4R8VA

Crystal structure of the hydrolase domain of 10-formyltetrahydrofolate dehydrogenase (wild-type) complex with formate
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
308
structure length
308
Chain Sequence
b'MKIAVIGQSLFGQEVYKELKNEGHMIVGVFTIPDKDGKVDPLAIEAEKDGVPVFKFPRWRLKGKAITEVVDQYKAVGAELNVLPFCSQFIPMEVIDHPKHGSIIYHPSLLPRHRGASAINWTLIHGDKKGGFTVFWADDGLDTGPILLQRECDVEPNDNVNSIYKRFLFPEGVKGMVEAVRLIATGKAPRIKQPEEGATYECIQKKENSKIDWNQPAEAIHNWIRGNDRVPGAWAEIDGKSVSFYGSTLLENDHFSSNGQPLEIPGASRAALVTKNGLVLFGNDGKMLLVKNLQFEDGKMIPGSQYFK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 10-formyltetrahydrofolate dehydrogenase
publication title Structures of the hydrolase domain of zebrafish 10-formyltetrahydrofolate dehydrogenase and its complexes reveal a complete set of key residues for hydrolysis and product inhibition
doi rcsb
source organism Danio rerio
molecule tags Oxidoreductase
total genus 91
structure length 308
sequence length 308
ec nomenclature ec 1.5.1.6: Formyltetrahydrofolate dehydrogenase.
pdb deposition date 2014-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
A PF02911 Formyl_trans_C Formyl transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.25.10 Alpha Beta Roll Methionyl-tRNA Fmet Formyltransferase; Chain A, domain 2 Formyl transferase, C-terminal domain 4r8vA02
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 4r8vA01
1FMTA 4ZYXA 4QPCA 3W7BA 4ZYWA 1MEOA 1JKXA 4ZZ3A 4ZYYA 1NJSA 4IQFA 1RBZA 4Q12A 3LOUA 1GRCA 5J63A 4R8VA 4TS4A 2CFIA 2BLNA 1RC1A 1RBYA 4DS3A 4ZYTA 4YFVA 1C3EA 4ZZ0A 1CDDA 4ZYUA 5CJJA 1ZLYA 3AV3A 2GARA 1MENA 4EW2A 3TQRA 4ZYZA 3GARA 4PZUA 4EW3A 4ZZ2A 2FMTA 2YWRA 1GARA 1RC0A 3O1LA 1YRWA 1MEJA 1RBQA 1S3IA 4S1NA 3AUFA 4YFYA 4EW1A 4TT8A 4TTSA 4ZZ1A 3R8XA 1ZGHA 3KCQA 1C2TA 3P9XA 4ZYVA 2BW0A 5J9FA 1CDEA 3DA8A 4QPDA 3NRBA 3TQQA 1ZLXA 3N0VA 3OBIA 3Q0IA 1RBMA 3DCJA 4NV1A
chains in the Genus database with same CATH superfamily
1CJMA 5KHOC 1QHHA 2E9SA 3G0IA 2P9QA 1ML4A 4LJSA 4F7DA 4UZSA 3EC7A 4Q9IA 5AW0A 3RGWS 5JVDB 2EFJA 4X6LA 3N6VA 3F1LA 3OPYB 5E4TA 5J2UB 3AYZB 1JVNA 4R69A 2DT5A 3CINA 5J4VA 1H1DA 4ZPXA 3L9XA 1IB0A 1NNEA 2Q5FA 3LWBA 1P2DA 3GG9A 3CV3A 3HDVA 2X4IA 2HY7A 1V8ZA 4ND8B 3WLPA 1CRLA 3E84A 2PRZA 1SPXA 4HQFA 5BMVA 4HB0A 2HNBA 1BTOA 1FSGA 2P2NA 4DCCA 4OLHA 2WUWE 5ESRA 1P75A 3DHEA 3KXDA 4FMCF 1DVRA 3IDSA 3MCTA 4C21A 1KP9A 4C0LA 4UBMA 4NBLA 2RGAA 3BQNB 3AL3A 3O84A 3JCZA 5DKFA 5AW9A 3S5UA 4XQEA 2I5PO 1GTVA 3WL8A 4YQYA 2ZBFA 4PLHA 1B8NA 3CN9A 2Q27A 4AZSA 2O2YA 5JBNA 1R9NA 1IEQA 2B3TA 3O8DA 1KJQA 1T1RA 5HNKA 1E1YA 1X2EA 3E9MA 3N8NA 2H9YA 3MOIA 4LQLA 4OK5A 2NW6A 5K09A 1HFWA 4J2HA 2EZ9A 4RSGA 1CUWA 1DQSA 2GM9A 1DFIA 2QGNA 4IZOA 2HXYA 3FHCB 2IYPA 1W2HA 3HXMA 4M6WB 2CV0A 4AG5A 3F71A 4RVNA 3CJTA 4P53A 3LFTA 1LSOA 3V7UA 5CNMA 2QTLA 1HOXA 2FMXA 4PGHA 4XCXA 2E82A 4MVWA 1DJQA 3DZFA 5DULA 3WLHA 1DQZA 1FZQA 2CHQA 1AE1A 3EDMA 3AQIA 3DQPA 3JQ9C 3VGPA 3W5UA 2QTZA 1H5QA 4RHUA 5F9HA 2GCIA 3HB5X 1CY0A 1HGXA 1XPJA 1RJ9B 1X7DA 3BFVA 3LWZA 4LRWA 2AXEA 5D84A 5CD1A 1UXIA 5GJBA 2CXRA 3F3MA 1JHQA 2IYEA 1G5RA 2AI3A 4Y1RA 5DLEA 1O0BA 4GOOD 4JBLA 2Q0XA 3O93A 4C2TA 3JY6A 1XEWX 1JKJB 3ECSA 3KJGA 2DHQA 3PENA 1KXZA 4RD6A 2W7TA 4JIMA 1IRIA 4MWTA 4EMSA 3BWDD 1T43A 1W94A 2ZBVA 4KFRA 4WDQA 4HT3B 4OQFA 4TWBA 4WEQA 3T06B 4CG0A 1AMNA 1QP4A 1AHHA 1GNLA 1MO6A 3A06A 4HQOA 4LHZA 4OM8A 4Y6SA 3RSHA 3FTEA 4OLAA 1SOVA 1ADYA 4ZQGA 3ZVRA 2ZI6A 3KEGA 3KUXA 3RS7A 5J2TB 4S05A 2J0UB 4PPQA 3GP8A 1N5DA 3DZKA 1OLUB 4D02A 1RJWA 1QGZA 2CZGA 4DCGA 5CFLA 1RWWA 3GI1A 3QU4A 4OB7A 3HBJA 5E0OA 2VZEA 1NUUA 1JTVA 2FFRA 2Y1CA 5HKBA 4F4FA 2JFVA 2I6XA 5HJEA 1L6IA 3Q0TA 4DBZA 1WL8A 1C50A 2IEAA 3U7EB 5JJ5A 4Q0MA 2DQZA 3FVTA 3ZWBA 2X0JA 3GJXC 2W83A 4J4HA 1RMYA 1OLOA 1TZCA 4GLJA 4L3VA 1FL9A 2Z8YM 3LOQA 4EPVA 1QF6A 1F6BA 1IQRA 1J2RA 1KGDA 4JJFA 4IOKA 2RGBA 1YVDA 3FMFA 4RW0A 4FYVA 4MWCA 2ECOA 2RGDA 4PHHA 4X6YA 4E1BA 1IPHA 1PX2A 2RARA 2WG2A 5AI9A 3TIIA 5F1KA 4PHGA 4B6OA 3LW8A 4MS3A 1W93A 4UEOA 2HYIC 4AI6A 1N0VC 5L51A 5KAMA 1N5RA 2NIPA 4LHSA 1BHO1 2HIAA 2J3KA 4KJXA 1AQIA 2KYRA 4EM6A 3U4QB 1E60A 1D09A 4YCLA 2IE0A 2G1JA 2J0VA 2RH4A 2A58A 1GYRA 2XYQA 4G9EA 4K88A 4M9SA 3R4CA 3RU9A 5JMOA 3BILA 4TLAA 4RPGA 3KZNA 5HZKA 3HKEA 3RG8A 1YFJA 1OGYA 3T9DA 3IKTA 1NA5A 1XQ9A 1DV1A 1I1NA 2HMSA 4K9RA 1EFUA 3S5JA 2JD1A 3PC4A 3Q3GE 1NM5A 1S2NA 1HFJA 4H77A 2G9ZA 3TSAA 3EGWA 2A30A 2GUGA 4UMDA 5TV2A 2WOJA 5DHAA 3LQRA 4C22A 1KGSA 4DCMA 5A4FS 5L4NA 2ZUFA 1N6KA 3S27A 1I7DA 4HAOA 2Q4TA 4PLZA 1CSEE 2OXCA 5TJHA 5BURA 1FPQA 1R0LA 2N1BA 1GTJ1 3IAM1 3NI2A 4NWIA 3UV7A 4E94A 1GM5A 1X9IA 2A86A 2WTUA 3WSVA 2KLHA 4I1OA 4EARA 4X63A 4TS3A 3I39X 1VMIA 3JWHA 4PBSA 1GQFA 3D8UA 3WBFA 5AVJA 1U8FO 5EWMA 1E58A 2O2ZA 2VP6A 2X3FA 1K4YA 4CHGA 4DCTA 2VSQA 1OPXA 3HLTA 4FNMA 3C7KA 1JDSA 1LW6E 3OJEA 4KXYA 5FUYA 2OM2A 5EZYF 4EL5A 3L7KA 4RSMA 2XLBA 1WP4A 4U7GA 3CVYA 2O5CA 1DRKA 2ZI5A 2DTEA 4BV2A 5CEJA 2GRAA 1KP3A 1UQUA 2E18A 5KIAA 3MJSA 3DZDA 1E2QA 5DMHA 5KAPA 2CUTA 2AH5A 1A8PA 2PG3A 3SIXA 4LS3A 3ITEA 4DPMA 3GLRA 3HVHA 3U4CA 2JGAA 3QFHA 1P0IA 5ITZA 2QYTA 1F17A 3CXUA 3MRTA 3OZ7A 3FWZA 3ZEIA 3ND5A 5A9TA 4ARVA 4E2WA 1UC9A 2PUEA 2LP4Y 1AKEA 1Z6QA 2YH2A 4JC5A 1PP4A 1ZQ1A 3OY7A 2J7PA 3PR3A 4QT0A 1F4PA 1SCUB 1T0JB 2RHDA 3OECA 5CGQB 4JX8A 4Q3LA 2QYOA 3DR5A 1RHJA 3OFND 4N39A 4YXWD 3C6KA 8LDHA 5HQJA 3ICOA 1DGQA 4N8DA 1HE1C 2JJQA 1G21B 1H5NA 2DCUA 4QODA 1EVQA 1T6YA 5EE3A 3TGWA 2FVXA 2DF8A 3LBHA 3VO8A 4ONEA 3R8XA 5EZYA 4RCYA 1C3LA 3C8DA 1SXPA 4UAVA 1H2WA 3AUTA 1NQUA 1ISHA 1RQPA 2NZ2A 2VP3A 1GO2A 4F5ZA 5HUJA 1A3CA 1XZKA 1A8SA 1TU0A 3QW4B 4KN5A 4LX0A 4V1CB 4HEA1 5ELMA 3F9CA 4DQUA 1Z4MA 1UJ5A 4Y9TA 5BVHA 1R12A 5I5GA 1DHRA 3RQSA 2QT1A 3MLAA 2JFUA 3LRPA 2X8LA 1EUZA 1LH0A 1X7XB 3HHEA 4PYLA 4XGNA 4WKCA 4B7AA 4YRIA 3UICA 1NAIA 1VCIA 1NASA 3WNZA 4F92B 2AZXA 4BE7B 2XXAA 3OC0A 3O9VA 5DM2A 2AG5A 1HYQA 2DTXA 3R7AA 3W90A 4Z7QB 4PINA 4Q01A 1EFVB 1JLSA 3DBOB 3KT6A 3M33A 3EOAI 4G4GA 3BFPA 3EZLA 4KX3A 4L8LA 4CKWB 2PMKA 2I8AA 4KXVA 3IIKA 3O74A 5CJPA 4CTNA 2R00C 3UH0A 4BO7A 3NDBB 2A5FA 3ILHA 3LSTA 4FR5A 3WYGA 5GV7A 2JLQA 3HKCB 3NP9A 4P38A 4K6FA 1KEEA 2XLCA 1LBTA 2Z43A 4B0PA 5C1BA 1AUXA 1IXZA 1I36A 4XR9A 5SZJA 4X93A 2EKBA 3EX7C 1YZTA 1BFKA 1G8AA 2DFTA 2H2FA 4YBRA 3JATB 1CUDA 3QX7A 4GI3A 1E0JA 4CN9A 2O14A 5IG2A 4D6XA 2R62A 5LQRA 2H1FA 2Y1XA 2K2WA 4OQLA 1C1XB 1L5VA 2BFNA 4BNDB 4EATA 3ZDXB 3SHVA 4CEIB 3CX7A 4U5QA 3LDFA 1I5OA 3EQ2A 1XEXB 1GEGA 3N6XA 4JLMA 3TSWA 4DDTA 4M0LA 4C2BA 3UYLA 2ZZNA 1FSPA 1E2MA 1Z6PA 3MAJA 2HRBA 1BAPA 3HO1A 1MCZA 2WM2A 2ZRJA 3DO5A 3IHLA 3LBNA 3ENZA 4K0RA 5EE9A 2LGJA 3ZTYA 2XF2A 2W58A 1MT3A 1PLLA 2D0OB 2VPIA 2CFRA 2AOTB 3Q7QA 4ECEA 4YCSA 4FXOA 4MI3A 1GR0A 4WNYA 5BN4A 1O0CA 1P18A 5KTNA 4R5HA 4WN9A 1YZ3A 1C4WA 1BEUB 2C1ZA 2Q0HA 4EX6A 2B8TA 4KWTA 3V97A 4P7BA 2BVNA 5KVQA 3VDMA 2ZSKA 4CN8A 4AN1A 2VQFB 4ZTBA 1WU8A 3MGCA 4GYKA 4RXMA 4XPIB 4NV0A 3RKUA 3TCXB 3SF0A 1RLJA 3M6VA 3ZJ4A 3E81A 1PL8A 2ODNA 1BXGB 4MPRA 1V16A 3RYHB 2OOSA 4KWHA 2BWJA 1KVTA 2B0JA 1NR1A 3PFFA 3SYRA 2OD9A 2H31A 3K6RA 1BFUA 4HRVA 5KTMA 3R0VA 3O9ZA 4IJVA 2J9FB 4G65A 2RAFA 4KYIB 4AO7A 4P4GA 3WDMA 3ONDA 1ZCBA 3Q9UA 3ZBTA 3O1LA 4PQRA 2WHQA 1YRWA 4BQSA 1E8MA 3OM9A 5AKZA 1OD6A 1MX3A 1UL1X 3BXXA 3FUXA 2I4TA 2YWCA 3DZCA 2XRZA 2QG4A 2QNRA 1ULBA 2E48A 2JGMA 2YIDA 3BMQB 4QM7A 4TL9A 1E6EA 1ZIOA 4WKNA 2ASVA 1K63A 4OI4A 5TPWB 1Q1QA 4YA6A 2G06A 1R0RE 3F49S 1VG1A 3DD5A 3HXLA 1JKMA 1FVXA 3QLVC 4HNGA 2HI0A 5EIEA 1G2OA 5KYXA 2PAAA 2F1JA 2XRMA 4CCYB 5E9JA 4P0QB 1E5VA 2G1UA 4RK4A 5DTEA 1FXWF 1ENZA 2WM8A 7MHTA 1AKNA 2VYND 4LBWA 4RLFA 3FOCA 1HV8A 4BAUA 3F6RA 5HOEA 4UXHA 1QVWA 4CF5A 1OBHA 1YZHA 4PZAA 5LWQA 2B3DA 1VJ1A 1DAKA 3I28A 4Z8YA 5EAIA 2I3DA 1X1TA 2NTVA 4LYAA 2AUMA 2Z9DA 4FEYA 2EKLA 4AMYA 6YASA 1X2BA 3MTIA 3TQQA 3T5DA 3CEJA 3DO6A 3KVNA 2ZJFA 4J43A 3PA8A 4Y1EA 5ILGA 4AWXA 5CITA 4KGVA 1KOFA 5GGYA 1KEUA 4MCAA 3GJSA 3PTZA 4ZEXA 4ZFNA 4F5DA 2ST1A 5EQTA 2RBKA 2ANBA 1H2EA 2Z2ZA 1VGQA 1JHAA 3OOJA 3PIIA 2RB5A 4PLGA 5AW4A 5KNLA 1SXJE 4NPAA 5CIQA 2FUNB 4RQBA 1UPXA 3HADA 1ZESA 3LF2A 4BU0A 3GFVA 3FSRA 1WEKA 2JS7A 2FY8A 2Y93A 4GPD1 4EYOA 3NTVA 1XZFA 1FXWA 3C0KA 4I6GA 5C7LO 5EFZA 2CF5A 2HPHA 3MPOA 3RRXA 4DSTA 4BMDA 1RI5A 1FP4B 1VBMA 2G67A 3OTWA 3QVKA 5AOAA 1RYNA 4QIHA 5IM5A 1VSTA 1QC5A 1GGFA 5DWVA 3U3KA 4WV3A 3OZSA 2I3AA 4UDOA 3JQ8B 1DKRA 3KCNA 3VH2A 4AK9A 3MWGA 3U1TA 1KJ9A 1N36B 5FI5A 2EAUA 3HFRA 1GQRA 2J7KA 5DX0A 1MAUA 3SQDA 1N2CB 4I7EA 5A5EA 1OC4A 2ZJAA 1U8CB 4P7FA 5BQFA 1R27A 3MM4A 5FKJA 3BBLA 4DCPA 2IYTA 1WF3A 4NBNA 3A2KA 1QWOA 2W00A 1Y3CE 3BWVA 1SKUA 2WFLA 1RR6A 1YI8A 4X1YB 2YVKA 5HCIA 4A82A 3ZWMA 4TYMA 3HJHA 1UWKA 2EG5A 3GLIB 1DKNA 3N7UA 2DCMA 5C81A 1QH0A 2PK3A 5AHKA 2FJUA 4AJLA 5EFOA 1HLPA 5DTJA 1N1EA 4N0QA 3QVSA 4TMXA 5EZQA 1G3MA 1UUFA 1W581 3WK6A 4WKGA 4YUZA 1GAJA 1YE8A 4LNUB 1OAOC 4QTZA 5HX7A 1QDLB 1Q1NA 1YQXA 1QE0A 2KBEA 2PRJA 2XKAA 3K2EA 3KWMA 1KOGA 3G3EA 4X7MA 1E62A 3HNRA 3C7DB 3H16A 2PJRA 2O0JA 1K3FA 1SHUX 1C81A 3CLVA 4R05A 4R9VA 2FUG6 1Y4AE 3KDAA 4GICA 4HAVA 5CMLA 1LPPA 3N0TA 2ONCA 4GI2A 3ER8A 1Q91A 4Q4HA 5LSAA 2QD4A 3W78A 5L7TA 4JGGA 5EXDA 1TCBA 4UBJA 1JR6A 2H0RA 3K4PA 1WW3A 4ZVVA 8ADHA 3GLTA 3RBXA 4U2BA 1C7IA 3OEHD 3ESAA 1I7LA 3DPUA 1NFRA 1R5NA 3MXOA 1GUFA 2X9GA 5IP5A 1F8YA 4DDUA 4N8EA 1JR3D 1IMJA 1QBGA 3BICA 1R0KA 4Q9HA 5BOVA 1H9CA 13PKA 1UM9A 3F6SA 2IY9A 1C7RA 1XMXA 3UJ7A 4R31A 1GRVA 2GERA 1ZMXA 2XTZA 1XKQA 4J7CA 3QY0A 2BSAA 1JIJA 2JVIA 4I4TF 1BQ4A 4PG5A 5F64A 1ORIA 1XAGA 1QIIA 2A1TS 2RHWA 2FYTA 4MGZR 2RHJA 3RFVA 2Y05A 1M7GA 3DEJA 2CLEB 4IZ6A 2MMCA 1V95A 1UKVY 3N8GA 1SEPA 2YL2A 4X8HA 5KYVA 4GUAA 3SBEA 5IHPA 1EUQA 4GSYA 5IUKC 4WBSA 3VPDA 2WIFA 4LXGA 1QMPA 5JANA 2FN7A 4B73A 4A9AA 2ZAIA 3IQEA 3Q6MA 2E5LB 1TAUA 3LUAA 2FSHA 5C9ZA 5TIIA 4REQB 3E22A 2Q5HA 2O8BB 2OP0A 3R3UA 2R25B 2ZIEA 5BRNA 3ZXSA 4DMMA 5KQGA 4ZI7F 1VE5A 2B94A 2WD7B 2ATCA 3NOXA 4XVHA 1XROA 2ZYIA 1KVUA 1I3KA 1AXEA 2ZI9A 1PR5A 5EPUA 4YAUA 4Q9NA 1BX3A 4ZV7A 5KNCH 3LLCA 2C4NA 4DSNA 4L74A 4TT3A 2PU5A 4XRRA 4WLFA 2UYHA 4RESA 2FW0A 5JMPA 3PFNA 5TY0A 1PR6A 1TJ5A 2BD0A 2V7UA 1V4NA 1WHTA 1XF9A 4BJ3A 4OX9Y 4GZ5A 5DHSA 4I4TA 3RV4A 3R7WB 4OQMA 1WWKA 1D1QA 2WTXA 3VO9A 5JSQA 3UJPA 1CZUA 5H7XA 5KTYA 1GSOA 1YR7A 4Z99A 1BHQ1 1GFZA 2CYBA 3KUDA 4B81A 1HDOA 4BJHB 4CMKA 5C32A 3V32A 4A8PA 2DWOA 3EF1A 4LHXA 4AU1A 1AKTA 3SXPA 4E33A 1B7GO 1NBMA 3INTA 4LZOA 3A6ZA 4Q4LA 3A8TA 3CZQA 3MTQA 5JEDA 1I10A 4BLUA 1ZITA 1UMKA 4UC0A 4NCHA 1BMQA 4OK6A 3NWJA 5F33A 3RTAA 1YA6A 3CCFA 3VMFA 5IJ9B 3D6NB 4D9GA 4CGYA 4QDXA 2IS1A 4RKEA 4ZI7A 4D6PA 2HFJA 2H9IA 4OEHA 3H3XA 1II9A 3HXQA 2O19A 4MB0A 2ABWA 1R0SA 3UCXA 2ZBGA 4RAOA 3CVJA 2C77A 2I7DA 4LHVA 4P34A 3ESZA 1W5AA 4PRLA 4Q1AA 1OT5A 2HADA 2LNDA 2N46A 4JJ7A 1AB5A 4BMCA 4R83A 4D9HA 4G1VA 3VVBA 4MEBA 3LKBA 2H7YA 1INLA 5EE5B 3SHWA 1P9WA 1BE6A 3DCYA 4L16A 1QKIA 3IO3A 2I3ZA 3PHCA 4P22A 2ZYRA 1GL7A 2CHVA 2VL7A 3IUNA 3KKZA 3FNFA 4URYR 4ZZ2A 2GR9A 4DMFA 3KJXA 1M66A 5JQGF 3QPBA 2WFAA 1FRFS 1BH2A 2WSBA 1LV7A 3O94A 4BNMA 3Q8KA 3C8UA 3KSDO 4EG1A 3BSFA 4JP2A 2BEWA 1PR9A 3NV7A 1KK3A 2H5LA 4ZT6A 1JG3A 2B5WA 1EP3B 3EZFA 3WKCA 1FEZA 5G53C 5KI6A 3VYVA 1MABB 3AX6A 5IZCC 4NDNE 1IZ0A 1NOJA 1VLMA 2FH5B 3HN7A 2ZB7A 4WNCA 4CGZA 3IJEB 5CEEA 3H18A 4I5FA 2QX6A 2QM8A 3DFUA 5AM1A 3EVBA 4HSGA 1S8OA 4KXWA 4EENA 1W5FA 3T1QA 3GLVA 2AI2A 2YHIA 1QM5A 4INAA 3SQOA 3QPCA 4B2IA 4CODB 5CNKA 1YS1X 3MMPA 1G2QA 3ORSA 1QIJA 3ASVA 2WHYA 4MPTA 2EHJA 4B3HA 3WGVA 1FFWA 3U26A 1FDOA 1E4OA 2FFBA 3VYRB 3HE3A 5FUWA 2XSZA 3N8KA 5JQGA 1Z13A 2W6ZA 3S8MA 3GCGA 3U3ZA 1T3GA 4G63A 3C48A 1TAQA 3UENA 5J9FA 3PKIA 4QOSA 3KU1A 2ZAYA 1E2NA 2GBFA 3GN1A 1O1YA 1Z4JA 4G0QA 5JNVA 1XZAA 2EOAA 2OLJA 4KUHA 5FTKA 1QG6A 5JE8A 4ZHQF 4DB4A 1T36B 2QRUA 3VHXA 4JUCA 3GIDA 1BCRA 5K8TA 1RP7A 1ONOA 2HHJA 1SUBA 2W98A 2ZZKA 4AQYB 1RCFA 2B4AA 2EGUA 4L8GA 3UFXA 3KJFA 5CBPB 3AU8A 4CQMA 2GVZC 3ZHOA 1MC4A 3ND6A 2IJGX 2EHDA 1P7PA 4B9AA 3CZ4A 3AM3A 3EXG2 4H0FA 2IW3A 3W2GA 2UYCA 4UPEA 2QD1A 3OQ1A 4KL8S 2FXVA 5CFOA 1MF7A 1P5ZB 5DSTA 4DV7B 4Q3CA 3IUYA 1ZL0A 2J4DA 2JIZD 4YN3A 4BC0A 2BZGA 5JATA 3U5ZB 3QU7A 1ZOOA 4XB2A 4G5FA 1X14A 3DPSA 5DU2A 5HGXA 1ZD1A 3KEFA 4GGOA 2XZOA 5ELLA 5C1PA 1NVWQ 1DEXA 2C7VA 2VZLA 4FIZA 1ZGZA 4N0DA 3VBCA 4XCVA 1KYWA 2FEKA 2JEZA 4ER7A 3EZ6A 2PUJA 3U7RA 2PUVA 3HSSA 4X3OA 5FHRA 1PDOA 4DCNA 1SC4A 3NHJA 4AT1A 2BLNA 1RC1A 1CTQA 5TS2A 3ICPA 4XW2A 2EF0A 4WLOA 2NO4A 2NXNA 3O3OB 5F2OA 3DXZA 5EJ2A 5FULA 1UQTA 1WULS 3N2YA 4NAUA 1E5LA 1RKVA 3UOWA 1XNHA 3P26A 2J3MA 4FJ2A 4KZPA 3NDPA 1KDZA 4KYUA 5EA2A 2IHKA 4P3XA 4ESEA 2C3OA 2IXFA 1M6WA 3O8NA 5C4IA 1GT6A 1ZH4A 3NETA 1IPEA 3L92A 1WAMA 3CZCA 1RADA 2YJ6A 4KNWA 4XYMA 4J0FA 1XMVA 3FYCA 2F3TA 2QTBA 3AR4A 1XMOB 4H60A 4WI1A 3SX2A 4Z1OA 4AKSA 5JR3A 1DT3A 1KO7A 1SIUA 2Q2OA 1LRLA 4J1TC 3L1KA 2C07A 4QFBA 1FUYB 3W2TA 3ANSA 4BVJA 1J42A 3C3BA 3CH5A 1A95A 3P8ZA 2ZB4A 3ZWCA 3VKGA 1YJAA 3RSZA 1TJ4A 1N8KA 2IRWA 3E3LA 1Z6YA 4BZQA 1IXYA 2O2JA 2IE8A 4JJ8A 3ROPA 3B6MA 1XCBA 4NMMA 1EFLA 4G23A 3TXAA 5EUQB 1TT7A 4QLAA 4W5JA 2PO7A 4LF5B 1OBOA 1WUKS 1XDUA 1ZD5A 2FP4A 2HK8A 1D2NA 3O7WA 2VRNA 4KBYA 3X1XA 3ZE0B 3GZ4A 2ZTSA 3MOGA 1GUAA 2IH5A 1SKMA 2GILA 2ZEJA 3IP5A 4B6JA 4OBEA 3O83A 4TL6A 5EHZA 1U0SY 2I67A 4IICA 5KREA 1NSYA 1QS0B 3H86A 5BN1A 4I50B 2UVPB 1YZNA 3OEYA 2BUBA 3L4JA 3DMTA 4BCBA 4N41A 4NMWA 1QDEA 2YCBA 1H4QA 3OCWA 1NX9A 2G71A 4Z2AA 3QBVA 3G5MA 1EYZA 1WQ3A 1XXHA 2PMWB 3ICWA 4KQ9A 3AK4A 5EHNA 5BRAA 4IZHA 2ISQA 3EPKA 1KA9H 1PTJA 2R4TA 2Y92A 4DT1A 1W34A 4GAEA 1A4UA 3VR5D 2XVMA 1DV2A 1QH9A 1WA5A 3FPFA 2JIQA 2GPSA 3RVSA 3IAFA 5HFAA 3ZHTA 5A04A 3L8HA 5AUPB 1CQPA 1T8WA 2VXOA 3AF3A 1KQPA 3ET5A 1D1SA 3ESYA 5P8WA 2ZRCA 3EG5A 2P3SA 5DNWA 1UQRA 2B7LA 2PA0A 2W4QA 2XUKA 5AT1A 2WU4A 5AIAA 2ONZA 3QVJA 1J33A 1EZ1A 2IQIA 3SYTA 1IN4A 4NKRA 4E2FA 1OV6A 3CTMA 5AI6A 1G17A 3N2KA 1D2AA 1KFBB 2OXFA 4FILA 1G20A 2Q3JA 5HM8A 3COWA 1WNTA 4FZVA 2XMCA 1OWNA 3O5AA 1R6BX 4IOMA 2WWXA 1FFGA 2XTMA 1ZOSA 3H0EA 4U3JB 2IDMA 2PMBA 4JODA 3OE7A 2FPMA 2ZI7A 1DKOA 4RYDA 4DZRA 4JYBA 3SZRA 3WYBA 5J43A 5FOWA 3H8WA 1XA4A 1CR6A 2ZKLA 1LRJA 5K0GA 5LLTA 2P9EA 3O7MA 1TVCA 4CI9A 1J9GA 1H2RS 4QU9A 2BM1A 2LD4A 1DC6A 2OFXA 2R84A 3H5AA 4OXIA 2W6CX 1MV8A 5BQ3A 2ZJ8A 1UBFA 3PGA1 2ATIA 2Q5OA 1ACMA 2WWHA 2NOAA 3EGDA 1D9ZA 1SA0A 3AESA 2K87A 4KO2S 3ONNA 3MQ4A 3AUKA 4NBKA 2IXTA 2GN1A 3AF1A 1TM2A 1L7MA 2EX4A 4FMDF 1VI5A 4HXEB 1G4AE 3ENKA 4Z3DA 4EDHA 1DADA 4NL4H 4TTPA 1W9MA 1PEDA 3ZYCA 1Q5PA 1NBHA 4OHFA 1YFLA 3KSUA 4MUGA 4DVJA 4ZVRA 4M38A 4ALNA 3KEMA 2CVHA 3QIVA 2A9VA 3TTVA 4BAGA 3DLTA 4IXDA 2I8CA 4JEHA 4YRCA 2W2KA 5DJ5A 4CRWB 1APBA 5FFMA 3UUEA 4O4JB 2F55A 3I9MA 1AKQA 1A9PA 1UP6A 1DNPA 1JEYA 2CBGA 1D2EA 2G9UA 2JCXA 2OY0A 4G41A 4HH0A 4RPKA 3RUFA 1A4XA 3P9RA 2BI8A 2MJLA 4DIUA 2OK7A 1DL5A 1P2FA 1VJRA 1UBJS 1T9DA 2VJKA 1FX0B 3KB6A 3VJMA 4C0AC 1CP2A 1A2BA 1GGVA 4JZKA 4BHTA 2P3LA 3A7EA 2FPGB 1ZISA 1ADFA 1WCIB 3FVRA 1VJGA 5HJ7A 4WFIA 5KOJA 5SY6A 2X6RA 4YMGA 4FU0A 3KQHA 2IKQA 2JHGA 3NAQA 4LHEA 1GNQA 3D4IA 3LCCA 1U7DA 4CKEB 1RRGA 2JFFA 1UM8A 4LI0A 1SXJC 2XBMA 4KVFA 1IN7A 1GVNB 2P6MA 4YJFB 2XE6A 3ER6A 3TE7A 1TRHA 3WHPA 5L3SB 2C2ZA 4C7BA 3KLOA 1S5PA 4W6ZA 1OFUX 3WYDA 1Y9AA 5FFFA 3GPIA 3M8KA 1O6CA 4JVMA 4GL2A 2PZGA 4R6WA 3MVEA 4IEEA 4XD7D 3R7SA 4XFKA 1Z3CA 1GWNA 1LZLA 2EW2A 1U2GA 1NW7A 1D6SA 1IHPA 2HJHA 4HL6A 4RS4A 4EMBA 3ZDBA 1L4LA 2O2EA 4JLKA 3SS9X 3GD7A 3OQBA 4NI5A 1EG2A 2GBGA 4MI6A 1LPMA 2JAWA 4LOHA 5AJTA 2GA9A 2X22A 2NTNA 1Y6JA 4PLPA 1E6LA 1S1CA 2IGBA 1GPH1 2FDXA 3DWFA 4URUR 1HO3A 4WBNB 1UDAA 4Z0TA 3AB7A 5DBGA 2H1HA 3H9QA 3IOMA 4S12A 2AQ8A 1T2DA 3DDOA 3Q98A 2DUJA 3C2QA 3E9CA 3C5HA 2PKYX 2ORED 1W85A 3FFXA 3LVBA 3Q0IA 4JZYA 4X8OA 1PRYA 3CRVA 4DLNA 1TZBA 4EQ6B 2NSYA 3FVQA 4K6CA 4JNKA 3L0IB 5AQ1A 2CFCA 4KQXA 5B58T 1B6GA 4X92A 4ZI2A 5LXTA 1AV7A 1IZ8A 2F3PA 1ZVJA 5EZSA 1KJZA 4KB5A 4XLZA 3UWSA 3P19A 1JG7A 1W1IA 4WL0A 1GPAA 1R7RA 2DPYA 4CIVA 3OQHA 2PTGA 2VBCA 2O1SA 2WYIA 3UM9A 4MVJE 4RMHA 1DKQA 2FOLA 1I9GA 4P3OA 4G8BA 4XLLA 3GUUA 1FS6A 1Z37A 3I04A 5TPZA 4LBYA 2IZ0A 1IN5A 1GOTA 3QFFA 1C7EA 5AO9A 3N2LA 2EW8A 4JUFA 2I91A 3P9SA 1IHUA 3IERA 3RV3A 4Y1FA 1G5FA 1VYHA 4W5TA 3IPXA 4YWHA 4D9FA 1EX9A 3F8TA 3RO7A 3TR6A 2VPWA 2QTMA 3V8NA 1VKZA 5DFAA 3K1JA 3NU1A 3SC2A 5AOCA 1TAHA 2CDCA 2O2SA 4PSVA 5LC1A 3KYJB 3Q41A 4GPBA 4WZBA 2AQHA 1THMA 2XODA 3TUJC 4AMGA 5J4HA 1V48A 1XLWA 1E66A 1AM4D 5LUAA 1ECLA 3CHYA 4WGGA 2CVFA 2OBLA 4NMXB 3IAAA 1R6TA 5B3JC 4L22A 4X7PA 3FYUB 1XZEA 1D1PA 1WUJS 4RWZA 1HFEL 3HABA 5CRIA 2B8JA 3VU9B 4AIIA 4WRRA 1D07A 2H4ZA 2Q4BA 1TCVA 5JO9A 4L02A 2C9BA 4CTOA 4CTMA 2OFOA 2W8BB 1WY5A 1T3LA 4BFUA 1P29A 3ED1A 3A27A 3N6RA 2Y68A 4JB3A 2IITA 3L02A 2J0QA 3K09C 1J25A 3ZDZB 3WR5A 2C0PA 3PX7A 4D81A 4K6GA 1NI4B 4ML3A 2IWRA 3GT4A 3GJ3A 4AJKA 5M3BA 5CUQA 2PU7A 4FNGA 2QXYA 3NANA 4E09A 1EQAA 3FUCA 1O57A 4PGAA 3ZU4A 1D8TA 1KR5A 3WAJA 2YZ7A 3GGJA 4JJEA 4M1QA 1XELA 3G2PA 2JI9A 3GG2A 4AURA 2JFHA 4OF4A 2AMJA 3AI7A 4S1NA 2HF7A 2QTAA 1URPA 1Y6RA 4AJJA 4YRQA 1L3BA 4GFDA 2WJWA 3B1XA 1WDTA 1DKUA 1XK6A 3ZV3A 4EKIA 1HLDA 2KSQA 1T2FA 2WA1A 4TGLA 1GUBA 4JITA 3UN1A 2AN3A 3VV2A 4A8JB 2XUAA 1A50B 2EQBA 4Q93A 1MZPA 5KC9A 2BUAA 1KAGA 2FPLA 2H06A 1T4GA 3NIDB 5GM1A 5E3IA 4K81B 4K9MA 4C4SA 5IF9A 4F4CA 1VBFA 3AEKA 2ZB8A 2B4RO 1TZ2A 4Q3OA 5HXAA 4NP6A 4XYLA 2V5AA 4QECA 2GZ1A 4CV0A 1O4VA 2OBXA 1UEJA 2C92A 2WW8A 1SHZA 1QOQB 1HT0A 1US8A 2YFKA 4EF4A 1QTNA 4HNRA 3LGAA 1E94E 2H7VA 4PN3A 1F06A 1ZNZA 2ZJYA 2R47A 3T7JA 3JW8A 3K0AA 2NPFA 3D4NA 1IBLB 1P39A 4ZAZA 3CPEA 4RELA 4BGVA 1JZSA 5IU6A 2BN4A 2EG9A 3A1EA 4JGIA 4PU0A 5F1OA 1HI9A 1I4DD 4LJ9A 3WLNA 4BP8A 3W4IA 1B8OA 1LVUA 2FGKA 4YUYA 1QO0A 2WTMA 1WD7A 4F86A 1QH8B 1LB1B 4HWPA 5BMVB 3HY3A 2C3MA 1EX7A 2XZTA 3DBRB 4UTNA 5ERXA 2FN4A 2ZFUA 3IMEA 4PONA 3T5BA 2XXJA 3FSGA 3ESBA 4TMVA 4O4IF 1UPFA 5E3HA 1RXVA 1GTRA 3THRA 4DLYA 1RM5A 5FI1B 1YCGA 4WT7A 5AK6A 2VWQA 1MO2A 3RODA 2DLDA 3CSDA 1YBFA 2I8LA 1Z18A 2QTWB 5M2QA 3EIQA 4QUKA 4ARUA 3KKQA 2X2FA 1QXSA 2FR8C 4YJGA 4WX2B 5H5JA 3ZNOA 4UOEA 1P4AA 1JIQA 3KHSA 3PEFA 3NC0C 3G85A 4OCZA 3O90A 5EKDA 4F3YA 1XCOA 4FFWA 1PJAA 3OUTA 2CBZA 3QFRA 2XV1A 3JXEA 1AVTA 3BDIA 1NULA 3S81A 3HV2A 1BXKA 4UULA 3D02A 3K31A 2CEKA 4MGEA 3JWJA 4FR0A 4BMSA 4WH0A 3D1JA 2WHPB 2Z4RA 4R8RA 4MICA 3COJA 3RYCA 4D0LB 1CVRA 2CHGA 1RYHA 2E6KA 3AFGA 3D2BA 3ISJA 3NTXA 1DX6A 1PGQA 2H57A 1TZKA 1ZINA 5B7NA 3N53A 1Z6TA 4KVGA 4NRDA 3U49A 4FMCB 3ABZA 2WLSA 4O4IA 1TQ4A 4PN7A 4RTSA 4FYMA 4Y1RB 5CVJA 2YZMA 3ADPA 4DJTA 1XTSA 2OFPA 4KK4A 3AIMA 3LQ4A 5M04A 1YS6A 2GF0A 5DSXA 2F1IA 5D3KA 1HSOA 1H0HA 1O03A 3EODA 3M5DA 1S9DA 1ZUNA 2Z3WA 2J48A 3DE7X 1HBJA 3S28A 3ZDAA 1U4SA 3HU3A 3A9UA 1RM4A 2X0NA 4L78A 4WCFB 2NU8A 1MQ8B 1W30A 3ED5A 3Q3CA 4R01A 2V3WA 1J5PA 4RZ2A 2BAGA 1WQ1R 3QUAA 4Q18A 5J40A 4OP1A 1T0HB 2FSSA 5KKAA 5KTRA 2YBEA 1HDXA 1Q3KA 1WLSA 2P5YA 4X97A 3UK1A 4MVJH 2QLFA 2QZPA 3JYNA 3L8ZA 4TVKA 4Q24A 1PTKA 1P19A 2HK9A 4C5AA 2IUSA 3RVJA 1YBHA 2HGSA 2VS1A 3MS7A 2RK3A 1G3UA 2E4WA 3TRJA 3ZV6A 3BDVA 1WOMA 1M7HA 3DO8A 4B79A 1MMFB 4Q00A 1WCWA 3OC6A 3R5SA 2GK4A 4S1WA 2I6QA 4JCCA 5B1DA 3T0FA 3IB3A 1QONA 2EF1A 3D1VA 4PYIA 2HZBA 4RO0A 3SFZA 2Q1XA 5LR6A 4DB2A 5HKLA 3WMGA 3HY4A 4LXQA 4H6PA 1Q7RA 2CFOA 3IVGA 3KWJA 4TYQA 2Z2XA 1I13A 5EMJA 4PEVA 5B1SA 3RRMA 3HCBA 3RSFA 1QF7A 3NBMA 1FRNA 4ZA2A 5T4BA 3VQTA 1VZ3A 4AJ2A 5FDFA 3C85A 5ILOA 3D54D 4MJXA 1P7ZA 3GGOA 4F97A 4UTPA 1JU3A 1R37A 4Z2YA 2IYOA 2JKYA 3FWNA 2WABA 5IKXA 1NR5A 4MS3B 1M1YB 2JJ1A 5T3UA 2NZ8A 2IYXA 5FI0B 1F2UA 3NH9A 3C8HA 4Z51A 2C04A 2YV1A 2ZT7A 3DOCA 2RCYA 4NARA 5ILQA 1GYQA 1LBIA 1DBQA 5LZ7A 3LGSA 1KBZA 1E3WB 1CQIA 1NYTA 2AXNA 1L8OA 4BRZA 3HKEB 1B00A 3O73A 3U3OA 5JAUA 1YMVA 4US0R 1VMEA 3NWPA 2WOOA 1XHFA 2I1VB 4AMVA 4R0VA 2ZYDA 3ZIAA 2LZ0A 3QOXA 1L7XA 3AJAA 3EUFA 5GGXA 3OFVA 1IVYA 4U7WA 3ROEA 4EUSA 1V11A 3R44A 4G37A 4K9SA 4B3CA 3FZQA 1A4RA 4GKVA 1AGPA 3MW8A 4RPHA 5CA0F 1CFJA 3KEOA 4IJMA 2JBWA 4GLOA 3ACBA 5IAKA 1RABA 1R00A 3ETNA 4GNKA 1K2VN 4MWSA 4OI2A 3NVMB 4F4UA 3QE9Y 1NDHA 1O77A 2AV6A 5LBTA 5LN1A 3C24A 2EBUA 4ZZ0A 4TWZA 4YREA 1YIDA 3G2HA 2ZBRA 3ZY3A 2DFDA 2ZOSA 3ORQA 2CNBA 1QP7A 3IH5A 3L7JA 3FG9A 4GXQA 4M0UA 4UXIA 4I1YA 5H1YA 2BDTA 3T3HA 3VR3A 621PA 5MHTA 3EPHA 2GDJA 1QFXA 2V7VA 2WQ7A 3C7CB 4Q05A 1FZTA 1QH1A 1GSIA 2FSGA 2V0CA 2ZE6A 2D13A 5ALNA 2BGGA 2GOYA 2HYDA 1UJCA 3ZKWA 3PR1A 3ZE7A 3EPJA 1KU0A 1M8FA 2G8LA 1GDDA 5ALIA 3QQ5A 3CKYA 2BZ1A 4YXFA 1E3EA 3PV0A 3T0IA 5ITZB 1V1JA 1V41E 2YS7A 4M3NA 4R51A 4Z3KA 1EI9A 1OHHD 5LYJF 4DV1B 5CA0A 2QB5A 2W70A 3AF0A 5ICGA 4LX8A 4OREX 1GAWA 5EJ6A 2WF6A 1NUAA 4V38A 2A7XA 4BNWA 3H6KA 1C3JA 1P3JA 1PS9A 1UEIA 1OCEA 2YJ4A 5IJ0A 3MTDA 5JJLA 1J2JA 3NT4A 1T35A 4URXR 2YJNA 4XJSA 5F2KA 1RAEA 3E6AA 4X6XA 1LUAA 1O6ZA 2O50A 5HP4A 3IGFA 5EZYB 1BWSA 1A5BB 1IXKA 1IQPA 1H3NA 1I4TD 1M67A 3FPLA 4ROTA 2ZTHA 3A2LA 4G5OA 4KUEA 1LDNA 2X7HA 1NPDA 1XXLA 1JDBB 4GM1A 1L7QA 3NPAA 3QNUA 1MVOA 5BVHB 2R6ZA 1EZ4A 2XCOA 2ZSBA 3EXG1 4PNPA 4QXOA 4QGSA 3OCZA 3MTJA 2HBYA 4DLXA 3OQIA 5I9LA 1I9CA 1BVUA 1XTRA 3OIGA 2VT6A 1I14A 1PWZA 2I6FA 2UVDA 2XXAB 2CMGA 1I0IA 5LYJA 5ALOA 721PA 2QAGA 2H59A 3PNPA 3IKLA 2XOEA 4XIFA 4W7HA 4ZCIA 4O8CA 2QL5A 3JZIA 5CB0A 5CFMA 3DA8A 4DG8A 3MFYA 3LA8A 5FTMA 1SBCA 2XGGA 2I4OA 1U0HC 3NCHA 3NRBA 4AZVA 4WJLA 1JDVA 1X13A 2I7TA 1TQ2A 1II8A 3NHPA 4QYXA 4IQGA 4XX0B 1X1BA 4YC7A 5H3LA 1UBKS 2CUZA 1I3LA 1JXQA 1Q0PA 1KEEB 4LC1A 5DCWA 2XITA 5DWQA 3OLYA 5KSZA 4ZO8A 1XLTA 3T34A 2HA2A 3K53A 2C84A 2VP4A 4OHBA 4BTVA 5CFQA 2E7ZA 2QV0A 1NYRA 4OPMA 5AVUA 4M2LA 3AHHA 4BNNA 1OKKD 1K8YB 4NYJR 1TK9A 2RJOA 3NYRA 1NXXA 1JA1A 4HADA 4LXUA 4JKOA 3GLHE 4B0OA 1ITZA 3G8CA 5CT9A 1J1UA 5K3FA 2P1RA 2RGNA 1DI0A 3BQMB 2LDBA 4WNAB 3WZMA 3GUHA 3UWKA 3WO0A 5EIAA 1AS0A 5UKDA 3CISA 3SX0A 4EB8A 5L3ZA 3NOQA 4FHDA 2VPXA 3R76A 1TFUA 4FUQA 2JCYA 2YWFA 3SWWA 1Y5RA 3AHDA 3SNKA 2YIJA 1LLFA 1X15A 3GVIA 1U94A 4FC6A 2L0XA 2UZAA 5BN5A 1Z08A 2B21A 4RF2A 4CVNA 6AT1A 1DDGA 2AR9A 3DHNA 1GITA 3FE2A 2HCFA 3TDMA 4S2EA 3T4PA 5BN4B 3EYAA 2BJWA 2VAXA 2QW8A 4DN6A 2VNJA 4DLZA 2OC9A 1MXFA 1NPYA 1ZD8A 2YWGA 3P9QA 3T0GA 1EA5A 3B82A 4BV8A 3IEUA 2Z2YA 1GU7A 3B5EA 3EXHB 3IX7A 2QQGA 3H2ZA 1EM8A 2V6FA 4MW5A 3ZY6A 5I7OA 1NU6A 1S89A 3IQHX 4V03A 4INPA 3QTBA 4GUDA 5LQAA 2PKXA 3H99A 2LCIA 3AEYA 3PB3A 1V16B 4P2BA 5CA1F 2J9XB 3NNSA 4DIBA 1Q57A 2PMFA 2Z3VA 4MVYA 3IAXA 4I14A 1JKFA 1FUEA 2ZBQA 2A5JA 3DOFA 3HJGA 1F12A 3T3OA 1E6MA 2BEKA 4PIVA 1YTUA 1QO9A 1BXRB 5K6TA 1LC0A 3NQ41 4ZO7A 1Z0SA 1RVDA 2QX8A 3HPRA 2WJYA 1QV7A 2HV9A 1PK9A 2JIPA 3N0WA 1GZUA 1KORA 2Q4DA 4U2FA 5EKUA 3RB8A 2DAPA 3PKZA 1QTRA 4A91A 2BY4A 2CWWA 1W5EA 3F3SA 3F5DA 4JQCA 4N9QA 2CDNA 2RJ3A 1M54A 4L9WA 3TZEA 3ZJYA 1DO0A 2WF8A 1O2DA 3UK6A 2H08A 5PNTA 2E4YA 5CFRA 1CZKA 5GY7A 2IOYA 2YFHA 3RUIA 1L9XA 1J8MF 2OZEA 4PZ0A 3PI7A 3R7DA 4ER3A 3EB9A 2E5WA 1Z16A 2P4SA 4JHLA 2GPBA 2IHZA 4FEEA 2HSDA 5CA1A 3PYXA 5B2ZA 3VZBA 3GDFA 4ED9A 1CIJA 2FMUA 2MINB 4G84A 4P93A 2V6IA 5A1TA 1LSJA 4R3WA 4EPXA 4RFVA 4M21A 4NYIR 4BO8A 5DCUA 2CHEA 4WXEA 1JIUA 3MJVA 1N25A 4YTEA 3BL6A 2FZVA 1Z2AA 4PZLA 2P6PA 4COKA 4MKZA 1JBKA 1RZ3A 4CM3A 1THTA 2JIOA 1B6RA 3KXLA 3K70D 4PC1A 1COZA 1Z9BA 3OWXA 5CVUA 1Z39A 3FIJA 5I9SA 4DILA 5FO0A 4P1ZA 5CB4F 5JMTA 1ZUHA 3KPVA 2VDPB 4JKYA 2G5TA 1N2BA 4JC4A 3ZPXA 5G0UA 4QOGA 2VIIA 2QY6A 3WL7A 5D1NA 2ATXA 1PWHA 2HJWA 3MUOA 5F51A 4BFLA 1JJIA 2AVDA 3BWMA 1DRJA 4RLHA 2YCLA 4YCCA 4Y9SA 5CTJA 4JELA 2VXYA 4ID9A 1QC5B 4I9GA 3UB2A 4CZ2A 2PT9A 2PVCA 1SULA 3O4HA 4RD3A 1VMKA 1C80A 3M4XA 1UDXA 1WVMA 1DKPA 4MRNA 5TMDA 5KNDA 2N47A 2LPMA 3QENA 1RBZA 1WPQA 5G4LA 3TSCA 2XBLA 5A4DA 2ILVA 1S0UA 2WAAA 2H1RA 4TWIA 4A7PA 4EW6A 3WFIA 2CNWD 5KTPA 3BFXA 2QVCA 2O8CB 5BPHA 1NQWA 4S1TA 3BMXA 2G4VA 4YJHA 5LB4A 2H3EA 4U8GA 4LNHA 1V43A 2WFLB 4L0DA 2WWIA 4XEUA 3M49A 2Y77A 2Z9CA 4I81A 4RJ2A 1ZEJA 3LECA 3GQVA 3NTLA 4JAVC 1CUAA 3P4YA 1ZN8A 2C2WA 3EGEA 2EXXA 4DTIA 4Y30A 3L4BA 2C2YA 2WNSA 4D80A 3RLFA 4CEJB 1B8UA 1L7VC 1X3LA 2RHMA 3BJRA 2F3QA 1U4NA 2I62A 4ZEVA 2J31A 2H52A 2ZWOA 4D4HA 2MSWA 3N7AA 1A69A 4GT1A 1YR6A 2HA5A 3VPXA 3ZZUA 1C9JA 1J56A 1PYGA 2IA5A 4YT5A 3L6UA 2FW7A 5L95A 4JSYA 1YJCA 4YDHB 1FVHA 5LP1A 1V26A 1J8DA 4QYIA 1LS1A 3SS8A 1BVYF 3MWEA 5B5SA 1EBFA 1LDBA 4EG4A 5BR1A 1HX7A 4CMIB 1XKTA 4UUPA 4P6VF 4G4IA 4B83A 2PXCA 2ZG6A 2M6KA 1FFDA 2GBPA 1PF7E 4MQ6A 5FL7A 2Q7DA 3W2FA 3EW7A 3AINA 5BOSA 4CQLA 4AZ3A 2PBZA 3B5JA 1Z8NA 1RXWA 3G0BA 1XU9A 1OJ7A 3GX1A 1XYVA 1E1CA 3VNBA 3G2JA 3VU8A 4YRBA 2OMEA 4BLTA 1EX6A 1BEEA 2PNFA 3BC1A 1N92A 1LBSA 1U7UA 4PS1A 3WB9A 4KXNA 4B7UA 1V5GA 1XJ0A 3I2IA 1E1NA 3AMVA 4WWHA 2O5EA 5ALZA 3FZNA 3FMVA 4OHWA 3WBBA 2AKAB 2ODWA 3LZCA 4BQPA 2OO5A 1VRVA 1Y6ZA 4DG5A 5HRCA 4QJIA 4OGKA 1DKMA 1XALA 2XNSA 4JQZA 4K03A 1EWQA 3L2OB 4DWVA 4MITA 2OCPA 2OMKA 3CGWA 2C59A 3KOOA 4Q6WA 3UKDA 2D1YA 1LS6A 1SNYA 1EB8A 1K7XB 3IXMA 4KLNA 4PZDA 4WK4B 3WLQA 4BBZA 3ELWA 1Z74A 4ZOAA 1TVMA 1FS4A 3GEIA 5PGMA 4L6CA 3I6ZA 3IEMA 3FOEC 3DLBA 1GZ6A 3E22B 3BS4A 3TQOA 3EIUA 4MQUA 5AVSA 2CMFA 2WJ4A 4UU0A 1VLZA 4B33A 4DPLA 1EP9A 2CDRA 2CLHB 1NBME 3DFIA 4IR7A 4EUHA 4Z53A 1WQ4A 3TIXB 1DTEA 1XNQB 3V8BA 1PT8A 3HFGA 1SIBE 4DZTA 1V2HE 1F2TA 1P1HA 4MIKA 1NJ6A 5BR4A 3MUNA 5A6VA 2XH8A 4R1SA 3C5WP 4E2YA 4EL0A 3IP3A 1WHTB 2GEBA 2I7CA 5BSGA 2BKXA 4Q15A 3LT5A 3V4VB 4I4TB 3PQDA 3WO1A 1TW3A 4BATA 1KI6B 2EDAA 3G89A 1XRLA 4BNVA 3ZK7A 1L8QA 3CCBA 3FSJX 1KTVA 2JLCA 3P0JA 1MEOA 4B3MB 4WXRA 4TM7A 4I0WB 3ENVA 1GL9B 2HSJA 5HK8A 3V3KA 1L7OA 1EESA 1N3LA 3QI2A 3BCHA 2JVKA 3SYKA 1ZNXA 1GKIA 1KO5A 1JR2A 4B74A 3KFVA 4ZCLA 4M7OA 4N5LA 1EK1A 2VHXA 1Q0TA 5JUWA 4QQFA 1M9NA 2UKDA 4BBJA 1P44A 2P3OA 2OC4A 2R1VB 4K6MA 2AJDA 4PTLA 4ZI7B 1I2CA 1C0KA 2XNKA 3FNBA 5FUXA 4RH0A 1B93A 4HJRA 3GWZA 2MMGA 1PT6A 2FUG1 1YDMA 3EJ6A 3QLUA 3TD6A 3MMZA 4Z4EA 4R2WA 1NX6A 2VOEA 5JJIA 4RFSA 5GTDA 5THQA 3BXEA 5KJ6A 3FFBA 4DAEA 1M6VB 2PQ6A 5JY1A 4WECA 4DUZB 1Y5MA 4DRXA 3VKUA 2JA2A 3V1UA 3DE6X 4O1HA 2RKOA 1AA6A 2F6RA 1IQ0A 1RTKA 2NU7B 2HSGA 1FDTA 1UFKA 4GC5A 3ZLUA 5JC1A 4N48A 1P91A 4QYSA 3ZGXA 3DHWC 4K6OA 3QVGA 5FYDA 3EVAA 4US1R 1AO0A 2Y0BA 3TLCA 1O95D 3AY6A 4Q21A 2FZWA 5DEOA 2QXTA 4LE0A 1F8XA 4NESA 1H23A 2W8ZA 3PC6A 4ZAWA 1WABA 5K2MA 2BEWB 3H87A 4U9UA 4OU5A 3VTZA 2JFQA 3D4BA 1B41A 3FFTA 3FVVA 2B6HA 3N8HA 4LHYA 4IX1A 5G2OA 4DXAA 3BTUA 1Y4SA 1QX4A 1V96A 2D2XA 1XJ5A 1RHRA 1ZJWA 4PSAA 2NU9B 2EKDA 2WK1A 3OKPA 4XUDA 5HOQA 3IBGA 4Y18A 3COYA 1H5UA 5B1IA 2YHIB 3UOAB 4ZAGA 4TV8B 1S3IA 1RAGA 1VHJA 5CHYA 3TJRA 3CS3A 4EG0A 2Q45A 2ZE7A 1OW3B 3JR3A 3OETA 1Y7HA 5I7SA 1WKBA 3TJZA 1PX0A 2V7QD 5ALQA 3HXPA 4X6UA 5DNYB 1FNDA 3DAPA 3K96A 4LVNA 5JQGB 2VYVA 3HUTA 1QCDA 2P0EA 3IDOA 4AYTA 4DJAA 4H7DA 2BC9A 3KQTA 3O03A 4L8YA 4KXXA 4LVOA 4TRJA 5DI3B 1BGWA 3CZPA 2I87A 1GZ4A 2AI1A 1GUYA 3U4HA 2VOJA 3MOSA 5C18A 4N03A 4QEKA 4QOIA 1WVGA 5BQPA 4YP5A 2A4KA 2P4UA 2YN2A 4B9EA 3VVMA 4F46A 3KR2A 1CRPA 1BCRB 2GXUA 2A8YA 1DAHA 2IZ5A 3B3AA 1HLGA 2EFCB 4GLBA 4I08A 4BZZA 3KZCA 5DXAA 4CQMB 4QFCA 4WIAA 5K4AA 3OT1A 4J16A 3IEPA 4FLMA 3RVMA 3TD9A 4KKXB 2WRZA 4XVRA 4GI7A 1P77A 3RHFA 5D5QA 1Q16A 3RJ5A 1ODIA 1OYWA 4KMMA 3EFOA 2A5DA 2OA0A 4TL7A 5ALMA 4GMDA 3SSNA 2H4HA 3MQ2A 3JALA 4INZA 4KPYA 3W5JA 5CR9A 1DDOA 3EWSA 4F21A 2NO5A 2ONYA 4ZOLA 1CUBA 2HCJB 1TI7A 1DJPA 4OLFA 5DM1A 3G79A 3NGLA 3W5BA 4JI2B 5FNZA 4R2JA 1HYGA 3DDUA 2EX1A 1NGSA 2QHXA 3W5HA 1V5EA 1SHTX 3W2IA 1RHMA 2R97A 3ZQKA 4ZHQB 4NE7A 3AVVA 2ZU0C 3EF0A 3O31A 1JIVA 4FN4A 1FLAA 4D96A 3PHGA 4D9JA 2BGTA 3BMOB 5JZBA 3L7OA 4KLRA 1X6VA 1M1UA 3E2PA 1JVBA 1R4NB 3H5IA 3OZUA 1VMAA 4YLEA 5DBFA 1LF5A 4WD3A 3VSDA 4XCQA 4DM3A 1OGJA 4C9BA 1W96A 2MSEB 3VDXA 5KS2A 3CGGA 2ZRBA 1OVMA 1PG0A 3B12A 3VVCA 4YRKA 1Y1RA 3B2NA 1ZM7A 3LWNA 4G1MB 4QL3A 4B6PA 3CBGA 2HD4A 1IOWA 4FGZA 3SJBA 5KSOA 2BMFA 4XB6B 4JUAA 3WMFA 4LKOA 2X4GA 4LXTA 3UT5A 1WSWA 3THWA 4IS3A 2REQA 2VHQA 3A3NA 3ZQ4A 1VRCA 1DCKA 1MU0A 3D59A 1QAQA 2HK6A 1KE2A 2FG6C 4NCAA 1M6YA 2F9MA 3BE6A 3HLKA 5ED0A 4NXMB 5AM0A 1YB2A 3MMNA 1XXHE 4HX5A 1J4AA 3JPWA 3MSXA 5FB3A 3YASA 5T41A 3PPYA 1RDFA 4QKQA 3UUGA 2CXQA 1IZ7A 5JFOA 2LR0A 4B32A 4EVRA 3KD3A 2EL9A 2FP4B 3PUHA 3QBEA 4JI7B 1P5FA 4LOLA 4N7JA 1FW8A 1T3TA 4DGSA 1Z26A 1NTOA 3ZY2A 5EMLA 2CD9A 4DANA 5H9WA 4FE3A 2B98A 5KTKA 3MJEA 1W46A 1ZSNA 5F21A 3QPWA 2PFGA 1ZN2A 3WHLA 3IESA 3ZV5A 2XB2A 3G9UA 1VPTA 2H5IA 2JCBA 3PITA 4WBXC 2FX3A 3H1TA 3F4KA 3VZPA 2EU8A 2AYXA 4DLTA 2E3JA 5BSTA 4AUNA 4URVR 4F5YA 4PQEA 4XGQA 1ILWA 4DT1B 1G20E 4AWAA 1UBLS 3EZ7A 4MCIA 4FC7A 3RUAA 5IBCA 2HMYB 3LO8A 2WWVD 5C1IA 3U56A 1VE7A 1QYIA 4XGRA 4TMFA 4RA6A 4RZQA 1LTKA 1ONPA 2O0MA 1KK1A 3CXRA 3H9GA 4PE5B 1Z88A 5KINB 5AVTA 5LLDA 4ZVLA 4B2YA 2Q7XA 4KPGA 3IMCA 1W59A 2EX0A 4EJ0A 5JFTA 4FOPA 5ECGC 2EFYA 5H80A 2XB4A 5JT1A 1JHDA 4MCJA 1TT5B 3V3TA 2H2HA 3N2KB 3OM0A 3VXKA 4WKOA 5E38A 1G20B 5TGZA 1VCOA 5FBHA 4A2WA 1BMTA 2BDEA 1T24A 1K06A 1DG9A 3MZ0A 4HDOB 1OWMA 4XKJA 4E1VA 1J0EA 4S04A 1XPOA 4LYHA 5HE8A 1T26A 1X7ZA 2WNHA 2H48A 4BJ1A 4EA7A 4ARAA 2ID8A 1ZS9A 2YHBA 4BKUA 1I4OA 5E4JA 1SVNA 2ZUDA 5DM0A 2ZT6A 3QKIA 5JZSA 2C5LA 4XEHA 5BO5A 2FQWA 1DZ3A 2IFTA 3TVYA 2X4LA 5F7ZA 4CLRA 3N74A 4FD3A 2OCIA 3Q3EA 1LA2A 3NT5A 3QKSA 1SA0B 4NMHA 4UBIA 2AHOA 5BWBA 1QZTA 3HYLA 2IEYA 1JLLB 3GR6A 3ZX5A 4GKBA 5FEUA 1PD1A 2PHZA 2QRLA 2I71A 2JKVA 2UUPA 2Z8YA 2YWEA 4JR0A 4HWTA 4ON9A 3URKA 5JS6A 9LDBA 3MJDA 2FHPA 2J6HA 4PXAA 4LKRA 2ZDHA 4G1EB 4PHCA 5LQSA 3TLXA 4ZMSA 4CKCB 4EJ2A 5MFZA 5JBQA 1SXGA 2NXWA 3BGDA 4RZHA 1U31A 3CEAA 1C3EA 1M6HA 2J4CA 4MQFA 4TOIA 4YYZA 4BVBA 4R1OA 4P86A 3GNSA 2W2KB 2R11A 3QVWA 3U3RA 1U1FA 1NDQA 3H9JA 3P0FA 4N5HX 3DL2A 4W9MC 2DKNA 3AO0B 1JEYB 3FAZA 3QFCA 1R5JA 5B4TA 2ORIA 3H9EO 2JGEA 4ZYUA 1C9MA 3FPCA 4ENSA 4RIHA 1L5QA 1DC3A 3W06A 5LQKA 1A7JA 3KYDB 4JXJA 1ZBQA 3R74A 3V4PB 5JPDA 1YS4A 2KHZA 3KBBA 3PS9A 3RS0A 4L8VA 3BA1A 2KB0A 3FB1A 3DDHA 5KOJB 1TMYA 5DHPA 1R0ZA 1V6CA 3IHWA 3COSA 4DV3B 4FFBB 4FMDB 3DZBA 4ZVMA 3P2OA 4GXRA 2XKBA 3RVQA 3WGGA 3SP1A 3HK2A 3RC1A 1NXVA 2PH7A 1G41A 1L5YA 3QNWA 4ZVKA 2Y3IA 2VUSA 3H4IA 3LC1O 4BNTA 3B9PA 4NXNB 5I45A 1HNXB 4HQKA 1X1EA 3E3NA 5B6IA 1VJTA 1FBTA 2R96A 3QEMB 4DEYA 2XGJA 3ZW9A 1VFNA 2H18A 2QJTA 4UARA 5AVKA 1QNLA 4N0PA 1T8PA 2GLTA 4Z9YA 3KV3O 5B6JA 4Y2TA 5BORA 1PVOA 1GNTA 3O8BA 4IJKA 3CNOA 3G1TA 2MTBA 1KS2A 3GRZA 3X0DA 1EFRD 2BKLA 1SUSA 2ACKA 2GS9A 3RK1A 4I4LA 3TK1A 2IIVA 4RMIA 4CG1A 1W4ZA 2ZDGA 3HFJA 1XTJA 4QU5A 2CK3A 3LLVA 4TSFD 2GD0A 1RKUA 4G85A 4Z9BA 4MEJA 1ZC3A 4CMJA 3HR7A 3ZI0A 1QGYA 2X15A 1NVGA 3FH0A 3RG2A 2Q2NA 4RM2A 3N76A 4IVQA 2BTOA 1ONSA 5AW6A 3PWSA 2C98A 4M1TA 2O4UX 3GNLA 2LRHA 2Z95A 1D4FA 1OTHA 1UZUA 5HF8A 5JNSA 3JYQA 4HLUA 3GQBB 2W6OA 5EHIA 1X3SA 1YR2A 1UOPA 3SR4A 2DFKB 3I6YA 5TMBA 7REQA 2LKCA 2OV8A 3OQMA 10MHA 3CVVA 1GV1A 1N78A 5FTJA 1PWXA 1YHNA 2P2YA 3R5TA 1NP3A 4N8SA 2WKWA 2VATA 3IVMA 4MWBA 5H83A 5TVGA 1OI4A 4OQEA 4PC3A 3STVA 2DECA 1U5BA 1WMBA 2I2CA 2ORWA 3WOHA 4E6PA 3OPNA 3WIDA 4QXAA 3QXGA 3WRYC 3WZLA 4FMPA 2CMKA 1Y3FE 3RH0A 4U6QA 4C07A 1G8PA 4WZZA 4WZBE 1NE2A 1G7TA 4DFDA 2HGZA 2J07A 3NEAA 4R41A 2Z08A 2WQ6A 1JUDA 3N3BC 4IGFA 3CZ5A 3MPUA 3IVCA 3RYFB 1BNCA 2ZJ3A 2ZM5A 2O54A 1H2HA 2QX9A 2XYVA 2CDAA 3CT6A 1Q7EA 3GDGA 4GMFA 4RH3A 4YDSA 3KQLA 4PF1A 4LV6A 4M0PA 5CT4A 2PH3A 3TZCA 3D6JA 3GFSA 4OGWA 1L4YA 1H6CA 1W7AA 5JJKA 1UAGA 2MCFA 5AKLA 1M33A 1NNUA 2H4XA 3SC2B 2NAPA 1ZMRA 4R98A 1W88B 3PQ7A 4AJNA 4HLCA 2ACWA 4FYPA 1NMEA 1XRSB 5A9RA 1WVIA 2E4ZA 2JGDA 2ZJ0A 1PGOA 1VGVA 4JP1A 1X74A 2X5XA 2KS6A 4JLWA 1RBYA 2PL9A 2PLFA 3DAHA 2FWIA 2KE5A 4IGAA 2IX9A 1X80B 1H22A 2EP5A 4NK4A 4RXUA 5C1OA 4RGYA 521PA 1ST3A 5EWJB 4WXHA 4OXXA 5F7JA 4BKPA 3K94A 3CRW1 3RE1A 3KJHA 1KQGA 2GXAA 2YW2A 4XWGA 3SQNA 7AT1A 2XUQA 2WF7A 3SKVA 1I4EB 3ZE9A 4C1NA 3CE9A 3RKRA 4EEXA 1Z2DA 1ZK3A 1AURA 1SBQA 4RKQA 3EISA 4PFSA 4MR9A 3DLAA 3ROTA 1XTQA 1OBVA 3H17A 3LP6A 3IDFA 4NBWA 4EBFA 3U09A 3ECCA 1GGHA 1KKMA 1OX5A 1W5BA 2QLBA 1VSUA 2VPTA 4HAXA 4GZ6A 1B1CA 3TNLA 1J0CA 3EOZA 2BTEA 1E59A 3BWYA 7MDHA 2V1XA 1KEZA 4MV6A 3W9UA 3UMCA 1A27A 1PQ4A 4UHCA 1ZVKA 2E89A 1MQAA 1PJCA 4MV7A 4ENVA 3R7BA 1EXDA 2JLZA 1I6MA 3VM6A 2WMDA 3R0IA 5DIZA 5IYZF 1DT5A 3R0QA 4I55F 3TQHA 3T5MA 4JV5B 4QUAA 4ETIA 3DEKA 4BN0A 1PFUA 3WMEA 4BIIA 1VL6A 2JH8A 3BHNA 3EDYA 3KC2A 2ATEA 4NU5A 3U16A 5BR8B 1K6JA 1NWCA 4RPJA 3W1VA 5HPYB 3W6UA 1H4SA 3DAGA 3A9TA 2XCIA 2O0KA 1PFYA 1EFKA 4NNPA 4G9BA 4LTDA 4ZQIA 5IBRA 4AS3A 1PCXA 3OZCA 1BDBA 4JOCA 4B6QA 2ZQYA 4CM9A 3U6KA 1KFCB 4F2HA 4OA8A 4U7TB 1I4LD 1WBDA 1TMKA 2Q28A 1UK7A 3B48A 1M75A 1KC3A 2IUUA 1BJRE 5HSGA 1X42A 3GAMA 3L7YA 1GADO 1HNNA 3TO5A 1TU4A 1TEXA 2VK4A 4NG4A 4WPGA 3KQOA 3EH2A 1A5TA 1NBWB 2EFEB 3K0AB 4PLVA 2YBDA 3AR5A 1OIVA 5JSUA 3K0CA 2ZB3A 2Q5JA 2JFPA 3AP2A 3GJQA 1IM8A 1R15A 2H4WA 2MWMA 3LW7A 5F4ZA 4ZO6A 4TLCA 3V7WA 4HGPA 3UA3A 2IU4A 3HB0A 4PBRA 2DOKA 2HRRA 2DQKA 1RRKA 2QOEA 4KTVE 1CJTC 1YACA 1C1HA 1RBMA 5DHRA 3OHPA 4ZOQI 3JD2A 5CT8A 4G36A 4M9RA 5D86A 8ATCA 2EKPA 2H5JA 3CR7A 5JS1A 1KQ3A 2EBWA 2C2KA 2FRXA 2A84A 1BC5A 3N2ZB 3VYUB 1XMQB 2A5LA 1VPVA 3O4FA 3WYEA 2D62A 5L6LB 2BELA 3AWIA 2CV1A 1VL1A 3UQZA 3K7EA 4Z7OB 4AWBA 1YB5A 3DV9A 1TKRA 3K2BA 1IY1A 1Z38A 3S7TA 4WCDA 2F4VB 2NO1A 2JCSA 1D2RA 1P9RA 3BK2A 3PXBA 4I6JA 4MVCA 4YJGB 2LV8A 3W9YA 4EPYA 4IUCS 4ENPA 1FPMA 3DWIA 2GJ9A 2QN3A 3PGMA 1E69A 3PYMA 3AVYA 1NVVQ 2IVZA 2XQGA 4KG7A 4DR2B 4I2NA 1NF2A 3P27A 2WYWA 4F8YA 1Q14A 3MNFA 1JHPA 4RKFA 3EXFA 2EWVA 2AN1A 3PFIA 2I6GA 1PYOA 1KYVA 1BS1A 2HU2A 2VHVA 3ZH9B 1CERA 3RYCB 3BB1A 4QPPA 5JXIA 3ZDRA 1VDMA 3L8YA 3R1IA 1Z17A 2G77B 1OMOA 5J59A 4CM8A 4K9PA 1X0XA 3GHHA 4OKSA 4ZVOA 2NV6A 4BLOA 2DKFA 4O4IB 2YC2C 3WBJA 2QNIA 1GDHA 4A27A 3DE2X 4Q48A 1XMSA 5IJXA 3MHPA 3FGZA 4K7JA 5GMOA 2B1QA 1BKYA 5TJ9A 1KVRA 3DT8A 4CMHA 5F9FA 4PCLA 2ODEA 1JT2A 3VR0A 3PCRB 1O8BA 1JG1A 1ZUNB 2WJAA 2QSZA 1QSGA 3CW8X 2BJVA 4N6GA 3I8SA 1PZNA 1T9BA 2A9FA 3L49A 4C4YA 2GK3A 2ZI3A 5FNVB 5K0NA 5I7WA 1FA9A 3PF8A 1N7GA 3QI7A 1L8LA 5DYNA 1SRQA 1AO3A 4DLVA 2SHKA 4E7OA 3E5NA 1G6KA 3TRKA 2C42A 1P72A 4MR8B 4XJVA 3RANA 3TLKA 4FZRA 4C5CA 5C7YA 1QKKA 3D6MA 1RBQA 5DBHX 5LQJA 3P32A 5LU8A 3IBYA 3L07A 4PBTA 4YJ3B 2RHGB 3GRRA 4OFBA 1P1IA 4KLZA 8AT1A 3R5XA 3SQMA 4TTSA 3K8OE 1WE2A 1NUSA 1TC2A 2IPLA 3ZH2A 1NFFA 3A4NA 4DV0B 1WZNA 1HDEA 1YCFA 2OWEA 4PSDA 2BKAA 4QVGA 4BO3A 1ORWA 3TOVA 4ENQA 3GB9A 5BQXA 5CCEA 2DM6A 3E9ZA 5TX7A 1IAVA 1ZWLA 6ADHA 3PNVA 2FX5A 5TXGA 1MNQA 3OURA 4RHEA 2WJIA 4WUTA 3DWGA 1QIKA 5ALGA 4BVGA 3DNFA 3V1NA 2D8AA 1JQEA 4CR7A 1P6QA 1OFGA 3SYLA 4QSHA 1U2QA 3KUCA 4QGHA 1I7PA 1PD0A 3KKOA 2HQRA 4KR0A 3B9QA 2WMYA 3OZTA 5JSYA 2Z58A 4BECA 4O2BF 2PL3A 2YRFA 4EY7A 2QRNA 1F2UB 1MW8X 3EQ8A 4OSOA 5LQNA 4Q9JA 1CKEA 6GPBA 1OC2A 5IX8A 4DBLE 1M1XB 5JTTA 1XRPA 2BFEA 2H17A 5HKKA 1JHOA 1G2IA 1AT1A 1SWWA 2M98A 2R9VA 2NSDA 1ZX1A 2O1WA 3TZLA 1YGPA 4AS2A 1NKTA 1BXZA 3R6WA 1W4BA 2XR1A 2QVBA 3K2IA 5BV7A 2HT1A 4JASB 2W6JA 3OWHA 2QLLA 2F9FA 1R4MA 1A7AA 1V11B 2VLBA 4Z7JA 2W4IA 2W6QA 4YR9A 2JHAA 3CB4A 3OH8A 2QAJA 4TN5A 2P4EA 1XF1A 1H2YA 3L1IA 2BM0A 5EQFA 3DVSX 2PDAA 1CR0A 1DJNA 5J4YA 2XMQA 1JJVA 4NU0A 2BYTA 2HHHB 3S7ZA 5JH7A 4O2BA 3QG1A 1C5KA 1WTAA 2FG5A 4JEIA 4JLOA 1Q11A 4KH0A 3PQ8A 1XJWA 5CNIA 2CXUA 2PYZA 4M0EA 4MV1A 3JVVA 5AJHA 1GKLA 4V1CA 1VIVA 2VF4X 4A15A 2BT4A 4UW9A 2QT0A 2QSUA 1QH1B 4TM8A 5C3UA 4M7RA 3KDSE 3AKCA 4IRXA 1E7MA 5F2EA 1T5HX 2XI4A 1WPXA 3CNBA 3TLJA 2BL4A 3ZKWB 4CLDA 3NASA 5FTNA 4E3WA 3QWIA 3LDHA 5AP9A 1EJ6A 2WPDD 3UTCA 1BJKA 1E3IA 2BOVA 2HPZA 4WERA 5G41A 3IBCA 5CA0B 4Y2YA 5EMHA 3FMGA 1WNFA 1ZL2A 2AC4A 2JH9A 4F6LA 3NAMA 4UNNA 3DM9B 2IP1A 4TSKA 4MOWA 4G1CA 3ZHRA 5IJ0B 1IVSA 1YMQA 5L45A 1TC1A 2B36A 3E9QA 1XCLA 5K8VA 1A97A 2WV7A 5K3BA 1MFPA 3TVDA 3A32A 3LDAA 3C39A 3TZKA 3RRBA 1L2TA 4YAEA 3PJRA 1SUPA 3FRJA 1THGA 2ZSFA 5AR1A 4Z3OA 3NMUF 1DX9A 2PT7A 1LDYA 2G25A 5A4KA 2RGCA 3DS8A 2JPDA 2DEUA 2QVGA 5GJWC 1U2PA 1Z7GA 2WKQA 2YN4A 4WVFA 5EJMA 1MGOA 1JYFA 3KKMA 4E5MA 1F6DA 1TM7E 4Z49A 4DTCA 5EPOA 3ZDDA 3MIIA 3B1KA 3BHJA 4AECA 1J8FA 4FYIA 3ZDQA 4XR4A 2QMEA 4E5NA 2RB4A 4KR7A 2NUTB 2B8EA 4M1YA 1M72A 4R2MA 5LP6F 3WLEA 3OQIB 5EJFA 3ZJUA 1K97A 3KJEA 3REOA 1JHYA 2RBGA 1GCIA 4EVQA 2ZVJA 2BTQA 4DMUB 3JQFA 4YASA 2QAGB 1G9XA 2Y1LA 4Q4DA 4ZI5A 1QO7A 2XUGA 4O5OA 3FNRA 3MRSA 4XARA 3W8DA 4RHFA 2QJFA 3ABSB 4A6DA 3FUTA 1DWUA 4INOA 1S9HA 1PFGA 1JAXA 1YB1A 2PLAA 1YCDA 3CT4A 1IL0A 3KE8A 3SVTA 1EDBA 2COKA 5JDCC 5F77A 4DV5B 2G1AA 1YULA 4Q9KA 2OXTA 3WYAA 5JTUA 1P7VA 1XQWA 2A5YB 2X8BA 1KPGA 4KFTA 5D87A 4NCBA 1XMIA 1I30A 2LDXA 2QLMA 2C7PA 4EYKA 3ULKA 4MVJI 1UBNA 1BOOA 3JQ6A 3BYZA 3H2SA 1T0IA 2Q3LA 3HA7A 3K9FC 4JJAA 2WJ6A 4NECA 4BFYA 3E8SA 4EJSC 4ARIA 2AK3A 3CWZA 5E4FA 3VI4B 5HILA 4I4IA 2R2GA 2JI6A 1SHLA 4BB0A 5LP6A 1CLEA 4ESVA 2G1KA 2GF2A 4U5XA 3JD4A 4QUGA 3KLBA 4II7A 3RTCA 1BVHA 4ZP1A 1G9TA 3AIOA 1N2GA 1LQUA 1OXTA 1WZEA 2G5PA 1Q21A 3B53X 3NJRA 4ZOCA 1M5TA 3THXA 4Y0NA 4X64B 2CNKA 1U2GC 2G63A 3PFHA 5AK5A 1P4JA 4P4LA 1ZC4A 2GCGA 8OHMA 1QYXA 3FHLA 4A8HA 1CK4A 1HE4A 3GVCA 3B5IA 3DOJA 1M3SA 4IEIA 4JLDA 4KIFA 1YGYA 3VTAA 1QGED 4RORA 2MR6A 1UFOA 1JPVA 3FLBA 1P1JA 1IJBA 1CLUA 1ZIXA 2O7RA 3G6KA 4CM1A 1B6TA 1EP1B 3AM1A 5CX1A 3KXPA 5J5VA 1EM8B 2BMWA 2H65A 4M60A 2RK6A 1TO6A 4UBNA 5ICCA 4FGUA 1EBBA 3LP8A 5KHAA 1O7JA 1QB8A 1R6AA 3RABA 3UUWA 1Q92A 1JHZA 3SMVA 4ISBA 4EHFA 1EP2B 4BKMA 1AK9A 2ZREA 4ZALA 2YFYA 5I4BA 2O2IA 1KZYC 2ZGVA 3NM6B 3PJEA 5CM2Z 4O1MA 1D04A 1U3DA 4L4SA 3RUDA 4YT2A 1JDJA 3QIAA 3WJ2A 2AFRA 1YVUA 2WTBA 4FDAA 4LMAA 4XX1A 4X3CA 3DAYA 3SHQA 5F23A 2OV2A 3R8CA 2ZUTA 4EY4A 3IELA 1M7BA 3T1TA 2IXGA 1H9AA 4V2UA 1SCBA 4J1SA 3G2LA 2YDXA 4TYYA 4D3FA 1OSNA 4N65A 4DA9A 3ZK9A 4BO9A 2ACEA 3LCMA 2C9ZA 5LIPA 1KMCA 3IODA 2C94A 4QYTA 1PFWA 4M89A 3V4LA 1QIMA 5CLIA 3WKBA 1TFRA 3LX5A 3RSSA 3VR6A 2VTBA 4YRTA 4LUCA 2EEZA 5CVCA 2XPCA 4C7OB 1Z0ZA 1RPTA 4P32A 3BD9A 4DOMA 5CA1B 2FZ4A 2QRJA 4H7FA 5HE9A 1DMRA 3D4LA 2KPOA 3AFOA 3CWCA 3TRDA 1NHGA 1F60A 4BGEA 4OSEA 2WMOB 1DP4A 3QV2A 5KVCA 2YZGA 5B2EA 1JE1A 1R4AA 3GGGA 4YDRA 3IV7A 4PTZA 3K8QA 3KBOA 3N70A 4DLLA 1HZZA 2P0AA 4MAMA 1P8AA 5IKEA 4JXZA 2QN1A 2JRCA 1JL3A 3TBFA 3OUUA 5JBIA 3EPLA 1BX0A 4BUZA 5SZIA 2G76A 2XUHA 5MFPA 4BN5A 1P7WA 1FTNA 4XXHA 5C46F 1H2AS 3IQZA 1S6YA 1YL5A 2P41A 3AH8A 2OYSA 3FTQA 4QO7A 2QI9C 1ZSVA 4PHFA 1L5HA 4IY1A 5CYPA 5DTRA 5I8PA 3H5WA 5ETJA 2V5UA 4IDEA 5G1PA 5J4LA 2HTFA 4RF3A 4MR7B 3NNNA 3C1OA 4DUPA 2RC6A 2XVZA 5J2UA 3NORA 2AMLA 3OPYA 1C3XA 2FKNA 3OEEA 4K2HA 4KVAA 4PPFA 4FGKA 1OI2A 2BFFA 3A14A 3AL0C 1DEAA 1JLHA 2P78A 3A26A 4FLEA 3PTLA 5AUOB 1EWTA 4ALJA 3JVDA 1XZ8A 1JSXA 1UF9A 3WK4A 3CLUC 1S4MA 3UJ8A 4PYKA 2IF2A 3HJTA 2FW9A 2IHTA 1SKBA 3K32A 3L6OO 4OMDA 2QD3A 5AW1A 1Z5OA 1P1FA 2ZWIA 1ECPA 1M73E 2M32A 1CUIA 2PWYA 2FMHA 5CB8A 4Q1DA 4B85A 2ZXUA 1E9FA 4LDQA 3PLRA 2C58A 1U9YA 3FKQA 1QGUB 1P0CA 1X92A 4YJHB 4HXYA 4P84A 3TE6A 4KGZA 3TKLA 4DLAA 4TTTS 2W6ID 1L1RA 3JVUA 2CLKB 2AUNA 4IF6A 4LY9A 3VYSB 5CB4B 1W0JD 5ES3A 3Q1LA 1E2BA 2IHUA 4V24A 1EZZA 1J09A 1KH3A 3HDTA 3VI3B 4D9IA 4JT2A 2GZ3A 3Q8MA 3JASA 2IY7A 2WT8A 4E11A 3FBGA 1VOTA 1T5BA 3D8NA 3ELUA 3VGJA 2ZT5A 3IALA 4JX9A 4J9UE 3VPCA 2FW1A 4LISA 3QHQA 4MGYR 1GFSA 3IAM6 4PC6A 4P08A 2A0WA 4LAFA 4BZPA 3QHPA 1P2BA 4IIVA 1ZD9A 2IPNA 3NJ4A 1NNSA 1EVYA 1ZCJA 3PHBE 2YMLA 2RKWA 3R3SA 3V42A 2EKZA 4ENWA 5JSFA 1CY2A 1KIMA 1WXDA 3E8MA 5EOVA 4YUWA 3EUWA 3USZA 3ZX4A 5JXHA 1P5HA 1WIWA 1XYYA 3L7NA 4C7XA 1RJ9A 2RGXA 1GRRA 5IKMA 1DBPA 4Q1EA 5I7AA 2HJVA 3K73O 2PX5A 1SQ0A 3BTVA 1Q17A 4HMOA 4V0OA 3VVLA 5C7OO 4FDVA 1Q0QA 3OUZA 1I3CA 2OB2A 3DE0X 4WASA 5BOSB 3WQHA 1YB7A 4AZ3B 5KUTA 1M0WA 2NU6B 4C43A 4IZIA 1T5SA 2OCKA 3UCEA 3V7YA 1YDGA 1Y9EA 3O3CA 3INRA 1E1CB 5DX8A 1XBTA 4EHAA 2FE1A 4M0CA 1HWYA 1TZMA 5J2TA 1MIHA 2Q9CA 3AJDA 1WM1A 3L7LA 2SCUB 4EMTA 3L5KA 4N47A 1T9CA 1U6JA 3MEQA 4YUXA 1XZMA 1GA4A 3GEPA 2HIMA 4MB2A 5C8ZA 3PQ2A 4O0LA 1UPUA 2APJA 2WU0A 3FGNA 5IUNC 4XI9A 4RMJA 3AUFA 1NF3A 4QTUB 4WXYB 4XIYA 3WLKX 3X44A 3GLQA 3X3HA 4EHBA 1I2ZA 1QHYA 2HL6A 3DGFC 2O4CA 4DA0A 4PY2A 2ISSD 3KS9A 5IC6A 1Q3HA 2CL0X 2H2GA 4EKEA 1YR3A 3KAPA 4GX5A 5HKKD 2IVFA 4A0GA 1N77A 4DQLA 3FTDA 2CL5A 1ZGHA 4IH1A 4HGQA 4HDSB 4KMSA 4NOKA 4ZAXA 5AM3A 4X7BA 3CEHA 3K0FB 5FHQA 2C9DA 2CLLB 4LBZA 1E2PA 4HEA6 3AR7A 1I7SB 5EXEA 3G5TA 3CUYA 4IQ0A 4NYMQ 4HH1A 5JISA 1I8TA 2O3UA 2ZE5A 3GA7A 4UHJA 4OJNA 2Z5LA 2YZNA 4AUMA 1PJ2A 2CHFA 1L7DA 4FCVA 4ZVSA 4JH0A 1KK0A 4TMYA 5LMCA 1TYEB 4BX0A 3O3NB 2QNBA 3GBSA 4XSVA 5SV2A 2HQOA 3U4QA 3TL6A 2IKSA 2V9ZA 2ZROA 4UXJA 3MBKA 5ALSA 5G1OA 2QQFA 4JD5A 5KCZA 2BEUA 4I1VA 5IBQA 4N54A 1KWGA 3TLBA 2Y99A 4RVSA 3PUWA 4FW9A 1JRLA 5EQJB 5BNFA 1OV4A 2QVXX 3B6JA 3F3KA 4DEVA 4Y2HA 2I2FA 2PZKA 5KZMB 1XWFA 4MZXA 5B30A 2OK8A 1WTCA 2B8NA 3CLKA 4B4KA 1UC4B 1MVLA 3BULA 5F5XA 2EJWA 3R2JA 5HJ2A 3PNYA 3M9XA 5TEWA 3WWOA 3QEAZ 4ZZ3A 1W9HA 1G5PA 2XT0A 3VX3A 3U17A 4Y9UA 4EITA 1ISMA 4O4LB 3PPIA 1HKHA 3G5AA 5FL3A 3SBOA 3HZZA 3UV6A 3D7LA 3K9GA 1E79A 3QUTA 2V58A 2ODQA 5IVPA 1H6DA 3PWKA 4BPBA 1G0OA 4RFSB 2I9PA 4Z4CA 4KYTA 4JJKA 2H1SA 4HDCA 3F98A 4QOFA 4DGQA 4TSRA 3TLMA 3UMYA 1XNRB 1FRVA 1E9VA 3GUCA 4RGBA 4DRXB 1DO2A 3CSSA 3LFUA 1KBQA 1YAHA 3C6YA 5CXQA 3PCXA 1JSLA 2X19A 3BH0A 3Q1KA 2I4MA 4PZPA 5EZ6B 3QVGB 1NJ2A 3F46A 4GF5A 2JF0A 4U2GA 1Q12A 1VXRA 2XOKD 4ETWA 5GAJA 2H07A 5IHXA 5K3EA 2XT6A 5GV8A 5JCOA 3PNBA 1YHYA 4GC9A 5IVHA 5AKXA 2JDIA 4D92A 1T0PA 3ABOB 1ZRSA 1DOZA 4HB4A 3OCXA 3KQVA 1N2IA 1CPYA 2Q2WA 4U7PB 5AWFC 3SQXA 2J3LA 4OHCA 1H4VB 3SDSA 1GNSA 4L5JA 3WK9A 1I2BA 4FQ5A 3FDFA 3WIEA 4GX0A 1K8QA 4KUGA 3SN6A 4PS0A 3GLFE 3ND9A 1F20A 4RD4A 1Z0KA 2IYAA 2I9KA 3T1HB 1G21A 1KY3A 2JARA 4QXMA 4WEOA 1YU9A 5ALLA 2KQUA 1GCGA 4H1HA 2CHUA 4DBLC 2FUEA 2Q0QA 2DUWA 4F71A 1DXOA 3KG2A 1E98A 3U0VA 5FBVB 1YTLA 2GASA 4IDPA 2ZANA 2WPNA 4QUEA 3AI2A 4QPJC 2A9RA 4AD8A 1T0UA 4D8UA 2WHRA 4IDQA 1E1MA 3I37X 1EXNA 1G5TA 3LQQA 4FDTA 3OVMA 4LYFA 3CKKA 1DG1G 1X7XA 1YR9A 3CLHA 2NG1A 1DAPA 3GLFB 4INJA 3VC2A 1L4FA 3HS3A 3RRYA 3I9OA 1N2EA 3RFFA 1N6LA 3FDIA 3IS3A 4B5KA 5CDGA 4GYYA 3NYIA 4CLHA 4PWZA 4H7JA 3RFUA