4R8VA

Crystal structure of the hydrolase domain of 10-formyltetrahydrofolate dehydrogenase (wild-type) complex with formate
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
308
structure length
308
Chain Sequence
b'MKIAVIGQSLFGQEVYKELKNEGHMIVGVFTIPDKDGKVDPLAIEAEKDGVPVFKFPRWRLKGKAITEVVDQYKAVGAELNVLPFCSQFIPMEVIDHPKHGSIIYHPSLLPRHRGASAINWTLIHGDKKGGFTVFWADDGLDTGPILLQRECDVEPNDNVNSIYKRFLFPEGVKGMVEAVRLIATGKAPRIKQPEEGATYECIQKKENSKIDWNQPAEAIHNWIRGNDRVPGAWAEIDGKSVSFYGSTLLENDHFSSNGQPLEIPGASRAALVTKNGLVLFGNDGKMLLVKNLQFEDGKMIPGSQYFK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 10-formyltetrahydrofolate dehydrogenase
molecule tags Oxidoreductase
source organism Danio rerio
publication title Structures of the hydrolase domain of zebrafish 10-formyltetrahydrofolate dehydrogenase and its complexes reveal a complete set of key residues for hydrolysis and product inhibition
doi rcsb
total genus 91
structure length 308
sequence length 308
ec nomenclature ec 1.5.1.6: Formyltetrahydrofolate dehydrogenase.
pdb deposition date 2014-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
A PF02911 Formyl_trans_C Formyl transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.25.10 Alpha Beta Roll Methionyl-tRNA Fmet Formyltransferase; Chain A, domain 2 Formyl transferase, C-terminal domain 4r8vA02
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 4r8vA01
4ZYTA 4ZYZA 4S1NA 5J9FA 1C3EA 1CDDA 3NRBA 4R8VA 2YWRA 2BW0A 1FMTA 1JKXA 4ZYWA 4DS3A 3AV3A 5J63A 4ZYXA 1MEOA 4ZYYA 4ZZ1A 3P9XA 3AUFA 4ZZ2A 3N0VA 1RC0A 1CDEA 4EW1A 2FMTA 3Q0IA 2CFIA 1RBQA 1NJSA 1ZLXA 3KCQA 4Q12A 4EW2A 4QPDA 1GARA 1S3IA 1RC1A 4ZZ3A 4TT8A 4IQFA 1C2TA 3DA8A 4NV1A 4EW3A 4YFYA 3TQRA 3W7BA 3GARA 2BLNA 1MEJA 1RBZA 1RBYA 4PZUA 4ZZ0A 4QPCA 4TTSA 1MENA 3O1LA 4ZYVA 2GARA 4YFVA 3R8XA 3LOUA 1ZLYA 3OBIA 5CJJA 1YRWA 3DCJA 1RBMA 4ZYUA 3TQQA 1ZGHA 4TS4A 1GRCA
chains in the Genus database with same CATH superfamily
1K2VN 3IOCA 3BKXA 3Q41A 5EAIA 3UJ3X 3OM9A 3W6OA 4PSUA 1CY2A 5BMVF 1U3TA 3GT3A 2H4HA 1V9SA 2QD4A 3F8SA 2HMWA 3BJEA 4KKXB 4YAIA 2GA9A 4JBXA 3WNQA 4MS1A 4TL7A 3LUKA 3PS9A 5D3ZA 1KTVA 2P3SA 3AB3A 1P91A 2WVAA 4ZALA 5BNFA 3C3PA 4BNUA 2I8AA 4HDAA 4ABYA 5ITZB 1CERA 3PG5A 3LBAA 1GDDA 3D0OA 3K0FB 3NWEA 1K08A 4WNIA 1SUDA 3SOZA 3W5AA 5FEMA 1QQAA 4G5HA 4RAQA 1I2MA 2DRIA 3CXUA 2ZS8A 1L5QA 2FG5A 3H04A 1N2OA 2UYQA 5IBCA 1WETA 4Z4IA 1Z4MA 4A5SA 2Q8QA 2GETA 5AVJA 3LP5A 1II9A 2NOAA 1P75A 1GT91 3TCNA 3TLBA 3W6PA 5K8LA 2VYNA 4Q9JA 4HDNB 3UBTA 2HBYA 1T8PA 3ACDA 2O0HA 4EFNA 4YT5A 3NHKA 1W25A 1WXGA 5DHRA 3ZN2A 4QKQA 1CHNA 2JGEA 3LECA 5AQEA 4A5OA 1KTIA 1WSAA 5H3HA 1ZL0A 4HX2A 4GI7A 2XBMA 1R9GA 2PZLA 2ZDHA 1I80A 4FYPA 4RQUA 1ZI8A 1YFLA 1C7JA 4XQEA 2Q5EA 5TNXA 1X7ZA 4AF8A 4PQFA 1XPUA 4I14A 4P81A 2PX8A 2O07A 2F3UA 2KHZA 2RHGB 4PZPA 4YIKA 3HJBA 1TZJA 4FI3C 4Y2HA 8OHMA 3QF4B 1OYYA 3PHGA 4F21A 2RJNA 1G3RA 2BUCA 1RVDA 3PT9A 3A8TA 4C30A 4JA0A 4FFNA 3NOOA 4TLMB 3QVMA 3UY4A 4H1WA 1P1HA 3TOVA 2XWBF 1FFAA 3AF1A 3KM0A 3BWBA 4IDFA 4RVFA 5I9MA 1ZJ6A 3AVOA 3MTGA 3V8PA 4Y2UA 2QTAA 3EEFA 3HCCA 1Z0FA 1OTYA 2EWMA 4I6GA 4DL9A 1E18A 1XROA 2HMAA 1B8PA 4XDGA 5G1PA 4U39A 1RIFA 4YP9A 4L6CA 3TE7A 3U40A 4W9MC 2QX8A 3QOXA 4AU1A 4DB4A 3FNIA 2IKQA 2ZWMA 4U7FA 2BJHA 5HUJA 4MQ5A 4NQRA 1N2HA 4MWDA 3ROGA 1O8BA 3ZH9B 2PL5A 3AR4A 4MVJG 1CFZA 2GRAA 4OBEA 4QTTB 1SCNE 5HIJA 3TOSA 3MOSA 5C35A 4DABA 2WNHA 3B1ZA 3FJ1A 2AL7A 3QX7A 3M6VA 3AIIA 3UV6A 2UVPA 1T2CA 3RC3A 3NVKI 4P4TA 1I94B 2JIQA 3KCNA 3FMFA 1X80B 5H8WA 1ZKMA 4BKPA 1J2YA 2GFIA 3FE2A 3T9EA 4OAPA 3HCEA 3N74A 1LTHR 4UDOA 1MOZA 1XQVA 4IQFA 1UK8A 1R4MA 2E3JA 2W2MA 5K8IA 4BXOA 3F2IA 1W1IA 3SF8A 3S81A 3S8MA 2I78A 1T43A 1W4LA 5LVAA 1TE2A 3CS3A 1U2DC 2OLJA 3COPA 1EM6A 1IONA 3H5NA 5FUBA 1Q0TA 3PZRA 1I24A 1U0HC 2BCEA 3A1DA 3ND5A 2H3EA 4HS9A 4MVJD 1YS4A 2F8SA 5E2AA 3I9V6 1X74A 4PG5A 4M38A 1I4EB 2W2LD 3EXEA 5CXXA 3REQA 3K71B 4BY9E 1ZJYA 1HK7A 5AMXA 2JAQA 4MHOA 4HGPA 1YUMA 2VDJA 2OTCA 1TCVA 4UTVA 2A0UA 2HCRA 1O6CA 5IPFA 4V0KA 3FCSB 4WBNA 4CUJA 1O0BA 1DWUA 3A06A 4FSHA 1P2VA 4NONA 5LD2C 1P9NA 4MW0A 3KJEA 3RYHA 1PFYA 1VHLA 2J31A 2QB5A 1U8YA 3AFMA 3I1JA 1YS2X 2AG8A 3DEKA 2Y77A 3KPWA 1BAPA 4M0PA 4KITB 1C14A 1TU3A 2I2BA 2ZRDA 7ABPA 4NPHA 3LK6A 3RH0A 1WXEA 2FWAA 5TF0A 3UJ9A 4B4KA 4JOCA 4ZOBA 5CG2A 3KUKA 4RORA 3S7ZA 2DSNA 3ASVA 2RK4A 3KZKA 5EVJA 3LNTA 3A6HA 3W9UA 1M1UA 2HH9A 1OFUX 2PT7A 4I50A 1T36B 3HYRA 4O8CA 4PLTA 5E95A 4AICA 2OZLA 3KEMA 4PTZA 2CXPA 4WCFA 1ECCA 2OB2A 2VF8A 5EVCA 2CUTA 4ZT6A 2VJPA 4X7PA 2YUTA 1PL8A 1U98A 4PLWA 2J07A 1R4NB 1RRFA 2VP6A 1Z2EA 4NPCA 1GLGA 4ZCPA 1BCSA 4PFQA 2WIJA 4JJKA 4KK4A 2XE7A 4BNTA 1U81A 1K88A 4LNUA 2AH5A 1XCOA 2BH9A 2OHJA 2DPXA 1C29B 3FN4A 1OR8A 2ZUUA 3ROEA 3IDSA 3PSHA 3VISA 2BZ1A 1WCXA 2IZ6A 1TC2A 1QSGA 2HJGA 3ZLJA 5DU2A 3T1VA 5IUNC 1YA4A 3JD4A 4C3OB 2NU8B 3PLRA 4G84A 3AF2A 5ALZA 1YS7A 2IHKA 1K7FB 4NBVA 3RC9A 4DLVA 1CX9B 2H3HA 1ENOA 2EQ5A 2HHAA 1YU9A 4ZYYA 1H2YA 4ZZIA 3PCXA 1KVSA 3GJXC 4Q66C 3SJAA 3EQ6A 5KEIA 4W5TA 1L5SA 2ZPUA 4NPAA 2W2QA 1B2LA 2AHOA 3P0RA 1F51E 2YXNA 1KDOA 3QEKA 3GJZA 5DDIP 4LOHA 3ZQ6A 3AEXA 3T6KA 1YE8A 4L57A 1H1DA 1U6IA 2MMGA 2NSLA 3TX2A 1Y33E 3SKVA 3DAPA 4IGEA 1E1RA 3IVRA 3TTWA 5IXYA 1V6SA 1AVTA 5KUTA 1W76A 3GP8A 3ANLA 1DQRA 4OHZA 1JQBA 4HN4B 3FOEC 4PC6A 1PJAA 1Z2AA 1Y6ZA 4NXMB 2Z9DA 4JMPA 1J09A 1EWYA 2ZIGA 3JSXA 3MMSA 5FD8A 1VSVA 1JG4A 1JW9B 3D8TA 1BVHA 2XQVA 4OKNA 2DFTA 2ZJ4A 4ARAA 4LZPA 3JTMA 4B3BA 1IWPB 2GCOA 5AM4A 2WE8A 2ECPA 3HFGA 5JH7A 5LQJA 1KFEB 3FVQA 3N0VA 4JL5A 3D3QA 4UJ3A 5HF8A 3MHPA 2FW8A 1HF3A 3KNZA 4GE0A 5AKGA 3FWHA 1PBTA 4RTLA 4DR5B 3FPLA 3FY4A 3R44A 4NZNA 1PJQA 5CA0B 3VQTA 3JAKA 4P9NA 5DXFA 4L7QA 4R7ZA 5CG1A 3AVUA 1DIAA 2V65A 2QRGA 4GP9A 1UJ2A 2X6RA 2GPYA 3T4EA 1IJFA 1RHQA 2ZAMA 4QOGA 3UWOA 4RTOA 3VR6D 3HFJA 4LBVA 1RXIA 1V47A 1VKNA 2HQOA 5BN5B 1JECA 1SD1A 4P3PA 1SGWA 2IVZA 2Z2ZA 2WUVA 3BRSA 2EWVA 4K5QA 3WGYA 4EMSA 2DHCA 3ZDYB 1FVFA 1DEKA 3H7IA 3GGDA 2DGDA 4FOSA 3LCCA 3FA2A 3OCVA 3JX9A 5EQDA 4JYPA 1MDFA 1XJ5A 2I80A 2P1DA 5L3ZA 1Z37A 3JV7A 4BJHB 3A9RA 2WJPA 3L7MA 4ON9A 1Z0IA 3PNLA 2FEWB 3N8NA 3C6YA 1QV6A 4CTMA 1T36A 1ADJA 5DNCA 5PNTA 3KSBC 4MYTA 1MX5A 3MRSA 1V3UA 4CM5A 1GG2A 2X0FA 3JQ9C 4AMVA 1ZN2A 4H3SA 3WY9A 4B3FX 3ANYB 3IBCA 1JEQA 1NJ2A 2CHFA 4NEQA 2VH1A 2CL5A 3KTOA 3COVA 2P3OA 4FKMA 3UIEA 3WFZA 4EI8A 1D4AA 4ECAA 2YW9A 3LPMA 4EPRA 4AJ2A 3TSCA 3HVUA 1O5IA 4MUXA 3SQNA 2I03A 4L4ZA 1E2PA 1FFEA 4YJ3A 5HUQA 1AV6A 4C6RA 2O20A 3AUYA 4EB3A 1JHZA 3WDMA 3EB9A 3R6DA 5IJ0A 1E64A 4OQZA 3HRHA 4WRRA 4BAZA 5JCPA 5KQGA 3BMOA 1BO6A 3L6EA 3QU2A 3WGOA 1KKUA 4YV7A 2W42A 1A7AA 1XZHA 5T4EA 1VBFA 4CKEB 5JS1A 3CLUC 3QE0A 2FXVA 3AUJB 4HC4A 1UXGA 2F90A 2VDWA 3GEBA 1O95D 2UKDA 2V6MA 4LDNA 1C1XB 1LQTA 2BRUA 3AHIA 1OLXA 4N18A 1UEXC 4NEGA 5BRJA 4ITRC 5CDGA 3IAEA 5E9WA 5M34A 4ZP1A 3NHFA 2C9BA 1E1YA 1TPZA 4P4UA 3RV3A 4BO7A 1KFBB 1DEXA 1HFKA 5LZ5A 1RYFA 3HBNA 3BMXA 2RH8A 3IHTA 4PTYA 2EP7A 3B6KA 2B37A 2G1AA 3RWMB 1SQ5A 2BEVA 3TSYA 3LUAA 4LCEA 4M4SA 4YEDA 1RHMA 1BC5A 3BGVA 3QI7A 1S2GA 3NHLA 4NG5A 4D8TA 2ATCA 4E13A 4DKJA 1QMPA 2BBWA 5FI3A 1RLTA 3PDWA 5ALUA 2OV1A 1RXEA 3SVLA 4CL3A 1T29A 3GJTA 3WB2A 2A1UB 1DXYA 3ESDA 1HRDA 4UPEA 1K86A 1J42A 3KAQA 3E3MA 4L8GA 4DLLA 2C4UA 4UULA 3U2QA 1U0FA 4JEMA 3S68A 2GEJA 2GGSA 3FKSD 2D13A 3DQQA 1UKEA 1KK0A 1PR5A 1XVIA 1DC5A 1QP8A 2P8JA 4I2NA 4LMBA 4GOKA 3HEMA 3KOZA 4K46A 4A8JC 5BV8A 1ZR2A 2OHHA 4RKWA 1GG8A 3OT1A 4I19A 3S2IA 3GZNB 1QF9A 2I9KA 3WTCA 1C41A 3QWIA 2EYUA 3Q3EA 3CRMA 1GNTA 1FP1D 3JQBA 1YQUA 2BV3A 1OAOA 1D1QA 5ALOA 1UPCA 3DKPA 4KW7A 4ZOLF 1U1GA 1PIWA 2NXEA 2QN3A 5B4VA 5ED4A 1G8HA 4OH1A 4HAZA 1JS1X 1L4EA 3I2GA 2FSHA 5CLJA 4Y9SA 1EHYA 4EDHA 3RC8A 4NBKA 2J46A 1ZINA 3UAZA 4PGHA 5HRAA 1LDBA 1LZKA 2HRCA 4OQDA 1X7WB 4PNEA 2CMHA 4K7JA 4ZT2A 4BKQA 3LC2O 3KSRA 4HVTA 4D3SA 4IOMA 2IS4A 1GCAA 4HAVA 1LSUA 2QD1A 3WFIA 3GJ7A 4EY6A 2QMYA 2NU7A 3PNYA 3SJCA 1T2NA 5IKMA 4JI0B 3A2MA 5IYZA 3LE8A 5HX7A 2OXTA 3S2FA 4XWYA 4I2VA 1ZH2A 5FCDA 2H2HA 2XXAA 2C2MA 3LOQA 3N8HA 1LPAB 1ZP6A 4X54A 3TNDA 2GM5A 2YICA 4BX0A 4LF9B 1U2PA 3E05A 3FHTA 3ZNQA 5JEEA 2BBSA 1GDTA 4AN4A 4NYIR 2F1RA 3L0OA 3NR2A 3F4KA 1PR4A 3KUCA 5KVQA 3BIWA 1PVDA 4KO2S 4MQBA 4ZVVA 1LBHA 4CMAA 4DZTA 1VP9A 4O0MA 1TYZA 5FAKA 3SD7A 2P6NA 221PA 4GRDA 4MZXA 4Z9AA 4L5IA 3V4ZA 3MIZA 3T7IA 1Z73A 4B71A 1LGYA 2WU1A 4HWRA 1E2MA 4KX5A 3R75A 1T6NA 2P90A 4NG4A 4RPCA 1EFTA 3WL7A 4MHTA 3SIXA 2B1IA 4OHFA 4C4XA 3H9UA 4CCYA 1PGJA 1X1CA 2GN1A 1T6YA 3HKDB 1B43A 4IJ5A 5T4FA 4DAOA 2AR0A 2ERYA 4DAEA 2FPIB 3LX4A 1N7GA 4N7RA 3ST7A 1L7QA 2JAOA 1I6LA 3A1WA 3E6AA 2I4MA 3EVDA 4CU5A 1DFHA 2ZE5A 5HE8A 4JKOA 3OCWA 1MA3A 1CVRA 5GWXA 4TSKA 2EZTA 5T6MA 1T91A 1CK4A 1XDDA 3BN3A 3NHPA 3QBEA 4PCLA 1OGIA 1V5IA 4C14A 2Z04A 4OJYA 5CA0A 5J1TB 4RE5A 4MUHA 4Z4CA 2BZGA 3FNBA 2FMUA 1B3RA 2IA5A 2ZUEA 2J45A 2A86A 1J1UA 1S3IA 3DAGA 3T61A 4KXUA 4V38A 3QPBA 3AJ9A 2Z2JA 4LV6A 3KKPA 2Q0XA 4QUIA 5JW6A 4XKJA 3NAMA 4REQA 3ZK9A 4QUEA 1A8QA 4HRYA 3HP4A 4AQDA 521PA 3S2ZA 2FCRA 3E3AA 5A9SA 3C1TA 4Z0HO 2NTYC 3NC1C 1V43A 2C83A 3R40A 1KRWA 4B45A 4C4PA 1XMPA 2CXUA 2HJVA 1GXSB 2OBBA 1E1MA 3DVAA 3LW8A 4JBWA 4CKEA 4QECA 4WECA 3GIDA 4CM1A 1LU9A 1U63A 2FLVA 1KYVA 1MFZA 3TFQA 5D1HA 4D0RA 3KLMX 3TD6A 4IXNA 4CMGA 1K75A 4X1IB 2I6XA 3EH1A 2OCDA 3MD0A 4G4IA 4JGIA 2ZYRA 4J0KA 4P36A 1SXJA 2OQVA 4AUMA 1QCYA 4RXUA 3W77A 1UKAA 4R83A 3BT7A 4HFMA 1PU2A 4TTSA 4TKUA 5K2OA 1IULA 4IMJB 1W46A 5D3KA 3RI3A 3GJ8A 1G9TA 1DCKA 1KI3A 3K8QA 4I36A 4GECA 2W2OA 1VFPA 2X2EA 3AW8A 3LL7A 4Z9YA 1BQEA 3K4HA 3SPXA 3ZLUA 1CS4C 1TEZA 5DVZA 5C80A 3AEUA 3KKLA 4NBLA 1Q0LA 4BWYA 1QQBA 1SU7A 1W2HA 2OO5C 3GLHE 2H1VA 1TO2E 4DQLA 3IURA 2HU5A 1SWVA 3O9VA 2V6IA 1Z4JA 1JDZA 5K0GA 2PTGA 1J7KA 2O1EA 5IAEA 4KGZA 3BH0A 1O94A 1ADGA 4MQEA 4ZT3A 3DLTA 3VDNB 1JA9A 1NDUA 1TJPB 1HOTA 4MGEA 1H6DA 3O1IC 4GBMA 5AM5A 3WOVA 3M4XA 3SHQA 4DDVA 1DAHA 1KNXA 5BN3B 1K2WA 1N5IA 1H0KA 3PGA1 4UBMA 4GGMX 4GKKB 2HIGA 5JO0A 1NZFA 5IVPA 1MQSA 2QTVB 3RD5A 4K9QA 2AOVA 2CZGA 4IGIA 5JARA 3VZCA 5JLAA 3C5WP 4KQGA 4BEBA 1H2WA 1YJXA 3MA0A 4HNUA 3IAS6 2G1PA 3K9LA 2PZEA 5DIFA 2BTOA 2AZTA 3TLYA 4KR2A 2DUJA 1HURA 2B7CA 2EX4A 5HDBB 1Q3KA 2V6GA 4AB1A 3OM0A 2EBWA 5GOTA 2GVDC 3ZK7A 1E7SA 1DKPA 2P3QA 5JRJA 3RS3A 5M04A 4AJPA 2C4NA 5BOSB 1A2KC 2O05A 4ND7A 3QE9Y 4MUNA 2QI9C 1GOTA 1JDBC 2EERA 3RIGA 5C8ZA 3EZ6A 2L19A 2QY9A 3VNVA 4GHWA 4I9GA 3O4IA 3B8EA 4GOLD 4S12A 4D8XA 1QFZA 1ECPA 1EGMB 2EYQA 3O93A 1G60A 1T35A 1U1IA 2G6BA 1N8KA 4NX2A 4A10A 2OYCA 4ZVPA 1R16A 2BEWB 1AF4A 2DWOA 2YWDA 3B78A 1ZUHA 3GFRA 2P6PA 3M6AA 4UM5A 1YV9A 2IZOA 3RYFB 1NUSA 3V8VA 3L1IA 1T15A 2WRZA 3L0IB 4M1YA 5E9QA 2G76A 1US8A 3CPSA 4FFWA 1EBBA 1F6DA 4QPZA 5JPDA 1CNMA 2ZDQA 4NFSA 3IQGX 1S9HA 1U7PA 1YU6A 4K0RA 3EPRA 2XIJA 3HJTA 4B2LA 2V6BA 5K0CA 4DIUA 3X1JA 4EF6A 3VPCA 2HOQA 3E22B 4G1EB 3WGGA 2X6TA 3IO3A 2B25A 2ZBVA 3EGCA 3G2JA 1UBMS 3HDYA 1XK6A 4OK5A 5AKXA 1A5AB 1SKUA 4KPEC 1M2NA 3N2IA 3ABOB 4KDEA 1QIGA 4EG3A 3T38A 5AOCA 1JA1A 2A1TR 2OV3A 3FWZA 4A6DA 3PNPA 4XWWA 4JYAB 2OHIA 5L6MB 4UREA 3OQMA 3COWA 2VVTA 2RBGA 4RVNA 4EPXA 1K8RA 3D0QA 1O96A 5BWNA 3PQ7A 4W8HA 2OESA 2R4TA 2V4MA 2NUBA 3DMGA 5EZYF 4ZU3A 4BE4A 4RTKA 1C1DA 2V7PA 4R2MA 2NP7A 1E9SA 1LF5A 1Z13A 2BFDB 5BXQC 4NV0A 2ZUVA 3EOAI 3GHHA 3AEQA 1RWNA 3JD2A 1PL6A 1WPGA 3HY3A 4O8ZA 4Q21A 1XJQA 1W4CA 1NNUA 1LLUA 3DE2X 3PCRB 4I50B 4P8RA 4WBXC 3SKYA 1OUMA 3LQ4A 4AZ0B 1BSVA 3MJCA 3MQ4A 3IQHX 2OCYC 3UT5A 1OPRA 3UUWA 1U94A 4RZ2A 3UMFA 1YHNA 4IDHA 2HC9A 2YWHA 3IO5A 1MQAA 1SELA 9LDBA 2Q3EA 3EXHB 4FB4A 3NQ41 1QYCA 2EEZA 1YB7A 2VYVA 4HHEA 1SAYA 4URYR 5B1IA 3T0IA 2TYSB 4LPSA 3OE7A 1JH8A 5TQ0A 2BHRA 2J3MA 2QQ0A 4F4JA 2VT6A 4BV3A 5EXTA 3D7RA 3D5QA 3U1VA 2H2DA 3PNSA 1SBQA 1KSJA 1MHPA 2PMBA 3LY7A 5DSXA 1DBVO 3D8NA 1O89A 2E6KA 1F3LA 1C5KA 1Q12A 1Z28A 1Z45A 4EF4A 5FBWB 3P27A 4Q4JA 5IBPA 4C07A 1P0MA 1EHCA 2P91A 5C1BA 3N0TA 1FLVA 1EXDA 3ZGXA 1DKLA 1VDZA 1ZN8A 2VDKB 4U00A 1MC1A 2PT5A 1SG0A 2NVWA 4NENA 3CX7A 1COZA 4HNAB 4WD3A 5EP3A 5G41A 4CQMA 4EQZA 1E6MA 2V96A 3D6FA 3DO5A 3H2ZA 1SCBA 1Y4AE 3I73A 3N5KA 3PHCA 5IS2A 3HU3A 2PO5A 4D74A 1QE3A 5GM1A 4FBMA 1THGA 4A16A 2ZRMA 2E4UA 4DBLE 1QQTA 1UMBB 2V1UA 3ROQA 3OX2A 4P93A 1KE1A 2H11A 1Z8DA 2XUAA 4M8KA 3SYLA 2C8LA 2OWEA 2XNDA 4ZZ3A 1CZNA 2ZRGA 3GZJA 3JQ8B 3T5MA 3IR6A 1MVNA 1O6GA 1NL3A 3LLUA 3GH1A 3DMDA 4GX1A 4NL4H 4R40A 2YXLA 3UENA 3GR6A 5M5BA 3LT1A 2QJRA 5BW4A 4H3KB 2FKAA 3MJSA 3A27A 1N6IA 4EKNB 2QPLA 3G0HA 1DADA 1TF5A 4O1IA 3LTNC 3ANXA 4YJ3B 3C7TA 2IYAA 3RABA 1RXWA 4JNKA 3NUQA 3A1TA 1L5ZA 1GITA 3DZCA 2PV7A 4B8YA 4DOMA 1Y1LA 2Q9CA 3GJYA 3Q4GA 5JD5A 2H6EA 4TMYA 3HXQA 4LMRA 5B6JA 4EA6A 4JY7A 3LYUA 1WB5A 2J48A 1R9MA 3LX6A 3CR7A 4FCTA 4D99A 3LXXA 1UDBA 3FLBA 3QOYA 5E4FA 3HJUA 1EFCA 5IN5A 4H0NA 4BGDA 1L0BA 4QREA 1XZKA 1XLUA 1E7WA 2H2WA 2VOEA 3GOQA 5CVDA 3UHAA 5CB4F 2I8CA 2E4WA 2H7XA 2IDKA 2J0UB 3CSDA 1JQDA 2FWJA 3KDAA 3QLVA 5CJJA 5DCWA 3TZBA 1G8AA 3RJTA 1IWOA 4WKPA 1G18A 3BHMA 2WKSA 3DXYA 3KXDA 4FNAA 4X60A 5JDIA 2BGRA 4JYZA 1JFSA 2HI0A 1O96B 1JKXA 4Z0PA 3VYRB 4QUDA 4UQPA 1PLJA 5D3MA 4I1IA 5IHPA 1Y3DE 4WK2B 3A36A 1NBOA 1FDIA 2I87A 3E9YA 4Q1BA 3OPNA 2ONCA 8ATCA 3OJCA 5A5EA 1X7ZB 3MS4A 3TRJA 3W5SA 1AZLA 2ZRJA 3QUBA 5K3FA 3VNAA 1GO2A 1Z0AA 2P4HX 1Q57A 3BRCA 2D1SA 4FE3A 4IFEA 1EE9A 1WJGA 4RY8A 4RETA 1MABA 1B0AA 2J8ZA 3TGWA 3TWOA 3B53X 4AS2A 5BSGA 5CDYA 3VO1A 1W19A 3EARA 4YGYA 4UCQA 3PUKA 3ZWVA 3THYB 2Z9BA 1G1AA 3AR5A 1VLVA 3DZGA 3JZFA 1L7OA 2YZGA 4LNHA 3VR0A 4DMGA 5HQTA 5DM0A 3L02A 3CRRA 4CEJA 3VR2A 1FTSA 1SPXA 1YHZA 4GMXA 1L7MA 3BEDA 1UJNA 3H5AA 3Q9LA 2ZI4A 1ONPA 1KO5A 2DERA 4HDRA 1WMEA 4C0SA 1MO4A 4MW1A 2O0LA 2YWBA 3TL6A 3WBJA 5DASA 3E8SA 4OAOA 2NADA 3GY0A 3FGZA 1EXWA 3LWZA 1IQ0A 1QVWA 4M8IA 4P92A 5KCMA 1HLDA 3B13B 3IP5A 4EO4A 2O5EA 4L8VA 1V16B 5DTQA 1ZWKA 4D8WA 1J9GA 1IDN1 3I6YA 4FSDA 1KZGB 3FUWA 4MPJA 4A8JA 4XR9A 5GOZA 1JHQA 2WF6A 5HCUA 1NXSA 2EGUA 3LH5A 4FINA 1TAUA 5DHFA 5COAA 3MCWA 3KE9A 5J23A 3RM3A 1DNPA 2CEKA 1JIXA 2GASA 1CWUA 1IHXA 2J6HA 2VSXA 2PL3A 3W9SA 2OK8A 1BQ4A 1U9JA 3CB4A 3T3MB 4WJLA 5AVWA 4IIFA 4R1UA 3IJ5A 4DDKA 3EOBI 2G7ZA 4ZPJA 2REQA 2XIQA 5IDQA 2ZLBA 3K2BA 5K8CA 2Y1CA 3QA9A 1KMCA 5D2CA 1LRLA 2JK0A 3OE1A 4M0CA 2JI8A 4R2WA 1VLHA 1Y1PA 3PNKA 5JAZA 1KXJA 2CJFA 4JI3B 4CR7A 2IITA 3WGIA 5KWJA 3P9QA 1Z2OX 3OZFA 3QEBZ 2O8DA 5GINE 4IJQA 1QS0A 1JPNA 2HBRA 5AJHA 1VKZA 2C5BA 1KMIY 5KSZA 2QTZA 1JMKC 2GXSA 3GFVA 3JWJA 3AUTA 3FYUA 2AN3A 3QPAA 2NO5A 5LJLA 3C3DA 1B41A 4JEHA 2CFOA 5GONB 3KAKA 1GT6A 4ZZ1A 1Z12A 3KWFA 1XZNA 1CJCA 1ZOSA 3DFZA 3H65A 3STYA 3NWJA 2FRDC 2DE0X 4MWSA 1FP7A 4TWZA 2G9NA 1E1QD 1N5RA 2EQBA 3KEOA 3IULA 4FMBB 1IHPA 2ECKA 3DZDA 4BNYA 4X65B 3ZZ0A 1M7GA 4QFMA 4RVHA 3DV9A 4WXPA 2IWRA 1R37A 3M6IA 4UTZA 1E9DA 4AECA 4CTKA 4N7MA 1N6HA 2QXYA 4Y1RA 1OI7A 4X84A 3A2KA 3KU4A 2QNBA 4DLNA 4IQGA 1CLUA 2P9CA 2SECE 4G4SO 3HP1A 1RQGA 1JQKA 4WEQA 4WBNB 3SQWA 2WOOA 2Y05A 1AQNA 1XTUA 4ID3A 5AXDA 1E94E 4JT4A 1U6JA 2BY4A 3GVXA 3Q7TA 4M37A 3TQCA 4R9SA 5G0SA 4OFBA 2WMOB 4Q0MA 4EJFA 2N46A 4ZANA 3QF7A 3D54D 1SQGA 3NNSA 4NYIQ 2TECE 2WSSA 5A3JA 4Q02A 3RU3A 3H8SA 4REQB 4X00A 3N3AC 4BP1A 2M9MA 4N01A 5LIRA 1Q1AA 1NPYA 2PWBA 4Y9RA 4ZQHA 3JATB 5I8WA 4DKXA 2P65A 4O2AF 1OIWA 1VPDA 4P08A 4KRGA 3SAJA 2QN6A 2QIOA 2GPNA 1A9YA 1MEEA 2WT8A 4PWYA 3KLBA 4I4TA 4RH3A 3ZU3A 2WM2A 3QUAA 1VI5A 1L8OA 2ODPA 2WPDA 3B20A 1YQWA 3T35A 1W581 2HHCA 1GNPA 3H6GA 1J00A 1IH8A 1WCIA 3BM5A 4M7RA 2QSUA 2CFIA 1OY1A 2PM8A 3UJHA 3EZ2A 4C5CA 3Q72A 5H3CA 5JDIC 1DUIA 1H42A 1G8GA 1T6BY 2X6QA 3PXXA 1ENPA 2WD7A 3K6JA 4I66A 2FSFA 2WILA 2IYSA 3NVAA 4LRUA 2VJKA 4GO1A 3I04M 5BVHA 3PC2A 1C4WA 2OHFA 4U9IS 4MEAA 2O59A 3OBIA 2CJPA 1VGVA 2CNKA 4Z54A 3EXHC 4OFWA 3RAFC 3BA1A 4K6MA 3C4VA 1GZSA 1NN1A 5EFZA 1KC1A 4DG8A 5ADHA 1SG6A 1MIHA 2J59A 3JR7A 2WTMA 2C78A 3OIFA 4YREA 1PTKA 3GP3A 4M76B 3OZSA 5LQMA 1PK8A 4ZQBA 1HM5A 4X6XA 3WZ2A 5GONA 1CZLA 2QYHA 4KSCA 4Q9DA 4HBGA 5D7NA 4Z4GA 3QX9A 1GUFA 3L8EA 3RK1A 2VK4A 4D6PA 3ZKWB 4LMPA 3TR5A 1OXUA 2GO1A 4HH3C 5E1OA 3K9BA 2Q62A 4ARSA 2R8XA 1CDZA 3EVCA 2G5PA 4K03A 4OO3A 1I8TA 4OXIA 2FDRA 3FVWA 3ONEA 3HU5A 4R2XA 3S55A 4P38A 5AVXA 3UPUA 2O8BA 4BZWA 1N2SA 5EP2A 3TOZA 2YINC 3UXMA 2Z5LA 3AP1A 3P0FA 4UKDA 3QJGA 3BXEA 1RZUA 4N41A 3ZV6A 2JD2A 2NZVG 5IEJA 5E1BA 3FWYA 2WB4A 4UCFA 1N0VC 2RK3A 2ESRA 1WCYA 1QIDA 3HCRA 1UFKA 1EH5A 3KQPA 1QPGA 1Y8QB 1K7YA 4ENTA 5K6AC 3T1YB 1RAIA 3CEPB 3ZGZA 3RTCA 1AY0A 4O1MA 1BHO1 4B85A 1G0NA 5ESXA 1KKLA 3GAMA 2HGZA 2I7TA 4JUBA 2BFFA 3PD7A 4H17A 4PGFA 3HYTA 3V2IA 4UVEA 4FN4A 1DZ3A 5KREA 1T0UA 2IHJA 1AZWA 2AC2A 4CEHA 4CTJA 1C0IA 1PFVA 5TS3A 1K8ZB 5J4YA 3BA6A 2UDPA 3P26A 2HSGA 2FRVA 1QKKA 3Q9NA 2VJOA 1Y7HA 4JC0A 2M6RA 2FJUA 4J90A 4B4VA 1F5SA 3ABZA 5LP6C 3Q98A 4UM7A 3WKCA 4U5XA 1KEUA 5E3IA 2IIBA 2VAVA 3UJDA 3FPJA 3D2LA 3DWGA 5KOJA 4CKBA 4LK3A 3UPTA 1KH2A 1FS4A 1GZHB 1C9DB 3UJAA 1CNFA 4JJEA 2B94A 1GZ4A 1O8CA 4EZIA 1C3OB 3HVHA 4O2BF 5G40A 4FFRA 4OP2A 3U48A 1QRRA 4PRLA 4CHTA 4R0NA 1KI1A 1QR6A 3QXXA 3WQSB 3WNCA 3QKTA 2MSKA 1MABB 4DCUA 1GZ3A 2NWQA 4BMZA 5IG2A 2E1PA 4MW4A 2D7JA 4PYQA 3ZE6A 3D8SA 4JI2B 4DCMA 4DJEC 3GGOA 3MUNA 1G20E 5EWLA 5I7FA 1VA5A 3DD5A 2OV2A 1UWCA 1W1UA 2PX3A 3PGJA 1V96A 2PGJA 3PUVA 3KELA 3LGXA 5SZIA 3GBPA 4J3FA 4OUDB 3ROKA 5EHXA 5HJ7A 1WDMA 3N59A 1WHTB 3ZIAD 2VJAA 1AM4D 3ESCA 3RIEA 4BMSA 4I46A 1XTRA 1Y5RA 4JGGA 5FADA 4JZYA 4G37A 3LY8A 3TJRA 1PNRA 4PCVA 3ITNA 3WB1A 5LMCA 2ZJ7A 4DLYA 4ZT7A 4OGWA 4CKWA 4K6GA 1VKRA 1K9VF 2UZ0A 1NE2A 1K68A 1MJFA 1Q44A 4XCVA 1ECGA 4PGAA 2LDXA 1V71A 3U0VA 5KB3A 1Y6RA 4YLYA 4QSHA 1K6EA 1MV8A 1XAJA 2K2QB 3V4SA 2VDQB 2HRQA 4UUBA 4Q15A 4XRRA 2O52A 3OPYA 4LJ9A 2FSGA 2GJ9A 4WKOA 1AOXA 2UZIR 2C4TA 3P45A 3DCNA 5DXAA 4J1SA 2ZP1A 1YULA 5D1NA 3Q7IA 4CM4B 4RM3A 3N87A 4EA7A 4O5OA 4RA6B 4COOA 3AEYA 4D0LB 3LCRA 1CY4A 3TZLA 4G1MB 2WINI 5BQXA 1YZTA 3L0PA 4JR0A 3MIIA 2HF9A 4NCXA 4UHHA 3UFXA 2GZ1A 1I0ZA 3BGDA 2CNDA 1UZLA 2R6CA 2VT7A 3D6MA 4NV1A 4RHFA 3ADCA 3MMZA 2IYZA 1TL7C 3P0IA 3DW3X 4GRIA 4M60A 1UJ4A 1JYFA 1Z0UA 2DJ5A 3D31A 4NR0A 3CKYA 3T3PB 4EM6A 4EYKA 5IBQA 1XGKA 2Y0EA 1CR2A 2XQIA 2PO7A 3WSWA 1D09A 1SOWA 2X3UA 2Z98A 3QVKA 3U81A 3X43A 1N3BA 5A3VA 5BYAA 5F9HA 4LRSB 3ISTA 3UXHA 1P9WA 1UMDB 1CUEA 3P2EA 4JUAA 3MJHA 2WF5A 3FOBA 3C6XA 2OV4A 3GK3A 3NIBA 3R8FA 3QK7A 5CYFA 5FUXA 1S7CA 1AA6A 3ZCPA 3TL3A 1YRHA 1L7BA 1WU8A 1Y48E 5BW6B 3GJSA 4DMHA 1QIEA 1R3UA 1RCUA 1KZYC 4Q1VA 1Q50A 4A27A 5BN5A 5JROA 5JVDA 5LSAA 2EF1A 4Z51A 3UM9A 2A2ZA 3MBIA 3PNBA 2AEFA 2PX6A 3NEAA 2CLFB 4V0ME 3PUHA 4WK4B 1TTPB 1EJ2A 1FDVA 3S5JA 5HSGA 3DV0A 2L18A 1PWEA 2CF5A 2F9MA 1R0YA 3DM9B 1JH9A 4HYYA 1JHXA 4XW2A 3SZOA 4NNJA 1W88B 2Z2KA 3IAXA 5D7BA 1K0FA 3HCFA 2XGJA 2FR1A 4QM7A 5EHNA 4X91A 1KDTA 2FP4A 1OT3A 3OJEA 1JHPA 2GKSA 2RHMA 2YDXA 2QVZX 4TLEA 5U9CA 4Y67A 3G9UA 3L0BA 4YRIA 3LJKA 4H6PA 3V8BA 4ZICA 4F2PA 4MV4A 5LOVB 3W0LB 5J3JA 3DTVA 5F21A 4OXQA 1XRMA 5DFAA 4C05A 4ZQFA 4G1UC 1H8EA 3BZUA 4QGGA 3SHOA 4US2R 2C29D 2BH2A 4CI0B 2NVOA 3F7NA 3AW9A 4A26A 3WXMA 3FIUA 3WHPA 4B1FA 4EQ6A 4JBNA 4PX3A 2WKRA 3GPBA 4LCBA 1JZTA 3WJAA 5I45A 3FCEA 3EWNA 1C9JA 2HWUA 2FI1A 3HN2A 1SHKA 5E6UA 2QIPA 2ZT6A 4HB0A 3A9VA 2B35A 2V5AA 3EWSA 2GVZC 1T4GA 2Q5JA 4TT3A 2BR4A 1SOMA 4PPYA 1Q1EA 1RKXA 2GN6A 3OLQA 3IE1A 1KZ4A 4J0EA 2TRSB 1BXZA 4FW9A 3W2IA 3VNBA 1AKWA 1Z15A 4RK5A 3CLSC 3VR4A 1LPBB 2C4MA 2YHIB 3QVLA 4R1PA 3X1YA 5ITWA 3W4KA 3LCJA 4D98A 1YQEA 4U63A 5DULA 3G1WA 2FPWA 5DRYA 4HEA6 5TGTA 4B8ZA 5K8UA 1OFUA 1TEHA 3EEIA 2I67A 4AX8A 5DXJA 3WWYA 1YKSA 4ZVOA 3AIKA 3NIFB 1AO3A 1MBZA 3CZ4A 5FULA 1O9HA 1Q3HA 3DR5A 2O3SA 5JIBA 2Q5LA 2XUKA 4W5QA 4MDYA 5IM4F 2X5XA 3I09A 2VWQA 3STWA 3BBPA 5AW0A 5JYEA 3B2EA 4F3CA 5IHXA 4RDXA 2XTJA 4IZ6A 2FEOA 1FDUA 1G9XA 3JW8A 4QBKA 4DR7B 3PD0A 5KI6A 3ZEAA 1CEXA 3KEGA 2CKDA 4YYZA 3E15A 3ZU4A 4FR5A 2DECA 3B51X 3KE8A 3B9BA 2WJ4A 1XNGA 4TMFA 1ST3A 3PEUA 2ZRLA 2BTEA 3V8NA 4N49A 5AVTA 2C96A 3DTTA 3WMEA 3RUPA 1V4VA 4IHJA 3RANA 3AINA 4BO8A 1DTWA 4LVOA 1A4RA 4WY2A 4YUZA 2IZ1A 1ENYA 4DTCA 2FP4B 1GN8A 4L3VA 2ZSJA 3ZWNA 2G8NA 3HV2A 3SP1A 5JEDA 4OX9B 5ALTA 2IVFA 1E9CA 4CMHA 4J8PA 4XYBA 4D2IA 2AG5A 3EIOA 2O2JA 5GVSA 4OBXA 4PIVA 1Z3CA 3NU1A 1QXSA 2P69A 2LV8A 4B0OA 3EIXA 3A3YA 2IPXA 3NOXA 3OSZA 2Y92A 3ZZUA 3RKUA 3ET4A 1MF7A 4G4JA 1MTZA 2HU7A 4LW8A 2IDZA 2ZRBA 5HG0A 3WNBA 4DLWA 2O2EA 3BULA 4PXYA 3QVJA 2XTNA 3E9EA 2OEPA 4J2TA 3MFQA 3ZHQA 1AU9A 3V8RA 4HDSA 2ZJBA 3EXHA 1E1KA 1STOA 4FHGA 7YASA 1LSOA 2J5KA 3DAFA 3II6X 3M5WA 5KJFA 4DVJA 5LFAA 1YS9A 3CSUA 1BW9B 9LDTA 1SXJC 1BDMA 1XDUA 2A0KA 2AUMA 3KD3A 2FN3A 4GOOD 2YJ4A 3CM0A 1PFKA 4V0RA 2CN1A 2CK3A 3K70D 2QLTA 2XCRB 3Q11A 3KVNA 1FFCA 4MRMB 1UFQA 4NDAA 1QX4A 1SH7A 4ICIA 2HMUA 1FJ2A 2V4ZA 1P4SA 5DM70 3DH0A 3OAAA 4S2EA 3LX5A 1THZA 4QPDA 1KDZA 2R84A 1U7DA 2HSJA 1JXQA 5E7JA 1SOAA 2FSSA 4ZRDA 2FF7A 5TPZD 1W47A 4UQLA 5E1DA 4CR6A 4F92B 1YTUA 4BTLA 2XYHA 1RAAA 3FSRA 2VHWA 3QWHA 2Y2UA 4YXWD 3K09C 4DDMA 4B4DA 4JI1B 4L9SA 3QTBA 4FOTA 3MT7A 3V6LA 1HY3A 4A8TA 1YBFA 4Y6SA 1OWOA 4WN3A 3VH3A 3GNSA 2EQAA 2AN5A 4HWKA 1W0CA 1U28A 3BOSA 3D4BA 5T5QA 4Z4HA 2GEVA 3R24A 4D4HA 5EKTA 3BGIA 4F9GA 4Q9LA 1NLZA 5I7SA 1T2AA 3UKJA 1DX4A 2CL7X 4X20A 2FOIA 3OU7A 4FHCA 1ZN9A 1VG9B 4HK4A 1TF2A 1XXLA 3A9SA 3B36A 4LXGA 1IDOA 1OXVA 3MWLA 3OTGA 4BFWA 3HZOA 4V3BA 1KK2A 5KNDA 5MF6A 1FDWA 1FW6A 1IIRA 2P9YA 3QX8A 3H19A 5EXSA 1XMXA 4O4JA 3RYFA 5CYGA 1AKTA 3R3YA 1TI7A 3BQ9A 2KBFA 4JI4B 1RWVA 5BSEA 3GELA 4PBSA 3HN7A 1GPH1 3PE4A 3Q6IA 4WTOA 3RS0A 4WVLA 3HSKA 2DG2A 3AQIA 2C2YA 5T64A 2PRYA 2PVPA 2P5YA 3VAYA 5EJ7A 1SXPA 2YVAA 3DAYA 2XNHA 5E2IA 4XVQA 3VM6A 1SO8A 3B70A 3U3JA 4U2GA 1Z3IX 5AOBA 3TLJA 3U7FB 3KJQA 3I52A 1BU8A 3RADC 1FP6A 2HEIA 3M5DA 1XV5A 2GZMA 3ADPA 3C15C 1A95A 3H9EO 4AJ4A 1OWLA 3ICWA 4OFXA 4DUPA 2XUQA 3I5UA 4B3DA 3OFND 1MC5A 1WAMA 4KO3S 3FFTA 3DUWA 1UBEA 1XJ0A 1O9BA 3EA4A 5EIOA 5EE5B 4CQNA 4D43A 2XXJA 2ZAOA 3WADA 3ZI0A 4XUCA 3R7LA 4ACAA 1Y3HA 1CXZA 1NGSA 3I5MA 4EJ0A 4E11A 2VTEA 4DNPA 1U0RA 3OCXA 4G0XA 4LRYA 2PV0A 5CLLA 1EJ0A 1TTHA 3FMVA 3R3HA 4QTZA 2NPFA 4DIOA 2NU9B 5FTJA 1Z18A 1YIAA 2I4IA 2KW5A 2NM0A 3R3UA 4TWJA 4LI3X 3GLFB 1MVLA 5JTTA 1GGEA 1Z6QA 3TAHA 3WG9A 1J70A 3SEZA 5JBIA 1T8SA 1G4UR 4GQBA 1NXQA 4IKPA 3MWKA 2GJSA 3FWKA 1YH3A 4CLOA 3RU9A 1QO0D 3UYLA 4M9ZA 2HO5A 5T57A 4F1JA 3HNOA 4IFIA 1NOIA 4IDCA 3PPWA 4IYJA 1M34A 1XD8A 1M2HA 3O3CA 1N2CE 3ZCQA 1KSFX 3WLJA 3ZDQA 4NE7A 2DTXA 2ZTVA 3U9LA 4UU0A 1ZM3A 4XIIA 1ICIA 3B85A 2C9CA 2DR2A 1ZH4A 2Q45A 3PD1A 2B30A 1RAGA 3PNOA 4MWTA 5J59A 3Q9SA 4RVOA 3SVZA 2H7VA 1IVNA 1ABEA 5AHWA 1T34A 3C45A 1CUXA 3OJXA 4RQTA 2F1KA 4LWOA 4X1KB 2D4AA 3FAKA 3NT2A 3NCTA 5JANA 2B3DA 5F3DA 4DBVO 1DIBA 1M67A 3QBTA 5JSFA 3H1GA 3KBOA 1YD7A 3VR6H 3AERB 1E3WA 4F2GA 4QJBA 4QWMA 3P8ZA 3QKUA 3QHPA 4YJHA 3VVLA 3EBPA 2J08A 1RPZA 3VBEA 1SVMA 2OCXA 3E53A 4LDZA 3FF4A 3CH5A 4V0MA 3A3PA 1P2TA 1R1DA 1E2KA 1NI4B 4KRXA 4UUOA 4CDGA 1FRNA 1W48A 4KIWA 1Y9DA 2XB6A 1QOPB 2DWQA 2I8LA 1THMA 2FZGA 4UEWA 4UBKA 2PYDA 4EUNA 1ZD5A 4ZDWA 3RT1A 1NT4A 1BX1A 2J41A 4MMYB 4CG1A 1MX1A 3C4JA 3FCOA 1CP2A 4YJGA 2ZIUB 1C7IA 3E7XA 4X85A 4XD7A 3KT3A 3S1AB 4G0NA 2OY0A 4BZPA 3E2PA 2WD7B 3DEIA 3I23A 4PXAA 5LP6A 3CSSA 3EGWA 2IELA 4PX9A 4DGSA 3KHKA 2H16A 4DM4A 4ECEA 3EVGA 3RRBA 1ILEA 1YE5A 4PZZA 3IKVA 1ESNA 2AQ8A 1E1RD 2CCGA 2YY7A 2GBFA 2GO7A 4MQFB 4AKEA 4M8LA 1TYBE 2NUTB 3KYDA 4MYUA 5A4DA 2PMEA 5BWLA 2ZS7A 1Z17A 4N3AA 5CB8A 1TLTA 2XZDA 1L4GA 3W8NA 3IEMA 4HH4A 2E4AA 4U7PB 3ZY5A 3UB3A 2KI5A 1Z34A 3LF2A 2TSYB 4U7HA 3S2EA 4DREA 4IKEA 5FL7D 4XSGA 1F5NA 2GCIA 1KRHA 5JQWA 3MN1A 2IBSA 4TPKA 3VA7A 3SFVA 4QU9A 2NIPA 2X19A 3I8XA 4L9WA 2X14A 3PA8A 1LC3A 4MQLA 4EVIA 1L1QA 4EHAA 3KJFA 2WUFA 8GPBA 3KPJA 3N2ZB 1MO6A 4CDNA 5MN4A 4DJDC 5GVRA 3IH5A 5CCXA 5EHIA 2CNNA 3C6BA 4MR9B 1ZI6A 3JQ6A 2A14A 3NBAA 4KXWA 3TTYA 4RSHA 4X1YA 5B2FA 3Q88A 3G49A 4MRNA 3HUTA 4RTQA 1ONSA 4TRJA 1L7PA 4CG0A 1JT2A 3HA5A 4B6JA 1BCRA 1I9CA 5AP9A 1B26A 1ZIXA 4PZEA 5EXPA 5T8KA 4BFZA 2MSNA 5BQ5A 4FLFA 4OLJA 5KTOA 2PH7A 2LGJA 4K9DA 2Z8XA 3MELA 4R6XA 4RZSA 3NRJA 1SXJB 1KAMA 3DD1A 5AYVA 4INJA 2YXPX 1HOXA 3G2IA 2JKZA 5FX2A 3L7IA 2I4OA 4RYLA 1NRIA 1GTRA 1G7SA 5FOXA 1WW2A 1M0EA 1GXSA 3DVAB 3O8OA 2NXNA 3RT7A 2HK8A 1X2EA 1GN9A 3HADA 1HDOA 3BORA 2NYRA 3BJMA 1X14A 3ENQA 3ZTYA 5IKEA 1NBMA 1JZSA 1GKIA 4ES6A 3BK2A 4PG4A 5B1YA 4KXLA 4M99A 2A94A 4DLSA 3QLEA 3G6WA 1QH8B 5DHSA 1BE6A 1Q6ZA 3U09A 4HG2A 2HDWA 3EXIA 2XUZA 4OHMA 1X1EA 3B3GA 3ZE0B 1MB0A 4MP3A 1NY6A 2XY4A 3ORSA 1GCOA 3PRHA 1ZKDA 1HH4A 1M76A 3A28A 3KYDB 2NUTA 1IQRA 3LKDA 1I3NA 5DYYA 4A0HA 3CFYA 4ZFNA 2VP5A 2JRLA 1W5AA 3GGJA 4IJUA 1M6YA 4G41A 1LSJA 3H5TA 3PEEA 4QLAA 1E2JA 1WF3A 3OCZA 2JIMA 3ONDA 2BLLA 4MZDA 4YAJA 1P1BA 5IT4A 4BNWA 2JJQA 1EVEA 1NYTA 2EATA 3P96A 2AJCA 2I1VB 4KCGA 4P3XA 1TJ5A 4YK7A 4PBRA 3WL6A 4D46A 4DCGA 3CF6R 4BS9A 3PFIA 4EOGA 1G19A 4F3RA 4NOMA 1OWPA 4YJGB 1NG9A 1XMSA 4JLPA 1U4NA 2EKLA 1W0JD 5JS7A 1OFHA 1RJEA 2QLNA 1VHTA 4H7JA 5LJIA 1QU2A 5ALXA 1M1YE 3BK1A 2Z5GA 3IX7A 4FDLA 2D7DA 3BE6A 4DMRA 2JIDA 1YI1A 3CX6A 3Q9UA 2J7PD 4UD2A 3W4JA 2B8EA 2VBIA 2AV6A 3N2LA 1M8KA 3SYMA 2B83A 5B6PA 1AMUA 4DG5A 1V11B 3AOGA 4ZVMA 2P2DA 1Y7LA 3R5XA 3PR1A 3MOIA 2CLLB 1K7SN 3IA7A 3F5DA 4YMHA 1QFXA 2W6JA 4RLFA 4K05A 1LV7A 4OA5A 2I7XA 3CGGA 4G5QA 2F48A 2ZM6B 2PZBA 2NU6A 3QIAA 2J3LA 5DF1A 3VI4B 3NMUF 3V1KA 1PNVA 2E89A 1QPZA 1Y8ZA 1K06A 4HI0E 2PQ0A 1SVOA 3IIJA 4BCDA 2GT1A 2WM3A 2X1MA 5FB3A 1OT5A 3GAZA 4MINA 2WF7A 4J91A 1ILWA 4DCPA 2R47A 2P41A 4G81A 1XD2B 1XRSB 3ORQA 1M34B 1IWBB 1DHTA 1OROA 1XDSA 2PVSA 2AX4A 1JB1A 3C48A 1E4YA 2AFIA 4I8XA 4L6IA 1E2HA 1MJGA 5EXEA 4PYLA 1C3JA 3WHIA 4CM9A 1PFQA 1JDTA 2ZBGA 4MDHA 1DIGA 4DT1A 2X2OA 3DO6A 1GVHA 3PWZA 4WASA 1SUBA 5AK5A 4RW0A 3WQHA 4HN9A 1QYWA 1WMDA 2JH8A 1NVTA 2XMRA 3L18A 1D0IA 4LY0A 4RK7A 1V26A 2YQ5A 4DCOA 3KDSE 1RXUA 4O6VA 2RJ3A 2D5AA 3M5PA 5M7EA 4H6XA 1VRVA 2AX3A 2AYZA 9GPBA 1RFGE 5IXSA 3I6ZA 3AU9A 3JASA 4HWSA 5AJUA 1W96A 1T4CA 1RACA 1XCBA 3N07A 3R0VA 4HNRA 4IUDS 4U2DA 5BR7A 1KQGA 3IMGA 3ONVA 2JAUA 4IPTA 1IZ8A 2RKWA 3AVTA 1E77A 5HILA 2A5LA 4FFBB 5KNCH 2R62A 4YMTA 1XEAA 2GNPA 4YXFA 1T9DA 4L4UA 5H3LA 3DEZA 1HEIA 5TVGA 4AY6A 3ZHTA 3VZQA 5ADWA 3RYHB 4IRUB 4JT9A 3D81A 2VAWA 3IQZA 4ZOLB 2I4TA 3Q3HA 4FCVA 2XZTA 4F3KA 1NDHA 2QM8A 4BO5A 4DIMA 2QOEA 5E6SB 3HB0A 4C1NA 5IN4A 2RB4A 1EK1A 2BEVB 1L7EA 4FGLA 4C4TA 4DCNA 1S2MA 3OPMA 4OHVA 5LU8A 2IH2A 3SFZA 1BHJA 1R4ZA 2QM3A 2Z30A 3JRXA 4B3CA 2R6ZA 3SZRA 1KI4A 4G09A 4OYLA 3KWJA 1MHTA 2R11A 2NZWA 2XGSA 3N75A 4TLBA 4Y1EA 5HTOA 2Z8YA 1XZBA 4C7KA 5AHRA 3ELWA 1QG0A 5FPSA 2ZWAA 1VE3A 1H0RA 2HO4A 1K4KA 1JG7A 1LVHA 1A3CA 1KQ3A 1XEXB 3IPXA 5ALVA 5JOQA 2DBQA 4JD5A 1T9HA 1LKZA 2CVHA 2SNIE 1E0KA 1U7HA 1N0WA 1R5NA 1W85B 1WV0A 2QMUA 3UMSA 2ETVA 3D7MA 4Q4JB 3QU4A 2HSZA 5DBHX 3MLAA 2JRCA 1U0EA 3I28A 5CNIA 1WDTA 3EJWA 2ASVA 3HRKA 4REOA 3RFFA 2AFIE 1U2ZA 2DLDA 3BERA 3NWPA 2Q1WA 1RHJA 4Q1EA 3Q87B 2AJBA 4WOPA 3VYUB 3EDYA 5EEHA 1OE0A 1RRPA 2W43A 5FPYA 1DJLA 3W3AD 3A6EA 2OMKA 3I62A 3WLLA 2X23A 1XF9A 2Q0QA 2QAGC 1HFWA 4C7VA 2AXNA 1U5AA 4ZYZA 2B98A 3ITKA 3NP7A 2D2IA 1BEEA 2Z3VA 1CF4A 2ZRPA 2LKCA 2XMQA 4ETWA 2BFOA 1LI4A 3I9MA 2EFJA 3ZIUA 5HDQA 4OP1A 4OGLA 3R5TA 4X6UA 4YB8A 4D5GA 1KI7A 1CUGA 1XPRA 4MRSA 5JZMA 1FLDA 2WJVA 2Z4RA 2XCTB 1KYZA 2Q3BA 2XYQA 5F1YA 1OWNA 3AVPA 3OF5A 1RKUA 3EY4A 3G9XA 2NQ8A 1KXZA 3C3JA 5C2JB 4AKHA 3HJFA 3C3MA 1NFRA 2BLNA 3NEYA 1PV4A 1YR9A 3HR8A 4UAVA 5FJJA 1XWFA 1LX6A 5FWXA 3EG9B 4B76A 4MWZA 2JIZD 5TX7A 1T3ZA 3CF0A 1RWPA 3O3MB 2WF9A 1QGOA 4FN5A 4OHRA 4WGGA 3E61A 2EX0A 4DJFC 3QWFA 4QD3A 3ULKA 2CYAA 3MB5A 4BN0A 3KOWA 1VGRA 2EJWA 3MINA 4HUJA 1H2FA 3EA0A 5KINB 3DE5X 1Q0QA 4JL8A 3IQDB 4R1NA 3GLGA 4MMZB 5EHGA 3LLMA 4CF6A 2GBGA 2H65A 3B7PA 3VR4H 3NDPA 1LWOA 5EZ6B 1QHEA 4HAXA 4LWQA 2I3DA 4RD4A 4XX0A 1TU4A 4DZZA 5ALNA 1LI7A 3PJFA 2B1JA 4ZTZB 4D41A 3CRW1 3RSZA 1M1XB 1T6ZA 4JBIA 1ACMA 4YP6A 2ZR9A 2WD8A 1N57A 3EC2A 4KLAA 4P4SB 3BTVA 3LBNA 1LDGA 1W7AA 5ITZA 3IBFA 2VJNA 4F4HA 2X0DA 3QH4A 4ITVA 5BORA 5KQSA 4EF5A 2O50A 2RBEA 4LYYA 5AXCA 1CUWA 5IFLA 5LP6F 3AV3A 4JKYA 5KQRA 1MLDA 3JVDA 4IMIB 3MMPA 3OZTA 2IUYA 3QFCA 4DY6A 5A3SA 5CM9C 1QHHB 3AJ8A 4DLXA 1ZLXA 2DUUA 3TB4A 4CMCA 1HLPA 1SOUA 1FQWA 1JUDA 1RYMA 2YRFA 2ZULA 1AKNA 4Q37A 1JAHA 1WVMA 1A4XA 5T6BA 1M8FA 4GM1A 5A4KA 3ADDA 1S2NA 3AHCA 3HB1A 3NANA 5HZKA 4PZLA 4YCAA 3IBGA 3ZKAA 4L8FA 4N76A 1JQ5A 1CJBA 1AK2A 2F9LA 4YRQA 3HCWA 2NU8A 3L7JA 2QTVA 2FWPA 3KOUA 3LMKA 3TQOA 4ADSG 3H1TA 5HXAA 1UBRS 2VA9A 5EZ5A 4XA8A 4QELA 3RS9A 2FB9A 4JP5A 2H4JA 4S24A 1HA3A 2B7BA 5DH9A 2V7QD 4D4LA 4RFVA 1EXVA 2VH5R 3TBFA 1NJ8A 2PGIA 3A11A 2B4KA 4EPVA 5D3QA 621PA 4PZCA 2ZJ1A 3UV7A 3PYMA 4D8UA 1A9PA 4KQFA 1OXMA 1BXKA 4DILA 4AULA 4DQDA 3SDZA 4MAAA 5D5HA 1DCFA 1JJBA 1NVMB 4QXOA 3CG0A 2VHYA 4MR7A 1RP1A 4ZJYA 3IVCA 4PO9A 1L6IA 1T9GS 4A6XA 2W2VA 1FZQA 3QVGA 1RJDA 3PKJA 2XMZA 5E8RA 4PC1A 5B64A 3BCHA 3K70B 1ADYA 4RV4A 1TMOA 4B3GA 4TZ6A 1JQAA 3ADKA 3HYLA 5LOVF 4EFDA 1FQOA 1KR5A 3C85A 4EJSB 1I7QB 2GZ2A 3D64A 4B7UA 1I6KA 2PGAA 3AG6A 3L4EA 5JCOA 4TXLA 2PRZA 3TLGA 5A4IS 1N0HA 3B9QA 3FDJA 3PICA 3GLGE 3U60B 4EGFA 1CUHA 3O3OB 2I34A 4O59O 3DG9A 2C2OA 1L1RA 4C21A 2GDJA 3PYLA 1CY8A 1PDOA 4JELA 3HGQA 5LQUA 2ZB4A 4OHYA 2VNKA 1EGVB 3KPYA 3N86A 4TXHA 3UJ8A 1VYHA 3OOEA 3I30X 3O7MA 2WG2A 4IYRA 4JB2A 2BEJA 3AK4A 1V1MB 4POOA 5DLYA 4QQNA 3QKRA 4L78A 4D6XA 1E3EA 3TNLA 4KXVA 3TFWA 5DWQA 2ACWA 1UMBA 4HSEA 4LHYA 3AC0A 3IHLA 4BLOA 3QE2A 3AJDA 3T54A 1SUAA 4BXOB 1Z7WA 1V1RB 3MBKA 3IP9A 5AK3A 5TEWA 3V8EA 5E3HA 3NAGA 3R1IA 3U4MA 4DSUA 1SD5A 2WNSA 4PQGA 1S3SA 3K05A 4N6GA 2RMKA 2JHAA 4AXBA 1ULSA 3JPWA 3Q8LA 1D6MA 4G5YA 2GR9A 2WU0A 4P4GA 5HW0A 4QXAA 1HTTA 1G5PA 5E4JA 1CE8A 4JP3A 1I2CA 4ITUA 3M9WA 5TMDA 5L53A 3WLAA 3ETLA 1IPEA 1IY1A 3TSZA 4BP3A 1A88A 1M7BA 2A9JA 2ZIZA 3GX1A 5ALDA 3TQTA 1NWHA 3ZR4B 4CG2A 1KZ1A 2GMWA 4AM8A 3RNLA 3N2KB 4CLRA 3WL8A 1G6HA 4DPLA 1RSZA 3C3KA 5FTKA 1CY1A 4TV8A 4HEJA 4KXMA 1P7WA 4YUAA 2YHSA 4AP5A 1IZ7A 1KK3A 4UNNA 2QNRA 2E82A 1P33A 4PGMA 2FX5A 5HMMA 2F1OA 1T8TA 2IYWA 4FDAA 3G5TA 4EI7A 3JAWA 5DM60 3KYJB 3DXXA 1WG8A 5AICA 4B2PA 4CN9A 3L0CA 3FR8A 3OKAA 1L1FA 2ZG6A 4HXGA 2HWYA 1YO6A 2F3PA 3SE0A 3W7AA 4BVAA 3KS9A 1FA9A 5KQPA 5KSOA 4G0PA 4LDJA 2E5LB 2BEUB 1V4NA 2J30A 1B1AA 2F59A 3D2CA 3H3JA 3IQXA 3L0SA 5EMNA 2G04A 1CQIA 4HXYA 1L5HA 1NSTA 2PUGA 3VV3A 3FMGA 4Y30A 1GADO 4XGNA 4A6PA 1DKNA 4YHHB 1TEXA 3IDQA 4IHKA 4X1KA 1R0KA 2FHPA 2YY6A 4ZU6X 4WOJA 3NPMA 4AY5A 2R751 1TFRA 1KI6B 3L7DA 5JQGA 2VP2A 2BKXA 2JGAA 5A9TA 2OLEA 3C43A 4NVRA 2JGIA 2RAPA 2QPAA 1MRSA 3NZEA 2GH1A 2PUBA 1JQJC 3BXGA 4B3XA 1UXHA 2IX9A 2QJWA 3NNDA 3P4UA 1T2UA 2QG6A 3BCSA 3DNFA 4MWCA 2DPLA 4YUXA 5KOYA 2CVZA 3ZHCA 3THWA 2VRCD 4E7PA 5E9JA 3Q10A 1GRCA 3U4QA 2RAVA 2RJOA 3R5KA 2JJ8A 1D6JA 2A9OA 3M4JA 3L40A 4G8JA 1U8CB 5GJWC 4MWOA 4F9EA 1L7DA 5CA0F 2ETXA 3H05A 5CFPA 3HJAA 4B4OA 2P67A 5B2ZA 1Q0ZA 3VKUA 1XVLA 1NQUA 4LSGA 1X7HA 1ZISA 3EPHA 2N42A 5JFOA 2WAOA 4TYYA 2W2LA 1IZ9A 4O3FA 1I1HA 2CNBA 3CJTA 4QPJC 4RZIA 1C8BA 1ECBA 5JZBA 2LUOA 2GESA 4ODIA 5E4YA 2M1ZA 3X2FA 4BNHA 4W8GA 3MGCA 4B5KA 4TMKA 3QEMA 3LP8A 4DWVA 3J81k 2C7RA 1TCBA 4MO2A 5FUYA 2ZIEA 1LJUA 3GLIA 2AOXA 3ROZA 2MOKA 5ES3A 4U8GA 2OA0A 2C1XA 2NAFA 5HF6A 3TKYA 1TQ2A 2AKAB 4G9EA 2W6QA 3HNPA 4NF2A 4NMHA 2QRZA 1BS2A 5ADUS 5BYKA 4X9XA 4DSAA 4ZTBA 2QM0A 4TQGA 5IF9A 3LVQE 4MGYR 5KQLA 1QH8A 3CGWA 2O8BB 3KYIB 1ORIA 2J9FB 4BIIA 2IHNA 3TD2A 4HOYA 3FRHA 3S4YA 1SR8A 4R81A 4PPNA 1A8PA 4RZUA 3CNHA 3H1AA 5K3EA 1V5WA 3UGKA 4FZRA 5FOUA 4F6LA 1TK9A 3KEFA 4BMDA 1R6VA 1LCIA 3CLTC 1E8DA 1UADA 3I72A 4X92A 3C98A 3IMFA 1UPFA 4MYRA 3RC7A 4YPVA 1VPWA 3AEUB 3D7SA 1E5DA 2I1WA 3E1SA 3L5OA 2VOJA 1PG0A 5EIXA 4AF6A 1KHTA 2FU5C 1FTQA 1RTTA 2WA2A 5IZ4A 3TMAA 3X1WA 1KJ9A 3JZAA 3KVVA 4IG4A 1HE2A 4RHEA 3VKGA 5JXHA 4FKBA 4MVCA 2BJWA 2UZ1B 4URXR 3O84A 1BD3A 1YMUA 4R98A 5HJ2A 1QQ6A 1EDDA 1J20A 2VBGA 4NBSA 4KR9A 3GT7A 4ZYUA 3B3FA 2OGUA 3ACCA 5B6IA 3GRFA 3B3QA 3TZHA 4DYVA 1EAMA 2FA9A 2GD0A 4MVJF 4MV8A 2FZLA 4Q1AA 1YASA 1D2HA 4F6RA 2JASA 3N5CA 3OJFA 1C81A 1XG5A 5C37A 5JZSA 1ISIA 3T3OA 2EG9A 3OWHA 2HNAA 4YIHA 1FE8A 4UUPA 3BHJA 4JLJA 1PUXA 3IPCA 5DNVA 4GP6A 3T7JA 3B3AA 3ZHRA 4BLTA 4KG7A 1C9MA 1J8MF 3GLTA 3O8QA 1QYXA 1FVHA 4MARA 5CVJA 2BTQA 3V34A 1X9IA 3A3NA 3G8DA 4X7BA 1EUCB 1HDZA 1JSZA 2O19A 2CVPA 3HUDA 4O4IA 4RDIA 5C7YA 3VPDA 4NZMA 4YUVA 4EELA 5K6AA 3C8DA 1UXKA 1G41A 1VJTA 2DUMA 2O57A 4ZC8A 3UHFA 4GICA 4G9BA 4DIFA 1HTWA 3JQBC 1KVUA 2Q1SA 1P18A 1ORRA 1CRPA 3VH4A 4FOLA 4EB6B 4QHTA 2FHSA 3DOCA 3NW9A 5CDFE 2R60A 2WTXA 1ZESA 2VPIA 3IIEA 4KWHA 1E9EA 3VZRA 3ND6A 2D1RA 3AILA 1YZLA 3PRKE 4E2ZA 4PFJA 3LZCA 5J4VA 2F8TA 5DTEA 1ZNQO 2FSPA 5ABPA 1RKBA 2WWXA 3IOMA 4GMKA 1K3FA 5A6SB 2HA7A 4E1AA 2GCOB 4LZZA 3KR0A 4XWAA 4BNLA 1Z5PA 2EOAA 1W94A 3BC1A 1IBCA 4BB6A 2XVXA 2PU7A 3EW7A 1I6MA 5JS8A 1ZUNA 1E6WA 1GL6A 5FUVA 1CBUA 2JPDA 3GF4A 2H1RA 5JECA 3NPAA 5EMMA 5LR6A 1O87A 5C5IA 2V58A 1ONBA 1VTKA 3KP1A 1G20A 1KY5A 1M3SA 2HSWA 3T9CA 3FKJA 4BUZA 2ZANA 1ZD9A 4HAIA 4GC9A 4Q3LA 5BSHA 1OLOA 1CEEA 5EXXA 3L4KA 4X71A 4YJHB 2HK9A 1ZW1A 2QAGA 4MV9A 4UE2A 1WY5A 4EDFA 3CX4A 3OOWA 4DF3A 5A7FA 2H17A 5AW2A 5JJIA 2F3QA 1DBPA 1USGA 2VNSA 1O1YA 4H2DA 2PSSA 1MEJA 3GCWA 3IVAA 4I5GA 2REOA 3STTA 4QYWA 1XKTA 3U62A 3VSEA 4D9EA 5AESA 4F8EA 4EB8A 1Z2CA 1Z0KA 2PUEA 1VFNA 2JB9A 4H6VA 3K9HA 4LGCA 1IPFA 2FPRA 4DMKA 1GG5A 3ENVA 1L5RA 1FRFS 4NAVA 3D4IA 4YMSA 1ZNZA 3PUJA 1XLTC 3P1JA 5JSZA 1CZHA 2JEZA 4BLSA 2QRMA 4TKZA 3F8TA 3QLUC 2C0PA 4J9VA 3FGNA 2HJWA 5DIZA 2P2ZA 1FLNA 1WXXA 1NR1A 2XECA 3I53A 4WOKA 1Y98A 3NEJA 1MP0A 4FEAA 5KYWA 4P0QB 1BCSB 3AZPA 3UV3A 4HX5A 4D57A 3KCQA 3O38A 4QDXA 2ZB2A 3WWPA 2QMQA 2KMLA 3CIFA 3G0BA 4NYMR 4MLCA 1SK8A 4YP1A 4BVLA 1P4AA 2OGZA 2O8NA 3MNFA 3Q5GA 4RK1A 2UYGA 2G36A 4TXJA 3WFJA 1JMYA 1DC4A 2JLZA 4JBLA 4K40A 1IJEA 2QRJA 5ALHA 2RSLA 1GQYA 3U80A 1VSQA 3A1SA 3V6MA 1BMFA 2SCUA 3WGHA 5TGZA 4FGUA 1REQB 5BR1A 3C5CA 2GAOA 4KYUA 5GZ1A 3NXKA 2OCPA 4A0GA 2NO7A 3TLXA 5AI9A 2XWPA 3AM4A 4MWGA 1J24A 3ZE2B 2YV4A 1MIOA 4YV0A 4YC7A 2PSEA 1F4LA 3ZCTA 2CV0A 1FPQA 2P6UA 1YJQA 3L8ZA 1RHUA 1YI0A 1BFDA 4TMWA 2P2LA 1EE2A 2O06A 1R6AA 1KJIA 1SIWA 2BCJQ 3A4VA 1C2TA 4TSFD 1T10A 3RIMA 5LNK6 1PR0A 1VA4A 1O0CA 3OD5A 3K0EA 5HM6A 1VE6A 5FBQB 5AIBA 2C4VA 4AK9A 4UHJA 2WIDA 3IUJA 1IU9A 3NBKA 4UU7A 1P77A 1F17A 1MH1A 2PH5A 2HYDA 5REQB 3Q3JB 1O08A 1H9BA 3DB1A 3S3TA 2BYTA 3HVKA 1BEUB 1JFFB 2VK2A 1PDVA 4MA0A 3HSSA 3ZGYA 2ZUBA 3FMOB 1FNBA 3OBBA 1FTGA 4C7BA 4Z1MD 4FS8A 4WFJA 4RTRA 4UAUA 2Z6UA 1Z25A 4CE6A 3BWCA 2JBWA 3LWBA 1H5NA 3P0HA 1TZMA 4R71A 4QGSA 2QORA 3H5OA 3IALA 4V0SA 5AVVA 3QFRA 3WLPA 4BB0A 3EIQA 4FFOA 1PQ4A 1JF8A 1IHDA 3I9NA 3PHLA 1TKCA 2XSZD 2BGNA 1Y5LA 2C4WA 4C0LA 2JG3A 2R1VA 2GXAA 2EZ8A 1ESDA 5BR4A 3EY9A 2RH4A 3IB6A 2EDCA 2YV1A 7MDHA 1E6UA 1IEXA 2C2BA 2EG5A 2R8BA 1H8HA 3WTBA 5JBQA 2ZROA 4UJ5A 2I71A 4WLEA 1E0JA 4N0MA 5AVOA 3CQ9A 1PUJA 1AXEA 4I9HA 2NUAB 4WINA 1D8AA 2R6HA 4QG7A 2G1UA 3F7TA 4NMMA 1GSOA 2BGMA 1A5TA 4CG3A 3I64A 5CUQA 1UBSB 3QP9A 4IDNA 4DCSA 2R8ZA 1L5YA 1QHFA 4C2TA 1Y81A 4KJXA 4DCVA 4DQUA 2LVBA 4WXRA 2ZCJA 3ZJTA 1TTQB 3EQ9A 5AW8A 2R1VB 3RR2A 2X4LA 3BQNB 3F4BA 4IEIA 2GCPA 1E9BA 3VVMA 4XWKA 1P45A 4PLVA 1RMQA 1SJ9A 5BYJA 2P0EA 5BRAA 4RVUA 4BP9A 2IPAB 2RHBA 4M8SA 3VJLA 2QTMA 5EMHA 2ZM5A 1FFYA 3LP6A 4CV3A 1I2DA 3FUVA 2R2AA 1F0YA 2F00A 2QVLA 3WLFA 3EULA 3BWEA 3T5CA 1I3CA 3R4CA 1A5BB 1GZ5A 2QG9A 4URFA 1SCJA 4XOUA 5IVDA 4MUIA 3KZ1E 2JIRA 5K01A 2PH3A 2PN1A 1TJNA 1PX2A 4WCFC 5I7HA 2C3PA 2NSHA 5KX5B 2GM4A 1XYYA 1AQ6A 2XNKA 5KOHA 4OI4A 1GUAA 2WHRA 1B0PA 3R5JA 5IM5A 3WL4A 5K8JB 1BS1A 1HEUA 1ZK4A 2MT9A 4LDQA 3EXG1 2G88A 4FHDA 4JQSA 1W5FA 1SCAA 1YVPA 2CJXA 4EO9A 1HYEA 2XE8A 3ZIDA 4YRAA 1SY7A 1RVV1 2OZVA 1YOBA 2Q07A 4TMVA 5ERGB 4DM7A 3B6EA 4V0NA 1N3IA 3JCZA 4MP6A 4NFLA 4YONB 5FPHA 1KBOA 1UMKA 2N0SA 3CNBA 3QW4B 1RBQA 4MYCA 1A69A 3UT5B 4D02A 2JGFA 1GLNA 1P4GA 1PSDA 3EK2A 5CGZA 4LJRA 3K0AA 4FTWA 1GFWA 2Z1DA 3TRIA 1R0SA 3HHPA 3MTIA 4P4NA 3ZYZA 5AFSA 1NNEA 3RRMA 4Y6QA 5KVCA 3CMCO 4CYMA 2G0AA 3HGMA 2JFFA 1RYZA 3KHSA 4DLZA 4GFDA 2WICA 1P1KA 3HB5X 3A6LA 2C42A 3IE2A 3V55A 1ZVQA 4D4JA 1DDIA 1E3IA 2JGDA 5DK4A 1D4ZA 5C34B 4CIYA 4RK6A 5I9NA 3HQ4O 4F3YA 1UZNA 1F2VA 3QUQA 2DVMA 3O82A 5JC1A 2FR8A 5B7GA 1NQTA 5GIOE 1D9XA 3FBTA 1KERA 4MWEA 5CFMA 2HM7A 4KGVA 1QF6A 1FFHA 3CW8X 4K86A 2W0SA 3TUJC 1T24A 2VEDA 1ZJZA 3DW1X 4GOMD 5F7ZA 3H9GA 1TT7A 1XEWX 4DIBA 4QHSA 2VYQA 5AR1A 2XHZA 1JU3A 5BPHA 1E4VA 4CF3A 5AJXA 4L74A 1PNQA 4YT2A 1NY5A 2QAGB 1BX0A 1DRWA 2VJMB 2ZS9A 3CZMA 3IEIA 2XUDA 2C58A 4KO1S 1GTZA 1CULC 4XGQA 2VNJA 3TTXA 3M9LA 4F86A 3M34A 4GQAA 4KH0A 5FTNA 3W5CA 1G20B 4ND8B 3EFEA 4KXYA 2HT6A 1CB7A 2OUIA 5CT6A 4GLFA 4ZV7A 1E6EA 4YQEA 3B2QA 2BSXA 1USWA 2WAXA 2HD4A 3AUSA 1W49A 2XMGA 5AKIA 2ZJ6A 3OCJA 2IYNA 3NYQA 1GM5A 3OEED 4Q05A 1AKUA 2Q9AA 1ZH6A 3DEYX 3GVPA 2ZI3A 4TWAA 5DNEA 2WR8A 2O1SA 3R0ZA 3FZQA 4FEEA 3PDHA 1U5CA 1T5HX 1NA5A 2Q5OA 3FZGA 3L46A 3BD8A 3DLBA 3P5BA 3DDNA 3EH2A 3KUDA 5JV5A 3TECE 1KP3A 3H4MA 5CDUA 2MR6A 1GGFA 2Q3FA 2FN9A 3DBOB 4HFJA 4NQZA 5E6RA 5GY7A 3K0BA 1G17A 3QVXA 4X95A 4XPIA 1LA2A 2ENWA 5CCDA 2QXUA 1Z6YA 4ML3A 1R12A 2XYRA 4ALNA 2OENG 4ZOAA 1E2EA 1I33A 1Q15A 3ZCXA 3FTDA 3FHLA 3KKNA 2J67A 1NMZA 3CPHA 5FBHA 4RA9B 3ROTA 4XZ3A 3RS5A 1UAGA 2HRBA 4TRMA 3WKAA 2YBDA 3A6DA 5C32A 2NVUB 1JHRA 5TQ2B 3AR9A 3UWSA 5GJCA 1IOLA 5EP4A 3VHQA 4C4ZA 3JQ7B 3ZLBA 3BSSA 4KXFB 1K8XB 2OC9A 1GAQA 3L8GA 4QOFA 3R74A 5G0VA 1KEEA 4UTOA 3FRIA 1JHAA 3I61A 2CEAA 5TSDA 1H2AS 3FG9A 1KARA 5A4JA 3TZCA 3MCTA 1K92A 1U7XA 3RAGA 4IXWA 4JOSA 1QBKC 2N1MA 3QU7A 3R41A 4RHUA 5AO9A 2KLHA 3L8MA 1F4VA 8LDHA 3ZVNA 2AWNA 3ZUPA 1F0NA 3E5NA 2XBUA 1CIVA 1OVGA 3EOZA 3FCXA 5BQFA 5AW7A 2O8EB 1MORA 1W93A 4IOLA 4O0LA 3GU3A 4MLDA 4RA6A 3SN6A 2EZUA 1FVXA 3NASA 5IVKA 3OLXA 4GLLA 3RUIA 3R8XA 1KKMA 3DL4A 4BZZA 5KPJA 1WPRA 1FNCA 1RADA 1QM5A 3Q7RA 3ZZMA 5CIQA 2IKSA 3ZGNA 4KB5A 2VI5A 1GHTA 2P9HA 4F4FA 2P9TA 5DOVA 1H1LB 1AKQA 4M9RA 5E2BA 2WMYA 2HMYB 3GOHA 1KAEA 5EJ8A 1LX7A 3DOOA 3EGXA 2C5HA 3L3BA 4LOIA 4WXEA 2GFHA 3S28A 3V42A 1ZVJA 2RDMA 4QVKA 5I9SA 3NHAA 3I6MA 4HPWA 3MUFA 4NHEA 2F7SA 3UUFA 1Q7BA 3OAAD 3CZQA 2FMKA 1KMHA 1N6LA 3OVMA 4DA4A 4MPDA 2BHTA 1B0ZA 2XWJI 5ILQA 2ORYA 1FP4B 1WNTA 5KWVA 1H2XA 1HSOA 2QTTA 1NE7A 2VFAA 2L0XA 4DARA 1DJPA 2R85A 3H6HA 5F9MA 1PNTA 4G0UA 3KO8A 1QAQA 2WAMA 2K7ZA 5FAXA 3FOCA 1QGUB 3RUFA 5J2TA 3PNQA 5K20A 3ZG6A 3T4PA 1EK0A 4RZQA 4J7XA 4K1XA 1D2MA 2QSJA 3A1FA 3K0SA 4QBGB 1HZZA 2MYUA 1JBEA 4YAKA 2BCGY 3K8ZA 1ORDA 4M6WB 4XWGA 4RANA 4H08A 3SJBA 4C04A 1A7JA 2PJZA 4RBNA 3U7RA 3UKOA 4YRGA 3MEQA 1JR4A 1YJ8A 1NX9A 2H4WA 2JGDB 3MCVA 4UXHA 4UTXA 1JKIA 3R77A 2A5FA 2O7QA 3LXMA 4R2JA 1P73A 4IZOA 1DSSG 4Q3BA 4WK6A 3ZOKA 3FYCA 1I1NA 2XDQA 2R1UA 3AB7A 3ILXA 4MUKA 1CJTC 3UMVA 3LX8A 3V1TC 1WWKA 3HG7A 1XZJA 3RUDA 3E3OA 3LTEA 3GRPA 3MWFA 3WGTA 3B48A 1AK9A 4IIYA 4RPJA 1LEHA 3OF3A 3FZYA 3BMNA 5CM8B 1D03A 1QANA 2RAFA 4OREX 3NLLA 3ER6A 4R8RA 2ACEA 2WWHA 3G02A 2FUG6 1TCCA 3TPCA 2W2XA 2YWCA 1DL5A 5BQPA 2H1FA 4ZPXA 3VSAA 3FAZA 1O9GA 1UKVY 5EIBC 5JSYA 3HJCA 1GZUA 2FLWA 1X1BA 2DHQA 4J43A 3N39C 1N4AA 5JVDF 1HPLA 1NTOA 4PNZA 3EPKA 4N5DA 3BD7A 2VSQA 4W1RA 1HT3A 2XMBA 2DBRA 1H93A 2CZQA 2PRJA 1DKQA 1VE7A 1KYXA 3GV0A 2ATEA 4MVWA 5FNVB 3RRZA 3MWJA 1GPNA 3F8WA 1FQJA 5L3QA 5JZ9A 3MT0A 1E7MA 2CXHA 3JQFA 2X41A 3O7WA 3SNHA 1S9DA 1SC3A 2Q8PA 2OM2A 3VNSA 2Y1OA 1EDEA 2X13A 1O6BA 3GLIE 1RWWA 2W7TA 3CBGA 2PQ6A 2WZCA 3GP5A 2V0CA 3CUTA 2YZNA 3D4PA 4NU0A 4AG3A 1AUVA 3A1EA 3GG2A 5E1MA 5EZYA 4ZKDA 5CB6A 5FWYA 4R69A 3WK7A 2OXCA 3LF1A 4AZ3B 2AN9A 3JR3A 2OPHA 3MJVA 4DRZA 5BSKA 1ZO8A 3EIEA 4WBSA 3U4CA 3GLFA 2ZFUA 1N7IA 4X63A 2FMXA 3QXSA 1XJCA 4CN8A 4BEVA 1FJHA 1MB9A 2VAXA 1RQ2A 4EG8A 7REQB 1QFYA 2C9ZA 3TPZA 4Q3NA 1S8OA 5CAEA 4E88A 4YJ2A 1XZEA 1EI9A 3JAWB 4KFRA 4RGVA 3DYVA 3WKBA 5B2EA 3A1VA 4FONA 2NYAA 1D6SA 1YC5A 3LKBA 3TCKA 2BBTA 4JH0A 4UBJA 4V2IA 1Z5ZA 2FUEA 3CINA 1A82A 1Y9JA 1F8UA 4S05A 3HUFA 3VJRA 5LMUB 1ZD4A 1OH7A 2PX4A 2P4UA 2GUWA 3DWIA 2GPSA 4BKRA 4EZEA 1LLCA 5CX1B 1M54A 2O2YA 1K1EA 2G9UA 3ZWWA 4MI3A 4X7MA 5K0LA 4D8YA 2X9GA 1FX0B 5IJXA 4TMXA 5KNBH 1W85A 3VZPA 1B2RA 4TZ0A 3AEKA 1JILA 4FOOA 2VF7A 1FNNA 2QD5A 5GP1A 2EKQA 2QNIA 4LVUA 1Y3AA 3W79A 1BDBA 2G80A 3OFNA 2E18A 3PC3A 3W1VA 1PQWA 4KMOA 4MSUA 4EKEA 1R6BX 2DH5A 2WFLB 4EG5A 3I2YX 4CT0A 4HDSB 4LOLA 4PPGA 3IKLA 4WPGA 4XD7D 4ZEMA 1QKIA 3NDIA 3AHEA 1WO8A 1NAHA 2Y2VA 2IWHA 4B4UA 2QYTA 1X7XA 2ORED 4O2LA 2VDWB 3LQQA 1BU5A 4AUKA 4QUHA 4RMJA 4WLFA 3O8RA 1Q1GA 5AT1A 2P1RA 1U9YA 3L7OA 4TN1A 1KYYA 1BHQ1 3QVOA 1YZUA 2CBGA 2X1VA 4AD8A 3RLFA 2R48A 4IIHA 4G2TA 4QPPA 3EF1A 3PXDA 1OASA 4TTQA 5DX1A 1P60A 1S4MA 3KV3O 4ZJPA 4MQMA 1ZD1A 3OEHD 5CDHA 3ZQUA 2IXBA 4QA9A 1RXCA 3V32A 5JDCA 2G5TA 5K3DA 4D9BA 4QRIA 4B7CA 3KTAA 1OLSA 1OJ7A 2XH8A 3HXMA 1CRLA 2F1HA 2Q9UA 3DMFA 2F67A 2MIIA 3ENNA 3PT5A 2NACA 1QJCA 2JI7A 3MYYA 4NZ9A 4BO0A 1RC8A 1NF3A 1VJRA 2JEYA 1EINA 4I5IA 3LKVA 4DCCA 3HKCB 4EHHA 3KQQA 4CHGA 2QMZA 3AM1A 3UG7A 2XKJE 1YUNA 1DHRA 4N0EA 3FCAA 3K9NA 5JHHB 1LPMA 1K0UA 3O4JA 4D9MA 3RJZA 4OBWA 3T3DA 2RIPA 4MICA 4JLNA 3GVCA 4FBGA 4GKAA 2W4QA 3CVVA 1W6UA 2R6AA 1WABA 4C4SA 4NK5A 3HNRA 4BRSA 1URPA 3LHSA 4HVCA 1DO0A 4TXNA 3TEJA 5LQSA 1ZYUA 1NHWA 1NNSA 3NFYA 3TL2A 1F8FA 3RKRA 3TZQA 2HQBA 5HS6A 2GYWA 2JK1A 1FK8A 2AFIB 2X58A 3PQEA 1XLWA 5T67A 5FXMA 2QBYA 3HUUA 4PAMA 2Y71A 1GPUA 3PQ8A 2DFNA 5DP2A 3HC7A 3DOHA 3G0IA 4EG6A 4D92A 2VF2A 3QXCA 5B58C 4RIIA 3P4XA 2P7HA 1BN7A 1NU6A 3KV1A 4ALIA 1NVFA 1T0JB 2ZJ3A 3D02A 1P6QA 4HF7A 4EUEA 2O2SA 4HSGA 1UJMA 1Y82A 2A3RA 4E08A 1FU8A 2YVKA 4JUFA 5A5VA 3SF0A 1JWBB 4K0KB 1TX4B 4AZSA 1GTSA 4W5HA 1U8UA 4Y2TA 2X1LA 2AZXA 4XM1A 2EFGA 2ZI7A 4GBGA 4BX3A 4E94A 5FEUA 4RPLA 5JTUA 1ISGA 3NV9A 1AB6A 1KS2A 3FOFC 5AW5A 2ZR8A 2CWWA 3GIWA 3O4RA 3RYCB 4IWXA 3GRAA 1X7YA 2P5SA 4KSYA 5NLLA 4ZC1A 2MWMA 1KDYA 1WBDA 2O6HA 2FQWA 4MJLA 2ZIVB 1CFJA 1T8YA 3C8HA 4ZAGA 3L07A 1YAHA 3IT0A 5LD2B 5DHQA