2EX1A

Crystal structure of mutifunctional sialyltransferase from pasteurella multocida with cmp bound
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
388
structure length
379
Chain Sequence
b'MKTITLYLDPASLPALNQLMDFTQNNEDKTHPRIFGLSRFKIPDNIITQYQNIHFVELKDNRPTEALFTILDQYPGNIELNIHLNIAHSVQLIRPILAYRFAHLDRVSIQQLNLYDDGSMEYVDLEKEENKDISAEIKQAEKQLSHYLLTGKIKFDNPTIARYVWQSAFPVKYHFLSTDYFEKAEFLQPLKEYLAENYQKMDWTAYQQLTPEQQAFYLTLVGFNDEVKQSLEVQQAKFIFTGTTTAEGNTDVREYYAQQQLNLLNHFTQAEGDLFIGDHYKIYFKGHPRGGEINDYILNNAKNITNIPANISFEVLMMTGLLPDKVGGVASSLYFSLPKEKISHIIFTSNKNNPYVKVMRRLGIIDASQVIFWDSLKQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords a2,3-sialyltransferase, a2,a6-sialyltransferase
publication title Cytidine 5'-Monophosphate (CMP)-Induced Structural Changes in a Multifunctional Sialyltransferase from Pasteurella multocida
pubmed doi rcsb
source organism Pasteurella multocida
molecule tags Transferase
total genus 130
structure length 379
sequence length 388
ec nomenclature ec 2.4.99.4: Beta-galactoside alpha-2,3-sialyltransferase.
pdb deposition date 2005-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11477 PM0188 Sialyltransferase PMO188
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ex1A02
3.40.50.11120 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ex1A01
2EX1A 2ILVA 2EX0A 2C84A 2IY8A 4V3BA 2IIBA 2C83A 2IHZA 4R9VA 4V38A 4R83A 2IHKA 3S44A 2IY7A 2Z4TA 4V3CA 2IHJA 4R84A 2ZWIA 2II6A 4V2UA 4V39A 2IIQA
chains in the Genus database with same CATH superfamily
1J0AA 2EX1A 2ZRAA 1XZEA 3B8EA 4R41A 1Z2NX 1E69A 4KX3A 5JTTA 1AUOA 1Y6JA 2GD6A 3PGJA 2JHPA 2PZAA 4QAJA 4QOSA 3BFXA 4YMUA 4GR9A 1CJCA 2VI5A 5FQOA 3ZDFA 3RO7A 5JD6A 4OLBA 3RS8A 3WV5A 1E3EA 5K05A 1ECFA 1F8GA 4FHFA 4G07A 3QVJA 5BYBA 1AA6A 4HH1A 1DC4A 3ADPA 4WCFC 4HK4A 3OZFA 4WUTA 4R84A 1ES9A 4EG1A 2UYHA 4BNTA 2E4AA 1HORA 4RVNA 4L08A 4CETA 1ML4A 5WRFA 5G1NA 4O2RA 4L9WA 4NDNE 2F62A 4F8JA 3AHFA 4RPKA 2Z2IA 1KJIA 5H7XA 1I32A 5SV2A 1XZNA 3NGMA 3G89A 2F1OA 5C0OE 2ZT8A 1JQKA 2HLHA 3LT2A 1NVWQ 4D4JA 4KWTA 4RTJA 3IIIA 3U3JA 2QE6A 3TLYA 1P5JA 3GLKA 5DCLA 1GV1A 3LA6A 3JTEA 5DBGA 3RC8A 3IP5A 2Q5JA 4MWGA 1BOFA 1ZRMA 5CDYA 5B1SA 5E7MA 4BEVA 3OPYA 4CGZA 1M8KA 5DYGA 5H3LA 3KIPA 2ZROA 5DEOA 2WPNA 4BPRA 1NOIA 5COBA 1ULHA 2DR0A 3KHTA 4B2IA 4WEOA 2HX1A 4FYIA 1WKBA 4G1VA 4QJBA 3F3KA 3GGDA 1EFVA 3PLNA 4LYGA 1IXRC 1T2AA 3EVCA 3LT0A 1DAPA 4MRPA 4XYBA 3E9NA 1Z16A 3WHKA 5JY1A 4KG7A 3PC6A 5KWEA 1CDZA 4WVFA 3C48A 3K1AA 1JILA 1GZDA 5EINA 4NYMR 4F11A 5ICSA 1RRFA 1XTRA 1Z26A 4MVJA 3ZGVA 1JRLA 1ZM4A 2AK3A 4Y6QA 5EP1A 1EK2A 2NPOA 4Z2AA 5JSZB 3F9CA 3TEMA 2H7XA 2EFYA 1XTVA 5K0FA 1EBBA 1NP7A 4XTCS 3V2UA 3M9LA 1CXZA 3FPBA 4DE5A 5JYBA 2JC3A 3UB4A 4H0CA 4JU8A 4X7RA 2QE7A 3P94A 3P0HA 5F5NA 5LMZA 4LPKA 3CVVA 4HTFB 4EPWA 2WYWA 2XUAA 4J4HA 5DE3A 3UT5A 2BFOA 4HH4A 1SVNA 3R44A 4KFSA 5HZGA 5KJFA 4QTUB 5L4NA 5IVHA 1WOYA 2O3SA 1OA1A 3F3YA 4RENA 4E31A 3B1VA 1Y7LA 3CEHA 3L6CA 4AURA 4BO9A 5BMVF 4M98A 3SLRA 4MW9A 3DG9A 3UV6A 1Y3HA 2OBNA 5BNIA 1VMIA 4IJMA 1QE3A 4RD1A 2BISA 4TKVB 4Y2VA 4EGSA 1A9TA 4FFLA 1W29A 1KGDA 2XTAA 3PC8A 1Z4JA 1E9CA 2CDNA 4P53A 1T5IA 2C0PA 1CZNA 2QTMA 2VRBA 3KDAA 4J4BA 1ADCA 4Y7DA 3TL6A 1QRSA 1FFDA 2V9ZA 2IDZA 2WNSA 1TMKA 2Z9CA 3JSAA 1ZLYA 2CV1A 2ZBEA 3FNBA 5DN6A 1GKKA 4CMHA 4QICA 2PK3A 1UANA 3NOVA 3PBKA 4X63A 2GSWA 3SYRA 5B3LA 4GKAA 4UAJA 1I1HA 3HVIA 3O4VA 1ZJ6A 1TYEB 1GYRA 2ZBRA 4WDQA 5DVZA 1CKEA 2Y1XA 1K88A 5B6IA 3EIUA 4LNAA 4NYIR 4ARZB 4RY2A 2ZJ2A 3PZRA 4UBNA 2VQSA 1XU4A 2RHCA 4IEEA 2JEOA 4DJJA 3GUCA 5HFAA 1LDBA 4C4TA 4EGJA 2XHZA 4MJXA 4TXHA 2CN1A 2PUFA 4JELA 4HNRA 2GJSA 4F60A 1HE5A 1NI4A 2JFNA 5A4DA 3O93A 3F2VA 1C4OA 5E2AA 1BVHA 5REQB 2A1TR 1QYVA 1M2KA 1P5RA 2Q1YA 1GT6A 2D1RA 3DKVA 5EG5A 5LJIA 1VRCA 1CY4A 2AFIE 3RVPA 3ABSB 2AGVA 1N36B 3CZMA 2YZMA 2V4MA 2P3QA 1D1TA 2ATEA 3EJ6A 4UU1A 2HQBA 1M73E 3R9KA 1T9GS 4KYIB 3T3PB 2JLCA 3DFFA 2WUVA 2VS1A 4XCXA 4JVSB 4GLJA 3KWMA 1T35A 5LKAA 2P5UA 2QIOA 2C2YA 2YH2A 2HLDA 3D3NA 3MTGA 4B75A 2AOUB 2FXIA 3ER6A 4X92A 2C3MA 3T06B 5AVQA 4TUYA 1QE0A 3EHDA 3HFSA 1LJLA 4K2AA 1UFVA 4FFRA 4GL4A 1YBFA 3LW8A 3S40A 2CT8A 4GVXA 4JR0A 1G60A 3K32A 3LX4A 3VQTA 3JARA 1NQXA 4NKRA 4CKWB 4ZZ2A 1FQJA 2C9CA 1ZNQO 4IF4A 4NRDA 1OX4A 4HEA6 3C97A 5CCEA 2Q6IA 2Q41A 3F4LA 2JFPA 4FOTA 5K4AA 3SKYA 1VL0A 1EM6A 3N0TA 4ZAZA 3ZH2A 4ZJYA 1TL7C 4G23A 4GM4A 2AWOA 4KMSA 3U44B 1ZPDA 1H8EA 1DUVG 1V9SA 3INNA 3PEEA 1JDSA 3O7MA 3T3DA 1WSBA 4MR7B 3QEJA 4BNJA 1CY0A 3WL4A 3U3DA 1I3KA 3H9UA 1UBLS 3V4LA 2PZGA 3HVJA 1GITA 3C3MA 3RAPR 4C01A 3IR6A 4NYJR 4F9TA 1Z7WA 3K0CA 4H4DA 2VF7A 2JLAA 4LOAA 3VHLB 2A9FA 5TE9A 4B6EA 2DSTA 3I1JA 4KWCA 3V48A 4BYMA 3DC7A 4M9XA 1QH1B 1O5IA 3G5UA 4YRRA 4EGAA 3DUFA 3K05A 3R6TA 4S1PA 5F12A 1TJ4A 3ZDCA 2WFAA 3OCXA 3BZWA 2VEOA 4NONA 2FWAA 1DT5A 4TTIA 5JD3A 3FYUB 4EUKA 1DRKA 1UQTA 5FWYA 2CMFA 2BUBA 2BELA 3UMGA 1G6OA 2UZ3A 4IJUA 5FRDA 1PS0A 4K46A 1Q7BA 2QB5A 1GRCA 3O03A 1AKEA 5C8YA 4H3HB 4DF3A 2OM6A 3ZBUA 2PMWB 4OY3A 4HDQB 1TKRA 4ZV9A 3ZBTA 3ACDA 4A5SA 4YTEA 1Z5PA 1A50B 4PZLA 5D3MB 5CVCA 2QV0A 4EO4A 1SXHA 3C14C 3AIOA 1OXXK 2TS1A 3C41J 4Q3LA 4X71A 5KTPA 5EJ5A 1SHJA 2ZB8A 4V1CB 2JFHA 4OLJA 1DWUA 3F4KA 3MAGA 3TTSA 5CB8A 1EP9A 1C9MA 2HPAA 4UATA 5E6SA 4E5YA 1X77A 3CF4A 4K05A 4TVBA 4HBGA 1XTPA 4ALKA 4MQEB 4MHOA 4PGAA 1JHQA 2QGNA 1QF9A 3C6KA 3L7LA 1PR1A 3ZK8A 5DM1A 4KEAA 1GUBA 2AMYA 1BWQA 1P74A 5IDXA 1W96A 2CVQA 3JWHA 3IOEA 2WF6A 2WZDA 3J7AC 1E1RD 4I4TB 4Y2JA 1CJVC 1Z2PX 5CDGA 1BVRA 2NZYA 4TYWA 1YZGA 1XD8A 1KP3A 2HUNA 5AJUA 4BNGA 2ZIFA 1I7NA 1JMVA 3QE0A 2EZTA 4LYFA 5ECDA 4C0QC 5JAMA 4DGQA 4A2QA 4D3ZA 3SEAA 3K92A 1FDIA 3L02A 1JFFA 2HJVA 3PNPA 3U3RA 1OH5A 1KRWA 2O59A 5AICA 1MAAA 3DV2A 4QOJA 2KI5A 4AQ7A 3OX3A 1ZITA 2EIXA 5GV7A 1KAHA 3PQ4A 4P6VF 2QTTA 4OA8A 3TN7A 4X64B 2HMVA 3BTSA 1FIUA 3MRXA 4X45A 2B4YA 1LNSA 3AILA 4MW4A 3TLEA 4EHAA 1D6SA 1UMCA 3H99A 5LIRA 3EIHA 3SQLA 4Q47A 5JNLA 2XTZA 3KT0A 1GAQA 3TLJA 5B3KA 2ZAGA 1V8PA 5EIBD 3KAJA 1TF2A 4IZ6A 1WW8A 3IUJA 4WK2B 3JQAA 3OF2A 3K6SA 1SCQA 3CZRA 3SDBA 1IAVA 1QVWA 2R65A 3Q0IA 5D3QA 3SBDA 4E7OA 2WQ6A 1OC4A 1T1RA 2UUPA 4UHHA 3GZNA 2IHZA 3IR7A 5F2OA 2XUDA 1V7CA 2H59A 3R3WA 2NACA 3TDMA 5HTOA 3LVRE 4Y2UA 2UYGA 1E1NA 1E66A 2XNCA 2ZETA 1NV8A 4ZMRA 1E2BA 2A5GA 1OFIA 1I5EA 1O97C 3WDKA 4BQEA 1AKNA 1KBZA 4WFIA 4LE1A 2Y05A 1MD9A 3RKRA 5EMKA 2OGZA 4BRZA 4GI7A 5JVDA 1FZTA 1HFJA 1KIFA 3NWEA 4O0LA 2Q07A 5CW1A 2BR5A 5JAZA 3HJFA 3PJRA 2RHRA 1XZDA 5IK2D 1LK0A 3H2JA 3R23A 5JW6A 2D00A 1RJGA 1Z38A 4WBSA 3GDHA 5AK0A 5KZMB 1IBKB 1NAHA 3K5HA 3ADBA 1S2LA 1NJ8A 1O9HA 1LJ8A 1N9ZA 1PDOA 2XT0A 4PGGA 2VSXA 4ZJZA 5JNVA 2XVXA 3F9IA 2V7EA 3AH8A 4NIMA 4F84A 2FKNA 2JVIA 1EA5A 2YVKA 1A0OA 2IF2A 2VTKA 8AT1A 1D1QA 3OQ1A 3MTDA 1VKJA 4L6AA 3AL3A 1WY7A 1EDBA 1X7ZA 1DV2A 2CUZA 2QYSA 1OIWA 3DF9A 3HZZA 3SJ7A 3VDMA 3IDSA 5ALWA 1LSSA 5A5GA 4J1NA 4YXWD 1YGYA 5JMWA 3SHFA 2Z58A 2CZGA 2QLTA 4LUCA 5DEIA 2D5AA 1C0PA 5SY9A 3NI2A 4Z54A 1KMMA 2JEZA 2CXXA 1LPOA 3EUAA 3OE7D 4KXNA 4Q9JA 2FCRA 2FN4A 1ISJA 3SDSA 3O75A 3WGLA 1DKLA 4RY9A 3NTXA 5LMUB 1GQ2A 7ADHA 2X58A 3NUGA 5JNSA 4UAUA 3U17A 3HM9A 1VQ1A 4CL3A 4LDAA 4BMDA 4MZDA 1PX0A 4BY9E 5B37A 1M6WA 2X19A 1QHFA 4BGEA 4KHZA 4ES6A 4EB0A 1CQJA 2GHRA 3MD0A 3NHUA 4OI4A 1X7HA 3WKAA 1ECJA 2QP4A 1IYZA 1E1QD 2BC9A 4RADA 1E6WA 5ALOA 2UXBB 1HWYA 1R0KA 1XZMA 1YKGA 4DFDA 2NVWA 4YPVA 4R1LA 5TIIA 5HQTA 1V16B 2R1VB 3G23A 3HO8A 3IBFA 2W4QA 2YIMA 2QVCA 3OTWA 1GRNA 4JKYA 4OATA 3GNSA 2HMSA 4BQIA 2E21A 4FU0A 2LNDA 4MCAA 3ET5A 3MWKA 4P2BA 4E3ZA 3C8HA 3VU3A 2C4NA 3KETA 1D5WA 3S29A 5B6JA 4EUEA 5F23A 1SPXA 3EVZA 3C16C 3DMHA 4MJ7A 4P58A 5DLDA 1SIBE 3MJFA 4J0CA 1BFUA 1Z5GA 4GD3Q 4ZO8A 1FFEA 1T4CB 2JFUA 4DA9A 4GWKA 1Z15A 4PPFA 3KLPX 4QU5A 1C1DA 1ZP6A 4IV5A 3B1JA 1ZSNA 2Y99A 5KYUA 1JLKA 1E62A 2XBLA 2CLEB 2X6RA 3ORSA 3RE1A 4JHLA 4ZVKA 2QTVA 4ZT7A 3V4FA 4RTPA 2DPLA 3G2OA 2WKWA 2D5IA 1ACMA 2MYTA 1CZRA 4O2AB 3SHOA 2IHYA 4TZKA 2HWUA 3G1UA 3R20A 3L3BA 5F64A 1P61B 4ZIRB 4TMTA 3BFVA 4US1R 1RLUA 4RUKA 1KSGA 2XXBA 2D6FA 3HPRA 3HEBA 2IH4A 2CZCA 5FDFA 3HCFA 2OCLA 4QXQA 1X86B 3CUYA 4XKJA 1BRMA 2YWFA 2O6HA 2QUKA 3PPYA 4J0KA 4K9SA 4ENTA 4W7HA 5LQCA 1U1EA 2BW0A 2R8BA 3REFA 5CA1F 4P22A 5J2UF 5B53A 3PR1A 3FNIA 3HEAA 4QU0A 4A0SA 1JWLA 3NUZA 3VYSB 4L5JA 2B5WA 4LGMA 4N18A 4DIOA 2G0NA 1N2CE 4GXQA 4WERA 5DNWA 1KK3A 4R54A 3NDRA 5DF1A 2RKOA 2V97A 2XYVA 2ZUSA 3RB8A 4AXBA 2VHXA 4ESVA 1V3UA 3R3XA 4AWBA 3AEUB 2FX5A 3JQBC 1CS4C 4IQ8A 4IVPA 4F3NA 3PKJA 2FEAA 4WJLA 5BSHA 2QUBA 3TNDA 3KDPA 4PYRA 2A33A 4ER3A 1GFZA 4B48A 3HCBA 3WLHA 3FJOA 2FN9A 3CX4A 2XUJA 3IPAA 2R6GA 3N58A 4MARA 2XYGA 1IBMB 4WKOA 4AIIA 2PG3A 4CQNA 4ZARA 3W3ZB 2ET6A 3LU1A 1JPNA 5ALVA 2ISQA 4BO5A 4U3JB 4MTCA 3CQ9A 1N92A 2RC6A 5HRUA 1RP1A 2PM8A 3HKCA 2GNOA 2B98A 3IQFA 4QFCA 1XNGA 4TLAA 3TTVA 4A5OA 2JAHA 4ZMBA 5HKBA 2GLUA 2GUGA 4OF4A 1IE3A 3FFAA 4QQFA 3P8ZA 3PJFA 5JH7A 3RC3A 3HBFA 4MB2A 1N4AA 4CM9D 1ND5A 1DELA 3ZOZA 3GXOA 5A0TA 3L0IB 4BNXA 1BS2A 3KYDA 3QLUC 5KOYA 2OSBA 2R8EA 1Y6QA 1UAGA 4E2XA 2M6LA 3WKBA 1LBQA 4CDRA 1FDVA 5AO9A 3TSCA 2X0RA 2X1LA 5KYYB 4BNIA 4CLEA 2I3BA 1A8PA 1E0JA 2J9XB 4LJ8A 3THYA 4WOPA 1Y1RA 3NTVA 4NE2A 3GP8A 4H7IA 5BW6B 4P4SB 4PSDA 4HI0E 2Y1FA 3I23A 2XNDA 3EC2A 1Y1KE 3HU5A 5F5XA 1KMHA 1UPFA 3LO8A 4UPEA 4N6GA 4I55F 3I5MA 2P5TB 4MS3B 4HGRA 5TLSA 2ENWA 1XQYA 2FE4A 2PJDA 3KJFA 4CI0B 5I01A 2OHXA 4M99A 5GM1A 1WETA 3VYVA 1OVMA 4HNQA 2CJPA 4Z99A 5BR4A 3P5BA 3DBIA 3I3OA 3N8GA 4W5NA 5KTSA 3ZKWB 1YVDA 4BNLA 4ZC8A 3K0SA 4NL4H 5E9QA 2R6AA 1N0UA 5DBEX 3FHTA 3NJ4A 1QR6A 3UANA 5LQMA 2WYVA 3GBSA 3IIJA 5HK9A 4LYDA 5JAUA 2DTXA 3R6LA 4RL6A 5DHRA 1IQRA 4RACA 1YU6A 3TUIC 4F72A 5K8TA 2ZTLA 1T9CA 4RS3A 2OQVA 2VJLA 4RK4A 3FTCA 4BN0A 5GONF 1QQTA 3W5VA 1P4RA 3ZWPA 4Z5XA 1MJ5A 2IE8A 4C4PA 4CDNA 2YJ3A 3ANMA 3ETNA 3A9SA 1NVAA 1CUDA 2B7CA 2WA1A 2XSZA 1W4ZA 3PQ8A 3W5IA 2RMKA 2Y0PA 4IWYA 4HQFA 2G0TA 2V65A 1EXVA 4ZODA 3O38A 5AKKA 4RKQA 3LA8A 4GEGA 4QYSA 1QTRA 3LY9A 3MS4A 4J7UA 2HHHB 2ZWVA 1THZA 1S0UA 1MFPA 1EUZA 4IEFB 3EY4A 4PR0A 5HIKA 2BTEA 1IONA 4BQRA 2E49A 3MOGA 3Q11A 2FEMA 5GQSA 1IJFA 2HNBA 4RABA 1RJ9B 3EOZA 4OQ4A 1GKUB 2XB2A 1X8XA 2OCIA 3IPRA 1DI0A 3WNDA 2HV8A 5LQAA 2DOKA 1ORWA 4BP8A 2HMYB 1NTOA 2CLDX 1BGVA 3FPEA 3AO0B 2YJTD 2XQVA 2DWUA 1QE5A 2GHQA 5G4KB 5IN5A 3IC5A 3UXYA 3TE6A 1RHRA 5IYZB 4R7TA 1XXHB 2HF9A 3QMMA 1XKLA 4ZOBA 1FQWA 3A14A 4PXAA 4XFKA 1NXSA 4IKPA 1FYWA 1V2GA 3AFIA 3BJRA 5BQ5A 1Y9JA 3NAQA 1VHQA 3RFCA 1RACA 1RLOA 3O9VA 1RBYA 1JU3A 3TX6A 1G2PA 3ROFA 4DCOA 2YY6A 3VX4A 5KX5F 2IPXA 5JWHA 2GTPA 2I87A 3KYCA 1J9EA 2JGNA 2OAGA 4TROA 4BLVA 2G36A 4YCCA 2YQZA 3I8OA 4J90A 2B94A 4I46A 4FS8A 1DHRA 3E3NA 4WHMA 3V80A 2O8CB 3ZWVA 4D81A 4HDMA 3IDZA 1LPBB 2V45A 2IWHA 1LDNA 3DTVD 1VP3A 2CFSA 2CMKA 4MO2A 4F46A 4WQMA 1N9KA 2WHPA 5F1KA 1IZYA 1W85A 4IDNA 5AKEA 5AKXA 5FFMA 3NZEA 4I14A 3QUAA 4F4FA 3E9RA 3JY6A 2DMRA 4YY3B 1E9RA 2J3LA 4BNFA 5T7BA 4RLQA 1FSGA 4YV1A 1EJ0A 4LNUB 2NZ8A 4HJRA 3D6UA 3HXTA 1VG9B 2ONKA 1YACA 3UQYS 2N46A 3A3NA 2GEJA 4K7JA 1ZEMA 5FTNA 4G2NA 4KRYA 4D6XA 1BU5A 2F1JA 4R2LA 1Z5OA 2QJWA 3LF2A 1QFMA 2Y1WA 1ZVKA 4TLLB 2V5VA 2QM7A 5C8VA 2NX2A 4XLTA 3GA0A 5IC6A 2RI6A 3UH0A 5HPYB 2BVNA 1OAOA 4KXMA 1XCBA 1Q7GA 2I03A 4Q82A 4M1WA 1N25A 4EF5A 4L7VA 2X4IA 4TKUA 2XQGA 2J3MA 4HL6A 2M9MA 2MOKA 4PHHA 1TIBA 3TINA 4TV8F 2Z6VA 3ANSA 4UEJA 4BMCA 3HR8A 4HZUA 1BX0A 4KLAA 3M4YA 3ND5A 1ZH6A 4LXXA 2C9ZA 4ZOLF 3TPZA 1DOHA 5KWJA 1HEYA 3HR4A 3HUDA 3L07A 1VKNA 2O4UX 3G6WA 4G41A 5KS2A 4R2KA 1MRNA 3FOZA 4ZHQF 1OH6A 1PCXA 1GGHA 2AJCA 4BWYA 3AUAA 4KIJA 2F8LA 1UMBB 2OV2A 3CJQA 3N8IA 1XMOB 2W2LA 3SE7A 2PUTA 2OSVA 2AHRA 2WE8A 1R0BA 3VI4B 2PZEA 2WUWE 3LBFA 4C7BA 4AKHA 3ZNOA 1OBVA 4PHGA 4I6EA 2NTJA 4EKEA 1OF1A 3RVOA 4H17A 3CPSA 2BYTA 3WYBA 2X22A 1FP1D 1RYNA 3ZWXA 1DXHA 5KHOC 4E88A 1G4UR 3PEYA 3T9AA 2Z8ZA 3GT0A 3OEED 1DTEA 3HH8A 3LDFA 2I91A 2DR3A 2WJYA 3G7SA 3NLLA 4Y9TA 4QBIA 3B7GA 1C1YA 2ES4A 2G8NA 2HV9A 4B40A 5JXJA 5KTNA 3ZE9A 3DA8A 1G5PA 1Y8RA 3CZ5A 3UHAA 4AJHA 3UJ3X 1IMJA 4JI1B 1M2OA 2A84A 4BLUA 1HSZA 1R6AA 1U3GA 4MQUA 2JDIA 1RWMA 3SOPA 3W2GA 1KZYC 5SZJA 2LIPA 2Q21A 1BEEA 4B8YA 4Y3UA 2QAGC 3P9XA 1NWHA 3UJAA 4J0EA 1WABA 3DJFA 3DAHA 4BBJA 2I4RA 3DMPA 1RYBA 1PRYA 1BA3A 2Q8NA 3KPWA 5EFZA 2HPHA 4FDUA 3DE1X 3W04A 3WYFA 1S4QA 3GVHA 4M7RA 1OLOA 2LIVA 4OREX 4RVHA 4ZQCB 3TFOA 4BZWA 3GW8A 2BGTA 1ULUA 5L3SB 3JWGA 2HBZA 3GLGB 4AZWA 4O4JA 2ZI5A 5DLQC 2AN1A 1M67A 1II8B 1U99A 2OESA 3SFZA 4AJJA 4D2IA 5C4IA 5LOVA 2MMCA 3ILXA 3R3VA 4ZCTA 4A9AA 3K70D 3U9SA 3COSA 3CGGA 5K0JA 4TS4A 4W5WA 1PR4A 4LZOA 1RAHA 3RUIA 2JLSA 1T0PA 3DTVB 4N0DA 2EJTA 3BKXA 5LLTA 3IQXA 3AHJA 3RKUA 4L9AA 1K2VN 3RT7A 2VTEA 3L7DA 3STUA 2QEQA 2GCOA 2V3VA 3DR3A 2A35A 1CR2A 3LYAA 4YJGB 2V5UA 1JAIA 5EWJB 4MMZB 4EF4A 3H05A 1CUCA 1OTXA 2GK7A 3C7TA 2OAQ1 3PP8A 2AOTB 3VYRB 3RRZA 1DC8A 3M8KA 3FB1A 3OOJA 4R68A 2GPBA 3AFOA 2GN1A 1RRVA 5K8IA 4TQAA 2FMTA 3NHWA 3W6PA 4ASUD 1D9ZA 3Q7IA 5LXTB 2PUAA 1D0VA 2YNMD 3L0BA 3L4SO 5K0CA 3I9LA 3VPHA 1DMSA 2AMFA 2C83A 2DUWA 2OP0A 1L5KA 1VL2A 2C77A 2EBHX 3DLBA 3PPWA 5HGXA 4I5IA 3L9WA 3ENKA 4EATA 2DGDA 5CVDA 4DG5A 3V7NA 1N3YA 1SIUA 1GPDG 2V7QA 4Z3OA 1XROA 1QAOA 2YW9A 5J2TF 1J2JA 2ODEA 3U7IA 2DY1A 5BMVB 1IG3A 2PXHA 2GKSA 1APBA 5EE1A 3HG7A 4CEIB 3QM1A 1NQAO 1IBCA 1JWAB 3AR2A 2VZ9A 3AM1A 4G0MA 2DETA 4DB4A 1YS7A 1XHEA 5ER6A 4LFCB 5KYWA 5H70A 3WSTA 2Y0BA 3K8ZA 3QUTA 1NVMB 4IICA 2HF2A 1RIFA 3IPCA 4HZGA 3B3QA 3EPHA 4B81A 4KXFB 2A88A 1P75A 4ESOA 1TT7A 1Z6YA 4BMZA 4QUIA 3ETHA 4U63A 3KWLA 2Q29A 1E4OA 4DG9A 2VJMA 1L5FA 5J5AA 2DJIA 3ELWA 3F1LA 2BWJA 3HJHA 3EWAA 4GKBA 4B4WA 4RK1A 1ZRHA 1XJ0A 1U5BB 1E99A 2QR2A 1OE0A 4GNKA 3CLUD 2BE9A 2IPOA 3N2KB 4LTMA 2AWNA 4MGYR 2JKZA 3DHYA 2YZ7A 3SC2B 1I7PA 1SR8A 4HCJA 4KXVA 4MLPA 3VR5D 3W5JA 4Q4HB 4DMFA 3ZLJA 1XQ9A 4GAEA 4W5RA 2GBGA 2HY7A 2HBYA 4EBFA 4PLZA 4MUNA 1KORA 2BP7B 1SVUA 2C84A 2WVAA 3ELUA 3DVAB 4M1QA 5KJEA 2V0GA 2JLRA 3EAGA 2YN0A 2BM0A 3T34A 2YQ5A 2BZGA 3L7CA 3EIFA 4R2HA 4IR7A 3LT4A 5TC4A 3GJZA 3ZHZA 2IYYA 3CMMA 5LN1A 2O3RA 5BPFA 4GM0A 5LU9A 3HB7A 2FUG1 2P4QA 4QDZA 4D25A 3PQ2A 1ZRSA 1VM6A 4BGDA 4L6IA 2ZATA 4L22A 3SIWA 2YIVX 2SKCA 2O06A 4UEQA 5KSPA 4CMIB 2PV7A 5J47A 3NNDA 5CAEB 1L4KA 1THGA 1XZPA 2QXTA 4CCAA 2HC9A 2QYOA 1WWKA 3L5OA 2PFKA 3U40A 3UA3A 4LEIA 2WU0A 3FYHA 5IAEA 1Z6GA 3CFYA 2R8YA 1KSFX 1QHIA 1WKCA 2PTGA 3F6BX 2C94A 2IJGX 3PNLA 3T38A 3ZWDA 4ENQA 4ENPA 4DR7B 3DHEA 3BCRA 4Z3KA 3V4RA 1BW9B 4YCLA 3BCHA 1AT1A 5JCJD 4RJLA 2Z30A 3PLAE 3TSZA 5ADWA 3AP1A 4D4HA 3H2ZA 3GIDA 3L8CA 5YASA 2H54A 5A3RA 4YYZA 4JT9A 5IANA 3NIWA 1TZMA 1KQ3A 2QL9A 2RAFA 3VR6D 1MV5A 5LDGA 1XKTA 1Y3BE 3OA0A 4NCNA 2PT7A 5E6UB 5A3QA 4BGIA 2ZFUA 4U6NA 2P67A 3G79A 5G1OA 5AFSA 5IC4A 2XRMA 2O8FA 2AMVA 2F1KA 3ETCA 1ENOA 1EK5A 1OX6A 3A9RA 3BB3A 3DBHA 3NAZA 1YDEA 1DIBA 3PR3A 4Q1EA 3ABIA 3GFGA 4JT4A 4ZQHA 1R1DA 3UCFA 4ADSG 1OH8A 1X7WA 3RYFB 3OIWA 5JS8A 2A1TS 1TI7A 1TJNA 2ERXA 5JDCC 2RK6A 4LHVA 3KE9A 3WKCA 2R47A 4EECA 4BYGA 3D7LA 2QN2A 2C9YA 4Y2QA 4E94A 4BTLA 4F12A 1T9ZA 2AN5A 1UBHS 2BGNA 3DBLA 3LNCA 4GF5A 2XEDA 4L4RA 4B6QA 2X76A 4BQOA 2CVPA 2VBIA 3EGOA 5EKXA 2W8ZA 3JD0A 4XVQA 5AESA 4EX7A 4UM8B 4HQRA 2WP8J 1XG5A 3CVOA 3QPWA 1M8PA 1IULA 1QX3A 2D5BA 1R6BX 1QBGA 2G82A 1JLLB 3AR8A 4XVHA 1IUOA 1X42A 1POWA 2P40A 1SUFA 5KMGB 3SLGA 2NXWA 2GMWA 4ZQIA 1Y6GA 3BL8A 5DYTA 2BT4A 1REQB 5GV8A 1JB1A 4LXHA 3E35A 2Q5OA 3IURA 2WUGA 3WK8A 1U0JA 1VSQA 1J0DA 5FUVA 3G2QA 1P6QA 4DYDA 2ODQA 1OLSB 4DOMA 4R40A 1YVUA 1F2UA 2C1XA 2YASA 4O2BA 2EBFX 1R66A 1BCSB 1SIWA 1LI4A 5EZ6B 1N2IA 1C0IA 1NLZA 3G2MA 2XMZA 4RWEA 1MEJA 3S28A 1QP4A 1QK4A 3T3MB 3GRZA 4DNXA 3ESBA 4YMWA 4DLXA 4A8TA 3L0PA 2ZRLA 4ER5A 3USCS 2AFIA 4LRQA 3QE3A 4QOHA 1IHOA 3JQEA 1SMKA 3DPIA 4DJFC 5KKNB 1E5LA 4URHA 3V4OA 4YX9A 2B25A 4MEBA 4YJ3B 3VU0A 4LF7B 4X1IA 1WW3A 1ARZA 2JZCA 1ZRNA 2ZUEA 2Z0MA 3IVAA 3IBGA 1COWD 3CKMA 1FSZA 2NUTA 1AQYA 3N5KA 4QGFA 2P4UA 4E1BA 4Y98A 5IDVA 1QHYA 2B8EA 5LBUA 2I33A 4XCVA 1K66A 3U3KA 2QMUA 1RJEA 1KEWA 3PRKE 2IYAA 4XUDA 2Y0DA 1XRRA 1YZNA 2NGRA 1NA5A 3FPSA 4INJA 3UWPA 4FDMA 3T1YB 3X1KA 2OAEA 4C0WA 4I1OA 1C9NA 3H5AA 2ZZKA 4IHQA 2JATA 1YQDA 4LRTB 1BMQA 2YWHA 4K87A 4MKIA 2K87A 3ZI4A 5M7EA 4HNAA 1GZ6A 3RLFA 1FP4A 1U2RA 3D8HA 4RNDB 1EZZA 3GAAA 4G37A 1MG5A 3ZCRA 4C4AA 5BUSA 3E8MA 2AQKA 2SBTA 2YOFA 2R6FA 3LQRA 4A7PA 1D6NA 4B3IA 1X7DA 4JR1A 1C30A 3ND6A 4HADA 3IEIA 2GVDC 4MW1A 3SAJA 5BSKA 2QSZA 1G3QA 1YC5A 3A9WA 1WPRA 4WBNF 2UUAB 1E2JA 2PX3A 3SX2A 3DAOA 3DZHA 4MITA 3I3SR 2XA2A 2EHDA 2HSZA 3IEKA 4ZPJA 1MH9A 1QYWA 5E4YA 3ASUA 3CRW1 3ASVA 3RW9A 4L4ZA 4RDIA 3IMFA 3TTXA 5DNYB 2CXHA 2HHJA 1CIVA 3LUHA 4I8DA 4BKPA 3LQYA 1BJKA 2YJ4A 1JECA 1LC0A 1VE9A 2FSSA 4FE4A 1D2CA 2NT4A 5I8WA 3GC6A 3LHKA 1VIVA 2H92A 4JEMA 3ILHA 1ZM2A 1XV5A 3BGSA 1RM0A 2QZ9A 1OY1A 5LM3A 2X41A 1QVZA 3DDNA 4EFLA 1LDGA 3C5WP 4KVAA 4PONA 4KOEC 1SZJG 1WAMA 4U0JA 5EHXA 1D07A 3D5TA 4RHXA 3RARA 5L40A 2I4MA 5BOSB 1HC7A 3WSVA 2J6HA 4JWTA 4XPZA 2GBLC 1Q12A 3RK0A 1BS1A 3W05A 3HU3A 5K4HA 4XJXA 2OCAA 2BI7A 4M60A 3DWEX 2UZ1A 2Q5IA 4QELA 5IULC 2QG6A 3H8JA 2C98A 3HKDA 4GLLA 4ZPXA 3Q3HA 3IV9A 2ZAOA 3DZJA 1SHZA 2ZXEA 5IHPA 1UJ2A 3C5CA 3BRWD 1OXKB 5FHRA 1YUNA 2IXBA 4KDRA 3W5UA 1NF8A 1K7SN 6PFKA 2W71A 2OFFA 2RAVA 1JMYA 1MO5A 3ZE6A 2C57A 4K9LA 4ETMA 5MDHA 2DHCA 1RFLA 3DF7A 2RBEA 3JQCA 3TIVA 4LQ4A 2PNFA 2QVYX 4MCHA 4OB8A 4Y0NA 5CYFA 3WJAA 4F0JA 7REQB 2Z2KA 2FXVA 3K35A 2H5JA 3DDOA 3GELA 3OPMA 1X19A 1G38A 1L6IA 5JCZA 3IUEA 1HG1A 1NBMD 2O0JA 3CISA 2NPIA 3BAZA 2DECA 3PQ7A 4Q4DA 5AP9A 4BTEA 4PC3A 5F9FA 4HO1X 3NJRA 4K40A 5HZHA 1T0HB 2GEUA 2F9FA 3V9AA 2P4SA 5KVCA 3IAUA 2PKCA 2R8RA 4EO9A 2CFTA 3GVIA 1D2GA 3OUTA 2BDEA 3NP7A 3KKNA 2W6CX 4K9DA 2IWRA 3ZJYA 3QTLA 4CUZA 4MUYA 4BNDA 2XE6A 4INPA 2ZS7A 1FOEB 3R8XA 1PT5A 3RGWS 1R8YA 5J3JA 4KXQA 3OLQA 4MYRA 3ORRA 3LW7A 4A8JB 2PGDA 2PMEA 4UDOA 4RH0A 1MDBA 3NQ41 4HMOA 4UFOA 3URMA 3QOXA 3V9PA 3VNSA 4V1CI 3A1UA 4NMWA 5HZMA 3OCVA 1T2FA 2D0OB 3FHJA 4I5EA 4ABTA 1MJHA 4H0NA 3H0EA 2NZWA 2UUBB 5FBKA 3T7IA 5CA1B 4RA9A 2M2IA 5BQ3A 3HKEB 3I2GA 4N0MA 1W581 1NYQA 3RC1A 3WL3A 1O94C 4TYYA 4KO3S 4D8XA 4LOHA 3DP7A 3FJYA 3OG9A 4QRDA 5F7XA 1QKKA 3RSHA 4FC7A 3G9QA 3DPUA 5CPFA 4G4IA 4KWIA 2AF4C 2E48A 4CKZA 4DR1B 1YUBA 2FFBA 1CEXA 1WPGA 3ED1A 4BKOA 2PTHA 3AF5A 2XWQA 3HWX1 1G8AA 2ON6A 5JBNA 2AG8A 1IZ0A 2HIHA 2WWHA 1C9DB 4EA8A 1W36C 3LRPA 4PRLA 1QRRA 1T8SA 3VISA 4NU6A 2XQJA 1PYOA 1OMOA 3PFNA 3M5PA 3WB0A 3H5VA 1BVUA 4IH1A 2OZPA 5FQNA 3CSUA 5JS7A 3WRXA 1GGKA 4FK8A 5AOVA 1L4MA 4PVDA 1ZCZA 2KX7A 3KAKA 4ZGBA 4FP9A 1P3DA 2YIJA 1K4KA 4UTOA 4B84A 2D2EA 2ZVDA 1PJAA 1F9EA 1IN7A 3SX4A 4XYLA 4KAAA 3VC7A 1YZTA 4AJ4A 5E6RA 1W5FA 2XUHA 3BQNB 3TLMA 5JAOA 1G16A 1OLUA 3IB6A 1MIOA 4PLGA 4F8EA 2IDKA 2TSYB 3FWYA 1DT3A 3OZTA 4O6VA 5IAKA 4C0BA 1SCKA 3HP7A 1QGUA 2B7LA 1ZJ5A 2SECE 2H29A 1QRDA 5DGHA 1T1JA 2EP8A 3O0TA 5K3FB 1SU7A 1T5DX 5KJ6A 3HFRA 4G6ZA 3V4ZA 4M2LA 4JP5A 4JQSA 3B6EA 5ALHA 1WA5A 1Q0ZA 1QUEA 2BHTA 3GG2A 3EQ2A 1TA4A 4ZU3A 4RA6A 3PX7A 2J32A 4I55B 1LDYA 5E1OA 3DVQX 2FNAA 1N2JA 4XIJA 4YRFA 2AN3A 4PAGA 3RJZA 3G0GA 3HSSA 4M8LA 5LKRA 1U7WA 3KTOA 2FK8A 2Q5LA 4GGMX 5BN4B 1VG0B 2NNLD 4G67A 5DOZA 3RF6A 3WP1B 2OZVA 3I83A 3P19A 4NHEA 1O96B 4LXIA 4K26A 4GH5A 1CS0B 1YHNA 2Q5CA 2WAAA 3KTAB 1ZA1A 4YRIA 2XYHA 4IWXA 4KZKA 5CHEA 1RS0A 1WO8A 3JX9A 1CQIB 5GONB 2PKQP 3FYCA 4CQLA 1ZVVA 1L5OA 5BW5A 3LUAA 3QVGA 3O9MA 1E98A 2IF0A 3IKJA 3EARA 3AEXA 1IVYA 2AJLI 3O4RA 1MQAA 4QODA 1MPXA 3TLXA 4I50F 3OIGA 5JXGA 1PR2A 4CM4A 2JB9A 1E89A 3VR2A 3C4JA 4O4LF 3AKDA 3AJRA 2WF7A 2X9NA 5IABA 3FAZA 3HWSA 1CNEA 4ZA2A 2V7TA 2NZXA 2H4JA 4RO0A 5E9AA 4ED9A 4ER7A 5DM60 1X8KA 5H16A 1SCAA 3A28A 4EFDA 3FKQA 1NBAA 3ZE2B 2X23A 5KOHB 4AY2A 3HTXA 1FDSA 3H1FA 3JYLA 4G0ZA 1U9IC 1HG0A 2OGWA 4O4IF 1N2CA 4GC9A 3B9BA 4HBZA 4NZPA 5TGTA 5ICCA 2I7VA 3ICWA 3FOWA 4X5OA 3AC0A 1X13A 2K2WA 3FOFC 4MKGA 2ZYAA 2GESA 1CUSA 2D3TA 2H2GA 4Y2SA 1AGPA 4OXYA 3PTAA 3FYUC 2R8ZA 4I6GA 5BVGB 2EFHB 1JA9A 2BFAA 3MBOA 1M6YA 4X00A 3AVUA 3TJZA 3K8YA 3ENZA 4DMGA 4BKRA 4C5BA 1A8IA 2O54A 2XMSA 4QJ5A 5KX5B 2OP1A 3GPDG 3BGWA 3GLSA 1QTIA 1BX3A 4K6HA 4L4YA 3EXHB 4EG6A 2VVTA 2Z56A 4DUPA 1R0RE 2V8OA 5LSAA 1GUYA 3GUYA 4F9GA 3KR2A 4PQRA 4DV3B 1YE5A 2FSFA 1MV8A 2FW6A 3Q4GA 4KI0A 3ZGOA 2DKFA 5SYMA 3TD9A 4U5QA 3EFOA 3OVMA 2QY9A 2HKIA 3L92A 4MEJA 5J59A 1JEOA 3RYHB 3WXBA 1T9AA 3GCDA 3L84A 1A1VA 1JDTA 1JMKC 1L5WA 4R6XA 2RKBA 5FOSA 3TDKA 2WFLA 2ZUVA 3EGDA 5HG0A 1ZGZA 4L02A 3WHPA 4OK3A 3N86A 4F3KA 4ZDKA 1LD3A 3FB4A 3K8QA 1O6BA 3AF3A 1N3LA 3E84A 3P9QA 5FI3A 3CC8A 2AF3C 1A7AA 4CIDA 4H6VA 1DDIA 3LLMA 4P32A 1GPH1 4URYR 1PR9A 1AXGA 1TTHA 4RZ3A 2P1ZA 4BMPB 4PG6A 2CWWA 2NTNA 1ADBA 1CUGA 1CUXA 1NW8A 4B09A 4BX2A 1U1GA 1JXAA 2CFOA 5CH5A 4C0XA 4AQDA 4D98A 1UP6A 1H0HA 1S2MA 2ZJ6A 3RFXA 4KSCA 4TM8A 3AF0A 1U7TA 2ONJA 4YUZA 3BD8A 3UMCA 1YVPA 4LI3X 3L7BA 2EJBA 4K6CA 1NSYA 3HB9A 5BMOA 3A2MA 3E58A 3U48A 4TV8B 5D3KA 1TK3A 5LL6P 3LUGA 3N7UA 3FDZB 1BDIA 4YACA 1N2SA 1SXIA 1QAMA 2ODTX 5AI0A 3U4AA 4F91B 3V7UA 5FV4A 3E18A 2LW7A 4ZOLB 1XTBA 1I8TA 1P77A 3S1AB 1EFPB 5KJCA 3KQPA 4MULA 5A4FS 1FMLA 2CBZA 4ZHQB 3GYBA 5EIFA 1D2NA 2ERYA 2QTGA 5EUBA 4F1KA 4OV6B 1LLDA 4G1EB 3Q87B 1YJ5A 1LQUA 4JZKA 1SCUA 4G5GA 1CYEA 5EJEA 3WIDA 2JL1A 3FN4A 2L0XA 4G0QA 4YB8A 3RRJA 3AETA 4D57A 4UOZA 5IUKC 1MB3A 3LWZA 3P2KA 1QCYA 3HBJA 3I0MA 4M37A 4MQFA 4P7BA 1KZ6A 5DGXA 1XO1A 5HCUA 3ZEAA 5ADHA 3VSCA 4Y67A 1YV9A 1HNWB 2GAOA 2PUVA 4JYBA 2HUPA 2IYVA 3B20A 2C8LA 3I2IA 4WUVA 3SNHA 1LLCA 3WNBA 4PG8A 1I6LA 1BTOA 2CBGA 5CLHA 1CW2B 2BR4A 4PIVA 2OB2A 4ERXA 3A6PC 1G5RA 1UJNA 1ZD3A 2Y77A 3AVQA 2QA5A 1OUMA 1A04A 1C7IA 3BD9A 2OE2A 2DQYA 4CCWA 4RF3A 3OHSX 3RSSA 4Y18A 4CMEC 5DGTA 3JU3A 4ARAA 1QKJA 3JQQA 1F7UA 1K5DA 1UQUA 4DQUA 5DNAA 1XZQA 1LX7A 3FNFA 1SC9A 3HGMA 4JCCA 4MIOA 4MRMA 3MWYW 4AZ3B 5CB4B 3FGNA 5HKOA 2WJ6A 4B82A 2OCYC 2X1MA 3H42B 2I3AA 2BMFA 2R85A 1FDUA 2FG7C 4EYKA 1SN7A 3ECCA 3HEMA 4U2KA 1KP9A 4F71A 1EZ1A 2XMQA 4KO8A 3RSZA 5H3CA 3G8BA 1C5KA 5A5VA 1G2IA 1LZKA 1MVNA 4EPVA 2AH5A 2GEKA 4FILA 4R2XA 5L4LA 4LZWA 1EB8A 1NX6A 2HDOA 3ZDQA 3THXA 3C3XA 2QQEA 3RYIA 3PCRB 5A4JA 2XE7A 2JGLA 4NI5A 4EIWA 4I1RA 1K97A 2YMMA 3PXBA 2C5EA 2FMKA 3F5FA 3KSUA 3Q6NA 4Y2PA 4BFWA 1UEJA 3RVRA 2I6FA 1BXGB 3IDAA 1HBJA 1HYGA 4P3NA 4ZVSA 1UBRS 2B82A 4HD8A 5ERXA 4L8YA 2QLBA 1JIXA 1F2TA 2IT1A 1V7ZA 1U3UA 2MJLA 3AY3A 3QNMA 4U2BA 1FE8A 2RE8A 5M29A 2FEOA 1O77A 1IZ7A 1BC5A 1PG0A 4NTZA 2V58A 4X0EA 5BURA 3RBVA 2HIMA 4C78A 4Q3BA 4PZCA 4NARA 1XMIA 1AD2A 1JQAA 1Z74A 5JI2E 4ZOEA 1K8YB 3A37A 2XODA 3SFVA 4R98A 1VSTA 1XUOA 3P9KA 2DCMA 4NMLA 4GVPA 4ENRA 1WV0A 2H1CA 2EFCB 2YV1A 3O9ZA 3S3TA 3ZCTA 3KKLA 1M2NA 3CPEA 4OH1A 1TK9A 5GZ1A 5AR1A 2ZAIA 2NO5A 2ZU6A 3OF3A 3IFSA 3WLRA 5BT9A 1ODJA 1C41A 1XZJA 4J6FA 3DV0A 1MB9A 4U2EA 3X44A 2HMTA 3LY8A 3E22B 4AKEA 1FTQA 2Y0EA 1PV1A 5EPOA 1T13A 1YRHA 4FOPA 3WA7A 1RT9A 1SGWA 5EWLB 3RJMA 2WWYA 2LCQA 3EZ2A 2PLNA 3PF8A 1Z12A 3ZGYA 1DMRA 4L8FA 4XW2A 2PUHA 1ORVA 1NFRA 3IP3A 4G25A 4NHOA 1L3BA 2ZYWX 1INLA 1E77A 3N8NA 1YZQA 4UOEA 5U9CA 4S35A 4GW3A 3TPFA 4CKEB 1DOAA 5DIZA 5FWDA 1F4PA 4PAOA 5IBQA 1Y5MA 2O2SA 3RIGA 3UUWA 3VR5H 4BRWA 2XTNA 2H9YA 2J3HA 2DLNA 2VK8A 3HMQA 3IR5A 4EG8A 1CUBA 1QCZA 4HH3C 4Q7QA 3I2HA 4TXLA 4OQFA 4F85A 2Q4RA 1B8PA 3CWQA 5KNCD 3CIOA 3BMXA 3EC7A 4HPJB 3QUSA 1UXIA 4R6WA 3TWOA 1PTKA 3WO1A 2Q6KA 4D8VA 4EMBA 1GGJA 2AJTA 3RT1A 1GLVA 1IBLB 3RFVA 1HYEA 4X54A 5IM5A 4BP9A 2VPXA 4Q4AA 4ZC1A 4OQQA 1LLUA 2X3FA 3F4BA 3IEPA 3E03A 2H7YA 4DR5B 1AVTA 1CUYA 1F7VA 1DIHA 3K1TA 2DVMA 4ZI5A 1JEAA 4B44A 1LY1A 1W47A 2C0QA 2K7ZA 1JR3D 3IP6A 3KBBA 4LTNA 4OAOA 2IU4A 1RAIA 3TG2A 4NDAA 1H8HA 3A9TA 3E3MA 1ZICA 4Y1RA 2A59A 1F2DA 2XVAA 4WW0A 4RFLA 3GD7A 4C3ZA 1E9SA 4KE9A 1PNTA 4Q48A 2WHRA 4LX8A 3BL6A 5IJ9A 4N03A 4JSTA 4RHTA 2I55A 2XOXA 4FWIB 5ARCA 4CMJA 4C4ZA 3KAQA 4DR3B 5EYPA 3AW9A 1UC4B 2REBA 1TGYA 3MNFA 2ISCA 2DUMA 1ZN8A 3SM9A 1L7AA 4ZQFA 2VDWB 4YONB 4KE6A 2WP0A 3DL7A 3K71B 1PQYA 1MAHA 1PJ8A 4EY7A 3QU7A 2RJ3A 1L4GA 1KP2A 4H15A 3STTA 3G8CA 4S1OA 2NYAA 3BOSA 1UOQA 1UK8A 3VR6H 4DLYA 1GTVA 1FX0B 1P5ZB 1SC4A 3SF8A 4JYPA 4Q5IA 1D8AA 4M87A 1ONNA 4ZI7F 4X41A 1N1EA 1DTWA 2EBUA 1AGNA 4KQXA 5BQPA 3CV3A 1IY0A 1RC1A 3TRIA 2H7VA 2QR3A 2ZB3A 4DBLE 1U0FA 2PSSA 1GZ7A 1Y3CE 2AQ8A 2VPTA 3WJ2A 1BQ4A 3TLKA 2NM0A 3PXUA 1TM5E 2GAAA 3F6PA 3FWPA 3M2TA 1PBNA 1ZC3A 3RYCA 4EY5A 4N8DA 2BRUC 4MP8A 1A9PA 3GJ8A 3GQBA 4KE8A 3WK7A 5IT9A 3PVSA 3TJMA 3AONB 3WHIA 3VU9A 2XZLA 4DG8A 1GYPA 4HAIA 2C59A 3SBXA 4BQFA 1O87A 1ZX1A 5EMHA 2FUKA 1D2AA 2FQWA 3QBEA 2R8OA 4NCHA 5L7TA 4O29A 4F5YA 2SCUA 5KC9A 3D8BA 3AXTA 2VATA 5JD4A 2PL3A 1KOLA 4G0XA 4P81A 2BFFA 3L4BC 3THWB 2CV0A 1JT9A 3OQIB 2O2EA 1QH8B 4KIUA 5ENDA 1QZXA 3ZX4A 2UVQA 5CXSA 2OVBA 2ZRMA 1YRYE 1J0EA 1GZ4A 3LBIA 4N0EA 2WB2A 3T3OA 5DK6A 5F2EA 1ZMRA 4LZPA 4XFDA 1RI4A 5TPWB 1GTZA 1Z0ZA 2MTBA 4ATNA 1NXWA 2GCEA 2QHXA 2FP3A 2QPTA 3BHIA 3SPXA 1XSEA 4C6TA 5BUCA 5KYXA 2O7SA 4O5AA 4NNJA 1KS9A 3PB3A 3VHRA 5AM3A 3GMTA 4OHCA 3W6UA 5DMHA 3OO0A 1WCIB 3GRPA 2JZOA 3O4GA 4DR6B 3S8EA 3D7NA 2DP4E 1NUPA 2EGUA 3D1LA 1XCPA 4JYMA 4CLOB 5JHHB 5DNUA 2ZBUA 1WPXA 4R69A 2AEMA 4QRIA 3WLLA 4K9QA 4QM7A 2O19A 4AJNA 3NGLA 1GP2A 2VIIA 2VK4A 3BF8A 3LCUA 1J1UA 1L4NA 1AQ6A 2CJFA 4YK7A 4MDFA 1GKYA 5CT5A 2UUCB 1JE1A 4BMOB 2HJSA 3QEKA 2BGIA 4DTCA 3VR0A 5CFNA 1QGOA 1YA4A 4LY0A 3ZDYB 3EBOA 1H6CA 3M6IA 4IGIA 5GOZA 4D4IA 2JGEA 3HSKA 4TL7A 3HK2A 4XIIA 2VJDA 5TGDA 2R84A 2OOSA 4LG1A 5KDLA 1RE1A 1RQLA 5BNTA 1D3AA 1ESNA 3CURA 4X9XA 4M49A 3NH6A 2ZEJA 1W88B 2PMKA 1KJQA 3O26A 3DQQA 2R7AA 2GCGA 4C5CA 2P2YA 2F17A 2YWGA 2EQ5A 5CH3A 1PLLA 2ZJ8A 1FU4A 4IIFA 2WTXA 5A02A 3ZOKA 2VTBB 4WCFA 4XWKA 3IALA 1EDZA 2A1IA 3IXMA 3UOAB 2PX8A 5AJZA 3KZKA 3L0DA 1NMXA 4FYVA 3WRYC 4B33A 3GLFA 3CUTA 5HOQA 4MXDA 1JJVA 3NDIA 1KIMA 3V7YA 1VJDA 3QPVA 4FNOA 4A2WA 4B3CA 4XDYA 3HO6A 2PN1A 4CGYA 3KHSA 1XLTC 4YQFA 4RXUA 1YB4A 5CLGA 5PGMA 4DNOA 2NQTA 4L4SA 1BGXT 1UCFA 1JHPA 4TYPA 2O50A 1V6CA 3D6TB 1ONPA 3EIWA 3BZBA 1HDRA 4JC4A 4RZ2A 4X8HA 4D1YA 3HUFA 3B7PA 5KVQA 2Y2UA 1ZINA 2VQ3A 3TTUA 4D42A 5LNK1 4E1AA 5L53A 2X8WA 1QGDA 1Q0RA 1RZRA 4R1QA 2R4UA 2R00C 1DBSA 1JHRA 1UBEA 3KT3A 3HA5A 1BKSB 2OWEA 3D3WB 4JK3A 1TKCA 1XYYA 2FUG6 3T9EA 1JSRA 3V8NA 4ZOCA 3QEMB 1Z9BA 2PX2A 1FLAA 1GYQA 4P31A 3WDMA 2GNAA 4ZYXA 1MEEA 3GVCA 4E08A 3D2CA 1H6DA 1P39A 4OX9B 2UVPB 3IB3A 4RGQA 1B8OA 4CE6A 2IL1A 5I3CA 1Z2AA 1A8UA 1L7XA 3GDWA 4A6EA 4DJEC 3PDCA 2VUSA 3OSZA 4WBNB 3LQFA 1I2CA 1NKTA 4EYQA 3RVDA 5H4GA 2FF7A 4MI9A 4R51A 4CL2A 4AJKA 4CIAA 4JGGA 3MJVA 2VFAA 3GA5A 4IY1A 1YB1A 1RCUA 3AUJB 3KKOA 1KK0A 4G4JA 4OHXA 5D8DA 4CM6A 1JR6A 5ECYA 2ZRKA 4ZALA 3H2HA 4BVKA 4AROA 2UUOA 2EWWA 1QV7A 3TW4A 1E9EA 2GARA 1HF3A 1JNYA 1IPEA 2AMLA 1G291 4QJ4A 1ZN9A 3TE7A 2Q3DA 3QFRA 3NTOA 4JYAB 3GJQA 3JPWA 3R8CA 1D7AA 3OE1A 5HGJA 5LP6F 4BOYA 1QF6A 1JW9B 4ZANA 2AVNA 3AR6A 4NBRA 1KS2A 3EEIA 3PNSA 3QXGA 2WRZA 2XGJA 4MVYA 3IIEA 4MLDA 1QGED 2LVBA 1C14A 2IHKA 2W42A 2AZ4A 2Y3IA 1XF9A 4HWRA 3ZCSA 1TD9A 4J9UE 3UENA 1Z5NA 3EEQA 1X1EA 2AUNA 2AA3A 4X1YA 5JLJA 2AR7A 2FOIA 2WWGA 1SXJD 3I4CA 5HKAA 2JA2A 1S8AA 2FEKA 2VZ0A 3ZS9A 2QMEA 2UZ4A 3PTZA 2VBCA 3BGOS 4B2LA 5B30A 4IINA 3GJ0A 3OJCA 2HRZA 1DWQA 3VHQA 4DLSA 3UTCA 1ZU5A 4JL8A 3QE4A 3OICA 4EW3A 1EWRA 1KSJA 1RZVA 2O48X 2PQMA 2E6KA 2P9CA 4YQZA 5C80A 1ZH4A 2HRCA 2PSFA 2Z57A 3KB6A 3NONA 1Q0QA 1USVA 3WYGA 2QIPA 1PJZA 4EPYA 5TF4A 1BKDR 3L7OA 1IN8A 4L6CA 5H8WA 3MLEA 4ZRNA 2J48A 3H84A 2BZSA 3T61A 3IJPA 2I7TA 2PSEA 1WB9A 4NENA 1WXIA 5EHIA 2RH8A 2HHCA 3PVZA 1C3OB 3QYFA 4WESB 4MWDA 1DCTA 1P72A 1E3WB 1YAJA 3TRFA 1G5IA 5HUHA 2YWDA 4XWTA 2E5WA 3FCOA 1SUEA 2OEPA 3I6IA 4RK5A 1QK5A 3FROA 2VH2A 1BSVA 2GEBA 5A9TA 2I6GA 3FUXA 1P8JA 2FJPA 1ZUWA 1K5PA 1KC3A 4RL4A 1KY4A 4X20B 3DKRA 5BQOA 2XA9A 1JB9A 1QF7A 1VB5A 1V6SA 1NUHA 3OSUA 4PXYA 1UWKA 4ND6A 5HDBB 1P29A 1U3DA 2ZUTA 1VE1A 1GPLA 1DKUA 4AS2A 3BWMA 3T15A 4N5NA 3INYA 2GQ0A 5I9MA 1MO2A 1JKJB 5DW0A 3D3QA 2VP9A 2R7LA 3VR4A 3EN0A 4TN5A 4OJQA 3E23A 3PHBE 3A11A 4FFWA 1SQGA 3S8MA 1Y3DE 1EJ6A 1Y6ZA 1J0BA 1ADFA 4F5DA 4MYUA 3ANLA 3GVPA 1X8JA 3U0VA 2ZJ0A 5FBQB 3VDNB 3NRCA 4B9AA 5FOVA 4UU0A 3AUFA 3UHJA 3I73A 4BQSA 2HBRA 2P0EA 3HYSA 4ZVMA 5KBYA 2DPXA 3D0KA 2HQRA 3ESDA 5EUCA 4KO4S 3C6BA 2BFNA 4U6SA 3AFMA 4L72A 4R7GA 3HZOA 2V6GA 5AQ1A 3ECSA 2Q1SA 3HN6A 2NYUA 4P7GA 1W5BA 1EHYA 5HRAA 3SXUB 5L6LB 4HDRB 5JPIA 1L8LA 1AZSC 3AF2A 3WBFA 5JUWA 3FCYA 5B5SA 1ZOIA 1OWMA 3MBKA 1YQGA 2CE2X 4UD6A 4HMQA 1EU1A 2PV0A 2MYPA 4J1TA 2ILTA 1E63A 2VDPB 3QUQA 4EQ6B 5KYKA 3D1VA 1XL0A 1ZD8A 3H97A 2GKOA 4N8EA 4Q9DA 4MS4A 3OM8A 3ZE8A 3AOEC 1C1XA 3DS8A 1YS9A 5SZIA 2CHUA 4ZTBA 5AW6A 1N33B 1OXUA 1YVRA 3JRXA 4L8LA 4A2CA 4CI9A 3IRVA 3A4NA 3UF0A 4WY8A 2JJ2D 1DV1A 1EVIA 2W6NA 2W6OA 1KY3A 1SXJB 3L0OA 4MUIA 4YV2A 2YYYA 1JDVA 2FSIA 1P9NA 2Y4OA 2QD3A 2WD7A 4PPGA 4C0JA 5TMPA 2NSLA 3AYZB 3VR3D 1PJ3A 3LKBA 4NZNA 3G8YA 2RH5A 3ETJA 2EEPA 1LB1B 1GQOA 1U6KA 2R3SA 4BVHA 4YFVA 3JATA 4ZK6A 3T4EA 4MV0A 2WILA 3TFQA 4Z2YA 5EA2A 1KJWA 1A97A 1P31A 2DBZA 4LJ5A 4PVCA 3W2EA 4UM9B 2D54A 3PFIA 3ZK7A 1P91A 4IIJA 1X1SA 5THKA 1Y9DA 2OQIA 3ZU3A 2DHQA 4YGXB 1A98A 2JAXA 1KEEB 3KR0A 3B5JA 4MRVA 4S1VA 3ZWNA 1E1DA 3N07A 4KSYA 2W0SA 4LS3A 4FFVA 5E3IA 3AEYA 4PXSA 3FVTA 3U37A 1J2YA 4PLWA 3BJEA 1QMGA 1J7JA 2PZLA 5CMLA 4CQMA 4YCDA 4P82A 4Q6WA 4CT0A 1NJSA 4G26A 4H6XA 4LOIA 5FPTA 1EIWA 3K2QA 1CF2O 16PKA 4A0QA 2D8MA 4ID9A 4INAA 4KO2S 1QGAA 1ZNXA 4EHLA 2XXAA 1ONSA 2C5GA 4JDUA 3LQ4A 2PWZA 1DKMA 1N8TA 3RUFA 2FMUA 3T12A 2YJGA 2GZRA 4JJEA 1EB9A 1FQKA 2H0QA 2XVYA 3IA7A 2DCUA 1G20E 4IIXA 5I9SA 3KVNA 3PV0A 1WQ1R 1HL7A 4OGFA 4MW5A 3FCAA 4BU0A 4LF8B 3F5QA 3EIXA 2F55A 2PWPA 2YNMC 3ITEA 3EVBA 4TLBA 4ALJA 1KJJA 3A9VA 3FMGA 3AIIA 4UZSA 1WM1A 3PITA 2O2CA 2OY0A 1VGRA 3TSYA 3DAFA 1NMYA 1IM8A 4HAZA 4TMYA 1JIVA 3IEXA 4FGLA 3O8QB 4QQ8A 4PYOA 2CL6X 1NW7A 3QU9A 1Y5NA 3KQVA 2RB5A 3NPMA 4IUDS 4LI0A 5DM4A 3GN2A 2NO4A 1AV7A 3EXFB 3PICA 3ZWWA 1JLMA 1BHSA 3V3TA 3LCJA 4AX4A 2BFDA 1KI7A 2PMCA 1JE0A 3L6DA 1A2BA 5EP3A 1YQWA 3HBAA 2BCJQ 4RFSB 3VDQA 3Q3JB 2FWIA 3N6VA 3IILA 1Q7CA 3KXLA 1XHFA 3TGLA 3I9KA 2PKYX 4D3SA 2PZKA 5CA0A 3FFXA 3ZLVA 4QG3A 2G5PA 4V0KA 4IHJA 3RRYA 4AP6A 1QFJA 2R8XA 2BM1A 3WIEA 3E7PA 1VJGA 3TEJA 3JXEA 4LC0A 4LJYA 4AN1A 1BE0A 2REQB 4EFNA 5IDWA 3OEHA 4DV5B 4PIMA 3GARA 3SYTA 5IZ4A 2BGMA 4FW9A 1VHDA 1QG2A 3DZ8A 3ZBPA 4CKBB 4P0TA 1Q3KA 2LRHA 3CLUC 3DGEC 4MS1B 1CLUA 3CO5A 3ANXA 1KDZA 1PGOA 3DL2A 4G1BA 3PWTA 4U4AA 1P0CA 2AI1A 5BSWA 3ZHCA 1W2WB 2PBRA 5M04A 2E0IA 3H1BA 4EGQA 1QQ7A 3R5FA 1MF7A 2C1EA 3HM2A 1ATZA 3V2HA 4PGFA 1CFZA 1V5EA 3OQJA 2W43A 1BGWA 1TUBA 3N2LA 1QX4A 4WH0A 5K3AA 1IC6A 3RC9A 1XEAA 3EQ7A 3OM9A 3GLHA 2ZZMA 1R15A 2WHQA 1AKYA 2I7DA 2PRSA 3V1MA 2XD9A 3ETLA 3ZQ4A 4BUCA 4DBZA 2VPQA 1VL1A 4GRIA 1EUCA 1E5XA 4MQ4A 2I3GA 1FRVA 1MO6A 1PHPA 4MKRA 3Q85A 5K0LA 3EXAA 1VJTA 4JJZA 5JCOC 1OB2A 2IUYA 5FT9A 4EY4A 5ARBA 2G1PA 3DYVA 2NQ8A 3PC3A 3PVCA 3ROMA 4FW8A 2IA5A 4QUGA 2IXTA 2VP6A 4FX2A 1TVKA 3V1NA 3TZEA 1CF4A 3A1VA 3GAZA 4KJXA 2V6FA 4ZCPA 2XKJE 1II0A 3QVLA 1ZR4A 4KBGA 3VAAA 3UXHA 3VVCA 2HK6A 4HEJA 4AL4A 2IPAB 2NVUA 2OHHA 4GYWA 3X3HA 3Q7RA 5KB3A 3DLPX 1ADJA 1E4YA 2XADA 1GCGA 2OZLB 3BMOB 4HSEA 4L5CA 3DZFA 3LXXA 1TCBA 2QT9A 3OWOA 4PX3A 3MINA 1V96A 1L4UA 5F1OA 4JLDA 2C99A 2ZJZA 3K5PA 4PWZA 5FA8A 2I0FA 2C61A 1YAHA 3IQGX 1LBEA 2WWIA 3K30A 4UJ5A 2BEWA 5ARDA 4FYHA 3NNNA 3O8OB 1FMCA 4L2IA 1JEYA 2I9KA 1FTWA 2AFHB 3G9TA 4Z0TA 1XTJA 3RC7A 3VZQA 5BWNA 4F2WA 2IUTA 5CB4A 2F8MA 5EUMA 3IOCA 1FRZA 4EYEA 2GPAA 1W2HA 1PP4A 4HDKA 2D59A 4OMDA 5CH8A 4K9MA 1WL8A 4TVSA 3DYIA 1SELA 3FCEA 5AM4A 3W79A 2F00A 5E1MA 3ROTA 1CIJA 3R0JA 1O7JA 3QXHA 1R7RA 3JQBA 5HQ3A 4RSRA 1Z5ZA 5CFOA 3BUSA 2C4WA 4PRZA 1M0TA 4PY2A 4XM2A 5DK4A 1QQ6A 4D0RA 4HWSA 3OC6A 4KTTE 1V37A 2VK2A 1A9RA 2QTLA 5CIQA 1W4CA 4JLWA 2OTCA 4J0GA 2RCNA 1P6XA 1MRSA 1SULA 1DBIA 2WKRA 3SSNA 1KARA 3VH4A 3KKZA 3KOXA 3GT4A 1I4DD 3SEQA 1FVFA 4PZ9A 4EMTA 4AFNA 1R4NB 1XRPA 2PR2A 3QFFA 1VPWA 2J5RA 1SKMA 2ZCJA 3WYCA 3NEYA 3R41A 5ADUS 2PUEA 1IHDA 2BTQB 4P36A 3V32A 3PCTA 4HQ0A 5IASA 1YQQA 3QLUA 5F9MA 5FTJA 5FULA 1V2HE 2BJVA 2C7BA 2FZKA 2VHTA 4GX0A 2XQIA 4B43A 4Q7MB 2VL7A 2Q0SA 3AKCA 1V71A 3CLVA 5CLIA 2ENUA 5IS2A 1Z73A 5TQJA 3USZA 4NF2A 2PUCA 1IRXA 1G6KA 2ZRJA 4MV4A 3HDJA 3LE8A 3NDBB 2O07A 5FPKA 4RKWA 4QD3A 5C1IA 2YWCA 2JGDB 3E9CA 4ZO6A 3B38A 4BV8A 3CF6R 3AHGA 5H4HA 4CF4A 5KNCH 1S1MA 1SUIA 1RMYA 1JR2A 2CF5A 2PH3A 2X8BA 3FZGA 3VOTA 1IIRA 4S2UA 3IAM1 4WNAA 2ZIEA 3PE3A 2KWIA 4B47A 3A6KA 4F9FA 4CEHA 4UU8A 3EQ6A 4YAWA 1QQAA 3MILA 4P84A 1L9XA 1N75A 1P2TA 1QHHB 5TPZD 1YL5A 3ZLTA 1A9ZA 1E4EA 4V0OA 1RWXA 4MDYA 4N76A 2D2FA 4MMYB 5EKSA 3SNKA 2BDUA 3HS3A 2P90A 3WIBA 2PA3A 3I9NA 4AMGA 2P4HX 1EGAA 4QWMA 4DT1A 4NC9A 4L07A 4C0SA 5LQRA 2R68A 2OXIA 3MMXA 5BR8B 4EY6A 3JYHA 4HDAA 2QN1A 2EG5A 2NU8B 1QLWA 5HBGA 2WA2A 4A8JC 4CEJB 5F5LA 5CEJA 2WJ3A 4P38A 4C76A 1GGFA 3ND7A 3ZXXA 1JEJA 3A6JA 5T4EA 4KXUA 3S6JA 2LWIA 1LZLA 2FK7A 2Z4TA 4CV1A 1T1SA 2GXUA 2C8JA 3HJRA 3NO4A 5CK4A 3WDSA 4AJEA 2P78A 1BFDA 1JVBA 1TW2A 2Q2QA 2XUOA 3BWBA 3MWLA 4GMXA 4GPBA 2H1SA 1LSUA 3LUDA 2EWMA 4MV6A 4XXHA 4C7VA 5JNWA 4Z53A 5AKJA 1DEKA 5A5EA 1N7HA 4D0LB 3CO0S 2R60A 5CRIA 3MMZA 2FRDC 3DR5A 4UD2A 1PWZA 1Z47A 3PEVA 1EP2B 2ZR0A 3E82A 4FEGA 3P7MA 3RBAA 1DX6A 2AKYA 2C2ZA 2AV6A 4CTMA 5I4IA 4G0OA 1XDUA 2HZ7A 3BCUA 1C3LA 4QO8A 4ZQBA 2WTMA 1Z25A 4MPJA 3UMJA 2GVZC 2A30A 3ZV7A 3RV3A 5H82A 1CQWA 1L4YA 4B3SB 1DXQA 1A27A 2QZPA 4EG5A 1URPA 2P27A 5M3BA 2CNWD 4RORA 3EIEA 4NBVA 1U63A 1C9EA 2J46A 3T7AA 3E15A 5AM2A 4WX2B 4EO7A 1J5EB 2WF9A 1W5SA 4BEWA 1QNLA 2V1XA 1U4SA 2DKNA 4HAVA 4PEVA 1WG8A 1EX6A 3UMFA 1IBSA 1TYAE 1V39A 2DRIA 2CDBA 3G1WA 3GP5A 4Q4JB 2H16A 4YUWA 3ITNA 2JFOA 5A7HA 2C88A 1X80B 2IIBA 2QZZA 2ACKA 4EARA 2XCSB 3DZBA 2EGGA 1CZHA 1K7YA 1SEPA 2YCBA 3BEDA 4OI2A 3V7FA 1GG5A 4KFUA 3ILSA 4C0AC 1QANA 2H4ZA 4RTKA 1SBZA 2JCVA 5DH9A 5H59A 1VXRA 5LA6B 3GEPA 2IP2A 5JYDA 1R6TA 1M5TA 9ABPA 1Y8ZA 1B1CA 1JAXA 4U7HA 2WTUA 1PW7A 4JA2A 1GNLA 2KSQA 1MX1A 1TW3A 1NGSA 2C2HA 2NYRA 3OA2A 4L0CA 4HYTA 4PZEA 4RMJA 1PDWA 5CUQA 5CFQA 2BLLA 2HFJA 2YXNA 2O2ZA 2OV8A 2W2PA 3PHGA 4HN2A 4WFQA 4BMXA 3WYNA 1E0SA 5DM70 3OQMA 1V1MB 5JQGA 3NTUA 3PUHA 4OKIA 3G0BA 4MH0R 1F12A 1XQXA 3CUWA 3HJNA 4LBVA 3RUAA 4EENA 2C4TA 3QVXA 3EMBA 1X92A 3LCVB 3GZTB 4U00A 2KE5A 3EULA 3I0ZA 3MGGA 3PU6A 5AJYA 4OHVA 4DVGA 5JD5A 1ONBA 2FN8A 1WLSA 4FSHA 3FKJA 1E79D 2RGXA 3OH8A 4XDGA 1M8GA 1J23A 4WZBE 4YAEA 3TVYA 4BS9A 2PKQO 4TTRA 3OZ7A 4IFEA 1RD4A 2IQ5A 2FPPA 2O3UA 5F3RA 4ACBA 2NO1A 4EQZA 2QRPA 4EJ6A 1VJ5A 2J0VA 2OO5C 3ZR4B 4HYEA 2RGGA 1AXEA 1XNRB 1RHUA 1T9BA 1LLQA 4MWZA 2N42A 1YB2A 3E0QA 3ASZA 3DZKA 4GHWA 2MSNA 2LXNA 3RREA 2HMWA 3VUEA 4BKMA 4B3HA 4Z7NB 3HXMA 1EVEA 2VT2A 3Q2KA 4C9BA 4HYYA 1GZVA 1RR6A 1U2PA 1W1IA 3RI3A 4JSRA 3W2HA 2PX4A 3HL0A 3R5JA 3A31A 4G1FA 2HLDD 1HRKA 3A4IA 4I1UA 1PLKA 1UDXA 4RPIA 4IMIB 4O5OA 1QIHA 4LVOA 3WZ2A 1IVSA 1IEWA 4RD2A 3IUQA 3NP9A 5F78A 3CEMA 3OPYB 1C7FA 4K3UA 3ESCA 3NCHA 4IOMA 4KQ2A 4BXOB 2VUHB 3E4CA 3ZZNA 5KDOA 5TEVA 2FKAA 3ZHYA 1P5FA 2IZOA 2JIZA 3OO1A 3SEFA 3NTQA 1J24A 1K7CA 1TJPB 4HLDA 4EHDA 1J0CA 4LJKA 1UDRA 2PAFA 5SZKB 2IH2A 3CY6A 4NQRA 4PV7A 1GQRA 1VDMA 2XWBF 3QPAA 1GADO 2QAGA 1QFXA 3K1AB 3A0RB 3A2LA 4OK5A 2XBUA 3U31A 4E7PA 2PBLA 5H80A 3WIVA 3EXHC 2PS9A 1AUVA 5I48A 1U0SY 3HYRA 3I2KA 1KMCA 5B58C 2GF0A 4LYAA 2Z6UA 2G28A 4Q0MA 1L5RA 5DNDA 4ND4A 4UE2A 4WXEA 3WZMA 2O8VA 1B4DA 5LYJA 4ZDJA 1AS0A 1T2UA 1ZUNB 4IH9A 4P4UA 2PU5A 3ODPA 2FDRA 1U81A 2QTWB 2XNSA 5I9NA 1BE1A 2W8BB 3CSDA 1DQNA 1W94A 2W2KA 4UNRA 1HV8A 4YAFA 3K0HA 3UT5B 2PSJA 1J70A 2BN4A 4FYWA 5IG2A 1DEHA 2Q9AA 4D9FA 5GPBA 3ZWKA 2UYYA 1ZW1A 1VPLA 2N75A 2ZYSA 4RKYA 1E6LA 4M7WA 1OBHA 4WVLA 5C34B 3M82A 2I4LA 3M6XA 4RPCA 3S2FA 3ZX5A 4NOLA 2QL5A 5HILA 4BE7B 3AEZA 2QMZA 3H4IA 3H11A 4PSVA 4IGFA 3P9NA 1ZD4A 1WDKA 4YIKA 2WHYA 4PTYA 1PFWA 5BQXA 4TQGA 1W4LA 4HSGA 4Z9XA 2YL2A 4TSFA 1QDLB 3ENNA 1Q11A 2Z2YA 3DP9A 4MQLA 2QUHA 3FPJA 3KJXA 5DTJA 3K2EA 2BKLA 2GAIA 1F6WA 3Q15C 121PA 4M7PA 2NU9B 1SOVA 4BLWA 2ERCA 2FQ1A 4B79A 4GO1A 4GOMD 3NJ8A 1RYDA 1ZCAA 3NOQA 2G5TA 2HGZA 5ICFA 2NG1A 3GFBA 4HVTA 3WV4A 4AUNA 5KUTA 1E1CA 3HCDA 3SHTA 2JFVA 2PD6A 2Q2WA 4FNAA 3UPDA 3FD8A 4EHIA 2C7VA 1EGQA 3JWIA 1JEQA 2O8NA 1YE3A 4LJ7A 4ZVQA 1WUHS 1V11B 1GCUA 4RV4A 1NZFA 2GD0A 3ECAA 2V7BA 1F06A 3G6KA 1QO9A 4I1PA 3I6MA 4LPSA 1PNRA 2JAPA 4L85A 4U7DA 1M3SA 1TU3A 1ZK4A 3L93A 4PC7A 1JIJA 4CRWB 4YJ2A 3FDIA 2H7CA 1HOTA 4EY3A 2BFCA 4LZJA 3TEFA 2W37A 4JT2A 5LU8A 4DWOA 5GOTA 1ENZA 2XGSA 3AI3A 5F98A 3W5AA 3E9MA 3OI7A 3HY3A 4C21A 4N48A 3R40A 4G5QA 4UXJA 3UFBA 5IKOA 2YWEA 3OM0A 1WU8A 4JI5B 3QE2A 3DVRX 1JXOA 1FRQA 3DW1X 2BFBB 3WX0A 2PIDA 3GF4A 2QRVA 1GRVA 2J85A 3ZN2A 1GUDA 2A1UB 3JARB 4TLEA 3IMGA 3UXMA 2WZBA 1TIPA 1LKZA 1AQNA 4L50A 1P73A 1PJBA 2CZQA 1DIAA 3H17A 3P2OA 4GNRA 4QDXA 2V7PA 2AXNA 3A1WA 1TE2A 3K4QA 1NONA 2P30A 2E4XA 4TV9A 4NOJA 5JWRA 1KDYA 2A6PA 4DA7A 2ROQA 1DBVO 2PBZA 2WZQA 3H9EO 3QKRA 4F06A 2FFRA 1J5PA 2K5UA 3FFWA 3FKSD 4ZAXA 4EGCB 1CG6A 2A0YA 4YLGA 1X7YA 1RHMA 1PUXA 3H5OA 1RQGA 2GPJA 3QWIA 4DM4A 2GA9A 4YCBA 5D6OA 4IM7A 1M2VA 1XIVA 3MMSA 2W2TA 1FUYB 1J8YF 3KHUA 1CNMA 3OX1A 4YJDA 4OGKA 3LTNC 1X9GA 3CE9A 2H4WA 2C4MA 1PV4A 1W49A 5DW3A 2PWAA 3DUFB 1RQRA 1DDGA 2XT6A 1RYHA 1OHHA 3FZQA 1JZQA 3KUXA 4MK4A 1TQ4A 1G3RA 2WIJA 5HP4A 4PQEA 1YDMA 2PLAA 3LYUA 3WLEA 1YS6A 1ISMA 4B73A 2Z9BA 2FPGA 1NM5C 1JAHA 1F20A 4KX5A 1HSOA 3ZY6A 4AECA 5DZSA 2ZJFA 3CLTC 4DYVA 3N59A 4V0ME 3VNBA 4Q3CA 1QG6A 2X2EA 3A10A 3MFQA 4A1FA 3E3OA 3L6UA 1GSOA 4GECA 4M46A 3T5TA 1P80A 3AJ8A 1OH7A 1O6FA 3Q5EA 4WSOA 1UJ4A 1ESEA 4XTRA 4F56A 1KOJA 4LC9A 3T8YA 1GN9A 2XDWA 4JT8A 5E6SB 1WULS 1A9YA 1POXA 4B5LA 2CD9A 3M33A 1NBOA 3ONFA 1BN7A 3KVOA 5TQ2B 5C1DA 1WMEA 2B35A 2IUEA 3KLMX 4KODA 2CUKA 4MUEA 5IARA 3X1YA 1VPEA 2ATXA 3UWKA 5FUQA 2VYCA 3WLAA 3B2NA 3IPYA 2DERA 2P0YA 3E3AA 2LZ0A 3DHNA 2DM6A 1NMZA 3F0TA 3HVHA 3L8MA 2BUAA 3MQ2A 1XFAA 4LRYA 1J25A 1EWYA 4JJ6A 2JIDA 2JA1A 4EZIA 4RD6A 1GHTA 1VBNA 4OL9A 5HSGA 5JDCA 2Z4RA 3Q0TA 5KSOA 3RRMA 2VSQA 2X5JO 5ESRA 3LL7A 2YHAA 1I13A 1V5GA 3S2YA 1R0YA 4LMAA 4HUJA 2QRGA 1N0WA 4U0KA 1JFFB 2OFWA 5FNVF 3PIDA 5HKKA 2ZM5A 2JJQA 2MINB 3QKSB 3UQZA 4N47A 2Q62A 1KZ4A 3QMWA 2GZ3A 3VZBA 2MSLA 3GPLA 1CK4A 2G09A 3GDFA 2P9HA 1QOPB 2HQ1A 4KI7A 4EHBA 2J4FA 3B48A 3QELA 4G8JA 3LO5A 4Q7KA 5KTOA 2MSKA 1K8ZB 2ZK7A 1G21E 1M1YB 4QBHA 1JKXA 2XX3A 4K0RA 1L7VC 2IBSA 3L7NA 1A8HA 2HCJB 2VHZA 5IT0A 3U3XA 2FCAA 3JQAB 3K6SB 3BG5A 4HY3A 1QYDA 2I2BA 1G7SA 4WK4B 3VVBA 1ZA2A 4PO1A 4WN9B 2VF5X 1OC2A 1RAGA 4G09A 1PL0A 2P69A 2ATIA 4URXR 3FYTA 2QRNA 2A92A 1K1EA 1TZ2A 3TZCA 4DZRA 2CLSA 1TCVA 1UMDA 2ID9A 3FCSB 2G40A 4QGSA 3UKJA 5GJBA 3EIQA 3IAEA 1PG2A 3IP7A 4H1UA 2W9XA 4MROA 1E6MA 4OHZA 4GBMA 5DX1A 5I3ZA 1MVLA 3E70C 2OD7A 1I9CA 5C7LO 4BFUA 1PL6A 4CIBA 2PGIA 3PEFA 2Q4DA 4DLBA 1E64A 1FJ2A 5EJ4A 2O3JA 4KZPA 4XJVA 1W0JD 1M2HA 1YZYA 2W6JD 1GGMA 2I99A 4ISCA 3MMPA 3OEWA 3PGA1 2GYVA 5DULA 4EVIA 5C5CA 1Q14A 1PWXA 3CR7A 3IL2A 4C2TA 1CRPA 3O2NA 4Q9NA 2X1VA 4LC1A 2IPLA 1X1QA 3AM5A 1UMKA 3O73A 5ALJA 3V1LA 1F1JA 4IEIA 4MW6A 3TKAA 2PPVA 2EARA 1P8AA 4B6JA 4CTNA 1NU6A 3LXRA 4B74A 4DLWA 4JP2A 1F38A 2P9BA 1VRWA 5F3WB 2IS2A 1VI6A 1PSZA 2Q50A 4GUAA 1O2DA 3RWMB 3FDJA 5D1HA 1BG6A 2ZWPA 4G0UA 1GSIA 1D2EA 1X7ZB 3L79A 4QVKA 3B7WA 2XCOA 4L0QA 4Q9LA 5LUBA 4ZDIA 2QPLA 3QW2A 2PLRA 2VHUA 3AGQA 2ZS8A 4F21A 5K0SA 3M6WA 2PWYA 4YALA 5FO0A 1SVOA 2G4CA 2P6PA 5A3SA 1UF9A 5JASA 4DSNA 2O0LA 2VYND 1NHGA 3MXOA 5F51A 2NO7A 1JA0A 1LU9A 2EQBA 4I2NA 4JASB 4QTZA 4UARA 5T57A 1GG9A 3FPHA 1E2QA 4ZAFA 2CLIB 2J0EA 3GOHA 3NB0A 1T2DA 3PQCA 1EFCA 4L5YA 4ZEXA 3VSEA 2PUDA 3QHAA 4HDNA 3OZCA 4MKHA 4BO0A 1TLTA 1EWTA 4GVLA 2G4LA 1VL5A 1XTUA 2G76A 3NEJA 3R5SA 3F49S 1CQJB 3I64A 2H8GA 3UWMA 2MT9A 1QJ4A 5JBQA 2QI9F 1X6VA 2GZAA 5CURA 2C96A 3ZQ6A 3MOSA 3OZXA 1PZNA 2CCJA 2HYIC 1KHTA 1W35A 5D00A 1L6RA 4Y9DA 4XE5A 4I8IA 5EPUA 4C4YA 2RHGB 3FVQA 2QGZA 3QBJA 3H7AA 4ZVUA 3GZNB 5GM2A 1W4AA 3ZLUA 4BBZA 4CM8B 1BX1A 3LPLA 4M9CA 2A86A 2QK4A 4RE5A 3NBKA 4ARUA 2YY7A 2V9PA 1T6YA 3OPVA 3KQQA 4ZJPA 3AGPA 3P9RA 4JXJA 1WQ4A 1UDBA 1PZGA 1KZGB 1S2GA 3C8UA 2UKDA 3EVGA 3G7NA 1HI9A 5G0UA 3OX2A 1F4VA 3DFKA 1WHSA 4FCCA 5BOSA 1KF0A 2GBLA 3RH0A 4IIYA 4V39A 2FSVC 2WJVA 3HDHA 4GR5A 3BH0A 5IH3A 3VO2A 4AZTA 4KQCA 1J1ZA 3FLBA 4ESEA 3DT6A 2QTVB 2CXUA 1C4XA 1NNI1 4K86A 1LGYA 3PQDA 1NN1A 3N6RA 4RCZA 4HLUC 4CV0A 1UBUS 1DJLA 2FEWB 4JUFA 3N2YA 2Z1DA 4Y9SA 5EHNA 4I4LA 2POQX 1GKIA 1QLHA 2C3PA 2FP4B 2QD1A 2ZJAA 4JX8A 2HQSA 3K9NA 2J07A 3SHQA 3VMFA 1ZJ4A 1RXCA 3NHBA 4TQ9A 1S4MA 4DV6B 2KHZA 2FPOA 4MKZA 2HSDA 2W2XA 4H7EA 1N1GA 4IFIA 3P2MA 2NADA 4CJXA 4JKOA 1G6HA 1E2EA 4IXTA 1BMFA 1ZMXA 4H3VA 5BNWA 5KKCA 3DEZA 4KVGA 2G1AA 2R6R1 1E6UA 2AMJA 4BFTA 2F1IA 4YDQA 1OFUX 2CHGA 1Z7BA 2XDYA 2WJJA 4M0FA 4KXYA 3NG1A 1X87A 3I0NA 3RTCA 1IHYA 1VJRA 1ZCBA 2TYSB 3FOAA 1NC1A 5I7UA 4O33A 1K06A 4YT5A 4EB8A 1M1XB 4N6OA 4R2IA 5FX2A 1L1RA 2FA9A 3OJLA 1W30A 4MAAA 4D6PA 4DLTA 4Z4GA 4P5DA 1PSDA 1SC6A 2C5SA 3TNYA 3V4PB 2B92A 1E7RA 1C3EA 3NVKI 4CXMA 5K20A 1RZ3A 1TLFA 3CINA 5KU7A 5F1YA 1VYTA 2IX3A 3AIKA 3KC2A 1WCYA 2IY7A 2Y92A 1A8QA 4O1HA 5U4XA 1P2SA 3F47A 3HKCB 3FM9A 3FUCA 4JITA 4LDPA 1G20A 3ELDA 4DDKA 4E2ZA 1WIWA 2ID8A 3EE6A 3WG9A 4QASA 3J81k 2HWWA 3W2FA 4NFLA 3H8SA 5IVPA 4OGGA 4GPEA 4NCXA 1O94A 4RIGA 5JSZA 2HU8A 1V3TA 2C3UA 4NR0A 2FI1A 3C3KA 3DBRB 5ALKA 3KYDB 2AX3A 1RI2A 3I04M 1FP7A 2HA3A 3EFHA 4GBED 4GXNA 2QXUA 3C7AA 1L5SA 3E0XA 3D9QX 3KO8A 4ML3A 1WSDA 5KU1A 5I7WA 1MIHA 4FZJA 4QGAA 2AXQA 2RFLA 3LPAA 3PWZA 2NU7A 1Q1ZA 3P9SA 1KXJA 1OFUA 4Z9BA 4ZI3A 4ZT2A 2PRKA 4N7MA 3UB3A 1LA2A 1RTKA 2XW6A 4WCVA 2OV6A 4INOA 4H2DA 4AULA 5C1OA 1OI7A 3ZY2A 4IGAA 1BD3A 3W06A 3DKIA 2DYKA 2BTOA 2I5PO 1DX9A 3RS2A 2RHMA 3ESQA 4JB0A 3DL4A 4ZKDA 2WSYB 3VXKA 1ZOOA 2RGAA 2HL6A 1NW9B 1N2BA 4CFYA 5IUNC 2QD2A 1Y63A 3TR0A 2OGUA