2AC2A

Crystal structure of the tyr13phe mutant variant of bacillus subtilis ferrochelatase with zn(2+) bound at the active site
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
309
structure length
309
Chain Sequence
SRKKMGLLVMAFGTPYKEEDIERYYTHIRRGRKPEPEMLQDLKDRYEAIGGISPLAQITEQQAHNLEQHLNEIQDEITFKAYIGLKHIEPFIEDAVAEMHKDGITEAVSIVLAPHFSTFSVQSYNKRAKEEAEKLGGLTITSVESWYDEPKFVTYWVDRVKETYASMPEDERENAMLIVSAHSLPEKIKEFGDPYPDQLHESAKLIAEGAGVSEYAVGWQSEGNTPDPWLGPDVQDLTRDLFEQKGYQAFVYVPVGFVADHLEVLYDNDYECKVVTDDIGASYYRPEMPNAKPEFIDALATVVLKKLGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Metallation of the Transition-state Inhibitor N-methyl Mesoporphyrin by Ferrochelatase: Implications for the Catalytic Reaction Mechanism.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Lyase
molecule keywords Ferrochelatase
total genus 119
structure length 309
sequence length 309
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 2005-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ac2A01
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ac2A02
1HRKA 2QD5A 4KLAA 2XWPA 1C9EA 2H1VA 2XWSA 1C1HA 2AC2A 1L8XA 2QD1A 3HCPA 2C8JA 2DJ5A 2HRCA 2XWQA 2AC4A 4MK4A 2XVZA 3W1WA 2JH3A 2PO5A 2XVYA 4F4DA 1QGOA 4KMMA 2HK6A 2H1WA 3LYHA 1TJNA 2QD2A 3HCOA 3M4ZA 1LD3A 4KLRA 3GOQA 2Q3JA 1DOZA 1N0IA 2PO7A 2PNJA 4KLCA 3AQIA 2HREA 2Q2NA 1LBQA 2QD3A 3HCRA 1AK1A 2XVXA 4CCSA 3HCNA 2Q2OA 2QD4A
chains in the Genus database with same CATH superfamily
4QDOA 1S01A 3IT1A 2FK8A 4OA8A 4CIXA 4UPEA 1VHDA 2LD4A 3AEZA 4F8EA 1GO2A 1VCIA 2HSEA 3I32A 3L0CA 1I0LA 2ICAA 3EVDA 3A6KA 2DE0X 3ELWA 5LFAA 1BKYA 3ZJ4A 4F9GA 4NBVA 4AQYB 4JOCA 1TEZA 2Z6QA 3EVBA 3HM9A 1BQ3A 3FYUA 3WI7A 4AY5A 4M46A 4FM9A 4D3YA 1OA0A 5DXFA 4BMSA 1OR8A 3QOWA 2BGRA 4M36A 2AYZA 1Y1TA 4PRKA 5KNDH 1PIWA 1HYQA 1J7JA 1KQ3A 1RWXA 3EE6A 2HA3A 3I37X 4BN5A 1QF6A 2W2KA 1TT5A 3A7EA 2IHUA 4FBGA 3VSEA 2DTDA 3BMCB 4AJHA 4BVBA 1ZAYA 3JAWA 1QPZA 3WGHA 3WDKA 2IUSA 4CMKA 3H3XA 3KZ1E 3Q8WA 4KNWA 4D6PA 4CUJA 3ERCA 3NVMB 2HA6A 2RBKA 1SOMA 3B2EA 4QJIA 4YMWA 2H1RA 1Q91A 4ZCPA 2HIHA 1J9ZA 3DWIA 2O5RA 3Q9UA 4L0MA 1K8RA 4ARBA 1DEHA 3AJEA 3WMWA 4QT4A 5A2QA 2CXOA 2NUAA 3UFXA 2E4UA 1DKPA 2PDAA 4KXVA 5BQFA 3VYVA 2F9LA 4QGAA 2C2MA 3D6AA 5IN5A 2Z1NA 4PIMA 1KS9A 16PKA 3KOZA 4UNSA 2OT3B 1PZFA 2JIRA 3CW8X 3P9ZA 4XYEA 5KU7A 5DBGA 1O2DA 3JQ6A 1NVBA 4YRKA 2D5BA 1GZVA 1R4NB 5DT2A 1NRXA 1SEVA 4IOLA 4PHCA 3ZWDA 2CXNA 4JIGA 3FAKA 4U1RA 3ILSA 1SAYA 1M8PA 2VF4X 3R44A 4KR7A 1WVMA 3ZE6A 3MQFA 1K66A 1MU0A 3OLVA 5AM2A 2YY7A 1VJ0A 5HCUA 1LVGA 3H2YA 5B53A 4PX2A 2GTHA 1FL9A 1CIVA 2XB6A 3MAAC 3MBOA 3U3XA 4ZCRA 5JJ5A 3ZZ0A 3L8EA 1WZCA 2AXQA 5ECWA 2NYAA 4ESHA 2H1OA 1HNWB 1VDMA 2COUA 1OHHA 5I4KA 3TXAA 1R8SA 1ZP6A 3FWHA 3CEPB 3TVTA 2VBGA 5TGDA 1NAIA 1H8ED 2WHRA 1IXZA 3OZIA 4TM7A 4P7JA 1HYEA 2PE5A 3H0CA 1XZMA 1TTTA 3AK4A 1T0PA 5G4LA 4WESA 3RT1A 3AQIA 4MUHA 3TEMA 2W2PA 4F91B 1USVA 2PTHA 3T34A 3QEBZ 2DUJA 3STVA 3IXMA 3VZDA 3G2QA 3D02A 4AWAA 4R51A 2LKCA 1M6VB 3TH5A 1Q84A 2QNBA 1BA3A 2ZSHA 2XGGA 3CNQS 3I5UA 1NRIA 3GRZA 3Q7EA 3IBGA 2NZYA 1O6BA 3INGA 4WUVA 2PRKA 4CZ2A 2XMZA 1PR6A 3WAGA 2EYQA 4I5EA 2LZ0A 4B4UA 2EGGA 4WBXC 5BSFA 4GE0A 2N47A 5EHIA 2LPMA 5EJ2A 3JV7A 1QUFA 1R18A 3PC4A 4XGNA 3V1YA 1YKFA 1V3QE 4D4IA 2CVFA 3ANLA 2W6JD 3DUFB 1DTWA 5LLSA 1AHIA 1E6KA 3C6MA 1KP3A 1SVWA 4RTKA 2QRGA 2OCXA 5FLYA 1EFVA 2AR0A 4W4TA 3PENA 2AXEA 3FDJA 1VE1A 3L7CA 4C0AC 4ES6A 5A03A 3PFGA 1QH1B 3I83A 1YQUA 2GI4A 2ZYTX 1M6WA 3UUFA 3HRHA 4OOFA 5BXYA 4OU4A 4YMUA 1NJ2A 1G20A 3S2GA 1NPDA 1Z74A 1ENPA 3T1HB 1WHTB 4U0JA 1G2PA 4XCXA 2B8JA 4YRJA 1P1FA 5KAMA 5HUQA 3E53A 3GLIB 5F73A 1J24A 4P4NA 1AGNA 3VHRA 2BN4A 2R7NA 4CR8A 3D3QA 1PR0A 2NSYA 1Z8DA 4XRRA 2C07A 2X5OA 3H4MA 2G40A 4HX9A 3IUNA 4ZEOA 3KL4A 4KOAA 5EJ4A 3P96A 3WWEA 1V2HE 5CLFA 4ER7A 1O77A 1SUBA 1J1IA 3DNPA 1JI0A 3F74A 2JJ2D 3TAUA 4MIKA 3TR0A 5BN5A 2VDNB 3ZJUA 1F6WA 4TS9A 4JGBA 5B2FA 3RRZA 4RL4A 4BNJA 4MR7B 4EZIA 3GJZA 3R20A 2MHCA 2JAXA 2HHJA 3GFVA 1OU0A 1WU8A 3SJCA 1BVUA 1ZG3A 3GLIE 3KB2A 4ZJPA 4NU8X 3A1SA 5CIWA 1JFTA 3A4YA 1F48A 5EE0A 3RFCA 1ZIDA 1BO6A 2ZRIA 1WZNA 3E5HA 4EWLA 1JNYA 4KSCA 1PNVA 2AEFA 5ALWA 1XP8A 4EVRA 5L3QA 2PLWA 5MFPA 2EW1A 5JCZA 2PL5A 2HDHA 3EPPA 1OX6A 3QMVA 4YT8A 3UMSA 4L3VA 4RVGA 5E7IA 3EPLA 3BMOB 1TQDA 4HXFB 5SYNA 3QUSA 1SU8A 1Z07A 4JC0A 3VYUB 2FEOA 1VHQA 4B6FA 1SHZA 2DM6A 3S2UA 1NW5A 5CA0B 3U17A 1P2SA 4BMNA 3BJRA 2GBFA 1BW9A 3OEHD 4Q82A 2QW1A 3TXYA 4YAGA 1AZLA 3ODGA 1P1KA 2C83A 2HWYA 1IZ9A 2SNIE 4PGGA 4R68A 5K8IA 5KWVA 1R4MB 5LP6F 3FYHA 4RFVA 1V1JA 4K9OA 4LSWA 4P22A 3A6DA 1YQGA 1DBVO 2BBWA 4P3PA 2IU0A 4I1IA 4OYHA 3DJFA 2R1TA 3JR3A 2NU8B 4I6EA 2F62A 1XSEA 3QFSA 2IFTA 5SYAA 4CEJB 5EZ6B 1R12A 5HZGA 2CUZA 2X3YA 3N8HA 1XWWA 1IULA 1YJAA 3I6IA 1F2VA 1ODJA 4KQIA 3RYTC 4BEJA 4ETMA 2C7OA 1GTJ1 2IHVA 5LR6A 3AHEA 2E49A 3K3PA 1J09A 1JAYA 2G1JA 1WOYA 3PGXA 1E1CB 4JYCA 4P08A 2P11A 5B3JA 4CFYA 3D31A 3PUHA 5CT6A 1P0QA 4YQFA 2ADOA 1OMOA 1U9IA 1KR5A 2G04A 1NQ5A 2RIPA 4QUGA 3C3DA 5I9LA 3OTQA 3COVA 3QYFA 5KTNA 1K75A 3A4IA 1HFKA 2YHIA 3ETGA 1VYHA 2PL1A 4YEDA 5EWJB 3CURA 4ZQHA 2NU6A 2ZROA 5HIIA 5TPWB 4AZSA 3QWBA 4CLRB 2OC9A 5LZ8A 2R6ZA 3OAAA 5J4LA 5KTMA 5FA5A 2R7KA 1E1MA 1PX0A 1SIOA 2CL0X 2JHAA 1AQUA 2DGDA 2Q3LA 1EZ1A 4HK4A 4IIVA 2E5LB 2P2LA 2HKIA 4MB6A 2Q27A 4HH4A 4M6WA 5ADVA 1DWPA 2FPPA 3K8ZA 3NB0A 1AB5A 2P9YA 2FPKA 4RPGA 3RODA 4GI5A 4M1EA 4PVDA 2G1UA 4HH3C 4YREA 5C51B 5CIQA 5EJAA 5BN1A 4ZHSA 5LMNB 4HRYA 4LJKA 1O94A 1PGQA 2PD3A 1A9QA 2BFAA 1YFKA 2REQB 4FZ5A 4D6YA 2UZ4A 1U63A 4TSKA 5I8PA 1TK2A 3K2EA 3JVDA 4R81A 2F8MA 4LEIA 5GONF 1PTJA 1V1RB 4HFMA 3PHCA 3DLPX 1NKTA 3HUTA 4IV5A 5JS2A 4FDAA 1NVXQ 4C4OA 2GPWA 3HB0A 3WIOA 1CIJA 1U1DA 1QYDA 5C7OO 5CM8B 3EIUA 3GY0A 2JA1A 2IYWA 4OHUA 1PWHA 4PZ9A 3MTJA 3RM3A 4RESA 5L6MB 4FQ7A 1CIPA 3I4FA 3COWA 2PN1A 5E4FA 2CDRA 1Y1QA 1WSWA 4LCJA 3O4FA 1A5TA 1M34E 5J5AA 3CRVA 4RACA 2XB4A 1P3Y1 3K8OE 1IBLB 3KVRA 1INLA 1HYGA 1CWUA 4JI3B 5LOVA 3G9XA 4IS3A 3RVKA 3DF7A 4LHSA 2PPLA 1K86A 3CKYA 3P9XA 1XD2B 4FD3A 3RPEA 4G8DA 3EEYA 4PSUA 3MOGA 4TKVA 5KYKA 4DRYA 1ZM3A 3K72B 1E2KA 3DBHB 5K8UA 1JIXA 2ODAA 2V6MA 4U9HS 1SUDA 1OWMA 4JLJA 1TW2A 4DR5B 1N7HA 1E2FA 3E03A 1CTQA 3EGDA 1F5SA 3OTHA 4LWOA 2PUCA 2FUEA 2X7HA 4YMTA 3F90A 1Z6XA 2PZJA 3W05A 4AXXA 4M0DA 2QUJA 1NBIA 3VUFA 1ONNA 2Q46A 4IF4A 1YF3A 1EK1A 4JBNA 4AMVA 3I5AA 2EYUA 2FRDA 3LP5A 3A9VA 3GRPA 3B70A 4BZWA 4Z4IA 2D00A 3O4RA 3F7TA 1H05A 2WD8A 2JGNA 4OGKA 3V42A 3Q15C 1K4KA 4F38A 2RFLA 3GW8A 1E3IA 3QKUA 3R3ZA 5A9TA 2HJ9A 3H1AA 3NXKA 3GQBB 4CQLB 5GVSA 2A94A 5D1HA 3NYWA 4RC9A 4N0QA 2P9ZA 2V7QA 3BQNB 4RTPA 1M2WA 1XCJA 3MWGA 3WISA 4AN1A 1FDOA 4ZFNA 2ZIVB 3EARA 3H9GA 4ZAWA 2IS6A 2QVZX 4D56A 3BE8A 3H5VA 4ZV4A 1U2EA 3FYUB 3CVWA 2W22A 2RHDA 4JAVC 3QE0A 5TGZA 3QKWA 1PJAA 4DLBA 2D7DA 4XPIA 3A6ZA 5LD2C 5ALKA 2WM9B 1FYVA 3CKMA 4Y7DA 3BXOA 5F7OA 1IJEA 2JLZA 5LIPA 3NYRA 4O1MA 2XZPA 4K9MA 3FVRA 1OC4A 3R7LA 4LA4A 4R3WA 4LGCA 3FCUB 1S89A 1PQWA 4JX8A 4JZYA 4E6PA 5BUZA 4MJ3A 3W5JA 1IDOA 2PX0A 4LOJA 2OY0A 1C4WA 3RUFA 2L69A 4CKYA 2D1SA 1LJUA 4UARA 1HSOA 1DKMA 3SVZA 4JK3A 5JTUA 4Y2RA 5BOVA 2R751 1O08A 4TN1A 1KPIA 2A58A 5B1IA 3U2QA 1MUUA 3BICA 3L6BA 4OEHA 4W5QA 2BI4A 1R0KA 1UXOA 4V39A 4G5FA 4YRZA 1R9JA 4UTOA 1JHYA 3ZV7A 5FPYA 1QRSA 2GEVA 3AKZA 2ISQA 4N0PA 1XU7A 2D1QA 3SN6A 4N41A 2Z5VA 3OZUA 1UZUA 3EJWA 4CMIA 1D1TA 4WLOA 3ELUA 4C4PA 1P4AA 2JLAA 3EYAA 1Z88A 2LNDA 4KX3A 4NIMA 2CJFA 5SICE 3SQMA 4BFYA 4FXOA 2V9ZA 2H2AA 3UWDA 4CRWB 5AVQA 2GHTA 4JJKA 3FHOA 3I09A 5KQGA 1VSQA 1ZCJA 4UDOA 3WBKA 2CYAA 2FZCA 2NZUG 3IV9A 4D92A 3KQOA 4OP2A 4BFVA 2YJGA 2FLKA 3ER9A 2H08A 2DY0A 4Y2SA 1E3WB 2FMFA 3FLEA 4BO1A 2OHGA 1W88B 3QVWA 3IPRA 4RZ3A 5C3UA 4GNKA 5E38A 3W04A 1FP4A 4IIJB 4RJJA 2RIRA 5CDHA 4ZO7A 1RACA 2DHQA 4Q7JB 3EQZA 2DHDA 3G5AA 4NULA 3P4UA 3WMFA 5D3ZA 1XZBA 3G5TA 3GEHA 4FE7A 1RRGA 4KR6A 1NDQA 2EFDB 3AESB 2NPIA 1PD1A 3GIDA 4OGFA 4DIFA 1UEXC 3DVAB 2C9OA 5DHFA 4Z7NB 1Z12A 5IYZA 5KNCH 3IE0A 2QB5A 3WJ2A 4US2R 1AN9A 2IYZA 4PNPA 4PIVA 1YTLA 3NT4A 1LXCA 2IZZA 4DDHA 1UM9A 5C7YA 3PI6A 3X3HA 4IG4A 1EIWA 3LUPA 3QYJA 4DA8A 1ZIXA 5M5BA 2CHGA 1PJQA 1QIIA 3I04M 3KQYA 2HYIC 4XFDA 1E9AA 3AJ9A 2VRNA 1N0VC 1XA4A 2ONCA 4EF4A 1XDSA 3FMGA 3M3HA 5FPPA 2BHNA 1PGNA 3OC0A 1R5NA 2V6IA 4BVHA 3DYBA 3G0CA 3RV4A 4U6QA 9ABPA 3IDSA 2FRDC 3W5DA 4BIIA 4YRPA 4R5MA 4S05A 5DCLA 4DJDC 2AOWA 2A0FA 2AW5A 2BEUA 4N54A 2WJAA 2FFHA 3I42A 4I8IA 4DV0B 4LJ5A 1T25A 3NPMA 3OCZA 4DBVO 5IKEA 2VWPA 4BB0A 4CKEA 3EIQA 1AGRA 1SC3A 4CCWA 2QV0A 3DBRA 1R6TA 3NC4A 5EJMA 1C1YA 5EERA 2J3HA 4E21A 4CQJA 3IVCA 2FDCA 3T9FA 3HYSA 3LL7A 3O38A 1DHRA 4QU0A 2FVYA 1E4YA 1M74A 4N5MA 1TC1A 5K3DA 5DNUA 2QGZA 5CFZA 2QUHA 1OVGA 1VYVA 5J4VA 3MRXA 4E30A 1U7PA 5F98A 2XCQA 3EEQA 1KPHA 2Y0DA 4FWTA 5ALPA 3IFSA 1AVTA 3ICOA 2BTQA 4UAVA 1CS4C 1ZY2A 5EFZA 3UC9A 2JLXA 2OUKA 3JY6A 2ID9A 3S7TA 4CM8B 4E1BA 1X80A 4KVAA 1PZNA 4LX0A 3KTFA 3P9KA 1GSOA 2Z8ZA 2HNAA 5ERYA 4E32A 4BXOB 2WUGA 1NN0A 3EDQA 1Y8CA 4QC2A 5D6NA 2B20A 1J0EA 1MQ8B 1G8JA 4D0RA 4YRGA 2UUCB 3SOZA 1A9PA 1SKYE 1SURA 2HMAA 3KBBA 2HU7A 1GEEA 1DEAA 4P80A 3UK0A 4KXYA 4QXAA 2AE1A 5K0NA 2PSFA 1LNSA 5IEJA 2WHXA 4U2FA 2VBFA 4HNRA 4F8JA 4IYJA 2HRDA 4UHFA 2KYRA 4A0GA 2G17A 1AUOA 5C4GB 3GBVA 2C8LA 5EUCA 5IKMA 3A05A 2O5CA 3DOHA 1JYFA 1N4DA 2Y0EA 4DTCA 2C94A 3IOYA 2GA9A 5A4FS 3QEAZ 5TIIA 1N34B 1WMBA 1K2WA 2GFQA 4XM2A 1DIHA 1ZR2A 5KSPA 1PX2A 4FI3C 5FAXA 1XI2A 4YAOA 4BRZA 3NTQA 3K71B 4I6JA 2J08A 5EMJA 3NAGA 1E0JA 1H9AA 1V7ZA 3HCNA 1NHGA 4O0LA 1F3OA 1VL6A 2PKEA 2AKYA 2OCAA 3PC2A 4MP6A 4P7KA 3VISA 1H8EA 2FOXA 3OOEA 4REQB 1Z2EA 2I22A 3K15A 4EMTA 1U04A 3R4VA 1Z5GA 1RYHA 1W85B 4TKVB 4TTPA 4BFZA 3PEUA 1LW7A 2ZE7A 4CG2A 5A5GA 1ZR4A 1N2EA 2I76A 2SICE 3HZRA 3WLOA 3CONA 2XT6A 4OQPA 3EF0A 2IUFA 1GKKA 1Y42X 1YB4A 5KOIA 2DBQA 4RDXA 3BQMB 1HSZA 2FHSA 5EZSA 4AO8A 3P0JA 3KZMA 2B9VA 5G2OA 3IDQA 2X58A 3ADBA 3D6FA 5J2UB 3C16C 5THKA 2FETA 4GOJA 1C8VB 3AUTA 2R5NA 3WYNA 2E4YA 3ADPA 3GWZA 3V1TC 2OBBA 3FPCA 3UV3A 3ZY3A 1E5LA 2Y3IA 2YL2A 4NV0A 4KJZA 3WKBA 1MVLA 1L4KA 4KUGA 5CYPA 3SX0A 4FLFA 3WBFA 3KYCA 5FI5A 1CDZA 4MRMB 2V1UA 3GAAA 3TKAA 3O3OB 3T54A 2XCTB 4QT0A 3SYLA 2DPXA 1K6IA 4OXQA 4YCJA 5BQXA 1QP8A 3WGIA 3P5SA 1ICIA 3OO1A 4YJ2F 4ZPJA 5C5DA 3WIBA 1AKMA 1QLWA 4WK6A 5I7FA 3KUUA 4RTRA 2DLDA 4R8MA 1Y6JA 1DXHA 1HPLA 2QRLA 1NXWA 3FMIA 3FMOB 2A78A 4RWEA 1GFZA 1OFVA 2M6RA 5EQJB 4OHVA 5CH3A 4OXIA 1G66A 2X1LA 1SIBE 4GOMD 2I29A 1YR6A 2C00A 5FOUA 5KO2A 4FOOA 2JDID 3AV3A 4F21A 3VVLA 1V3VA 1JG7A 2AJDA 2NVBA 3VR6D 4ALMA 2F7SA 1CLEA 1I2AA 3HU2A 2ZT5A 3D4OA 5CA0A 2WUEA 2JVIA 3ZKAA 4FYIA 1OFUA 1FVXA 4BCBA 1Y1RA 3K9NA 5DLPA 4UTRA 5B4TA 1NW4A 4JUBA 3UBTA 2YHBA 2GZ3A 3LUCA 3M6FA 4EG3A 1W9HA 4Z9FA 5DNCA 3DP9A 3WRWA 3ZDBA 2GZ2A 1L5GB 4BAZA 4YMHA 5JWRA 5FNZA 3V32A 1VJRA 4DDKA 3KWFA 2ZRGA 4RXMA 2HF8A 3K5HA 2JJ2A 3ZGYA 5JT1A 2XTMA 3Q8LA 3FYUC 3JD4A 4TZTA 5IW8A 1B8NA 1WO8A 3G0GA 1TYAE 3H4VA 3NWPA 2GVDC 5D84A 4YRAA 1KR2A 4U2CA 4IXTA 4MQUA 1PJTA 4EPVA 1JGTA 4YMGA 5BN3A 1EAMA 4FIZA 4RABA 1B8PA 1LF5A 2CMDA 3CCFA 4BU1A 5JJCA 2Q1UA 1WHSB 1OTYA 2H59A 3KVVA 2PYZA 4IDCA 5CFLA 1Z2PX 3GVIA 5HRUA 2GYUA 5IZCA 1S8FA 1CB0A 4X6YA 2IYLD 4GLBA 4PQGA 2WHYA 4NATA 5KPDA 1JDBC 1KP2A 4GDMA 4CHGA 5F1PA 1BEEA 1U8EA 4XVRA 3T7KA 4F7WA 2W42A 3MTDA 3HDYA 5KS2A 1U1GA 3QVGB 2VJAA 3OZ7A 3CLVA 1NTRA 3FWYA 4AY6A 5FRDA 3K20A 4QLOA 1QHHA 4LY0A 3U4QA 1FQKA 3COYA 1NVTA 4EHFA 1ZONA 2VP0A 4BB9A 2JL1A 1XYVA 2NU9B 3BA1A 3SI7A 1GUBA 1JVSA 3KLMX 3TB4A 5IFKA 7MDHA 1XVAA 2IYPA 2PH5A 2XUDA 3DE1X 4JBHA 4UUAA 3OEHA 1DKUA 1CUBA 1QGUA 3OU7A 3SXUA 2C4UA 2BGTA 5CBKA 2FSHA 1DG1G 2VTKA 3A27A 4Q9HA 3I30X 5U4XA 3U7QB 1YOVA 4PGAA 3PHJA 3QKSB 3ESDA 1N1MA 2ZSBA 1M5UA 3ROMA 4DAEA 3CO0S 1UWLA 3DKRA 2IXBA 5GOZA 3U40A 1KBQA 1WQ3A 2H7YA 3LY7A 3REGA 3S70A 1RS0A 3E8SA 5DGIA 3J80A 1OILA 1U2GC 2JFQA 4LV8B 4MW1A 3RE1A 4Q47A 4GIBA 4P98A 5BPHA 2BFBB 2H29A 1QBKC 2ZG6A 1RM4A 3EQ7A 2ZYDA 3HKCB 3KR1A 5HBRA 3VYTB 3B8HA 2PR7A 4AZTA 3O1IC 4ZK2A 4IP0A 3QVUA 4QDJA 5E6UA 5G3ZA 1AUXA 5DSZA 3PVCA 4KFCA 1T13A 2CLKB 1MG0A 3D4LA 3PFKA 3AU8A 4AMGA 1DAPA 3L05A 1CUWA 4QNMA 1FXWA 2BFNA 5JSZB 1ATIA 1GV0A 1VPLA 3KLPX 1OWNA 1SH7A 3GAMA 3IOMA 4N65A 1J5XA 4UVEA 5K0SA 3E70C 1SUEA 1ZJ6A 2H4FA 3KL2A 4Q6WA 3QIVA 5EZQA 7YASA 5ICGA 2IY9A 3OH8A 1SY7A 1U0GA 1UKAA 4IWYA 4J16A 3L7MA 3L7KA 5CVVA 2WMYA 3AI1A 3OAAD 3JPYA 1SVUA 2G25A 5DLQC 1KMHA 2VS1A 5PNTA 4YRIA 4HDKB 2O54A 3P9YA 3GDOA 2VATA 1JG1A 3PNBA 2EBFX 5ERXA 3VC2A 3C6YA 1MW9X 1E94E 1RYMA 4L02A 3UGTA 3PLRA 2Q8PA 2R1VB 5I4IA 4DT1A 3O6VA 1EGMB 3E5MA 1IZ8A 5ERGB 1F4VA 4L8LA 3KYCB 1D8AA 3EYWA 2ZDHA 4EUEA 1MMFB 4P32A 3NPAA 1C7RA 3GEMA 4GRIA 2V97A 1SD2A 1T8UA 3CWZA 2VAMA 3T3PB 3WS7A 1GG2A 4JB8A 3W5HA 4D9MA 4JVSB 4AP6A 4EHLA 3WJ7A 3IVMA 2PV0A 3ACBA 5TPZD 4NEQA 4AS3A 1VPDA 2MMGA 4B6QA 2AMVA 2JF0A 3EUEA 1IWPB 1AM4D 4JT2A 4EHKA 1OI7A 4M9XA 3DXFA 4Q02A 3G6KA 1Z8NA 2JEZA 2YKGA 3Q0TA 1EA7A 1XTIA 4LW8A 4Z8YA 1D07A 4AL4A 5KSWB 2VYQA 4WY8A 2HF2A 4LYFA 4RV9A 1FYEA 3STWA 1APBA 1HL3A 3B60A 3R3XA 2PRYA 1USKA 2BFMA 3ZNQA 3I5YA 2X9LA 3TX6A 5DRTA 3OQ1A 4G67A 1N9KA 1IIBA 1FW6A 1PUXA 5BV2P 3IP6A 1WZUA 4INAA 1K89A 5CT5A 4D2IA 1EK6A 3KZOA 5JVDB 4B43A 1BA2A 2QTMA 1LH0A 1R6AA 4M1WA 1J56A 4QEZA 3RABA 4MWZA 4RANA 1B4DA 1T9GR 2PZEA 2W4QA 3M82A 5DYWA 2W9XA 4DV4B 2HU8A 1TU0A 3E9NA 3PRJA 3DE0X 1CQXA 4WADA 3U6KA 2CC2A 4RZXA 4XCQA 5AVJA 4F72A 1SXIA 1DC8A 1ESNA 5EIBD 1SHTX 5A9SB 3PEYA 3NC0C 4R1NA 3L0ZA 4BFTA 4UTVA 1G291 2QN6A 2E85A 1U2ZA 5M2QA 2R8XA 3K6RA 4F11A 1TA4A 3THYB 2B30A 1Y5MA 3KYDB 1YV9A 1M0EA 4J91A 4FEYA 4AJ4A 5CAEB 2C9CA 2YYAA 1U81A 3G82C 2R96A 2Y68A 5IXJA 2XXAA 4ICIA 3U19A 2P5YA 4ND8B 1N8SA 3A6LA 2JKVA 1S2IA 3G0OA 1E92A 3QV2A 4EA6A 2OOKA 5GWXA 1QHNA 5FWNA 1KJZA 1A1VA 2RJOA 4GPTA 1E63A 3QSYA 1IBCA 4DIUA 1OX5A 1TUGA 5HF5A 3RIXA 1S3SA 3A6HA 4CBVA 3PUJA 5BNZA 3QE3A 4I9HA 1VDZA 5FTKA 1CG6A 2E5FA 3ORSA 2I03A 3QQ5A 5BWBA 3I4CA 3RK4A 4U7WA 5DF1A 4CKWB 3KVYA 3I73A 4TZKA 2ROQA 4O3MA 4D3FA 5L3VA 4WLUA 1OY1A 1YIDA 2B83A 2P68A 1PJ3A 3AI3A 1J0BA 2WU4A 4HF7A 1L5MA 5DMXA 1TKBA 1KEZA 3A1FA 2QE7D 2NUTA 1H2BA 3NDJA 3FOCA 3H11A 2FXIA 4X92A 1D4AA 5DLDA 4ENPA 1PJ2A 3CX7A 5LB4A 4CEHB 1OV4A 2VHCA 3ANSA 2ZYGA 2ET6A 3RS3A 3DEFA 4GPAA 1AU9A 4UW9A 3PFFA 2D2IA 4KO2S 5AUOB 2GHQA 3GB9A 3NBQA 1KNQA 3LBHA 4DUPA 4PV7A 3EXEA 2YVQA 1I33A 1VCHA 3G5LA 1R4NA 2MR6A 5AH0A 5TDHA 3V8RA 1EVJA 4J29A 4LDZA 3HYLA 1K8YB 1L5OA 1VB5A 4NYIQ 3D6UA 3J81k 2VYVD 3BM5A 3IP9A 1A69A 4ZT3A 4QJ3A 1SHUX 2BFOA 3T95A 1FFEA 4EJ0A 4OK5A 1PGJA 2GF9A 3DKVA 3MXOA 3PPIA 2OMKA 4U9IS 3T52A 1X94A 4REOA 1U7OA 4AQDA 4EUNA 4BB6A 4ESVA 4DV7B 1FBNA 4C04A 3IP8A 1GFSA 1VBKA 3PB3A 4LYEA 3FWZA 2HCFA 1XPOA 1I94B 1SCKA 1U2PA 2Z4SA 3HVIA 4QPDA 4Y6GB 5DKFA 4AKHA 3UWPA 1WCXA 2B3DA 3U44A 5D8DA 1B14A 1FEZA 1XEWY 3EGEA 4M1OA 3IQXA 3KDPA 5I6DA 1RPTA 3DVQX 1EK2A 1NA5A 3C7CB 4OHKA 2GLTA 1HURA 3IMKA 1SBQA 4TUYB 3S5JA 1CXZA 1PV4A 3TSYA 3DW1X 3MS4A 1IXYA 3EBPA 3T35A 2Q6LA 4RYDA 5AW0A 1BZYA 5EMNA 2XRFA 5HG0A 2Q3EA 3KETA 1EE9A 1D03A 1P5ZB 2KB0A 4W9NC 2DEUA 4CQNA 4OFWA 4BNGA 4GSKA 3UUGA 3KB6A 4M8LA 1KY5A 1WOMA 2W6IA 4I9GA 4L9SA 2P9HA 1OIXA 1S4MA 2Q3DA 2FU5C 3QBEA 4HQ6A 4D42A 3MXTA 1IH8A 4JDUA 5JD5A 3V4PB 3AP1A 1QG2A 2B6NA 3DP7A 3WRYA 1UC5B 4OHMA 3DOIA 5LQRA 3G1WA 4LF5B 1RIIA 2ZTLA 1Y7LA 2QG6A 2F3QA 4YJGB 4QPCA 1WW2A 1AF7A 2AQKA 5DI3A 5HEKA 1HH4A 2PGJA 3BSWA 1NUAA 3JQDA 3HWWA 5K2MA 1D2MA 4EY3A 3WO0A 4WOKA 2AC2A 5C37A 1T36B 4TPKA 2V7WA 3HJTA 3URKA 3HNOA 4CF7A 4MS1B 4HRVA 4M3NA 4I2NA 2J41A 2V7EA 3KZVA 1RRMA 4KN9S 2G0AA 1A95A 2RK6A 4TQ9A 1C4KA 4AG6A 2HMTA 4Q18A 3WIUA 1W87A 5BW5A 4EG5A 2F4VB 2WD7B 4N7BA 5EP4A 4P2BA 3ROQA 2OHVA 1ISGA 4DR1B 4N3CA 5EMKA 1G3IA 3L6RA 2L0XA 3CT4A 2HZ7A 3FNIA 1B6SA 4FVTA 3S0JA 4OB6A 3UM9A 4ZODA 1II0A 5JISA 4OLAA 3PS9A 4DNFA 4GBGA 2DBYA 2XWBF 3G7SA 2IUUA 2XRMA 4E5VA 2GK4A 2AFRA 5CRIA 1NUQA 3BWDD 5JRJA 5K9ZA 4UM7A 5AUQA 1YFLA 3H9UA 3QPUA 4E11A 3HXOA 2XYHA 3KUKA 4NL4H 4JJFA 4BQNA 4CLOA 1ZNZA 3FFTA 1EE2A 1SBCA 4DM4A 4FGLA 1R7RA 2OV1A 4HJRA 3TTSA 5ALQA 5JSYA 2O6HA 4NYMQ 1Y63A 1GPUA 2OKCA 4J3JA 2JKZA 3WDSA 1Z5NA 2O2EA 4W7IA 3RIYA 4JKIA 2WSIA 2FOIA 2YN4A 1KSHA 1JE0A 3OQJA 5DBFA 3RFUA 1WB9A 3QX7A 4C9BA 1ECJA 3BBLA 1XZPA 2ATCA 4IDPA 3IP3A 4X1KB 3KQLA 4MI9A 1EXDA 2MIIA 4BMOB 2BFCA 1QZUA 2E4ZA 4RCVA 1DNPA 4J0EA 4W8GA 4BC1A 2FZ5A 2H2IA 3P9RA 1FUEA 4XVQA 4URVR 3GG9A 1Q44A 4L5CA 4C78A 1SXJE 4RS3A 4D3ZA 1AMNA 1QGOA 4DMFA 4PRLA 5CDFE 4G5GA 3H2IA 1MXHA 4Q4AA 5CGZA 4D4KA 1UKVY 1W48A 1HM5A 4QOEA 1U9IC 5DBHX 1NMXA 1QAQA 2EBWA 2X4IA 2NO4A 2EW8A 3WK9A 3SHWA 3W5SA 4OUKX 3FNQA 3QY0A 3ZBPA 4J1SA 2CVHA 1EFLA 2CNWD 3SZ3A 3W6PA 4BNMA 1TQ8A 3H8WA 5DZSA 1MP0A 3CRNA 5JNWA 1JQJC 3BL8A 3S81A 3V80A 3FPKA 2DT5A 3CZCA 4KI7A 4QTXA 4WLFA 2B4AA 2Q3CA 1L4MA 3KQVA 4XD7A 1LQUA 3IKLA 2UVDA 2DUUA 3LRTA 4AP5A 6YASA 3AM4A 1TJ5A 2I3AA 1FB5A 2P30A 3Q2KA 2BFWA 3DAOA 3RS9A 1SKBA 3G2KA 1JWLA 2BLLA 1M66A 1PT5A 3OP1A 3KX2A 4HZUB 5KSOA 2B69A 4KV7A 2BKEA 4NVRA 1XPRA 1PGPA 3SAJA 2QGNA 1GN8A 2BY4A 5EWLB 5BSUA 1V48A 1YBAA 1G8YA 3WZMA 2C4MA 1L4LA 1II8A 5L40A 3F5MA 4HAYA 2V45A 2F00A 4KN8A 4HPJB 4EG0A 5P8WA 5C3MA 2AI1A 1DIAA 2C2ZA 1U7WA 3PYXA 1I7NA 2VSQA 3D3NA 3ITEA 4A0HA 4N3AA 2PVCA 1N5LA 3GU3A 4W8OA 4NKRA 4PN7A 5C1PA 1G64A 2EP7A 2QN8A 1TF2A 1MJ5A 2ZYAA 3DLAA 4NJOA 3UW1A 3UYLA 2PMDA 5G1NA 4CIVA 2DHRA 1GL9B 3NIBA 1YZFA 4PGFA 2CVQA 1G8KA 1ULZA 3E9EA 1AA6A 2CSXA 1IHOA 3LDUA 2GH1A 3CFYA 1L4NA 5DISB 4BE4A 2CLHB 2A35A 2I2BA 1T26A 3L7BA 1ZOPA 1XTRA 2FWJA 3GGSA 3OQHA 4L4UA 4S24A 1G9TA 5I8ZA 3TBFA 2A9JA 4F9EA 4UNQA 2QG4A 3UAWA 3HN7A 4BV3A 2HLPA 2B1GA 3UJ8A 3TLEA 4BOYA 4DHWA 2R7LA 5J40A 5CVUA 1GR0A 1WR8A 4NCIA 2A1UA 3I76A 5JWOA 1UMBA 4KPUB 1NWHA 5AJWA 3AHJA 4J1TA 3DBLB 4IDEA 1QG6A 4WZBA 4D1YA 1JHZA 3PNLA 3A9TA 1JWAB 1PR9A 2DWUA 3JQAB 4IDAA 3RRNA 1TCBA 3PFIA 5FR1A 3TW8A 2D2FA 4ILKA 2YMPA 2X0NA 3R0VA 5TVGA 4LQCA 3NTVA 3I64A 1FFGA 4YDSA 2GXUA 3LH5A 1HETA 4ITVA 1OWPA 3ORYA 4C6HA 1GGJA 4Y9RA 1VYTA 4XOIA 1Q22A 4B84A 4WMLA 1N2IA 3O83A 4L1KA 2EOAA 2NTNA 4HH1A 2AOUB 3WIEA 3RHFA 3N8KA 3LL4A 2GK7A 1FK8A 1WB4A 1E1KA 1B3BA 1HLDA 3HC7A 3R3HA 2VDMB 3ABRB 3A10A 1WZIA 3AGQA 1JBEA 1ZQ9A 3Q9LA 1AC5A 2EQBA 4RJIA 2YXEA 3VYSB 3DLCA 3OHMA 4WTOA 2F1KA 3ZCVA 5JNSA 4YJ3B 3Q8KA 1W0JD 2JC3A 3PF9A 5FHRA 4ZXFA 3SQNA 4R8LA 3NTLA 3Q0IA 3RNLA 4NC9A 1NVFA 3TTTA 4F1WA 3NHZA 1NVDA 1Z22A 1J00A 4DDUA 2IZ6A 2QNIA 2X2FA 3H9CA 3L9WA 3BGSA 4IKPA 4LY3A 4OL9A 3DG9A 4U8GA 2ES4A 4F6RA 5LA6B 3AIKA 221PA 2Y0BA 2BMVA 1F0KA 3EPJA 1QK5A 2JJ8A 1SU7A 3LYUA 3TNJA 5M34A 1EG7A 1I13A 4ZHQA 4AUNA 4RDHA 4Z0NA 2QYOA 2HJSA 3EPRA 3ZWBA 1N5KA 3HBAA 4V02A 5EPOA 3WGZA 1RFGE 3OKAA 3I5XA 4R3UC 4YALA 4D3DA 2OYSA 1G60A 3FOAA 3KU1A 4LHVA 5KOJA 3IO5A 4JYZA 3AKDA 1KYTA 2WYOA 3PC8A 1Z4JA 1XLTC 5ETJA 4DMUB 1O95A 3K9LA 1AS3A 2E48A 5HDQA 3PYLA 3H9BA 4JB2A 4FZ3A 4EGQA 1H0HA 1XCBA 2EL7A 2YWGA 1IY0A 4OOEA 4PGMA 3W5IA 2WPDA 1K5DA 1JEAA 2C54A 3JQBC 4PONA 1U99A 1ZCBA 4LOLA 4D45A 2IS1A 3FRJA 4B81A 3OZXA 4DT1B 3RTBA 3ZTYA 3L7JA 4TZ6A 3MAJA 4FNMA 3IBYA 4KDRA 4EMBA 3RGWS 4X63A 4CF5A 3EUFA 1M34A 5KYUA 4EHNA 4PC2A 4K9DA 2R6GA 3ILVA 3PKIA 4MCIA 3WXMA 2I6SA 4FJ2A 3OPNA 4JOSA 3SIXA 2IVZA 1TQHA 1Z6QA 3CPSA 1NQAO 4FZVA 4RUKA 4HQKA 3W9UA 2BM1A 3AXTA 2YMMA 1DMSA 4R71A 3FOEC 2INGX 3LM8A 1SGWA 2YIJA 4OXKA 4YCBA 3I1JA 4JB3A 4KQHA 2WJIA 1JZQA 4KGZA 1E7WA 5FUQA 5KJ1A 5GGXA 1OBVA 1W5FA 4ZVPA 3VNAA 1QIFA 2BI8A 2O1WA 2VFAA 2P9GA 3F9RA 3ZWVA 3KEQA 3KT0A 4N7JA 1Q74A 3GO4A 4NNPA 3SLKA 4R1PA 1NBMA 4GZLA 3B1YA 3QE2A 4ZWNA 3BKXA 3GD7A 2Q7OE 4OSEA 3R6WA 1C7IA 4CCSA 1N2ZA 3Q10A 5FR2A 3T5BA 4EIWA 4CIYA 3STUA 4I4CA 3TLZA 5IU6A 4M8KA 3OESA 2VCHA 1VHWA 3W2TA 2OCBA 1MRNA 3VR5H 5LWHA 2P65A 7AT1A 4G9BA 4M87A 1J8MF 1K6MA 4REQA 2LR0A 2HMUA 2R6AA 1QFXA 3GX1A 2G8LA 2OK7A 3Q72A 2OXTA 4QM6A 3I3OA 1U28A 4QU8A 1ZMBA 3KQWA 2DFDA 1Y9JA 5D7NA 1RZ3A 3EXG2 4A6XA 2HCTA 2ZYVX 4FCTA 1GTMA 3CZRA 4H4EA 3VYRB 5LYJB 1N9GB 4JJ7A 1IRXA 5SZJA 4PNHA 3RAJA 3ROZA 3ON5A 1P72A 3P0EA 2HRBA 1NJ8A 4HXGA 4YDRA 3SC3A 1SCQA 1GRVA 5BN5B 1EFAA 1RBMA 3K0BA 4QQNA 3TTWA 4C0XA 4RFSB 4UM5A 4AYWA 4DLZA 4BNTA 4E5SA 1GRCA 1A72A 1FJ2A 3LFHA 3EBOA 2BONA 2XOKD 2AEMA 2O23A 1XK7A 3TL3A 1Q0HA 1CZNA 1WXEA 2IYUA 2FF5A 3IMGA 3Q88A 4UM9D 4WNYA 3TS1A 3AOGA 2XSZD 2YYSA 3RFXA 1QRTA 2RHGB 2RI0A 4B6OA 1XEAA 1YZYA 8OHMA 1LY1A 2ZRPA 5ARDA 1VE5A 2QTBA 1N8NA 3DOCA 4IHJA 1X0VA 3BIXA 4RAQA 3VTFA 2R00A 2QNRA 2UZ1B 1P5RA 1M1ZA 3I2IA 5E6RB 4M55A 3GUCA 3PNKA 3B38A 2PVPA 1JIIA 5EINA 5FBZA 4XWOA 1M1XB 1Q92A 1W5SA 2OPHA 3RFVA 1BHQ1 5CG2A 2FUCA 5KEIA 1TQ6A 4GR9A 1O7JA 3QE9Y 1I51A 3DHEA 3DLIA 4MULA 3UJ9A 4LQ4A 3MCUA 1NVKA 2BEWA 4WOJA 5FWYA 3SR4A 5L8VA 4KRFA 2BFPA 4WXPA 4JGIA 3VR2D 4JHLA 2AJBA 1FW8A 3C24A 2VZEA 3L93A 1KYYA 1ZQ1A 2FZLA 3CR3C 3KQSA 3VR0A 2DKOA 1J5EB 1GSAA 1IVYA 4CT5A 4KLZA 5DVZA 3LC7O 2WM2A 4G0NA 4PPFA 3L8YA 3MQ4A 2VT2A 4MUKA 2ZR7A 1XZEA 4OL0A 4TLCA 5H70A 4KWEA 4ZI7B 2B1QA 2ZCUA 3WMRA 4HMOA 2GAAA 4EB0A 4UQOA 3RH0A 2IT1A 3ZLBA 1G7TA 3IUQA 2C88A 2JZNA 4WT7A 2IYSA 5INTA 1ZH8A 5JH7B 5EI5A 3TMAA 2G88A 5AKLA 2AC7A 3K1AB 4MA0A 1QGED 1HY3A 1X7WA 1Y3FE 3LDAA 1BMDA 1VGVA 1UBHS 3BB1A 3IC5A 2HA0A 5DO9A 1IHXA 4MWOA 1KZHA 3RVSA 3LZDA 2CLMB 1X80B 4J0GA 5EP1A 5HZKA 2J7PD 5KNDA 4G65A 1MTZA 2VNJA 4MZDA 3AY3A 1VE3A 4PQRA 3WLJA 2D1FA 3DCJA 2Q1SA 2VUIB 2CFRA 3HZHA 4G1VA 1QYXA 4X95A 5DWDA 2QR2A 5ESDA 1ZW6A 2XNDD 4AM8A 4ZTUB 5CDUA 3LT1A 3N2YA 3PKJA 3AETB 3JWJA 2PQ2A 5EL0A 2CJPA 3TVYA 3ZU4A 3T5CA 1DV2A 1X3SA 1L5ZA 1PEAA 2FJPA 4QUJA 3QPAA 2PNJA 2BGNA 1YE3A 2Q3BA 4NCHA 3HI4A 3WV4A 4HDNB 1U80A 1TYBE 5IAJA 1MTOA 5H82A 1YA8A 2BMJA 2X86A 3QX9A 1QYWA 1G4AE 2R11A 4DKXA 2HT1A 5IK2A 3H13A 3MERA 2FW9A 3GPBA 3HS3A 4JL6A 3DOEA 1XF9A 3OM1A 1JSRA 1SKUA 3JVUA 2FK7A 1DT5A 2XVAA 1ZCZA 1BCSB 2FMKA 3F5DA 1O6CA 1X1RA 2YZMA 3BS4A 2WT4A 3DMRA 1M1UA 4RF4A 2C42A 1QMGA 2CD7A 5EEGA 4DXDA 3EX7C 1VJDA 1USIA 3GFQA 3LQKA 3CPJB 4HWKA 5I9SA 4Y7CA 3JWEA 5J63A 5BNFA 2Y6VA 2LIPA 3NDIA 6CHYA 5K0ZA 1ENOA 1KAOA 1NVEA 3K09A 2P3QA 4QHTA 3JVEA 1MGPA 5AKHA 4E88A 1H2AS 1UUFA 5G0VA 1FXUA 1MENA 1H93A 3LBYA 3W78A 2RH8A 1SXPA 3ZEIA 4CCYA 2XV1A 3GK3A 4QYXA 2Q50A 2YXNA 4UM9B 2ZI4A 2C9ZA 3DHYA 5C8VA 4W5RA 1JSXA 1U8UA 1THMA 1XELA 4Y2PA 3ZV3A 3CF0A 1AKWA 2O06A 1CUGA 1IEQA 1QK4A 2WVAA 4ZP1A 4PLCA 3WK5A 2DB3A 3R5HA 1GGVA 2FTKE 2G7ZA 2Q45A 4FYWA 2C2KA 1T1RA 2QSZA 4A8JA 4CJXA 3HEAA 4AJ9A 4BKOA 2QYSA 2R62A 4PN3A 3OO0A 3BFPA 1O9GA 2ONYA 5ALHA 4MQ4A 1CKEA 1PUJA 1TMGE 2AWNA 4H7HA 1BXKA 1Z9BA 3RREA 2C59A 3ETJA 4YP5A 4I3GA 3KHUA 2LGJA 4XX0A 3DMTC 4P7FA 2ATEA 5A4DA 2JG3A 4RFSA 1NGSA 1F1BA 2XRYA 5F7JA 3VPAA 1U8YA 2JKYA 4PX9A 4UC0A 5AOBA 1VLLA 3CIFA 5DXJA 5T57A 4BTLA 4DUGD 1XFDA 3K94A 4ZVRA 1L1FA 1NPTO 2IPNA 3M5CA 4JI0B 4RAOA 1M2FA 2GILA 2I87A 4YFYA 4ERNA 4X7BA 3FHCB 2HFKA 3NV9A 3LY8A 4M0UA 1JHXA 1UH5A 4QBGB 3N6XA 4D4HA 3PEFA 3AH8A 3K2IA 2J0EA 3CF2A 3Q3CA 4GM1A 3TG2A 2NSHA 1IEXA 3EMBA 3HL0A 3RSSA 4C43A 5ALXA 3EFHA 2Y66A 5A4MS 1KC1A 2BBOA 2BIFA 3C97A 3NCTA 1BXRA 3OUTA 2NTEA 2O7SA 4FYKA 1SZCA 3NP9A 1DV1A 1E2DA 1QE3A 1QZXA 2B7BA 2PJZA 3B6ZA 4JBWA 1Z7EA 5KCZA 4RK0A 3OT1B 3L84A 2JFYA 3NALA 4Z54A 4ZQFA 2O3SA 4FW8A 4ARVA 1ABFA 1RC8A 4QOJA 3ILHA 3WWPA 2BFEB 1A4RA 2RGXA 3TD6A 2GUWA 3BD8A 3W9SA 5IWCA 1M10A 3F9IA 1ZJ5A 2O3JA 5LC1A 2J5QA 1EVKA 4PYOA 5BQPA 3GDHA 5ALOA 2XE6A 3SSMA 2YOFA 1I3LA 5JFOA 5LL6P 1DHTA 1UK6A 1SOAA 2P7HA 3SP1A 5CU7A 3TNDA 2WICA 5C5EA 1C9YA 4AO7A 1DAHA 3NXSA 3GEPA 4JR0A 4LY9A 3CU5A 1HTWA 4CR6A 3H7IA 5CDYA 4YT5A 4E1VA 2JFBA 2Y9MB 4XQ0A 2F8TA 2G36A 1N3YA 1BN6A 4RK4A 1ZDMA 4GF5A 4OBBA 5CB8A 2IK8A 5LOVF 1K7CA 1TM3E 1NONA 1ZU4A 2JHCA 3ORQA 4GRAA 5FO0A 2C2YA 1IVNA 3AJAA 2RI6A 1JHPA 2JZCA 1NWCA 1TF5A 2NU9A 1DRVA 1FXWF 2GM5A 3I6ZA 3TLGA 5FT9A 3WNDA 1M8JA 13PKA 3F5QA 1K0UA 3GGGA 5TQ0A 1BHJA 3PNPA 3V5NA 3BREA 4ZDJA 2GPJA 1PVVA 3IHLA 4H7PA 2X6RA 3HB4X 3PEVA 1SK8A 2LKDA 5ED0A 4B4OA 3CSUA 2QTNA 5AK0A 1K97A 9LDTA 1EXNA 2IP4A 1TJ3A 3U48A 2OENG 3P2IA 3OP4A 2MTBA 4DLRA 5F2EA 1FU8A 2IYNA 1KH3A 2YWRA 3SMQA 3T7RA 1V95A 2CUKA 3GJ5A 2G0TA 2O0MA 1P75A 2XUOA 3QQPA 1QDEA 4IIFA 4XD7D 4CM1A 3IKMB 3RK0A 3PJRA 1MX1A 3TD9A 1YK0A 4WOBA 3ZTTA 1OH6A 4CMJA 1QOPB 4LJ8A 3RVDA 3ZGZA 4EI7A 1FDWA 3ZWWA 5CXQA 4YMVA 4L5JA 4MUJA 4QUDA 4TWBA 2G5GX 1HEYA 1M1NB 2RGYA 3OT5A 3RRXA 3RYCA 1JBKA 3A70A 4HJXA 4QUIA 5I01A 4R9UC 2A3RA 4LE2A 1N2OA 4LHEA 1M76A 3TJRA 1R0RE 1JLLB 5CYFA 2B5VA 3RKRA 2LV8A 3T15A 4EBBA 4NNOA 1AKRA 4D41A 5IJ0A 1NMEA 3T0GA 2PXHA 4J76A 1BHSA 2PZBA 5KC8A 3BFXA 2Y92A 2ERCA 2WU3A 1E2QA 1UDCA 2EVWX 4AKIA 2WHQA 5THQA 1XAJA 3D4NA 2R8EA 1U90A 3KJXA 3ETEA 1ZKMA 4G0PA 3DFMA 3VMFA 4KW7A 1Q14A 5H7XA 4WCDA 3F3YA 2WDZA 5E0KB 2IRWA 2GFHA 3CNEA 3BMXA 1GYQA 2C5BA 4TLEA 4CM9A 4GVPA 2WKPA 3GRCA 1AOXA 1OYOA 1IPFA 2FSVA 1UT5A 3CA8A 1ELOA 2XBLA 1K9VF 3HUUA 3I6MA 3NOXA 5B2EA 1J8FA 1GCIA 4QQ8A 4ZAXA 5IBQA 4ABYA 2AX3A 1GD1O 3IR5A 1G3QA 1ZD3A 2FG6C 4ENUA 1MC1A 4OM7A 3CLTC 1JDPA 1ZOIA 2Q5LA 2EEPA 3QLVC 3OM0A 1ES9A 1SMKA 1ODCA 2L19A 2EJUA 3H84A 3Q3HA 4IWNA 4JBLA 3UT6A 4HAIA 3RWBA 2P1RA 2BKVA 2QMUA 3H3FA 5T6MA 1E1LA 1ZW1A 1QHEA 4RJ2A 1FY2A 3KKPA 4YP7A 5JAQA 3ECAA 1L4GA 2GHRA 2XWJI 3EUAA 3ZIAD 4AXBA 1L5HB 1IM8A 4L75A 3K31A 5C1BA 5L3ZA 1S2DA 5CYGA 2IHYA 5KSYA 4HKTA 2B1JA 5JDCC 2JI9A 3QOXA 3I9JA 3ZUGA 4NAVA 2GESA 1T9GS 4PO9A 3I05A 2OXRA 4FFVA 4B0PA 2UZIR 2FPXA 1O1YA 4U2DA 3GBSA 4AB1A 3S28A 1YB5A 1GY8A 4FFMA 3TZEA 1TKCA 5G40A 4Q4CA 3VX4A 1AHHA 3GL9A 3DDNA 2XTZA 3AERA 4R4JA 1XN4A 4RGVA 2PZKA 4CL2A 2VSNA 2ZR9A 3O74A 1CU1A 1E3LA 4KO3S 2YQ4A 4QVIA 3GLHB 3NTOA 1LSUA 1YQXA 3MC1A 4KO8A 4HGQA 2VUUA 4E2YA 5JR3A 2YWDA 4R2MA 3LPNA 4A1OA 1KZGB 2QX7A 3O1HB 1M1YE 1E1DA 2VJOA 2QU7A 4Q39A 4Y1FA 3JCZA 3W9BA 4YUXA 4QNNA 2BMAA 2J5RA 3JARB 4FN5A 3HJRA 4PC6A 4B83A 4GLLA 3KKKA 3NNNA 2YRXA 2PMEA 4YH1A 1B3RA 3CH4B 1UKEA 3SEFA 3UK1A 4FSDA 4F8YA 1ITZA 4OO3A 5H1YA 4W9RA 3UGQA 2O8BB 1SVOA 1SBYA 2Z58A 1AXRA 2MSCB 3I0MA 4HGRA 4PYMA 5ALMA 5CCEA 1DFHA 4OGLA 2XWPA 5H02A 3SBXA 3M1IA 4YNBA 2R1ZA 5KKCA 5AXBA 1X7ZB 2IY8A 4ZQCB 1W36B 5K3SA 1PJLA 5FJJA 1HDRA 1QO7A 2Q6OA 1MH9A 2CD9A 4HX2A 4R9NA 4WN3A 5DJ5A 3A06A 4BKMA 1VRVA 2EZTA 1ZK0A 1AS0A 3D3EA 2CVPA 2PUFA 1CR6A 3GFOA 1HDEA 4MYDA 4PQYA 1BOFA 1YKGA 3BRWD 5HJ2A 4EY6A 3DAFA 2VXYA 5C0OE 3Q9SA 3UWSA 4CMBA 4S35A 1H2FA 4LCEA 4MI3A 3N7TA 2JJ1A 2J8ZA 3EWNA 4RL6A 3THWA 1D2NA 2C9YA 3BWYA 3HJUA 1WMAA 4I4TB 3LHFA 1FIUA 1SQ5A 1W2GA 1UQRA 5ITZB 4TT3D 4M88A 3SF8A 4DR2B 1Z38A 1LPSA 1JJ7A 2QZZA 2H54A 4Q3NA 4OHPA 3EAQA 3KHSA 3AUJB 621PA 4PC1A 1Z0ZA 1Q2XA 3JX9A 4K9KA 1DDOA 5IKOA 1GPDG 4Z3DA 3O7WA 1EDBA 3EFEA 5ED4A 1OREA 4WECA 2CNOA 3GLFA 1ORHA 2VHVA 4WKCA 2O0JA 5LP6B 4I4NA 4M8NE 1Y9AA 1VP3A 3RJTA 2JLQA 2A4MA 2C4VA 2KLHA 2QMHA 4LDAA 2OBFA 2XUIA 4O4IB 4PAMA 1RWBA 3HG7A 4XGKA 3E9RA 3VPFA 4DLKA 1PNQA 1QF7A 1GDDA 2VQEB 4MNTA 1JIKA 1XHFA 2D0IA 3IAFA 1MRSA 2PFGA 1LCIA 4V24A 2QYHA 1QWSA 1U8ZA 2OM6A 3ZE9A 4IUYA 1T1EA 3WSVA 5JNRA 1CUIA 1M54A 5HIJA 3ZDXB 4LS3A 3SM9A 4ENSA 2WHPB 2MSKA 3PZBA 2Z5GA 4Q7MB 1GZUA 1I1OA 1XJ0A 1CUXA 2G07A 2I3DA 2Q1WA 5TC4A 3ZLTA 4E5PA 1XT6A 2H51A 2GXQA 4BMVA 3BRCA 2BI7A 3DE2X 1OBCA 1Z2CA 2WINI 4N40A 2NZ8A 4RH3A 4M9SA 2IE8A 1K3TA 3EIHA 3WR5A 3AVWA 2KW5A 2XVXA 3WHLA 4R40A 1MLDA 5JRDS 3WYDA 1ZK2A 4GM0A 4HADA 1GWNA 2C9DA 5BQOA 1VMAA 1VL2A 4JSYA 2CLSA 2JI7A 3JSAA 2LUOA 4UTZA 4QSHA 2IKQA 3C7KA 1N1EA 4WN9B 4M9RA 1NXVA 5TARA 1QH8A 3IT3A 4ZI7A 3AJRA 1NMQA 1FRQA 3SYRA 1PLLA 1I5RA 3SZLA 1IY2A 4G8CA 1H8HA 2G6TA 4R2IA 3NRJA 2MYNA 1RHQA 2GEDA 3FCAA 1TZ2A 4B6EA 4HNAA 3Q85A 4MB0A 4YCSA 2HK7A 4ZXPA 5JECA 3AVTA 2OHJA 3B5IA 2ODNA 4PLGA 3TO5A 2XSZA 1B6GA 2PKWA 2DHCA 2CY0A 1X7YA 2XITA 4RD0A 1XAHA 1IN4A 3OFNA 3T5AA 1ID8A 1EDOA 3E22A 1AA9A 1E5DA 1R8JA 3COPA 1FFAA 1EAYA 1TEXA 1ZESA 3TIXB 5JASA 4MHTA 1VTKA 4IILA 4YJ2A 4B76A 4MS1A 1YZGA 1FSGA 3OCWA 3NHPA 3VO9A 2GEKA 3T7SA 1WLYA 3FH0A 4YCLA 2IJGX 1NM5A 4GKVA 4CKXA 5JC1A 2FW6A 1Q12A 4RCYA 1GVNB 1IHDA 4BGIA 1W36D 5MGNA 1EMDA 4NE2A 1SVNA 2OV6A 1EG2A 1GG9A 3L0DA 4U9UA 5JQGA 3PTZA 2W70A 5EKSA 1KXZA 1EFCA 3IBSA 4KO4S 2QT0A 4DZTA 1U94A 4IRXA 4OLBA 2WTUA 1XRJA 1WUJS 1YZ3A 2H5JA 3A26A 5E0OA 3U7IA 4B44A 4L6IA 1BWPA 4FHDA 1Z7WA 2GOYA 3CVVA 4M86A 4CL3A 4YJ3A 1LNQA 2Q5EA 2EC5A 6ABPA 4G84A 4WI1A 4A8PA 4DRZA 2Q7DA 1Z16A 3HO6A 4RSHA 5CNJA 2QZSA 4QRIA 2QVBA 3A37A 3EZ2A 3CUTA 4B3FX 5C1IA 3HDQA 3Q7RA 2IDMA 1P4JA 4OFXA 3TI9A 5EE3A 2J7PA 1V8DA 5KNDD 2VQSA 4OKIA 3G8CA 4KN5A 1H4SA 3DYIA 3GEEA 3GMTA 4PU0A 5CURA 3JVVA 2EW2A 2RI1A 1J0AA 1P6QA 4DA7A 1K3FA 4H1WA 3AEKA 2CV1A 1W8DA 3WLPA 1COWD 1VKJA 121PA 4QBHA 5CVDA 1BMFA 1XQ6A 1GJRA 3P2JA 4PSDA 2CJWA 3NDRA 4FX5A 4QPNA 1O94C 5AJUA 2PS0A 4ZEXA 1RDFA 3IXQA 3BKWA 4GX5A 4Y2VA 8LDHA 3CMMA 5ALJA 3LECA 4LX8A 1BFUA 4NYJQ 1M8FA 1G6HA 2JFNA 4FC6A 3ZCTA 4KH1A 3NBZC 1CUUA 2CFOA 5B58T 3T41A 3MRVA 1SC4A 1QV9A 5EAIA 2XCOA 3CMCO 2IEZA 1Y3BE 3AF4A 3FLMA 1L3IA 1G9XA 2YIDA 5C34B 4H35A 3KTOA 1DJMA 4YPOA 3K7EA 3MM4A 5ER9A 1F20A 1L7XA 2ZYWX 1UINA 2OB1A 3E2IA 1A8PA 4KX5A 2C3UA 3RAGA 3HJFA 3MTEA 4BNDA 4P34A 3B48A 4QTUB 2ZRLA 3FSGA 3MUFA 3Q9NA 2EL9A 2AE2A 3C3AA 4L6AA 3URMA 2ZJ5A 3AO0B 2PAAA 1GT6A 1TO2E 1DI0A 1RABA 3ZCQA 1MXFA 1QE0A 3VPCA 4BVAA 3CF4G 4GQBA 3BXPA 1KGSA 2JRLA 3F78A 3IH5A 3ULKA 2VJLA 5JMOA 1XEFA 2BKXA 2ZYHA 4TKUA 1YBHA 3ABZA 4S0XA 4MP3A 1KVUA 3R7AA 4B47A 5EWLA 3G9QA 1P0IA 1Z5ZA 4MWSA 2FMXA 3SDSA 3H04A 2XZTA 2Z1DA 2YTZA 3FFXA 1Z45A 4TV8F 4JOQA 1ZNQO 1PCXA 2G76A 4PLYA 4V0LA 4CLXA 1FP1D 3OZRA 4IOMA 2ATIA 3T12A 5JVDA 2NO5A 2WSYB 2C2WA 2PKQO 1KJQA 1U0FA 2OZLB 5HKLA 3N74A 1HTBA 2VYND 3D4IA 3EHDA 3MWEA 3CYFA 4JODA 4OM8A 4XQCA 3VR4A 3FOWA 2GWHA 2Z98A 1GAWA 4NHOA 5U9CA 1A5BB 1JL3A 2JD1A 1ANKA 3A1NA 1OROA 1DAEA 4KMRA 1KPGA 3T8YA 3ESYA 3UTCA 4GGOA 4FK8A 1S2NA 2PRIA 3NATA 4RF2A 4A7PA 3LQ4A 4Q5IA 1P2TA 1XFAA 3IB3A 1W6RA 3COZA 5CXXA 3EVGA 4JR1A 4F04A 3BD7A 1Z6PA 4L22A 3SGLA 1YULA 1WQ4A 1P6XA 1DQNA 2V5AA 4ZT7A 1QUEA 5EIXA 4DUGA 4M60A 3A32A 3NHFA 1R66A 3IVAA 5GP1A 3TF5A 3OJEA 3I9FA 3AP3A 3F4KA 1HC7A 2BM9A 2H18A 1RM3A 3UPTA 3EA5A 4C6TA 2A5YB 5AK6A 2QKYA 4FYXA 3HKDA 5EHQA 3JALA 2OOSA 1K6EA 2EKLA 2PL3A 4V2UA 3LAWA 1WCV1 5AO9A 1IY1A 1N77A 1I3NA 2VDKB 4DC0A 2F9FA 3G5MA 3I9LA 4YBRA 1JDVA 4GXQA 3SSOA 3UAOA 1JJAA 4LOIA 5BORA 2VZ0A 4Q7QA 2W58A 5EZYF 1F8GA 2YZ7A 3FE2A 4OAQA 3MWJA 2W2LA 2D2XA 3D0KA 3TQSA 1QDLB 2CEKA 2NYVA 1G20E 2O2IA 4E13A 5LQNA 2QVGA 2QTAA 3CX8A 1LBHA 4R83A 5B4UA 5HNKA 5JQWA 2FUKA 4O4IF 5CMLA 1I5EA 1Q7RA 4AG3A 1N2XA 3CX4A 5K99A 2PWZA 3N70A 5JEDA 4TYWA 1H5NA 1X7HA 1NKSA 1VCNA 2WP8J 5FUYA 5DSXA 3ZX4A 4P0TA 3C70A 2C4HA 4DV5B 3TTVA 3KCQA 1LLQA 2JFPA 2O5VA 3EG9B 1SG0A 1XVIA 4NH0A 4PXSA 5DBIA 1YE8A 2UV8A 4F6RB 2ZYUX 4Q1CA 1NE2A 4DR6B 2DYKA 4RADA 2PJDA 3ZV6A 4WESB 1YRAA 1FPMA 3HWSA 4ISBA 1FDVA 1SCAA 4BO5A 3K9QO 3AR8A 3PR2B 1TMYA 1ZL0A 4MS3B 5CPFA 1R0BA 2V03A 1EBUA 2UZ0A 2M1XA 4HXEB 1O58A 1O95C 3IV7A 4OQXA 3ZDFA 1EESA 1QQ5A 2OB2A 3JS5A 1MKYA 2BJWA 2Q29A 3PXGA 3R7NA 3UMJA 3MVEA 4BKUA 4QASA 1ZU5A 5H16A 4IEIA 1NPYA 3LO5A 2HBRA 4JYBA 1LK0A 2I8AA 4IXDA 1QFMA 2VTEA 2FP4B 5CJ2A 5A06A 1C5KA 3DEZA 1UM8A 1FS6A 3F6BX 3H19A 3KTAB 4HMQA 1PAUA 3U80A 1WUHS 4L8YA 5TEWA 1DUSA 3HXTA 4EAQA 1IZ0A 5E4TA 4Y2GA 5ECDA 3F67A 1DOAA 4JSRA 4ZVKA 2IUYA 4D43A 5HVNA 4PSVA 4ZCIA 2HCRA 5KI6A 3JRWA 3FSEA 4IAOA 1IM5A 1A5AB 1DQYA 5FL3A 4H7FA 1OPXA 1MNAA 1CEEA 2RH9B 4DCSA 1R4AA 4MJ7A 1CNMA 1XZAA 4BBJA 3S3TA 1TX4B 5HK9A 4FS8A 3RJ9A 2R44A 1YCGA 4OJMX 4QECA 3BTUA 4I2VA 4KPFC 3RFFA 3S40A 1R16A 4QAQA 2C3OA 1UR5A 3DE4X 1GQ2A 3GJXC 4BMDA 5JZSA 2XQKA 2D2VA 1G17A 3I2YX 2ZSKA 3Q87B 1JHVA 3O4HA 4HYTA 4B3RB 5CVTA 2AEEA 2ZVQX 2J9YB 3EH2A 2CE2X 2YN0A 2GNAA 3GGOA 4CF6A 4OQYA 2WQ6A 4YRTA 3L7NA 3PSHA 2O2JA 4YN3A 3O21A 4F85A 1E62A 3H87A 5JYCA 2PTGA 4UUMA 4TRMA 4TLDA 1NW7A 1VJ5A 1E3DA 3AY6A 4XFJA 3WDLA 1GITA 2PKRA 4RHXA 3RS2A 4FKBA 3MW8A 2CLCX 4AYXA 4DDWA 3DFKA 3PTLA 5GM1A 4B3XA 1UJ4A 1LGYA 2D1TA 2P3LA 2QIPA 3D3JA 1KI7A 2A5JA 1QFJA 2AYXA 3GQBA 3UA3A 1DDGA 4CQLA 4DLAA 2FZKA 5H5JA 4O5OA 4CKBB 4RMGA 2Z3WA 1LTHR 2BLNA 3GRRA 3AIIA 3FWPA 3OECA 4MGZR 1P2BA 2I3GA 2PLRA 3QP9A 2AK2A 3O91A 5HF9A 1WDKA 4Q6BA 4RPJA 3RHSA 4BDSA 4Y30A 4DJ5X 5IT5A 1DAKA 5IUJC 2QBYA 2I2AA 1JMYA 5E1MA 3HWRA 1YI1A 1YA6A 3BWVA 1BFKA 2Y0CA 3EEIA 4OXYA 4R7GA 1TTQB 2WG0A 4LF9B 2IGTA 4FDUA 3G0HA 2YUIA 2BBSA 1KZ1A 3C5WP 4HR7A 1CP3A 4HLUA 1CDEA 1SXJA 1GGNA 4RLQA 4DVJA 1H1DA 2BD0A 1ABEA 2ZPUA 5CDFA 1WVGA 2ZAGA 3L1HA 4F4JA 1NW6A 5IKPA 2XYRA 1QGAA 4DQDA 2IH4A 2CVZA 4GX1A 5K0TA 1Q1EA 4IJWA 3UFBA 2YH2A 1PJRA 2AFHB 1O96A 3R3VA 3ZW7A 4MUAA 4DABA 1OHHD 2XE7A 3L6EA 4XE5A 4KRXA 1S02A 3S8MA 2G9NA 4GXNA 1F60A 1W25A 1QKJA 5FTMA 3U4QB 2B8EA 4GRDA 4D02A 1C9MA 3LQYA 5KX5F 1EXMA 3P52A 4RKWA 1KI2A 1ZM7A 3B78A 4B3JA 3STYA 5HIAA 2DWPA 4J0QA 4B87A 3SD7A 4URHA 1S3FA 3LQRA 5AUNB 3L3BA 1WDMA 5CVCA 3V1UA 3GRAA 4OYYA 2WJVA 1AG9A 2XAUA 3V4VB 3VAYA 2IPAB 4PAGA 3WLHA 1HNZB 2F43B 3HBMA 1IXRC 2QA5A 1LI4A 2ONJA 6GPBA 3H5NA 5JDIA 3SBDA 2PZFA 3JAKA 3P9QA 4HTFA 2W2TA 1I1NA 3T9AA 2ZIXB 3H2BA 2XYVA 4WX2B 1T35A 4KGXA 4BNHA 3E3LA 4Y2UA 2A1IA 2J3EA 3TFWA 5B7QA 2IIPA 4S12A 4HLQB 1QHSA 3GFTA 3H6HA 4EJSA 4NARA 1A76A 1QHYA 1E6WA 2FWAA 2Q99A 3OE7D 4CV2A 4ZYYA 3H9EO 5IJ9A 1KL7A 3L7YA 4AKGA 3BTVA 4MQMA 2GBCA 1RCTE 3FXAA 1HGXA 1XTUA 3USZA 3V7NA 1Q5PA 4I81A 2UUBB 4LRXA 1S3GA 2VT7A 3L7AA 3GD5A 4YJ3F 1WD7A 4Q7EA 3F8SA 3MUEA 1FLAA 4BMZA 4DCJA 1Z6GA 2Z1MA 2HBQA 1L4YA 4E4YA 2OO5C 2D8AA 3KWMA 2IV2X 1YDHA 4TS1A 4ROSA 2YJNA 3O7MA 1SZDA 3G49A 2PGIA 5KAPA 3EEBA 2OLJA 4D9CA 2A2ZA 4O59O 1JEQA 4PX3A 4R7TA 4PYRA 2JEOA 2O2CA 3IEMA 3LCRA 2IOQA 3EMDA 1PS0A 1OXMA 2DERA 3HB5X 3A3OA 4R8SA 1HQKA 4OI0A 3EVEA 5BSKA 1JQBA 5CLGA 1KQNA 1EUQA 2O2DA 1FLNA 5I9BA 5EXEA 4N1AA 2OCKA 2EGUA 1Q0PA 2VF2A 3NO4A 3ZZTA 1R4ZA 2JD2A 5E7JA 5JLAA 2GBIA 4BNNA 4F84A 1ZFNA 4QOGA 2WWGA 2PUVA 4LZJA 5BMVB 4UKDA 1QG4A 4LF4B 3OEWA 1WKCA 3K1ZA 4EZEA 4C06A 1C0LA 1P45A 1L4BA 1ZINA 2V4MA 5J4HA 4KQGA 3OKPA 4QDTA 4B8YA 4DMMA 2GKOA 4YJFB 3PTAA 1Y6FA 1C1HA 3G02A 2UZ3A 3ND9A 3PU6A 1DC3A 4WPGA 2FDRA 1W29A 2NTJA 3GLHE 1KIMA 1LQTA 2JGIA 3E8MA 3B6JA 3FNBA 3HDJA 1PYGA 2AWOA 4JX9A 5H81A 3SDZA 4C4XA 5JCXA 4C5CA 1V1RA 4II2A 4JUIA 2D5CA 4MVJD 4US1R 2Y76A 3PDUA 4V0ME 3T38A 4A8JC 1K68A 4L57A 1C8BA 2VAXA 3M4ZA 4JLSA 3TZCA 4N5IX 3T7JA 1TAGA 4R8RA 3EGDB 3NU1A 1Y9ZA 2FZEA 2MINB 1WQ1R 1G6Q1 2WTEA 3DM5A 3H17A 4HWTA 4RQBA 5B37A 3C87A 3WJAA 4AX8A 5LSAA 3N0TA 1AH2A 1OGIA 1WMDA 4MGYR 4O1IA 3LY5A 4D79A 2AK3A 2POCA 2CL6X 1GPMA 3P71T 5DOZA 5FUVA 1J0DA 5LKAA 2E6UX 4NICA 5C2JB 1JXAA 4QHYA 3OTIA 1QH0A 2C5FA 3QEMA 3RWOA 4QGSA 3TRFA 2FMHA 4NENA 4D0GA 4DQUA 4OI2A 3FPLA 3EVFA 1UAAA 2Q9BA 5JROA 4MPDA 1T8WA 2HQRA 3G89A 4JVOA 1YIOA 4X3CA 5BW8A 2RHTA 1QP0A 1HORA 4IW3B 1G8AA 2DBVO 2CLIB 1NBOA 3RC7A 4EARA 5GONA 1BH6A 1VKRA 3FCXA 3TZLA 1R3UA 4OP3A 4XR9A 3REOA 5IAKA 1RAHA 3UGJA 1AT1A 2H9AA 3D8NA 5B55A 2AG8A 3MTQA 4K5QA 4P4SB 4UE2A 3PQEA 3F2IA 4ECEA 1E8MA 2DUNA 2GBPA 2C1EA 4WKBA 5BWLA 3ZE2B 4LHZA 5BR1A 1E6UA 2EKDA 2IEDA 1U9ZA 1UC4B 2H0RA 4CLEA 1AUVA 4K46A 1XZGA 4C05A 1CR2A 4MRAA 2EP8A 3C98A 3AUUA 3OWHA 3QUAA 4H3VA 1EYZA 4B5LA 3I6BA 1C29B 3UK7A 2XUQA 2V7GA 5AK5A 2E4XA 3OOYA 2O8FB 1W35A 2Q5CA 3EDRA 1BJTA 1T4BA 2YRFA 5LWQA 1H0SA 3T7CA 4A9AA 4B1FA 1IATA 4XB6B 3NHJA 3BH7A 1VFNA 1P19A 4KZKA 4WKGA 4TRJA 2A9VA 4XWGA 4OKSA 2OBNA 3G8DA 3DEYX 4ZVSA 3ZWOA 4BX9A 1PK9A 3C6QA 4B3IA 1TL7C 3M3PA 3DDSA 5CH8A 5COAA 5E6SB 5A5DA 3WOHA 5JVDF 1KSGA 2DQSA 3GJQA 2ECPA 3NEJA 4RENA 1AKUA 3ENVA 2ZIXA 2ZQYA 3DQQA 3TW0A 1DKRA 3RF6A 4HMPA 1DWUA 3RG8A 2ZBDA 1XALA 3RQSA 4G5SA 2HRCA 4NR0A 4F4IA 4F2DA 4CIAA 3OEYA 3DT8A 2B7LA 3K2BA 1Q0LA 4DR7B 1E1CA 1U7HA 3NBUA 2CXQA 5AT1A 2OFWA 2FXVA 4TKLA 3MOIA 4PO8A 4Y1RA 1U02A 1UDRA 4NZOA 3MCWA 4W7HA 5EIHA 2WZDA 4PZAA 2FN9A 1ZN7A 3WTBA 5AKGA 4FW9A 1KK3A 1U6KA 3VU9A 2WKWA 2CCKA 1IBMB 3D0QA 1XNQB 4BNVA 1BMFD 2JZOA 2W71A 5H3CA 3FOFC 1KF0A 4P35A 1E6LA 2AN5A 2D74A 3EXHA 2WZBA 1ODFA 4PTYA 1K8QA 1V25A 3CRQA 3A9UA 3FHLA 1CEXA 4UU0A 1I14A 3RD5A 5AW4A 5ALLA 1KO7A 3CLSC 3DZBA 2IWRA 3JQEA 4JP3A 2XJ9A 3FETA 3WHPA 5A4KA 2YQ5A 4FYMA 1U65A 2VXCA 3BF8A 1A7KA 2IUEA 1L6RA 3QUTA 1U5BA 4I1RA 5GVRA 2WE8A 2C3YA 3PP8A 3D7NA 4BY9E 5JSZA 1NLFA 2PUJA 3CCBA 5WRFA 3OBBA 2JGKA 1DEOA 2FPIB 3PDCA 4M9QA 1NDHA 4UCQA 2D1YA 4WY2A 2VRWA 4UZEA 1A77A 1DG9A 1DAMA 2HT6A 4H08A 2Z6UA 2ISCA 4P3OA 1KJWA 3EAGA 3ZH2A 1H6CA 2CHVA 4YRDA 4KXQA 4DFDA 1U3WA 1XVVA 1QZTA 1GPJA 2WTMA 5E8RA 4QDUA 4I50F 1FTQA 1MJHA 1DGQA 4QQFA 3KJHA 5L4SA 4LHXA 2MOKA 4ZYZA 1RBQA 1P4GA 4P5EA 1P18A 2R1VA 4OXXA 2F8LA 3WGVA 4V0KA 1JECA 4YJGA 3OCUA 1AQJA 4G63A 2NZXA 4ABTA 1MV8A 1C0IA 4HQFA 1DBWA 1JT9A 1MPTA 1VRCA 1V1MB 5C8YA 1GLVA 5BQ3A 3MD0A 3ZK7A 4NZNA 5EP2A 3IEKA 1K1EA 5IXYA 4R0NA 2DFPA 1RI1A 4OQ4A 5JWHA 4X84A 3K1JA 1GTVA 5H9WA 1B41A 2ZB2A 4A6PA 4DYDA 1RJGA 3PRYA 2O2HA 1MRZA 1GZ4A 4O4IA 2GVZC 4U39A 3SEZA 4D3SA 3KWJA 5C4IA 1G0OA 3QLVA 3RJZA 3DGEC 2H3HA 2O7RA 3VR4D 1FFWA 1D0VA 1KOLA 4NU0A 5AVVA 4RVOA 1E9RA 4X00A 5B7PA 4EHDA 2JBWA 1XOIA 4KXWA 4DLWA 3INNA 3LDGA 1OXSC 4JI4B 1LS1A 5ANRB 1IOVA 4LKRA 4M0KA 4ZT5A 4IUCS 1E98A 1T6ZA 4AKSA 4D8YA 4YV1A 5IASA 3SC6A 3VM6A 2UUPA 5ICCA 2HEGA 1P31A 2ZRDA 2CXHA 5FWDA 4DLNA 4P84A 2X2OA 5CFPA 4IEFB 3E58A 4NPCA 1Z8HA 1JSZA 2IX3A 1L8LA 3GEDA 2WA1A 4XUDA 3TAXA 2GN0A 3T1TA 2P2YA 1GIAA 5AQEA 3KR0A 4DLPA 2O20A 4HVLA 2WZCA 3BB3A 2ORED 2QTRA 3E9DA 2IU4A 4C7OB 2YDYA 4OFZA 2FSFA 1ZX1A 1OI2A 3WYCA 1Z18A 2Y8EA 3L77A 1FLDA 5FXMA 4AY3A 3O90A 3D6VA 3C74A 2CDAA 3KKMA 7ABPA 2QBYB 4LUCA 3ASYA 2ZDQA 2QVYX 2ZIEA 3TUZC 4I6GA 4DE5A 1NNUA 2E6KA 4HSEA 1TAQA 4OQNA 3RBXA 4LJ7A 5B3AA 2OL4A 2UYOA 2BC9A 1VL1A 2PL9A 2Z57A 2PWAA 3IHTA 1FP7A 1GQSA 2DFVA 5DBOA 2P79A 3FPEA 1KDTA 5CA1F 5E2IA 1IWBB 1LD3A 3PNOA 4RA6B 4Q24A 4K2AA 2FH5B 2YVUA 1KC3A 2WWYA 1TAHA 2W93A 3GGDA 3P2OA 2V4ZA 2ZU6A 3C6KA 2HN9A 4X41A 3KB8A 3AR5A 1TLLA 3LYAA 2B5WA 1DS6A 4IIHA 4MWCA 2QJFA 4NX2A 1JA1A 1ZS9A 3WLIA 2QRQA 4DMKA 5CA1A 2FQ1A 1OZ0A 4B7XA 5HKKD 1CS0B 4E03A 5EWJA 1AY0A 4MR9A 4DMGA 2VH2A 5K3AA 4CIDA 5FPQA 3PGKA 3ZG6A 3GEIA 1MNQA 3LCMA 3BWEA 3K6SA 1H2EA 4O2AB 3LS2A 3TL2A 2JCBA 3M49A 3FBTA 4C6SA 4EECA 5EWMA 1BE0A 2VDQB 3C5CA 2FPPB 1N2CA 1XAGA 4G81A 3VPDA 4X8HA 3VU9B 4FFBB 4CI0B 3GVXA 4KV9A 5A5FA 2AMFA 5CFMA 2C04A 4LSZA 5DM70 5HCIA 2BZ0A 4WK4B 3THOA 3SNKA 3H75A 4YT4A 3IUSA 4CKCB 1A04A 4KAXA 4L3OA 4DWJA 3RRMA 5ADUS 4MV3A 2FB9A 3BFVA 5ISMA 2WJGA 2GZAA 1MB9A 2ORYA 4OK3A 1N5IA 5EXTA 1I3MA 1R9MA 4S1TA 4W9NA 2QORA 4ZT2A 3TXXA 2WAAA 2Q1XA 3VVCA 1IUPA 5IZCC 5FOQA 4F9FA 2A4KA 3L0BA 4Y9SA 1TU3A 2PJUA 4ZZ2A 2VI5A 3ITNA 4YVFA 3C5EA 3THYA 4GXRA 4U2GA 1P7WA 3R6DA 5HX7A 1XHLA 1NNLA 1U9JA 3H99A 1UFRA 4BNZA 4CFSA 1RMTA 1SELA 4IFIA 4XEUA 1UPUA 4Z7QB 1JLSA 3W3AH 1SVKA 4NMXB 5AVXA 1U5CA 5EIFA 2I4RA 4YYZA 3WB1A 1IQRA 3WIVA 4JLDA 4UPVA 3VH1A 3NWJA 2VZ8A 4GZ3A 1Y81A 4R6XA 3ZGNA 3VZCA 3ZU3A 1T5SA 4DXHA 3NIDB 4RY0A 1CJSA 2FPGB 2JBAB 5JLJA 2GDZA 1VI2A 1XLWA 3RYIB 2V8BA 1C1DB 4TYQA 2YIVX 1GYRA 4W6QA 4EKNB 4JDPA 3FW1A 4Y2TA 1G5QA 1IK6A 2EARA 3VR1A 2WD9A 4AF6A 4Y6SA 3A4VA 1F2TB 4LZPA 3AFIA 4IDNA 1XGKA 4YP6A 2XF8A 4U00A 4BVJA 4A0FA 5IF9A 4CT0A 3U9SA 4JQCA 1D1QA 1VHTA 4DQKA 3D4BA 2BGLA 1MX5A 1P91A 2KHZA 2OK8A 2X0EA 4CF3A 5LNK6 2Z83A 2WMNB 3Q98A 3QVKA 2OXEA 1BKSB 4MDFA 2J67A 4B0OA 3A8TA 3HVJA 2A92A 2WJJA 1BD4A 5C35A 1TUEA 4O5AA 3VZSA 2AFIA 1PEKE 3W8NA 1DFIA 2OORC 5J1TB 3BJEA 3M4NA 1QOZA 3G79A 4B9AA 2XDQB 4EF6A 3RIEA 1MB0A 4RV5A 4R2XA 1CUFA 1Y5LA 2CMGA 4I08A 3GJSA 1CZHA 2DR3A 1GADO 2F3RA 1YC2A 3OSUA 4EW3A 3S44A 4WCFC 2EFHB 3E2MA 1Y5RA 1OH5A 2QVCA 1GKLA 1IVSA 1ZKDA 2ERXA 3CLUD 5IF3A 1M5TA 3HXKA 4C4AA 3JYLA 5KYWA 2IHKA 3IAM1 1YNSA 4INPA 2Q28A 1C4XA 2YJ5A 4TMTA 4CYMA 3V2UA 1R6DA 2XT0A 1U5AA 2QUIA 4MKRA 3QHAA 4NS1A 4O2BB 4XIFA 3H5OA 3TLJA 1LDBA 4Z5XA 4P58A 4GNRA 4PYKA 1N7IA 2XTNA 3RR2A 1U3DA 2CWWA 1HDXA 3O92A 4XIGS 3L06A 3SCZA 1U8AA 3N8IA 2HW8A 1JEQB 1E58A 1I0ZA 1PFVA 3QVGA 1W1WA 5HPYB 3L0OA 1EEXB 1FJXA 2Q5OA 2WC1A 3ZD9A 3ZUPA 1TVEA 3OIWA 3H2JA 4I4IA 1E96A 3O0TA 4MGKR 4C2BA 1PNOA 2P62A 1BGVA 2PH3A 4P4SA 4Z53A 3KPYA 1GZ7A 2E3JA 5BNWA 1EDEA 4J75A 4ZAFA 1QO9A 5CM2Z 1ZK3A 4YK7A 2A3NA 2V59A 4WLNA 4JOBA 4P36A 5C7IO 5T4BA 2VDWA 4CKZA 5HKAA 2OKGA 3VPSA 1S96A 2IXGA 3OZTA 4L78A 5DN6A 1TCVA 1F2UA 4PZUA 2JAQA 1AK2A 4AURA 2GDJA 3WNVA 4DSZA 1Z36A 1ISJA 1MO5A 3QNUA 4KU4A 4BXOA 4TS3A 4TMVA 1X8KA 3HCAA 1UOOA 3EPKA 3G88A 5FJIA 3VTZA 1KDPA 4C1BA 1XROA 1BVRA 3FCEA 4FLMA 3HPQA 4K03A 3W5UA 5HJ7A 1FP4B 4IIJA 2HNBA 3QWHA 5TT0A 1U6JA 1SRRA 1CHDA 4ZU6X 1PEDA 1SCNE 1ZZGA 2QPTA 5LDHA 4KTTE 3VJRA 1WXGA 2A59A 4PZEA 3ELYA 2GZDA 4RK1A 1ENZA 3WA6A 1HO3A 1IJFA 1ADYA 1R0LA 3RC9A 1VI6A 3O31A 3M6UA 4M1YA 4WZ6A 3M9LA 5DIFA 1YR7A 3JAMA 1UZLA 2P6NA 4O63O 1NIJA 4B6SA 4BO7A 1XN1A 2PUAA 4EVSA 1Y5NA 3OIGA 1GNVA 1DIOB 1YDEA 4RZ2A 1IOWA 5JMPA 1V4NA 4BJ5A 5FBRB 4JEHA 3QUCA 3SFTA 2ON6A 3LG2A 4NH4A 4EVIA 2XF2A 1V3TA 4BDTA 3OCVA 3A1DA 4ZTBA 1IK4A 4BEWA 1DKOA 1HT0A 3TGWA 3H5RA 2G5CA 1MOZA 2MSDB 4RIEA 4P8RA 1Z4OA 4QWWA 4XW2A 3TPFA 2I91A 2RCNA 4ZI7F 5KOYA 1K88A 2DULA 2YXBA 3M9XA 3BN3A 4XB2A 4NOMA 4BKRA 4DCOA 4XSHA 4BNUA 2RJ3A 3QTLA 5IVHA 5F23A 5KYTA 1MH1A 3HDGA 4IV0A 4XTCS 4CG1A 1W0KA 4KJXA 5HRAA 3EQ6A 4OMDA 2DSTA 4QXPA 2HFJA 1RI2A 1FCJA 4GAEA 3IQGX 4AYTA 2GN1A 4FGJA 1P7VA 4TWAA 2J09A 3DC2A 4JD5A 1WPQA 1ODIA 3FHJA 2VP6A 4I50A 4MO2A 4NESA 1OXUA 1J25A 2OSBA 3IE2A 4QGGA 3GOHA 1JHMA 1MAVA 4ZK6A 3A4MA 3W4IA 3N2NA 4Q93A 3O2NA 1PYDA 4JLAA 3NZEA 5F3DA 2BCGY 5A4IS 1NQXA 3OWOA 1VOTA 1XVTA 3UF0A 2O05A 5E7MA 2VPXA 2FCAA 2QR3A 2XEXA 4G1MB 3RU7A 1PVOA 1UWKA 3ZYCA 2VEOA 3NHWA 4QXQA 3D7RA 3ONEA 4Y2YA 3M6VA 4C2TA 2ZTSA 1WUTA