLHA 4EECA 3GLIA 1GZ7A 1WPQA 2FKNA 3I73A 2CBZA 3L49A 3L8DA 5DNEA 3V3KA 1DO2A 2RGEA 2G77B 2ONYA 2X2FA 2FE1A 4RMNA 1Z8DA 3LZDA 3ZZUA 4WLEA 3AUUA 3GB9A 1ZVQA 2H07A 2YNMD 3LZ6A 4GGMX 5H80A 1V5EA 4MR9A 1XROA 1XV5A 3PGJA 2HLNA 2YUTA 1FVHA 1XCPA 5KHLB 2WU3A 1OX4B 3V80A 2M2IA 4HWOA 3OSUA 1FDRA 4WKPA 1PQPA 2YWRA 3OO1A 2BFFA 1SA0B 3ELWA 1IG0A 5CYFA 4ZT3A 4XWKA 5JNWA 1UIRA 1XHFA 4EPXA 5HIKA 5AUNB 5K0BA 4YMSA 3F46A 2XVXA 4KXMA 4NU0A 1E2KA 4EK9A 1ENOA 4R7GA 3RQIA 3GN1A 5M34A 2BKLA 3R3VA 3T61A 3ZCQA 4R1TA 2W6IA 4IPTA 3W4JA 4HHEA 1MC4A 3QVMA 4HLCA 3ZV3A 2Q3CA 3FSRA 3DE6X 1N9KA 1U5BB 1YS9A 3EFBA 4HFNA 3MWFA 4KPUB 5ES4B 3ECCA 3KKPA 1PGNA 1XNRB 1H2FA 1M2OA 3COPA 4GMFA 4QO8A 3JAMA 1BCRA 2Q1TA 3AP1A 1MJNA 3BWXA 3H5OA 3AEQB 5FPSA 4PPQA 1S96A 2FSPA 1COWA 2VJDA 5EQTA 3V4FA 1RCTE 1E2PA 3V4VB 1NQAO 4OAPA 2V7UA 3LF1A 4PO9A 4QECA 4QU5A 3SN6A 4IHJB 4HX2A 4EPYA 1L4YA 1RJ9B 1YVUA 2IYFA 1U1CA 4LOJA 1U65A 3BRQA 3DOUA 2XGGA 3C24A 4MVWA 4F38A 3EBPA 5IABA 5A1TA 2SBTA 3QX3A 1OLUA 3EFEA 3TFWA 3L4BC 1QV9A 3X1XA 4M49A 4EFKA 5FADA 5JCOC 2ATCA 3W5DA 3M0EA 2RONA 2JLSA 3MCZA 3O5AA 4XLLA 2BI7A 1QB7A 4NBUA 2VPPA 4J0JA 4BGDA 2AEEA 3X1WA 2PVSA 3KQMA 1UJ6A 4PTLA 3W3ZB 1XSEA 1E3TA 1MNQA 1HWYA 3FHOA 3T5MA 2FYTA 1E6WA 5JQGB 4C0AC 2ZT7A 4E7PA 2I71A 1RXUA 1T2CA 3JW8A 1USIA 1NXTA 2VZ9A 4BNJA 5KJCA 2YY7A 3I32A 2JI4A 4RVSA 4B75A 2BZ0A 3A4MA 1XZEA 3C3KA 3WGZA 4CLOA 2GAOA 5TMPA 3Q9UA 1MJHA 1VMIA 4BO1A 4L8LA 2NG1A 2R47A 2BTQB 4NCIA 1XCOA 3ZV6A 1ULSA 2XUQA 2B20A 3JYLA 3L9XA 1HA3A 4FWBA 1GNRA 1XWWA 3FMPB 3JQ6A 5JCJD 3TSZA 1NR5A 1IBSA 3OLVA 1Q7GA 3C4JA 3Q7QA 4GOJA 2WWRA 5IYZF 1MPXA 2ENWA 1F9EA 2R00A 4X54A 4LYDA 1GDDA 1KI3A 1TCCA 3CRQA 3P9CA 2TMGA 4ZAWA 3ESCA 1XTQA 5FF9A 4Q0MA 1KE1A 3AQIA 4XVCA 4AI6A 1Y9AA 4EPVA 4R0VA 5BP7A 3PZRA 5CFLA 1L7BA 4IL5A 1YL7A 4I4TF 2H2WA 2ZYRA 1NURA 3KQVA 2J9GA 3UOGA 1MG0A 2XHZA 4QREA 3U4MA 3UHFA 3ZDZB 3ZHXA 4K26A 3WMEA 1XRPA 3WV4A 2UYOA 1TAQA 2C61A 2EKDA 2Q5FA 1K97A 4J0QA 5HFAA 2V65A 2W6PA 1P91A 3IH5A 3T7SA 5AK4A 3UWOA 4AJ1A 4YYZA 3DBHA 1F7UA 3WTBA 1L5MA 3KL4A 2JARA 4QBGB 1CE8A 1TA0A 3FDJA 3OIWA 4JVLA 4RM3A 5CJ2A 1NQ5A 2P6NA 1OIXA 4M55A 4XFDA 1P3DA 4IYJA 2QBYB 2YWBA 2ONJA 4C05A 4QNNA 3WRYA 2RI6A 2QVXX 3G8BA 3HB5X 1FDWA 3N28A 4IXMA 3WK7A 3FLAA 4B4WA 3ZLJA 2NOAA 3R3SA 1Z13A 3MPOA 3Q40A 4ZCSA 3SYRA 5AW1A 3G88A 1BX3A 4ZAZA 1NYRA 3RDPA 4C43A 4EI7A 1QQAA 1LPPA 1YCGA 3WK5A 2ESRA 5FULA 5HNKA 3L4SO 3DOCA 1WU7A 3H9UA 3D6JA 3GRPA 4KSBA 3I6IA 2WPDD 4PR0A 3DDCA 3OM8A 1EK5A 2PIDA 1TVKA 3T7AA 2BE7A 3TTXA 5KNCA 4D4KA 2ZYHA 4IJ5A 4FGKA 4FEYA 2AZMA 2ACVA 3BF7A 3SEFA 4Y1RA 2Q49A 2PYZA 1FFEA 2O8EA 4D92A 2CW5A 5T57A 1JKFA 1AGPA 1V95A 1D2GA 1ZUNA 4UTVA 4N76A 1BAPA 2ZU6A 5U4XA 4DABA 4YRBA 1K89A 2ZJ6A 4K6MA 5KYUA 5JBIA 1DJLA 2FV8A 4KWHA 3ROEA 1N9GA 3K5IA 4QUEA 2H1FA 2XOEA 2QTGA 4HMOA 4YQYA 2B8EA 3SF8A 1LFAA 4D82A 1XXHA 3E82A 3GAMA 2JJQA 1PR1A 4YTEA 3ODPA 1QKKA 3P9ZA 1JVSA 4F4HA 2HGZA 4NX2A 1YXMA 3ILHA 4HBZA 1KIFA 1PR3A 2IXGA 1XALA 3CR7A 1EDDA 1SPXA 1XZGA 2R86A 2O48X 3BS4A 1UBKS 3H5RA 3PUXA 2J4CA 3AM5A 1DEOA 3ONVA 5FBKA 1X38A 2PUHA 5K0ZA 4LC9A 1TEHA 2VP0A 2WQZA 4MUHA 1LCIA 2ASVA 4R2WA 3SOZA 4N41A 4J1NA 2AV6A 2G08A 3GCXA 1KGDA 4MR8B 3SLKA 3UWPA 4ALLA 5IJ9B 1V6AA 4KXXA 2JGIA 1NUSA 2REQA 2DTDA 3DKVA 3EZLA 4LWOA 4YJHB 3SKYA 1V8PA 3LNTA 3R77A 2GUWA 1FFYA 2F3UA 4AT1A 3MBKA 2Y0DA 5DLDA 4BMYA 5SY9A 2IHTA 1QGAA 3WMGA 1VI6A 3PJDA 4Z54A 3BXFA 1YI0A 2WE7A 3ZI7A 1EUYA 2E4VA 4PLYA 5JAUA 2YS7A 3LTEA 3MHTA 4KU4A 1EWVA 3DF7A 2CNBA 1M67A 2H31A 3ESDA 3LUGA 4CV3A 2XE6A 3M1LA 3M49A 4NLLA 4KNWA 2PV0A 1P6QA 1OXUA 2A1IA 2HTFA 1VKNA 4ZHQF 1FY2A 3L0SA 3GVIA 2PUFA 3SSNA 4GI7A 3TLGB 4Q6BA 4GVPA 1RYNA 5AVSA 3GMIA 2FRDA 3M7IA 2C1XA 3QOXA 3T7JA 2G4LA 3G0BA 4R0NA 5EJGA 3UK6A 1EE9A 1SOUA 4UPVA 3FZEA 4D8YA 1KJQA 1NMSA 1OU0A 1MAWA 2EJBA 1J6UA 4FZ5A 4KN8A 5ALQA 3U9LA 4WY8A 5BN4B 4EF6A 4ZJPA 3UWKA 5AVXA 3UXEA 1SBZA 4HADA 5FUQA 2V3WA 3SS9X 2H63A 3CZ4A 4K1XA 4PQYA 5DBGA 3ZCRA 1NVVQ 4BX3A 4MR7A 3GG2A 1UKEA 1GRRA 3Q2KA 3K0HA 4JGBA 1NLMA 1G18A 3ND5A 4O4JA 4RVFA 4V0NA 5DLQC 3TIVA 2P40A 2J46A 4QXAA 2CHFA 3IE2A 1VIVA 4RH1A 1XTSA 3KUCA 1EBBA 1JLLB 3OPXA 5IM4A 3ZJ4A 1TJPB 4NMLA 3ADCA 1QQTA 4U6NA 1DX6A 3BH6A 3P71T 1QPGA 3LPDA 4M3NA 4P81A 2HA3A 1NJ8A 1QGUA 3DLIA 2FWMX 4S12A 2HA5A 1V6CA 2HJRA 3YASA 2YJ3A 4XEHA 4WBSA 4A0FA 4Z86A 3CUYA 4R8SA 3S29A 1TECE 2OB2A 3L8EA 4FDMA 4EWLA 3AU9A 3N6RA 2AJDA 2I9KA 1YASA 3L6OO 2R8RA 1GVHA 2AI2A 3JZFA 5A7HA 3ZXUB 5GINE 4JI0B 5J5CA 1QH1B 4P92A 3EFOB 2YQ4A 3GPDG 1LWNA 4ZYVA 4OHFA 3JD3A 4WL0A 5JWRA 1A2QA 1NY5A 4MUXA 3AVWA 1QIHA 3E8SA 2A5DA 5I7RA 2A59A 4G9GA 2WV7A 3DAYA 2XBLA 3ZGZA 2E4XA 2XUHA 1VHTA 5FBVB 2OZEA 4I5IA 4IDBA 5C8YA 4F2DA 1A5SB 1F8FA 3O8DA 4GDMA 4XZ3A 2W6QA 1GFSA 2NM0A 3DT8A 5FFNA 4ABTA 5TRTA 7ADHA 3GJ5A 2HV9A 1MH1A 1UK6A 1C1DA 2G4VA 2H06A 4QU0A 1PYDA 3QG5A 1H0KA 1GNLA 4MV3A 1DQPA 4EB6A 2ZTSA 1JWAB 1EWQA 1YS7A 1RHKA 1VJDA 1YTLA 2EFJA 3CT6A 2B99A 2FSIA 4WJKB 5GAJA 1T0PA 2HAEA 1UL1X 4MWEA 4QRHA 5JSQA 3IPAA 4Z53A 1QYVA 4R8VA 4IXDA 3ZYCA 5ICGA 2UDPA 5BUSA 1U7UA 3HJHA 4NAVA 5K6RA 2Z2IA 4JKOA 4RK1A 3RWMB 2F8MA 2J3JA 1NC3A 1THTA 3BWCA 1U7DA 1Q11A 4IM7A 3VR6H 1A72A 3DG9A 5JJKA 1JBQA 1T4BA 3BE5A 4XUEA 2F4VB 3ANTA 2UVPB 3AR9A 5BYJA 2ZYAA 5BSTA 3HJCA 5B7GA 2PUDA 2X0FA 4X97A 2YVUA 2CSUA 4CTJA 3CEMA 2QXUA 1NNEA 5C4GB 1YS1X 1ODKA 3TX6A 3WQSB 1I36A 1QF9A 4NOKA 1YE5A 3WLQA 4L85A 1H42A 1MJFA 1Z22A 5AP9A 3NP9A 5LXTF 4ZVUA 1LK0A 4NG5A 1RKBA 4WW0A 5CB4B 5LKAA 1LQ2A 1F5NA 3IXLA 3UHOA 5AKJA 3ROZA 3SIRA 2E49A 1GPNA 2RGNA 5E7JA 4K81B 1GV0A 3V4ZA 1EA7A 3RIGA 5BNWA 3WP1B 4HGQA 3W79A 1ZN7A 2CNLA 1DWPA 4DR1B 4IOJA 4FHDA 3O4JA 5E4YA 3E22A 3TZLA 3QLUC 1QFMA 1FA9A 2J3LA 2O7QA 4OV6B 2WT8A 5HDQA 4ZRDA 4P3YA 4R51A 1HDIA 3W05A 2AK2A 3EUWA 5FTMA 3KTOA 4DA7A 4WH0A 1CUYA 2BFEB 4LX8A 2QSZA 2JRLA 1L5ZA 1H0RA 2GD6A 5DHUA 2XD4A 2PZEA 2AR7A 3DAFA 1BJKA 1FU8A 3UOAB 3IL2A 1K27A 5KSYA 4C2BA 2OV2A 1N3YA 5DBHX 1AKRA 4PZDA 3NBZC 3LUAA 4HWTA 1UJ5A 3CRMA 5KYGA 4TSKA 1SGWA 1ZH6A 3OZVA 4D9GA 3DAGA 4F3KA 4MYUA 4HXGA 1TF5A 3A4NA 4D9HA 2BBWA 2ZI4A 1T4CA 3VU9A 4Z99A 3U2QA 5EZYA 4RK7A 2IOYA 3BHJA 3NANA 2PKEA 4TXMA 4DUZB 1UJNA 2XE8A 4QDOA 1TADA 1W1UA 3EFHA 5DV9A 5EVCA 3TMAA 2IXFA 3W2IA 3HR8A 4WSOA 3V8QA 5C3UA 2B7CA 2JI6A 2QNIA 1YDFA 3MS2A 2VK4A 4D98A 5AUOB 1P9NA 3AR8A 2BDEA 3EDRA 4O08A 4FHZA 4FNGA 2C4UA 1MVOA 4F1KA 4OXQA 1QVWA 2VCHA 4ZCIA 4DV2B 1W30A 1WXHA 3GG9A 4U7GA 4ZVNA 1HYBA 1YGYA 3J80A 2P68A 2JDID 1HDGO 3R3JA 3DPIA 3COSA 3QYPA 3RUEA 4QVGA 1Q19A 5D51S 2XH8A 3MOGA 1VL6A 3OEYA 1AKUA 2TMYA 4OFBA 1MR3F 2GCEA 3C5WP 4G81A 3MINB 3R8XA 1E4VA 1JDBC 2Y0BA 1IN6A 4JASB 4KO8A 4HB0A 2W8BA 4UVEA 1P29A 2G70A 4CI9A 1PJ8A 5A6SA 2Z2KA 3E1SA 5FHRA 5H3HA 4DWWA 2GF9A 2Z08A 3E8XA 1XRLA 1Y9JA 2X5NA 3EDCA 5CLJA 1ZR2A 2G5TA 2QRVB 2BOVA 2ICAA 3PXXA 4ZVQA 1JXAA 4NFSA 4C5CA 2VCEA 4J4TA 2OYCA 2VUIB 4QQ8A 4J6FA 5H4GA 3V5NA 4NHEA 4DBVO 3A1SA 5A0TA 3KVVA 1HRDA 1IY1A 3GLTA 1DI0A 1NWCA 4LWQA 4GPTA 1Z63A 1BYUA 1NXPA 3OMWA 4QOSA 3U48A 2ZDQA 4E51A 4ZANA 4ON9A 5BSVA 1H9AA 3T1QA 2I4IA 1US8A 4ILEA 2YOHA 4PZLA 4UMDA 3J81k 4QNMA 4PGFA 4PR3A 3P2KA 4AVYA 3I6YA 2X7XA 3DWIA 2G5PA 1V4VA 1KO4A 3FKSA 4IXWA 4BNIA 3ISJA 1V47A 2HUNA 2O2XA 3GA5A 3E48A 4D99A 3I2JA 4AMYA 2C4WA 2UV8A 1KU0A 5E0OA 3PQ4A 5TPWB 1JQLB 4YV1A 3H0EA 3DHEA 4Y6OA 3L8YA 4UUOA 1TMYA 1W4LA 3H3FA 2PPLA 3OTOB 1ND5A 1RXWA 1LXCA 4MUFA 2OUKA 1Z5WA 1PZHA 2YHIA 4NZNA 4BFUA 1Z2EA 4JP1A 1NLFA 3AB7A 3LT5A 2WK1A 3LQYA 1Q7BA 5T67A 4AUKA 2GMWA 1TDJA 5ADHA 3QZUA 4Q7LA 4KLAA 4WEOA 2I4OA 3KFLA 1DT5A 2FF5A 2QN9A 2E4ZA 4N01A 4PIPA 5FNZA 3G9UA 3VYRB 5EWMA 2NO0A 3Q8LA 3AZQA 2IZ5A 1P0PA 3G2OA 4YQEA 4ERNA 4Y6LA 3P45A 4P3XA 2I2DA 1MEEA 1IUKA 3ZTTA 3HN2A 4AZ3A 1K2WA 1EINA 4LJLA 1Q21A 1XTVA 2PXXA 3OQJA 1SQ0A 3HYLA 4TUYA 5GGYA 5IUKC 2B7BA 2Q41A 1PJ4A 5IWCA 3A2KA 3DQQA 1OYYA 1Q1EA 3Q5EA 2Q4OA 1BA3A 3VDXA 4DCCA 4BPRA 2IOHA 2MYPA 2J0SA 1H4VB 3KRTA 1SZCA 1YD7A 2QAJA 4I1RA 2FA9A 3O8QB 4LRYA 2E21A 2I4LA 1FRQA 4ALMA 2WVJA 3BGDA 3F3SA 2X6TA 2XQFA 2GEKA 3BZBA 4MX8A 4DLZA 3AL2A 2PBLA 1OYVA 1G20A 1SCBA 2WYHA 4DHEA 3CNQS 5AUPB 5C8ZA 1W36C 5EKUA 1ZRHA 4BFLA 1HO3A 2QR5A 2MINA 2XTNA 4M1SA 4ETMA 1DFGA 1F2DA 1FYXA 3E5NA 3FBTA 3HN7A 3JS5A 3I12A 5F51A 5TX7A 4DARA 1UQTA 1V8ZA 2OEPA 2YZKA 3E0XA 4X1YB 4E12A 4GUAA 2ZVJA 3VZDA 3X1JA 3BOSA 1EM6A 1M33A 1T6XA 4UQPA 3MFYA 4KX5A 2PRKA 1D9XA 4N1AA 3OBIA 3EEOA 4TOIA 2W0SA 1HFJA 3L92A 3Q7PA 4O5AA 1LK7A 3MRSA 4JBYA 1ZN2A 3ZK9A 1R00A 5JTTA 4OLBA 4IVQA 4RY9A 4Q05A 1Q1AA 1XLUA 4X24A 1JVBA 5GM2A 1RZ3A 5THQA 5JLJA 2WHYA 1IM5A 5FAXA 4UUMA 4AJ9A 4IIXA 4TYQA 1ZK1A 5SYMA 5KUTA 1FDTA 3BCSA 3D2LA 4FFVA 1S9DA 4U5XA 4NU8X 2PIAA 2PX8A 2X7JA 5K3FB 4HDKA 4IGKA 2CL5A 4JS0A 1L5YA 1I9CA 1IBMB 2IZ1A 2M1XA 1MQAA 3TR5A 3E7WA 1U8EA 1RJWA 1XBTA 1SUEA 4R8RA 1WKCA 2IRWA 4YJ3A 1MHPA 3TLEA 3VOBA 2ABWA 2AG5A 5E6UA 2R9VA 3PNQA 1QHIA 3N74A 3R6WA 3VGJA 1IOWA 5IJWA 1GTG1 2ZXEA 1AKEA 1ESMA 3E9QA 4IDOA 5LYJA 4R0MA 3PNOA 3RVBA 3HCNA 3G5UA 3M9LA 1YRHA 1P4JA 1Z8NA 3F98A 3F8SA 4KIFA 3L8CA 3FNGA 3LC1O 5H83A 3CUKA 4BKUA 5KTTA 2WWYA 2XMDA 4BV8A 1EG2A 3M6MD 3KD3A 4ZQBA 1YQTA 2Q3EA 4RNCA 4ROSA 5ALKA 3ZDXB 3VPAA 2OA0A 4H7JA 4YPFA 4BZPA 4HUTA 5IBCA 3P2YA 2A9QA 3UXHA 1N9ZA 2UZ4A 5IK2A 3LQQA 1N5IA 5GVRA 1UBRS 1YB2A 3OQIA 3FYCA 4HQRA 2OCPA 1X87A 3BK2A 3KSRA 3O1LA 1JDPA 2Z8XA 2O2JA 2A7XA 1F17A 4MMZB 1COWD 2ZIAA 1XELA 1A5AB 4MVJH 1V43A 2RGXA 1R0YA 2ZVDA 2PNFA 3MAGA 4JZYA 4QEZA 4Q9HA 4C6SA 3LVFO 4DM4A 5HYVA 4MUIA 3DVAB 4CM7A 4HSGA 4JBHA 3B2NA 1DXOA 1W1WA 2ZW9A 3CXRA 2E4YA 5AUQA 2LIPA 3OPVA 4ZVLA 3UAZA 1GGHA 1HOXA 3CWZA 4WKCA 4G65A 3K92A 2JFGA 4TKZA 4EX7A 1AA9A 1XD2B 3RIEA 1GFWA 5BUCA 1KDPA 1PTKA 2SICE 4R8KA 3FIJA 3FFBA 2PMEA 4OY3A 3C43A 3CV3A 3UZUA 3OLZA 3PHHA 2AZXA 4PSKA 2QD4A 3PR2B 1RACA 1T0HB 4U5QA 4ANFA 2LBPA 2QVYX 3NASA 4QXRA 1L5HA 5HHTA 3UJDA 4LSWA 2HSDA 4DIEA 1QIDA 3O84A 2FGKA 3CC8A 4UHFA 3SX2A 2OORA 4FMCB 1BX1A 4YBRA 2YXEA 5DOZA 1BQ3A 3NEPX 2PT7A 1QGZA 1UPAA 1ZJ4A 5EJMA 3FSEA 3GLHE 4LY6A 1KP2A 5ICFA 1CY7A 3DMYA 2BYTA 2UUPA 1EXMA 2H65A 2QK4A 3I09A 5E9WA 1GGKA 4Y2XA 1WXGA 2J0UB 3DOJA 2XE4A 5EIHA 3CJTA 4QJIA 3WYDA 2V4ZA 3GRUA 3X1DA 1K88A 3VR4A 1M8JA 2PD3A 1QIIA 3DB1A 2WNSA 2IL1A 4PQRA 6YASA 3WGQA 4BGIA 3NVDA 3AJRA 3RVQA 1HPLA 5LZ2A 3EUAA 2PLNA 3I6QA 3JVEA 2WVAA 3IPYA 4JB0A 4M0CA 4YT8A 1EKXA 1PKXA 3ROPA 3UGTA 1QIFA 1W5BA 5DM0A 1N6KA 2P7IA 5JS2A 4DBZA 2DJ5A 3CWQA 4B8WA 1NFFA 2ZK7A 5AW2A 1MIOA 3KR1A 3I62A 1XZIA 2BHNA 1DCTA 2PRIA 4PFJA 3RSLA 4BATA 5LP1A 5D1HA 1M5RA 2NVBA 3GH1A 5E3HA 1Z2DA 2GN6A 3PI6A 2PKYX 2PCJA 3JWPA 4KAJA 2ISCA 2WSYB 2XWBF 3CGWA 4TXLA 3I3OA 3CR3C 2YICA 3CF6R 3MOIA 1N2XA 3PNMA 2QJRA 2C83A 1YRBA 2QLBA 4FEAA 4MVXA 4A3SA 1I0ZA 4XB1A 1QZUA 2P9QA 1E3WA 4MWSA 3QKSB 4FT4A 3FOAA 4R40A 3EEQA 1XCJA 4EPWA 4LFBB 3RJZA 2VJNA 3IEIA 5KYXA 4KO4S 2Z8YA 3D6FA 3OIVA 5F4ZA 4DJ5X 4OU4A 4P83A 5C1PA 1KJJA 5LM3A 4XQGA 2JCVA 1Y8RB 1II8A 3HLKA 5BNFA 3H7AA 3GEBA 3HO8A 4KCGA 4YGYA 2HQOA 3GFBA 1QO0A 2DFDA 1VL1A 4KN6A 2P4SA 4G4JA 4TLEA 2QT1A 5BNTA 4WY5A 1BKDR 4A6PA 4LJ4A 1PT8A 2QY9A 3HUFA 2P90A 2AW3A 3ONFA 1IPEA 1TTPB 2VF8A 3ITEA 4UEJA 2M6SA 4JHLA 1LRKA 1RMQA 2R1TA 1WCXA 2Z43A 1G9XA 3C6YA 3PJFA 4LQCA 4M1OA 3VSEA 1XQ1A 4ZGWA 3RS9A 4D2IA 4DVGA 2OXEA 5HS6A 3N6VA 5IVKA 2CMGA 1UWCA 3FGZA 4S2EA 3A7EA 1M1XB 2PL5A 3MW8A 3OI7A 3PICA 1E9AA 4GRIA 2YJGA 4OK3A 4UHKA 5G1PA 5KOJA 2WQ7A 1Z28A 4MWZA 1DWQA 1Y1RA 2C7BA 3PR1A 3OA2A 1JG7A 1ZIDA 2QLMA 4MPJA 5DTIA 5K0JA 3SZOA 4TRNA 2RJNA 4KVZA 4YRGA 1TLTA 4MS3B 1J5PA 1OFIA 2CUKA 3I5XA 1VKZA 2RK4A 1EEHA 4EGCB 1XZLA 4YPOA 1DC3A 2NADA 2D7JA 2OK7A 4FZVA 1JP7A 3TEMA 4G41A 3ZOZA 4Z9FA 3WYAA 4FJ2A 3D2AA 3FMGA 3RNLA 3WRXC 3M6IA 1WF6A 3F4LA 1CK4A 4O59O 5ICCA 2X42A 1SHKA 3K2BA 3IQZA 3FDXA 5L45A 3QYFA 2AF4C 2XJ4A 5JR3A 1FJXA 1XL1A 3QU4A 2EBFX 1REQA 3OEEA 2R84A 3SXJA 1ENZA 2QAGB 2A0XA 5FUMA 3ASYA 4RYDA 4MB0A 1YFKA 2J45A 2OHJA 4KDEA 3WYFA 3NVKI 3JQPA 3WKDA 3S2ZA 2Z6QA 3KZXA 4ZZ1A 1AQNA 2AYYA 1BGXT 1Z0KA 3OFSA 1A5BB 1WU8A 3O82A 1XLWA 1NQOA 3OT1A 4L4YA 1I3NA 2AQKA 2IYZA 2YYSA 5E9AA 1Z5PA 5IC5A 1GD1O 3TLXA 2YXNA 1D07A 1OF1A 3ZU2A 3B9QA 4C01A 2ZJ5A 4A10A 1ZOSA 1SRQA 2O19A 2ZRAA 2Q45A 4ND6A 1E58A 3D59A 2IHZA 3P9IA 3L1HA 1S2LA 1GCOA 1M6WA 3CLSD 4M1TA 5CX1A 4DQKA 2GK4A 2PA3A 4ZK2A 1RJFA 5LQKA 1N3LA 4D8WA 1AGNA 1VLZA 3H11B 2BKVA 1T9BA 3P20A 1C4KA 2CVOA 1ZN9A 4V0MA 5JMOA 4CG3A 5KMGB 4GP7A 4QLBA 3KKNA 3G79A 3TIIA 5KOHB 4ZXPA 1LLCA 1WDMA 3K6JA 4HWRA 1VM6A 2Q6IA 4H3HB 4K6FA 5DBIA 3SCZA 4ESEA 4IOLA 4CETA 4RS4A 3W6NA 4D0SA 4Z0PA 2EG5A 1YRYE 4QBTA 2OLJA 4O2BA 5CIWA 4DG5A 1KMCA 4FGLA 4XTCS 1IAVA 3UW3A 4BWVA 4IIDA 4X5OA 3SG0A 3EG9A 1KOLA 1BX0A 1W0JD 3LL7A 2H5JA 3D7NA 4YAOA 3QVUA 1Z25A 3LP5A 2VQ3A 5DVZA 1N78A 1E1QA 2YKGA 2YWHA 4KDFA 4OJYA 2CBXA 2P8JA 1ZJZA 3A6ZA 1J70A 2BKUA 4HNAA 1ZGGA 3CTMA 1IXYA 4PEVA 3FTPA 1RLJA 1T2UA 4Z4FA 1GZUA 1M5UA 1AS0A 3LX4A 2N3ZA 3VPFA 3DGFC 2PJUA 2AG0A 3EMBA 4X20A 1L1EA 3TLCA 1U9JA 3MUOA 3NVMB 1K66A 2BGKA 3IP9A 3NXKA 2FAXA 3RRZA 3KEFA 3NETA 1L2TA 3BGOS 1NRWA 4DDHA 4GPBA 3L4EA 3GJYA 1KKMA 3PE6A 3DEAA 1RI2A 3PEYA 2Y6UA 3PC7A 1RW4A 4L57A 3HVIA 5FBWB 4AJEA 5JD4A 3RRYA 3NHLA 2ZS9A 3KWJA 1LS6A 2HF8A 4GH5A 4J03A 5KPJA 3MMPA 3EXEA 5BYKA 4K3VA 4GMKA 2Z83A 3ZDCA 1SAYA 1Z4QA 4FKBA 3WLFA 3RANA 4KFCA 4EDHA 1CUUA 4QDJA 2D2VA 2IXEA 2MSDB 3AILA 3OETA 4D96A 5JDCA 1J7KA 3CW8X 1XXLA 4JENA 4OJNA 4KAFA 2C82A 2WM8A 1VSTA 1Y1QA 1X3SA 2XYQA 2ZR8A 4EDFA 2FZ5A 1J97A 1Y3HA 3S55A 1CZLA 1T1SA 1W29A 2PMCA 1BDJA 1UFKA 5LOVA 4KHPB 3ZBTA 2HRBA 4Q4HA 4QQKA 4CF3A 4P93A 1BJTA 4WFKA 5C5EA 3GJ0A 3ECSA 4FSDA 1TM5E 3AIOA 3O3NB 2JFVA 4N7BA 5CPBA 4EKDA 1CUBA 1K9SA 4UFOA 1DZ3A 1YZUA 3NTQA 1RDFA 1IXZA 4BBZA 4DMHA 1NE7A 4TS4A 3LPLA 1CR6A 4IZOA 5CBKA 4WK4B 4KN9S 3B36A 1MQ9A 3K16A 3RU9A 1G8JA 4MUJA 1F4PA 3FRHA 4UUBA 2IDMA 1EHYA 3KOMA 3ZKWB 4ENRA 5CA0B 2YZGA 2NU7B 2VSYA 4MIYA 5F76A 2R4TA 2A9RA 3UXMA 2DEUA 1XRRA 1O58A 2EL9A 4PVDA 1NVUQ 2I8AA 4INZA 1P7YA 1S1MA 1H1LA 1S2IA 2G0TA 3F7OA 4TKVB 5DHAA 3T3OA 3FAKA 2F3QA 4JLDA 3PFIA 4N5NA 3P2IA 1GQRA 1LLUA 1MJGA 3QVTA 2REBA 2D5CA 2Y66A 4EEXA 3BZWA 3KDAA 3G0GA 4QM7A 2ZBQA 2ISQA 3ZPXA 4OB8A 1RAFA 5CXXA 4IJVA 3REFA 1CZRA 5FBRB 3E23A 1NW9B 1GYQA 2VQDA 4QUHA 4RD3A 5DIZA 2DFPA 2X5KO 4NEQA 1VSUA 5A0VA 4LYFA 4P4LA 4KDRA 5E38A 3LPCA 4CDGA 2XUZA 4CT5A 3K2QA 4M98A 1NJ1A 1OWPA 3KXIA 5KJ1A 2G1KA 3FY4A 5A5EA 4BX9A 3WLOA 5TEVA 5A9TA 2BKEA 1EX1A 3PD0A 4FVTA 4QLAA 1GSIA 1XQWA 5ENZA 3TRKA 3F2IA 1MJGM 3ZD8A 1AHHA 1UBTS 3IGFA 2C7QA 1VI2A 5JS8A 2R1VB 1K7FB 5EE5B 2O05A 1PFUA 2GCPA 2IUFA 2Q3LA 1Y4AE 2V74B 1P5RA 4L4XA 4JJGA 2JVIA 3QKRA 3MTIA 1XCLA 2BFDB 1DIHA 4LHVA 5EUMA 4RTQA 4XKJA 1NRIA 2GBFA 3OKAA 1K8ZB 2WG1A 2AB0A 3L8ZA 2E5FA 1TCVA 4ZIRB 1H2RS 1UMCA 1XEFA 1LI4A 2VAXA 5TT1A 4ITRC 3A04A 3REGA 2H2AA 2BFNA 2ONZA 3SQMA 3T3DA 5CM9C 4B3TB 4QJ3A 5DYNA 3NHRA 1XU9A 1QAMA 5KC9A 3RS2A 1YHYA 4TLLB 2H5LA 1DAPA 1R5NA 4OGWA 4LJRA 2IYVA 2L69A 2WRZA 2ADMA 3K0CA 3O8CA 1H65A 1NVFA 2Y27A 5DLYA 5G4KA 4A36A 3OZXA 1MIHA 2OGUA 2ASEA 1QTRA 2PLAA 3P52A 4HPJB 3HU3A 4IUCS 1TKCA 4PS1A 3THOA 3ZWNA 3OZCA 5AR1A 3T1YB 3PPVA 4TM8A 2O7SA 1BXGA 1YMVA 5KDOA 1RI1A 2VRNA 4C29A 4KXYA 1E1KA 1D1SA 5JJIA 1J0AA 1KSJA 3KZCA 5FA5A 4BVFA 4BNXA 1I2AA 2QDKA 4AJLA 3CU5A 4PHHA 1K92A 1TB4A 1U6IA 2GXQA 2H00A 1CW2B 1W5SA 2HK8A 2RKWA 1E2MA 1FPMA 2RC5A 5BXQC 1Z74A 4RA9B 1RP1A 4Y9TA 1W47A 3JQ8A 3HYCA 3QVJA 4OH1A 1EBUA 1R8YA 2JZNA 1NJ2A 1WF3A 5FB3A 3WDLA 4PRZA 1WCV1 1JA9A 5KJ6A 3C4QA 2EEZA 3NEJA 1I4TD 1T9DA 4GZ3A 4PICA 2I29A 3V1KA 2FJ0A 1IB6A 5KWVA 4Y2YA 5CCBA 3WWYA 2CDRA 1JJAA 2RKBA 2IU0A 4I5GA 4JCOA 4NARA 3FKSD 4WNCA 2Z5LA 3QF4A 3KQKA 1NVWQ 1BJRE 4URZR 3H6HA 3CNBA 4URVR 4YJ2A 2VJLA 1XZJA 3CEHA 3GEPA 2E7ZA 1X1AA 4Q3DA 3EPRA 3E3AA 3LQKA 2ZT6A 1BG6A 1GPUA 4M4SA 1H2AS 3AX6A 4KR9A 5BR8B 3I5AA 2A9PA 1FFDA 3Q7EA 2DE0X 1T36A 2IEYA 1ICEA 3EDQA 2HDOA 3B9PA 1WWKA 1U0BB 1KWGA 3FI0A 5FR1A 3HP4A 4IS3A 4UD2A 4IUDS 4IGFA 5DWVA 4B8YA 3KJZA 1X1DA 4N39A 4BJ3A 3T3MB 3C3WA 6ADHA 3BB4A 4JA0A 1MDFA 3ORHA 3I64A 3CZAA 3ZLVA 2QSUA 2V54A 3NM5A 4IHJF 3NDRA 6REQB 2VYNA 1SWWA 1WE2A 4RPIA 2OLEA 4GBGA 2VF2A 5KQGA 3UWMA 1G8HA 1M34B 4CCSA 1V1MB 2JCSA 2VP9A 5E1MA 5B2FA 5JRZA 2XXAA 2HCRA 2O8DB 2IYUA 3AERB 1HOTA 1QHYA 5I7WA 3TDKA 2XPCA 3NV7A 1F3LA 4YRQA 2GYWA 1P9WA 3TL6A 2A9FA 3IDQA 2QGNA 3JASB 5E4JA 2NQ2C 421PA 1FX0A 3GD7A 5F9MA 1LTKA 3EVZA 2IH5A 1XO1A 1VP9A 1YBHA 4OHYA 1FVXA 1FMTA 1R4NA 2E4WA 1C8LA 2W2KA 5ALZA 5ELLA 5IEBA 4DWJA 3UJCA 1EG7A 4JKIA 4UU1A 2Y9PB 3NTOA 5HF8A 5NLLA 5A5FA 1EDBA 2XQKA 5DLPA 1VE7A 5H70A 4NV3A 4WKOA 5J63A 3V1UA 1I01A 4ETWA 4MQUA 2VBGA 1PDOA 5T64A 3ZEAA 4Q34A 4RH0A 3RS4A 3W5UA 4ALJA 4WVLA 5HM6A 1GCGA 4BQIA 3MGAA 3MJEA 5C80A 5K8JB 5CG1A 4O29A 1TVCA 1VKJA 1Z0UA 2FPLA 4B5LA 1JSZA 1V9CA 3R1IA 1SZDA 1LRJA 1P2SA 2PKRA 2Q5QA 4QUKA 4NQZA 1NR1A 3OQ6A 5CP8A 1I10A 2MOKA 1DQYA 3P0JA 4WOJA 3VPDA 3SZ3A 3EQ9A 4HPXB 3LA6A 4PLCA 1PR5A 1PWYE 3RS0A 5CHYA 2A35A 5F5NA 2QR3A 4HNSA 4J2HA 4KR2A 1MKYA 1DVRA 1CY1A 3ZC3A 2QENA 3TQHA 1W35A 1N57A 4BDTA 1DPFA 3P9YA 5EN4A 5A9RA 5IT5A 2HT6A 1WXWA 1BVHA 2IOFA 3HH8A 1ZL2A 3WIEA 3AW9A 2QU7A 4UUPA 4EY4A 3NFYA 1ENYA 1YNSA 3BX1A 3PEUA 1H4SA 2H29A 4Z1MA 1EVYA 2N46A 3JQCA 1JJIA 3GAZA 3K9CA 2ZYWX 2PNJA 2F17A 5F33A 1QU2A 2QTTA 3K53A 1Y5LA 4BS9A 2OD7A 4YJGA 1Q17A 2I4TA 2H5IA 3DNPA 2R79A 2ZYDA 1TVMA 2IYYA 4FJ0A 1A4IA 3WGVA 1ADYA 4GGOA 3GEMA 2XECA 1TZCA 3OHPA 1F6WA 3IEUA 3C1UA 3HV2A 1H2WA 1GQOA 1XF9A 1NVXQ 4L1KA 3T3HA 4D6XA 3ROKA 1AUOA 1HL7A 2B78A 2JGKA 2CL0X 2CXQA 1LRLA 2FETA 3NCHA 2LR0A 2Y1EA 4JC8A 4RTJA 1TX4B 4M60A 4B81A 5BUZA 4QD3A 4WBNA 4QPPA 2ZUWA 5FRDA 1ETUA 3GYBA 4QEDA 1G6KA 1QDUA 1X19A 2C57A 5J47A 3GRRA 3H9QA 2ZQZA 3WBFA 2VVTA 1LBIA 3AG5A 4OHMA 4QYXA 1N2JA 2VF4X 3FOBA 4IUYA 3TSWA 4FB5A 2ORED 1Y8AA 4E46A 4RKWA 1L6IA 1BFDA 2TYSB 1KSGA 3KBOA 1CV2A 2AR0A 2W90A 1G8PA 3WNVA 4ARZA 3ZZ1A 1T0UA 1EGAA 1NAIA 2PBZA 2BFCA 2VP3A 3C15C 3HRHA 1E9BA 3LO5A 4FYVA 4TMTA 4J4BA 3TK1A 1CS4C 4BX8A 4BGUA 3O8BA 3FYHA 3B85A 1VL0A 3H8VA 2BEVA 3M6LA 5JHHB 1MDBA 3M33A 4GYJA 5CB6A 5FLXA 1LDGA 2HMUA 1Q15A 2PQ2A 2Q2QA 1JDJA 1ZI8A 2EDCA 4MEJA 1OXXK 3D0QA 1TTTA 3CKYA 1Q1BA 5E2BA 1W49A 3B6MA 3DOOA 3U5TA 1TK2A 5EPUA 2V3VA 2PO5A 5BOVA 1PR6A 1FZTA 3VR4D 1QIMA 2R7MA 2VCYA 4UTOA 4HN4B 2TMKA 4JQSA 5T3YA 5TJ9A 2QN7A 6CHYA 2JW5A 5EJ4A 4KIWA 2R60A 3D8NA 3JD2A 3EGDA 4TQAA 1WCIA 2J5BA 5CB8A 1JZQA 1FSZA 2B5VA 2KWIA 2WYUA 5L7YA 1JEOA 1CJVC 3M70A 3OMXA 3H5TA 1B73A 5JVDB 1H4TA 1GPKA 1ZMXA 5AICA 5ALGA 4Z0TA 5AVVA 2EEPA 3KO8A 4WE3A 1GKYA 1P2TA 1P33A 1PNOA 4HH0A 1CHDA 3I8OA 4N54A 3L1VA 4XQ0A 1GT91 4QSHA 5TEWA 3RYCA 4TMWA 4HEQA 3OWHA 1MMFB 1O1YA 3DMHA 3P2OA 1P1CA 4O8ZA 4KFSA 3KD2A 2B4AA 1E98A 1H0SA 1EMDA 1OU4A 2Y1XA 3BTUA 4BLTA 1EVKA 4RJ2A 4E11A 2PANA 4U2GA 1Y3DE 3KPUA 3CG0A 4ML3A 1NJSA 4ARSA 2J09A 2GPYA 1QC5A 5JXWA 3I1IA 5TQ0B 5DMXA 3PXAA 1CUCA 4CM1A 4UNRA 3N0WA 2GRAA 5GONB 4DMLA 3L8HA 1CJSA 2CVZA 1GZDA 2FX2A 3M6UA 4BO9A 4DM3A 2X19A 1PWZA 4WX2B 3GRZA 2OKCA 1QPBA 1SHJA 2ZIEA 3H2KA 4M7WA 3TPFA 4WNYA 1JDBB 2CHUA 2PGDA 1UAYA 3AT1A 1DV1A 2QMUA 1CQXA 4HCJA 1QYIA 1VP3A 2BN4A 3L8GA 4WMLA 2OO5A 3BTVA 2PM8A 4W63A 4Y9DA 4CZ2A 2CFSA 3KUXA 4DL9A 4Y9UA 3TM5A 4C06A 1CRPA 3MWYW 4ZEMA 1QVAA 3M1AA 5KCZA 1QG6A 3DVSX 2DFVA 1RPTA 4HLNA 4LYGA 3GEIA 1CF2O 3KOYA 5EEHA 3OOJA 4L8YA 4M37A 2ZJZA 3NYQA 5ICEA 4OL9A 4FKZA 4FYKA 1I7SB 1SPBS 3L7AA 4UUNA 1KYZA 3KPYA 3NG1A 4L5AA 1JJVA 3T95A 4MULA 3SJUA 1ZU4A 1XF1A 3QUAA 2XNCA 4WXPA 3PDIA 1Z08A 3B3FA 4ZOLA 3OIGA 4N3GA 1KQOA 1KZYC 5EGSA 3DD5A 1EIZA 2QM3A 3IQHX 4K2HA 4X3OA 4XJSA 4KRXA 1JDZA 1NT2A 1DL5A 4HB2A 2V7XA 3C6ZA 3THWB 1JAHA 1YOVB 1NKSA 1AUQA 5BN3B 1F0NA 2ERYA 2BI4A 4N5MA 1JPNA 2NLOA 3NPAA 4JEUA 4TV8A 5TPZA 2Y8EA 4LPSA 5ALRA 2AN4A 3TW0A 3HXPA 3LYUA 5LP6C 2WSIA 3TKLA 3NLLA 3UFBA 2FK7A 4V2IA 4F9EA 1QHFA 2JJYA 3F78A 1OXMA 4ZJYA 2WAMA 4G8BA 5AJVB 4AMGA 1X13A 4W99A 5EIBC 4ZV4A 5AW3A 2O2GA 5KYVA 3BD9A 4IJ6A 3LUCA 2E89A 1SC3A 2WZCA 2X8JB 3PVCA 4K8OA 4BNYA 4MVCA 4AY3A 4CF6A 5KSZA 4R3NA 1ZM9A 2ZRMA 1CY4A 3GCZA 5DHQA 3OEED 5CDFE 4Y2JA 3L4KA 4XUDA 1RRKA 4KLZA 2LGJA 5U4QA 5LLSA 4L6IA 1KMNA 2IGBA 2XB9A 2WVGA 4ZJUA 3T5TA 2I6SA 2XMSA 4BVGA 4P33A 4UTZA 3UJ8A 3UUFA 4BRWA 1SK9A 2C5FA 1ZD8A 4Q21A 3RUAA 3GR6A 4R3WA 3W5AA 2VRBA 4FE7A 4QU8A 1ZH4A 4TWIA 3QVGA 3QJGA 3PHJA 4NCJA 4ZI5A 3UK2A 3ZJVA 2VZEA 1Y1LA 3RARA 2R6JA 3B20A 1OH6A 4LE0A 2VSFA 1XCMA 4N6NA 2OWDA 2WJAA 2XZTA 4KKVA 1M1ZA 3D3KA 4KUEA 3MT9A 4LXIA 4B73A 5KYYB 1R15A 1ULZA 3E05A 3GVCA 1CNMA 5C35A 1W36B 4R3UC 2XWSA 1U3TA 3MSCA 1PE0A 3HO1A 2WR8A 1RPAA 3ZE6A 4HNVA 5CB4F 3AM1A 3LQ1A 4HDCA 3X3HA 3ZBQA 3CW9A 5L53A 5I47A 3IAHA 1HEYA 1OXKB 2AOXA 2WZBA 1N5LA 2ZR0A 1YB1A 4J1TC 1HE5A 3LCJA 4R1PA 3VH2A 1GQ2A 1N5MA 3DFMA 5A3VA 4PZZA 3WWCA 1J2UA 1RRFA 3D31A 5FA8A 4MROA 1JA1A 1XTKA 5TT0A 5KVVA 3E2PA 3ZQUA 2VQEB 4JBWA 3LLCA 1QTIA 2QLLA 4PNHA 2IV7A 3UA3A 2O8BA 2VJMA 3DPSA 3EVDA 3DXZA 3NTLA 1XN1A 2LCFA 4FC7A 1E1QD 3VU3A 2GLXA 1ECFA 2WJVA 5KO2A 2JAUA 1GNPA 4ZVRA 1KEZA 1WVIA 3P19A 1TYAE 4LG1A 4NBLA 4GZLA 5F7OA 2GB4A 3IBYA 5A05A 1ZGJA 2AFRA 3NBFA 3VNSA 1HG0A 1PD0A 2D6FA 4QTXA 3E9EA 2VJYA 3MTGA 1ELOA 4OU5A 2HMWA 1DKQA 3ZE1B 1XPJA 2VAPA 5K3CA 3BERA 1IHDA 1TQ6A 2OE2A 4MXDA 1IBLB 2CJFA 1BWSA 4G5HA 3EZ9A 1TZKA 4C7JA 3EWNA 1VPDA 3WLAA 4L6AA 3P32A 3UPUA 2BONA 1RPNA 1E1CA 2Z5FA 4DB2A 2R5WA 3RYIA 1FPQA 3ZNQA 1GA6A 2PHZA 2TECE 1J8VA 5ELMA 1IJEA 2C9DA 1VMEA 2B21A 1POXA 5K0NA 3GOQA 5HUHA 1RM0A 2FWBA 3VTZA 5FLKA 3UMSA 2AOTA 3WV5A 1ONBA 2HXSA 3IQWA 3JQ7A 7AT1A 1WKVA 3OOEA 4BQEA 2FPOA 2XYHA 2HD4A 1KDYA 5AW4A 4J75A 4IZIA 4OB6A 3CLTD 4TTQA 1VGRA 3LP6A 4MVJF 3WDSA 4G5FA 4PSUA 5ETJA 1IIRA 3PXUA 1CUHA 5GJWC 4CL0A 3S2EA 4PHCA 3RC1A 1RRGA 2IYXA 5IUNC 3QEOA 4F7DA 1YAHA 3D02A 2NVUB 2HR1A 1N32B 1PUJA 4HUQA 3WO1A 4YJFA 2OPBA 1G8FA 1M6HA 3M3DA 5KNCH 3SHTA 4ZMRA 4MEBA 4ZYWA 2HL6A 1IQ0A 3IEKA 3MYRA 1JVNA 3UV3A 1Y8QB 3R4VA 3T8YA 4ABYA 3LYLA 5L40A 1EESA 4AURA 1NP7A 1LPSA 1TQHA 4JJ6A 1YKGA 2W2XA 2B8WA 3U62A 2E4UA 5ERXA 3P4YA 2CVPA 2PXAA 1WPXA 1Z7EA 3EH1A 1AXRA 5K0SA 2Q8NA 4MYDA 4YXWD 1L4MA 3GD5A 2BSAA 3BGWA 1M8FA 1WMEA 4JJ7A 1CUFA 1DAFA 1U6JA 1ZNQO 2YUIA 2AUNA 1WDWB 4OFZA 5F5LA 4GQAA 2JGLA 5BMOA 4RDCA 1KJWA 2FZWA 4ZOAA 3FLEA 4TT3A 4ZPXA 4UW9A 5CFOA 2VDPB 3PQ8A 3B1KA 2CLFB 3FNIA 1H93A 2BIFA 1LPNA 4IH4A 3EIWA 4G25A 1XG5A 4EHLA 1T5SA 4I50B 5F98A 1V35A 2DT8A 1U2GA 1L4BA 1U28C 3CCBA 1RXIA 1Y6RA 5HEKA 2PGXA 4II2A 3KJIA 4ZO8A 3RUPA 4CR6A 3PDCA 1DTWB 3GFSA 1HE1C 1Z9BA 4TTAA 4NCNA 4ZU6X 5GY7A 5L9AA 1KOGA 2YIMA 2ZPUA 1YL5A 3HJUA 3SGLA 4B4VA 4ILKA 3D4LA 1A9OA 1QSGA 4GC9A 4JSRA 3VR5H 1CERA 2X7HA 3BDAA 5BN1A 4HQFA 5CJPA 4H3KB 3FOZA 2D4AA 1CYDA 5FJIA 3WBKA 2XRFA 3HXKA 4WESA 2Q3JA 1K7CA 2FMUA 1MRZA 1QKJA 4OCZA 1KHHA 5FLYA 3O2QB 1EK6A 4UDYX 3MD0A 3JWGA 1PL0A 4B74A 2DULA 2L18A 2IX9A 3E58A 3BMOB 4I5DA 3GJSA 5LZ4A 2V0NA 5FTWA 5KYWA 3URMA 4F86A 3QBDA 3NQ41 4NZOA 2QXYA 3WGKA 1CU1A 4Q4JA 1I8TA 1VIDA 3WIOA 1R6VA 4EI2A 3DBVO 1FP1D 3RAPR 5IJAA 5DGDA 2CXTA 4GOLD 3UOWA 1B00A 1OPXA 2C88A 3ZXXA 5JSZB 4F4FA 1NVVR 1QNFA 4CTOA 3A32A 1EX7A 2HSJA 2LWIA 2WAOA 3ASUA 5F3WB 1P2DA 4FIZA 4YRJA 5EIAA 4I4TA 4WZBA 1UKCA 3CINA 3Q4GA 1SFRA 3RPEA 3AP3A 1AZWA 2P6PA 3LGXA 1G21A 1XWFA 2CT8A 5I4CA 1L5FA 3VO8A 3RG2A 3BMNA 5G1NA 3QA3E 4BE9A 1ZK0A 4I5FA 1U1GA 2ZI9A 4E31A 2O0KA 3BM5A 4F3NA 1CUSA 2BUBA 4BUJA 1VBFA 2V6BA 3PZBA 3W04A 5ABPA 3ZVKA 5T4EA 4KQJA 4OP2A 4NRDA 2EQAA 2ISSD 4Q66C 4L9WA 2DETA 1QOQB 3K6KA 1DX9A 1O9HA 2ZYGA 4AYXA 5BVGB 2IXBA 4MV6A 2JK1A 4P7FA 3CSSA 5EYPA 4NJMA 4UHJA 3FWNA 2QRJA 1OVMA 4XB6B 1NMQA 2Q4TA 3CVOA 1RYYA 2PSDA 3VVCA 2X13A 1DTEA 3GFQA 4OSPA 2QSYA 1VE6A 1C30A 4HI0E 1NI4B 1C4OA 4LOHA 4IQGA 3HDQA 3COZA 4J0HA 3WYCA 5HF5A 5AI6A 5DP1A 4M7PA 4HFJA 4BMZA 3EZNA 3T4UA 4A73A 1AV7A 3HA5A 3D8UA 4K9QA 2FEAA 4OQQA 4YR7A 1GAXA 4ARIA 1KYVA 2ECPA 4BCCA 3FOCA 5AOAA 1OILA 3F7TA 3Q3EA 1KVUA 1MF7A 1BW9B 2MSCB 1XCGB 2BEWA 3O1JC 1KIMA 1YRLA 4RS3A 1WY7A 4B2PA 4B46A 4HGOA 2IT1A 3KQUA 4TS9A 1RWPA 4RF4A 5K3SA 1NRJB 1OZFA 4WZAB 8OHMA 4JN6B 3CKKA 1V9LA 5JASA 1OI4A 1NXWA 3IDAA 1G9SA 1RWBA 2XVAA 4K6KA 4EQ6A 1OH5A 4Y0NA 5DCYA 3ICCA 1XMJA 3ZE2B 4ED9A 5DXFA 5DM4A 5DSXA 5KQMA 2PWPA 4YCNA 4FR2A 1KORA 5E7MA 1U7OA 4FEGA 4GBJA 4K9KA 5IJ0B 1HE4A 1AX9A 2NUTB 3JQ9A 1B26A 2VBIA 4TTJA 2VYND 2Y6VA 1QB8A 2B25A 2ZB7A 4H27A 4YRFA 1D2EA 3KLBA 3RG8A 1XDUA 1KF0A 3B7PA 4JEHA 3SZUA 3RRXA 4UVHA 5JXGA 4RA6A 5I48A 1Q16A 3FUTA 4OQYA 1Q0SA 1XZKA 4H6VA 4OQPA 3LQ4A 1SC4A 1GLNA 2EJTA 2HK7A 3AKDA 3V46A 1PHRA 1RLOA 1XKLA 3ANLA 2ID9A 1AQYA 3H1TA 2POQX 2AZDA 2YZNA 1LZKA 3K1AB 4OHRA 4UE6A 1Q92A 3CISA 1R37A 4F5DA 5B1YA 2OO3A 3MLAA 3A7DA 1QX3A 2VNKA 1JG2A 4OYYA 2ZWOA 1RQ7A 2A9OA 5K03A 4BE4A 4FMCF 1C80A 2W43A 4MDHA 3D3WA 1VJ0A 2D0IA 3HZHA 1KTIA 4P4GA 1T1JA 1VKRA 2YYZA 3EEYA 4QBKA 2J41A 4UNPA 4CL8A 1GLGA 5KTOA 3GJZA 1Q3TA 4C08A 2A1TR 3EXG1 3ND9A 1TUBB 3H1GA 4YH1A 4QGGA 5LIPA 4J9VA 3D0OA 3A6PC 2VSQA 4RGBA 4KR0A 4BV3A 4US2R 5K8LA 4S1OA 3LDGA 5C7IO 1ODIA 1MO3A 4PVCA 4ZT6A 2EKLA 1Z4OA 5I9NA 1VRCA 4PC1A 1IM8A 1WV1A 4M1MA 5ITVA 2ECOA 4IWYA 3LKZA 2C59A 2I7CA 3O9MA 4FDUA 1EB9A 4DSZA 3I0NA 1XGKA 4HVTA 1YIOA 2ZRJA 4ZQHA 3MB5A 2OBMA 2R6R1 1SNYA 4QOJA 2IV2X 3W9BA 4RHCA 3ER6A 1UKAA 2IH4A 5SZJA 1IPHA 4WUVA 4LNUA 4ZEXA 4AZ0B 1B4DA 3QHPA 3X1MA 2PX5A 4BMNA 4P4SB 1PFVA 3BHIA 2GJKA 4A16A 1MZVA 5IRCD 4E3ZA 1PJSA 1O94C 3CEJA 3GVHA 2UXBB 3BQ9A 4PLFA 5BVHA 4TTTS 1GTZA 1N2HA 4KYVA 2YXLA 4EUKA 2BCJQ 2H2GA 3A4VA 2AJTA 3OURA 4URYR 3GT4A 4OOFA 5KU1A 5JATA 1CZUA 2HO5A 3AG6A 5D6OA 4NU6A 1NY6A 4Z1MD 5KNLA 3EHEA 1DEXA 2G83A 5J5AA 1MC1A 1XQXA 1EZ1A 4X00A 5EESA 3MT0A 1OY1A 3KZ1E 4O2AB 3LY8A 1C3OB 4Y1GA 1PQYA 4Y8VA 3IEVA 2ERCA 1CUGA 4Q03A 4ZCTA 5EAIA 3JQRA 4AZVA 5BQXA 1SCIA 2IS4A 1I2BA 1GAQA 1XIVA 3TRJA 2HJGA 3JARA 1L7EA 2A92A 3NGMA 2Q0SA 2VS1A 1RSZA 2GM9A 4PCAA 3U09A 2FZLA 4J7UA 1Q3KA 4KW7A 1TAUA 1U0JA 3GW8A 3RFVA 2MTBA 4KR3A 4A1FA 2RGUA 1VPWA 2CXNA 3U3XA 2Q9BA 1EFVA 4DR6B 4FIDA 3A9WA 1VSVA 1LLFA 5JARA 3H9EO 1T5DX 1MX3A 1YNOA 1I0LA 4EB3A 1HZZA 3DDUA 5FL7D 4BNWA 3FB4A 3ICQB 2GO1A 3DEYX 1T5IA 4TMYA 4G5YA 1VSQA 1B6GA 1JEEA 4MKGA 3E5MA 2GN4A 3PSHA 1DKLA 1XHLA 1DDOA 3A14A 1OIVA 2QMOA 4NAHA 1GR0A 2Z9CA 1UM9B 4UAVA 3UK7A 4EYOA 3ER8A 4DLBA 2RH8A 3P27A 4I99A 3H0KA 3UB4A 4ENPA 5AM2A 1UC5B 1X39A 1RE0A 2GBGA 4LDAA 2NTNA 3T3NA 1H8EA 4PRYA 4C4RA 3AFGA 4N65A 2AR9A 1WD5A 2A67A 4WBXC 2V7WA 4MQ6A 1EXNA 1UMDB 2ZRLA 3VSBA 2CJWB 1NDUA 1N7IA 4H6PA 3RH0A 4EL5A 1RJDA 1LC3A 1ZMRA 5AKGA 3LHFA 4EI9A 1M7BA 1YFJA 4TQUS 2OXFA 4TSRA 1XFDA 1FP2A 2I3ZA 1Z8HA 2GYVA 2WP8J 2ZE7A 2HQRA 3PIRA 5B4TA 3O75A 1Z0IA 1GU0A 4P4NA 3IDOA 3JZAA 4DRXA 2VN8A 2B82A 4LGCA 3MEQA 2B36A 2BISA 2KM1A 5ALXA 4HZUA 4ZDWA 1L5RA 4GYYA 5FWYB 2WD7B 2BHLA 1J20A 2LW7A 4IYRA 4PF1A 1NVGA 1TT5B 1V96A 1XJ0A 2ZB8A 1HG1A 3WISA 4E5YA 1GYRA 2ZSDA 4XGQA 1OFUX 3GNSA 3P26A 1CF4A 4YAJA 5DTQA 3VOTA 1U3DA 4CN9A 4ENVA 1SOVA 1SOMA 3NO4A 4Z4EA 4OXNA 5CX4A 1FYFA 4BEVA 4DY4A 1MA3A 1V37A 2BMDA 3D6VA 4IIGA 4AX8A 2H1WA 5EE0A 2QZJA 5K99A 5JHGB 3TR6A 3CSUA 3CLUD 3COYA 4MP3A 3ZCSA 1LDNA 1QK5A 2VHVA 2BGIA 3FDIA 3G6KA 3QFSA 3OD1A 4IDFA 4O4LA 1MENA 3IJ5A 1I7PA 4PLWA 1Q22A 2FG6C 3U7IA 4BN0A 3IHTA 5JQWA 3ISVA 1SQGA 1WXFA 4KLNA 4L8VA 3WK4A 2Z2YA 1XNQB 2OPHA 3VYWA 3PKJA 3RRBA 2D1QA 5H59A 1EIWA 5JLAA 1GHTA 821PA 4HN2A 4H1UA 4BVJA 3OUTA 1FDVA 3FUXA 1WW3A 5FYQA 1JN0A 3WMXA 2BGGA 3W78A 3Q7TA 1ZAKA 3INRA 4NNPA 5EKDA 3A10A 1WW2A 1IXSB 2VYCA 2B4QA 4P0TA 1QLWA 1WZUA 3KKZA 4Q3AA 1P4AA 4RACA 3U26A 5LBUA 2J6CA 4I46A 4BNDB 4D81A 5JV5A 1D6MA 1TK9A 3PJGA 5KNDD 2BP7A 4ZMSA 3CUEF 1P4HA 2FR8C 3DZHA 4Z7JA 1HNWB 3ZZNA 2EQ5A 3H6KA 5EIFA 1MOPA 3O9VA 2A0YA 3WLRA 3T6KA 1AURA 3RIYA 1KYTA 1G59A 1VE1A 3AUSA 4EA9A 2XA9A 2GN8A 5H82A 4CEJB 4FLEA 4KIUA 2HU2A 5JD5A 3HI4A 3KYIB 3QXHA 4JNKA 5KZMB 3O4RA 4KQXA 1RBZA 1KRXA 2IPAB 4H16A 5AT1A 1RM5A 1ZRSA 2GAIA 1EFRA 2FFRA 2NX2A 4P82A 1WPGA 3B3GA 3T1TA 1Z4JA 4ROTA 2NYRA 4EQZA 5L6LB 2OMEA 3KE9A 2R7KA 4FUTA 4DDWA 3RVPA 1CG6A 3F5DA 1FP7A 1B74A 3R76A 4PWYA 3L41A 3U37A 1SELA 3AK4A 3BICA 2UUAB 1Y6JA 3B8EA 2GXAA 4MPRA 4AN4A 1GU1A 1EFUA 4YLGA 1EAMA 1VSBA 3RS5A 1C7IA 1BXKA 4BZXA 4Z51A 2QMYA 4C6TB 5F78A 4L5JA 3AC0A 1MRNA 4CMBA 3VNRA 1CVIA 4NS1A 3RUIA 2PDAA 4CL3A 3LHDA 3MWGA 1E6MA 1V16B 2H17A 2M6LA 5B4UA 1PHPA 4OTZA 2N9UA 2ZSKA 5BYBA 3MJHA 3CIOA 2IF2A 3GCDA 5TPZD 1J22A 4JDPA 3WGLA 2E82A 4MUEA 1Z5GA 1L3CA 5ER6A 5IKPA 1C7EA 1R64A 4FFRA 4R8LA 2FPMA 4O2RA 5GGXA 3ITDA 3ZHCA 1P9RA 2X0NA 4J43A 4K86A 5D7NA 1PYGA 4DLUA 1RWQA 4MMYB 4WEQA 1UXIA 1PSDA 1I1OA 2VSOA 1I14A 4BWGA 4C1BA 3S6JA 5AVTA 3DEZA 2TMDA 5FI3A 2X8AA 4QYWA 2BTEA 1EFLA 1QZ3A 3NYRA 5DULA 4BY9E 1DUSA 4WA7A 1FS5A 3SY8A 3GJ3A 1QRAA 1ZI6A 3QU7A 1YH3A 3WBJA 4EUEA 3PTZA 2OGSA 3CLKA 3HXQA 1YB4A 3HKEB 4F9GA 3OX1A 4WLFA 3HYTA 2GD1O 4ZO7A 2OCLA 4BNFA 4M6WA 3E3LA 4DPMA 2GPWA 4E5DA 4DR3B 5K01A 1CZNA 3ME5A 4W4TA 1FJHA 2JIOA 1NX6A 1TD9A 1OFTA 1NASA 4MAFA 1E7MA 1UDCA 4RC9A 5JMWA 2VT2A 2CE7A 4FCCA 4NK4A 2QM7A 5IN5A 1KMMA 2UAGA 4RPLA 4EAAA 2REOA 1MABA 2O9JA 4PX2A 2ZM5A 3T9EA 4JZKA 3GXBA 4C4OA 5B36A 1ZUHA 4MA4A 4K05A 1P0IA 4M7OA 3Q1LA 3SHFA 3I5UA 3OMLA 5L6MB 1V3UA 4LXTA 2ZRHA 1EFAA 5DISB 1DARA 4MWBA 1NW5A 4X93A 1T2EA 3SYTA 2OD9A 1M1NB 3ZW7A 4DMKA 5B57C 2N1BA 1QFZA 2ZS8A 4GWGA 3TUZC 3E03A 3P9SA 4DMRA 3GV0A 4IGEA 3KR0A 4I55B 4LV8B 3KJXA 1ZGBA 2G9ZA 4HDSB 2XGSA 1Q0QA 4LJ7A 2NU8A 4AWBA 4BO2A 4F6RB 2ODAA 5FWXA 5EFOA 3G8YA 1R6BX 2JD2A 1V8OA 2Q5JA 5COQA 2AJCA 2WKSA 1U80A 3ADOA 2PXHA 2FPGA 4KQGA 2Z3ZA 5FNVB 1NBME 1LS1A 1LSOA 4BO8A 3KVNA 1WP9A 4FMBB 4Z4HA 4MUAA 3E7FA 3ZY5A 1POWA 5CEFA 2FUG1 5CD9A 1ZYUA 3TEJA 1UMBA 2YDXA 1F5SA 3EVBA 1DRWA 1JKJB 2OFOA 2C29D 2V0CA 2AX3A 4IIBA 1QCDA 3GJ7A 3MRTA 1G8YA 1I6WA 3IUMA 4EG5A 1Z26A 2VXYA 3QKIA 4PC6A 1IZ0A 5DX8A 3R3WA 2CDAA 4LHWA 4RLSA 2JFHA 1WZCA 1NSTA 1W87A 4GQIA 4JLAA 3UH0A 3IDZA 4FFMA 3MPUA 4L28A 3IBFA 1WQ3A 4MPDA 3W6PA 1WO8A 1ZPDA </