4R8VA

Crystal structure of the hydrolase domain of 10-formyltetrahydrofolate dehydrogenase (wild-type) complex with formate
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
308
structure length
308
Chain Sequence
MKIAVIGQSLFGQEVYKELKNEGHMIVGVFTIPDKDGKVDPLAIEAEKDGVPVFKFPRWRLKGKAITEVVDQYKAVGAELNVLPFCSQFIPMEVIDHPKHGSIIYHPSLLPRHRGASAINWTLIHGDKKGGFTVFWADDGLDTGPILLQRECDVEPNDNVNSIYKRFLFPEGVKGMVEAVRLIATGKAPRIKQPEEGATYECIQKKENSKIDWNQPAEAIHNWIRGNDRVPGAWAEIDGKSVSFYGSTLLENDHFSSNGQPLEIPGASRAALVTKNGLVLFGNDGKMLLVKNLQFEDGKMIPGSQYFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 10-formyltetrahydrofolate dehydrogenase
publication title Structures of the hydrolase domain of zebrafish 10-formyltetrahydrofolate dehydrogenase and its complexes reveal a complete set of key residues for hydrolysis and product inhibition
doi rcsb
source organism Danio rerio
total genus 91
structure length 308
sequence length 308
ec nomenclature ec 1.5.1.6: Formyltetrahydrofolate dehydrogenase.
pdb deposition date 2014-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
A PF02911 Formyl_trans_C Formyl transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.25.10 Alpha Beta Roll Methionyl-tRNA Fmet Formyltransferase; Chain A, domain 2 Formyl transferase, C-terminal domain 4r8vA02
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 4r8vA01
4Q12A 4QPDA 4ZYUA 4NV1A 3Q0IA 1ZLXA 4ZZ3A 1GRCA 4IQFA 1RC0A 1C3EA 4ZYTA 1MEJA 1ZLYA 4TTSA 2GARA 3AV3A 1CDEA 2YWRA 4ZYVA 3NRBA 4ZYYA 4YFVA 3P9XA 4ZYWA 4ZYZA 3TQQA 1RBQA 3KCQA 3DCJA 4S1NA 1MENA 3AUFA 3DA8A 5J63A 4ZZ1A 1RBZA 1RBYA 2BW0A 1YRWA 4PZUA 3W7BA 4DS3A 4EW2A 5CJJA 2BLNA 4TS4A 3LOUA 4YFYA 1MEOA 4EW3A 4ZZ0A 1FMTA 1ZGHA 4ZZ2A 1GARA 1S3IA 1RC1A 1RBMA 5J9FA 4TT8A 3TQRA 1JKXA 4ZYXA 4R8VA 1NJSA 4EW1A 3OBIA 3N0VA 1C2TA 3GARA 2CFIA 1CDDA 4QPCA 3R8XA 3O1LA 2FMTA
chains in the Genus database with same CATH superfamily
2QUHA 1BWRA 2HK8A 4PHGA 4PC3A 4XD7D 4MYTA 1YFKA 3VR4H 1V43A 3KBBA 1FYFA 2IZ0A 3KV1A 2GXQA 4HZIA 5A04A 4N76A 1J21A 1LPSA 1GPYA 1Y3CE 3L0BA 1II8B 5SZJA 3TEMA 5E4FA 1FX0A 4J16A 3VPSA 2DT8A 3DVAB 1I33A 5KYKA 2P3SA 3QBVA 2BBSA 4US1R 3VU3A 3H16A 2WYVA 4WK2B 4URFA 5EJ7A 3ON5A 2ZRJA 3RS2A 1CYEA 2XNCA 1TPZA 4KVAA 1KXJA 3HBAA 5KVAA 3OFNA 5AKHA 3GMIA 2BZ0A 2H7VA 5KIAA 2B6HA 2QAIA 4W5HA 4MHTA 3L1KA 4DRZA 1MO4A 1DC4A 2X22A 2QM7A 5THQA 1ZLYA 4OXYA 2I7CA 4HLUC 1SGWA 1SVMA 2XRYA 3VH3A 3YASA 5JI2E 2Y0DA 4YR7A 1LRJA 1DDIA 4LFAB 5AVWA 2FMUA 5EKSA 5K20A 1PVOA 2ZR9A 4EGFA 3HMKA 1UWCA 4BB9A 4PRLA 3ZV5A 3II6X 4HNTA 4N03A 4MKGA 3M5WA 4GSYA 4EUSA 1QHXA 3WNBA 2EKBA 1AO0A 4HAIA 3OE7D 2QP9X 3OPQA 4TYNA 4OHVA 2C2HA 3OKCA 1O77A 3KQMA 3I45A 4XCVA 2W90A 1JAZA 1WLYA 2CEAA 2E4XA 1R15A 3H5WA 4HLQB 1L8XA 4IJKA 1KEUA 5IP5A 5DH9A 2PX8A 2D1RA 4HB4A 5TV2A 4PYNA 1I3CA 3GLFE 1X86B 1U7ZA 1I7LA 2H2IA 2WP8J 3UIEA 2EBHX 4N7MA 3ZYCA 2RGGA 2CFCA 5HKLA 4TYYA 4R2LA 4MS3A 4KPEC 4R31A 4W7HA 4X7BA 4UE2A 3CH6A 3RGWS 3BXEA 2FZLA 2H9YA 4DWJA 2L82A 4DARA 2P90A 1AHIA 1G4HA 5EMNA 1MQ8B 5HZKA 4DCVA 3PRYA 1LX7A 5C32A 5BN3A 2UZIR 5EUBA 5FBKA 1RJWA 2Q9CA 1GQRA 4YIHA 1F1BA 2OMKA 1P7WA 5DBFA 5E7QA 3AHGA 2AJ8A 3EQ6A 5LOVF 1PBTA 3N07A 2PMFA 4HJRA 3I39X 5L6LB 1OBHA 3IE0A 3B3FA 4CEJB 1SQFA 4BNWA 1FFXB 1FVOA 3E9CA 1EUCB 1GKIA 2B8WA 4M76B 3ZJ5A 3P9QA 3UPTA 1AMOA 2I03A 1E6UA 3E61A 1UFKA 2V4ZA 3RVQA 3VHXB 2RHWA 5LQCA 4TYPA 2P9JA 4WCFA 3WK6A 1S1MA 5JD4A 3PGJA 2I78A 2OD2A 2I6UA 2RK4A 3MJDA 4K05A 2GM9A 1YVEI 4Y6LA 4DA6A 4J1SA 4BO5A 5ALDA 3RRMA 2GNPA 4YUXA 3BGVA 5ESRA 4RD4A 1TTPB 1CY1A 1UWKA 2P75A 4NCAA 2Q0XA 3PU6A 2R11A 1DO0A 3WDMA 5ITWA 3QX3A 1DOAA 2PWPA 2GEKA 4O4HF 1TAQA 4LNUA 4Y1FA 3L6RA 3PEFA 3T3MB 3RC8A 2DUJA 2ZFUA 5AT1A 2I4MA 4J2TA 3SJBA 1IY2A 4PZ0A 4FXOA 1VCNA 5C5CA 2JJQA 3UHOA 2C4WA 3VR4D 1XF1A 1A9TA 3A6KA 3B2EA 1YZGA 5C4GB 4HEA1 1KF0A 3UB2A 1ADYA 1O0SA 1AK2A 2C2YA 2QD4A 5IT0A 2VDUE 2WNIA 4LTDA 3SM9A 2IS2A 2LRHA 1PZMA 3C4VA 3J7AC 2EQ5A 3ZWVA 2OCKA 4QAJA 2DE0X 1BMQA 1FRNA 2X5KO 2AX3A 1HOTA 2WJ3A 1EWVA 3C39A 1FMLA 4OHRA 3WC4A 5LU8A 2ZVJA 2NVWA 1ZSVA 3OPYB 4KIWA 2Q9BA 1Y6JA 2IIQA 4YUAA 5K8CA 1QGDA 1UDRA 2GQ0A 3NHLA 1GPAA 4ZV9A 5LP1A 3V2GA 4MYRA 1CUYA 1SQGA 3F1KA 2XI4A 3LKZA 1E9BA 2PSFA 1W88A 3OOSA 4YRKA 3ZCQA 1SKYB 1ESNA 2H63A 1PO7A 3HEAA 3GR6A 3IKVA 4YASA 4TYMA 2BJWA 4RKWA 1P0PA 5CB4B 3V8EA 4YYEA 2A0WA 3OZAA 3VKUA 1LBHA 5AFSA 4F0JA 1JJFA 1NVMB 4P6VF 3ZG6A 2VDVE 2A59A 1XLTC 2B4KA 2DCMA 3B9BA 2IWRA 1UT8A 4QOGA 2IU0A 4QDKA 2A2ZA 2AFHB 3QBJA 1OH6A 1EGAA 4FDUA 2FG5A 1PWYE 2RK6A 4G2NA 3PXXA 1M0EA 2D2VA 1L1EA 3E7FA 1DUSA 2C31A 2WWGA 3NP9A 1K6XA 3HC7A 4PQGA 3U7GA 4S2UA 1LI7A 1XTUA 2JFXA 3PQ5A 2NOAA 3BZWA 4GS5A 4V02A 4BIIA 1B8VA 1G2IA 1WJGA 4BMVA 4B75A 4E09A 4F1KA 5KOHA 1X8XA 1OAOC 4TUYF 3E3LA 5JJ5A 1RRPA 4OXXA 5ILOA 2VLBA 1N2CE 1CRZA 1OI3A 1T0IA 2NTYC 1JEQB 1UFVA 1E64A 3OTIA 5BW5A 5DNUA 1GFSA 2J59A 2VAMA 5EIFA 2CLOB 2GPBA 1H85A 2VDMB 1P17A 2RIRA 4AIIA 3OJEA 1JZQA 3HP7A 2PWYA 1L5MA 1T5IA 1Z6TA 4DIOA 2VAXA 3RB8A 1U0HC 3IEPA 4DT1B 2DKFA 4XVCA 4YXWD 2CHEA 4EG8A 3O8BA 4IIUA 3KPJA 1J24A 3AP3A 5LQJA 3WSVA 1DJOA 2AMLA 1Z4KA 3I9KA 3G79A 1ZITA 2WD8A 1IIRA 1MPXA 2ZPTX 3LDHA 2PKEA 3WK9A 2OCBA 1H9CA 3HCWA 4YP0A 1DEHA 1UBNA 2HA5A 3NEJA 3NU1A 3KSDO 3TSWA 5K99A 1LV7A 3GP3A 1E61A 1T0BA 4FDVA 4PCVA 3H5RA 4Z86A 2ZJBA 3WGTA 5ALQA 3STTA 4Z1OA 3TZHA 3QKRB 5JAPA 2FKAA 3RJTA 4B6RA 2P1DA 3OZBA 2GOYA 5KNCH 3STVA 5CDYA 3JV7A 1MCZA 3IMCA 3K5HA 4NEQA 3E3NA 3ADKA 1S89A 3FUUA 1HNWB 3GT4A 2QNIA 4RD3A 4NYJR 1YUNA 4DM7A 2BZGA 2FEMA 5EZQA 2IXFA 4FFOA 3U26A 4BLQA 1P77A 4WBXC 2OHFA 1XMVA 3LUHA 3IAM6 3OTHA 4AFNA 3H2SA 2RDMA 4LF5B 3F2IA 3I23A 3OJWA 1KTVA 5HP4A 1XMQB 2AR9A 3NIFB 5CH3A 4X24A 1PUJA 3QG1A 4WXRA 4IQGA 2OCPA 3ICPA 4MTCA 2Q3BA 1XCJA 1GG8A 4YI3A 4YMVA 4Z7NB 1U5CA 4OJNA 2EATA 3JATA 3O1JC 3LP8A 1R6XA 4ZAZA 4A9AA 2C7OA 3TTSA 1GNRA 4QLAA 1J0AA 4BLUA 4C3VA 5UKDA 1C2YA 1T9DA 4Q3KA 4BMNA 2HLDD 2PO7A 2ZZKA 5GGYA 4F11A 4LBYA 4R0MA 2GGSA 2YHUA 2DG2A 2PGDA 3M82A 4DSZA 1ACMA 3GJ3A 1XQXA 3UW3A 2H00A 5K3DA 3DAGA 1DV1A 3BB1A 2Q5OA 4D9NA 3OZGA 3QQPA 1LJ8A 2I8CA 1A8QA 2V0NA 3T9CA 3DDOA 1G1AA 4BNKA 4C0QC 1F7UA 1NW5A 1RLUA 2RHTA 5B3AA 1XQYA 2FFJA 3DPUA 1Q3TA 3CG0A 3W0LB 4YJ2A 2CFOA 4XQEA 4MQLA 5K3EA 1Q84A 3O4IA 4IGEA 1MJ5A 1BX0A 4NAVA 4D97A 4IZHA 3ZCTA 4C01A 4BX9A 4LGCA 7ABPA 1VMEA 2GPYA 2O4CA 2BIFA 4W8OA 2FPSA 1NI4A 2P27A 4MINA 4CR7A 3WGUA 3EIFA 4DLRA 2FPRA 4FJ1A 2Q2QA 3I0ZA 1B14A 4QM7A 1JUDA 2X13A 3BWXA 4PGMA 521PA 4EMUA 1K0UA 4R2IA 2R0QC 4MUKA 1NXWA 5JCOA 5B30A 5B7QA 2R6R1 2ECQA 1WXWA 2B82A 3BXOA 1MJGM 3E9YA 4NMWA 1UPFA 4OQPA 5H7XA 1ML4A 4AZWA 4LPKA 3NR2A 4WZBE 1CC1S 5IRCD 3HKDB 2R4TA 4EKIA 2H07A 2LVBA 3AEQA 2P0AA 2FMHA 3BMOA 3FNGA 2BGNA 4NZOA 1SCUB 1VKRA 3F71A 3QH4A 3QGMA 4LJ5A 4XB6B 1NV9A 2KX7A 3R23A 3A1VA 2SCUB 2W8BB 2WB4A 1HQKA 1U94A 1VG0B 4FEAA 4HX9A 1REQA 5BSUA 4MWGA 5JW6A 3EIOA 2IHTA 1JNYA 4EMTA 3U7JA 1ZCZA 2ZEJA 3A10A 3JASB 4Q9DA 1WEKA 4TXJA 1C1DA 1GQYA 4UZEA 2YWBA 3B3JA 3QPAA 4HBZA 4J0GA 4P98A 3TFQA 3FHCB 3ZVMA 3D1VA 3CHYA 1NDHA 1DKLA 1NJGA 2DF8A 3C48A 3JVEA 3C41J 3KFLA 2QVBA 3AR6A 1MJHA 4ITVA 4IICA 4LMAA 5DX8A 4AY5A 1U2TA 2D13A 2I2CA 1TQ8A 2H11A 2ZYIA 5AVUA 1PQPA 1FXUA 2QTHA 1XE3A 2C92A 2WD7A 4IDCA 2QPLA 3DAHA 1HDEA 2I54A 3I30X 2CWWA 2XUOA 3B78A 1JEEA 2CLHB 3C1TA 2VHWA 4Y6SA 9ATCA 4R16A 5BYJA 2PKWA 2F4NA 3KUDA 3QNWA 4R1QA 2XCUA 3T7SA 3U37A 1P6UA 1USWA 3GGCA 2A35A 3HY3A 1OV6A 3V4SA 1E0AA 4C1BA 2LD4A 5DYTA 1M2FA 1HFKA 1QZXA 5FPYA 1MHPA 1H8ED 3C7CB 5LZ7A 4TS3A 5AK4A 3H6HA 1NJ1A 2GLXA 3D0RA 3L6UA 4E21A 4BGDA 5EXEA 1WV0A 1NQOA 1ONOA 3EK2A 1L7NA 1LPPA 1R0BA 1TUIA 4LJYA 4NJMA 4BO3A 4AKHA 3P2JA 4QA9A 4XDHA 4CKWB 1YZNA 2P9YA 2IFTA 3U31A 2FP3A 4Q7JB 1MHTA 1J4AA 4WACA 5JYDA 4IL5A 3TG2A 5CB8A 3B6KA 2ZETA 3MM4A 3MTIA 3AW9A 2CCKA 4KEAA 5FRDA 2JIZA 5IM4F 4DADA 2CV2A 2ZQYA 1XTKA 5G3YA 4K0KB 2RGBA 3AF5A 2X4GA 1EP2B 1XAJA 3QYPA 3IDFA 2VLIA 4U2FA 1JR2A 3QRWA 6GPBA 1MUUA 3GFPA 4BRZA 2HHHB 2XHZA 3CURA 4XARA 1AT1A 1ZZGA 1JMYA 4IV5A 4DXHA 3LKVA 1C3EA 2AKYA 4MKIA 2O8BA 3NLLA 2ZSEA 1KJJA 3W04A 4DQUA 2PZJA 4QPJC 4UEJA 3EF3A 1FNMA 3D2AA 5E8JA 1ODCA 1EJ6A 3ZIAA 3NWOA 4DN6A 4EG6A 3TZKA 2W2KA 3GA0A 1UBHS 1ISMA 1M74A 3FZQA 1MNQA 4OKIA 4TTVA 3U7QA 1XMJA 2KM1A 3BMXA 1G64A 2WSLA 1KY3A 3ZW7A 2TSYB 2Q5EA 3IYLW 3RQIA 2FQ1A 3EWAA 5B7NA 5I4KA 4JGBA 2ZXUA 4KO4S 4NMMA 4OBWA 2Y77A 2BH2A 1ISIA 3BOSA 5LBTA 1H2ZA 5REQB 2ZUEA 3TLGA 4QRHA 4ABTA 2H8GA 2Q1SA 3GFFA 2ZUUA 3I32A 1LBSA 4IIJA 3ZY6A 3BJRA 3RIHA 2UZ1A 4HWRA 4RUKA 1QFSA 1U6KA 4PFQA 4TWZA 4LC1A 4H4DA 1SU8A 3T3EA 4AF6A 2GXAA 2QL9A 1JYFA 4MW6A 3HU5A 4URYR 3RJ9A 5JADA 3NH9A 1G8GA 2R6FA 4ZK6A 2P3QA 1U2GC 3SJAA 4YRBA 2B1QA 1PK7A 4KP7A 4PLFA 3LC2O 3TGLA 1QF7A 4C0LA 1XNGA 2H7YA 2EYQA 2NN3C 4KUHA 3I04M 4RE5A 5BPHA 3LKBA 5IAEA 3SYNA 4ZK2A 3GZ4A 4HZUB 1J8FA 1GZUA 2UYQA 5FNVA 5FXMA 1UFRA 4CWAA 5K8VA 4UVIA 4MB0A 5EXDA 1VHJA 1EVZA 2F1OA 5ANRB 1RWMA 4AP9A 5JANA 5E3IA 2R1TB 2X7JA 1N2JA 2FDCA 2BEUA 3BB3A 1ZJ5A 4B85A 1ENPA 2NUBA 1CF2O 4FFSA 3UMMA 4JLUA 2J9FB 2BM1A 2YFYA 3M9LA 3USES 4O4LA 3GCXA 1NSTA 2PH7A 1EFDN 4ICIA 3UB3A 5B7GA 5C0OE 1NN0A 4N0MA 4Z4GA 1U65A 3VYUB 1QYDA 4RH3A 1N4DA 1DWUA 2Z4RA 3DNFA 1EFTA 1L6RA 1XWIA 2CNBA 5EVJA 1VJCA 5C4IA 1AJEA 3D3EA 4NBLA 3DO6A 2GA9A 4YFYA 4XPZA 3QHQA 3SF8B 2C61A 1MEOA 1WXFA 3A70A 5EINA 5HIMA 1UIMA 3AL0C 3HKEB 3CISA 3VV2A 4QDJA 1T2NA 2D06A 4NLLA 1JMKC 3PUHA 4K9QA 2ZREA 3QI2A 3ORHA 2J07A 2WJHA 4XWGA 3W2IA 1J56A 1O8CA 4DC1A 2JKVA 4PW0A 4H59A 4GI1A 4TWAA 1RHQA 4U6NA 1W35A 4W5NA 1MB0A 3T95A 4IMPA 3K16A 3OZRA 1PD0A 4D80A 5JASA 3CEPB 2O8DA 4JP3A 2WVHA 3JWJA 4XWYA 4IIGA 1H0RA 1P2BA 3L0CA 4I7EA 2JGFA 3T1YB 3WWDA 1ML3A 3HCAA 1W4AA 4WK6A 3UOWA 4DR2B 4UMVA 1XDBA 4LDAA 3P20A 1BCRB 4P54A 3RW9A 5KWSA 1Y3DE 4NL4H 3OP1A 1J00A 4FK8A 4YN3A 4ZALA 1CP3A 3AI2A 4M46A 2BGGA 4RFVA 4FGKA 1TF2A 5K3AA 5FPTA 4OM8A 3IOMA 3O3OB 1J5EB 4ZEOA 5BV7A 2CL6X 5ALHA 3Q4GA 3TLJA 3VC3A 4RETA 1OCEA 1KO7A 2GCPA 4YMGA 4ER5A 2O5VA 3DYVA 2X9QA 5DOZA 3PTLA 3RABA 4US2R 4ZVRA 3LHKA 3NBXX 1V9CA 2CDBA 2HEGA 3FXAA 5FO1A 4PX2A 1TQHA 2BVNA 4WEQA 5A4DA 4TV8B 1ZOOA 3H9GA 2WHPA 2Y8EA 3OUUA 3TMKA 1EP1B 1SXJB 3ENWA 3HABA 1NSYA 1WNTA 2MT9A 2ZIEA 3NTOA 1F8UA 4NQRA 4R83A 5G1OA 2C78A 4C4ZA 1RYDA 4QJ3A 2ZB7A 2Z8ZA 4LZWA 5BVHB 1ULBA 2ZR7A 1ADCA 1RTKA 5CCEA 2HU5A 5FTJA 3KVRA 2JHFA 4GSLA 4G8JA 1D5WA 3BE4A 4JV5B 2VCEA 1I3NA 3HCOA 3PS9A 2A7XA 4MPJA 2DX7A 4UEOA 3TRJA 4IMRA 1DINA 5JNSA 1E1MA 1T13A 3OE5A 2VYFA 1UBRS 5FR1A 2GCIA 3Q3EA 2FQYA 5SYAA 5IVKA 2ZWPA 1Y1RA 4FHDA 4GVPA 1ZNWA 4PTYA 3A11A 2REBA 5F3WB 1KFJB 3OFVA 3RSGA 5CYOA 4QDZA 1E7QA 4Q18A 3UMBA 5AICA 3PVSA 5F98A 2R7AA 1U3DA 3FJOA 1V6AA 4Y6GB 2RGCA 3MOIA 2YBEA 5DV9A 2I66A 3AVTA 3LTEA 5ALIA 1TJYA 4HNHA 4TMVA 1U9IC 1J33A 1Q3KA 3ASZA 4LUCA 4I5DA 5AM0A 3ZXIA 4CLDA 2QYOA 2Y6VA 3IQWA 1AOXA 3RU7A 3DVQX 4CDMA 2VA9A 5KPJA 2I7VA 3DLIA 5JRDS 3HCDA 1WXEA 4WN9A 1SUIA 3E1GA 2VJPA 1IN7A 3H2ZA 5FLEX 3TOXA 1PK8A 2Y3IA 2AJBA 1B3RA 2B1RA 2QT9A 1W581 2WKRA 4HHEA 5IANA 2J3MA 3DDHA 4WI1A 4QOSA 3U7IA 2VTKA 1KAGA 3GNSA 1OWPA 2A4KA 3LT2A 3SNHA 1IDOA 3GCZA 1F0PA 3V7UA 5THXA 2C9BA 4J0IA 1R10A 2O0JA 4H18A 2DR0A 5ECYA 4CMIA 4BDTA 2D4AA 1R66A 3IBSA 1AHHA 1Z7EA 3KAPA 5KQMA 3X1XA 4G86A 2HWKA 3HDYA 4GBGA 1SIUA 4JT9A 1ODLA 1MRNA 2PUJA 3KVYA 1JA1A 3TFWA 1CWUA 2G63A 2ZVDA 6AT1A 4D4KA 4IDFA 2AG8A 1AHNA 1R37A 1Z0FA 2ARKA 2B8EA 2QW1A 5DE3A 5IKOA 2BHSA 4KK3A 5J4LA 1ZJZA 1KWGA 2HCTA 4ENUA 1UF9A 2GF0A 4CKYA 1LXCA 1JHQA 1XLWA 3L5KA 4EPTA 1JFFA 1PQWA 3KWJA 1YL6A 2AHRA 1H3NA 4KLNA 3TS1A 2CSXA 1CZHA 2CFIA 2DPXA 2R97A 3D7NA 1Y5MA 4MGKR 1NHGA 3A4IA 4MUNA 1OU0A 1BFKA 1ZCBA 2QN9A 1O4VA 3M4YA 1S8OA 3PC8C 4M7PA 2HBYA 3FX2A 4M55A 4L0MA 4R2MA 4X6YA 1EGMB 2AJDA 1H2YA 2X41A 4FP9A 4TS9A 5IF9A 4AQYB 3WO0A 3U44B 4B6OA 4LISA 4C6SA 5CLHA 1KMMA 2QK4A 1CYDA 3VNRA 1DI0A 5LDHA 2IOFK 3OT5A 3LIPA 4LDZA 3UICA 4IH1A 3RRZA 1UJBA 4JSYA 1GRVA 3HDJA 1JT9A 3JZMA 4IXMA 1FUEA 3PRHA 1P39A 1V6CA 4JNCA 3U17A 2V9ZA 1SG6A 4NAUA 1EX1A 3I9NA 3N2IA 2O0KA 2GZAA 4J90A 4WX2B 1YB4A 4KWIA 1S3SA 4PCAA 3AJAA 3MUFA 4H4EA 2ZT5A 4R9SA 3PENA 1UKEA 3UA3A 1FXWA 1CB0A 4IMIB 4JR2A 1YVUA 5HFNA 5I9MA 2RK3A 3BFXA 4BO6A 1E2EA 2MTBA 3CKLA 3JARB 4OYYA 2GK3A 2Y9MB 3TTUA 2IRWA 2VPTA 2OILA 3DEJA 3TNLA 4ETWA 1RYMA 1U7XA 3LHSA 4B45A 5KX5F 2IHUA 1DRJA 1OXMA 4CLOB 1OVMA 2J5RA 1RRMA 2ID9A 4YJGA 3NHYA 4JLNA 4RACA 2PAAA 4QVGA 2YZ2A 4P7JA 3RYTC 5EJ4A 4B33A 3OFJA 1E3LA 2EU8A 2Q5QA 3QXSA 2YZNA 4J6FA 3HU2A 3AOEC 1CXZA 4ZYWA 2AK2A 2W6ID 1NW6A 1NQ5A 3DE7X 3N05A 5HF9A 5EHXA 2QYHA 5K7SA 2Z8XA 4I9HA 1E3DA 4MS1A 1FRZA 3KLOA 3O8OB 3EA5A 3JWHA 2GTPA 3I0NA 3B1WA 4QATA 3KWFA 3R3WA 5TXGA 5B58C 1Z6GA 1YMUA 2WUWE 3UK7A 2AIRA 4JY7A 2YRXA 2P77A 3WRXA 5KNBH 4IGAA 4S1NA 2FFQA 3OEHA 1QG4A 3JCZA 3OHSX 4L22A 3L4BA 4L4YA 2M6RA 4JUBA 1I14A 3NQ41 3C45A 4L85A 3VHLB 3WKDA 4EITA 4C2UA 3OJLA 2D1YA 4GLFA 2RGEA 3NALA 5DIZA 2VG8A 2QTLA 3KJIA 4LCBA 1V48A 1M72A 4BZQA 1LK0A 3GW8A 4R7TA 3K70B 2O8VA 4F46A 1NLZA 3A6PC 1H65A 4V03A 5MF6A 3VJMA 2XVZA 3VSEA 4HWGA 3D2CA 1GNLA 1R8QA 4D0SA 1EQ2A 4HLNA 4MPPA 3KFVA 4QXQA 1Z56C 1U2EA 3JVDA 4LYGA 1MD9A 5B1YA 4RS3A 3RC1A 4A6XA 3VHRA 4MVJF 5CPFA 4JX8A 3X1YA 1GPUA 5FOUA 4DE5A 2QP4A 1KR5A 1Z4IA 2G8LA 2QR3A 2VJMA 4XFDA 3QW4B 3ND9A 3WIBA 5LD2C 2UUAB 2HN9A 4LJ4A 1DEXA 4PHCA 5KNDA 5EWJB 4BNTA 1ATZA 3G8DA 3EARA 1HEUA 2ZUTA 2A9QA 4KPUB 1GFIA 2EW2A 2W2LD 2XH8A 4UM9B 3D7LA 5C7YA 5FUMA 3FWPA 1WW2A 4JC8A 4BRUA 4DJTA 5EJEA 2WI8A 1OV4A 2R4QA 2FPPA 2XJ4A 3DP7A 3EGWA 4G8CA 1YZKA 3K1AA 2C4HA 4LRSB 2F3UA 4KQ6A 5DO9A 3AHHA 3H2JA 4IJWA 1I36A 2QZ4A 4HD8A 1GAEO 5KDDA 1XZPA 4B2IA 1KY2A 2FSGA 1WMBA 1KOFA 2RAFA 4HWSA 3KSRA 1BW9A 4U5XA 3OQOA 5LC1A 2GXUA 3WX0A 4DXAA 1YZLA 2OEPA 3EDQA 1ZUWA 4G89A 3GY0A 1I30A 4OSEA 1DOZA 1L7MA 1N8NA 1RAEA 1U1EA 1Y8QB 2ZRMA 2NU8A 4Y2UA 3KUXA 1EZ1A 1B6SA 1MP0A 1J99A 4H1VA 2COUA 2HJSA 2HMAA 2C9ZA 5ITSA 3QPUA 3AVVA 1GG9A 2HRQA 1RMYA 5CGQB 4ARSA 3OCWA 2BGMA 4H6VA 5BOSB 3GGJA 1V25A 5JXWA 3WRYA 1U4SA 4ER6A 2CLIB 1PWZA 3GNTA 1RZVA 5EOVA 3TXAA 1ACLA 2IHJA 2IEAA 4Z3OA 3T5AA 3I34X 2QVLA 3A06A 3MJHA 2QM3A 3AETA 2DYKA 3CLSC 4EFDA 2OOKA 2WTAA 1YS6A 1XAHA 2JK0A 5J59A 5T8KA 3N7AA 2QLNA 4K40A 4CZ2A 4LNHA 2JNWA 1S2NA 3N87A 4NICA 4ZQFA 2GAAA 3ORSA 4QELA 2IEZA 3I9OA 3TKYA 1NXVA 3LU1A 3BGIA 5FPQA 2R8YA 3QVJA 3IDQA 4UEKA 1K92A 2VT6A 3D6FA 3QPVA 1RR6A 2QXYA 2C0CA 1GPNA 3JQAB 3FKQA 2VT7A 3ETJA 1ZOIA 3N8KA 4QPPA 4Q9KA 2WKQA 5KNBD 2VF7A 4Q3BA 3UJ7A 1X42A 1ZD1A 2G0TA 4I2VA 3TIGA 1ZC4A 1Z6PA 2OHXA 4XCXA 5KNCA 3OF5A 2PG3A 4JJFA 4M4SA 2J4FA 3U9TA 4UHEA 4H27A 2I8AA 3Q8XB 1H0HA 3EC2A 4DXDA 1TOAA 1X1AA 3ZDCA 1BXRA 3R09A 5KSOA 1JEDA 2FZKA 3T52A 2W0MA 2CUKA 1E4EB 4QFMA 1U0LA 3L6DA 2OL4A 3TUZC 1N3LA 1YE8A 1YA4A 2ORVA 4XCQA 3S5JA 1CFJA 2EKPA 4CJXA 1XRJA 3M2TA 4XGRA 5FL7A 3ASYA 5A6SA 5CYFA 4AF8A 3WGVA 4OYRA 4YCSA 5F1YA 2VA8A 4CL3A 5BMOA 4JK3A 1OWLA 1DFGA 1L7XA 2GWHA 3EFBA 3G0GA 4B3XA 2A0YA 5NLLA 4D9EA 4HGPA 1OKKA 3HLKA 4ZCSA 3FNRA 2J30A 2GYVA 4S1VA 4MUFA 2RJOA 3VTFA 1ZOLA 2HB6A 2J4DA 2W6CX 4BQPA 5B6JA 2NVUB 4PZAA 2ZOSA 4B43A 4UFPA 5IMSA 4PZCA 1SCKA 5H9VA 4HFRA 3UBTA 3TD6A 4L0DA 3MFYA 3IUEA 1E1DA 4KFCA 3RFXA 4DV0B 5G1NA 3D59A 2EEPA 1T3TA 4OHKA 4BP8A 1CUFA 4TVSA 3BJEA 2JFNA 4QASA 1YC2A 1F2VA 2Z5LA 2X0DA 5ADVA 5ITVA 5FUYA 1AQJA 4F86A 1GZHB 3I1YA 3IVMA 3Q2KA 1RT9A 4LZLA 1D5CA 2ZRIA 5F5NA 1AHPA 2DSTA 1UMDB 4J3JA 1YULA 1S2MA 1XQWA 4LVUA 5T67A 2Q4EA 4WBNB 4CEIA 2XNSA 4G5YA 2GHIA 1BQEA 2P65A 5J4YA 2QW0X 3F5MA 5JCJD 4HEHA 1XL0A 4LV8B 3WMEA 1Q0LA 1W96A 2YZ7A 1XZDA 1QYIA 5EIOA 1VJTA 5D1NA 1C80A 3KUCA 5HZHA 2YXDA 4BUCA 4TRMA 2REQA 1WY5A 3EGDA 4GXQA 2VP5A 3FWKA 1T5BA 4YO8A 4XRGA 3C3EA 2XCTB 2P1RA 5IN4A 3ERCA 3UENA 2UVDA 2H5LA 1Q20A 5JVDF 2XRMA 3H5IA 4G1FA 4AO7A 3UT6A 5MN4A 1XRMA 1W36B 2QBYB 4OX9B 1WD5A 4M9XA 2C1EA 1W47A 1YA8A 3IVAA 2Q0QA 2JLCA 2P69A 1DFIA 3M9XA 5TE9A 3S2EA 2IXEA 2KE5A 5BSKA 5E4TA 1YA6A 3LX5A 1GZ4A 3DMTA 1SXPA 1O5OA 2FW1A 1GV0A 1P62B 1DXHA 3SCZA 2FZGA 1GPBA 3ZBPA 1JPUA 1EB9A 2ENUA 2WTUA 3V33A 4J7CA 4DG5A 2MSEB 1QQ6A 2AQIA 2PVCA 4JI4B 3L18A 3ZR4B 4JBLA 2ZXEA 1VJDA 2CNOA 2H4YA 4MKRA 1BOOA 1V35A 2PLWA 4X41A 5AESA 1JH9A 3CQ9A 2QE7D 1JKMA 3MTJA 5D51S 5HNKA 7ADHA 2GBCA 3CW9A 4AXBA 2QGNA 2GEFA 2Y0EA 3I5UA 3M1IA 3K0FB 5M34A 1J8VA 2WIGA 4BAZA 3CVJA 3RANA 4OK3A 3A6GA 5EJAA 3R7BA 1ES9A 1Z82A 2HADA 4LRUA 4OHBA 4DB2A 1HK7A 2B37A 1M7BA 3QUCA 5CFLA 4C06A 4PBTA 4MAAA 2I87A 4Z53A 2ZRHA 3LY9A 4WZAE 4YJ3F 1HLGA 1AUVA 1KP2A 4YQZA 4PZ9A 1EQAA 1KZ9A 5FP0A 3QW2A 2VUTA 3QTBA 3BSSA 5DHAA 3MQ4A 2WJPA 4KAJA 1IUPA 4HC4A 2Q3CA 4BKPA 3IAFA 5AVXA 1QXSA 2CJWB 4B76A 3LTNC 2VP3A 5F33A 1F20A 1H8HD 1HE2A 4PR3A 1C1HA 4WUTA 1IHOA 3O4GA 4AO6A 4JHLA 1YJ8A 3OAAA 2NXWA 3TAHA 3VVMA 4DA4A 2GZDA 1VCMA 3OC6A 4IILA 4J0DA 4F38A 1Z38A 4LS3A 1XMOB 2IDMA 4GZ5A 2DH6A 2WM3A 3MJTA 4BRSA 1L5NA 3VO8A 3A4MA 1M6NA 4M3NA 3H9QA 4QUDA 5FA8A 2VZEA 5HFJA 3ZDDA 4IDOA 1QV7A 2WE8A 4IOJA 4R1MA 3PJRA 3NDBB 1BDJA 2PX6A 4XH9B 5FKJA 4D4GA 3T9DA 1TZBA 2WQ6A 4Q7QA 4PIMA 5J2UB 3LT4A 3EISA 1M2EA 2C07A 4OL0A 3U40A 4R0VA 1AV6A 5CVCA 4ENRA 5LLTA 3B38A 1RQ2A 2HJWA 3L93A 3WMGA 2BR5A 1FUUA 2QX9A 1B0PA 3E8XA 3GH3A 2WQZA 4CLXA 1UEXC 2YCBA 3B1YA 1FJXA 1ECGA 1U4NA 3D5EA 3A9UA 4IKEA 1A1VA 2Q2NA 3DMFA 3IHTA 4IR7A 1CUXA 5HZMA 2UZ4A 4P1ZA 3K73O 3PNPA 4PBRA 4YUWA 3BUSA 1UADA 1JR3E 2VQDA 1XA0A 4JFAA 2F67A 5BN5B 1FP1D 5H70A 3BSYA 2YBDA 1T8PA 5G40A 4NBKA 3PHIA 4Y9TA 4X1IB 5EP4A 3GXOA 2JGDA 1XF9A 2XYGA 3VI4B 4EPXA 3H75A 3O8RA 4G0XA 2G67A 1X3LA 3ZZNA 3CONA 3RHZA 1Y34E 2E9SA 4HFMA 2NV2B 4M9SA 1EM8B 4S1TA 3LQYA 1T9GR 2Q1TA 4L27A 4KSBA 4TQAA 2YQ4A 4IG4A 5MFPA 2H4ZA 1KPGA 3RGGA 2RJNA 1ZK1A 2VJLA 3FYCA 3ZI4A 3Q3GE 3QF4A 3ZHYA 1LNZA 2Q1UA 1L1RA 4N47A 1AKVA 1XPUA 1C30A 1L7OA 3G8BA 3AESA 1K8ZB 1PBNA 1PI3A 1UOQA 4F4FA 1S8FA 1NR7A 2DUMA 1JXMA 2ZIVB 4DPMA 2QTGA 2PL3A 1GUZA 3CSUA 4Q6WA 4WNAB 4BNJA 5LPNA 1V45E 1F17A 2A6PA 4DLPA 4JR0A 2YZMA 5IXSA 5A3SA 5YASA 2JAWA 5AXAA 1RHJA 4DLAA 3WGYA 5IN5A 5C1BA 3GPIA 1Y48E 3AZPA 1L5ZA 3QOWA 4G81A 4L02A 3Q41A 2PRSA 4RJJA 3IQZA 4AVYA 3ZC3A 4AURA 5LNK1 1F0YA 3EA0A 3H8VA 1FNNA 1HQYE 1O4WA 3GOHA 4LVCA 1FMFA 3WHPA 2GJSA 1K2WA 4CG0A 5CLQA 4LOIA 1GDTA 2NUTA 3I05A 4O0LA 4BNYA 5F3DA 1DX9A 1X92A 3PQFA 3H2HA 1GL6A 3H8SA 3CPEA 3LXUX 1UMCA 4P5PA 4WINA 3RVKA 3ZZUA 5HJEA 4REMA 1RACA 4DV1B 2P62A 2GAFA 3P9KA 3T3IA 4X66B 2AD1A 2PYIA 1CUGA 1D9ZA 4E1AA 1G6Q1 5HPYB 4CHGA 4AYWA 3S2GA 2QJRA 5E2BA 3ZYZA 4JI8B 1P5RA 3E82A 1JTVA 4FMDB 4G9BA 4EHIA 3H86A 5E6UA 4D02A 1XMSA 4YLEA 1R6UA 3I6MA 4FSXA 3VFDA 4D0LB 4F9TA 4RPJA 3AKZA 2O50A 5ARBA 3V8QA 3B5EA 3R5HA 2WBLC 3LD9A 4UUOA 2M9MA 3HVKA 3K9HA 4EI9A 5I3ZA 2QTRA 4J49A 1XZEA 1X80B 3JAKA 2NYUA 3ZEAA 2BEKA 2WYHA 3F6CA 2I3DA 1SY7A 5EWMB 4DDTA 1AH2A 3QWIA 1DS6A 3P2EA 4GUAA 4O4HA 2WINI 2W2QA 3F46A 4HMPA 5H4HA 2JCBA 4CEHA 4YNBA 3AUUA 5HQ3A 1QHHA 2V7GA 3IMGA 3MJ4A 2HK6A 4TN1A 3W9YA 2YYYA 5BWOA 4OK5A 4PSVA 4UTRA 2PZLA 1BXKA 2KMLA 1ZNYA 3MCZA 3SP1A 2VEDA 3GJSA 1Z5UA 1LRLA 2XSZA 5JAZA 3MSXA 1E8MA 3IALA 3FETA 3QWAA 2CVPA 4P7KA 3RFVA 3V4FA 3VR3D 5GIOE 3ESXA 4L0QA 3GLFB 2WOJA 3IPCA 2C54A 5KYUA 2ZJ1A 4EVRA 5U4XA 4YB8A 1Z7BA 4QODA 3MTQA 1YZTA 1J5PA 3ENQA 4XOUA 4YAGA 5KVSA 2F55A 4KAFA 4JA2A 1GGNA 1Z25A 2IKSA 2W6OA 3KJEA 4PTZA 4JLOA 2BFWA 3V8RA 4B35A 1ZHHA 1JN0A 1YJ5A 5IW8A 4Y9UA 1WE2A 4O3MA 3RFFA 3OLXA 1DKQA 1EX9A 2JFQA 4BKOA 3O83A 3CZ9A 4D25A 1OU4A 4CKCA 1IZ9A 2C97A 1Z7WA 5DGIA 5BR8B 2AH5A 3REQA 1IN6A 1N2BA 4Q9NA 5CFPA 1Z45A 1DSSG 2O2ZA 1Y6GA 4XD2A 5GONF 3ZU2A 1USUA 4IQ8A 4FMBB 1NX6A 1OBFO 3L1HA 4UBLA 3U7EB 3WLFA 3EXHB 2ZPAA 3STYA 4DCTA 1TJ3A 2WF5A 4AUKA 1BROA 3ZGVA 2OBFA 1TM2A 2PXAA 3TK1A 8OHMA 4HH3C 1QFMA 3OF2A 4EB6B 3OMXA 3O38A 4W5OA 5J40A 2P4EA 3OEEA 2P2ZA 3ISJA 1SVNA 4JI3B 3EZ7A 1M67A 4WDRA 4YCAA 1KDYA 1H5UA 2ZSAA 4UAGA 3TRDA 1CK4A 2BCEA 3DXXA 5LMZA 3AR9A 5FLXA 4ZA2A 2X3YA 3H4VA 2OGUA 4PTLA 2UYCA 3ANYB 2Q21A 5FWYB 4C0AC 4LF9B 5LA6F 2DLDA 3IURA 4TUYA 1LTKA 1C29B 2X8JA 3DXZA 1WEHA 3WLEA 4Y7CA 5DN6D 5FOWA 1WZUA 2CXSA 3Q5EA 4LHYA 1Y5IA 2NU7B 5EUQB 5SY9A 4A91A 3HHEA 3PEWA 2XMRA 1TL7C 5FD8A 1H6CA 1JA9A 2BDEA 4AZ3B 3RG8A 1HSOA 2OO3A 3TRFA 2OWDA 1X3SA 1QNLA 5DLEA 3SXJA 1UM8A 4RVDA 4JBNA 3HO8A 4ESOA 2BKAA 1DP4A 1JG2A 4H6PA 4I19A 3JQBC 1T5SA 2GM3A 4HUJA 4IW3B 5C80A 3BX1A 4ZVLA 3E70C 3E4DA 1TEXA 1XLTA 1SZCA 3FI9A 3TW8A 4OLAA 2UXBB 3SZLA 1NDQA 2FJPA 1MBZA 3KSZO 2W6NA 2Q29A 4YUVA 3EXEA 4N40A 3TLKA 4Z8YA 2ES4A 2DPGA 1HKHA 4F2GA 1TZ2A 3SZMA 1TB4A 5AWFC 1D7AA 1HMYA 4J0EA 4NU6A 4W1SA 1GZDA 1VRVA 2JH3A 3KG2A 3Q7PA 4LC0A 2C9DA 1E2MA 2RKWA 1N9GB 4AULA 3WA6A 1OR8A 1MA3A 2IELA 1L4UA 4O4JB 1WF6A 1SZJG 2L2QA 2FWPA 5EMMA 4YT5A 3N2LA 5I5EA 1PV1A 3DOIA 3S2UA 5IF3A 2GN1A 2Q8PA 3OM9A 1K7FB 4DZRA 4B3RB 3OOEA 5D6OA 1AA6A 4B74A 1YJAA 4FNAA 4B3IA 2EFHB 2ZAOA 1TQDA 4GI5A 3SS7X 1TMOA 2XWQA 2UDPA 5B6PA 2L42A 3T99A 1ZR4A 2JS7A 2AUTA 2JEYA 3P9YA 1E5TA 3V46A 5ILGA 3PE6A 3TLEA 4EJ0A 5I3CA 1FFBA 2VC2B 1K66A 5DK4A 4A6EA 4M22A 3RSHA 5AKXA 2CLKB 4DSTA 5HE9A 1GYQA 3IEXA 3THOA 2ICAA 4UFOA 1WZNA 3LM8A 3NHPA 3NUGA 1VTKA 3ZTTA 5AW9A 4TT8A 2IVZA 5FBQB 3CN9A 2Q4DA 1E4VA 1C3OA 2EJCA 3QKSA 3SIXA 1O2DA 3TPCA 1AQLA 2H5EA 2EHJA 1QH8A 2KB0A 1Y4ZA 1BGWA 2AKEA 4U0JA 3P32A 2PSHA 4JYBA 4J0FA 3RLIA 4M1ZA 1GQQA 4KN6A 1ECFA 1ZFNA 3JYNA 4MXDA 4OVKA 2QKYA 1XEXB 3D5TA 2D8MA 5C8YF 1CQWA 3T5TA 4RCYA 2H0RA 4PXAA 4QXRA 3V00A 2W7TA 2FSHA 3LFTA 1OLXB 1XD2B 4I3GA 1NVVQ 3S1AA 4DLLA 5HILA 1F2TA 2FCRA 5AUOB 1OH8A 2XB2A 2V74B 3DZIA 1RYYA 1DC6A 1UBUS 1YR9A 3IS3A 1A9RA 1S02A 3A2MA 3W05A 5GADl 3RS3A 3I01M 2ZYWX 1KJYA 1YR3A 1VFNA 5LLDA 1V8BA 1AXEA 2GVZC 1TIKA 2CXXA 5G2OA 5IAOA 2R4UA 5K2OA 4AX8A 2JLBA 4QECA 1W52X 3N3BC 4HT3B 2FMKA 3RIYA 3ZE8A 4ZQEA 2I1QA 3CG4A 3O8NA 1M8KA 3OPVA 3DDNA 3FOBA 5JXIA 3V1UA 5E9WA 4GVLA 3H11A 2NACA 1USKA 2QRNA 3E2IA 3FHJA 4FZJA 1O3YA 1GN8A 3GFVA 4OQYA 1L8QA 3EJ6A 4NBNA 3S70A 1XQ9A 3EFHA 1HSZA 5B2ZA 1ONPA 5KJCA 2NP7A 4GYJA 1W75A 3C6KA 4ZKEA 3IJPA 2HDOA 3AJ8A 3EQ9A 2WU4A 1R0RE 4HQFA 4UBOA 4CKBA 1Y5RA 2RI1A 3HKBB 4OXRA 2H5IA 1V5EA 4PC6A 4RJ2A 1L9KA 4EWLA 1SXJD 1J0BA 3CY6A 3E6AA 2F90A 3DG9A 2EVWX 1YZUA 2V65A 2Y1KA 5TQ0B 5JLJA 3FTEA 2FUEA 4MRPA 5CM8B 3DEKA 3F9CA 3LV8A 4H7HA 4EYEA 4ZV7A 2ACKA 3OSZA 2JBAA 4O3FA 5LP6F 3L7AA 2YY7A 1C7IA 3N0WA 3LVFO 2I29A 1GNVA 2PV7A 4DAOA 2HA6A 3F3YA 2UUCB 4AMVA 5FYDA 3OCUA 2X7HA 3UFXA 4YT2A 3HN2A 4ZHQB 5GZ1A 1JR6A 2F7SA 2PRKA 4HDMA 5BNTA 3KZMA 1AUPA 3GPCA 5K9ZA 4K3UA 1XKQA 1V2GA 2XCIA 2YIMA 2ZJYA 4LBVA 1BX1A 1CQXA 1E7WA 4AS3A 4D3XA 3IOYA 1W30A 2M6LA 3SFTA 1V37A 2OY0A 4E5SA 2DQZA 5KVVA 4ENSA 2WUVA 3U16A 3BFVA 1PEDA 1MIOA 1CNEA 3Q6NA 3WGLA 2O7QA 1EFKA 3E18A 4JNKA 1BX3A 3IV9A 4CG1A 1B7GO 3INYA 4UMEA 5AXBA 2H1OA 5CM9C 2LP4Y 3C85A 1Z2CA 4I6EA 4KIUA 1M66A 3GRRA 4HQKA 4MLCA 4OHMA 5FLYA 3L1UA 2JRCA 5EY5B 3WV4A 1A69A 1OFVA 3CIFA 4LJKA 1H2HA 3F3KA 2WSSA 3GRZA 4QOFA 3LK6A 2ST1A 5BR7A 4B40A 2AMVA 2E5FA 2H1CA 2QW8A 2EL9A 3ANTA 4F21A 1N6HA 4KYIB 2XQFA 1JSLA 3JRNA 3QPWA 4X8OA 1ISPA 4ZAGA 2GYWA 5LQKA 1LLCA 4RS4A 3A6LA 1WKVA 4WFQA 2P6UA 4DY6A 3LDUA 1QDEA 1JKIA 3V7YA 2BOVA 2DWCA 4PGGA 3ENKA 1JKXA 2O1XA 1PFGA 2I1VB 2YN0A 3TNJA 4Y1GA 2ZE8A 3IDZA 4ZJZA 2DWOA 3JD2A 5CDGA 1JXQA 1E5QA 3Q6MA 4ZDWA 1B23P 4PM4A 1MQAA 2AOUB 3H83A 3IOCA 1EFVA 4N0QA 1RE1A 4KSCA 5TVGA 3LIIA 3MWYW 5AD1A 2W71A 5JD3A 2BTQA 3VTKA 1B0UA 3ANLA 4W6ZA 4EVSA 1CUVA 1PYDA 1HZJA 4K6KA 4EOGA 2CJXA 3I5XA 4BXOA 3TQTA 1PJ4A 4JMPA 1QKJA 4JAVC 4Q3CA 5D3KA 5FWAA 3NBAA 4J3NA 1ODIA 2FB9A 4UCXA 4A0HA 1IQUA 1K7SN 3R9IA 2P6MA 4B82A 2C5BA 3KVOA 3A6EA 4LY0A 4TKLA 4NBWA 4RY0A 1TW3A 4Q00A 4NEGA 3U3XA 4MR9B 1IN8A 4TV8F 2GZRA 3R9KA 2YVLA 3H42B 4OJQA 1W59A 2G1KA 4HKTA 1IY1A 4IDDA 4V0ME 2I3BA 1EJ0A 3KAJA 3LP5A 3VO2A 1U1IA 4DHWA 1QRTA 2IBMA 1DO2A 4E08A 2OZLA 3AUXA 4U0KA 3ZD9A 2ZJ5A 3EFOA 5KYYA 4QYIA 1Y8AA 3N53A 5DT2A 2C1ZA 3WAKA 4B83A 4YRNA 5BN4A 2CZGA 1NVXQ 3D02A 4MITA 3PTAA 5K0EA 1K3FA 1R0SA 4L78A 4JLPA 1IEVA 1KEPA 1JBEA 1N92A 4GNRA 3AEUA 4MS4B 4MRSA 5AO9A 4A0GA 4AJLA 1C41A 3SZOA 5B57C 4UTOA 3GWZA 3HSSA 1Z47A 1I6WA 2BPOA 4TYQA 2YWCA 1LDBA 3KYCB 1RE0A 1WD7A 3DKPA 4INZA 3BJZA 2FFBA 2I34A 3G23A 5E9JA 3IT2A 4FLEA 5F2KA 5FEMA 4BPRA 5JAHA 1KFBB 4GYWA 2ZS7A 2PBZA 2YJ6A 4IYJA 2G1PA 2FQXA 3N7TA 4RADA 2O7RA 2W4QA 1ZBQA 1KMIY 1M9NA 2H08A 1M8PA 2QMEA 3NAGA 4G26A 4Z9XA 1GWNA 3ZHZA 4KQXA 1QQTA 4U9IS 2I3ZA 2QUAA 2C96A 4NBVA 1AXGA 3A6DA 3CH7A 1KJQA 2NM0A 3D8UA 3HFGA 1TGYA 1A76A 3NC1C 1OLUB 2XDQB 1E1QD 2QTVA 3MMNA 3MTBA 4L5CA 3RJMA 2HSGA 4CETA 4B7CA 1R4ZA 4KRGA 3MWDB 4FHEA 3C8MA 1JQJC 1KO8A 4UCFA 3ROXA 4XGQA 1D2GA 2FP4B 4C0SA 4MVJP 2QJWA 4G97A 4HAVA 2M6SA 4R40A 4EQ6B 3Q3HA 4XSGA 2TMGA 3LWNA 2AKAB 3RBXA 1WMAA 1E3WB 3IAS6 4XSHA 3QE0A 5TY0A 2XIJA 4O2LA 3KWLA 1D6MA 2HI0A 3CYFA 1BHSA 4LY9A 4R9NA 4P36A 621PA 1LQTA 4TLEA 1E2BA 2BH9A 4C0JA 1TTHA 4NCXA 2VS1A 2YRFA 4K3VA 3UXEA 1FUYB 1RYNA 3E48A 1M75A 3ILXA 2E4VA 1YKFA 3ILSA 3MF4A 1DCFA 1NJFA 1JQAA 1RNLA 1DAGA 2OAP1 5BUQA 4LC9A 3RIGA 5HQTA 3CPSA 3M4JA 4H2DA 2YYAA 4IH9A 4NR0A 2AXPA 4ALKA 4BNFA 2J7PD 1WLSA 1QIGA 4J4TA 4LV5B 4PG6A 3U3MA 1V1MA 2R00A 4CF7A 3AJDA 2A92A 3KTFA 3V3KA 4Q21A 3SU8A 2R47A 5HOQA 3JQ7A 4D9KA 3RVMA 2ZSIA 3UJ3X 3VZRA 2GPTA 2VQSA 1KU0A 2MWMA 1M8FA 2Q27A 4IRMA 3ZGXA 1BS1A 4CM4A 1GQ2A 2DY0A 4CMJA 2JAHA 3HS3A 4F3NA 3NWJA 3DBLB 3GRCA 1XCLA 1KSGA 4JLMA 1VL1A 5FV7A 3W1WA 3R0JA 3RRNA 4U02A 2QRGA 3PR1A 1N5MA 4FFPA 4Z0NA 3BRWD 3KZOA 4M7WA 3C74A 3QVKA 1LCIA 1GRCA 4FR0A 5FOQA 5IX8A 2CXOA 1JQBA 3C3PA 2NGRA 5H1YA 1KO4A 4ZCIA 3VKGA 2CNWA 1KOLA 3PPIA 2OFOA 2GF9A 2Q3DA 4D74A 4NFLA 2FMIA 3SIPA 3WLPA 1Q7EA 2PV0A 4PFSA 4Q0MA 4ZOAA 5DU2A 5A4JA 2P2YA 4IFEA 3KJQA 4KFUA 2AFIA 3K70C 4NY1A 3C1UA 5F3RA 3H0EA 2OHOA 1MVLA 1SG0A 4FFRA 1J9EA 4QYSA 3RUHA 1P2GA 2VPPA 1USGA 1FX0B 2IDJA 3KO8A 1J97A 2BR3A 1GUBA 3NT5A 5EWLA 2CXPA 4BUZA 4CR6A 5H16A 3CX3A 2C00A 3PSAA 3OX4A 1C0EA 5JRZA 3EEIA 4JLDA 5FBVB 2OV6A 1DBSA 1R6VA 2P9BA 3O93A 1F8XA 5LQAA 3W5AA 2NYRA 3G8AA 4QXOA 2PZAA 3EA4A 3S0JA 4PPFA 1PFUA 5E7JA 4GGMX 1UZUA 3ZV7A 2ZZMA 3PBKA 5DSXA 1KYIA 1U7DA 4IFTA 1VI2A 3GF4A 4QTXA 1VLQA 1OTYA 2JJMA 4F06A 1KQPA 1EBFA 1F8GA 3CLUC 2EOAA 4UE3S 4W8GA 4CDGA 5M04A 3BCSA 3HDGA 1J39A 2H1SA 2UKDA 4ZRDA 4X62B 1ZUHA 1MG5A 2HFJA 5C1OA 5HM8A 3HQ4O 2R87A 3CRQA 2JJ2D 4TQUS 1NUUA 4K9KA 3W4IA 4AF7A 1HLDA 3CJTA 5JE8A 3K8YA 1U5BA 1U8TA 2EERA 3AM3A 1G18A 3AVPA 4FSDA 2VK8A 1OGYA 3V8BA 5JOQA 2WAOA 2CNNA 4E88A 3IKJA 1MENA 3O7WA 4M0CA 1O96A 4O2AF 4Y2RA 2VDJA 5CRIA 5T3YA 4DEYA 3W3AA 5FEUA 2E49A 4RESA 1KJIA 1T8UA 3UUFA 2QZZA 1WABA 3IQIX 1R1DA 2ZDGA 4AG5A 4E31A 4PNPA 3IOEA 1IVYA 4N65A 3B3AA 1H2XA 1O9GA 1U90A 4H08A 2IYOA 4MS3B 5FCDA 1ZRMA 4UQOA 4B80A 4CIYA 1KJWA 2XUGA 1EDBA 3INGA 3OM1A 3U0BA 3ILYA 2QUBA 4JJGA 2EJBA 1OBOA 4R5MA 4B73A 4X6UA 4BV2A 3CVVA 3WK5A 5BN3B 1M8GA 1FC0A 1MB4A 4N82A 3CF2A 3WYCA 2W2MA 1ADFA 3TTYA 2CDAA 3KKKA 3DV0A 4ZCRA 2B1GA 3VX3A 4WVLA 2GZ3A 4QYXA 5P21A 4ZCTA 1UPTA 1O1YA 2YY6A 5CU7A 5A7GA 2Y66A 4I4NA 3PL5A 1D1PA 1WR8A 2WPNA 4FCTA 4LE1A 5ETJA 4DM3A 1J1UA 5GZ3A 2XA1A 3BMQA 4XYMA 3LUKA 3ME5A 1T8RA 3QOFA 4KN9S 3ZDXB 2OG2A 4EGJA 1PEYA 1HT1E 4TSFD 3JSAA 1NWCA 4WCFB 3TW4A 3WBFA 3J80A 3ZBQA 3L6CA 4G1VA 1B8OA 1SK8A 2RGWA 3IBYA 3ELBA 1M7GA 2JEOA 2R44A 2W6PA 3DPIA 3P0EA 1HT0A 1NXOA 3Q9SA 3ZJVA 1H1DA 4ZAFA 2X0KA 4G0ZA 1T8WA 4N5LA 2DQ4A 4ND2A 2XNJA 3NWBA 4QDXA 1DIOB 3LUAA 2OOSA 4LG1A 1OBVA 1T3GA 4NCIA 5K8UA 4BNDA 4LNUB 5AHOA 3K9BA 4ZVKA 3PA8A 2WWIA 1OPXA 1M83A 2R6ZA 5BURA 4NCHA 2VR1A 1OXSC 3GHYA 3M4NA 3WLRA 5C53B 4CMEC 1X7HA 2NT3A 5U4QA 5KX5A 3OIDA 3DZFA 3O47A 1X7XA 1NN1A 1H2AS 4NS1A 4QGBA 4GSKA 1X39A 1M2VA 2AYZA 1RXSA 3VR6H 2J3KA 1J0EA 1MRZA 3MEQA 5M5BA 4NFHA 1EEXB 5IT9A 2D5AA 3L01A 3Q10A 2GSDA 3Q8WA 1XDGA 3LLSA 1I24A 2AZDA 3AJRA 1OD6A 4X7MA 1N36B 2QLMA 1OTHA 3KTAA 3R0XA 1U04A 4CBVA 5AJVB 2R3SA 4OUKX 4DJAA 2YASA 1QIDA 2Z6UA 4CL8A 2WSMA 3HFRA 4GR9A 1DKRA 1T1GA 2RBGA 4M9CA 4CNQA 3KQYA 1U2DC 3D7KA 3R3XA 3RYIA 1T91A 2I2FA 5A05A 2AEEA 1PJQA 4LXXA 1W88B 4CQMA 2KHZA 2B35A 1SG9A 1XMXA 2JJYA 3EJWA 2B98A 1OFUA 4TL7A 5KWJA 2WM8A 3CNNA 4G65A 2G7ZA 4C0WA 3FFXA 1IBLB 3ZDAA 2HWYA 2ZSUA 4OHUA 1HGXA 4GPD1 4OKSA 4OPMA 3DWIA 3L4KA 2XECA 1CQIA 4A6PA 2BTEA 3VZBA 1UMKA 2XF8A 2ORWA 1V8PA 4CIWA 5IULC 3SJCA 3FNBA 2P41A 1LW7A 3DZ8A 2F1KA 3ADBA 3PX2A 3RYCA 3TLXA 1LK5A 4BQOA 2ZM5A 2ZCJA 2GTIA 3DEFA 2BHRA 2F3TA 3R5KA 4YWHA 4B32A 2DM6A 2HQSA 3LQ1A 4BBZA 4QSHA 2Q6OA 1Y8ZA 2I7DA 5A7HA 1VIYA 1XAGA 1PT8A 1G42A 3KIPA 3PUXA 2GD2A 1A3CA 1ZG3A 1IG3A 5K1ZA 3DT8A 1SXGA 1WSAA 2EW8A 3QFRA 2OVBA 4ETNA 4YRCA 5KOHB 1RU3A 1X1BA 1SVOA 2PA0A 3C98A 4JL5A 4N8SA 2Z6AA 3GMDA 5DCYA 2G07A 3ITKA 3ZNOA 3F96A 5ER9A 1N7JA 4ECEA 3FSEA 1W36C 5JBIA 4Z1MA 4DA7A 1A2KC 4AK9A 1US8A 4WLOA 4Y2SA 3PXDA 2OO5A 1J2EA 1O5IA 3PVCA 3EH2A 1N0UA 4RZUA 1XHEA 2I80A 3A6JA 3Q98A 4BEVA 1TKAA 4MVYA 4BMDA 3HO6A 1PQUA 4MV9A 3H1FA 4EQZA 4Y9RA 5CFMA 5JD6A 2COKA 1NP3A 4CHTA 1NMYA 3WFIA 1GRQA 1KY4A 4P93A 5HCUA 2NYVA 4WBNF 4M9ZA 1I2BA 3KOUA 3RAFC 2ATXA 2JLQA 1IG0A 3V9PA 4G5GA 1JDSA 3OA2A 1YI0A 1LGYA 3PC6A 5EZYF 3T0FA 3V6LA 1W9HA 1NULA 2N47A 1FDIA 2UXDB 1F0NA 1TJ5A 3KR9A 4R3WA 2XBUA 2HA3A 3IAM1 4C3UA 2WSBA 3FLEA 4D9HA 1Q57A 3ONNA 3L8GA 4N3BA 3SC2A 2YZGA 5H0IA 4J07A 2CJFA 3VPCA 1ODKA 5K8LA 5KDOA 1CEXA 2PSSA 5KWIA 1N32B 4Y0NA 2FZWA 1W94A 2A0FA 2POQX 4KLAA 3GGSA 3ZS8A 1D8TA 5JATA 3E5HA 3P0RA 3VR6D 4U9UA 2BSQA 1U1FA 3DCYA 4DJFC 1SOVA 2O07A 4ZYUA 1UM9A 1ZLXA 2NZUG 3VZQA 1ANKA 1ZD5A 1WW8A 2LCFA 2AW5A 1ZIDA 2HGSA 1FNBA 2IU6A 1YL5A 2RAPA 2WYOA 1U5AA 1W0KA 1I7QB 2J85A 5TS3A 4C7KA 1JU4A 3RWMB 2Z08A 3T8YA 2ZTVA 3JATB 3S1SA 4E5NA 5L7TA 5BW4A 1OIVA 1IUKA 3D4OA 5HE8A 3VZPA 4K2AA 2FJUA 2PS1A 4OU4A 2Z5GA 4QQRA 1KBZA 1P5JA 1RXCA 5AXCA 4CEHB 4EECA 4E1VA 1E92A 3O74A 4MLZA 4RX1A 3UAGA 4LZJA 3BCRA 5K01A 1WMSA 1L5QA 4RVCA 4RJLA 2R48A 3A26A 4QUJA 3UH1A 4RD2A 1EFCA 4OB7A 5DASA 4AJ1A 4ZO7A 5I7AA 1ND5A 1BJKA 1HL3A 1ZXLA 4JYCA 5GM2A 4QQ8A 4ZFNA 2HMTA 3NUQA 1GU7A 2QJOA 4YJ2B 4QUEA 1TVEA 1Y5NA 4GC9A 3ZHBA 1WTCA 4BFXA 5K05A 5KJ6A 3SQXA 2K87A 4GM4A 2BY4A 1U1DA 1SBCA 3NRBA 3RUEA 2CLSA 3WIEA 1K8RA 3RE1A 3VR2A 2ILTA 2P5YA 3TAUA 1NI4B 1VHQA 3Q6IA 1UQTA 3OQPA 4L5AA 1MNAA 2QMUA 4E5YA 1Z16A 1I4LD 2PEZA 4O8ZA 1JHYA 4FVTA 1JKFA 1FFSA 2F9FA 3GFSA 2VDLB 2XAUA 4EUKA 5JFOA 1XJ5A 3L46A 1G59A 4DIFA 3UPDA 2UAGA 3C7KA 4TLMB 1TVCA 4R8RA 4M8NE 1QBKC 2WWHA 4KVGA 5BPFA 1YRWA 3AEQB 4KRXA 1E2UA 3BMOB 3P9PA 1EK1A 1K89A 3FMOB 2WHEA 4HUQA 4G4IA 5AXDA 1E58A 4MUIA 4POOA 4QBHA 3EDMA 3VKVA 1AC5A 5HKKD 4P5EA 3RS0A 3QLTA 2VPXA 1REQB 4YDSA 1IJFA 2MR6A 1EK0A 4LY6A 4OHPA 5A02A 4O4IF 2VQFB 1PLLA 1CUZA 2HQBA 2Q07A 1SVIA 3MWLA 3T5DA 3TYXA 1ZNQO 3UAYA 4YMLA 2FQQA 5MN5A 2QDXA 3S1LA 5JXGA 1VE1A 2CF5A 3EWIA 1LBQA 3LY5A 3EQ2A 5J47A 1N6NA 2C82A 4ZAXA 3RR2A 1LDYA 3ZI7A 1BWSA 3PR3A 4JS0A 2GAJA 3RU2A 1W87A 2HYDA 3DYBA 4YX9A 4ND8A 2CE2X 2J3DA 2WD7B 3F8WA 1GA6A 1PJZA 3KT3A 5J5AA 3D3QA 4ILEA 2QI9C 4AJOA 1P3DA 4B4DA 2VN8A 3ETLA 4DWWA 4MWTA 5JVDA 2VNIA 1NW9B 3IGFA 1NFRA 3KYIB 3HV0A 4KWCA 5E1BA 3SF0A 1GYRA 3P52A 4N4AA 4PXSA 3SXUA 1IIBA 2G9QA 2XD4A 3C3KA 1A8IA 3CBQA 4B84A 2Z58A 1GUAA 1U2RA 2WD9A 3MFQA 1J09A 1KJ9A 3D4LA 2PLNA 4U7FA 2QN1A 1VMAA 1ZIYA 1TVMA 2NNWB 3F49S 3GJXC 4MP3A 4NJMB 1P5HA 1CEQA 2RI6A 1JAIA 4NOMA 3M6AA 3C8HA 2EW1A 3HK2A 4DLUA 4I4CA 5F51A 4YRGA 4OQEA 1JSZA 1OB2A 2W0SA 3K1JA 3ZJ4A 2AT1A 4C43A 1TQ2A 3PLAE 1VBNA 1TZKA 4FW8A 4HADA 1NKTA 1YQEA 2H18A 1C50A 4G37A 4KQCA 4A8JA 5EEHA 3AT1A 5ELLA 4EA6A 1J70A 4EHHA 1G5QA 2QI9F 1W1WA 3U4CA 4QDTA 1FNSA 1V3TA 3LUGA 3GRFA 1R8XA 2DUNA 3WP0A 3BWCA 3JYQA 1N6LA 4CRWB 4YJ3A 2Z04A 5IAGA 4IM7A 4NPCA 2IOYA 2O8BB 1PL8A 2D4HA 2JJ1A 1PZHA 3IVCA 1L3CA 2ZRGA 4WOBA 1AXRA 3HWWA 1YBFA 2LPMA 3OJOA 1JVSA 2D2IA 1C7EA 1XXHB 3RARA 4TYWA 4B4KA 4ES6A 4UDXX 1J9GA 2L17A 4LF4B 1YIDA 5CT5A 1XNHA 2W2KB 1GLVA 3ZE7A 1YR2A 3U7QB 4YAIA 4N5IX 3M7IA 1GADO 1QMGA 3LGSA 4LDJA 2D0IA 4YJFA 5A5FA 4C4RA 2Q6VA 3AVUA 4XM2A 2ZBPA 4U2BA 4UZSA 3P26A 2H0AA 4NU8X 4YRIA 4KQWA 4OUDA 3TLGB 3IBTA 4CXMA 4B5KA 3EH1A 5TMBA 1ZGZA 1CD5A 1LFDB 2FN9A 3HA7A 5L4NA 2L69A 4IIJB 5IU6A 1WULS 2H5JA 1RI4A 1KYVA 2UZ1B 1TD1A 3PZRA 1DC5A 4TMFA 4V39A 1MH1A 1RCFA 2FW9A 2J1LA 1ECJA 4U2EA 1W9MA 2XKJE 3PNLA 4YQFA 4WOCA 1A96A 4EZIA 3B1VA 1Q92A 3VDMA 1XP8A 1RW4A 3F98A 4OAQA 3JTEA 2VDPB 3T7AA 4BCCA 3FTFA 4QG7A 4GM1A 1P2TA 1W5EA 2RH5A 1DLJA 1EFUA 1GCAA 1QP8A 2IPLA 3A1DA 1VE9A 2VJNA 1E3SA 2CW5A 3HPQA 1DAOA 1GN9A 4HG2A 4ND6A 3WYDA 1YDMA 3ZGNA 4Q4JA 2JEZA 4A03A 4ZMSA 1T26A 1WXXA 2QY6A 5JCPA 2BEUB 1N6PA 1NMXA 2EV9A 3LCCA 4PRYA 2HUNA 3OEWA 2C2KA 3SC4A 3R75A 5K4GA 3IJRA 1WDTA 3PPXA 5DBGA 4O4LB 5AVJA 1Q1NA 1QFZA 3DQZA 3F6RA 4BFUA 2GJ8A 4XQ9A 1GV1A 3D8BA 1U3GA 4G1EB 3ZK9A 4O2BF 2XZTA 1NNUA 2GZHA 2OB2A 1L7AA 1QM5A 4OQZA 5T64A 4C1NA 1I01A 1CUEA 3EOBI 3U3DA 1JDUA 2QX6A 2ZSDA 3OBBA 4RXTA 2NPOA 3W5HA 1EBBA 3GJ6A 3PC4A 2PL1A 4IWYA 1P1JA 1Y1SA 1PG0A 2BC9A 5C9ZA 2C4UA 1GNTA 3RSZA 4U7JA 1KTIA 1Z4LA 3IJ5A 3N5CA 3NHWA 3N2EA 3R5FA 3CINA 4CM5A 1WXQA 4RSGA 2G7MC 1QRUA 2JLWA 4TL9A 3WYAA 5K8TA 4BUJA 1SA0A 3ROGA 3TLBA 3AQIA 2BMVA 4MW5A 1G8PA 2O8DB 3UGTA 4N5NA 3KEGA 2GM4A 4PU0A 1R9JA 1RIFA 2IXTA 2QNBA 3K0HA 4MGIR 4QQFA 1I51A 1XRNA 2REXB 3LZDA 4HTAA 2HPZA 4DBLC 4LTMA 3PYMA 8GPBA 4HZGA 1HPLA 4J9UE 5K6AA 4RMIA 1VDMA 1PL6A 4KXMA 1JU3A 5CVUA 5LYJA 2H48A 2ZRPA 4GP9A 2FW7A 4RVGA 2ET6A 2IDZA 3MGCA 1QBGA 4NOKA 1C4XA 1MORA 2MIIA 2AE2A 4Q7MB 3K09A 2BMAA 3STXA 1AKNA 2V5AA 4FOOA 1Y8RA 1B15A 2MHCA 3OI7A 1UKBA 2O3QA 4HGYA 1YQ9A 3PK0A 4B48A 4EGQA 2O5RA 1A04A 1BJTA 4JJKA 1XZGA 4H16A 1KMQA 2X5OA 4OBEA 3JWIA 5EKTA 5GY7A 3THRA 2RGAA 3CWCA 5BP7A 3ZK8A 1KQ3A 1IL0A 3RHFA 2FSVC 3AV3A 5JNLA 3CLTD 2OAEA 2WHPB 2UUPA 3AIIA 4GKVA 5KCMA 4A16A 1FFYA 1OY1A 1FSFA 1O97D 3QJYA 4J94A 4RJTA 4HDRA 1QORA 2G1UA 3NPAA 3M6UA 1T9BA 5I9NA 1IJEA 4X45A 2XBMA 1QIFA 1ZL2A 4S0XA 1NA5A 4KIJA 2CBZA 4E2WA 1KFEB 1BDBA 5C5EA 3LQKA 4MW1A 2AG6A 4H0FA 3NKVA 4EG7A 3OMWA 1NVTA 3LCJA 1YBHA 1Q22A 2E7ZA 2OCLA 2VPWA 1N2ZA 3GJ7A 1HT2E 5DISB 2R96A 1DAFA 4YQEA 3PGMA 2ZBQA 4E07A 2C99A 2GPJA 1RM3A 5ALFA 1RAFA 2WJWA 3EIQA 1GVHA 2HZBA 2N75A 2ZI7A 3KKQA 4P3OA 1MTOA 4QD3A 4UAUA 2J3JA 5JSUA 1Z39A 2RJ3A 2GKSA 2Z4SA 3EOAI 5FBWB 3HJCA 4JKOA 2JIMA 4OOEA 3MPOA 3N0RA 3BH7A 4OLJA 4R2HA 4WN9B 2WFZA 4WXPA 2JBWA 2OENG 2X8BA 3HJFA 3M5CA 1ENYA 3M6XA 1W44A 4F2WA 3PF9A 3AFMA 5EERA 3D6NB 3TRHA 5GONA 1DKPA 1R00A 4WL0A 3WQQA 2FLWA 1D6SA 1TUBA 2IGTA 2X42A 4BATA 1NNEA 1FPQA 1HZZC 4L9WA 1Y6FA 2C5SA 2VYQA 2Y9PB 4DMHA 1ZMXA 1PFVA 3AY0A 3FDFA 3Q72A 3TD9A 5LB2A 4WMLA 3T9FA 1M0TA 2ZS9A 3EVNA 3QV2A 4KXXA 4C4TA 4CMIB 1N78A 1O6FA 3E3AA 1Z5GA 1QYVA 2AC7A 5ALEA 2EHDA 1A1SA 1CJTC 2EKZA 3K9NA 3N0VA 3SLGA 1CY6A 1RYBA 4EABA 1ORTA 5LA6A 4LF8B 2HMVA 3HY6A 5EZ5A 4PO9A 3UMVA 3FB1A 2GN9A 1ZVKA 2B21A 4HGQA 4LVNA 4J1TC 1GP2A 2XCQA 3OOHA 4HDAA 4EW6A 3IAUA 2DJIA 2JFBA 3LWBA 3VDNB 4AM8A 5CHEA 3WAGA 1UR5A 2X9GA 4DQ0A 1Z07A 1PTJA 4X90A 1JFFB 2BFFA 2N42A 4EM6A 3L4EA 1PT7A 1L5GB 4JSRA 2EP7A 2P11A 1E79D 1V5WA 1VCIA 1Y1PA 1ZD2P 2HA4A 2QZPA 4XPIB 4RELA 4LHVA 1T35A 3EIXA 3TIFA 2FSIA 3IVRA 4LOAA 5LQSA 4JWKA 5I7HA 2DTEA 3DT6A 5K3CA 1QX4A 2FPGA 2VP2A 3DHVA 2Y05A 3GLKA 4MCJA 4KBFA 4F4DA 1PDOA 1PHRA 2C2BA 4HDQB 4GBJA 1E0SA 1PKEA 4B87A 2OV4A 3AHFA 4UAVA 4A3SA 1JFTA 2OHGA 5G4LA 3M83A 4NATA 3B6EA 4JXKA 2I3AA 1U3VA 1Q7GA 3OWHA 4ABYA 3SVTA 2BRUC 5IYZA 1U9JA 4FTWA 3W7AA 4B3MB 1KYWA 3RV4A 2DCUA 5FAXA 4C88A 3U4HA 1DZ3A 3FPJA 4PLPA 4MJ7A 1NOKA 2X8WA 4JR1A 1IQRA 2XB9A 1U1GA 5DWDA 1U3CA 3O0TA 3T3GA 1RQGA 5DW0A 3DVSX 3VRHA 3RJ5A 3UAWA 1ZIOA 2ZIXA 3E9ZA 4Q02A 1N9KA 3UJPA 2QRJA 4B9AA 2DFDA 3H3FA 4YPOA 1F14A 1POXA 3KDSE 3IP7A 1Y4SA 1T0UA 2PGJA 2AV6A 2Q3HA 1U8UA 1NRJB 3HDTA 3PKIA 4CM8B 2OE2A 2D59A 1OHHA 1EBUA 2BFBA 2R6GA 4IHJF 4U63A 4U1RA 1VLJA 4B17A 1MJNA 1MGPA 1SC3A 4D9GA 4RK1A 4YJGB 2DWQA 3JW8A 1OZGA 2XTNA 5DGXA 1L8OA 4KPFC 1SQ0A 4OQXA 4B2LA 4BMCA 1IM5A 4FHZA 2JVJA 3QXJA 3ZWKA 5AM2A 5GIPE 4KLZA 1ID1A 4MMXB 1JFVA 1KJ8A 4X7PA 4KITB 3IHKA 3R4CA 1B2LA 1UJ4A 2GKGA 3MS4A 4FBGA 3REOA 1ATIA 4B3FX 4Q3OA 4MS1B 3X2EA 3QEAZ 3ABRB 2A33A 3FLAA 4Z2AA 2OZPA 3ROFA 1DXOA 3BWEA 2FW0A 2JJ8A 3AKYA 4Q03A 4DYHA 4YP7A 1I3MA 1EVLA 1M2JA 4L4SA 5IASA 4I1VA 2YN2A 4R41A 5DM60 3FPAA 5C8YA 1WY7A 1WL8A 5JY1A 4EVQA 1ZEMA 4FWIB 4R6WA 1WPRA 2F17A 1K6JA 1PL0A 1VB5A 2BHTA 2YTZA 5FPPA 5TMDA 1P7VA 5IZ4A 1G16A 2VWQA 2R65A 2PRIA 4KH0A 4IUYA 2IUEA 1V3UA 3G0DA 4NOLA 3T3DA 4FEYA 5FPKA 1SH7A 2GSWA 3FGNA 4OLBA 2BI7A 1KKUA 2IEIA 3QUTA 3UCEA 1UJ2A 4AO8A 2C57A 2GS9A 5EUCA 4W5QA 1W4LA 1Y7PA 4RTQA 1V5IA 4IXNA 4OFWA 4OXQA 2XMSA 3HGQA 3ZHRA 2CNKA 3NONA 2VJMB 3I6IA 3AUYA 1EA7A 1OGJA 5DSZA 1I1HA 1WDKA 4RFSA 1QYRA 3Q7SA 3ACBA 1MTZA 2HW8A 1G3UA 5E2IA 4IIFA 1NY5A 2I67A 3E9EA 3O9VA 1U2ZA 4Q3AA 3PPYA 3CLRC 4XIJA 3NHJA 5F77A 1VOTA 3MLAA 2ISQA 4EUEA 1RJDA 3NOOA 5FWNA 2IP1A 4LQCA 2FPPB 3RT7A 1T24A 5BYKA 3K1AB 3K0CC 1HQCA 3L05A 1Q1EA 3VYTB 1C0IA 2DKOA 2WIDA 5LP6A 3QU9A 4PQRA 1I2AA 1I4WA 3F6YA 4B6SA 5L45A 3KXPA 2R1UA 1Q95A 3HXMA 4TXNA 1IXKA 2HLHA 4F45A 5JQGA 5JS1A 1OXUA 2H1FA 2ORED 1Y82A 2Q4BA 3RT9A 1FB5A 2Y0PA 2WF9A 4ZDKA 1BW9B 1GQSA 3EGCA 3AC0A 3IELA 3OPMA 221PA 2MMGA 4GX1A 2IH2A 1ZY2A 4U2KA 5HQJA 2JANA 2EFJA 2V7WA 3ESZA 3HJHA 4NK4A 5B53A 2HMWA 2X23A 1A9PA 4UARA 2R5WA 2G1JA 2NU8B 4L6AA 6NULA 2VEOA 2YYSA 2OYSA 4R9VA 3NTUA 4RVNA 3DW3X 1TKBA 1ZESA 1J0XO 3QWHA 4YRRA 4L73A 2XE7A 3NT2A 3Q85A 3STUA 4D4MA 4YA6A 5F2EA 2ZZNA 1X9GA 3WKAA 3Q1LA 1TXGA 1GZVA 3FR7A 4C03A 3DLAA 2R68A 2VXYA 4YFVA 3WIOA 1H2EA 1ZS9A 2R7KA 3E1SA 4LRXA 4MW9A 1IVSA 3AETB 5CD1A 4O2RA 5EI5A 4XFKA 1OC2A 1NTOA 3ZWWA 5JSHA 2YWJA 3QELA 4F6RA 1V4VA 4MP6A 1HX7A 4PC2A 1YCDA 5AW5A 4RYLA 3AR5A 4EHKA 4I08A 1Y7HA 3MWFA 5CLFA 2C3YA 1KRXA 1P4HA 3C5HA 3FVTA 4MVJM 3UN1A 3DTVD 1UXIA 2O4UX 5D2CA 1ZNXA 3QLUC 5EHNA 3W78A 2VRWA 1WPGA 2DQKA 3HCNA 3LOPA 4RK4A 1OA0A 3CCFA 1IAQA 4QYMA 4GQBA 3M1AA 3PHLA 4TMYA 1BJRE 4WNIA 5TRTA 1OXTA 10MHA 1D4OA 2I4TA 3R40A 2IHYA 1QX3A 4XIIA 1BXRB 3B9PA 1CJSA 3EDRA 4DMCA 2PWZA 1RIIA 4DR1B 3OU2A 1M1XB 2GCEA 4MB6A 4BE9A 4WXEA 2CCGA 3DCIA 2R9VA 4U00A 4BB5A 4QU5A 2ZUBA 1W34A 3W2HA 4UBNA 5K6TA 2V6MA 2C8VA 2ZRNA 5A6SB 2IJGX 4J16C 5FO0A 5AVZA 1L8LA 2RHOA 2FX3A 3DOHA 2XKKA 1QTNA 2C84A 2CMHA 2NG1A 1QSGA 3JQCA 1CDZA 4GP7A 1K0FA 5CDHA 1NYLA 4JJZA 1XCOA 4OHZA 1DKMA 4TMTA 4RAOA 5AOCA 2O59A 1U0TA 2EFDB 4RZXA 3KKMA 1T15A 3TQRA 3WO1A 3CF4A 5G0TA 1KA9H 3I8OA 2OM6A 1COWA 4R7ZA 3NETA 4KREA 3GMSA 2NADA 3M81A 4Q4CA 3IPYA 3L9XA 4YC7A 1NJSA 3DOUA 1JIXA 3AM1A 3TIVA 2Q45A 5L3QA 2ZI3A 3TL6A 4MP8A 4CIBA 3ETHA 1U9YA 3QHPA 3G5MA 4Y2TA 3WKCA 2M1ZA 4DM4A 3QIVA 4E46A 1GU1A 4ZGWA 3PXEA 3EULA 4NYMR 1I2ZA 1MLDA 4YJDA 4X93A 2JLYA 4IIHA 2GPSA 2VAVA 2X2PA 3WGHA 3T5PA 1E5DA 3SX4A 4C2TA 2J0UA 2XIQA 4H3SA 3UW1A 5BYAA 1HR0B 4ENVA 4CEIB 5SZKB 3TQIA 4ANFA 5F7XA 3I5MA 2GNAA 3GT3A 2VNSA 5HUJA 3K9QO 2GEVA 2BFEA 1XQ6A 4ZO4A 1RLOA 5G0UA 4EJ2A 3OCYA 4Z4EA 4XD7A 5AHXA 4ZVTA 3HGTA 3QNUA 4BO1A 4EEKA 4ZT5A 2REQB 1AK9A 1L5HA 5IVHA 2Y4OA 3A37A 3EGDB 1WCIA 1SHTX 2C7PA 1WB9A 5C5DA 4XW2A 4RY2A 4GWKA 1XRRA 3RAPR 4Q6BA 3L6BA 4KDRA 2X0FA 2GBLA 3EZ9A 2AXQA 4CG3A 3BBLA 3GJ4A 1TPYA 1ZK3A 2P91A 4KBGA 4I5EA 4EB3A 5GJBA 1G9TA 1AU9A 3GV0A 2G77B 5LMNB 3IEVA 1J06A 4QGHA 4DPLA 5TGTA 1L9XA 3L1JA 4LXHA 1XZ8A 1IJBA 1TJ4A 1OXVA 1E6EA 1GCOA 4L3OA 1NUQA 5ALJA 4FM9A 2C7QA 9GPBA 3UTCA 5KTSA 5M7EA 3BKXA 5HMLA 5JCXA 4P3KA 4JIMA 1HLFA 3EZXA 3GJ0A 4WCFC 2Y76A 1XZFA 3F73A 3CF0A 1DIRA 2PMBA 1LDNA 1ESZA 1N33B 3G49A 4ZRMA 1JKJA 3AKEA 2C0QA 3OOWA 5ALUA 1YJBA 2QDKA 5AI4A 2W6ZA 3O3NB 1E6MA 2PXHA 2Z2ZA 2B8JA 4MV7A 1AUOA 2OESA 3BRQA 5ERGB 3OE7A 1T9KA 5EIEA 3H05A 4GFDA 3VKHA 1TO6A 2B25A 1NTRA 1R6TA 2Y2VA 4EUHA 3GJZA 3G2KA 2BGRA 3QU7A 4L4RA 4QEZA 4TRNA 4C08A 1FJHA 1PTKA 1IFXA 3Q3VA 1E77A 1ND6A 5CLIA 5D8DA 1V95A 5H3CA 4EMBA 3PWZA 1FEZA 3GGPA 1T6ZA 2AG1A 1JG7A 2JFZA 2REOA 4KV9A 1JIUA 1VIMA 2A14A 4TTRA 4Q9HA 4YWJA 3Q7EA 1HRDA 2BDUA 3KZNA 3L8CA 4PZUA 2D54A 4HVTA 1X7ZA 5FQOA 2MSNA 3UKOA 3JRWA 4P2BA 1TC1A 3ESRA 4YP5A 3CJRA 4EY7A 3I6BA 3E53A 4G24A 4ZT3A 2ZRKA 1M1UA 1CVIA 3PKZA 5LQNA 4ZZ0A 2V7QD 2PN1A 1WX1A 2YXPX 2A57A 3A1FA 3GCGA 4JFRA 5AM4A 2V03A 1GARA 1Q1AA 2DPLA 2K4MA 2FLKA 2ZIGA 4N54A 4Y2YA 4RANA 4G36A 3UGQA 3PUZA 1NLUA 2PUTA 2V7XA 2FU5C 3SKXA 3G2PA 4YYZA 5JD5A 3EPJA 4KSYA 2HUPA 1N5DA 2XMPA 3RC9A 1QCDA 3FNFA 3MRXA 1UJCA 2XDYA 3PQCA 3DMNA 3QP9A 2QG6A 4QNNA 5A9RA 1IK4A 4NCKA 4G0VA 5AJYA 1JRLA 3V8NA 1SEPA 2AHOA 2WTXA 2VL7A 4KQGA 4QBFA 1VG8A 2O3TA 3PDCA 3T61A 1PWHA 3C3WA 3IEUA 1ORIA 2W2OA 1JSXA 3A1TA 2JI6A 1G5TA 4KNWA 4NYJQ 1YDGA 4GX0A 1MOZA 1FYXA 5AW2A 2VSOA 3MGGA 2VT2A 3D1LA 4CIVA 5IAAA 4Q12A 3ZD7A 4KR7A 1PFWA 5JRJA 3TXXA 5DYYA 4UM8B 3VR4A 1JF8A 1ZXXA 4J1QA 4Z3DA 1M5TA 3U0VA 4EVIA 4GBED 3I52A 1DBQA 2JGDB 3LYUA 3RTCA 4PN3A 2Y67A 5BNZA 4FYHA 5JY6A 1P60A 2WMNB 1UPCA 4M7OA 4R1SA 3KZ1E 5KJFA 4MEBA 4C7XA 4FFWA 1RRCA 5ALKA 4JJ4A 1X77A 1LY1A 5TR9A 3BA6A 1W5BA 4URXR 3K0EA 4OHWA 4W9NC 1LW6E 5WRFA 3MJRA 3VMMA 3KQLA 4HDKA 1W8IA 2CMGA 4C7VA 3VO9A 4TLLB 1V1JA 5IBPA 3QF4B 2OQ2A 1IDN1 3ASVA 1C30B 5LMUB 3MGAA 2X0IA 3LX6A 3AESB 3L40A 4ID3A 4YH1A 5E7MA 4ALLA 2WZQA 1PR9A 1GSOA 2CWDA 4G3XA 4I9NA 4R1TA 4R68A 4RK5A 3Q12A 4RNCA 4IJMA 1JAHA 2JW5A 4O2AA 4JBWA 4HV4A 2QQEA 3ZCXA 1Q74A 4FKMA 4HFJA 3WB1A 5JO9A 1FSSA 5COAA 1JDVA 1CHDA 1JFRA 1VCOA 5K0LA 1BXGA 4A5OA 2QUKA 1N25A 4MA5A 5KKAA 4XWTA 1ADBA 3P1JA 1E7SA 4I9GA 4H3HB 4AQDA 3AV0B 5L95A 1RPAA 4LZAA 4Y2HA 4FT4A 2NUTB 3NM4A 2IQIA 3VV3A 3ZW8A 6ADHA 2DFVA 2WU3A 1DJLA 3CN7A 1IXRC 3RU3A 1UMCB 4LW8A 3TVYA 8AT1A 2WA1A 1SBIA 5B6IA 1RRGA 3TOVA 1NBMD 2C2MA 2J3LA 3OZTA 5EFZA 2GM5A 4N5DA 4IDAA 1XTJA 3FNIA 2M6KA 1I7SB 3JVVA 3QEJA 1K4YA 4M1MA 4U7PB 4ZT6A 4N6OA 1TCVA 2C5FA 1A9ZA 2HEIA 5E6UB 3TUIC 3PLRA 3SX2A 2O23A 2DC1A 2N9UA 3SZRA 4CG2A 4EW2A 1R0ZA 3TBFA 2BLNA 3NVKI 4DQKA 1UQUA 1I0ZA 2FXVA 2JGAA 1Y98A 3V34A 4YXWA 1Z6AA 2ZQZA 3E9QA 3JAKB 1JSCA 1JHDA 1GZ5A 3B6MA 1X9IA 2R8EA 2W37A 2VH2A 4K6OA 4XYGA 5G4KA 2BFDA