2EX1A

Crystal structure of mutifunctional sialyltransferase from pasteurella multocida with cmp bound
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
388
structure length
379
Chain Sequence
MKTITLYLDPASLPALNQLMDFTQNNEDKTHPRIFGLSRFKIPDNIITQYQNIHFVELKDNRPTEALFTILDQYPGNIELNIHLNIAHSVQLIRPILAYRFAHLDRVSIQQLNLYDDGSMEYVDLEKEENKDISAEIKQAEKQLSHYLLTGKIKFDNPTIARYVWQSAFPVKYHFLSTDYFEKAEFLQPLKEYLAENYQKMDWTAYQQLTPEQQAFYLTLVGFNDEVKQSLEVQQAKFIFTGTTTAEGNTDVREYYAQQQLNLLNHFTQAEGDLFIGDHYKIYFKGHPRGGEINDYILNNAKNITNIPANISFEVLMMTGLLPDKVGGVASSLYFSLPKEKISHIIFTSNKNNPYVKVMRRLGIIDASQVIFWDSLKQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords a2,3-sialyltransferase, a2,a6-sialyltransferase
publication title Cytidine 5'-Monophosphate (CMP)-Induced Structural Changes in a Multifunctional Sialyltransferase from Pasteurella multocida
pubmed doi rcsb
source organism Pasteurella multocida
total genus 130
structure length 379
sequence length 388
ec nomenclature ec 2.4.99.4: Beta-galactoside alpha-2,3-sialyltransferase.
pdb deposition date 2005-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11477 PM0188 Sialyltransferase PMO188
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ex1A02
3.40.50.11120 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ex1A01
2EX1A 2IIBA 4V2UA 2ZWIA 4V38A 2II6A 2IY8A 4R83A 4V3CA 2IHKA 2C83A 4V3BA 2IY7A 2EX0A 2IHZA 2ILVA 2IIQA 4V39A 2C84A 3S44A 2IHJA 4R9VA 4R84A 2Z4TA
chains in the Genus database with same CATH superfamily
1RYEA 2CHGA 2CUKA 1ZP6A 2DAPA 2WF8A 1N1MA 2YASA 4DNQA 2Q5LA 5KIAA 3HZOA 1KDVA 4CG3A 2EEPA 4E2FA 3KWLA 2C0PA 2F8TA 4JZYA 1K86A 3B3FA 3ZD8A 2WU3A 1M66A 3A04A 4U2BA 1KK3A 1SHJA 1XRLA 2Y05A 4J0DA 4IO0A 2NQTA 1UBHS 1CZKA 4KI7A 4B87A 1X77A 2Z6VA 4FD3A 3F49S 2OZVA 1U2PA 1DG3A 3NVKI 1R0LA 1T35A 1Z4NA 2NGRA 3BXFA 2NZWA 3ED5A 3R23A 1HLGA 4LDJA 1VL0A 4N5LA 5DX1A 5FUWA 2AD5A 3QXXA 2JCSA 2L0XA 3TEFA 4DWOA 2AEJA 1P5RA 3TD6A 3K6SB 2O54A 3ZXYA 4N5IX 5LFAA 3FY4A 2JARA 2VEOA 4JQZA 4OI2A 4UU1A 3VH2A 2RAUA 3PI6A 3A70A 2B3TA 5IAJA 2FE4A 3IKVA 3H11A 3BGDA 4MRPA 4LMPA 2G1JA 1AQ6A 2FP3A 3ICVA 3P5BA 4J1TA 1O94D 2APJA 1WUHS 4GPBA 1RCFA 3GVXA 2DT8A 2AVNA 5HGXA 5KDDA 3EH2A 2HCTA 1SBQA 3NWBA 4XUEA 4OAPA 3CW9A 4G5GA 3S5UA 1QBKC 3NNSA 5H70A 3DVSX 1ZOOA 4HWPA 5BSFA 3WIBA 3BRSA 3CNEA 4AAYA 4CKEA 1DSSG 2XQKA 4K9OA 4MROA 1K5GA 3UATA 3GJXC 4ISCA 4PVDA 1E92A 5KOJA 2ZUFA 4LECA 1PZMA 3BGWA 3EXG2 3OT4A 5CT4A 3WIUA 2QZ4A 1WU8A 3A6LA 1CE8A 1I8TA 1HETA 4I1OA 2DECA 2HWXA 4JGIA 5G4LA 1OFGA 2A1UB 2NAPA 3GI1A 1N25A 3PFCA 3CVOA 3SY8A 3VI4B 2ZTHA 2R6GA 1Z5GA 4FB4A 2GRAA 4CIXA 4MLDA 4CM5A 5EMHA 1MG0A 1TYCA 4HLQB 4XYBA 3RODA 1TAHA 1O6CA 1WDLA 2BFWA 4E2WA 5A6SA 2E49A 5BUQA 5HKKA 2WZQA 3NH9A 3PNOA 4WKOA 4ZOAA 3UHAA 5BRNA 3LWBA 4IDAA 5HDBB 5HS6A 4DQDA 4HFRA 1DBIA 3GZ4A 4DR5B 3PNKA 4M7OA 2FMIA 2J4FA 2XNJA 2WVJA 4NFSA 3ZKWA 4BFLA 3C8UA 3CXRA 1K3TA 2HZ7A 4FYHA 4LXYA 1I51A 2AZ4A 2HU5A 2RI1A 1KNQA 3N5CA 1DZ3A 5I7FA 2HSJA 4MI9A 1GPKA 4EI7A 3INGA 3OY2A 4HAXA 4BBJA 3G2QA 4GGMX 1WB4A 3EVGA 1PK8A 5A03A 3DLPX 2MDTA 2MMCA 1YVEI 2WNIA 4HFNA 3CVVA 3EEBA 2OGUA 1QFSA 2OFOA 4FX2A 3H2KA 4R2JA 3WFJA 2ZDHA 2I71A 5KB3A 5LU8A 3GMSA 2BI8A 4L57A 4AJHA 1NXVA 5ALDA 3F46A 4TS1A 4YV1A 3A1WA 3FYHA 4GL4A 2D1SA 2A1TS 2H16A 1ZESA 1NNLA 1JILA 3EC1A 4LGYA 2V7XA 5LP6F 2G8NA 1P4AA 4XA8A 1N6HA 2H2IA 2RAVA 3GJQA 2CEAA 1LEHA 1ZICA 4GL2A 2G1KA 4HL6A 5CCEA 1BJTA 1YB2A 4MYCA 5MGBA 1JDZA 1PR3A 1Q0ZA 1VFPA 4NR0A 2ZCJA 2FMUA 3W7VA 4POOA 1SCKA 1P8JA 1FK8A 1HEYA 4DNFA 2OGZA 3VVLA 3AR3A 3AHFA 4DA7A 1XDGA 1FFWA 4MDEA 3OEED 3PE3A 5IBCA 3KUCA 5FUQA 1E3MA 1JHAA 2O2GA 2X7XA 1YC2A 4V0OA 3AY6A 1WUJS 2JATA 2D5AA 3DYVA 3KYJB 4NBWA 4HX9A 4W82A 1O94A 3RGWS 1EFLA 3TEJA 2D1FA 4KP7A 1UEIA 3LPAA 5CD9A 2DBZA 3HC7A 2AXNA 5HBRA 3LL4A 2CB9A 1KWGA 4OJMX 2ZAIA 3GVHA 3GY0A 1BFKA 2I62A 2IZ5A 4JB8A 4AYTA 1AX9A 3MBOA 4HEJA 1ND5A 4EPTA 5IVIA 5INTA 1USKA 2WJAA 1Q2XA 1FMJA 2HEIA 4AJLA 4WTOA 2VNKA 4LC1A 2QY6A 4Z4FA 3Q10A 3F5MA 1BH6A 1GN8A 1X9GA 3BDVA 4P7GA 4DSAA 4ARSA 1J6UA 4IRMA 3SWWA 1F3LA 2FRDC 4AO7A 1BU8A 1IQPA 2HJ9A 3UFBA 4ZOQI 5CEEA 5K0CA 1UPCA 4D0GA 1LF5A 4TZKA 5F21A 4CT5A 3EXHC 1NVAA 1F12A 1JAIA 3N2LA 4X93A 2PVSA 2OK7A 2P2ZA 2Q1XA 4I4NA 4C14A 2WA2A 1RW4A 1I3CA 1C7JA 1DC3A 3BDAA 3CT6A 3VO2A 3MD9A 1WB9A 1C1DA 2O8CB 2PUHA 2I2DA 5TGZA 5KTSA 3LCRA 4PX3A 2JFVA 1ADBA 1I14A 3V8MA 1JHZA 1PFUA 3TZEA 2VI5A 4J0CA 1Z13A 3PQ4A 3UCEA 5J9FA 1XLVA 2YRXA 1P2BA 4OREX 4AJ2A 4CM4B 1U7HA 2WZCA 1TJ3A 4IWXA 3I6MA 3W8RA 3DE3X 4CL8A 4HXYA 3CRVA 1N2CB 5A5FA 3WX0A 1QIIA 3OEWA 5A0TA 2P0AA 5HILA 2JANA 3WRWA 4L0DA 5JEDA 2PYDA 4XVHA 3JD0A 3LQRA 3DEKA 3LQ1A 1WW8A 4QHTA 1LDGA 4CLEA 4QOHA 3NKLA 1FW8A 3OETA 4XUCA 5GV8A 3EBOA 1C7QA 1LPNA 2Y1GA 4QXPA 4B3HA 5FV4A 2GCOB 5LJLA 1IEWA 3LYLA 3V4SA 3WLEA 4B9AA 4CXMA 3BXPA 1EVQA 1Q6YA 2MSLA 6LDHA 3THOA 3JQ6A 4PAGA 1E1KA 3E05A 3QKTA 1CZNA 2P4QA 1MT3A 4L2IA 1WMBA 1YKGA 1HZZA 1I4DD 3DBOB 4XOIA 5L3ZA 2PJUA 3TDKA 4HUTA 2XQGA 4G84A 4N49A 4HN9A 4G1MB 1R6AA 1SZPA 1N5LA 2IPAB 1HDYA 2ZVPX 4QOFA 1V16B 2BCEA 4YASA 3PIRA 4HH3C 4OH7A 3EOZA 3OPQA 3T54A 2WWXA 3LDAA 4PY2A 2BTEA 3HABA 1QE0A 1JU3A 2P3QA 3SOZA 1HORA 1E5TA 1OXKB 4LS3A 4CQNA 3QU7A 4ZAVA 1I30A 3OEEA 4X5OA 1FFHA 2OBLA 1CF9A 1SCIA 3FBTA 3HVJA 4BO4A 3UKJA 2JEZA 4BNWA 1SOUA 6YASA 3F0TA 4RIGA 2CD7A 3T94A 1F9EA 2CXNA 1QHSA 5TEVA 5AK0A 4MKXA 3WO0A 3GVPA 2W2XA 2BFCA 2Z1MA 3K9HA 5ABPA 2FZWA 5KJCA 4DA9A 1DT3A 1KYXA 4OQEA 2FG7C 3U4GA 3IP8A 1J0BA 1X1SA 4KR6A 3HFGA 4B2YA 1M6HA 4BGDA 2RHCA 1ZGJA 3PC8C 1L4GA 4CCYA 1JFFB 3MG9A 3OIUA 4RORA 4TS9A 3MGCA 1RVDA 1IMOA 3HCEA 5DOVA 2VK2A 3GRZA 3M1LA 3MJEA 3R7LA 4A5SA 5L95A 1B93A 2IZ7A 4I0WB 3HDVA 4R2HA 4S1NA 2HYDA 5K0JA 1ZKMA 1O08A 1C3EA 1ODFA 1UBOS 2QB5A 2Z8YA 1JHUA 3IUQA 4X20A 2E85A 3AP3A 4DNPA 1KJNA 2ZJ1A 3WNQA 1Y6ZA 3F3SA 3KSBC 1XKLA 4FR5A 5BUZA 5BYBA 3GB9A 5IJZA 5FR2A 5LN1A 4D25A 1C8BA 3LBHA 1VKJA 2QY9A 3AUSA 4FYYA 3FWYA 4NV0A 3U5ZB 2B37A 4NPCA 3I53A 5GP1A 4GXNA 3Q88A 3R77A 4QJ4A 1NNI1 2CLCX 2IKSA 1ILEA 1B41A 3ZLBA 1MT0A 3CH5A 3IT1A 2DQSA 3M8KA 3EIOA 3P96A 4GNKA 3IAUA 1R6DA 3OE7D 4PN3A 2AG1A 4PYMA 1FRNA 1YDWA 4JKYA 1Y48E 3TI7A 4A26A 4YI5A 4MV3A 2NYUA 2WKPA 1ZJ6A 3K9WA 3ZJYA 5JAOA 5CMLA 1O1YA 1WUIS 1ZUNA 3AX6A 3LRXA 3OOEA 4XGRA 3NHMA 4MQMA 5ANRB 2ZS9A 5F1OA 5EE9A 2ZYIA 4ZXFA 4ZT7A 2JFOA 3LC0A 2G0TA 3Q3VA 2X0FA 4JWTA 1E2NA 2FUG6 4OTZA 1T2UA 5HR5A 3BULA 3PICA 2IYYA 4X45A 2XHEA 1VKRA 3IRVA 4DRZA 1ESDA 3DV0B 4LRTB 4PW0A 2QN7A 4WUTA 1V5IA 1Z56C 4B43A 1KL7A 2VUSA 3ITKA 1JRLA 3B52X 3ESYA 2VF8A 4DJFC 5BWLA 4U63A 4JJGA 4H3HB 2JFWA 1T15A 4ZQGA 6REQB 5EIOA 3MWDA 3QUCA 4FUQA 2C2YA 1ULTA 2VK8A 3N7AA 4YJFA 3RAJA 1DKLA 4WXPA 3LW8A 3OHSX 2IVZA 4RK0A 3W90A 1JBEA 5TGTA 1DIOB 5BVHB 3HNOA 3DFMA 4RXMA 3B7GA 2IL1A 1RLJA 3IVAA 3W8NA 3WK6A 1A76A 2BELA 3NHJA 1UBKS 4PVCA 4CG2A 4YMLA 2ZETA 4HDSB 3U3KA 1E6WA 1E99A 2VVTA 3ZE2B 4EAQA 3DLTA 3ZI7A 1OB2A 3EMBA 2BR3A 4IY1A 1G1MA 2PA3A 4CKCA 1H42A 4FGKA 5GONF 3DPSA 2Y0PA 2WE7A 4H4CA 2HO4A 4IHJB 3HP4A 3BMNB 4DT1A 4GP9A 2J3JA 2IEBA 3M6UA 1O8CA 1UOQA 2HMVA 4EJ0A 4KO8A 5BORA 4R69A 1Z4OA 3IMFA 4DIKA 3NUQA 4X8OA 3KJXA 3DMTA 1VBNA 3JQAB 4II3A 1E0KA 3VPFA 4AYXA 1VJ5A 5DM4A 2NU9B 2QLTA 1C1XA 2OBBA 4C0BA 4HFMA 1Q2UA 4X71A 1RM5A 3M3HA 5I9LA 2IEIA 1GQRA 5G3YA 1VKZA 2EJTA 1PE0A 4FCWA 3VTFA 1UBSB 3W6NA 4CLRA 4FDLA 3AL3A 4Q47A 4JLKA 4Y9TA 3RC2A 3IEMA 2I6TA 4TQ9A 2IU0A 1U4OA 4YP0A 1NDUA 1NMEA 1DAEA 1U99A 5E4FA 1CIVA 3W9YA 4GX0A 4PAOA 3WVNA 3VX3A 2HIAA 2V98A 1WHSB 1IPEA 3E22A 6AT1A 4L72A 3EJ6A 4RVFA 3S7ZA 4AMBA 5A4KA 3UMRA 3HDQA 1W93A 3IPAA 3NB0A 2UYCA 1G9SA 1H65A 1XPOA 1E2GA 4AF6A 1H4QA 1W44A 3WNCA 1O6GA 2VZEA 4UEJA 2VOEA 1F2VA 3D02A 3OZ7A 1W76A 4MW2A 4OJKA 4DV2B 1M8FA 3HWWA 3NG1A 3ORFA 4JT9A 5J4HA 3UO8B 4YR9A 1U8ZA 3L6DA 4HQKA 4D02A 1PUJA 2HIMA 4GU5A 4J7CA 4N03A 4QODA 3SCZA 3WY9A 4ABYA 2AW3A 1RP7A 5IAGA 3C3XA 2NUTA 1C5KA 3FPBA 1NBHA 3GNQA 5E1DA 1J90A 1H2WA 2GO1A 4MR7A 3S55A 3SZRA 3ET5A 4YV2A 2AR7A 4QG3A 4UZSA 4L3VA 3W04A 1MORA 3RM3A 3W5VA 3Q7QA 3OI7A 1ZMRA 3VKVA 2IRWA 3D3WA 2NACA 3NMUF 3N8GA 5DISB 5EESA 5AT1A 3X2FA 5HMLA 1PJ4A 4LV8B 3WJ7A 2QTFA 1JA1A 1GEEA 2O4CA 3SE0A 1S8AA 4TVBA 4AS3A 1TJ4A 2WW8A 3TO5A 1AKQA 4D74A 4BJHB 2VNIA 3R3UA 1QE5A 4I08A 1XMVA 4WLUA 2Z08A 4RSHA 5BW4A 3NOVA 1HX7A 1Y1TA 3IUNA 4O4HF 2Z8ZA 1I4TD 1BXRB 3PJGA 1NFFA 2GT1A 4FJ2A 3OM9A 4MGKR 4QAQA 2C92A 3QELB 3F7TA 4CHGA 2B1RA 2D5LA 4KYTA 5LP1A 4RELA 2Y76A 1IG3A 3RC1A 3NGLA 2BIFA 1SCUA 1WOMA 1ZLXA 3QKRA 3UG6A 2ZYUX 2NSLA 2QVGA 2ZRIA 4UM7A 1L5ZA 2VATA 5JROA 5KOYA 4MCAA 1XLUA 2GSDA 3URMA 4K28A 1DIBA 1KERA 1RS0A 5EIAA 1EP2B 2OG2A 4WERA 2QE7A 1TGVA 3D4LA 3OBBA 1GWNA 5B30A 4KFTA 4B75A 5ADHA 3N7UA 1JW9B 3EPLA 3VPGA 1NT2A 1KI1A 4KACA 4JT8A 1OZGA 5KYVA 4OF4A 2OLJA 2QMEA 3OD5A 3ZDDA 1OFHA 2VT2A 1MD9A 1Z9BA 4ZI3A 3E2MA 2VWPA 4F3RA 1I7PA 1PSDA 5AH0A 2VJDA 4H9GA 1P2FA 2P4SA 4G0OA 3K32A 4KAJA 4XQ9A 3ROQA 3L2OB 2GKSA 4YXWD 3CWCA 3ZCUA 2RIPA 3OIGA 2IUTA 1U2DC 3JVVA 1SD1A 2YBEA 4NV1A 1WL8A 3IH5A 5CW1A 4D0LB 4HPXB 2D2EA 4GOJA 4NNOA 1V9LA 3VHLB 2FSFA 2XTJA 4EF6A 5FNVB 1Y7IA 4ZAFA 4S2EA 2Q5CA 3D8HA 3TDNA 3MN1A 2PL5A 1SAYA 5ALHA 4B3CA 1YQXA 2CXPA 4COKA 4EKIA 1MMFB 1WCXA 4U7PB 1ADFA 1ZM2A 3TD9A 3DWFA 3EFBA 4AY5A 2E1RA 1QZUA 2R5NA 4KGDA 1QH8A 5H7XA 5JRJA 1HRKA 4F86A 3PXUA 4BAUA 3M5WA 1H05A 5TDHA 3B5EA 4PHGA 4PLGA 4ZC1A 3UAYA 4KIUA 1NLMA 4KXVA 1OLSA 4HKTA 1ISRA 4EK9A 2YIMA 3WB2A 4ZMRA 3CUSA 3DB2A 2XB2A 3O1HB 3FMVA 3MM4A 3HY4A 4P6VF 2DSNA 1UIRA 1FVFA 3DG9A 3EOBI 3EXEA 1R8XA 4KE9A 5T8KA 5AYVA 3VH3A 4C6SA 5MN6A 2YYZA 5CDHA 3GAAA 1CLUA 1ECCA 2QN2A 1MC5A 4P3KA 5F35A 1T36A 3SG0A 4YUAA 2ZI9A 3A11A 3EDMA 4ZJZA 3ZE0B 4GI5A 5IEJA 1CY1A 3VZRA 3PHHA 1L7DA 1T2DA 4AF8A 5JSFA 1K7FB 4A0GA 3IP7A 3TX6A 3KR1A 4IMJB 5CAEB 4LC9A 4PLWA 1JHMA 4I46A 4OSOA 4EUFA 1IYZA 1SU4A 5D2CA 4FGSA 2B5OA 4J07A 3GQBB 4E2YA 4FOPA 5EWLB 1Z8HA 1T3TA 2G7MC 2CY0A 3F1KA 3I05A 1IN5A 1Z4LA 1EFUA 3LZ6A 3NO4A 5FOVA 3OU6A 5C4MA 1DQSA 3T1VA 3TPCA 2XQVA 4KXNA 4E11A 4QGHA 3U4HA 3R2JA 1IBMB 3DHYA 1N6RA 1YCDA 3N9IA 1II9A 1FMCA 4TLAA 1NVEA 1HV8A 1J0EA 1GPH1 4HGRA 2GKGA 1G3MA 3DYIA 1B2LA 1Z0SA 1N32B 1O95C 1CRWG 4MQ5A 5E2IA 3CLSD 3B3JA 1NURA 2C31A 4M1KA 3SS9X 2PXAA 4PSDA 1TJ5A 1Y9JA 1GY8A 4D8YA 5G1PA 5CIQA 2FI1A 3AZOA 3ZLUA 4FQ8A 1W36D 1YZ3A 3U61B 3DC7A 4F21A 3IHLA 4K3UA 4DR2B 2BFBB 2BGNA 1EUYA 2X23A 3GFRA 3MQ4A 4QTYA 1HGXA 3ZCXA 1B0UA 1B2RA 3H42B 2VDMB 5KYUB 3NDIA 121PA 2VFAA 1O77A 1ZI8A 2YZMA 2H0AA 2KI5A 3AOEA 3QWFA 4FCVA 5A9RA 1SQ5A 3TG8A 3B3QA 1M54A 2D8AA 3A2LA 4PCAA 4F04A 1H9CA 3HU2A 2PU7A 2F3PA 2DEUA 9GPBA 5HVNA 4RA9B 5JZOA 1O6BA 3QVSA 3LK7A 4NDNE 2IF0A 4RF2A 4B85A 1TTPB 2DFPA 1M8GA 4MEJA 1DKMA 4QJ5A 3PLRA 4YXWA 3V1MA 2QW0X 4DM7A 1DJNA 1P39A 4L07A 4H18A 5DP1A 5HCUA 4N65A 1JPNA 2VDVE 2QRKA 1GKKA 3BXEA 4BLWA 5DYWA 2A9PA 3D2LA 3OQ1A 4UUMA 4JC5A 5TS3A 2Q46A 4LCJA 1N6OA 1RIFA 2GESA 2BMFA 2XCLA 5KYWA 5EZYB 2Q1UA 1MEJA 5K8JB 1Z16A 5LMZA 4LSZA 4MP3A 3ODGA 5DHUA 3D2AA 5BOSA 1ZINA 4MVJD 2FMHA 4IUCS 3UT0A 6ABPA 2HQ1A 3RKUA 1NMQA 3H86A 1P17A 3TGLA 1N7JA 1R74A 1L6RA 3FFTA 2R97A 5HCIA 4HRAA 4MMYB 3THYB 2F59A 2AEFA 4IRXA 1D5CA 3R3HA 3U7IA 3D4IA 4S1PA 4OHFA 1ZD9A 2HK7A 1EMDA 4XWTA 1R5NA 3WFZA 3WL3A 1U3DA 2R2GA 2YMPA 4LYDA 1YC5A 3FCSB 4PCUA 3V46A 1Y4AE 1XG5A 2FWRA 4IQFA 4II2A 3AVVA 1I2ZA 4CMGA 2XMSA 1UEXC 4J4BA 5F1KA 5C34B 1GM5A 1HQKA 4MP8A 4RK6A 2E4UA 2YXPX 2G9QA 1VIAA 4F7DA 3HUEA 4HPWA 3C5WP 4K03A 4NVRA 2IX3A 1GOTA 4JJIA 1JL3A 4I9HA 5KX5F 3A9RA 4QT4A 1B14A 4FQ5A 2EW1A 2Q6KA 3F6BX 5DK4A 3I4FA 3M83A 4JP2A 5B2ZA 4JI5B 3UFXB 3KYIB 3L9WA 5CFQA 2LE0A 3ROZA 4RD4A 2XWPA 4OA5A 4H27A 5AW4A 1ACMA 5DN9A 4E5VA 2OMKA 2ZWOA 2MSDB 1DEOA 4MMZB 5FPKA 3KRTA 1GJRA 3WBBA 4DMFA 2DUWA 3I6QA 2D5CA 4ZANA 5HP4A 1AG9A 1WB6A 3RVRA 2BKLA 4C0JA 4KH1A 2FV8A 5K45A 3N0TA 3FTFA 4GPIB 1EGMB 2FCAA 5LBTA 1QJCA 4C6TB 1LK7A 5JISA 1EXWA 1K27A 3V9AA 5KNBH 2JLUA 4E5KA 3FZQA 3D7RA 5L6LB 1NM5A 3UMYA 2EKZA 3WK8A 3GEIA 3PJRA 3FJOA 3PLAE 2P4EA 1H6DA 3HN7A 1SUPA 1SVUA 2EP7A 2WHYA 3G2KA 2O6LA 3TW6A 3VJMA 1EM8A 4J4HA 2XUZA 3CSSA 3I04M 1TYAE 2BLLA 1E3QA 2WOJA 3AI2A 3FG9A 3A6HA 3FR8A 3GGCA 1XP8A 4QO7A 4RADA 2PSEA 3W6OA 4AQYB 3ILYA 1IJBA 4NFLA 5EQJB 3E8SA 4NCBA 4PR0A 3TLXA 1QC5B 3UBTA 4EJSB 3T12A 1DAOA 3MTBA 3VGPA 16PKA 3U62A 5DX0A 4WNCA 2A3NA 2FSVC 1W52X 1GL7A 2PUVA 1SQGA 1JLRA 2EW2A 2ILVA 2ZSAA 3LJKA 4K8RB 4WKBA 3BJIC 2B6HA 3UY4A 3JWPA 2EYQA 1E0DA 2EERA 3E9ZA 3E5HA 3ZWVA 2FW9A 5JQWA 4WD3A 3M2TA 5IJ9A 2IS6A 1N6PA 1EBFA 1JAHA 4C0AC 4PRLA 3TSYA 4NQRA 2R47A 1S3SA 4E4TA 2JVKA 4EATA 1O96A 3FNIA 1B1CA 2GCEA 3KO8A 5DRTA 1C3LA 3VZSA 5A7GA 4MVJA 2QYHA 4AK9A 2ZB2A 4YCSA 5JPDA 3EXFA 1SURA 2E0IA 1DADA 4FLFA 4AF7A 4BAZA 1MRSA 4MVJE 3QBEA 1FFCA 2FSSA 3QYFA 4P38A 2AMFA 4PCLA 3SN6A 3LT1A 1AF4A 4KPYA 2CLEB 2WE8A 5ARCA 1S8FA 1FL9A 4IJ6A 4IEFB 3IEXA 4QSHA 5E7MA 4S24A 2DWPA 2P7HA 3CH6A 4OFZA 1TZMA 2EJCA 1PR1A 4QU9A 4DYVA 4MQ6A 5JU6A 3HMKA 1RWVA 4YCCA 2JIQA 4CDMA 4DMCA 1JHVA 5TY0A 3FPGA 1PX2A 4D26A 3K6RA 1CT9A 2H2DA 4HGQA 1RAFA 4FHZA 1E9FA 4BNDB 1P0IA 2H5JA 2H57A 3DBLA 1J22A 1JUDA 4FR2A 2JRCA 4MUIA 4FXPA 2C83A 1ZK0A 4UMDA 4O4LB 4EPXA 3IAS1 4RPCA 2G88A 1VHJA 3FYCA 3BD8A 5TVKA 3NRJA 4EG6A 1BEUB 5D87A 2NO7A 4PPGA 5AUPB 1J8DA 2GD2A 6ADHA 1H6AA 1U2ZA 2QYOA 1J2YA 4MDHA 4RA9A 5K0SA 2V9CA 4HP8A 3FTPA 2BKUA 1DIHA 5ALEA 4PG4A 3EPRA 1X7YA 2F1OA 4O2AA 2KWIA 3VO1A 2R4TA 1LY1A 1RE0A 2GBFA 4ZIRB 4C4OA 3WSVA 4X64B 4I1RA 5DTRA 2VDWB 3HDHA 1QDLB 3B12A 1A3CA 4H0CA 3U16A 4O0MA 3W34A 1XZDA 4N39A 2PLAA 2PKQP 2BAGA 2XUAA 4L7VA 4U7HA 4Q16A 3A36A 4DZTA 3V8EA 2QRUA 1RI1A 4JBIA 4F11A 1S0UA 2R85A 1LZKA 1EQ2A 5E7IA 2I80A 1G66A 4IV8A 3GRFA 5IVKA 1HF3A 2R8RA 2NUBA 1G8PA 4XFKA 1U2EA 4B6FA 1RAIA 3N2ZB 4Q4CA 1X8KA 4TGLA 5A6SB 1FFSA 5L6MB 1FTQA 1Z6PA 4HVLA 3WYDA 4KAAA 3FOAA 3JPYA 3ZD9A 2BGMA 2IDJA 3SFVA 1W5SA 1USGA 1YZUA 2O2EA 2ZUTA 4FOOA 5CK5A 1YAJA 4D96A 2J6HA 3ZKWB 1WPRA 2NVOA 1T29A 3T0FA 2YJNA 1ST3A 2ZSDA 1P5ZB 2CMHA 5J2UF 2AXEA 3X1DA 1J0AA 2FUKA 5G02A 4P80A 1G2IA 4HWGA 4B3DA 5KWEA 2DOKA 5CLHA 4ESVA 1SHTX 3LLUA 4AIRA 4MKFA 4B32A 5KWSA 1FZTA 1EHIA 4JL5A 4N4AA 5EWMB 3RR2A 3OIVA 3R9WA 1E2KA 4FD2A 4TWRA 2EIXA 3RRMA 4F2GA 3ZGZA 2VQEB 3FLAA 2BFAA 4MV1A 2AE1A 4U02A 1FFBA 5JMTA 2LD4A 2YS6A 3WLFA 2Q4TA 2B8JA 3P2IA 3PK0A 5CVJA 4P4LA 3WLJA 3HN2A 2H5IA 4W9NC 1AKYA 3HUTA 4OQ4A 2B4KA 2IYZA 3F6RA 1BEZA 1NQXA 2IYEA 1PAUA 2XLBA 4XB6B 4XM0A 3UUGA 3WGUA 3J80A 1ES9A 2AJDA 3Q8MA 2AUTA 1S96A 2P2NA 1JDBC 1RLOA 1WQ1R 1Y8RB 3AVWA 2CBGA 4O8ZA 1QH1B 2OHIA 2JI6A 3KTDA 4BNUA 5E4JA 4IIJA 2Q5HA 3IMCA 3HEMA 4R3UC 2P11A 2P6PA 2Y1LA 3HZZA 3PDHA 4U9IS 4UU0A 4YCJA 5JSQA 2XB9A 2E82A 1GU1A 2JEYA 5F7JA 3SZMA 1Y8ZA 5FHRA 1T6BY 3H1FA 4D3SA 1JXAA 2R60A 3T4PA 1LB1B 3IO3A 1OLXA 3WR5A 5KINB 3GDOA 3HA7A 4H0FA 1LI7A 4EAAA 1KK2A 2Q0XA 2XVAA 1J25A 5LZ5A 4NNJA 2KS6A 3PNQA 4YCNA 3CEPB 3MCAA 3C41J 5DI3B 1V5FA 2PKCA 4DCCA 5K7SA 3LNTA 1MRNA 2WMOB 5TE9A 5G2OA 5JVDA 3EIQA 2ZRBA 2QL6A 4P34A 2WF6A 3NVDA 1LPPA 2AT1A 4H59A 5AJTA 3PNPA 5BR1A 3HPQA 3WJAA 2IHZA 3VPXA 3RAEC 1E7YA 1SR8A 4FJ1A 2REBA 4FXOA 4GH5A 1WXGA 3V6LA 5JAMA 3RNLA 4IZIA 4BN5A 2Y71A 3SF0A 3AGQA 1W48A 2NN3C 3EFHA 5C8YF 5B12A 2HRDA 4RZSA 2JHFA 2R00C 4ASUD 3PFNA 4LQDA 4F4HA 1QKJA 1PUIA 2YZKA 1YDGA 3QLVA 4B5LA 2E3JA 3IUMA 1BROA 3A9WA 3K05A 2DPLA 5TPWA 2IDZA 3VVMA 4ZYWA 5M3BA 2FPSA 3PEYA 4B82A 1SVIA 2X40A 3OA0A 3COYA 4JJ7A 4UPVA 5HHTA 1E60A 1DQPA 3GCGA 2P4HX 2W7TA 3BSYA 3MUOA 4QPNA 5HQJA 2V96A 4U4AA 1WPGA 1XKTA 1OASA 3A6EA 5HIMA 3TLBA 1CQPA 1ST2A 4MPTA 1B3BA 3EUWA 4PQYA 1RJDA 4PHCA 3WRYC 2IUSA 5KYXB 2QX9A 1E3TA 4FFOA 3WG9A 4UAGA 1OGYA 1Z15A 2DWCA 1YB4A 4XX1A 5DSTA 4CDRA 5J5CA 1VKHA 1BGVA 1C0KA 1U9ZA 1OILA 1X7XB 3H3XA 1EAYA 1WIWA 3Q3GE 4KLNA 4TV8A 2XBUA 3FNEA 4QBGB 2VWHA 1GIAA 4YQYA 1XVIA 2QVZX 3WIVA 1R8YA 5F7OA 2JKVA 2P6RA 4ZOCA 2OCBA 2ISCA 1CUIA 1VPLA 3U3DA 5JSZB 1P91A 2QDKA 4Q3CA 2Q2QA 4P84A 4XCXA 3QOFA 5HFAA 4HAIA 5IMSA 4L2IB 2OHJA 1HQYE 1LS6A 3BQMB 3HR4A 5JNTA 3AVTA 2JAWA 5E9JA 3KZXA 4D4MA 4KDFA 5JXWA 3KE8A 1RQ2A 3AVUA 1KJZA 4A0SA 4LDPA 3D9QX 1T6XA 2F9MA 2Q99A 1ZGCA 3D6UA 4KBYA 1E96A 1KE2A 1N8NA 2GPNA 4OHUA 4Y18A 1ZIYA 1OLUB 1P9RA 2ZS8A 3WL8A 2B78A 2PS3A 1RXWA 4NXNB 1SZJG 1PJAA 1COWD 4O3FA 4RTNA 1JEYB 5LNK1 2BGWA 2JC3A 2BJHA 2FG6C 1SC9A 2FGKA 1S9DA 4NOJA 4DMGA 1CU1A 5JT1A 3IEVA 4FFBA 4OB8A 3UCFA 2PPVA 2W98A 2XGSA 3RFTA 1G7SA 3P9KA 2J6BA 3DLBA 1HPLA 1SUBA 4GS5A 5F98A 3PUYA 3VDMA 3KQNA 3BF8A 2PIAA 4Q4JB 5CGQB 2A9VA 2BFCB 2H5EA 3MJCA 4KIJA 4UFOA 4BFZA 5BURA 1XCOA 4MS4B 3BVPA 3E9MA 4DR4B 2ZJFA 4ND2A 1GP2A 1VGRA 4N0EA 4LRXA 4YYEA 4KR7A 3H4TA 1E6EA 3KKPA 4AKTA 3DCYA 1WVIA 2E55A 3EW7A 4QGFA 4B8ZA 4YJGB 1AKEA 5KU7A 2JD0A 2PCLA 3EIFA 2P40A 4BATA 2ZJOA 2WFLA 2C9CA 4LQCA 1U8FO 1TF5A 3CRW1 3E3MA 2ODTX 3IC5A 4BTVA 1Z2DA 1DUSA 5CPFA 1C7ZA 1JHRA 3U7RA 1NJ1A 3HZHA 3K0CA 5K6AA 3FUTA 2K87A 4KO4S 2P9YA 4UDXX 1W7AA 3VSDA 2DHQA 1E5DA 4J16C 3T06B 3QU5A 5IAEA 1AKTA 4JBGA 5AP9A 3PPIA 5THQA 3PHIA 3SKVA 3SYTA 3C4VA 3FOWA 3H9UA 1GAWA 4KKVA 4N9QA 1A04A 2CCKA 3UOAB 4EL5A 3T7CA 2H54A 1F2UA 3DAFA 3E2PA 3ICPA 4GOXA 4J0FA 3OZIA 4A0FA 1MOPA 1A4UA 3Q9UA 4BOYA 1D07A 3M6XA 3R09A 4Y9RA 3X1XA 3EXIA 3ND9A 2HGSA 3DLIA 1Q1QA 2MTBA 4GQBA 1GUZA 2FLKA 5FLKA 3FYUC 4C87A 4FOTA 3ZWOA 1MW8X 5MN4A 4NZYA 4BIIA 4F6RB 3WJ2A 4RVDA 1KR5A 2Q6TA 5EJ4A 2I6QA 1NZJA 2C0QA 3DOJA 1LBQA 1T0IA 3CF0A 3OZVA 2WWTA 4UATA 5JJCA 2DJIA 4FUTA 2Q4OA 3RTDA 1Y3BE 2VJQA 2DFLA 2WWHA 3WTBA 2A9KA 1XMSA 3MJHA 5IBQA 2FPWA 4TLCA 3QY9A 4DMHA 4REOA 4AY6A 4GIBA 2I4NA 3WA6A 3EH1A 1SXJA 3K5IA 1B6SA 4IRUB 3TIXB 1JTEA 1E1LA 1QUEA 5K0ZA 3DZ8A 2N1BA 3F7NA 4ZALA 4E2ZA 3RYFB 1NRJB 3EG9A 1NJ5A 2FZ5A 3KM0A 4D43A 2V74B 1Z2CA 3M4NA 4W5WA 2NU8B 3GPBA 2BBSA 4RTKA 3P0EA 2G6BA 3AFIA 4F4DA 5FWNA 3MJTA 1IXKA 2A78A 2FQYA 2P8JA 1CY4A 3UA3A 1XXHA 5F5LA 4JEIA 2V45A 2BD0A 4MLPA 4RVUA 5KAMA 1COWA 5FFNA 4ARZA 4L4RA 4ZGGA 1KA9H 3QI2A 4UXJA 1K6JA 3NDBB 1XXHE 2Y1WA 1KJIA 1G8SA 2ABWA 3KJEA 2HY7A 4CKCB 3I12A 1NI3A 1QP0A 3LXUX 4E7PA 4NCHA 3NI2A 3RVJA 1D6NA 2CLSA 4U2KA 3G8CA 4MVJI 5KO2A 3SFTA 1IZ0A 1CUYA 4BJ6A 4YDHB 5BYAA 3IPYA 1E2BA 5B36A 1E3SA 1CNEA 1AQIA 3LQQA 4Q4DA 3A2NA 1EIZA 3NNNA 4J1SA 4TKUB 2OCDA 1O0SA 3M6LA 4WX2B 2R8PA 4Y2VA 1D4AA 4ZI5A 1SY7A 5DE3A 7ADHA 2PZJA 3TM4A 1A95A 2FWNA 2EWMA 2WMNB 3I6YA 5FV7A 3CZ9A 1WZEA 5ALVA 3B89A 2P6UA 3F96A 4G23A 4C7OB 3QTBA 4MZXA 5H8WA 2QL9A 3L8YA 2Q8NA 5ECGC 3EAFA 3QEMB 5K8VA 4L75A 4BMZA 1G6KA 3VH4A 4UQPA 1QAQA 4YJ2B 3BKXA 1F5NA 2JIDA 2OO7A 4PNZA 3M0EA 3GLGA 4XJSA 4HNQA 5I8PA 1ZMOA 3W4JA 1U5BB 3HZRA 4QL3A 5A0VA 1Y3CE 2E4VA 3HWSA 3QUBA 3E35A 4YDRA 3EIHA 4YO8A 1DRUA 2H4WA 2P68A 5ESWA 4EPYA 4G1FA 3PHBE 4BB9A 1OLOA 4EW1A 2TMKA 5E8JA 4LYFA 1JEQA 3QGMA 3UG7A 2BY4A 4Q4HB 4HV4A 5CX1B 3OQIA 2ATCA 1M6VA 4KCGA 1G7TA 1HEUA 2PUTA 3LC1O 1YIAA 4BWFB 3V7WA 3JYLA 1C7IA 3VU0A 3BK1A 2R7KA 3L4BC 4P3OA 1TEHA 4DCTA 2ORYA 1EWKA 2XCOA 5JANA 5JR3A 2ZIVB 4FLMA 1DP4A 3SSMA 2GN2A 1U3GA 2H11A 2HHLA 2RJOA 3VNSA 1L5NA 4OVKA 1W4BA 3D3WB 1XDSA 1GTMA 2D00A 2XITA 4GDMA 5AXDA 2XBLA 5T3UA 4F6CA 5DDIP 2JCBA 2Z4TA 2GB4A 1DKUA 1V5EA 4YRJA 3E1SA 4DARA 2ZIXB 3P19A 4G0XA 3TR0A 3RRXA 2D1RA 4JYCA 3LHIA 1KOFA 2OLKA 1SOMA 1KE1A 1OFTA 2Z9BA 5JYCA 2VWQA 2QEQA 2ZYDA 5LDDC 5B1HA 1XMPA 3ZIDA 2VYVD 3L77A 4HH1A 1E1CA 3KSUA 5BT8A 1MCZA 4G37A 5JRDS 3R5XA 1XLTC 2VZLA 3NKFA 5I9BA 4XR9A 3NV7A 1BJKA 4BLPA 3FGOA 6Q21A 2Q41A 3E7PA 1OXBB 1QB7A 3D59A 5EERA 2J07A 5EFZA 5AM5A 5BV2P 3BEOA 1OBHA 2IOFA 4BMYA 3VAAA 1ZW6A 1ULHA 1ZL0A 1SQ0A 2RIRA 1XWFA 4RFSB 4ENUA 3EA4A 3H5WA 4MV8A 5DHAA 4ZGWA 1OXUA 1OH8A 1L4MA 1M7GA 2XQJA 2DQ4A 2F1IA 2Z6UA 3AFNA 3KG2A 2REXB 5DLDA 3VBEA 5B37A 3T3DA 3ER8A 5K20A 3E9DA 2IKQA 2JFGA 4NHOA 4ZEWA 2PQMA 2PQ2A 2Q0SA 3QUTA 3ZOZA 4Q1VA 4Z2AA 2HHJA 2H7CA 1R7RA 3R0QA 3W3ZB 1PT9A 3CF2A 5AOCA 3JXEA 2PJZA 1E58A 3BCSA 4J0GA 4LHWA 4L6IA 4QHYA 5K3EA 1OV6A 3L6BA 3FWNA 3UT5B 2ZUUA 4QNNA 4D3ZA 1HYQA 4IJUA 4PSKA 3BZUA 2R7NA 2KYRA 2RHTA 3QVWA 3AU8A 4RDIA 3JVDA 5F1PA 5KEIA 4JB2A 1TFRA 3C3AA 3AYZB 3D3JA 4URWR 3WZLA 4D0SA 1T1SA 3ML1A 5I3CA 3PR3A 3ZDZB 2EHDA 3PDCA 4B47A 4AO6A 3DGFC 2CV2A 1JYFA 2RDMA 4Q00A 5AXAA 4E7OA 5EVCA 5GQSA 1IWOA 1I5OA 3HCAA 3LDHA 3R44A 4ZT2A 4CGZA 2H9IA 221PA 4JL8A 1CJTC 3MWEA 4MWOA 3BWVA 4WFIA 5C5EA 3L7IA 3IJPA 1QIEA 2HJVA 4CMKA 4EDFA 5SZKB 3QWIA 2AI3A 2NP7A 1OLSB 3C8DA 1PJQA 1QDUA 2FDRA 2W9XA 3H6HA 3HEAA 3O4JA 4IDBA 2BEVB 3ZI4A 3UGJA 4F4JA 4B6EA 1UDXA 4G0NA 4MVWA 4Y0VA 2CF5A 1WNFA 2BGKA 4W5OA 4DLUA 1HTTA 1M8KA 2XOKD 4JJ8A 4GPD1 4O4IA 2H1CA 1Z0ZA 1F7VA 1YL7A 1G20A 1TADA 5A62A 2OBXA 3U31A 1ABEA 1QIKA 3EVNA 5IX8A 4TM7A 1QKKA 4O2BF 5E2AA 4M98A 1EFTA 1G20E 3OJ0A 5C7IO 4UMEA 1LNSA 2ZE7A 1XZEA 2WTBA 2XOEA 2YBDA 1GGFA 1YQGA 2D2VA 2HCBA 2DM6A 2NPIA 4R9SA 2HSZA 3MAJA 5ALNA 1H2FA 2EZTA 2VYQA 3MTAA 4EX6A 5FPYA 2W2KA 4XQCA 4LNAA 3VKWA 1N4AA 4DV6B 2VAXA 3T7EA 4DBZA 4ARCA 2IS2A 2VYVA 1YS1X 2UYQA 1KK0A 3MELA 5AKJA 1PW5A 3ADDA 2QGZA 1CYDA 1L5HA 3PRHA 4FWBA 2ZBGA 3REOA 2X8AA 1UMKA 2PPLA 4I5DA 3B85A 4J6EA 1Q1BA 1KI4A 2O5VA 5CXXA 4DV5B 2V0CA 2ZUWA 3FSRA 4G0QA 4RK1A 3WNDA 4OCZA 2I2XB 2A1TR 2D2IA 1VA5A 3V42A 4LJKA 3NDPA 2HBZA 1U7XA 4WCFA 3F97A 1ZHOA 2W2LD 3K31A 4ZMBA 3QXGA 5REQA 4A92A 3T5AA 1GR0A 4QOIA 2BM1A 3D0QA 3UAXA 5JH7A 3K0HA 1RHRA 3GLFB 4G26A 2X9QA 1R64A 3SZGA 4BYGA 4FMDB 4URVR 3A1EA 2J85A 2W8BA 4WVLA 1AGNA 3PDIA 4EJMA 3ZCTA 2A7QA 5ALZA 4MO2A 2H6EA 3UWDA 1Z2OX 2CNBA 1W19A 1IAVA 4F5YA 4XVUA 1XRMA 2A5JA 4DWWA 1M33A 1YR1A 3JSXA 4B3MB 4LY3A 3NBFA 3WGJA 4LFAB 2X8BA 2IT1A 3ZGOA 1PHPA 3HDYA 7REQA 2QI9F 2JHGA 1YS4A 3IQXA 3UKDA 4IIYA 3RC7A 2NO6A 2PMWB 1JALA 4J29A 1QHFA 3KB1A 1ZIOA 3D6HA 4P9NA 5IDVA 4AJJA 5JSUA 1ZCFA 3KEMA 5BY2A 3MPUA 1MVLA 1HYEA 1VG9B 4FZVA 3GFFA 5AM1A 1EDDA 2R6JA 3NBAA 1MGOA 1LQTA 4NLLA 2EP8A 3T4EA 4AJPA 2CLOB 5KSZA 4CLOA 3KQMA 1TM7E 3EUEA 4JELA 3QIVA 1EFPB 3RNOA 3P9CA 3QJGA 4D4HA 1SJ9A 2PNJA 3K0BA 4TYYA 3WL4A 4HR7A 4RMHA 4V38A 2FMXA 3UJCA 3JV7A 3NPMA 1PUXA 3OX1A 5C52B 5FL7D 1M6NA 1ZKDA 3H16A 421PA 1MQAA 4ZZ1A 4C05A 1S8OA 1Z6YA 1KFKB 1OT3A 2LDXA 2XOKA 4I36A 4DUPA 2UVQA 4YNBA 1RFGE 3BX1A 3UTDA 5B4VA 1BNCA 5C1OA 5AVYA 5L53A 1VYVA 4MGZR 2VUIB 3R3YA 4RY8A 4U6QA 3U19A 4FIZA 1U7ZA 3Q1KA 2BI7A 1GFZA 3DQPA 3GRYA 3HBLA 3K0FB 5AKHA 4HT3B 1NRWA 1MFZA 2PK3A 3H5AA 4EIWA 4QDZA 4TV9A 1R88A 1ZL2A 2GWHA 2PHZA 2JASA 3BGVA 2ZUDA 3LPDA 4WESB 5AW0A 1FP6A 2YJZA 4LHZA 3K1AA 3QHPA 5L3QA 5LP6C 3RSOA 3FPHA 4UVIA 3Q5GA 1L5GB 3CSUA 1DNPA 1T0JB 3AY7A 2AWNA 4QX6A 3LHKA 1CFJA 2JNWA 1KI7A 1YQWA 4YALA 5E8RA 3R7BA 1KWKA 2GM5A 5KDLA 1FCJA 4G0VA 5ECWA 2WJ3A 1W0CA 2FPUA 1B16A 1EZ4A 5LR6A 4JDUA 2BP7A 4DLNA 3Q8KA 2FPIB 2B8WA 4D4JA 4FGUA 5JTUA 3QYJA 1N5RA 2PMKA 4PO3X 2OO3A 2VJMA 3IR6A 4RHCA 2VXYA 5BRJA 4XR4A 4ZJYA 1O9GA 4X7BA 3HUUA 2C4KA 3JQ7A 1A8HA 2OV3A 4B4WA 1T1IA 1KP9A 1UXHA 2VRNA 3VUFA 2W2LA 5AD1A 3T52A 4UAJA 3L0CA 1T4MA 3V4OA 1RQGA 4S1WA 1DOAA 1OH7A 3NIDB 4JEUA 3EQ6A 1EM6A 1F2DA 1NMXA 3RBZA 1CXZA 4DOMA 2PD4A 2EWVA 1VYUA 1FU4A 3GYGA 1W59A 2BCJQ 1I36A 1H0HA 2OZLB 5AJVB 2IXBA 1FDOA 2KBEA 3GZNA 4RV9A 5JCOA 3USES 1XNQB 1R8JA 3NBYC 1EK6A 1PTJA 3RO7A 4ITRC 3BDIA 2C96A 5ESDA 2QPTA 3V4RA 1QP4A 1IPFA 3UMBA 4MRAA 4WA8A 1KP3A 2IHVA 2A5YB 4C06A 3VQTA 2IUYA 2DLDA 2XB6A 5DSXA 1E2UA 1ULZA 2BTQB 1U7DA 4PQEA 3LA6A 4RETA 3DFUA 1GNRA 2I2WA 1SQSA 4KRXA 5CVDA 2OYSA 5H1YA 2QBYB 2YW9A 4YX9A 4JI8B 1QF6A 2QRHA 1XQWA 2GZ3A 5BNIA 2OTCA 1UC8A 4MDFA 3KZMA 2AI2A 5IJ9B 3AUFA 2VSYA 3B7WA 4EG0A 2RGBA 3BICA 1JE1A 5FOXA 1GPJA 1GD1O 1RWQA 4L8WB 4AZSA 1JP7A 3K70D 3GXOA 3GAZA 2EDAA 2R65A 1NQAO 4TMWA 5EC8A 3MPOA 1GPYA 3TLAA 3X1JA 4RF3A 1PJLA 1N6IA 2IE8A 3HVUA 3NOOA 4RZXA 5E0KB 2ROQA 4BFTA 2QR3A 3B1XA 3H8SA 1TA0A 4BLUA 2VP2A 2Z30A 3IP1A 3O3OB 2BN4A 1EX6A 1U1CA 4PZEA 2O1SA 2VDOB 2VKQA 3AJEA 4GRAA 3DUFA 4PTYA 3DDWA 5F12A 2JCGA 3WP1B 3DLHA 1UMDA 4UUAA 4C7BA 1QMGA 1MO3A 3FTEA 3DCIA 2LIPA 3MUNA 4L78A 2ZU6A 5EXXA 1YA4A 2XNDD 4FDVA 3T7AA 5IK2D 3PGMA 1BSVA 3M34A 5KKCA 4MPJA 1YUBA 3BEDA 1J8QA 2Z3ZA 1GSIA 2V4MA 1FYFA 3I9KA 2ATIA 3RTAA 1Y82A 3WAGA 4GM1A 5DLYA 5FA8A 3OMXA 2Y0DA 4EH1A 4CLXA 3RAPR 3KETA 3GD7A 2AYZA 1XLWA 2Z9CA 5ALKA 1CR6A 4NZZA 1XK7A 2QSZA 3UA4A 2HMWA 3BSSA 3WGMA 2PEZA 4O25A 1P1FA 2YN2A 3NHKA 2NZJA 4F71A 3U4DA 1T1GA 5IF9A 3P0IA 2MYTA 2B8EA 2OO5A 4TTSA 4KQCA 3WOHA 4AD8A 4YDQA 4CEIA 4ZRMA 1E89A 1AQUA 2CZQA 3UJ6A 3WA7A 2FPXA 5GAJA 1OZFA 4M3NA 3V1KA 5IU6A 2RJNA 1XZPA 4Y2SA 3TSZA 3VR4D 4QBIA 4P4GA 3SJAA 3V97A 1BVYF 3G8YA 3LUHA 5IN4A 1CF4A 4RKFA 3CNNA 3C3PA 4CR7A 2P9ZA 5M7EA 4M0CA 3S27A 4I55F 2LW7A 3RSGA 1Z4KA 5AOBA 2XHZA 1YVDA 4KQ2A 2XH8A 4PE5B 3IFSA 1P9OA 2DHRA 2A3RA 3C16C 3IDSA 4Y98A 1YJAA 1AGYA 1CPYA 3I1FA 4OFWA 5BV0A 5GTDA 1X7ZA 1PS0A 1Z25A 4XWOA 1CQZA 3G8BA 1YE3A 4NYIQ 1E9EA 1L3CA 2HSDA 4Q12A 1TPYA 2J45A 1WY7A 3KHKA 4S1VA 4PS1A 3AKZA 3T3OA 5M34A 5K0GA 3LHFA 1JR3D 1KZ7B 3ZDRA 4D9FA 3L0YA 3GRPA 3MFYA 4FFWA 1QGDA 1WB5A 3KSAC 1C3OB 3OZBA 4P5PA 2JLZA 4GLBA 2P27A 1CYEA 3RTBA 3FVQA 4ZOLB 4RJKA 1CDDA 1E69A 3ET4A 3AKDA 4X3CA 2X0NA 4CYMA 3ZXXA 4A6PA 3O8NA 5JJ5A 4TTQA 3ER9A 4LWPA 1Y33E 4A6DA 4K1LA 5ALQA 5CA1F 1HDIA 2W2QA 4EZBA 5CCDA 1UKVY 1BQ3A 4WIAA 1AUQA 5BXQC 3OSUA 2QLBA 5E3JA 3R5SA 5FBLB 3LOQA 1Z38A 2QRJA 2J09A 2QMOA 4OKNA 4RY9A 3BGSA 4WDRA 3KJQA 1GILA 1QRRA 3L1JA 4XX0A 3GLFA 1FJGB 3OOJA 2R1TA 3ZBTA 4ZCLA 1J2RA 3AQIA 2LVBA 4NBVA 4OOFA 3U17A 4DA0A 4ER5A 3GLFE 1Z63A 2CSUA 4CN8A 4GMXA 4ACBA 5EKUA 4BNZA 2O3JA 3HV2A 4KODA 3X44A 4KUHA 3ZE7A 3JQGA 4RMGA 4Q9JA 4Z0NA 1DC6A 2XNDA 3FCXA 3M49A 2CXOA 2PSHA 4MYRA 5IK2A 1J20A 4QEDA 2R0QC 2GJ8A 1JZTA 4F06A 5B4UA 1ADYA 4RWZA 3K9CA 5EE3A 4GI7A 2OUIA 2IP1A 2YHUA 4IIJB 5FI5A 1P19A 1AUOA 4OP3A 4DCUA 5HMMA 4RLFA 1IH8A 2CKMA 4R8LA 2KPOA 4I5FA 1P75A 1E1MA 4Q3BA 5DCYA 4CODB 4E08A 1O6ZA 2C88A 3GLVA 4RS3A 5HF6A 2Q45A 4NFYA 5JPIA 3VSEA 3DNPA 3T5CA 3B1WA 3TWOA 5B7GA 1OLXB 2QVBA 4ZCMA 2O1EA 3JQ8B 4LRYA 2O0HA 4U9UA 1U0RA 4E09A 2Q6OA 3FZNA 3WLOA 5KHOC 3G0OA 2ZAYA 4MIEA 3AI7A 1GNPA 5DYIA 3GJ3A 5D3MA 4IFIA 1NE7A 3JW8A 2VN8A 1BN6A 3VR4A 2DFKB 2FUG1 1I7LA 3ADPA 3CZPA 4ZZIA 3HDJA 4CFYA 5F5XA 3QU2A 3RS0A 2WKSA 4GI2A 5G4KB 4OL9A 2FW1A 1OIVA 3S28A 3TE7A 4DF3A 1TUIA 4OX9B 3H6KA 4NTZA 1GU7A 4CQJA 1BE0A 8ADHA 1E6MA 2F67A 3AF6A 2BFFA 4CV1A 4L5IA 5ECDA 1I2MA 1ONBA 1QRAA 2QAGA 3FUCA 3W3AD 4OD0A 1CC1S 4NJEB 4XWAA 2C0CA 4TYNA 1U8CB 3SM3A 3TOZA 4RQUA 5CNIA 1OCEA 1UBFA 3EGEA 2IYVA 3R6LA 1QANA 2P3LA 4M83A 1Q5PA 2XMQA 3WYEA 4DQKA 3VNVA 3K9FC 4HQRA 1NPYA 1WU7A 2EV9A 2ZPTX 3BAZA 3CR7A 4L6CA 4A9AA 3RRBA 1OA0A 2Y4OA 2XXAB 1JR3A 1P81A 4RLQA 5I9TA 3VNQA 3KKNA 5EIHA 4NP6A 2QX6A 3R7NA 3LQYA 1VRVA 2CUZA 3KQLA 1T0BA 1OHHD 3O0DA 4LJ6A 1DOHA 2YVUA 1FSPA 2KX7A 1JR3E 1MFPA 1VLVA 3DFZA 2WT4A 3CNQS 1E59A 3NP7A 3SQMA 3T7RA 1ZVJA 1VIMA 2V6FA 1GXSB 2XGGA 2ZATA 4BO6A 3BAFA 2RGCA 4WFQA 1CR2A 3C45A 1UIMA 4PGFA 3U0BA 2Q0HA 5EJIA 4L50A 4N3NA 1D4FA 1XZIA 3ZNQA 4FM9A 5FWYA 3C5CA 4TKMA 2B21A 3BERA 3CKYA 3T9CA 5C81A 2IIBA 2O48X 4P92A 1K66A 4PAQA 1VOTA 3T34A 2PL3A 4LNHA 1ORTA 5CLLA 2C2GA 1NLYA 1J21A 2OUKA 2XEDA 4BCBA 5CHEA 1HNZB 1IHUA 3GXBA 4ZVKA 3TG2A 5I7WA 1QHHB 4OI4A 1ZAKA 1ESNA 3GOHA 4HHEA 3RARA 3UYKA 2QRGA 5CXSA 5J1SB 4P81A 1Q7BA 1QPZA 1GVHA 1ZISA 4IH1A 1MU0A 3WB0A 4BJ5A 1A7KA 1QDEA 1WXWA 2OA0A 2W6OA 3ABRB 3VXKA 3HI6A 3ILXA 3TVTA 3RYTC 3NAMA 1XVAA 1IJFA 2J87A 3ID6C 1G19A 3LBAA 4GR9A 4Q24A 4QFCA 4K9DA 4WXHA 3BRWD 3TFWA 1PD1A 4X94A 3B1KA 3CA8A 1U2QA 4H6VA 3GEBA 4W1QA 3KXKA 1MIOB 1PWZA 2TRSB 2QMQA 3LOUA 2UUBB 5C8XA 3L84A 5TT1A 2PY6A 4FYJA 2W6PA 1N3IA 2C3UA 2ZJAA 3HVHA 2FFQA 2HBYA 2V4ZA 3D6VA 2XB8A 3PU6A 5GM2A 2WINI 1VCOA 1XF9A 3Q5DA 4G65A 3UMGA 3C74A 3VUEA 1DAIA 5AW6A 2IPNA 2H48A 2NSJA 4EGAA 3DYBA 5K99A 1ZM9A 2C3PA 4AZ3B 2ZYRA 3WMRA 2Q4BA 3L5OA 2CYBA 1M6EX 3CUKA 1EGHA 1I7NA 3A37A 2PG3A 1G42A 4BGEA 4K9RA 4WH0A 3M4YA 5DTJA 4HWTA 2VK1A 3MJFA 4U7JA 5BVGA 2HT6A 4C6RA 3JD3A 2L18A 4CIDA 1KEKA 3BJRA 4V2UA 2YJ3A 521PA 2QUZA 1QU3A 2VBCA 3KPUA 4FGWA 4HATA 3SHWA 5C35A 5CTAA 2ZZMA 3W3AA 3U3OA 1PL0A 1NSTA 1NW9B 3NTQA 1W5AA 1ZRHA 2NZ2A 3N6XA 2X8LA 4QELA 2IUUA 1R9NA 4RWEA 1V2GA 2ASEA 2HM7A 2I2AA 4FI3C 1T9AA 2VQ6A 1WW3A 2RB5A 4Q15A 4YTEA 4DKJA 4ZDJA 2GD6A 1FDIA 4MXDA 4N3CA 3DO5A 3KZCA 5GOTA 2PL1A 3FDXA 3HP1A 1PZNA 1VDMA 2JKYA 2QVLA 5FB3A 2WTXA 4TRRA 3KT8A 3U9TA 2M6RA 1OHHA 2QRVB 1L6IA 3INNA 1B42A 1PEDA 2JLVA 1EVJA 4MQUA 5CK4A 1KZYC 4O2AF 3CHYA 4NESA 5JE8A 1N3LA 3TGWA 2ZUSA 1M8PA 2PDAA 3FKSD 3PFWO 3ON5A 4CKXA 4B3FX 4XPZA 3PEWA 2DLNA 3EXIB 1SEPA 3R7WA 4M46A 3WWOA 4DEYA 2O7VA 2NADA 2D7DA 3NJ8A 3B6MA 3BFJA 1Q6ZA 4Y7DA 1RLIA 2BHLA 1U3TA 3C15C 3TIVA 1SULA 2EC5A 2WPDD 5JWHA 5BN3B 2ZUBA 3V2IA 1A96A 5GINE 3PITA 4OG2A 2XCTB 4A03A 1DWPA 2B61A 1VCMA 3NBMA 1JIQA 4II7A 2CUNA 2QX7A 3DR5A 4AMYA 2W43A 4IX1A 4JBXA 3UJ7A 4TYPA 2BZGA 1EINA 4N6GA 1YRHA 2ORIA 1PK9A 2Z2YA 3AETB 4LX8A 1DG9A 1E2IA 4MW7A 4NEHB 4I99A 3T7KA 3MZ0A 2FFAA 3IALA 4IS2A 4A8JC 4DA4A 4L08A 3ZEAA 4B3TB 1JDJA 2O57A 1G2PA 3B60A 1KDRA 3DVAA 3JWIA 3UMCA 5LQMA 2QMZA 3O90A 4XD2A 1X0VA 3U7QA 3U7FB 4DLBA 1GL9B 2ZSHA 3A26A 4UTPA 1X70A 3OLXA 3STTA 4YUYA 3VR5A 1L8LA 5JQGB 1UM9B 3T3EA 4ZI7B 3O1IC 4O63O 4A2CA 4Q7QA 4H1TA 1VHTA 1VI6A 3BRWA 3TZ6A 4ALJA 1J8YF 1ZNXA 3LCUA 1LPAB 4RM3A 2DBRA 3ESCA 4I19A 4R9UC 1H0KA 3W8FA 3ZJ4A 4EVSA 4RJJA 5CLIA 3NW9A 2WIFA 5KWIA 5DB4A 3I01A 5F7XA 1KOGA 2OCGA 3S2UA 3VHQA 5P21A 3ZWYA 3A7EA 4BC1A 3JVIA 4JOCA 4Q3AA 3OLWA 4I1IA 4QPCA 4YJKA 1QFYA 1LSSA 1OPXA 3FPCA 3KT6A 5H9VA 3K16A 3SC4A 4KXQA 3L1VA 5IAOA 1QHNA 1WZUA 1ZGZA 3CO0S 5KSYA 2ONJA 4OBEA 5DMXA 1B73A 1PNTA 3KSZO 5DV9A 1G9TA 2QR2A 1EZZA 4PG6A 2IQIA 2BEKA 3CEHA 3IR7A 4BGVA 1NN3A 2V6GA 4RVGA 2XVMA 4HVAA 4A2QA 4DR3B 4MZDA 2UUCB 1U0LA 1Y4UA 2VT7A 1J99A 1ZVMA 2KM1A 2OORC 3ZGYA 5J4KA 1ID1A 3JQBC 2VQ3A 2JVIA 2NZVG 1LSOA 3JASA 4JJKA 1I4EB 4B2IA 4E5UA 4GGOA 4HK4A 3MIIA 2PUWA 4IXWA 1YUNA 2YIVX 3ZJ5A 5EUBA 1P1RA 1SBZA 2C3OA 5IYZB 2H3EA 4L3OA 3B78A 1PR5A 4FGJA 4W7IA 3WGQA 2W48A 3WQSB 2ALJA 4JLDA 1IEQA 4XIJA 1KIMA 2A1IA 2V7VA 4DBLC 4ZK6A 3RYIB 2AYXA 1E1DA 1RRPA 2BFMA 2RKOA 4FBMA 2JJ2D 5SZJA 2AUNA 4B1FA 4PYQA 3T5GA 4YRKA 1DJPA 4CKBB 3GFVA 1PV4A 1Z2PX 1RR6A 3QVLA 4WXEA 1DJQA 3I32A 3IAAA 4GQIA 1KFBB 5LQNA 5JSKA 1JAZA 1Q50A 1RXEA 3NHZA 2C2WA 4AKEA 2UZ1A 1B74A 1E1NA 3JARB 1R9JA 4Y6RA 1LKZA 2VP3A 3B6ZA 3FKSA 1UQUA 2XUOA 4BJ3A 1K3UB 2CC2A 1GGNA 2FRVA 3B8EA 3TE6A 2J9GA 2ODBA 4CM3A 2C82A 4CHTA 1GYQA 1E4OA 1QS0A 4FSHA 4GQAA 2WPDA 1QCCA 3OZCA 4QQNA 2FZKA 3VKHA 3K1YA 3ECAA 2DQYA 4M9RA 3GUVA 5JADA 1THZA 2W70A 4HSEA 5J59A 4B6PA 2YN4A 3WICA 1OXMA 3EUFA 2YYAA 3MT7A 3ZLJA 1MABB 2X2EA 3TTWA 1S3IA 4YQZA 2E4XA 2YC4C 3SI7A 2YFKA 4Q1EA 1KFJB 2L69A 4R8KA 5BR8B 3RBVA 3QSGA 2ZRKA 4Y2HA 3QE2A 5KPJA 3CEMA 1O7JA 3OQPA 2FJ0A 3KQVA 1G8MA 1O89A 3ANTA 4Z3KA 2TMDA 3TNDA 5LQAA 4DADA 2WU0A 1Q0UA 4ZAXA 1E1CB 2ID7A 1HG1A 1FYEA 3FCCA 4U1RA 5FTNA 5TB5A 2X0DA 5ITZA 3L9XA 2REOA 1G60A 4P7FA 4OATA 1RQPA 3MA0A 3KALA 4OAQA 5FOTA 4EO9A 4DE5A 4EBBA 4LDQA 3V4LA 3NM6B 1ONOA 3H3JA 4BEVA 4IZHA 4Z4IA 1W88A 1CZHA 1V37A 2GLXA 4GLFA 3D8NA 3K4PA 3JD1A 1L5LA 3U26A 4GYYA 3UGQA 1N7GA 2OEPA 4YMTA 5L7WA 2YQ5A 2J3LA 3K8OE 5IBRA 2CV0A 4TV8F 2SKDA 4NARA 4RHFA 5TQ0B 3LQ2A 3DE0X 3QMMA 4WASA 1EFRD 5ICCA 1KVUA 2WAYA 3CKKA 3D64A 3HI4A 4OHPA 5ER6A 4AZ0B 2XDQA 5HKLA 3OOWA 1NHWA 1RBQA 4WAUA 1FPQA 1KOLA 4B33A 4BQOA 4CQMD 3BTUA 5ALFA 4ZJPA 4CT4B 2QYTA 1P31A 4ITVA 1VJCA 3VYTB 1IHOA 4V2IA 2YXNA 4U8HA 2YJGA 5KSPA 4UBIA 4JXXA 4IW3B 4KG7A 1CY2A 5AVSA 3EN0A 2PRZA 2EXXA 4BLSA 3Q3HA 1LNZA 3VYVA 3WHKA 5KU1A 5J2TA 1HURA 1YR8A 1ML4A 4KLCA 2AC7A 2PMDA 4FYWA 4MKIA 3BA6A 4PXAA 1UBTS 1VSQA 5ALOA 5FLEX 4N47A 1KYQA 4NH0A 2CLLB 2NG1A 2B1QA 5GWXA 2ZTUA 2FJUA 1VJ0A 2ZYGA 1OVMA 2IY8A 2XUKA 1GU0A 2ZRLA 4JSYA 4YJDA 3HKCA 2NPFA 1ISFA 4QNMA 3FRJA 5JZ9A 5H68A 2UUAB 1Z35A 2ZBUA 3QPAA 2YX1A 1AV7A 1RMTA 4FE3A 4A15A 1N8SA 2JJ2A 5TSDA 3VU9A 2FPRA 2PXCA 3RIEA 4JU8A 3ZWXA 2HK8A 4G67A 1PYOA 4RPKA 1J2UA 3AWDA 1XCBA 1XQVA 4FS8A 1TF7A 2ZSJA 3EPPA 3G79A 4FYVA 1QU2A 3QVGA 2J5BA 4CCSA 1QQAA 3WHIA 1G0OA 2TYSB 1KZ4A 1JSRA 2CDCA 2BONA 5T6BA 4FHGA 3BB4A 1JQBA 3GLHA 4QT0A 2PX2A 4UDYX 2WV7A 2HIHA 2HLPA 3EARA 2DULA 3O73A 1QOQB 4RHTA 1Q12A 3DW1X 5ER9A 2QG4A 4CF5A 1M34B 3VDNB 4BRWA 3B6IA 4LXXA 3CE9A 4O4IB 5JAZA 3R5KA 3IILA 4AG5A 1C14A 2V7BA 2V6JA 2CCGA 3B9BA 3IAFA 3TTTA 2RE8A 1ZN9A 1H5QA 2J31A 2B4RO 1DL5A 2IGBA 3Q2OA 2PSFA 2W8ZA 1IRIA 2GPBA 2PLRA 5KYYB 5LQCA 3R8FA 4Z8YA 4A1OA 4WBNB 1PL8A 4JLVA 1I6WA 1IK4A 2H4FA 2FN3A 2XXJA 4UUQA 3AJ9A 1TA9A 3CLUC 5AIAA 1RP1A 3ZEIA 4GICA 2XVXA 4Y6OA 1SD5A 3PFHA 3UUEA 2X5XA 5FULA 2BGIA 1E64A 1TDJA 1E20A 4UKDA 1QLJA 3N7TA 1JGTA 3RF7A 4JLBA 4UUBA 3WWPA 3H99A 1BFUA 3ZDCA 2LCQA 1VGVA 2LP4Y 1JKJB 1JQ5A 5A5DA 4ZYLA 4H17A 3WDMA 3WNBA 3WRXC 1KPGA 3KOOA 1OAOC 2JHCA 3H3FA 3U13A 3RSQA 1B26A 1IY8A 1RCUA 5EKTA 1ZVVA 3QG1A 2M2IA 1X87A 1IZYA 2VXOA 3H8VA 2AG6A 3EXHB 3KLPX 2IP2A 2VJPA 2X1MA 1GA4A 3F6CA 3VGJA 3UB4A 2IZ0A 4U8GA 3QH4A 4WCFB 5KVAA 4ESEA 1EFRA 3SQLA 5BSHA 2IXDA 2FEOA 2WP8J 4YJHA 3H7AA 4IWNA 4E1VA 4CQMA 4YRAA 3NDJA 5IWCA 5JH7B 4OXIA 4EP1A 1WHTA 1HT0A 3N0WA 4ETIA 2TECE 1VP9A 1XT6A 5EE1A 4ERXA 2CVPA 1MAHA 1D6SA 3W4KA 4AZTA 1FDUA 3V32A 3N0VA 4PU0A 3MXTA 5LA6B 3I8OA 1G21E 3G9UA 1E8NA 3NC0C 4EFMA 2ONYA 3RF6A 1XJ5A 3U6KA 3EGIA 3P26A 4OHZA 3NOXA 4F6LA 1SC6A 3OPYB 3P8ZA 2I8LA 5LQDA 4R8RA 2QUIA 3IV9A 3KNZA 4UZEA 4GZ6A 5BRAA 1Y7LA 4E2XA 3STWA 3RJTA 4E6PA 3NS7A 1GL3A 4M86A 5CG2A 4YRFA 1W2GA 2DBQA 3ZE9A 2HQOA 4G4IA 4J1NA 1YZKA 4QPZA 1EFDN 2ERXA 5BT9A 3RI3A 3TNYA 4Z9XA 1WUKS 5BMOA 2FSGA 4DG8A 1QX4A 1CUXA 3HLYA 1HLPA 3UGKA 1W73A 1P61B 2EF0A 4W1RA 4JUCA 1N7IA 5IW8A 5AOVA 5DU2A 2CNNA 2BR5A 1M2WA 1BH2A 5DKFA 3WNVA 1QGUA 3OOYA 1D1PA 4R68A 3KP1A 2VPIA 1KPHA 2AZTA 1YL6A 1NU6A 1W2HA 1TK3A 2YY6A 5ALMA 5F33A 1EVKA 2C4TA 2IEYA 3KVOA 4LAFA 4BVBA 2FK8A 4LF8B 3C1AA 2WQ7A 2V6MA 1CJCA 2ZBDA 4B6QA 3K2IA 4C20A 1QQTA 5CLJA 5T57A 5K9ZA 1W0JD 3I30X 2PZKA 3SZLA 3PE4A 4XW2A 2PKEA 5LYJA 2DJ5A 2QZZA 3FR7A 5BV7A 2WFZA 4RPGA 3GLUA 5C3MA 1TU0A 3AG5A 4TV9B 3GLIB 2ZE5A 4BBZA 1ACJA 2EGHA 4NE9A 3PENA 1EUCB 2NU6B 1MGPA 3H19A 4EUNA 1MW9X 3ZY2A 4K05A 2P67A 3A9TA 3T7SA 4JI3B 5HRCA 1U4NA 5FBWB 2XMDA 4DM4A 4IICA 2HJRA 1YBFA 3CIFA 4R2LA 4ARBA 4WE3A 4AP5A 1KK1A 4G63A 4K1XA 1WEHA 5JLAA 3HBJA 4X60A 4EHBA 1AZWA 2JGEA 3GJ7A 3S4YA 4UTVA 5E9AA 2GXQA 5DTIA 2VTEA 2W6NA 5IBPA 1KFCB 4AP9A 4NOMA 1TMOA 1VM6A 4NULA 3JAWB 4B80A 4GWLA 1E3WA 1FC0A 1T9DA 4C0LA 3HB5X 4BX8A 2IVFA 5CA0A 2BEWA 2VJMB 3W05A 1XFAA 1QORA 2OAQ1 1XA3A 1RABA 2QSYA 4F97A 1ENYA 1ZK2A 4KRYA 1GDHA 4QM6A 2H1VA 2XTAA 1CRPA 4BVHA 5HUJA 1P2GA 4TKVB 2QAJA 4NENA 3T1NA 4JP1A 2I1QA 4ML3A 4PLFA 5K3CA 3I9OA 4NS4A 3P0HA 3RUIA 4ZQHA 5G0SA 3DL4A 3NM4A 4NEGA 3WTCA 5CB4B 2FMTA 1EX7A 4LBVA 1UWKA 3DOOA 1C4XA 1U2TA 4HYEA 4OLJA 1CIJA 4GOND 2J3MA 5ILOA 4RUKA 3S8YA 4IJMA 4LJ8A 4UBKA 2OXIA 4EQ6A 4JYAB 3P2MA 1XROA 3MIZA 4JASB 4BVFA 4IO1A 4L0MA 2ZEJA 5HF8A 2I7CA 4HB4A 5AVOA 5CPBA 5IMBA 4XH9B 6NULA 3V8RA 1YB5A 2DUJA 1U8XX 4DDHA 3BD9A 3DT6A 4WA7A 2Z9DA 2ATEA 5DYNA 4X24A 2P77A 1P5HA 1LPMA 4N0DA 5JI2E 4D8TA 2X4DA 1QGED 4TPKA 5FQOA 1PLJA 1P7CA 1E7RA 1I6KA 2IYSA 3MJVA 4D9IA 3KR9A 4RZ2A 1TUBA 3ESDA 4GO1A 1OI3A 4HAVA 5IDYA 1CUUA 1R3DA 1RM3A 4C0QC 4AUNA 4C2BA 2YMMA 4BX9A 2F3SA 2WF7A 4HGYA 4IDGA 4WLOA 1JB1A 2X5KO 1DINA 3BH6A 3FNGA 3H9CA 1PG5A 4GWKA 5AJHA 1STOA 5DYYA 5EWJB 3THSA 3FHJA 2Y66A 3ERCA 1F2TA 3C3YA 5THXA 3E7XA 3GP5A 5HJ2A 2WMYA 1N5OX 5BN1A 1ETHA 3U3MA 1JEJA 1KEEB 1GG8A 1GSHA 3OLQA 4IJWA 4LI0A 4BNKA 5L8VA 2C5BA 2WVAA 3RVKA 3G0GA 1XO1A 3AEQB 1YFKA 2AN5A 1QNFA 1B8NA 3T7JA 1W0JA 3TRKA 2YIJA 5L7TA 3UJHA 1RYMA 1QP8A 3KFVA 1PR0A 1U94A 1NNUA 1TTQB 4H7DA 1KSGA 3NHLA 4XWWA 3I76A 3KL2A 4XYMA 1Q1NA 1OWNA 4KWTA 3SNHA 2ZIGA 3DMHA 1JEOA 4RAOA 3JQFA 5F23A 3UXEA 3FOFC 4BZXA 3MD0A 5AO9A 3FROA 8MHTA 3N70A 1JKIA 3SEAA 4YMGA 1YJCA 3QP9A 2BBOA 3BC1A 2QIOA 4MEAA 3K5HA 4O5AA 3IMKA 3LO8A 1ODLA 3P5SA 3N5KA 3LV8A 4MA5A 4KN5A 5BUCA 1RJFA 4X6LA 4OYYA 1GA1A 2KQUA 1CHNA 1L7AA 3OZSA 3PEUA 3TLGA 5DYGA 1REQB 2UZ0A 1ID8A 2X4IA 2GF9A 3O0TA 1WQ4A 3ZUGA 2QD2A 3AR8A 1YR2A 1FMFA 5FUYA 2PAAA 1V6AA 1H2EA 2VP9A 4BUJA 3WQRA 3E48A 1K88A 1E4YA 3LSYA 4BLRA 3WZMA 3MMSA 5KHLB 3ADOA 3OT1B 1Y63A 1DO0A 1ESCA 1XD8A 5LXTB 5IJ0A 2PZLA 2NMVA 2FF5A 4GRDA 2C04A 5D7NA 3SS7X 3EVZA 4MKRA 5IKPA 2IW1A 4GOOD 1AKNA 2CWDA 4IF6A 2GA9A 5K3FA 2HD4A 1D4ZA 1CZLA 2UUOA 4KPFC 3RJZA 3IKTA 5KVCA 1KU6A 1IXRC 4U5XA 3UMJA 4EI9A 1P0FA 1K9VF 1TNDA 1D7OA 3L4EA 2G76A 3NLLA 1NHGA 3E5RA 2X0JA 3BN3A 3HKBB 2NTJA 2HRZA 5HGJA 1BHSA 4DYHA 2I66A 4RH3A 4QYIB 2COKA 3GH3A 5GJVC 2XJ4A 1JJFA 4WNIA 1CZRA 5HQ3A 2MR6A 3ZW9A 3HMQA 3R0ZA 4J1TC 5C1PA 4PPFA 4NKRA 1DLIA 1Z2EA 2C4NA 2ZYAA 2JHPA 1BE1A 4M8SA 1B0AA 1ZRMA 3A4IA 1FFAA 4PSCA 4DC1A 5LLTA 3EQ9A 4UVGA 2RKWA 3G59A 1E3DA 3ZWQA 5J43A 4XIGS 4TL7A 5KJEA 5JASA 1ZIXA 4Q9DA 2O1WA 4KSBA 4XLTA 4BU1A 1V7PC 3PYXA 1GZHB 1YS6A 4UNPA 3I23A 4BKMA 3N6RA 3FIUA 1NLFA 1ZC3A 4RKYA 4OXKA 4AICA 4YGXB 1UKZA 3LYAA 2OESA 3BTVA 1CQXA 2JHAA 2WHQA 3HBFA 1BD4A 1LFAA 4FNAA 3WLRA 4IQ0A 1SVLA 1XE3A 5KC9A 1U6JA 2W6ID 3SJCA 1KQGA 2OKGA 4UOQA 1XJCA 2RHWA 5D1HA 2AJLI 5DSZA 5SYNA 2FSPA 4WLNA 2PZEA 1T6ZA 2PBLA 4OHXA 1C9JA 2ZAGA 1PK7A 3PF9A 2Q4DA 4OP1A 1JG1A 4PO1A 3L0IB 3UT6A 2REQB 2C9DA 1DI0A 3PUIA 2P91A 4UBMA 1T8WA 4E1AA 3VVCA 2BWJA 3G0HA 5C9ZA 3VR1A 1TJPB 3WMEA 4I81A 4J3NA 5DVZA 4JUAA 1ZUD1 4KC0A 3VDRA 2G63A 1T2NA 5K8IA 2YDXA 4A73A 3S1SA 1US8B 4JBLA 1UPAA 2ZWPA 4JGGA 3AEYA 2VTDA 5BMVA 1X1TA 5D3MB 3SLKA 4ND4A 4ZJUA 5A7FA 2JIOA 3B38A 3G9QA 4PLZA 5LQRA 3ZDFA 4MKHA 1Z74A 5JPCA 1EWQA 1OZAA 2A9QA 2B9VA 2WC1A 5K51A 1O5TA 3L8FA 2Q3LA 2YWCA 3OZUA 4INJA 1G8HA 1CJMA 3CIOA 1SRQA 3R41A 2VJKA 4OH1A 4XRRA 4K9NA 4YV0A 1ZSVA 3DA8A 4RGYA 1ZJ4A 3CPJB 1TA4A 2PSJA 2I29A 2QAGB 1ML3A 3FSGD 2Q5OA 3HJTA 3IX7A 1SHKA 3P0FA 4OIFA 3REQB 3W79A 3JZDA 4BDSA 5L3VA 1TVCA 4NF2A 2P2DA 3O2SB 3Q0TA 2QPOA 1D0VA 1PGJA 4IIHA 2XNKA 2D2FA 1J42A 1XTUA 2ZI7A 4HS9A 4I14A 5AI4A 4EZEA 5BN5A 3GEMA 1UZUA 4LXHA 1DC8A 2WIKA 3L05A 1DAMA 3VR0A 1O0BA 4F2HA 1TK2A 4MW4A 3U48A 1P4SA 4UTZA 4ETMA 4MWTA 4OQXA 1CUZA 2YWHA 3FCAA 3W9BA 4KPEC 3OU2A 4M9UA 2G83A 3QW4B 1Y5IA 3RIXA 4PYJA 4OHYA 1P3Y1 3CWQA 4GI1A 4YWHA 3TMKA 3V4ZA 3ZWWA 3WGGA 1NQ5A 2C9MA 4DV0B 1OR8A 2BRUA 2Q49A 1JKXA 2IY9A 3VPSA 3AESA 1ZUHA 4AMGA 1O94C 4Q0MA 1Q0HA 4BPBA 4OHOA 1YJ5A 3G5UA 1XCPA 3O4HA 1H1DA 4BB0A 1M1YA 4BE4A 2HL6A 1EP1B 1II0A 5BW8A 2VHEA 4KQ6A 4D4LA 2XZPA 1FXSA 3W7BA 3EY9A 1DX9A 1M1YE 4FGZA 3R8CA 3EXG1 3F78A 1R10A 4BFSA 3Q7PA 4C01A 1X80B 2JLBA 2Z98A 5LZ8A 3UTCA 2VJAA 5GMOA 2QTNA 3G88A 4P33A 4FWIB 2DR2A 5EY5B 4KWIA 2VDUE 3PXXA 4H08A 4B84A 4F3NA 4MS1B 1FA9A 2QRMA 2W6IA 1CZUA 4URZR 1VBKA 2EKQA 1PFWA 2H2AA 5TX7A 2IX9A 4E31A 1JS1X 2X76A 3DBRA 1I0IA 1C1YA 1OWMA 5AJWA 4IJ5A 1EJ6A 3OJWA 1Y6FA 2NAFA 4BVEA 3A4NA 5EIFA 3WV5A 2JKZA 1OXVA 4UXIA 3WDSA 3V4PB 2K5UA 4MCJA 1FF9A 1T34A 1YRWA 3OX4A 1LLUA 3LY8A 4QFBA 1ISIA 2Z3WA 1V8DA 4HYQA 4JI7B 1WW2A 3F6SA 2PUJA 1ZIPA 4Z4EA 5ICEA 2OKCA 4BNNA 4PFKA 4IYJA 3HL4A 3D2CA 2GJSA 4ND5A 3V8QA 2R6CA 4CMEA 3K0AA 1CUEA 1XPJA 1P73A 4EPVA 3M9WA 1FNCA 5IT4A 5EL0A 2A0FA 5K3DA 3GJRA 3C3MA 2DKNA 1DXQA 2ZB3A 1Q0PA 1VMAA 3BMXA 3N8IA 4GZMA 3SPXA 4ZHSA 1EG2A 2Y27A 1A2KC 1D5WA 5HA5A 4P4SA 3GJ0A 1D8AA 2W00A 3BG5A 3NXSA 4WFJA 2R1ZA 3P4XA 4ZVPA 4B7UA 1JIVA 1LDBA 1E4EB 1F20A 1QR2A 4UDNA 4KR9A 4DA8A 5DM70 1RPZA 1ETUA 4DR6B 2O5EA 3FSGA 1DIAA 3O95A 4LOAA 3ACCA 1QKIA 4J7AA 1HZZC 1CKEA 2J3EA 2MOKA 2VL7A 3VHRA 4BV9A 1MB9A 2OYRA 5D6NA 4DTIA 1EEXB 4R2MA 1MB2A 4GP7A 4V1CA 2XRMA 1Z6XA 1NVBA 1U0JA 3QKUA 4IMPA 5AUNB 1T1EA 2DRIA 3UW1A 1MDBA 2ZQZA 3WL5A 4BRZA 2MU1A 3THWA 3FUUA 2OHFA 1U1FA 5F2NA 3O6VA 4HB3A 3MTDA 1N3YA 2XRZA 4OHKA 3H0KA 5AW8A 5EJGA 1B0ZA 5AICA 2X8WA 5IKXA 1KJWA 2DZDA 2YR0A 2YZ7A 3DMGA 4M1WA 1Q17A 1RI5A 1Z62A 1GYRA 3AU9A 1N0UA 3AFMA 1U28A 4Q6BA 3OQJA 1RRMA 4B9EA 3GRAA 4XWGA 5BWCA 2MT9A 1VJ1A 3EWSA 1EXDA 2VHVA 4REQA 3HNRA 4H3KB 1QG2A 4N8DA 3M3DA 5C5CA 3AUUA 1VMKA 4FIDA 3RAFC 4I1PA 1VLLA 3FAZA 1MZVA 2PGOA 1KORA 1O2DA 4DAOA 1GN9A 1TB4A 4M0LA 2XKBA 4D8XA 3KU1A 4C30A 2V8OA 1TX4B 3ZHYA 1SOWA 3DQQA 4DIDA 2Q3JA 3DE5X 2A57A 3GMIA 1YU6A 2GEBA 2X3UA 3LI2A 1W6RA 2BOVA 3JWJA 3Q3JB 4G41A 1K9SA 4LJ9A 2AKEA 4D1YA 1XZCA 1D9XA 1I4OA 3KXDA 3NTRA 4X91A 4WMLA 1YCHA 4KPUB 1G5FA 1JLMA 2VUUA 3V6MA 1M2OA 3TPFA 3KSRA 1HFWA 1BEEA 1NN0A 5J63A 1PVDA 2K6GA 4V0SA 4ESHA 4KR3A 3RROA 1XHEA 2JH3A 1D2GA 1E3JA 1V5GA 1P29A 4PBRA 2JGDA 3G1WA 4LZJA 4MIKA 3ZV4A 4B76A 3AUTA 1JT2A 2J9ZB 3OFVA 3RSHA 1AMOA 4DQLA 1BRMA 1NYLA 3OC6A 2BT4A 1YR9A 4M7WA 3KJNA 1KEZA 2X77A 2Z2IA 3EGWA 3LUAA 2FKNA 1V8BA 1Y1PA 2EKBA 1Y8CA 4RD6A 4RHEA 5CM2Z 1RYBA 1RZUA 2QT0A 2PKWA 1N2XA 3MT0A 2X0IA 1DBSA 5TGDA 4YRQA 3GJ5A 3AHCA 4TN1A 5I7HA 3MB8A 4MW9A 2WMDA 1SCJA 2C98A 4G9EA 4OYHA 3GJ6A 4HNHA 1QIMA 1VSUA 2QJTA 3GH1A 2WEKA 5GPBA 4BPRA 3CCCA 2D59A 2WFAA 3AFHA 2YRWA 3RKSA 1SHZA 1JEAA 2RHDA 4XJVA 2GYYA 4IM7A 4JSRA 1BVUA 1WXFA 2JFNA 1J09A 4RVHA 1M3SA 5IF3A 3WC4A 3NTVA 1PBNA 4LV5B 2DT5A 4IDPA 5HYVA 4E12A 1C0PA 1M1NA 4BX2A 1G55A 2QPLA 3DCNA 7AT1A 5ENDA 3U4QA 4PC7A 1GTVA 1FIUA 2PMBA 3PHGA 3PI7A 5JD4A 5LM3A 2XXBA 4D3FA 2OILA 1AUPA 3TZCA 3Q7EA 3RSSA 5IG2A 3F1LA 1GFIA 1RKQA 4YCAA 2F9LA 5IZCA 2NUPA 4JKOA 3K94A 2ADOA 1IIRA 1UC4B 3HHEA 1WDWB 1ZW1A 4N0PA 1GG2A 1XPUA 3V9PA 4MUNA 3CRMA 3ICWA 4J76A 1SVKA 4FJ0A 4RY0A 3WWDA 1TCUA 5DLQC 3PQ3A 1MX1A 1E66A 3T0GA 1TLTA 2G80A 3ZU4A 3ADKA 1LCIA 4ILKA 1JFRA 3DDSA 4H3SA 3HL0A 4A91A 3BSFA 4YREA 1CVRA 3DMTC 4LHYA 3EGXA 1HQDA 2PFGA 4C4ZA 4BP9A 4LJ5A 8GPBA 1IOZA 5FOWA 3WL7A 1EFHA 4XKJA 1N2JA 1UF9A 5EP4A 5F2KA 1EG7A 5FTJA 1I2BA 4BKOA 2G4CA 3QVOA 4WT7A 2VAWA 2QZJA 2XYQA 1B43A 1U8YA 3AJ8A 3QNWA 1ARZA 3O7MA 1JFVA 4GXQA 1CUBA 1O5IA 2FN8A 4K5QA 2QLJA 3GG9A 1NIPA 3G23A 3FPSA 2JI4A 1XNHA 3KJZA 3MRTA 4TLEA 1ND6A 5JXHA 1E3LA 2J41A 2BL4A 3AVQA 1MX5A 4NMWA 3H5TA 4U6SA 2HTFA 4MCHA 4IJVA 1I1NA