2EX1A

Crystal structure of mutifunctional sialyltransferase from pasteurella multocida with cmp bound
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
388
structure length
379
Chain Sequence
MKTITLYLDPASLPALNQLMDFTQNNEDKTHPRIFGLSRFKIPDNIITQYQNIHFVELKDNRPTEALFTILDQYPGNIELNIHLNIAHSVQLIRPILAYRFAHLDRVSIQQLNLYDDGSMEYVDLEKEENKDISAEIKQAEKQLSHYLLTGKIKFDNPTIARYVWQSAFPVKYHFLSTDYFEKAEFLQPLKEYLAENYQKMDWTAYQQLTPEQQAFYLTLVGFNDEVKQSLEVQQAKFIFTGTTTAEGNTDVREYYAQQQLNLLNHFTQAEGDLFIGDHYKIYFKGHPRGGEINDYILNNAKNITNIPANISFEVLMMTGLLPDKVGGVASSLYFSLPKEKISHIIFTSNKNNPYVKVMRRLGIIDASQVIFWDSLKQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cytidine 5'-Monophosphate (CMP)-Induced Structural Changes in a Multifunctional Sialyltransferase from Pasteurella multocida
pubmed doi rcsb
source organism Pasteurella multocida
molecule tags Transferase
molecule keywords a2,3-sialyltransferase, a2,a6-sialyltransferase
total genus 130
structure length 379
sequence length 388
ec nomenclature ec 2.4.99.4: Beta-galactoside alpha-2,3-sialyltransferase.
pdb deposition date 2005-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11477 PM0188 Sialyltransferase PMO188
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ex1A02
3.40.50.11120 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ex1A01
2II6A 4R84A 2IIBA 2IY7A 2C83A 4V3BA 2C84A 2IY8A 4R9VA 4V2UA 2IHJA 2IHZA 2Z4TA 3S44A 2IHKA 2EX1A 2ILVA 4V39A 4V38A 4R83A 4V3CA 2IIQA 2EX0A 2ZWIA
chains in the Genus database with same CATH superfamily
2JLSA 1T0BA 1XTKA 2BAGA 3UHJA 3VV2A 1J7JA 1ZVQA 5F7OA 3H4VA 2KB0A 5D3MB 2BHNA 4AICA 1Y6RA 3HDGA 3TUJC 2MSCB 4P81A 2K7FA 4ZKEA 4I1SA 3ZNQA 4KXYA 4AQYB 2VP2A 3KYCA 4ND4A 2CXSA 3K3PA 1SCJA 4GRAA 2P9CA 1BCRA 1B8UA 3VJLA 2IITA 1KERA 3AUUA 3OU7A 2GARA 3RJ5A 1T2EA 4EI7A 1Z4QA 1EK0A 1VXOA 2ZCVA 1G4AE 1LV7A 1ISFA 4EA6A 1Y34E 3EDYA 3DE2X 4L4ZA 3OT1A 4RGQA 3PGLA 4EYSA 3DR5A 2HNBA 4DJ5X 5KKCA 2IZ0A 1KJJA 7REQA 2F3SA 1IG0A 5ULLA 4NFYA 4AY4A 5LMNB 4C1BA 5F4BA 1HV8A 2E9SA 1CUYA 5DPMA 3OX2A 3KSZO 1R3UA 1Y1RA 4RTJA 4CM5A 2BGTA 1T2FA 3KV1A 1XGKA 1Z7WA 3MD9A 4R98A 3JAWB 1R15A 4P98A 4O4LA 4FGWA 5CLGA 3LGXA 2DEUA 3AJ8A 1TIKA 2PG3A 1QANA 2A9QA 1K7XB 1L5RA 2BMEA 3BFPA 3L82B 4HRYA 4RKQA 3QJ5A 3GAMA 2HHJA 3Q11A 5DBOA 3WWYA 8GPBA 3FHTA 2OBLA 3TSOA 1MA3A 1MN6A 1XJ0A 3PXCX 4HATA 1FB5A 4J0KA 4LXYA 2NYAA 3D59A 4HX5A 2VTVA 3ANMA 4LJLA 1A9RA 3QVJA 1ZIOA 5CNIA 3RTCA 3U40A 2MINA 3HPRA 2POCA 1CRQA 1CQZA 3HWSA 3LCUA 4QUIA 2CEAA 2LCQA 3AEQB 4Z3KA 2GN0A 3RUCA 5BN5B 5CHEA 5HRAA 1LSUA 1XAJA 2J7PA 2J08A 2LBPA 1TUGA 2KQUA 4X91A 5I9TA 2PXAA 3NTXA 3O9MA 3FGZA 4G5RA 5H80A 2QRUA 3FFBA 3WGTA 1QDLB 1SBHA 3KWMA 3W0LB 4B2YA 3C3MA 1XC7A 5L6MB 1WXWA 3TQOA 3IMCA 4J1NA 1HR0B 3DEHA 4B40A 4HWRA 5HF6A 3CLTC 1LFAA 3IFSA 3G1TA 3GFOA 3AINA 5JQWA 1DLIA 4KI0A 2ILVA 4V39A 1I9CA 1FDOA 1HKHA 3BTOA 2VKTA 4JLPA 5BUSA 5JJBA 1RS0A 3GGOA 4RAQA 3RRMA 2FNAA 5CA1F 4M4SA 2OO3A 2X4GA 3ZUGA 2ZJAA 1SC6A 4BXOA 3U4QB 1M7GA 5HZKA 3L8MA 4LYDA 4O0LA 2DT8A 3EQ2A 2HA4A 1QG2A 4IFIA 4NH4A 4YK7A 1J21A 3DE0X 1Q0LA 2JHAA 1Z25A 3QKRB 3PC7A 2E3JA 2HBQA 2VYQA 1NPYA 3FSJX 3U9SA 1FNDA 3INNA 2VZ8A 4MR7B 521PA 2Q5HA 3I3SR 4A0QA 4B34A 4WUTA 1SN7A 3SP1A 1N0WA 1VSQA 3ST7A 3UMJA 4DABA 4FFNA 1KEKA 1QV6A 1YZHA 4CUJA 4BO1A 1EHCA 3MCVA 2FV8A 4K9QA 3TPCA 4GECA 1T5IA 2NO7A 1L7DA 2X6RA 3RS0A 3F9IA 4A91A 6CHYA 2VHWA 3X1YA 4IJVA 4FLEA 3FAZA 3K0BA 2GETA 4LF7B 1EFAA 3AR7A 3D43A 2Z2XA 4M54A 2R6DA 4QDZA 4RH3A 1R6DA 1CUHA 5KTNA 2YVQA 3BGVA 1C80A 1BWRA 1FS4A 2V6JA 3MQFA 1EDZA 2ATEA 4WEQA 1YZ3A 1M2GA 2P9QA 4C03A 1Z5VA 1PYDA 5F1KA 4C1NA 3DBLA 4ZCTA 4XM0A 3AFOA 2NU6A 3AHDA 2EIXA 4FDUA 1ZPDA 2XNSA 4ZVMA 3E27A 4Y6OA 1TXGA 4M1YA 5HEKA 5A6SA 1HRKA 5JY6A 2GN2A 3R3JA 3HKBA 3I8XA 3IVGA 2LGJA 1CJUC 4EELA 3VKGA 1EK6A 4DADA 2RE8A 1U7HA 1IWPB 3HNOA 1NI3A 2GYYA 1LQ2A 3OO1A 3IBYA 1OAOA 2DTDA 2HIHA 1JS1X 3L79A 3T4XA 3UOWA 3DLCA 4J6EA 5JAUA 2C0QA 4U39A 1E2IA 3HG7A 5D5HA 4RCVA 2D4AA 4QZVA 1J39A 4UBIA 5DISB 1MBZA 3FYTA 1DGQA 5FPKA 5DI3B 3VX4A 1ETUA 2OAQ1 2J8ZA 2RK3A 3C45A 3HDQA 2XMRA 1WHTA 4H7FA 4O2AB 4PLWA 2R2GA 4I3HA 4BE7B 2JG3A 4G89A 2XB8A 4UUPA 3HM2A 3LLUA 4HGPA 5LWHA 1BHO1 4ZU6X 3UK0A 2PNFA 1W2GA 4YHHB 1GD1O 1SM4A 4YJGB 5KJ6A 4YDRA 4MVJI 5KNDD 2E6UX 1YASA 4WK0B 4RGYA 5DBFA 4B4WA 1ELOA 3VR6D 1ICEA 3RSQA 1KK2A 4R8MA 2HMSA 5FO1A 3W5JA 3ZQKA 2FP4B 4YAIA 1K8QA 1ZI9A 4IQ4A 4C0LA 2HA0A 2OMEA 4DNOA 2FRDC 1FRZA 2EZ4A 2I2BA 3LHDA 4QJ4A 1GAWA 1MOSA 2ISSD 1SHZA 4YJDA 4E1BA 1K9SA 1XEWX 3V42A 5JJCA 1XU7A 1CY4A 1T34A 3DVSX 4D4JA 1GSHA 4M83A 2RHLA 3U7QB 1P6UA 3N2KB 2ZBPA 4Q7EA 3GZJA 1IZZA 4KPYA 1TTTA 5BWMA 1CY6A 4BVJA 2FPMA 2TRSB 3FMFA 4UNNA 3ZJTA 1OBFO 2X3YA 5KNLA 1Y8CA 3IOYA 3DYVA 1ICIA 2FZEA 1Y3HA 2WPDD 3HL4A 3KAPA 3RG2A 4V1CA 4Z3OA 3EXHC 1JXOA 4JBWA 2XLCA 1BX3A 4HFNA 4JJ8A 3D7RA 3UXMA 1GGEA 4D9IA 4ZCIA 1DJNA 3TL6A 4LSZA 4OHVA 1AKNA 2HM7A 3NR2A 5F2EA 4D7AA 3O31A 1BVYF 4XGRA 1QP4A 1KC3A 3IIKA 5BNIA 4LDJA 4GYWA 4GGOA 3L40A 4Q48A 1FRVA 1R12A 4CKBB 1DAMA 1QLHA 1REQA 4DSNA 4YYZA 4TRJA 4V3CA 3TGLA 2GHIA 1LLDA 2P6MA 2HNKA 4CW7A 3FZYA 3OZAA 1K5PA 4OQXA 5BSFA 2GUGA 1T5DX 1W36D 3SBDA 5HUHA 1BW9A 5LQSA 4DNQA 2FQ1A 4GLOA 4BN0A 3KZMA 3ADPA 3L6UA 4PO9A 5JO0A 1H2BA 2IYPA 4HNVA 3U9TA 2IHUA 3KSUA 1YRLA 3PA8A 3LBFA 4EX6A 2C61A 2CYAA 5F76A 4BQIA 1I10A 4UMFA 4BZWA 3U4MA 4JWTA 5F23A 3CX6A 4RTRA 3B2EA 3HWX1 3KNZA 2QMZA 3KQMA 3TI9A 4CEJA 1QQ7A 1IM5A 3I6ZA 3MEQA 1LPOA 3PHHA 3WRWA 2XI4A 1UFKA 4WZBB 3TX6A 1AC5A 3S5UA 2ZRAA 2WWTA 2QOEA 1T25A 2B7BA 1LUAA 2WTNA 5E3IA 2AFIB 2CZGA 1JDVA 1ZGZA 4AM8A 1FP7A 4EY8A 2BKEA 5I9BA 4B8WA 1RRKA 2H0QA 4FI3F 2ZBUA 1NVGA 2GFIA 3V7NA 2VKQA 4PLFA 2JI9A 1M5RA 3QE0A 1JR6A 1WIWA 1HYGA 2B4QA 2KSQA 3NDJA 3W3AA 4DZRA 4F2WA 4FFOA 4PX3A 1O96B 3CZAA 3QELA 2F3UA 1JBQA 3RFTA 4YBRA 3FUTA 4WA8A 4EL5A 1QQBA 4PG4A 3OIFA 1YOVB 2V45A 3ETJA 4HMQA 2FF7A 3CNOA 3DAGA 4J0CA 3UM9A 4UFPA 5TR9A 1YDGA 2XWPA 2WB2A 3ONEA 3PUVA 3ZBQA 4NATA 4NY1A 1N1MA 4QYSA 3RLFA 2WE8A 1ABEA 4YYEA 5JPCA 4KH1A 3KUXA 4M98A 1XWWA 2VSOA 4XUCA 3V2GA 2Q2VA 4XJXA 5CFQA 1XVAA 3SZOA 1DAHA 4H7DA 3CY6A 1KYYA 2W6JA 3G2NA 3R24A 5AHOA 3UHPA 4F72A 1RNLA 2AG6A 2L2QA 3LO8A 4FMPA 1USUA 5C35A 2D13A 1R50A 2UYGA 1T0JB 2W2XA 3AF2A 1V5WA 4N3NA 4UDYX 3UA3A 1JJIA 3PD1A 4ZYWA 4V03A 1BXZA 1BHJA 1R2QA 1S3IA 1IVYA 1Q1QA 3CF4G 2OGWA 3USZA 1L1QA 3V8EA 3F8WA 4R2WA 1U94A 1MB3A 1UBEA 4LHYA 5EHZA 2BHRA 3ZU3A 4WLUA 4A92A 2Q3FA 3WK9A 2M9MA 3ETDA 2QUJA 4GMFA 5DX0A 1Q15A 1JU9A 5CXUA 2RMKA 2IF2A 3PS9A 2AXPA 3QKIA 2I7TA 1H2XA 3GEEA 1V7QA 4NZYA 2UZIR 4GI5A 5JQGB 1QZUA 1L4MA 3X1KA 4ME6A 4X1YA 5DIFA 1V3UA 4JUAA 5ILGA 4DUZB 2IXDA 3F3KA 2P2CA 1IUPA 4UTOA 2AYYA 3M33A 3DULA 1OH8A 2G7MC 2ZSDA 4BNYA 3THWA 2QW0X 4RCZA 3V32A 5F9HA 4L8WB 2C9ZA 3TZCA 5EJ2A 4CM8A 5H0IA 4I4NA 3IOCA 3JYNA 1L4FA 4L74A 4DANA 2G9RA 4LGVA 2FX2A 1YKFA 2H1LA 3IDOA 4LUCA 3NBUA 4P83A 2W6OA 4UW9A 4P4GA 1NURA 3HN7A 1I2MA 5IAJA 3WL5A 2GBLC 2OV3A 3CJQA 2CXOA 3VHXB 2FZKA 1DKQA 5EP1A 1WDWB 3O3MB 5IBRA 3K20A 1J2YA 3FF4A 4PCLA 1GTRA 2VDNB 3ND6A 3TINA 4C14A 1FFGA 1SXJB 1E7WA 3WO1A 4F12A 4WJKB 3NAZA 4IHQA 5HQTA 3SZRA 1K88A 4QEDA 2B37A 2G63A 3ADDA 5HIAA 1RIIA 3BCUA 1ZY2A 4U7PB 1MB0A 2YXBA 3AOEA 1XPJA 1Z16A 3CG0A 4PQGA 2WHPB 3VSBA 1B2RA 1WBDA 3RRYA 5I4BA 1C0PA 5IT0A 2P75A 1W44A 2J3KA 5H81A 1U9ZA 2NX2A 5AJUA 4Q82A 5FI1B 1WVMA 2GTPA 3KZOA 4WINA 1QCZA 3MGKA 4KXMA 4ARSA 4CGYA 1AGYA 5DASA 1Q21A 4PTLA 5HKAA 3I45A 3RUEA 2D7JA 4ZQCB 5DYGA 1X7ZA 5AXBA 4L4YA 4EJSA 1QJCA 2ILTA 3E18A 1TX4B 3EGDA 4MB6A 4LC1A 4POAA 1RWOA 4NHOA 1R88A 1SC1A 1BXRB 3H1PA 5CLIA 4LMAA 2MWMA 1QB8A 1ZISA 3HB4X 3WFIA 1I9GA 5CA0F 1Z73A 4RQUA 1EJ0A 4I6JA 4K40A 2GCEA 1II8B 1NM5C 5IAOA 1DIRA 3HK2A 3A1VA 2ORWA 1ZD5A 1AS0A 3CBGA 2N75A 4MINA 4V2IA 4C7VA 5CFLA 1Y6GA 2F1IA 3ANTA 4HDSA 4IKEA 5IYZF 4KPGA 4OTZA 1Q20A 3MD0A 3TQSA 4UVHA 1R0XA 2B82A 2BE7A 3H87A 3W7VA 5LZ2A 4LYJA 1G21B 2OLJA 4GR5A 4ID3A 2AS0A 4RMJA 4CKCB 4R2KA 1HETA 4Z5XA 2FMTA 2VCHA 2I33A 2GEVA 2YYYA 4YGYA 1LPSA 2GEDA 1VSVA 3DM5A 3R3WA 4PZ9A 4XLLA 1DBIA 2JL1A 2VA8A 1QIGA 5BRNA 2BZ1A 4Y1GA 5FF9A 3ZHYA 1VDZA 4GKAA 3ID6C 2EWVA 1A2QA 1NXQA 1XEFA 4W1PA 2QJFA 4BJ6A 2ZJ7A 4DSTA 1OLUA 1HEUA 2ODBA 4AO8A 3WISA 3I9OA 4ARVA 4Q3CA 2I22A 1OSNA 1WSAA 2I3GA 2V03A 5BN3B 1J2TA 1ZU5A 4X20B 2P35A 3QENA 2HV8A 4JP2A 4MNTA 4QPDA 3WSTA 2XYQA 3D3NA 3TDKA 3ZU6A 4IXNA 2VT2A 3E2PA 3NHMA 1JQ3A 4ALMA 4DR5B 3TAXA 4ZIRB 4Q1FA 2WW8A 1IONA 3UUGA 2JCYA 3QBJA 1BKDR 1J42A 1PFVA 1UBNA 2NXWA 3IOBA 1O97D 4RZ2A 3AKDA 4LX8A 4ZT5A 3ER9A 4OQQA 4HAIA 3QLVA 1KVSA 3VTAA 1S2IA 4JI4B 1MTZA 1KI8A 5IG2A 4K1LA 5IUKC 1K7CA 2Q29A 3JZDA 3DFUA 2IDKA 4U5QA 7MDHA 3FG9A 4LNAA 3STVA 3UK6A 1XF9A 1M66A 2J5KA 3OI7A 4V1CI 1QM5A 3P2OA 3PF9A 3BMOB 1HNWB 1XMOB 3W8DA 5FWXA 5AKJA 4LFAB 1KH1A 3T3MB 3C7DB 1XAIA 3M2TA 3G0HA 1ZKMA 5BQXA 4HQLA 2AVDA 1I3NA 3H2KA 4E11A 1RZRD 2EZ9A 2GHTA 4H6WA 1R9GA 4ZQFA 3EIOA 1C2YA 1MJGM 1WPQA 2B3TA 2XQFA 4X44A 4KXVA 2BUCA 3GFTA 4M7RA 4OXQA 2EKLA 4Q4DA 3T0GA 4ZOQI 1HE1C 5FAKA 2CUKA 3G0CA 3OM0A 1QFJA 1NOKA 4C6TA 4EFMA 4CL0A 1SC9A 2P3OA 3AFHA 3VTFA 3QITA 5JXIA 4PYMA 1DDOA 3JQ7B 4RY0A 1KZ7B 2JCGA 2WHXA 3L46A 3OZBA 4M49A 4P4LA 4CIVA 2HA2A 5FYDA 4IO0A 5DM60 4GQBA 5JVDA 5HP4A 4B8YA 2XVZA 1BC5A 1V39A 3QU7A 4OA5A 3DNFA 1IJEA 3RVDA 2JFZA 3R20A 4ER5A 1V1MB 1HQKA 1J5EB 2IEYA 5DXAA 2W43A 5BXYA 4X1YB 2BFOA 3OKAA 2IS1A 3A10A 1QK4A 3B12A 3ICWA 4ONEA 1H8ED 4UVEA 3Q8WA 4QUBA 1JA1A 3GGPA 3PPIA 4IXDA 2D0PB 2E55A 2KMLA 4D9KA 4O2BF 4RF2A 2VP6A 1Z0DA 4B45A 4E5YA 3H4IA 4DR3B 2J3EA 3BHNA 4F5WA 3VKFA 3CTMA 3GLGA 1CYDA 1DKRA 1R6AA 3EVAA 3WLHA 2G76A 4YRGA 3DR3A 5BN4A 1VRCA 1E1QD 1XR3A 2FSHA 4RDIA 2QLLA 1ESMA 3BXFA 3CO5A 1I24A 3F4LA 4ZC1A 3WWDA 4X7BA 4OLHA 3GAFA 5LU8A 3K70B 2FN7A 4QEKA 4ATNA 2BV3A 4JLMA 2HQSA 3HQ4O 2FUCA 2OP1A 4ARBA 4E5PA 1KDRA 4PR3A 2R6FA 4FR5A 4R1QA 3ZDYB 1MQ8B 3D5EA 4K2HA 1JIJA 2EJTA 2QT0A 3P9XA 4Y6SA 1TUBA 2CCJA 2IS6A 1X7WB 4TYMA 4QAJA 1DUSA 2I2WA 1P8AA 3C24A 1FMFA 2XIJA 2CC2A 4JWKA 1NXSA 2CHUA 3BXOA 4GXTA 1I7DA 3L1KA 2JGDB 1SQGA 2B69A 4DWOA 3KOUA 5FB3A 4CEHA 3IUBA 2ZTSA 4ZOBA 1JP7A 4XH9B 1N2HA 2PT9A 3Q6NA 4KAAA 3WQRA 3WLIA 2XWBF 4AG3A 2Q07A 2YN0A 1E2KA 1RYMA 3IPLA 1SOMA 2OZLA 1G41A 1E0JA 1Q7GA 2JIPA 1CVLA 3PC6A 5D6NA 2C2XA 4QHYA 3HR7A 2Q1XA 3A1FA 2OG1A 1CETA 1IEQA 3AW9A 1OU0A 1BE6A 1Z6XA 4RHTA 3SF0A 1DG1G 1GQSA 4B6RA 1GNLA 2X15A 5DWVA 1YF3A 2IHYA 3WNQA 3PXBA 2BPOA 3OQBA 1E3DA 1QGYA 1Y3FE 1FX0A 2OEPA 3MBOA 1VSUA 4JLOA 1RMQA 1WCV1 4E3ZA 5M2QA 2YQ5A 3W5VA 1L3IA 1ZGGA 4GOKA 4LG1A 3PI7A 5HX7A 2QMEA 3NHFA 3RANA 2EGUA 2VDRB 3SS8A 3NNDA 1ESCA 2Q9BA 3A70A 4AJPA 4ASUD 4EGFA 5JSYA 2OCLA 4G1FA 4ENTA 1HTBA 4Q1EA 6ADHA 1DBQA 4Y9SA 5KYTA 5G0VA 5LD2B 5ALRA 1NT4A 5K09A 4MKIA 3DV0A 4ZP1A 3H3JA 1PBTA 3KWJA 3VOAA 2EBWA 2NXCA 2FEPA 5SYNA 1TC1A 4Y6RA 4JJ4A 4NVRA 5ESDA 3OCUA 2O5CA 5TQVA 3SYMA 1EBUA 3RRXA 4FW8A 5KOHA 4D3ZA 3QQ5A 1TZMA 3I73A 4KUEA 4OHCA 5DTRA 2P30A 3SC3A 3VYTB 3B6KA 3QMWA 3A1NA 2PH3A 3TIVA 4EK9A 2G88A 1AF7A 4MW4A 3AZOA 3INGA 3LBNA 4MHSA 1Q14A 3OTWA 4PYNA 5EXDA 2WSSA 1HDYA 1PR4A 1W9HA 2XUPA 4MYSA 2O5RA 2HU7A 4K7JA 2I71A 3O3CA 2AKYA 1FFXA 4S3MA 721PA 3HN2A 4NFLA 4MQ6A 5CYGA 3Q9LA 1CUDA 2HMAA 4L0CA 5JXHA 2M98A 4D0LB 2A88A 3FMOB 4AY3A 3BBPA 1HT1E 5FFFA 3QFHA 3THXB 3CF4A 5ALJA 5HA5A 4AZ3B 4CHGA 1L7EA 2V7QD 3ZHXA 4GIBA 1KVUA 1JBKA 2ZPAA 2XBUA 3IDAA 4UM5A 1YZQA 3NJ4A 4DV2B 2W11A 1U1IA 1U9IC 4IWYA 4DF3A 3BZBA 1AOXA 1CC1S 1XZMA 3QBEA 1GNRA 1I36A 1G6OA 4MVJG 3T3HA 3UHFA 4YV1A 1I94B 3K8YA 1MAVA 3RK4A 3PVCA 4F60A 2ZUTA 3H5TA 3OICA 3E23A 3PXGA 4I81A 4AKHA 1F14A 2B2XA 1XZEA 5IJAA 4TGLA 3ZWQA 2EX1A 4Z7NB 1K4MA 2CXTA 2CV1A 1Y4UA 2O3UA 1NY5A 2O8BB 1LSSA 2JBWA 1FDVA 4H7KA 4OQEA 1U2QA 4QC2A 3EQ7A 3N86A 3D6MA 5B64A 4FILA 2FUG6 3BQ9A 1HUQA 3AIOA 4H3KB 4J0GA 3AVYA 1LW6E 1U6IA 1TQ8A 4FJ2A 2EW1A 4YJ3A 5B1SA 3PCRB 2JLXA 1YU6A 2CF6A 1QYVA 3NRBA 1VMEA 1GUBA 3R76A 2A35A 2QD1A 3BXGA 2GRUA 4GOMD 3O4FA 1ST3A 3OQVA 4S12A 1AMNA 2JI6A 1DX4A 2JFUA 3CE6A 3MJRA 4DSOA 3OPYI 4LA4A 3EEYA 3QTBA 4K05A 4OJQA 3SR4A 1RE1A 1QCYA 2Q5QA 2V96A 3D7KA 1G8HA 4XQCA 4XQGA 3EZ6A 4YMIA 2I4MA 3U7EB 4G65A 5E7MA 2QEQA 1OAOC 4ZJYA 3MTBA 4LFCB 3FNBA 2HWKA 3H4MA 1J9EA 5EIFA 5IEBA 2FA9A 4FYYA 2I3BA 3F7MA 1UCFA 4LDQA 4R83A 2X0RA 1QONA 2GZHA 1S0UA 4S0XA 1L1EA 2Z57A 4RSMA 1ZYUA 5DHAA 2HK6A 1OFGA 2V7PA 3N2IA 1NOJA 3SAJA 4PGHA 2JAPA 2IDZA 2YMPA 1YR3A 3GFSA 3I1JA 5CCDA 1MPTA 1G7SA 1PFUA 2BSXA 3U4IA 4E5VA 4DR2B 2RGRA 4TYYA 4NFHA 3GJ0A 1O5OA 1EWTA 3B1VA 3M1IA 4N5IX 4TZKA 2XMCA 1PJ8A 3F78A 1KR2A 2QJRA 3MTIA 3T9BA 1GT6A 1ODFA 1CQJB 2RHTA 4CF4A 4KR2A 1MJFA 2MJLA 3ESZA 2BGJA 4IRUB 1N6KA 1KI6A 4NYIR 5F51A 3UMFA 4OB7A 3FSGA 1EFTA 1H4SA 1KAEA 5C8YF 5KYWB 2WKSA 4OMUA 3LK7A 4OM8A 3RTAA 3SICE 2AI3A 3EOAI 1XRRA 2ZT7A 5U9CA 4RE6A 1X0VA 3OT4A 4B2LA 4XDYA 2DVMA 3U62A 3VXKA 1DX9A 3QE2A 2AC2A 4GKVA 3H2HA 1ORTA 1WUJS 4R8SA 1Z26A 1E2PA 3P9KA 4KX5A 3SI7A 4ZRMA 1VBFA 2ABWA 1G6HA 1J97A 2PKXA 3T34A 2SKDA 1XDDA 4EYGA 3PP8A 5FFNA 5AM3A 2FPGA 1K5HA 2YDXA 2XTMA 3O4VA 5T4FA 4U9HS 3UT6A 2R00A 2A9KA 4S1VA 1V8ZA 1W4ZA 3PKIA 2HCRA 1HMPA 4J2HA 2PGDA 3I5UA 4JLDA 4BVFA 1DELA 2KX7A 4OHXA 1A0OA 1MX1A 1RRGA 2D4HA 1LVUA 3K09C 1PZMA 2Q3JA 2A1TS 2I99A 3WKAA 1JFLA 2GZAA 2NPIA 1EWQA 1WZEA 2QGZA 2AGVA 1Z4NA 5JJKA 1M2HA 2BFBB 3QTTA 3FSGD 1SURA 3IP1A 3V1MA 4BWVA 2WYVA 2Z8YM 1U98A 4BECA 1VE6A 4EUEA 5KQGA 2YUIA 1Z68A 1JMKC 2DCUA 1JG2A 1NVEA 3Q3HA 4HGYA 4EHKA 1BJTA 2YYSA 4YWHA 2QR3A 1Z83A 4MW6A 1NNEA 1ODKA 1NR1A 2ZANA 2WNIA 3MBIA 2NZYA 1M2VB 4DY6A 4M3NA 2VXCA 3VR3A 4BGIA 4KE7A 3AHEA 2WWYA 1J7KA 1PJZA 2IYNA 3E9EA 5CIWA 1V6AA 3BRSA 1GWNA 3ORYA 1BDBA 3RVKA 1SKMA 2O2IA 3L8EA 4Y0AA 5IC5A 3EWSA 4DW8A 3S7ZA 4IRXA 1EDOA 1D2MA 1TEXA 2DFLA 3TNYA 4MVJA 4RVOA 2V7BA 1PV4A 4TWBA 1CLEA 5E2IA 3GCWA 3MUFA 4HMOA 5DB4A 5ICEA 3TLMA 3H18A 4A8JB 4BVEA 1LK7A 4P08A 5DM1A 1GFIA 2WLTA 1S4QA 2OWDA 2ZW9A 4EF4A 1AZTA 2A6PA 1AH2A 3UHAA 1NVXQ 3ZH2A 1KDPA 1DIOB 4J3JA 4U2DA 3VSAA 3WB1A 3GJ5A 1T24A 1HT2E 1QHHA 2GN9A 4Q3LA 4HT3B 1PUXA 1SCUA 3PSHA 4MQUA 3AFNA 4RDCA 4ESVA 3L8HA 4ITUA 4ZHQF 1DO8A 1F60A 4ZCPA 1QYRA 3TZ6A 4ENRA 4B3HA 1KIMA 4RD6A 3ZVMA 3W6UA 3LHKA 1Q11A 1RM3A 4KBFA 3AR2A 4L8FA 1WQ3A 2QMYA 2TYSB 3SBXA 5AUOB 5FLYA 4ZZ0A 2W2KA 1WB9A 4QVKA 3CFYA 1M34A 1BIFA 4CLRA 4IS3A 4OLBA 1XIVA 3SU8A 3IQZA 3KU4A 1A8QA 3LT5A 1UEXC 3RTDA 4Z4QA 3D6UA 4X1IA 1YRBA 4R3WA 3DEYX 3OC6A 4F11A 2PVSA 4KPUA 3KE9A 3LCRA 4YY3B 1VKNA 1K9VF 5K8TA 2ZJ6A 4WXYB 1GCOA 2C8LA 5AHXA 1BN7A 3EVFA 1AMUA 1Z3IX 2IYRA 5DYYA 2FEMA 3DLIA 1X87A 4G6ZA 3K1AB 5MF6A 4U1RA 3BUSA 5B7GA 4Q05A 4J0IA 2NNWB 3EZYA 1AQUA 4DTIA 4GH5A 1EZZA 1X13A 2B92A 3GMSA 3D7LA 1R4ZA 4Y8VA 4UHFA 3BQMB 3VR0A 2VAXA 4F8EA 1JFFA 1QLJA 3RS9A 4CIBA 2D8AA 4CDMA 4AULA 5HKLA 1S3GA 5TPWA 3ETLA 1AXEA 2P5SA 2Z1DA 3KSBC 1QP0A 1M1NB 1FZTA 4HB0A 3EAQA 3SSMA 2A78A 4TL8A 5FTKA 4RK4A 2EBUA 1L8AA 5E9WA 4IP0A 4A0RA 1SVSA 3FFAA 1NJ1A 1PTKA 1YO6A 1D1SA 4QOFA 3LP5A 1JEDA 1EH5A 1NW5A 1ZH2A 4MGKR 4JGGA 2DKFA 2QRVA 2OVBA 2XUKA 3ET5A 3L7KA 3LCJA 4XB1A 5C9ZA 4HTFB 4E51A 4R3NA 4O1MA 1QHNA 2I3AA 3AXTA 4LVUA 4PY2A 3N0TA 3PICA 4JUIA 4Y7CA 1VJTA 1QV9A 3GWZA 3OTIA 3SEQA 4AIIA 4DQUA 2IZ7A 5IZCC 4ES6A 2BFMA 1XZCA 3TB6A 2AG5A 3KU1A 2PRYA 1GITA 1VG0B 2I4LA 4ND3A 4P6VF 2QLBA 2YXLA 4CDNA 2RI6A 1N3LA 3M4ZA 1JIVA 5AYVA 1DEAA 3KOWA 3ISJA 4PCVA 1T4GA 4PEVA 3WKDA 1L5QA 1Z35A 2LIVA 1KFBB 3LDUA 4MZXA 2RGGA 1GGKA 2KE5A 3M1AA 3LUDA 4G1MB 1WULS 2YWBA 1A9YA 4RYLA 4G1VA 4DSZA 5AJZA 2K2WA 3QFCA 3FSRA 1N6NA 1QTRA 1GPJA 2ZI9A 2RB5A 1DQZA 4W1QA 2WIDA 3TGWA 3UK2A 3LH5A 1LRKA 1NUUA 3Q10A 3PITA 1JQEA 2CXHA 4ZTZB 3D4LA 2O50A 3GIDA 4JYMA 5EERA 2XNDA 1RT9A 2VJAA 2WTXA 3DBLB 3ETCA 4NONA 2ZI7A 1DEHA 2XODA 2HHLA 3PE3A 3T3PB 2PHZA 4BV3A 4EW6A 1F20A 1DAGA 1KZ1A 1JVBA 4IOLA 4YV0A 4TZTA 1GYPA 2BOVA 4WRRA 5TMPA 3HB9A 2Z08A 2J3MA 3QJGA 2DLCX 2ZBRA 1Y5MA 2HH9A 3MT8A 1TAUA 1V2GA 3QPBA 4PGFA 2FYTA 3ZQ6A 1JJFA 1RJ9A 1VI2A 5LB2A 1QO7A 4KR0A 2EG5A 2ZJ8A 3I6MA 4ND5A 1KDOA 3TLBA 2JA2A 2Q5LA 1M1UA 3NEJA 4DJTA 4HWPA 4P7JA 2OA0A 4PSKA 1CR0A 4Y2VA 5D84A 1HF3A 4X3PA 2DLDA 2R751 4IDFA 3ZU5A 5LYJF 1VLZA 4CLXA 2XX3A 3FHOA 3KR9A 3PNQA 3SEAA 1TYDE 1Y1TA 4CCWA 3L7BA 2XRYA 3MCWA 2FMKA 4FCTA 4P34A 2OK8A 3JS5A 3TZQA 3U5TA 1QF6A 3LQ4A 3GGCA 2P7HA 1G7CA 2PL1A 3KYBA 1D4ZA 4R2JA 1WW2A 2SECE 3L8CA 4L7QA 4RNCA 4B9EA 4DDWA 4RTPA 1G18A 1GZ7A 3DDSA 4KVGA 4FZJA 2IYYA 2C88A 4PV7A 3WHIA 1RRFA 1KZ9A 4UMDA 3WWOA 4C78A 4HAUA 4BJ5A 1GLVA 1T29A 3NHYA 4LQCA 3LUPA 1Z6PA 4BFCA 3A3YA 3PIRA 1HPLA 1ADCA 5LP6F 2GCOA 1WUIS 5ICMA 1K5GA 4J91A 3GW8A 3ZS8A 3TRHA 2OO5C 1FUUA 1C3JA 2P2GA 2PXXA 3CURA 2C29D 2JASA 1H6AA 1DWPA 3IDFA 3VPDA 5I4IA 1AXGA 1GUFA 1SEVA 1C9JA 1VLVA 2G9VA 2JGAA 2PLWA 3E3AA 1PVVA 2H9YA 1ECGA 3F6EX 1SVIA 2G07A 5GV8A 3TLGB 1GTJ1 3VJKA 1ZUNA 1VLLA 1LNQA 3O2NA 2FOXA 2HEGA 4I9HA 4JAVC 4KOEC 3PXAA 3TWOA 2C7OA 1Z18A 3QNUA 1DC4A 2I7DA 4C6TB 3LLCA 6PFKA 4MUIA 4M9RA 4R8RA 3T3GA 1V1JA 3AUJB 2X5XA 4LYYA 4P80A 3E03A 2DPYA 2H51A 2PANA 3D2BA 4Y7DA 4AN4A 1VIVA 1UDRA 2VJOA 1QORA 3NHJA 4RVCA 3SS7X 3NYIA 4E2XA 2IHZA 3IXQA 4LTNA 5TLSA 5ALKA 3URMA 1TYZA 2X0EA 3STTA 3UYLA 4DKJA 1R27A 3ZCVA 4G9GA 3CG4A 1YI8A 2W2KB 3DBVO 3KPWA 4OBEA 1DWOA 1NT2A 2Q50A 1NUAA 2OENG 1HG0A 2FR8A 3E84A 5E4JA 4ZVUA 4AN0A 2XCQA 1M34E 2P8SA 5BVGB 3P45A 5DNEA 2H2FA 2V9PA 5AVTA 5D3KA 5LZ5A 2P9YA 5EJGA 1HNXB 2IEBA 3A3PA 3L01A 2NZWA 2VHCA 1UOQA 2IEZA 4IHJB 4FHFA 1K86A 1M75A 4URHA 1Z0UA 2W5UA 4QIHA 4GI3A 1SUFA 4QUKA 4R9VA 5ALZA 1J09A 1NSTA 2CVOA 4D0SA 2RFLA 1FMJA 4C4PA 3SYLA 3T3OA 2EERA 3AFMA 2WF8A 4Q6WA 3ANSA 4B48A 3GUHA 3CUEF 1K89A 3PE4A 1KS2A 2C0PA 3ONWA 4DRZA 1Q0SA 3BFXA 2XNJA 5C51B 3C5VA 4UUQA 4US0R 2JEZA 3VV3A 4LJKA 4OHRA 3BHIA 4IOKA 4RFVA 1O03A 2FETA 2RAFA 2Z6VA 4KXLA 1Z22A 4BVGA 2Y4OA 1UMCA 2GM3A 3OZ7A 1XZLA 5EIHA 3VU9B 3CUWA 1TCVA 5AHKA 5TT1A 2G67A 2VDQB 3IUEA 4LSGA 5KJ1A 2J9ZB 3O82A 4JVOA 4KJXA 4I46A 1S8OA 2VVTA 1IXZA 3AEKA 3CKYA 3E15A 3Q41A 4LJ5A 3O2SB 1EFPB 2IHVA 5LZ8A 3RSZA 3V9AA 1IN1A 2P1DA 3SVLA 1XP5A 5CFNA 2ZB3A 1LBTA 2C4MA 2YJTD 4YJHA 4HWKA 3GP5A 2ZT6A 3VJMA 1LBSA 3DZBA 3SC2A 3BTSA 2EQ5A 1AV6A 2QN9A 4QDUA 1NFRA 3LBAA 3DV9A 4J16A 1H1LA 2EFYA 2N0SA 1I7LA 1ZCJA 1YS9A 3B9QA 3AR3A 3FDZB 4KUHA 4EFKA 3OU2A 1P3DA 1RC0A 3DMTC 4EY5A 3NYWA 3NETA 1ONSA 4Q7LA 1RHQA 2OC4A 2VF4X 3H2SA 2HV9A 4UXJA 1E2JA 5J58A 3RU3A 1N75A 3JXEA 1FRFS 3ANXA 1YQQA 3QGMA 4KFCA 1N9GA 3DT9A 3GD5A 2QM8A 3IKMB 1JL3A 1BW9B 4J3FA 1NV9A 3ZY5A 4YQZA 4EG5A 4C89A 4BFYA 1SUBA 1PL7A 4A15A 5JNWA 4UASA 1NQVA 3VU8A 1E3SA 1QOZA 2JBAB 2GAAA 3DMHA 4I55A 2JHPA 2R96A 1DIBA 3PIDA 1GPWB 5PNTA 3IVAA 2BGRA 5BWBA 4ZQHA 5HCNA 5BSTA 3DAFA 3GJ7A 3CGWA 2JGJA 1O97C 2YZNA 1YUBA 2WU3A 3NBQA 3OEEA 4PGGA 2YMLA 5AJYA 5GONF 3QE9Y 3J7AC 3KJNA 2D2FA 2OOKA 3THOA 4DR7B 3UWKA 5EESA 1R00A 4BJ3A 1J9GA 5JEDA 2ZUFA 3GLHB 3JVDA 3OZRA 1R6TA 4JI0B 2E5LB 1Z4IA 3ACCA 1E1CA 3GG9A 3Q0EA 4YI5A 2VPWA 1GO2A 3KO8A 5M3BA 4CQJA 5BSEA 5LUAA 3FMPB 2PS0A 1W4LA 4BAZA 5AQ1A 3UMSA 3WGQA 2X6QA 2JAWA 4PGAA 1ZVJA 4TM7A 3NBMA 1FXUA 1OLXA 2ZBDA 2VPXA 2EF1A 5EE9A 2BKXA 2QNIA 4AUMA 4BLSA 3KQWA 1MQAA 3II6X 4D6PA 4NV0A 3ZCUA 4W82A 1R16A 4E32A 1Z6QA 1FSZA 3WB9A 5K0EA 5A62A 5GZ3A 5C8YA 1GHTA 4RD1A 2BI8A 2GBIA 1DINA 1VHQA 4N0DA 3IPYA 1PZEA 1VI6A 2YC4C 1ZNXA 4X1OA 5ALHA 1Z2EA 1K27A 2QTZA 2VUTA 2IWRA 3NAQA 1QOQB 1GDDA 4JUFA 2FRXA 2HQ1A 4FGUA 1U7ZA 3DOIA 4PLGA 4D98A 4IDGA 5BRJA 5CBKA 1YFLA 2AT1A 1JR3E 3MOGA 4HXEB 3ME5A 1I7NA 4DXDA 2FR8C 2IYOA 2HU2A 1CUAA 3LOUA 3OHPA 4Q15A 2QV0A 3G02A 4NTZA 4AZSA 3NM5A 2D74A 4MRSA 1Q0QA 5EHQA 1E9AA 2BI4A 3TPZA 4K9LA 1VRWA 2ODNA 3E35A 2P4HX 3KXPA 4HDMB 1G5PA 2XKBA 2RHGB 2PIAA 3FKSD 1OJLA 3IVMA 2D3WA 2FJPA 3OFND 4GLFA 4MPJA 4W6ZA 4B6JA 2HKIA 3DHVA 3KWLA 4HAOA 3T3IA 4GPAA 4JB0A 4GD3Q 4ZV9A 5BYKA 2DWQA 2ZREA 4LQDA 2P1RA 2WF7A 3WDLA 1PR9A 2ZI3A 5IJZA 4NSNA 3I0MA 1PNRA 3LYLA 3I28A 1W4CA 4GF5A 1XZIA 2PSHA 4J1SA 4GGPA 2Y0DA 3RLIA 1YTLA 4QJ3A 2JANA 2HQOA 3ZNOA 2UYCA 3L7MA 4L78A 4M8KA 2IS4A 2EFHB 4DLZA 1AVTA 2HZ7A 2O0HA 2Q28A 3TZEA 1SKAA 2C9OA 4OQDA 10MHA 4JKYA 4MJ3A 1ZVVA 3EIUA 4ZO7A 3HN6A 4PNEA 1R3DA 3B36A 3N2GB 2VJKA 5K3DA 2YN2A 3DM9B 3T5MA 1B42A 2XE8A 1C14A 2QLJA 1OQAA 1N92A 4D9GA 1T2UA 3L0CA 1TCCA 1ZGJA 3U3JA 4GXNA 5JAOA 2JGIA 3PUYA 4RX1A 3ZDCA 5JMWA 2BT4A 4GM4A 4IIVA 3I0ZA 2WDPA 2Z5VA 2F3TA 2N9UA 5E4FA 1JIQA 3NHAA 4CFZA 2XKAA 3GQVA 5NLLA 4BBPA 5FEUA 3R7LA 1CUFA 1YC2A 3HV0A 4MYDA 4XQ0A 1NJ8A 2GNAA 3RCBA 2P6RA 3VHXA 5K45A 4PXAA 3D4PA 1KQFA 1U2EA 2ZYDA 5H8WA 2Y4NA 3FLMA 3KKKA 1B93A 1XA4A 2ZS8A 1K6EA 2FSVC 3H0KA 2C2YA 3MRTA 1H5QA 4LPSA 5JSFA 3OE1A 4M60A 3L18A 1MFZA 1R0BA 2H1HA 3PT5A 4CL3A 3LLVA 1QHSA 4OREX 1RBZA 2IT1A 1QG4A 2YJ3A 5G4KA 1L7RA 2YFKA 2O2JA 2FWPA 2FZGA 1VJGA 3DV0B 3IEXA 3SFZA 2B4RO 3U48A 3KLMX 3WLEA 4BB6A 3PNVA 4L5CA 2Y67A 2Y1OA 5J3JA 3ABSB 1Z33A 2DBYA 2I4RA 1J00A 3NTRA 4K9RA 4TKUB 2D2IA 2DFNA 1VSTA 1M8JA 5BY2A 3PCXA 4R68A 3UMRA 2IKSA 5J2TA 3I12A 1W48A 2OQVA 2XHZA 2PQ6A 4AZ0B 3K9GA 3AT1A 4G0XA 1EDDA 4DSAA 4UCFA 3LC2O 1H5UA 2R7MA 5HJ5A 3QA9A 1X7ZB 1UQTA 2BMWA 2R97A 2VHTA 1AG9A 4ID9A 3TRFA 1KY2A 1V9LA 3L02A 4R9UC 2EEPA 2MR6A 1XVTA 4I99A 5IWCA 2E4YA 3WX0A 3BS4A 1WSBA 4ITVA 2MIIA 2DPGA 4O3FA 1ZMRA 4C6RA 4C4AA 3PT9A 4X7MA 4CM4A 4BQQA 3CVJA 3UV7A 4RGVA 2CE2X 1X2EA 4RTKA 4BJHB 4ZVLA 3HKDB 3HY4A 4H0NA 4PG8A 3WIVA 2R6ZA 1JLSA 5C81A 4KFSA 4D9EA 4ZI7F 1PR0A 1P0IA 2ONJA 2F64A 2CXUA 3G8YA 4N6OA 4UUMA 3UV3A 5KVQA 5IZCA 2NU8B 3M4JA 1T8TA 1WPRA 3C8DA 1YNSA 2RH9B 4H6VA 3S7TA 1W35A 1PT6A 3WJ2A 2QPLA 1P4GA 3T1OA 2X8JA 4UBNA 3GRVA 4LYHA 5ESXA 4FEAA 3IVXA 4X3OA 1JG4A 2Q4EA 3HVJA 3B3JA 1M2KA 3CZ5A 5AVVA 3SJCA 4UCXA 2BCGY 3VI3B 2O1WA 1DOAA 3PGA1 4NNOA 4ZT6A 4LVOA 4B3CA 1O9BA 2GLTA 2ZFUA 2AOUA 4IIJB 4QGSA 1WEKA 2BF7A 4KDEA 1X38A 2FVYA 1T3TA 5IF9A 3HDJA 1UFOA 3EK2A 2PCJA 2A4KA 1XZHA 1OHHA 1GRVA 2VG8A 3C3PA 3MOSA 3UWMA 1LBIA 3QEMA 1GG5A 1K2VN 5LC1A 4RM2A 3I39X 4WOCA 3KVYA 1GA1A 4HQKA 2OHOA 2LXNA 3CTPA 3G2IA 5E9QA 1WHTB 3BILA 4O2AA 4DARA 2FFAA 3ZIAA 4I6GA 1UJBA 1CP2A 4KXNA 4YJHB 3VPSA 4LRQA 3D2CA 1T9AA 2V6IA 1T0PA 4D8VA 1G9XA 1RDFA 3OLYA 2AFVA 2YY7A 4UHCA 4C4ZA 3GEPA 3O3OB 3RFUA 1OU4A 4A9AA 3IESA 2YS6A 4G67A 3G1WA 3JWGA 3WMXA 4DIEA 3UGKA 1UM9A 4EVIA 3FLEA 5K8CA 2V4ZA 2MU1A 4EM6A 1OD6A 3Q8LA 3U44B 3WLKX 1N3BA 4C20A 5JZVA 1KFKB 1CZRA 1VLJA 4HYQA 2VJCA 3EF1A 2FI1A 2HWYA 4P7GA 4KSBA 3H6GA 4DYHA 1ULZA 1T4CB 3K73O 5IFLA 1WEHA 3EH2A 3GHYA 3GFBA 2HIAA 1THGA 4M1KA 1JZTA 1WD7A 1X42A 4KO4S 4WBNF 5CA0A 5LLDA 3CVWA 2AKEA 4BMPB 2QIPA 5AW9A 1OT5A 1N1DA 3R1IA 4HDMA 1RM4A 1STOA 1YQXA 1Y4AE 3R09A 2YY6A 5E7IA 3DP9A 4RK7A 3UPUA 3EH1A 2V4UA 3P0RA 2QSZA 4BVKA 4LHVA 1VB3A 3I1IA 3U13A 4R0MA 4YMHA 4V1CB 3GPLA 3KZVA 4MS3A 4CMAA 3HRHA 1U0NA 4CQMA 1KI9A 4KQXA 4PAOA 2P62A 2VYFA 1SUPA 3O26A 5FP0A 4A8JC 2IUUA 4WW0A 1JV2B 1TO2E 4OAPA 4XVQA 1NF3A 5B58T 5KYUA 3F3SA 4LC9A 1UK8A 1OV4A 3GEBA 1RP7A 1UXJA 2E87A 3HDVA 4PN7A 5B58C 1VQ1A 1TB4A 5T57A 2GRJA 3C74A 2GCPA 2PKRA 4QUEA 3OZEA 4IJ5A 5EHGA 3UJBA 4X20A 3ZH9B 3DPIA 1XCOA 1QO0A 4Q4HB 4L27A 3N39C 2PV7A 2J33A 2Q4BA 2BFEA 1PUIA 4MTCA 4U7JA 1RQ2A 4JROA 3ZN2A 2XT9A 2A9OA 4QOSA 4ZK6A 1XPUA 3DNPA 2CFIA 2WA1A 1B1AA 2RHCA 1JVSA 1G3IA 4WOJA 1DJMA 4J07A 5JG7A 2JH3A 2W0SA 3T52A 3VFDA 5AW6A 5KOJA 5HQJA 3DBRA 3MQ2A 2Z3WA 3AZQA 4DVJA 1TYBE 1QVZA 1E3EA 1NLYA 1T5SA 2ZRNA 3KPVA 2JFVA 3OBBA 3R3SA 4R81A 1XFDA 4EARA 3O1HB 1JYFA 1XP8A 3TVTA 4D25A 1JG6A 1MDFA 3JQGB 4HDAA 1DDIA 4A7PA 3ZHRA 1JXQA 4AO6A 1FSFA 2AG0A 3DZFA 3H2JA 3OZWA 1HBJA 2AMFA 4MH0R 1MNQA 4FWTA 1BU8A 3PFGA 3SR0A 2IH5A 5TGTA 3ZWOA 1XNQB 3PPXA 1VHWA 7GPBA 4IDCA 2Y1FA 5CDHA 4GDFA 1MW9X 3OCYA 4CCSA 4PLVA 2UYOA 2ID9A 5EZYB 2J9YB 3S44A 5K2MA 5BV8A 3BT7A 2B8EA 4TLCA 2JFQA 4MUKA 4PXSA 2VF5X 2W2VA 1R10A 4X95A 1QNLA 1ND5A 1ZK2A 2ZBGA 3K9CA 3VYUB 2GHRA 1LK0A 3MPUA 5E8RA 1Y1QA 2C2GA 1FFYA 1ML4A 3ZOZA 3CS3A 3CCBA 1SQ0A 3EZGA 3AHIA 4FMDF 4MIEA 5KYWA 2P8JA 1AMOA 2ZWVA 4LZLA 1NAIA 2HJWA 5KMGA 3BGOS 4DA0A 5A4MS 3HBMA 2JIRA 1Y3AA 5TT0A 1FJGB 1ZCBA 3OOJA 4C0QC 1VZ2A 2YIDA 4CG3A 1IXYA 3AMVA 4P31A 1OFIA 2BFWA 1DZ3A 3FCCA 2ZRMA 2A0UA 3P9QA 1SBYA 2ZROA 3JTMA 5EMJA 4UHHA 1FNMA 1WCYA 5IJWA 1W36C 3CNQS 5F5NA 5J47A 5AJTA 3AIKA 2HJSA 4BASA 3BWMA 3I3OA 3I30X 5FOVA 4F86A 2DBZA 3OQIA 1ULUA 5BSGA 3H2BA 2IYAA 1DCMA 4GNKA 5TPZD 3L9WA 3WNBA 2B35A 1U5AA 4EJFA 4Y9TA 1BKYA 3LSTA 5LR6A 1M0SA 2PPVA 4EMSA 2NUAB 2FSPA 1M6YA 1J1IA 3NOXA 4MRMA 4V0NA 2F1KA 3VYWA 1TMKA 2AX4A 1SIWA 2JD1A 2BH9A 5CX1A 5DW3A 2BFFB 1WMAA 5EGSA 1AHPA 4I9FA 1O77A 1NVAA 2WU8A 4BUCA 4EPRA 2F2TA 2ZUWA 4R2LA 5JH7A 2P79A 2FOLA 1HDEA 3FUXA 3L1VA 1N0HA 2NSLA 4N3AA 4EQ6B 4UOZA 3UPTA 1RI1A 2PBLA 3IQFA 5EXEA 3LQ2A 2F9MA 4MSUA 4F93B 5CLHA 2E4AA 1ZR4A 4DDHA 1BDIA 1DKNA 3BB4A 1CVRA 1IN4A 1L4YA 2CUNA 3BVPA 3L6RA 3EDQA 5CG2A 3NVKI 1Y0BA 1DXHA 1TA4A 1GSOA 1X1DA 3RV4A 3F4BA 4OJMX 3HCOA 4QU5A 1NP7A 3PD0A 3ROMA 2VK8A 2HHAA 5CB4F 5CFRA 4Z9YA 1BA2A 1UT6A 1ECPA 3T5PA 4IVNA 1FVFA 1QPGA 2GWHA 2OFPA 3E2IA 3HCNA 4JX8A 3ER8A 2C9YA 3PHGA 3IA7A 4DLTA 4M0UA 4D3FA 5E6UB 2X42A 4I55B 2D3TA 2I67A 2E18A 2IEAA 2MYNA 4HTFA 1B1CA 4JJ6A 1GQQA 2J4DA 4TZ6A 4TUYB 4YONB 2DERA 4BBZA 4AYXA 1A98A 4A73A 3ABRB 4J03A 1G17A 3IP9A 1KY5A 4BFTA 2QPOA 3JR3A 4X84A 1KI4A 4MB0A 3SZ3A 4C01A 3UTCA 3OIUA 1M9NA 2MYPA 4BCCA 4DIDA 1ISGA 2QY9A 4I1OA 4P3NA 5E6RA 1RCFA 1VL5A 3LYHA 4J6FA 4BTLA 2PRSA 5ELXA 3ITNA 2G70A 5C18A 3CVYA 1T9GS 2DHEA 2JBHA 2VJMA 2C07A 4HX2A 4J43A 3FRHA 2JLQA 1P9WA 1U0SY 3GLRA 3P96A 4LPKA 5EJMA 3S68A 4YRSA 1QB7A 1CS0B 5DP1A 3VPXA 4WNYA 5IK2D 4CGZA 4LOIA 2P9JA 2VP5A 5FO0A 1FSGA 3H5WA 3NW9A 1T9HA 2XCIA 4ND2A 5JC1A 5IM4F 3NBAA 1OZHA 4X8OA 5DX1A 2E48A 3BGDA 1P7PA 2NXNA 3B1ZA 1FQOA 4OFZA 4NCHA 4NEGA 3EDOA 4OJTA 2O8VA 2FDXA 5EE1A 1E5LA 2COUA 2ZSIA 4FYJA 3ILHA 4LV5B 3RH0A 3ZWBA 5BN1A 1L8OA 5I7EA 3QHQA 4O4LF 2AN1A 1X39A 4L0QA 2AVNA 3RF7A 3RI3A 3L84A 3SKYA 4Y6PA 4TWIA 4NZOA 4BLQA 1O8BA 2WAMA 3PUKA 1JHVA 2VCEA 2L17A 4FYXA 2P9HA 2YOFA 2RONA 4OQNA 5A9TA 4DJAA 4I4LA 2OCYC 3GLFE 1NVKA 3P4YA 2IU0A 1U8ZA 2PGNA 1RD4A 2IP2A 2O0JA 5G0WA 5J2UB 5BQ5A 3R7SA 5ARDA 4CM9D 4YTEA 2NTVA 3DEIA 2EEZA 3ZS9A 3UXYA 2ZJ2A 3TD6A 2CNNA 1YVEI 4INAA 2Z2KA 1IJFA 4XCVA 5DFAA 3U3OA 4DMMA 1I7SB 1UDBA 3IAS1 3UO8B 3K1JA 3PEVA 3H83A 3ITKA 2WAOA 1GTL1 1IB0A 2WDZA 3KKEA 2HJRA 3KQTA 1U7PA 3P7MA 3A04A 4KFTA 4WZAE 5F77A 4AW9A 4X71A 4XYBA 5FUXA 3S2EA 1T8YA 3CRMA 3RVJA 1SUSA 2L42A 3M6AA 3OY7A 3A2KA 2GD0A 2P7IA 4E12A 5HF9A 4WVLA 4X66B 4X24A 2WWIA 5FQNA 1K6IA 3RIGA 2W6IA 3BFVA 1TTQB 1J0XO 4QUJA 2RGXA 1NIPA 1S01A 2CXNA 2R85A 3AM3A 1XZ8A 2JJ2A 1T13A 3OY2A 3GBSA 2BDUA 4PQEA 4H1HA 1M2FA 3OFSA 2PMBA 4UAJA 3ZXIA 4GSKA 2NO5A 1CUJA 1Q6YA 4WZBE 3FGNA 2G25A 3L0ZA 4M8SA 2B8NA 2YVAA 4RPIA 4HN9A 5BR4A 4I4TF 1NC1A 4X6XA 1IL0A 2C5AA 2E21A 2JZOA 4RABA 2GK6A 3JALB 3O0DA 1F2UA 2IYWA 1WU8A 2BSAA 2J3DA 3OKFA 3V8PA 3OAAA 2GTIA 3ZW8A 4HVAA 2JGNA 2DFKB 3RSOA 4CMEC 3VPGA 3PB3A 4B83A 2J85A 2O7VA 2DJIA 2OGSA 3ER6A 4OU5A 3L6OO 4HLDA 1IZ0A 1PNVA 2VHUA 3BCRA 3GUYA 1T1RA 4PZCA 2QD2A 2P9ZA 2WIBA 4XGNA 2HLHA 5FOWA 1RZVA 4IZ6A 5ADVA 5LU9A 2R60A 2UV8A 5CLQA 4IJ6A 2NZ2A 1BE8A 1QGUA 4I1RA 5JH7F 1PGQA 2J07A 3A9VA 2A7XA 5EI5A 5JOQA 5FTJA 1CP3A 5DULA 2LIPA 2O2HA 3V8MA 1KF0A 3GRYA 3V6LA 3ZBPA 1DAPA 1LSJA 5BW8A 5IVDA 2FP4A 2W71A 4O25A 1OLOA 3CX4A 5TS2A 5GJCA 3CVUA 2OZLB 2NUBA 4YDHB 4GPD1 2MSEB 1ZRMA 2QTAA 3DDZX 3SS9X 4M1QA 4WBSA 2DBVO 3IPRA 5C3MA 4UKDA 3DDOA 3Q5GA 1Z5UA 2ZCUA 2Y1XA 1IHUA 4HWOA 4JY7A 4KXUA 4LRYA 4BJ1A 5J2UF 5EUQB 1QZTA 4JD5A 4IHJA 1VCIA 3MOIA 5EA2A 5B4TA 1NW7A 2OKCA 3EWIA 1GPMA 5AOBA 4G24A 2V1UA 5IJ0A 1M8GA 3CVOA 3K71B 1J0DA 2PX6A 1YTUA 3H2ZA 1BSVA 1KBOA 3SN6A 1T10A 4AP6A 1UZLA 4DIKA 3LECA 5IHXA 1Z6GA 1TQDA 5DLYA 1TLLA 2DUJA 4N76A 5FX2A 2ERCA 3KK0A 2ZT5A 4WZ6A 1KK3A 3SLRA 1EWRA 3KKPA 1SXJA 4PO8A 4YCSA 4XYLA 3ORQA 4KIFA 4RESA 1T9ZA 2IIQA 1P6XA 4WCVA 3ISVA 3ZIDA 3HYTA 4GOJA 5FBLB 2D1YA 1ECCA 2R6HA 2DY1A 2X0NA 5IVIA 1MG5A 3QWBA 5AW1A 4AJHA 2JLWA 2DHCA 1UT5A 3KQOA 2ZQYA 1IOVA 1L5LA 3DQZA 1R5NA 2P41A 4G86A 2XQVA 3RUAA 3KXDA 4MAMA 2RGEA 1ZN9A 4BKOA 1X80A 2IW1A 3GH1A 1X9IA 3G9ZA 4ESHA 1V3VA 2GUWA 5CG1A 1V47A 4LBWA 1RAGA 1JILA 1P7VA 4U6NA 5G1OA 1RRPA 1LC0A 1QH9A 4YNBA 1LQTA 5FL7D 3NOOA 2JGDA 2QX4A 2VHEA 2ZTLA 2O1EA 1VLQA 2AHRA 2LPMA 4C7BA 3P0IA 2CMGA 3AKCA 4CKWA 1EAYA 3IODA 4DLNA 5EP2A 1Y7TA 3GELA 3D1VA 4Q66C 5ICCA 1UDCA 4DQLA 1B2LA 3QWIA 1OFHA 1JH9A 1N0UA 1BX1A 1E2MA 3V4VB 4ZAVA 5JYEA 4A2PA 2L69A 3EFOB 3V3KA 1DQSA 2NNLD 2WK1A 3CA8A 1VBMA 2RH8A 2PL3A 4HPXB 1L4GA 1IBKB 1VL0A 4YUYA 2VHQA 2XADA 3KTAB 3PLRA 4NHEA 4QGAA 4L73A 1EGMB 5C5EA 2NUAA 3DOUA 4RY9A 1SOVA 4RZHA 4NCBA 4XPIB 2RGDA 5CMLA 2E49A 3F6PA 3FFWA 4MJXA 3RJ9A 3ZJYA 3VA7A 1Y3CE 2G82A 4E13A 1XROA 1LPAB 1GNSA 1X94A 1YIAA 3EBPA 1FLAA 3RIHA 3W3ZB 3WWCA 4EI2A 2F8LA 2WBLC 5D1NA 1LS6A 2C99A 2G4VA 4LE2A 3K9LA 3E8SA 3VZDA 1YS4A 3VU0A 3ZWYA 4GO1A 3KRTA 3R6TA 1EGHA 3UAVA 1TUEA 1E8NA 1PHRA 2QT1A 4KMRA 2PPLA 1CEYA 2GZRA 3QOFA 3THYA 2VQEB 1EIZA 1ACJA 1OYYA 2WIAA 4IZOA 4QPNA 4Z0TA 3B60A 4CQNA 4DIBA 3ZXXA 3IT1A 2FR0A 3GBVA 5J2UA 4LOJA 1COWA 1MT3A 4RJJA 2NUTA 3SXUB 4HNHA 2HPZA 1FYXA 2OBFA 3CUVA 3FPJA 1QNFA 5DTQA 3SWWA 3T15A 1YL5A 2PO7A 3WZ2A 3NS7A 3T99A 4DJDC 5C8DA 4B3XA 1F6DA 2QL5A 4PO1A 4KCGA 2WABA 4W6QA 4Y0VA 5DU2A 4IIEA 3V48A 3ZGNA 1KZ4A 1NAHA 2QHXA 2ZAOA 3FZNA 1G9SA 3UWSA 5KOHB 1Z07A 5JV5A 3K5PA 2IYSA 1OBVA 1JGTA 5JHHB 2YS7A 1R8SA 4XIYA 3K0CC 4G8BA 4AJ1A 3VYRB 4M38A 4N49A 3S70A 3AOEC 5T6MA 2UU9B 4HDQB 4L85A 4WLEA 2FJUA 3GVCA 4E5NA 5KNCH 4TUYF 4OX9B 1TF2A 4FMCB 2WTAA 4LCJA 4AMUA 1COWD 1EUDB 1B16A 3UGJA 1WPGA 1BO6A 2A0YA 3ED5A 5F21A 4PCAA 1F1JA 5I01A 3QPUA 3LJKA 2ZIXA 1JEYB 4MVJF 1ETHA 5IKEA 1G291 3PEFA 1PQWA 3JALA 3QLEA 2QY6A 5BUQA 3BIWA 3N5CA 4H08A 1ZIPA 2IV3A 3ZWWA 1MAWA 3AUYA 4KU4A 1JYEA 3EE6A 3QHAA 4QDTA 1VE1A 3D0OA 3KKZA 4OMDA 1KQNA 1PWHA 2VH1A 1BD3A 3ZV4A 1J8QA 3PEWA 2IH2A 1RADA 3F1KA 4AYTA 1RZRA 5KYVA 2YHUA 1EM8B 4MA4A 3TZLA 1NPTO 3W78A 4MRRA 2CNOA 3JZIA 2WT8A 5ILQA 5AM0A 1B14A 1AUQA 3EAGA 4DFDA 2XF2A 3F5DA 3KV3O 3N7TA 2ECQA 1MO2A 2VDLB 3QX9A 4NS4A 4TLAA 1NVVR 2QTVA 3USES 1GSIA 2CDNA 5HHTA 3PPVA 1KVQA 3R4VA 3L93A 2XR1A 2HXYA 3KUDA 3E61A 3NP7A 4CYMA 1NYTA 4G1UC 1KEUA 5KINB 1S2OA 2WVGA 2JAOA 5HVNA 4DM7A 2NZVG 1IE3A 1PX2A 3COSA 2I7XA 4W5HA 2PJUA 1WXGA 3NEYA 2JZNA 4GKBA 1U8CB 2WM3A 3CN7A 4CIYA 3DT6A 4X45A 4JI5B 3HJGA 4D81A 5KBYA 5B5SA 3PSAA 5C7YA 2YDYA 1C3OB 3NHZA 4Q00A 1PR6A 1MXHA 4YRAA 2XNDD 4HQNA 4CKXA 4KPUB 4MI9A 1D07A 1Y3IA 1ISHA 3D9QX 3OEHD 1EK2A 3RO7A 4MV8A 2P0EA 3IH5A 2J09A 1SKYE 3N3BC 4O2AF 3WV4A 4GP6A 1OAKA 1X9HA 1ANKA 5DTEA 4I2VA 4BNUA 3CGGA 4YQFA 3AEUA 4HB3A 1VHDA 2HF2A 5DEOA 1N9GB 2XWSA 1P2TA 4LTDA 1MFPA 2FSUA 2IGBA 1JZSA 3ESQA 3PGXA 4AJJA 1YDFA 5EJ6A 1XT6A 1BYIA 1BFKA 2IK8A 4PYRA 1XE3A 3D7SA 4CG2A 4ZAFA 1P0FA 4DKXA 2MSLA 2R84A 2LZ0A 2UKDA 4ZANA 2X9NA 4AZ3A 4NPAA 1NULA 4NKRA 4BHTA 5BYJA 5CVTA 2VJBA 3PRHA 3LHFA 1HDCA 4KE8A 3DJFA 4LMBA 5HR5A 1UFQA 5HK9A 2D5AA 3A1WA 1PSWA 4W8HA 1IOZA 3L6CA 4A0HA 1FFEA 5ER6A 3ISTA 1AO0A 2RKWA 4NICA 4OMCA 2W37A 3M83A 3AESB 1GP2A 4LXQA 2WVAA 2DKOA 4I9GA 5LP1A 4ZYZA 1UBSB 1P9RA 1A9OA 3ZK7A 4JEMA 3DBRB 1PR5A 3VM6A 2CGEA 1DTWB 2JKZA 2OOSA 4IQ8A 3TTWA 1JEOA 3ZIAD 2QRZA 1T1JA 1Y4DE 3NP9A 1BA3A 4HPWA 2P4QA 4JITA 4JYCA 4F4JA 1E7QA 2LNDA 3F3YA 3CF6R 3H1TA 4Q12A 5FULA 2IXFA 3BXEA 5FBQB 2F8SA 2J9RA 4KEAA 4Z0PA 2W8BB 3P2JA 2NU6B 4QQKA 3KDAA 4LZZA 3T3EA 2V7TA 4RTOA 4FN4A 2F62A 4B85A 1QRDA 2G9ZA 2AZXA 2JHCA 3KTAA 1FQKA 3I58A 4CMIA 1KE2A 5L9AA 3VR2D 4I50A 4D99A 4TV8B 4GBED 3EVNA 4ABYA 2F00A 8OHMA 1W8DA 1L7OA 4CMKA 1GGMA 1C30A 1Z17A 4FUTA 3LUKA 1ZVMA 2WSYB 2EARA 3MRXA 4GXRA 4UEKA 1JQ5A 1G20E 5F9MA 4HWTA 4QHTA 3NHRA 2I62A 3OUTA 4RA9A 1TZBA 3W8EA 1GUYA 1JG1A 3LU1A 1A8PA 1K98A 1IJKA 1E79A 4J8PA 5DI3A 4F85A 4Y2TA 2B7LA 2W98A 3BDIA 3K0FB 2X41A 5CFMA 1JKJB 1RM0A 2QXUA 4RH1A 2R3SA 1UH5A 1KFJB 1GCIA 2PZJA 4QO7A 3KKNA 3MCTA 1ZSYA 4I3GA 1JR4A 3BHMA 3UUFA 1WZNA 3JAKA 5EXTA 3RJMA 4IIJA 4KQ9A 3V7YA 3PGKA 1W36B 2BGNA 3B70A 1PFGA 2Q1YA 4P1ZA 1Q1ZA 2RHOA 1CU1A 3I0NA 4R40A 1XDGA 1PN3A 2BDEA 2XQGA 3T5GA 1KPIA 1UK7A 2N46A 4UE3S 3VDMA 1LPPA 3IB3A 2Y0CA 3Q7IA 4K1XA 5L3RA 4AKTA 3WR5A 1QQ6A 3K70D 1ZNYA 4CVNA 4NAUA 2RHHA 4PQYA 3RAGA 2QRPA 2YC2C 4C08A 1GNPA 4H1TA 4C2BA 4KLCA 1FY2A 3H2IA 2FXIA 1YBAA 1PJ3A 3TAHA 3VYVA 4P8RA 3N58A 4DLSA 5A03A 4LI3X 3WKEA 2EBFX 2B1QA 1IOWA 1AZWA 1H2EA 1C3OA 1E89A 1VDMA 1UPFA 4RDHA 5CVVA 4GE0A 3NC4A 1QHHB 2FZLA 3THRA 5AVRA 2Z04A 3GVIA 2ZYTX 3LX8A 4DM3A 5B4UA 5A3VA 2OILA 5JVDB 3HCPA 3AI7A 4S1NA 5CTJA 4B3FX 3NOVA 1X8JA 1VKRA 3L4BA 1DO2A 2B78A 4Y2QA 1Z37A 2PKYX 1YBFA 2OLEA 3I8OA 5E6RB 1QHIA 3UPDA 4K6OA 4DSUA 5FPTA 2IIPA 3M6UA 2V0NA 2FPGB 1CQPA 3CPJB 1DXQA 3IHWA 2ZZMA 3CZPA 1QCCA 4I1VA 1A1VA 4UBJA 4KIUA 2DR2A 2IYXA 2PD4A 2ZB2A 4L1KA 2C5SA 4FVTA 5FH9A 2B94A 2HT6A 4OBBA 4J7CA 4KGXA 4ZOLB 5JIBA 4RXTA 1XALA 2A0WA 2JFBA 4EQZA 5E2AA 4M36A 4NNJA 4WUVA 1YFZA 3ROQA 4AC9A 2WSMA 2GPWA 3L1JA 4K87A 4D0NA 1YMUA 5BO5A 4GP9A 4H6XA 5A5FA 1OXMA 4O5AA 2Q3CA 2J5BA 4HDNA 4Q3OA 3FAKA 5BXQC 3MJEA 1XPRA 4O4IB 3TIFA 2Y1WA 2YQ4A 3FDZA 2PSDA 1ODIA 2QVCA 1YI1A 4CQLA 4C7OA 3B52X 4P36A 2JHFA 4HUTA 2QQFA 3DTVD 1L7BA 3OIVA 2OCKA 2ZRLA 2YZKA 1QWSA 4FHGA 1FVXA 1ATIA 3AZPA 2XMZA 1XKLA 1MC4A 2CVHA 3FYDA 3K8OE 3TMYA 2JLUA 3HZRA 3PFWO 5AVYA 3OOHA 5ANRB 1SBCA 2FMUA 2I66A 3Q0IA 5KYNA 1CPYA 1RBMA 1NFQA 2O54A 4IWNA 1PDVA 2OQ2A 4BTVA 1BEUB 1RWKA 1TLTA 1M6EX 5DYIA 1QFMA 3TN7A 1V96A 1KDYA 3HTXA 1Y1PA 4M9UA 3BG5A 5KCZA 4MROA 4F2PA 2HU8A 2XXJA 1DPGA 3FDFA 4W5QA 3UKDA 3H42B 3UG7A 1R0RE 4X61A 2F1OA 3WBJA 2C58A 3PA6A 1JWAB 5CDFE 2WWXA 4YX9A 1M10A 1TZKA 2CJWA 3O9VA 4YECA 2QTLA 4ZGBA 2CHGA 3Q3IA 3WIDA 3OCWA 1OF1A 1U1DA 3WAKA 1JKJA 1O9GA 4B3SB 1H8HD 3LDGA 3JYLA 3QOXA 5KZMB 1E66A 1WY7A 2FW0A 1QSGA 3MCZA 3GLFB 3N2GA 4KWIA 2Z6UA 3R0JA 2BF4A 2Q5EA 3I9FA 4H15A 4CCAA 2IX3A 2P6PA 3FNRA 1WAMA 4FSHA 3EIHA 4EMUA 4JB8A 1USIA 1F8FA 1KARA 3R41A 2Q7OE 4F4CA 1TJ4A 1JHPA 1MB4A 1U9YA 3IE2A 2JI7A 3WMGA 4BB0A 2WWFA 4QDJA 1QX3A 1SGWA 2O07A 2IH4A 1OX5A 1P2VA 4MI6A 1JE0A 3JASB 4WKCA 5E4TA 1A4IA 1GU0A 3TQIA 2ZWPA 3ZCTA 4Q16A 3WHKA 4F04A 4JR2A 1J23A 2HREA 1KAQA 1JI0A 1T8UA 2P4UA 1L3BA 1T5HX 3PVZA 4UEJA 4XWYA 1DLJA 4O1HA 4RQTA 3G7SA 4YS6A 4C0AC 4PPFA 3VDRA 5JCXA 2NMVA 5J4VA 4Z3DA 3EXIB 1FDRA 4P92A 1NSFA 1HFKA 3RSCA 5A5VA 3IKTA 3WWEA 3PXUA 4G63A 2OZEA 2WTEA 1Y6FA 1JQAA 1PLKA 3GZ4A 2XEDA 3NHBA 3L0DA 4MGYR 4M1MA 5CW1A 1P1JA 2IHJA 1GFZA 3GPDG 3REGA 1AQIA 3D8TA 5DT2A 5A5GA 1W6UA 3V4RA 4DLWA 3UKJA 3WSVA 2I34A 2YWCA 2AJBA 1I3MA 2JVJA 4FE4A 1C8LA 2W58A 3FCAA 5K3FA 4EL0A 1P4HA 2BEWB 3MLEA 3K0AB 3VPAA 4YXFA 1ZFNA 2P9EA 1BDHA 1CX9B 2RB4A 3EF0A 4BLOA 4Z4HA 3GEIA 2C77A 1IPHA 1JFSA 2W90A 4D02A 3MXTA 1QAQA 1YCHA 3IDZA 1G3QA 3P0EA 1UQRA 1LBHA 3AF1A 4QWWA 3WWPA 3AJEA 3JAWA 4IX9A 3O03A 4G3XA 4E21A 1KMHA 3VO8A 5EIWA 5FPSA 4QL3A 2A5YB 3N07A 3ECSA 3AEXA 2ZR0A 4EENA 5LKRA 1PX0A 2RGBA 4I5EA 4D43A 3G9XA 5K0CA 4XGKA 2HFJA 4RHUA 3KEFA 2C3YA 1CE8B 3LDAA 4LHSA 2IBSA 1TJNA 3ANYB 2VR1A 3D6JA 2YHIA 3BWXA 2BFPA 4PHGA 5DM70 1KO7A 3G17A 1K6XA 3FOWA 2QBYA 4ZQGA 1TC2A 1RW4A 1URPA 3N2ZB 4ZAYA 5IC4A 1NDHA 3GUZA 3TLJA 5JS7A 3L5OA 5H82A 4DLBA 4CN9A 4OK3A 2PD3A 4FT2A 2Q4TA 3FPFA 5LM3A 5M5BA 5BQ3A 5KYYB 4MV4A 1D4FA 3Q7SA 3N8HA 5ER9A 3IDQA 1NQWA 3LO5A 5CIQA 1QQTA 2H1WA 5ALIA 3P19A 2PJZA 3H5VA 1A8HA 1KL7A 1TAQA 2CHQA 1E32A 1L5OA 1YB4A 5A3SA 2JLVA 3CRW1 2A9VA 3P20A 3KAJA 4Z54A 4TTJA 2VSQA 1M1XB 2PSJA 1U9JA 4JOSA 4JU9A 1PBNA 1AKRA 1W5EA 2DPHA 4QRHA 3BSYA 4RV9A 4U8HA 1X7YA 2WICA 2ZPTX 3UV6A 2QMQA 1S2LA 2IQIA 3NALA 1L9XA 4E2FA 3LT1A 4F1JA 1SCAA 1KY3A 1U3FA 2GJKA 2XWJI 3CSSA 1VHTA 1Z6AA 2IYLD 4FW9A 1V3QE 4NCIA 3P4UA 2C5EA 2GDJA 5J2TF 2HHCA 4NCKA 1FFSA 1FLDA 2JH9A 3W8RA 5M34A 1SOAA 3OQHA 2DT5A 2IPOA 5JDCA 4MV5A 3MWFA 3EMVA 1GQOA 1V8PA 1I3LA 3OAAD 4M1EA 1USKA 3KL4A 3AOGA 3Q72A 2WPNA 5K4HA 1R5JA 1YNOA 4IBOA 2COEA 3HY3A 4CF3A 5D86A 3KT6A 2VK1A 3T7JA 1P8JA 4QGGA 3HXQA 4EUHA 1VJRA 2WYOA 4ZXFA 1POWA 3FBGA 4QRIA 4LDPA 4QJIA 3HM9A 3DNMA 2ST1A 4U02A 1JQLB 2CSXA 4YRJA 1QH0A 4ETIA 2ZITA 2XRFA 4B74A 3NKVA 5CEJA 4BLWA 2NYVA 4DCGA 1TGVA 1QHYA 4GWGA 5C5CA 1N5IA 2O6HA 1WOYA 1FUIA 4X64B 4ZA2A 1HE8B 5CLLA 4DCNA 1W5BA 5KVCA 2J41A 1GEEA 1LH0A 1HNNA 3ZKAA 2HY7A 1NUPA 2J4CA 4M7WA 4NK4A 4B6OA 4F38A 1BEEA 5FKJA 3KX2A 1C1DA 1OJ7A 4MPPA 3USCS 4ZZ2A 2WWRA 1CKEA 3F49S 1CNFA 3W8NA 4XVUA 2NQTA 3F46A 5EC8A 2H52A 3WDSA 5A9SB 1QGOA 1KYIA 3QVWA 1L4KA 1GKIA 5IS2A 1HM5A 1FDTA 2HO4A 2VEOA 2AFIE 3MCUA 3R0IA 3PXDA 2BFNA 1UXHA 2OAP1 4FNGA 1N2CA 1H4VB 1Q7TA 5BNFA 1ZM4A 3KTFA 3SJBA 3DGFC 4UMVA 2PE5A 3OZVA 1HTTA 2XSZD 3PL5A 1ZOPA 2C9CA 4E5DA 1A7KA 1EE2A 1DX6A 4W7IA 1B00A 2GMWA 1IFXA 1SQ6A 3R5FA 4JMPA 4Y6LA 5J5VA 3MS4A 5FBZA 3N0VA 4RVSA 1XZJA 4C3VA 4TXHA 3SKVA 3GT4A 1TVCA 2FCAA 2PGAA 2O2XA 3REQA 1X7WA 4CT0A 5KS2A 4MV9A 3RWMB 4XEHA 3S1SA 1XUOA 2YINC 1LTHR 1DCKA 2YBEA 3JU3A 1UWLA 2IIVA 4YMTA 2DETA 3DPUA 3L8FA 1OZ0A 4XRRA 4H0CA 2YV2A 1DXOA 5CJPA 5JBIA 1U0HC 3MRSA 2K87A 1UBRS 2IXEA 5EEGA 2BJHA 1RYDA 2W8BA 4G97A 4V3BA 3NAMA 2QMOA 4BGVA 1T1IA 2VPIA 2JIDA 3ND7A 4YPOA 4PIMA 2DX7A 3TUZC 2HXSA 4J2TA 2EGHA 3AUAA 4YVFA 1Y5LA 4E33A 1IXRC 1E1NA 1GUZA 2NT4A 4RSRA 2D6FA 2IRWA 2ESRA 4YDSA 3KD2A 3L4BC 3OQ1A 3HCAA 1WF3A 3T12A 1XCMA 3FWYA 3FWNA 4IH1A 3D3QA 4LZJA 5CB8A 4AP5A 4B5LA 5JWHA 3ZJ5A 2A58A 4JKIA 3A7EA 2X1VA 4DWWA 1RSZA 1JLRA 3QP9A 2B25A 3S2ZA 5IKXA 1Z4KA 1Z5WA 1SHLA 5IJ9A 1I0LA 3S2SA 4ROTA 5F2OA 4DLLA 1KYQA 1T9BA 5G1PA 3V1NA 3AR8A 4ZYUA 1L5SA 1SVKA 3B6MA 1EYZA 2P90A 1E7RA 3AYZB 4MMYB 4NBRA 2C9DA 5JSHA 4DNXA 1BFUA 2WJZB 3RVOA 3MA0A 3PG5A 4CV2A 4F7DA 5L3SB 3HXMA 2V55B 3EGOA 1Z12A 1OX6A 1VE7A 3WLTA 1GAQA 1TGYA 5KVAA 4CTNA 1A9PA 3F6RA 4Q47A 3IV7A 4JC4A 4QM6A 3CNLA 1YZFA 4NBWA 4UM9D 2HDHA 1ZJ4A 1U7UA 4YRPA 4DCTA 2MDTA 2JAQA 2Z4RA 4EG3A 3FWPA 1SY7A 3P2IA 1H2RS 4JLBA 1AN0A 1KSHA 1VZ3A 1EVLA 1WUHS 2QTCA 2XGSA 3OT5A 4G07A 4KE9A 2C7QA 4BC0A 2ONKA 4K2AA 4MQBA 1RQXA 2H29A 2P5YA 3A6FA 1GYRA 4W1RA 1W6RA 3CLTD 4B80A 2G3YA 2JA1A 1LDBA 1JHUA 1H8HA 2HMUA 3GMIA 2F8MA 4A8PA 2GPAA 3THYB 1ZMTA 1XHEA 3IQDB 2P2DA 2WQZA 3DOJA 1UKYA 2GEKA 3BC1A 1NN0A 3EGCA 4KDCA 4X92A 3W8FA 2VPTA 4Z4GA 1ORHA 1BE1A 4MS1B 2ZBVA 1NBIA 3J81A 5J40A 3LFTA 1VJ5A 2I1LA 1WQ1R 4GRIA 2XHEA 3O4HA 5AI6A 3PNLA 3JD4A 3KFVA 5DBEX 3UK7A 3VVBA 1FFBA 3QEMB 3M4YA 3IT3A 1Q83A 1XRMA 4AJ2A 2C5LA 1I3OA 1ILEA 3H0EA 2SCUB 1P1IA 1PQ4A 3G13A 5EINA 3EA0A 5EVCA 2PLFA 3GMTA 5DLQC 2VQ6A 4YFVA 2GS9A 2ZTHA 5LP6B 1J1ZA 1F2VA 5K3AA 1DU4A 4KBGA 3DOEA 2W2NA 4KKVA 1SD5A 4URYR 2VXOA 4EKIA 1H6CA 4ZYVA 3WGVA 1MABA 4E5MA 3O8RA 4F6RB 1XMVA 1E1CB 3DTVA 3FXAA 1OXUA 1F51E 2G71A 3PNYA 4KIWA 4OFXA 4K6HA 4R9SA 5J1TB 1UKEA 4L5YA 5JLAA 1UJCA 4BLVA 1T0IA 1YACA 1X6VA 5LQDA 2R8PA 1PLJA 4MV1A 1QIKA 1ZZGA 4XYEA 1QE0A 3GJ8A 1OBCA 3AUTA 1RCUA 3LSYA 2EL7A 1PJBA 2HQRA 3MXOA 2XA1A 3W2HA 4ALJA 3RPEA 4KVFA 1U1GA 4JL8A 4QD3A 1TA0A 1C7QA 2VAVA 3P71T 1EUZA 1C4KA 1DZIA 1DXYA 2R8OA 3KYDA 2HRRA 4N5NA 4C5AA 1KYVA 1IY1A 2LWIA 3N59A 1K7SN 4S1TA 3TIIA 4HN4B 3H8VA 4INOA 2ZYWX 2HOQA 3OPYA 4IOMA 3S1LA 4UTRA 3E5MA 1NVTA 2O52A 1NQUA 3I01A 3NCHA 4YUXA 3TKYA 2CE7A 2QTBA 4ALIA 3GNLA 4N8SA 5CGZA 5JDCC 1CBUA 1LVGA 2VSYA 3DE5X 3R6LA 1G5IA 3LWDA 4LGMA 3WGMA 3WY9A 3KBBA 5GONA 4MUXA 4OATA 1M2NA 3N0XA 2C8VA 1BRMA 2X86A 4QDKA 3DF7A 4ILEA 3FKSA 4REOA 4N1AA 5E0OA 4FC6A 3TNLA 1C0EA 2I0FA 2BIFA 2VNSA 3OECA 1YRHA 2DQSA 1UPTA 4YAJA 1KMMA 5DXFA 5LBUA 1RXWA 5TE9A 4ZCRA 4CEIA 1XLTA 5J5AA 3TECE 1YBMA 2C92A 4JCOA 5IJXA 4C43A 3UCFA 3X2EA 1XYGA 3K2EA 3H5IA 1SXQA 2ZVJA 3FWHA 4O0MA 4XIIA 3QVMA 2WJWA 3JD1A 1U4SA 4GI2A 2ZIFA 2BBWA 2VHZA 3ZE1B 5LQNA 3RADC 3M0EA 4KREA 2PFKA 3FYSA 3HLYA 4HYTA 3L7JA 4U2EA 1NF2A 5J1SB 4XLTA 4JVNA 1EI9A 4AJEA 3L0IB 4MCJA 1BVHA 3HHPA 4MWDA 5LWQA 2WKPA 1JEQB 2FUG1 1QFYA 5TRTA 4YAGA 1NN1A 3DLPX 1B8OA 2FLVA 4QTZA 1LZKA 1ZC4A 4R84A 3CEJA 1TM2A 2YWRA 1FTQA 3D1JA 3V8QA 4D8UA 1XMQB 2FHSA 4TVOA 4GSLA 1YR7A 4LVCA 5DGIA 3SCZA 4V0MA 4BFXA 4DV6B 3SHOA 1EPUA 4BL5A 2H5IA 4JP8A 4PX2A 1XO1A 3BRQA 4K3UA 1JDBB 3OLCX 3Q2IA 4ZVOA 5SYAA 3P4XA 5U1PA 2UZ1B 3TAUA 3MS7A 2Q0XA 4JJKA 3EOBI 1TW2A 2Q6VA 2P5UA 4LWOA 4HBGA 3RRBA 1Z8NA 3R3ZA 3IKJA 2HA6A 4XD7A 1ZUNB 3LPNA 3P9IA 5C37A 1HLGA 3OMXA 1I4TD 1PT8A 1UPCA 1YR6A 1GKYA 1KOGA 3QSYA 4EB3A 4Q3DA 1EVJA 3NBFA 3LGSA 4HZUB 1Y63A 1HZZA 4YJ3B 4CV3A 5LDDC 5ICGA 1WNFA 1TCUA 1XEXA 1RP1A 3FIJA 4YIKA 3VR4H 5B3JC 2N1MA 3OWHA 1JSRA 4D3XA 4JA2A 4TMYA 2G9UA 4AKEA 2FSSA 1NXXA 1JG3A 2AR7A 5HF8A 2WVHA 3DMGA 3L0PA 3DD1A 3WXBA 4Q21A 4LZWA 2E0IA 3AKZA 4OP3A 4E1AA 4UJ5A 1M2OB 3MS2A 1XN1A 4MMZB 4RM3A 4YACA 2E6KA 1BD4A 5BSRA 3GLIE 2QDXA 1MQ9A 1AUPA 2VI5A 4YT5A 4HEA1 3S2UA 1DBRA 4TSFA 3VTKA 3LF1A 3W3AD 2V3CC 3MJFA 1JKXA 2EF0A 2Q21A 1C41A 2QIOA 5I9IA 5JU6A 2ID7A 1CUIA 4BP8A 1QRRA 3LPCA 3BXHA 1IJBA 2P6OA 3K2QA 1W88B 2GB4A 2PQ2A 3HP4A 4Z86A 5F1YA 2E1RA 3YASA 1DV1A 1JDZA 3EXG2 3RWBA 1VYUA 3ZHVA 3ZW7A 4UNIA 1AHNA 1U6JA 2QPTA 5LA6B 4C0KA 1MO3A 2HMWA 3FLAA 3MSCA 2W6NA 3R3VA 4BLPA 1F7VA 3VNSA 1RLIA 1J5XA 4RTMA 3CEMA 1QVWA 4IUBS 1IQRA 4K9KA 4MEAA 1IQUA 4B7XA 2W42A 3BSSA 4PYOA 1OZAA 4XWAA 2GVDC 2MINB 3DOOA 3LY5A 4UEWA 1N25A 4RADA 4G4GA 3WIUA 1QYXA 3UAZA 4FYWA 4BVBA 3DV2A 3WWZA 2W93A 3F3MA 3OE5A 3TQHA 3OUUA 4E7PA 1ZEMA 3HR4A 1TQ2A 3CZMA 4LYEA 1QMPA 4ENPA 5MFPA 2WAYA 1MMFB 1JAXA 1D1TA 1XXHB 2IYQA 3HNPA 3O47A 4IINA 1RWBA 3TO5A 5A1JA 5JBNA 4BGUA 4PG5A 1KJZA 1EGVB 1N2CE 1NW8A 1WUKS 3LX6A 3PWKA 2ADOA 3R5SA 3TL2A 1GQFA 3PJGA 1G3UA 1E8DA 2AW3A 1TU4A 2X7XA 4FOLA 1D7OA 2QGNA 3PKZA 2OXEA 1ZH4A 5H5JA 2O3JA 3M4XA 3ZR4B 3ELBA 1P7WA 3PRYA 4YASA 3DSRA 3LP8A 4C7MA 1WDLA 3FCOA 3H9CA 1G5FA 4DHEA 1I32A 2FZ5A 1JDSA 3S8MA 2XT0A 2HIGA 4RZ3A 1RCTE 2XD9A 1SQ5A 3PK0A 4C05A 2I80A 1VIDA 1PK9A 2PUWA 3UC9A 4BWFB 1NXOA 1PJLA 4OHPA 2CEKA 3EMKA 4DM4A 5KMGB 5BMOA 1E7SA 1Z36A 1UL1X 3MW8A 3DKVA 1N4AA 5CCBA 5JLJA 4HI0E 3TBFA 2FFJA 3CLSC