2EX1A

Crystal structure of mutifunctional sialyltransferase from pasteurella multocida with cmp bound
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
388
structure length
379
Chain Sequence
MKTITLYLDPASLPALNQLMDFTQNNEDKTHPRIFGLSRFKIPDNIITQYQNIHFVELKDNRPTEALFTILDQYPGNIELNIHLNIAHSVQLIRPILAYRFAHLDRVSIQQLNLYDDGSMEYVDLEKEENKDISAEIKQAEKQLSHYLLTGKIKFDNPTIARYVWQSAFPVKYHFLSTDYFEKAEFLQPLKEYLAENYQKMDWTAYQQLTPEQQAFYLTLVGFNDEVKQSLEVQQAKFIFTGTTTAEGNTDVREYYAQQQLNLLNHFTQAEGDLFIGDHYKIYFKGHPRGGEINDYILNNAKNITNIPANISFEVLMMTGLLPDKVGGVASSLYFSLPKEKISHIIFTSNKNNPYVKVMRRLGIIDASQVIFWDSLKQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords a2,3-sialyltransferase, a2,a6-sialyltransferase
publication title Cytidine 5'-Monophosphate (CMP)-Induced Structural Changes in a Multifunctional Sialyltransferase from Pasteurella multocida
pubmed doi rcsb
source organism Pasteurella multocida
molecule tags Transferase
total genus 130
structure length 379
sequence length 388
ec nomenclature ec 2.4.99.4: Beta-galactoside alpha-2,3-sialyltransferase.
pdb deposition date 2005-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11477 PM0188 Sialyltransferase PMO188
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ex1A02
3.40.50.11120 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ex1A01
4R9VA 2IIBA 2IHZA 4R83A 2IIQA 4V39A 4V38A 2EX0A 2IHKA 4R84A 2IY8A 2C83A 4V3BA 2Z4TA 2ZWIA 4V2UA 2IHJA 2II6A 2IY7A 2EX1A 2ILVA 4V3CA 2C84A 3S44A
chains in the Genus database with same CATH superfamily
1XFAA 1AB5A 1SKAA 1WSWA 2J3MA 2MR5A 1OIVA 2VK1A 4OHZA 1P0CA 1YHZA 1K97A 2VP2A 4PX9A 2CYBA 4JOCA 2YFKA 5JEEA 3PEVA 5TB5A 1IB6A 3MGAA 1MJGM 4GM4A 4HH0A 3UB4A 2QRGA 4FZVA 3QELB 3GLGA 4HQOA 3PR2B 4UASA 4G0VA 4FYPA 4JIMA 2BZSA 2YVKA 2AOVA 4NDNE 1F06A 1J90A 3FPSA 3LM8A 2X42A 4MI3A 4X6YA 4LXIA 1BHQ1 5CFNA 1T10A 3DFUA 1ZEMA 3AEZA 4NFLA 1D2HA 1VLJA 3HRHA 2OC4A 3IHLA 2C5HA 4TL6A 1X0XA 4CR8A 1ZIOA 5C7YA 2BSXA 3IDOA 2QBYB 2MYTA 5EKTA 1YE8A 1A5ZA 1GN8A 3PGKA 1P4JA 5LWQA 1ENPA 4I6GA 2BT4A 4LSMA 4HN2A 3ILSA 5BW8A 2OD9A 3PQ3A 5LQCA 1BVYF 1R6AA 2A0UA 3A6EA 3CZRA 3OIWA 1R9JA 4JEHA 1IH8A 1ZISA 2PXAA 3JYQA 4KMSA 1SBZA 5TSDA 2QWXA 5HM8A 2VQDA 1K6JA 3BXXA 3T7EA 3FWHA 2J5KA 3PIRA 4G63A 1T2AA 1WXQA 2YWRA 4ZZ0A 2XIJA 4PLGA 1P6QA 4FZJA 3MWLA 3E3MA 4BFYA 3LBNA 3TQHA 4L9RA 3DZFA 2XDQA 3PWSA 3MUNA 5BUCA 1HDRA 3G8BA 1GILA 2BHNA 3VBCA 1WCWA 4XQ0A 2ICAA 2ZYUX 5JWHA 4B35A 1A7AA 2XWQA 5ECWA 5CA1B 1HTBA 3EAQA 1M1YB 10MHA 2QM7A 4KV7A 2O1XA 3TIFA 2B35A 1RRCA 4PSVA 5KKAA 4DNFA 1X94A 2FZEA 3E7XA 3TZCA 3UA3A 1O6GA 2JLYA 1USWA 1IMOA 1LXCA 1E2DA 3CNOA 3F4KA 4GDMA 4BCBA 1TZJA 2O5EA 1SQGA 4AP5A 1M34E 5L7WA 3E4DA 3U3MA 2NVUA 2JGLA 2QRKA 4QASA 2QIOA 2J07A 2DSNA 3LOUA 3NBKA 5EMKA 4O1MA 1EBFA 2QUIA 1HFEL 3FNEA 3HNRA 4QWWA 5K0EA 1LZLA 3VHXA 1CR4A 2Q0XA 3SNHA 2HW8A 2C8LA 3OE7A 5IAJA 4M9UA 1YZFA 5JS2A 3AUSA 4GPIB 4W82A 5LVAA 1E59A 3DQQA 2UUOA 4X65B 4IM7A 2FSPA 1UEIA 3IERA 1HT0A 4HP8A 1CKEA 2JFGA 3OBIA 4DCTA 3G0HA 1XXHB 2DPMA 3ZVNA 1JHRA 3BGDA 1X15A 1CC1S 4JEUA 4W5JA 1ZRSA 1NX9A 4FWTA 2MSLA 1VRWA 3STHA 3BZWA 5ER6A 2B78A 4JJGA 1NYLA 2QUBA 3HB7A 3G82C 4C89A 2OQIA 2HT1A 3T95A 1PL6A 2QROA 4FW9A 5TVKA 2M98A 4LHEA 4WNCA 2XDAA 3V42A 4BWYA 2EGGA 4ZJZA 1X87A 3LHKA 4XUDA 1IBCA 3O38A 1DJPA 2Q3HA 1NUHA 1R8SA 5IZCC 1OI3A 2FMIA 1PQWA 1HYEA 3MBKA 3NWPA 4IW3B 2VPIA 4JJEA 5AKEA 4HWKA 4W1PA 4WUTA 2O23A 4G4GA 1R0SA 4FS3A 1P1IA 3L7MA 4LMRA 1U2DC 5F3DA 1W0JD 3SG0A 2E2WA 2RONA 3DLCA 1XZPA 3DE1X 3BZBA 4UBIA 4C7BA 3N39C 2J9RA 3T41A 5CVTA 1LU9A 1U28C 2DPGA 2FZGA 3PITA 4FS8A 2ACVA 1MO4A 4ME6A 4O0LA 3ZDYB 4CKEA 1IN1A 4FOOA 1W76A 1R0RE 2QTMA 3VGPA 5FR2A 4GMXA 2WHXA 4MPRA 2NV6A 3NONA 3SZLA 3TW8B 3GIWA 3A3PA 4C3ZA 1CUIA 4Y9UA 4CIAA 3G79A 4OB6A 2X77A 4OU5A 1Z75A 2VYCA 1TTHA 3C3MA 1PZNA 2P2YA 4JBIA 4KGVA 3L43A 4OQQA 4QDOA 4JHLA 2FR8C 3W9BA 1J99A 3FYUC 1H9AA 3ZHYA 3RRJA 4DA8A 3DNFA 5TT1A 4BKMA 4JV5B 4IJVA 1RLTA 1UL1X 2R6R1 3CJRA 2W2LA 4TOIA 1LLFA 4TTTS 1N6NA 4JUDX 4IDEA 2PG3A 4XXHA 2CEAA 3W3AD 1BN6A 1JA9A 4L0DA 3U4GA 2YJ3A 4CODB 4EGSA 1FX0B 4TKZA 2IHYA 4Q47A 1ETUA 4PRZA 1O8CA 2IH2A 4O4HB 4LDZA 4M22A 4OHKA 5L51A 1I94B 1QHGA 4QXMA 1CU1A 2FN4A 3WGGA 3PZRA 5F33A 1E64A 3NBAA 5ADWA 1N34B 3OJWA 2IHJA 3G23A 4MYCA 3W9SA 2FOLA 4P86A 1FFDA 1ZD1A 4LISA 2IZ0A 1DI0A 2I29A 2MJLA 3I5UA 4MW5A 3KKPA 2H5EA 4RE5A 1HTWA 1TJ4A 1G4UR 1HT2E 2BOVA 1M2HA 2JGKA 1SOUA 2ZXFA 3E7FA 3P0RA 3QV1A 4QPCA 4RACA 5LD2B 1TM1E 2GRAA 2KJQA 2FEAA 3KDPA 2GK4A 4LI0A 2JJ1D 4G8BA 3K8ZA 5E9WA 3EPLA 4LF4B 1NFRA 1XEXA 4XGKA 5G4KA 2FXVA 1GFZA 2QD2A 1XIVA 3GRVA 2JBWA 2VCHA 5LA6B 4Z4CA 3NTVA 4MDFA 1S2MA 1F2TB 2P2DA 2YXEA 3F5DA 4BN0A 1L4NA 3BRSA 3MQFA 2JANA 2V03A 1KNQA 1L7XA 3GRFA 3H7IA 2QUAA 3QA3E 1M0WA 5FTKA 3LP8A 1BMDA 4S0ZA 2PUAA 5FBVB 5I4KA 4GZ5A 4RD2A 2QK4A 4U8GA 1KOLA 3VC2A 5ALLA 1KARA 4F06A 5IT0A 3PP8A 4D0RA 4ZTUB 1GG9A 2OWEA 3GL9A 4YY3B 2Q7OE 3HR7A 4RL6A 3SQNA 3GVCA 3I3SR 1GTG1 1I01A 1Y7TA 1PX0A 4POAA 4QUAA 1NOKA 1OLUB 2QX9A 4FILA 1FW6A 4CEIB 2ZOSA 1NTRA 1JGTA 2ENUA 5EMMA 4B2PA 1EQ2A 2I9PA 2IP2A 2Q4RA 3LHFA 3NI2A 3OJ0A 3ZLVA 3KUKA 4D4KA 5KX5F 5FOTA 5KWVA 3RAJA 1GXSA 3OC6A 4O1HA 2R8ZA 2XAUA 5KTTA 1C1XA 1O96A 4KIFA 4GPAA 4GPD1 5ALZA 2DFTA 4QFBA 3IDQA 2LXNA 4JLMA 3AI3A 3GG9A 4COKA 1JPUA 3TN7A 4JJAA 2HF2A 3TSZA 3Q6IA 1RWPA 3A1UA 3DE2X 3VZPA 4TVSA 1M2VA 2BE9A 5IVPA 1T8SA 1HF3A 1WUKS 2FW7A 2IPOA 3KM0A 1JKJB 1Y7LA 1P77A 3M6FA 4LHVA 3OEEA 3TGLA 3FPLA 1CUDA 2DLCX 3PHGA 2XZLA 1TW3A 2FG5A 3K0KA 3NKLA 2YXPX 1SK8A 4FFLA 3VDRA 1FP4B 4Z54A 2QN2A 4MR9B 3TEJA 3HB0A 4NMHA 1ZVVA 5KTNA 1MNQA 3GLUA 3FWKA 3QUQA 2QR3A 1P60A 4O4IF 4Z1MA 5IJZA 1W25A 2I4OA 3H1BA 2XUZA 2XDWA 1Z74A 1L8QA 1ZY2A 1Y1TA 3FPBA 4B4KA 1X7WB 1GJRA 3AILA 5B55A 1HE1C 4TRMA 4LHZA 4U02A 1D7OA 1A04A 1LW7A 1ZM9A 2R4UA 3GFQA 4I9UA 3GUUA 4HDNA 2WOJA 4K03A 4M37A 2GAJA 1B8NA 1BH2A 4QTUB 4ZEMA 1C7QA 1R4MA 1ATIA 1FA9A 1AGYA 2FQWA 2J5QA 5EYPB 3I4FA 3TKLA 4AF6A 2P2LA 3HXKA 1K8YB 2II6A 1MAAA 5IAEA 5TRTA 3DR3A 3RB8A 4EVRA 1CNMA 1L4EA 2PY6A 4LJAA 4QDUA 1TI7A 2PH7A 1YDFA 4C6SA 2PUJA 2WF5A 3LPDA 2KI5A 4LN1A 2E5WA 2QR5A 4W5QA 2YYZA 1N8SA 4H35A 4PONA 1UJCA 1MUUA 2VNJA 2OV1A 2PS1A 3RYFA 3U3KA 4URXR 1Y8CA 3UATA 4R8LA 5T41A 4DDMA 1L8OA 4INZA 1IDN1 5TR9A 3WHIA 4UQLA 5KWJA 3QSYA 1JSZA 5JJ5A 1E3WA 1QZ3A 1AHNA 1QGUA 1ZEJA 4GNKA 2FPWA 2XH8A 2BZ1A 2YQ4A 4X1IB 7REQB 1J07A 2BMEA 1V35A 1VPLA 5A0FA 2ZIWB 5JQGA 1H2EA 4MMXB 4DLZA 4R71A 3I04A 2NYRA 3KDSE 4HEA6 4QSHA 5HKKD 3HLKA 3J7AC 3DNMA 1IXRC 4DVJA 4JOBA 1NATA 2D7CA 5CLJA 4WH0A 4H6PA 2OAQ1 1UBNA 3GZTB 5EJ6A 1KK2A 4QPJC 3LT2A 3ZKWA 2JK1A 2ZUBA 2ZZNA 1XN1A 3SKVA 3IALA 4UEOA 4PLFA 1G5TA 1G6OA 4BV3A 2PR2A 5I7AA 4YRTA 3GAMA 4FE7A 5CDFE 5FB3A 4CM9D 1UKYA 3W5IA 3JRWA 3KFVA 4N5HX 1E2KA 2AXPA 3COSA 3S55A 4FBLA 4LJ9A 4TYWA 2HGZA 2IWHA 1JSXA 4L8YA 4D0GA 5K6TA 1XNQB 4OA8A 4M89A 3WXMA 3S2GA 1JHOA 3ABSB 2X0DA 3QXSA 1O77A 2OXCA 4P33A 2QRMA 2JGDB 1TKCA 3W2GA 3ZCUA 5EWMA 1ZOPA 2ZATA 1J24A 3O1HB 2ZVQX 4JIGA 3HABA 3MCTA 4I1SA 3TD2A 1ZAYA 1OLSB 4PTLA 1E5LA 5FCDA 4JLVA 1Q0UA 4XPIB 3KJFA 3SIWA 4B5KA 3NP7A 1UBCA 1B3BA 2IXFA 2VRWA 4I46A 3Q1KA 3AY0A 1ZI6A 4NJMB 4IEFB 4DOMA 4OHUA 1UK9A 5DLYA 4N8DA 5BV0A 3WY9A 4W9NA 3DWIA 2QQ5A 1T1EA 1K2VN 1T9GR 5FAKA 4MLCA 2YHUA 3T1QA 4E5UA 1I1QB 2HJWA 4I50B 4L28A 2NUPB 3DEHA 3FAZA 2X13A 4DV6B 4NPHA 2WWVD 2J5BA 1P1KA 4PXAA 1ZM4A 4DILA 4YIHA 2LE0A 1E2JA 2QE7A 2ZB2A 1RBZA 4DM7A 3R7WB 1A9XA 3K70B 3RAEC 2ZJ5A 4KNVA 3TTVA 3U7EB 1XALA 2DETA 2WWHA 4PVCA 821PA 3U1BA 3HXTA 5EJFA 2XBUA 4HD8A 1WG8A 4KEAA 4TV8B 5EWJA 3INGA 4J6FA 2PMEA 1DUVG 4NRDA 3A36A 3Q3VA 1II8B 1VSTA 1PDVA 4BB5A 4RK1A 2E85A 4CE6A 4Z7NB 1EHYA 3JAKA 4D25A 5FOQA 4CI0B 3X44A 5CRIA 4ZCLA 3SQMA 3A04A 1Z0UA 1XYYA 1T3SA 2GLUA 1ZMRA 4GD3Q 2AH5A 5HMMA 5B64A 1TMOA 1ONPA 3DAYA 3AKDA 4LK2A 4MW4A 4ZXPA 1YQWA 1EMDA 1G20B 3AVXA 2XSZD 4DMKA 3GBPA 1R0LA 4NZPA 3RWOA 4GMKA 1GA4A 1LSJA 3WNQA 4ZHQB 2R5FA 3W1WA 3P5BA 4Q3AA 2QLJA 4MP6A 1A2KC 4UMDA 1M6VA 4WVFA 4KN5A 2Y27A 4F7DA 2OVFA 2RHCA 4KPYA 1NW4A 4K9MA 3AK4A 2D1SA 4LYHA 4Q03A 1DGQA 2UYYA 2OGTA 4PO3X 3N8HA 3DHYA 3U7IA 3H9BA 3IKVA 4FGWA 3I05A 3P7MA 4RTKA 2YCLA 4U0KA 2PM8A 5E4JA 3WK7A 4GOMD 2YJ4A 4F3CA 3UAGA 3P2EA 2F8LA 5C8YF 4G1FA 4CMAA 3CG4A 3PX3A 1U3VA 1E5XA 4IIBA 4NU6A 3N87A 2BEUB 4G1BA 5H3HA 3TMKA 1ODFA 2B0JA 3LJKA 5FPQA 1EUQA 3DULA 3QPDA 3R41A 4XM0A 1DDOA 3OOJA 1KJWA 2PSDA 5FWNA 2A9QA 2ZRJA 3NIFB 5A71A 3I34X 4HFJA 1VE7A 4E1BA 5LIRA 5HTOA 5JI3E 1NVVQ 3JATB 2ERCA 3BKXA 1R66A 3L41A 3RBZA 5HKLA 3E58A 2PWYA 3TQCA 4U7DA 1NVDA 3UCEA 1DKPA 3GJRA 3V1KA 2LPMA 2P9QA 3KZKA 4PBSA 2AUTA 4QVKA 1GV0A 5EMJA 3RJ9A 2NOAA 4WK0B 4Y9TA 4EFLA 1V5WA 5JH7B 4U9IS 1JXQA 1DQZA 3IILA 4UCWA 1DOAA 2JIBA 4ZAWA 1KEKA 3U81A 4YAKA 2Q3DA 6NULA 2ZIGA 2GD6A 2HPAA 5EMHA 4MPTA 3RHZA 1EX6A 2AFVA 1Z7WA 4GBED 4GGMX 4AULA 4B74A 1FLAA 5CB4A 5FLXA 1Q0ZA 2H0AA 2OBLA 2WTNA 3FY4A 2XLCA 1V7CA 1BEEA 3C1AA 1F20A 3DDWA 3HE3A 3FRHA 2IU6A 3IIIA 3HKBB 2F1JA 5HZMA 2O52A 4WADA 1QRTA 4D9IA 4BXOA 3MMPA 2WHEA 4HDOB 3W8RA 4DRYA 1I2AA 2PRSA 1FJHA 1Z13A 3C0KA 1K5PA 4EQ6B 5BRAA 3CGWA 2A7XA 2EGUA 4ZT5A 3PDWA 2Q1SA 8LDHA 3AH8A 4EHLA 1SBHA 4XGQA 4HPJB 2IYXA 1A97A 4IDBA 3OLZA 4H7KA 4W7HA 2OZPA 3AP1A 4MZXA 3LT1A 3UMRA 3ZZUA 1MZPA 4PZLA 2IYSA 1C0PA 4XX0A 3I9MA 3FVRA 4W5OA 3N2IA 4GP9A 4I55A 3MILA 3SXPA 4PYJA 2XEDA 1EYZA 1AMOA 1KIAA 2IU4A 3PSHA 4PYNA 2PX4A 4NCJA 5EXDA 3TLYA 1A8PA 3ETNA 3Q9SA 2EZ9A 1SBCA 3KELA 2OSBA 3NC1C 3V00A 1NU8A 1PUJA 4HNAB 4RQBA 4B6GA 1U0JA 5IT9A 4XVHA 2WAOA 4PZYA 3MMSA 3KX2A 4BU1A 2ZXUA 5LKAA 1JE0A 3KEGA 2YL2A 3JQFC 1E1CB 2BFFA 2IS2A 2GARA 2IEDA 4KOEC 3G5MA 1JMKC 4OLFA 3TMAA 4OG2A 4MKHA 4UATA 1J25A 5HWSA 1DJQA 1YRBA 4C7VA 3RQIA 2VZ9A 2CMKA 3WQQA 1N5OX 2QPTA 2IXGA 2R66A 2QGFA 4FNMA 4EF5A 2GR9A 5JYDA 3LNCA 3R5JA 4KN9S 3SQXA 5AW7A 2BUCA 3V4ZA 1O94A 2KLBA 5AW6A 1R5OA 4L3OA 2GNPA 2QL6A 1ZQ9A 2B69A 3DMTA 3IBTA 4LIPD 1LPMA 4UPDA 5TMBA 1GSAA 2W2TA 1UJ5A 2X9GA 1PYGA 2YJTD 3RTEA 3UHOA 5CFZA 4BWGA 1J8QA 4TL9A 5ALXA 5EIWA 1A50B 2RAUA 4RGVA 1EFDN 1ZVMA 2HQ1A 4J90A 1M66A 4GYJA 3OETA 1OB5A 3TIGA 4PQEA 5IX8A 4G56A 1KZ7B 3BWXA 4P4SB 2QD3A 2YFHA 4O4LF 4EYEA 4L4YA 3DV0B 3T4EA 2RB4A 1PGNA 4XGNA 2YUTA 3QY9A 3ZW8A 1T0JB 2VSFA 3ZHCA 3KOZA 2Q1UA 2HM7A 5C53B 1W30A 1RC8A 4FOTA 4FQ5A 4AP6A 2ZU0C 3L4KA 3C1OA 2INGX 4EL0A 2PS0A 4HXEB 4UW9A 1WPGA 3HYCA 5DT2A 1A96A 3U4CA 1Q0PA 2O2IA 3LDUA 3BMNB 1JU9A 2AX4A 3F7MA 3NKVA 3PVCA 4FYHA 5IVIA 4UUOA 3V8NA 1VCOA 1Y7HA 4DLRA 2UZ4A 3WFJA 1FCJA 3Q3JB 1S01A 1E7MA 1G6Q1 2FWNA 2WTEA 3GGPA 3I45A 3M1YA 1PK8A 3RRNA 4FB5A 1TO1E 1LWOA 2PWZA 3MS7A 3O1IC 4BMYA 4FHCA 4L50A 5KYYA 3NTQA 3ZZ0A 1KI4A 3TJZA 4HGYA 4RESA 3UJBA 1DSSG 1UC9A 2HJHA 4HS9A 4LXYA 2ZUTA 1NVTA 4CMEA 1Z15A 3PYXA 1QVAA 3ESZA 4GXTA 3VTZA 5AJTA 1PWZA 1B00A 1ZSYA 2FHPA 2M32A 1EX9A 2L18A 2NXNA 3MLAA 5DE3A 4JYAB 3NAMA 4Q9JA 1WIWA 3NDJA 4YRDA 5EAIA 5JDCC 1K0FA 3RKUA 1DG9A 1YR2A 1C9MA 1SCJA 1T9CA 2AXEA 1GKUB 3A1TA 4GXRA 5TT0A 4BQPA 5PGMA 5IDXA 1I80A 3AF5A 2X1MA 5HFNA 4UFOA 3AF0A 2K87A 4WJLA 4LI3X 1J0AA 4IIFA 4DSOA 2W93A 3V8MA 1U9IC 1CF2O 1FDVA 1SXJB 3ROQA 2NU8A 3SHTA 1QZTA 4LZOA 5T4HA 2PX5A 4AKEA 2G5GX 3OM8A 4Z86A 1OYVA 5ITVA 2WPDA 5DT9A 3W2HA 4CWAA 3MRXA 4TM7A 4DYHA 4E5KA 1J1UA 4IMIB 5CLQA 3RDPA 5H83A 4ALIA 1P7VA 2R2GA 3LBIA 4DDTA 1G2PA 2A1UA 3MBOA 4DPKA 1J0XO 2P8SA 2VZEA 4N3NA 2GBGA 4REQA 4GYWA 4XYBA 4ZALA 2PKQP 3VMMA 4ESEA 4ZI7B 3ILXA 3ITEA 3WS7A 3VO1A 3JZDA 3I6ZA 1XZFA 3TLZA 4DLTA 3M6XA 1KH2A 5J4HA 1OWMA 1EFPB 5F3RA 4L8LA 2REQB 2W2MA 1SC9A 4M1SA 3KKZA 3FGOA 2CL5A 1YR6A 2A6PA 5HMLA 1V6AA 4Y2JA 1YL7A 2Y2VA 1WTCA 2QX7A 1OAOA 2Y9MB 2R8XA 3HR8A 3VMFA 5LXTB 5B3KA 3AVTA 2BCGY 3AMVA 3LTEA 1OXXK 5AM1A 3L0PA 4PZUA 2NU9B 5L3VA 1KIMA 3MJFA 4LRYA 1PQ4A 2ONZA 3IH5A 4GI5A 1KETA 1TW2A 1HYGA 1V0JA 4G4JA 4QYWA 3ZE2B 2PX6A 3IULA 2ID4A 1DELA 1O5IA 2PK3A 3D5TA 2PH5A 4U2DA 4LNHA 3F6EX 3LOPA 1E94E 4N0PA 1FXWF 4PN3A 5M34A 2FDCA 1XRNA 1XTTA 5B3AA 4BFZA 4CEJA 2XE7A 3C7DB 1WTAA 2PGAA 1MP0A 3FDJA 3HP4A 4L9SA 4Q3EA 4DRXA 3P27A 3ND5A 4HLUC 5TXGA 3W5AA 2HEIA 3O4GA 1OWOA 3ZLJA 1SQ0A 5G0TA 4L9WA 1U9ZA 3P96A 3PI7A 4CKBB 1C7ZA 1DX4A 1UDAA 4OK6A 1QR2A 2DKOA 4EG5A 3QA9A 1M8FA 4G6ZA 3CE6A 1HE2A 4V03A 1RP1A 1JTEA 3UW1A 3P0EA 4C30A 3C1UA 1NN5A 2I0FA 4ALJA 4BMPB 4EZBA 5ISMA 1H0KA 1Z0ZA 2XA1A 1HSOA 3KP1A 1QH1B 2O1WA 1AF4A 3Q7TA 5DOZA 2IIQA 1U2ZA 3SS8A 5CK5A 2JH9A 3S6JA 2GCGA 2L42A 3D6JA 3I4LA 1QIEA 2ZYRA 3HACA 5I45A 2XKAA 1ZNYA 2BFDA 2R44A 4EPWA 4KQ2A 3IVCA 5F7JA 4BFTA 1ACMA 2FAXA 4QYXA 1NMZA 1ZH8A 2A33A 5A1JA 5HVNA 1OXBB 2CXHA 4TXNA 1OXUA 4B3XA 2H65A 1X80A 2M6RA 4EAQA 1NDQA 3ZCSA 2V0GA 1XMPA 4QQFA 7ABPA 5JU6A 2PZMA 2VDWB 3KT3A 4UTXA 2G06A 5JJKA 3DB2A 4IDGA 2D0DA 5YASA 4YA6A 2VYFA 5AXDA 2VTEA 2GK7A 4HATA 4WSOA 3MZ0A 5KTOA 3AFMA 4U2EA 4QOIA 4PCUA 1LDNA 3A31A 2OGUA 4JXXA 2B3DA 2G5TA 2R68A 3EQ8A 3WYFA 1KI6B 1XEWX 3GFBA 3N5CA 3N7AA 3QU4A 3ZE1B 1MJHA 3F4BA 4HX5A 4WXRA 1UM9A 1F7UA 1XRMA 4DIUA 5EESA 4EI9A 3RJMA 2I1LA 2FF5A 3KG2A 3OLQA 4N18A 2MMCA 4OQYA 3W90A 2EWMA 3WNBA 4RTQA 1UPTA 3EVFA 3TK1A 2CHFA 4HXYA 3A2LA 5EXEA 1C9YA 1GRNA 5G4LA 5JAQA 2O8CB 3GBVA 2RARA 2C1XA 2JFBA 1JN0A 3MWYW 4N0DA 5CIYA 4ZQGA 3O3NB 5P21A 4NY1A 4E4TA 1EP3B 1OC4A 3ABOB 5M5BA 1Z3IX 2BKAA 4HNSA 4NATA 1QHXA 2FR0A 1RHKA 4NMXB 1ZONA 3UQYS 1H4SA 1IMJA 2OBFA 3Q3EA 1JEEA 4N9WA 5FLYA 2FR1A 2NN3C 3IAFA 1TRKA 2BH9A 4NOMA 1AE1A 4XA8A 1O4WA 5EPOA 3RFVA 3BFXA 1DC5A 1S2OA 1TT5B 2AVNA 1DRUA 3IAS1 4JR1A 4NCIA 4P32A 2P9CA 4PHFA 1NPTO 2IEAA 5F2EA 3OD5A 3NANA 5IKOA 2YV4A 1J0DA 6PFKA 1A9OA 2IUTA 1GCUA 2NAPA 4IUDS 5JNTA 1JYSA 3U40A 1YR7A 4O5OA 1XYGA 4IDPA 4O2BF 5HDBB 4KR7A 3AVUA 2P65A 2DUMA 2I65A 4WFKA 1KU0A 2PYDA 4P4TA 4D97A 1CQIA 3AIKA 4GFDA 3PWZA 3L6CA 1Q7EA 2AQKA 2E0IA 4BDSA 2O0KA 1PHPA 1GRVA 2GF2A 2FLWA 3IEPA 4FN4A 4MITA 1RFGE 2JAXA 2RMKA 4BHTA 2X3FA 1G8YA 3HDYA 3KJHA 5JCJA 1KJ9A 3O82A 4A1OA 4AZSA 1Q95A 1RI4A 1BFUA 1E9CA 1OT5A 1ST2A 3MGCA 3W5DA 2IBTA 5TPWB 2F6RA 1BWSA 2XGMA 7MDHA 2BC9A 1PEDA 2WF9A 2ONCA 3FZQA 3GPLA 3HCAA 3EBPA 1MIOB 2HPHA 2E5LB 1XJCA 1CY2A 1DWPA 1DB3A 1V41E 1KI1A 4FINA 3LQRA 2FVXA 4U3JA 3EVDA 1YMUA 2Y0BA 4FYWA 1FIUA 5DX1A 4F2GA 3BBPA 4QOGA 4R1LA 4RABA 1BSVA 1JQDA 3CPSA 3QWAA 1SO8A 5AVTA 2JA1A 2QD5A 4WY5A 4EO4A 2H59A 3DVQX 1V95A 4AKIA 5GY7A 3URMA 3ZE0B 2W6IA 4DB2A 1KXJA 2BISA 3SVZA 5EGSA 4M1WA 1KMIY 1OZGA 1NI3A 1MJNA 4E94A 3MUFA 1E6EA 3EXFA 2ZS8A 4RIEA 4YX9A 2G4CA 5DGHA 2W4MA 3BD9A 4P7KA 1P19A 1FMTA 1A8HA 1XDWA 2Z8YA 5TE9A 1H5QA 3QF4B 4Y8VA 3VKUA 1DIBA 4RQTA 4JBHA 4QDKA 3WDLA 1TU4A 4ZYVA 2QTTA 2FOIA 2HF8A 3S5JA 3DEKA 1COZA 3HCPA 1F0YA 4G0NA 1PR2A 4R2LA 2ZCJA 3NT4A 3M6UA 1ZR2A 4UNNA 2JGMA 3GJ7A 2BFEB 3VR5D 4LECA 3KUUA 5JXJA 4C0JA 2XT6A 2NUBA 2ZYTX 4FFBB 1IZ0A 2Q3BA 4JGBA 2ZUFA 5EE3A 4KC0A 1OX5A 1E1DA 1TCUA 2UZAA 3L8MA 3O4VA 4L6AA 3M89A 4MIOA 3OPYA 2VBGA 4P81A 2WM2A 4YWHA 5M29A 1TK2A 4NYMR 2JA2A 3D3WA 4XJSA 2JLZA 4U6SA 1RI2A 2FFBA 2Q8NA 3SR3A 3U7QB 2IYNA 4IVPA 3D7SA 1MX9A 1ODCA 3GX1A 3K0EA 4ZQEA 1OX6A 3OX4A 5A4MS 3D1JA 2QMZA 3TPCA 4GKJB 4EUNA 4LBYA 4HB4A 3WAJA 4JBGA 4ARCA 2CUZA 2CD9A 1T1SA 1UBEA 2EFEB 3PYMA 5J2UA 3I2YX 1ISFA 3QBVA 4DLLA 2GYUA 2IF2A 1UIMA 2D1RA 2H31A 4BZZA 5BYAA 2FDXA 1RBYA 1CX9B 2YVAA 1R6VA 1HFWA 3G7UA 3LCVB 1ACJA 2CFSA 4B2LA 1G7SA 2LCFA 1YUNA 2MYUA 3RI3A 2BL4A 3BTVA 3R5TA 1P2UA 3EQZA 1GA1A 1IYZA 1RMTA 3QVKA 4FNOA 2FDRA 2PE5A 3K4QA 4C88A 3LC2O 4HZGA 1JXAA 3H9QA 5G2OA 2AI1A 3DS8A 5DBFA 5FPKA 3BE8A 2ES4A 3SQDA 3ACBA 1TVCA 3IURA 4JD5A 3WK4A 4R5MA 3ER8A 4FDTA 1PWYE 1S89A 4LCBA 2VTKA 1KQGA 1XZKA 3IVGA 3PGMA 2VC2B 1I30A 3LDHA 5AKXA 3K1JA 3OJFA 5GAJA 1TA9A 2AG0A 1TCVA 3PZBA 5B57C 2FN9A 3GQBB 2CXSA 1RZVA 4HJXA 1YE5A 4J0GA 3THWB 1K88A 3FCYA 1U8AA 1VPEA 4S1WA 1LV7A 4E31A 1U7ZA 4I8DA 2W4IA 4JGGA 5IT4A 4X8OA 5FWXA 3S1LA 1G3RA 1NN1A 1SHUX 4FTWA 4G5YA 3CVUA 5HF5A 2DWPA 3ZWAA 2SCUA 2Q0HA 4F84A 3HN7A 4JT8A 1JIJA 2I76A 5CVDA 2Q8QA 4BJ5A 1FLVA 4R3NA 4D9HA 2R6GA 1G20E 1MT3A 5CM8B 1SBQA 2HA3A 1P1HA 5HKBA 3BK1A 3UJAA 3HMKA 2C57A 3K94A 3PVZA 3WFIA 1MW8X 1NSTA 5ES3A 3TTSA 2E87A 1JSLA 4KZKA 2ODPA 2IC5A 1EWQA 1H22A 3ZV5A 3FW1A 3FTEA 2QW0X 3RHFA 4NBVA 2BMFA 5KOJA 1NTOA 4WFIA 3TLJA 3CU5A 3AQ4A 4R9RA 2IUUA 2RHMA 2UXDB 4EECA 1KEEB 3LCMA 5I48A 1PYOA 3R8FA 3H97A 3O74A 1F4VA 1G4HA 2IL1A 2Y8EA 4HWTA 2FWMX 4UMVA 3I6MA 1QGAA 2AD1A 1HGXA 2CUKA 3WIEA 1ZG3A 2QE6A 4YCAA 4ZYWA 2NSLA 4R51A 1QKIA 1QVRA 2VDLB 1GDTA 5AVZA 2O54A 1SQSA 3N2ZB 1EK1A 1QE0A 4V0MA 4X61A 4IGFA 2CHUA 3AYZB 4IOKA 2Q2WA 1CZHA 2AC2A 1M54A 2PJZA 1IN7A 3R23A 4MKIA 4GBJA 4Q37A 3HCCA 1AKMA 2ARKA 1NXXA 4KQCA 3U3JA 1IY9A 1RRFA 4O59O 4P4UA 3I2JA 3LHDA 4LXTA 5F76A 2JD1A 2AE1A 5K8VA 1C30A 4QG7A 3V55A 3KUDA 4RHFA 2F00A 4ZCPA 3EMVA 3BAFA 4BO0A 1JFTA 5L6LB 4ZAFA 1OKKA 1Z45A 2G6BA 3BF7A 3CX6A 4XYEA 1D2MA 3V7UA 5KKCA 1Y8QA 1NMSA 5EIEA 1Q44A 1IATA 2F1IA 2IHKA 4HWPA 1Y6JA 1F1JA 1JBEA 1KYZA 2ZI4A 1G21A 4H17A 2EP5A 5EE5B 4ZVKA 1E8DA 3R75A 3ZZTA 2OO3A 1FJGB 3VYSB 4C4RA 4OQPA 5LFAA 1NJGA 5CDTA 3LF2A 2HU2A 2Z83A 2JFWA 3QVJA 3UPUA 3CUWA 2WHRA 2AHOA 2WWFA 4PR3A 4F2DA 1DG3A 2ZPAA 4S3MA 1SIUA 2XOXA 3ZBQA 4JEMA 2VQEB 2HV8A 1L9KA 5AT1A 3BIWA 5DRTA 1E1QA 4QDZA 3TM5A 3G5TA 2RAPA 4Y0NA 4Q9HA 4RPIA 1AKQA 1RM3A 1NUUA 2UVDA 1QO7A 1PV4A 2OK8A 3AFGA 5EXXA 3AV0B 3SE0A 5C1OA 2FKAA 5K2OA 4B32A 1J22A 1P8JA 2JH3A 3AGPA 3CNEA 3OWOA 1QF9A 4OGWA 3FOBA 3OTIA 3KB2A 1CJSA 4MZDA 1H23A 2P9BA 3HLTA 4N65A 4QXAA 3TLXA 4FXPA 2QGNA 3QE9Y 2LDBA 1XKQA 5DP1A 2PJUA 1NNLA 3BWEA 3GF4A 2QOEA 3A9VA 5EZ5A 4AO7A 2XUQA 5FWAA 3U4MA 4J9VA 1U0FA 4IDAA 2VSOA 3W5SA 3CX7A 1UOPA 2OV6A 2GGSA 5LYJA 4OSPA 1CLUA 4UHCA 2R6HA 2ZTMA 4WKCA 4Q0MA 4B4WA 1KI7A 1NVXQ 1RXCA 3QEJA 2DPHA 2F9FA 2FZ4A 4BVLA 5KX5B 2LRHA 3TXXA 1EU1A 1CUYA 3ZY2A 1A2QA 3A6PC 1RQLA 3S7TA 2O6LA 2CF6A 3K16A 4OFBA 4ENWA 2ZSIA 5HIKA 3ZGXA 3QE2A 3WYDA 1NXPA 1D6SA 3OF3A 5IRCD 1YO6A 4B17A 3OCWA 4KR2A 1U65A 3PUKA 2P35A 3QFCA 1ELOA 1VHWA 1ZH2A 2FWJA 2I3DA 2ZXEA 3FROA 4Q4JA 3W8NA 1GPNA 4D9NA 1I7PA 2YMPA 1IZ9A 1O95C 5BPFA 1RJDA 3NVMB 1F38A 2VP0A 4ROSA 1HETA 4RTNA 4MWTA 3BTUA 2WFLB 2XNDD 2VP4A 1SOWA 3OFNA 2GCIA 1C9KA 1NI4B 2WU3A 4KL8S 4NTZA 4NAHA 4RV4A 2WD7B 1KJQA 4Z4EA 2CVOA 4M87A 4LYJA 4WNAB 3PEYA 3C6MA 3STTA 3LGSA 1UMBB 1ULSA 2ZFUA 4J2OA 3ROXA 4QELA 5L3QA 1JTVA 4X00A 2YICA 3ESRA 1NYQA 3QTBA 3PNBA 1UMKA 2BFCB 1ARZA 3E9DA 1AN9A 1QPBA 3EODA 3GFGA 3LGAA 4XX1A 2OLJA 5JW6A 5E6SB 1RMYA 4QEKA 1AXGA 3SHVA 4MUKA 3ICPA 1Z4OA 1KFJB 2P2SA 1CY8A 3H2KA 1DIRA 2GF0A 4LBZA 3ANNA 1G3UA 4MEBA 4PZDA 3B52X 4JSYA 5IXYA 1QV7A 1GSOA 1EP2B 4RTMA 2F8TA 1PZXA 1QIDA 3GRRA 1TCCA 2DBRA 1D0VA 1G5RA 1VCMA 1YDWA 1HDIA 1OI7A 1QGZA 1QIIA 1E1LA 3L6OO 5JANA 4Q7QA 1C1DA 4JNCA 3QG1A 4FMDF 3JWJA 2V97A 2IHUA 4OMCA 1N2JA 2O7SA 4AZWA 2ZUDA 1ISHA 3VR6D 3X1ZA 2KYRA 3BWDD 3L84A 3SSNA 2TECE 4EBFA 2GA9A 4CEHA 2GI4A 1JX6A 1DXHA 3DMGA 5AUNB 3ZHUA 4PGGA 1AKYA 4N03A 3GZJA 2B4RO 2V96A 1YKFA 5CJPA 1ZWKA 5E8JA 1P2BA 2WJ4A 2Z56A 3C24A 4OBXA 1OVMA 1RWQA 1IUNA 2FSHA 3GHHA 4HX9A 4EA7A 5IZCA 2WHYA 4YMVA 1WU8A 1KSJA 4KLAA 3SGLA 3U26A 4CDGA 1UCFA 2A35A 4EUFA 2A9FA 3U4HA 3A1CA 3L7IA 3UJDA 3VOTA 4INOA 1XCBA 3DOEA 4RD1A 2LKCA 5SZKB 2OXIA 1NVUQ 1QAQA 2AOXA 4NIMA 1M2FA 4NBWA 5JAHA 1KSHA 4UNRA 1RCTE 2UVPB 2J0UB 3MJ4A 4ROTA 4PHHA 5JSFA 3KTOA 4D0SA 2ID9A 1E4EA 4HVLA 1E6KA 5J58A 4JI2B 4D41A 3ITDA 2YH2A 4RH1A 1N6LA 2CLLB 1GO2A 3OX1A 4O4JA 4TYQA 3SVTA 1B8PA 1QIFA 1Z6PA 2OBXA 3EZ9A 3GEHA 1C3VA 4JXJA 4DNPA 1SCQA 4ISBA 2H4YA 3P9PA 1A7JA 3ANLA 2A67A 3N1UA 1GQRA 1FDWA 2VNHA 4KITB 4EG6A 4Q9IA 1QAMA 1GG2A 1O3YA 3TOCA 1QTRA 3H2SA 2PL1A 4N5IX 4U1RA 2CLSA 4Y3UA 2FPIA 1M1UA 1DKQA 2I33A 4XWGA 3WRYA 4IJWA 2PUGA 3C97A 1G5PA 2A5DA 1SZJG 4HH3C 4OUDB 1SXIA 3U09A 1M2JA 2FU5C 2PA0A 2Q9UA 2PSHA 3HBLA 4YB8A 3CC8A 4B7ZA 3VHRA 1KQOA 4QM6A 2H9IA 3O9MA 4HKTA 3WL6A 1LBSA 4C0BA 1POXA 1T24A 1GUZA 3BD7A 4HH1A 4LBWA 3QMPA 4DEYA 3G8YA 1DBSA 3R7FA 3ZDCA 4B3MB 1CK4A 1WDWB 1E8MA 4N6OA 1LS6A 3VC3A 1RBMA 5A9RA 4BJ6A 2H1SA 2NTNA 3IOEA 4OQFA 3J81A 3GQVA 4I08A 3U3DA 4E2ZA 1FTYA 2GQ0A 1OJ7A 3IEUA 1M76A 2QTNA 3KWFA 3VDQA 2FX5A 3BGIA 3GRCA 1F3LA 3PFCA 5H3CA 3S99A 4P4LA 1M0EA 5DNYB 1YDMA 1OILA 4DPMA 1Z0IA 1B0PA 1DC8A 2VWPA 3GI1A 2PSFA 3RVJA 4DUPA 3LKZA 1B4DA 2AEEA 5FWYA 1AQNA 1Y81A 3JQ8A 1JSCA 1SC3A 2G0NA 3CLVA 1ZVKA 3FPHA 3PDIA 5E1BA 4MW6A 1XX6A 4Q48A 2G3YA 5JLJA 4BVGA 5LNK1 2RJOA 2VHJA 3L1IA 4BLUA 5HR5A 2ZYGA 1Z26A 4K7JA 4LX0A 3D2BA 3V6LA 5F9MA 3TVYA 1PG5A 4H7IA 4C01A 2XNCA 4GM1A 4W7IA 1ORRA 1N1EA 3NZEA 3SICE 4JNKA 2GLXA 1IZZA 3EWNA 5HUJA 3A2MA 1DRWA 3MD9A 2XTNA 4Y2GA 1ZGGA 5J2TA 2R6JA 3VR3D 4KLRA 3AI7A 1SVIA 4IZIA 3OWXA 3WI7A 1Y3DE 4F60A 1PD0A 1AS2A 3DMFA 1N2XA 3B5EA 1AM4D 2H63A 4ML3A 4K6HA 4MA4A 2YZ7A 2H7VA 3FOZA 1QFMA 1E3IA 1KAQA 2QJRA 2HA2A 1O9BA 1KPHA 1B73A 5AK5A 5JXHA 2ZE8A 3E4CA 2GXAA 4DF3A 1OOEA 4LE2A 2HMSA 2XWBF 4L74A 1UBSB 2RGBA 1A9TA 4K9RA 4BV2A 4LHXA 2FPUA 4KTVE 3D2AA 2GCEA 3JQ9A 4N12A 1AJEA 4L75A 2AC7A 1D6MA 1R0YA 4I5GA 4N7BA 5KJCA 3WZMA 5KVAA 1N1DA 3A4LA 4DIKA 2XMBA 4I7EA 4E2XA 4NOJA 1VRCA 5BUQA 4GKKB 3U5TA 4BDTA 2CVHA 3OX2A 1DIOB 4L85A 3O47A 3WB9A 1L7AA 5THKA 1EVIA 4PLWA 1JDBB 3REQA 1C9JA 4NDZA 3AOGA 4B73A 4EO7A 2EU8A 2C5BA 4M1YA 1YF3A 2VAXA 2QDXA 3C14C 1OV4A 3H1AA 3T5PA 4W5RA 2VKQA 2J9ZB 3LVFO 3P52A 3UJ7A 4HV4A 2OC9A 3A1SA 1E7SA 1XZJA 3BCRA 4J6EA 4RKYA 4ZCRA 2A30A 2AQIA 1WMFA 3NHBA 1ZI9A 2BAGA 4LMBA 4RM2A 1TCBA 1FS5A 1P31A 3GA5A 2JI9A 3E22A 3QX7A 3USCS 5IEJA 1N2CA 1Y3AA 5C18A 3Q9LA 3GLHE 3HZZA 1PIWA 1ENOA 1IPEA 1BHJA 3H4MA 4RF2A 2FSUA 1S1MA 1AD2A 3E3NA 5ILQA 3HJHA 4OM7A 4ZTBA 3LQQA 1S1CA 2R7AA 5F4ZA 4Z0PA 4F9TA 2J5XA 3NT2A 4OYRA 2BHRA 3AHHA 4EVQA 4MVJM 3OZGA 2A0WA 1G16A 4LOKA 4P92A 4B45A 5JIBA 4DLXA 4DA9A 4O08A 2YY7A 3A28A 2BZGA 4JQZA 3UH0A 4RULA 3EDMA 1JAIA 2MSCB 4I4TA 4QUIA 4ITRC 4WCFB 1PW5A 1Y4AE 5I9MA 2UVQA 4JUCA 4V24A 2CWDA 5HK8A 1ZJYA 2IY8A 4PPFA 4TTVA 2W6JD 2BFMA 3TUZC 2OYSA 1QP8A 1K8XB 3DTVA 2QU8A 3NBQA 1RVDA 1UXJA 3UAWA 3V7NA 3GNQA 5EOVA 2YFQA 2X5NA 1KMMA 4FT2A 5B4TA 4M0KA 2WJHA 4LWZA 3A6HA 5GONB 4UOEA 1CRLA 3GPDG 3SWWA 3ANYB 2YYSA 1K5HA 3UJNA 4E03A 1X9HA 3BMCA 4BB6A 4NJOA 1ORTA 3ROKA 3RTBA 4X9XA 1MAUA 1QZUA 5BRNA 2R6CA 1ZESA 2WFAA 3ELBA 2G71A 4KO2S 5JAZA 2YDXA 4Z4HA 5FTMA 4HLDA 3ISJA 2OR3A 4RHXA 1C80A 4YAWA 2D3TA 3A70A 1ZPDA 5BWLA 2XECA 1FQOA 5ICCA 1ORIA 1I3CA 3KPJA 3FVWA 3WBJA 2BI7A 1UPBA 2PMFA 3QE3A 1CY6A 1VMIA 3GMDA 3OZVA 1DKNA 1S2IA 2Z1MA 3TE7A 1AKRA 4DZZA 5KEIA 1HURA 2M6KA 3H4VA 4ACAA 2DY0A 2IYPA 2BMJA 2V65A 4MQFA 1P7PA 2WTMA 3AFIA 5SV2A 1AT1A 5HXAA 3ED5A 3GNLA 4FYIA 3TB6A 1BYUA 4IIJB 3N8GA 3PS9A 3VKHA 2YINC 2POQX 5FA5A 3ZK7A 5K51A 3NDIA 4BFWA 4DT1A 1BW9B 2B20A 3EGEA 3RRZA 3G59A 2WRZA 3B9PA 3CTMA 5AJZA 2I54A 1TA4A 4O4LB 4P35A 4B6FA 2JIDA 3E84A 2CXPA 4JBLA 1GGVA 3LBYA 4ODIA 4CW7A 4RTPA 1NQUA 1L4FA 2JIQA 1SBIA 1L1EA 3RUPA 5DIZA 5FXMA 3DV2A 4A2PA 1ZCAA 1SC1A 2NXJA 5C1PA 1MHTA 4NDAA 4X1KA 4ACBA 1QFSA 4WEQA 2VYND 5B2EA 2DJIA 1J21A 4XASA 4FKZA 2OB2A 2ZR0A 3VNQA 4EX6A 2YOFA 3EVGA 2R751 4DMCA 2HSWA 5J4YA 1VRVA 1XDDA 3R8XA 5I5EA 4DQLA 1LPNA 3UZUA 5LBUA 3OZ7A 2H5LA 2ZG6A 3CINA 3O8DA 3V2IA 1PR5A 5DM60 3HB1A 2FKNA 3QKUA 4OTZA 1H5NA 2D8MA 1OHHD 2D59A 3G9XA 3KUXA 3QOXA 5JJBA 2OOKA 1JB1A 4A0HA 4EYSA 1BDHA 3AW9A 4IO0A 4IICA 1MOPA 3FI9A 1B8OA 3FZYA 3HP7A 3WZLA 1OH7A 1GM5A 1GD1O 1MC1A 2QMHA 2OTCA 4KQFA 4EFDA 4UM8B 3N70A 2EFDB 4F11A 5HZGA 4EHJA 3AINA 1NXQA 3ONFA 2WE7A 4M9XA 1Y1PA 4MYDA 2DQ4A 3H9CA 1IBLB 1EB8A 2IOQA 1BG6A 5DXFA 1JEOA 5K0BA 1GNRA 1AA6A 5BQ3A 1GAJA 4BJ3A 2WDZA 1RTTA 4NNJA 3I0NA 3F8TA 2Q3LA 4NZZA 2ERXA 3JYNA 2I87A 5KOHA 1BMFD 1RPNA 2I1WA 3D7KA 3R0XA 1PG2A 4MVJF 4YJGB 2FFRA 3MHPA 4F56A 3GCWA 1SURA 2B1QA 2VF4X 2J8ZA 3I2GA 4YPFA 1Q91A 1KYXA 2EV9A 3EWIA 3OT1A 4LJ4A 1E2MA 2DFNA 4KO1S 4ZAGA 1HEUA 4I8XA 2BF7A 4MQEA 4OAQA 4O6VA 4TROA 1GNLA 2H6EA 2XTZA 2WJYA 5BWOA 3ZV4A 3T0GA 5GADl 1RQNA 1EVQA 2O2ZA 1FQKA 2QRHA 3E23A 2F55A 1YZ3A 1BXGB 1DBIA 2D13A 5AQEA 2ZBVA 5FPYA 5KJ6A 3Q1LA 3QEBZ 3MRVA 1KJJA 1P80A 2VR1A 4HNHA 5FEMA 4ZI5A 5K0GA 4RJ2A 1EBBA 4PGMA 1K3FA 3UPDA 2JHPA 3F3MA 3RLIA 3TLEA 3UUFA 1L3CA 3E18A 3H8VA 3V80A 3TO5A 1P4HA 3B7GA 4EGCB 2O3RA 2BEJA 3C85A 2EOAA 2O8DA 1NG1A 3LIIA 3ORSA 1RYEA 1L5FA 5THXA 3MT8A 3N6XA 4CM8A 3EZLA 5IAGA 2CVFA 1U99A 3I04M 3MIZA 1WPQA 4B9EA 1A0OA 4XWAA 1P0QA 2WI8A 4JI4B 4Q1DA 1WDTA 2DKFA 3MHTA 1UFQA 4JUFA 4DR5B 3L8GA 2CXNA 4B31A 1H94A 2XGOA 2A3RA 1XJ0A 2CCGA 1GU1A 1FVOA 1MH9A 2Z2JA 4B82A 1KFCB 1CIPA 3QKRB 5JSUA 4JASB 4KMMA 2B37A 3PQFA 1M5RA 3GJZA 5AMXA 3NMUF 1E7WA 1UWKA 4OQZA 1BQ4A 1XLTA 5CH8A 3EPJA 3K9NA 5EQDA 3U56A 2WEKA 1EVZA 1H69A 3O8RA 4E70A 1Q3HA 2B2XA 2WWGA 2XLBA 2XQFA 3HVUA 3IV9A 1NNEA 3ICQB 1OTXA 1QH0A 4DCVA 8ADHA 3ZH9B 4GOOD 4S1PA 3K70D 1CYDA 1M5TA 2P2CA 2Z30A 3KOXA 3ONEA 3K31A 1UPAA 4Q3CA 4ZO6A 3V97A 1RHRA 5EIBD 3R0ZA 1XCMA 4ND2A 3JQFA 1CE8A 1QQAA 4D96A 1XU4A 1VSUA 3QVLA 4H0CA 4Y18A 3JQGA 3BRWD 2F3QA 4FUQA 2RHTA 2RK6A 3PG5A 3T3HA 5DYIA 3W7BA 1M6HA 4RFSB 3ZW9A 5B6PA 3QNUA 3NWBA 4PLZA 4Q1AA 1L5HB 2IV7A 1HX7A 4BVKA 4B79A 5KMGA 2R62A 2B8TA 2GJKA 3ENKA 3U37A 1Q7BA 3H2ZA 2ZVJA 2IYYA 4H4EA 1PR1A 1V9CA 1WHSB 3H5AA 4CIDA 3GA7A 2QM0A 1C3JA 4YVFA 3EZXA 5CLIA 4YCDA 3TZBA 1I2BA 4PAWA 2QV0A 1GGKA 1SGWA 2AQ8A 2FFHA 4HAZA 3HXQA 1ZUIA 5FOVA 4LSWA 5EINA 4EF6A 1E99A 1IQ0A 3EZGA 2QXTA 5LLDA 3H84A 1A1SA 1PZHA 2NTVA 3DO6A 4MYRA 4TWBA 3ZKAA 4J0EA 3RS0A 5IBQA 2IZ6A 1CUWA 4I5IA 2BFBA 5DCLA 4Q16A 3REFA 3OQNA 2WU1A 3L8HA 3CM0A 1T8RA 4JC4A 1XI2A 2J32A 5TEWA 1XZLA 2G76A 3V4SA 3G8DA 3H2YA 4IFBA 2ISSD 5I7RA 4RZSA 5K99A 3COPA 1GITA 1L5OA 4NYJR 5KQPA 4K6MA 1EGAA 4IFEA 5B58C 5E7QA 3F0TA 1TOAA 2ILTA 3M6MD 3UJ6A 3TLMA 1UJBA 3JWHA 3LTNC 3HO1A 2PMDA 1EZ4A 1DTWB 2IYWA 1FFGA 4PZ0A 4EH1A 3FWZA 3UCFA 5E7JA 4NXMB 1ZC3A 2IOHA 1CJKC 4G0XA 5ED4A 3NAQA 4RNDB 2NYUA 4MSUA 3ZH2A 4OQLA 4DQXA 3OURA 1II0A 1QDEA 3NBXX 3ESBA 2V98A 4ZEVA 1IUOA 2ZYWX 3VPCA 4C2AA 2AG8A 2JVKA 4IEEA 4QXOA 4WCFC 2V6FA 5E0OA 5B58T 2CLOB 2IHZA 1FYFA 3K9QO 3NOQA 5EHIA 3DT9A 4AY5A 4OM8A 4RK0A 4O2BB 3M2TA 1M8KA 3K6SA 1U8ZA 3SQLA 4NVRA 3OPMA 3C3JA 3QU9A 2NP6A 1KO1A 4XWYA 2AXNA 2Z2KA 4L78A 5CYOA 2Y0PA 4M53A 4Q4AB 4K46A 3VPHA 4DE5A 2GJSA 2ZQYA 2ZULA 1SCUA 1CUUA 1T0UA 4PRYA 2XYHA 1PQYA 2QMUA 4QATA 4XIJA 2M2IA 3NOXA 4WFJA 5JDCA 3WWPA 2AG5A 2B1IA 4IIVA 1JQKA 2IA5A 2C97A 2QPLA 3S2IA 4A9AA 3LA6A 1W0JA 4DSUA 3IUYA 1Z7YA 4ENPA 1MZVA 1F0KA 3F6PA 4ZA2A 4UPEA 4ZV4A 1HZZC 4GDFA 3QKTA 1BX1A 3T52A 2JCGA 3ADKA 1NIJA 2EJTA 5EJIA 3H13A 1UPXA 5DYTA 2ZDHA 2E6KA 4UD2A 4ZYYA 1JIKA 1JYEA 2BRUA 1K5GA 2DX7A 2O4UX 3W04A 5IVKA 4ZIRB 3TRFA 4AWBA 4H1VA 2KBEA 1W5TA 2B8JA 3L6BA 3N2KB 2XUGA 3D4OA 4TWAA 3EQ6A 5E3HA 3RIMA 1Y9EA 3KFLA 5AD1A 4C4SA 2X8JB 3AZPA 3GY0A 3I5YA 4LF5B 1YQDA 3ESDA 3A1NA 1XF1A 5CEFA 3UHPA 1JIXA 3WIDA 4I6JA 1M6YA 3LCCA 4UVHA 1L3IA 1XCJA 3RSGA 3DZIA 3LLUA 4QBFA 2CNNA 1XWWA 3TCKA 4TVOA 4W5HA 3R7AA 4DCJA 1LY1A 4B2YA 4Q39A 5MFZA 4CQNA 3C3CA 2Y1KA 2FZCA 3M3HA 2PUTA 4JZYA 1L8AA 5U9CA 5HJ5A 2JG3A 5HQ3A 3QPVA 1MV8A 1WXDA 4ABYA 1OB2A 2CKDA 1ZU5A 4OGLA 2WQ7A 2XMDA 1TUIA 1Y8RA 1CJUC 2OUKA 2XYQA 4H1UA 4LC1A 4X7MA 5EUMA 5JNLA 5K3EA 1WNTA 3KYBA 4CGZA 2C2WA 4GPTA 2ROQA 2Q5CA 3C6YA 4ZVSA 3UBMA 5C8VA 2QGZA 5B6JA 1XZIA 2OBYA 3QOWA 4HAYA 2WSLA 5FTJA 2CMHA 3FPAA 3KKEA 3M49A 4IV5A 5IN4A 5I9LA 2BM1A 4CLOA 4TMZA 3KXDA 4D4HA 2JJ1A 4WZBB 5IF3A 1R16A 1NPDA 1PTJA 1PKXA 2EYQA 2P0YA 3H65A 3SYLA 3NBMA 1L5MA 3SXUB 4HLUA 3GRKA 3QJYA 1Z5OA 3QUTA 1LVGA 4PSKA 4RAOA 5ILOA 5JBIA 1VP9A 5COBA 3TAUA 2Q4BA 3IT3A 4YROA 4ANFA 4PZAA 3ZBUA 3U4QB 3SU8A 4G8CA 4HDRA 4BIMA 1NVVR 1VHLA 1W94A 5M3BA 1LI5A 1QHHB 1H2BA 2WQZA 3IIEA 3KQOA 3EXEA 5AI5A 1H9BA 2GX6A 4PPQA 5EIXA 3ID6C 5BOSA 3JTEA 4O25A 3VYRB 1Y9AA 3BRCA 4MUFA 4BWFB 1AUXA 2G88A 3U6BA 2P69A 4MV5A 5BP7A 3QK7A 3FYCA 1I1OA 3U13A 3ZGVA 4CMKA 1TPYA 3OTWA 4QO8A 1BOOA 4PQYA 2X0KA 3GU3A 1CQJA 4J2TA 1EP9A 4CR6A 2P6RA 4UQPA 3NHWA 3SDSA 3DVAA 1X38A 1BGXT 1D2RA 5LM3A 5E4TA 3LYAA 1RWOA 3ZY6A 1A9SA 4IRXA 4B84A 2ODTX 3AR6A 3T5GA 3LWZA 2PMCA 4MQUA 3I2KA 2X4GA 3K9FC 4PLYA 2F43A 5IKMA 4LAFA 2J3JA 1ZH6A 2IW3A 2VJAA 1EG7A 2ZU6A 1XL0A 2J4DA 3BICA 4GX0A 1FXUA 1LQTA 1CZUA 4FE3A 5FHQA 5LZ5A 3W2FA 2X22A 1MGOA 4EG1A 4HVCA 1NLFA 3A6ZA 3HJAA 4MAAA 1EZ1A 1VMKA 1WQ4A 2YV1A 1ZIDA 1UFRA 1Y3HA 1IC6A 3EE6A 3ON5A 4UDNA 3X2SA 2IXEA 3RC8A 4OSEA 1UT8A 1KHTA 2OHGA 2ZIUB 4JB3A 4G9EA 2ILVA 1QHIA 1DDIA 1WE2A 4ZJUA 2NAFA 2FHSA 3MWDB 2QN6A 1QPGA 5A1TA 3FDIA 2JH8A 2DR3A 1EUZA 3FH0A 2RK4A 2JGAA 1N9GA 4EELA 3OSUA 4WZAA 3A9SA 4Y2TA 1HTTA 1M73E 1V1MA 3AWIA 3D64A 1CF4A 1V8OA 2GSDA 4XR4A 1XAHA 1SXJD 2BMVA 3RKSA 1K7EB 1I6LA 4M7PA 2JZOA 3AR3A 1YZUA 1A82A 1RSZA 2EDCA 1HR0B 4OL0A 3GFOA 1T6ZA 1UBKS 2I91A 4EZEA 2JJ8A 2B1GA 3T5DA 2DUUA 2F67A 2XVYA 4CL2A 1CBUA 2GCOA 2ZITA 6GPBA 3ZJUA 3H6GA 4IJKA 1KBQA 2FQ1A 3M5PA 3Q10A 4WECA 2OOSA 1BJRE 5I3CA 4CMBA 2Z6UA 1XCOA 1YFJA 1UK8A 4LQ4A 2FPSA 2ECKA 4OXXA 1WCIB 1G60A 3U48A 1S3SA 4B3CA 1A9ZA 1JFFB 3BVPA 4MH0R 4YRLA 4BLSA 5AQ1A 5AIAA 1EDBA 1KQFA 4TKUB 1K4YA 1YR3A 1QHNA 5E2IA 2GM9A 4YH1A 1M6WA 2QTHA 3ZY5A 5HKKA 1A3CA 2IE8A 3LX4A 1QC5A 3L0YA 1D4ZA 3S1AA 5LJIA 4R01A 4EUKA 3QUCA 4F8JA 1NUSA 1VL8A 3LT0A 3O9ZA 1RWNA 4J91A 4EHDA 1DMRA 3OIVA 2MOKA 2RH8A 3OWHA 4I55F 3PXBA 1V26A 2B9EA 2VPPA 3UMFA 1EXMA 2JLCA 3QFHA 4YHBA 3LVQE 4DSZA 4XE5A 4F4UA 4CM9A 1U5BA 1J6UA 2P3SA 2QYOA 3G7NA 5F5XA 3G8CA 3QMMA 2RC6A 3GT4A 3C7KA 4L5BA 5H82A 4E1AA 1WF6A 5JXIA 1EFUA 4HCJA 3PWKA 2CNBA 4LYEA 2PUBA 4DV5B 1ZS9A 5T8KA 2PIAA 5DTJA 2P2ZA 1E63A 3H16A 4B2IA 5KTRA 1ZGJA 2OORC 3GEMA 1MD9A 3CLTC 1J33A 4GVLA 5KQRA 2SKDA 1SOMA 4YQYA 4DTIA 1XP5A 2Z43A 3NBFA 3KVVA 3L8CA 1R5BA 5CLHA 3OJOA 1FNSA 3QF7A 5KIAA 5GMOA 1TU0A 5IDVA 3A6GA 4OSOA 4NXNB 5LQMA 1XHEA 3B38A 2HSGA 2A9OA 4O2LA 2HBYA 5IN5A 3QPWA 2GWRA 3C8HA 1ZCJA 3FSJX 1WXHA 2G36A 3OTQA 3GMTA 2W43A 5E0KB 3UB2A 1TZKA 2WHPA 2BN4A 1G8SA 4LDQA 3RNLA 1OGIA 1JF8A 3OTHA 2XB9A 3A1WA 1DKUA 2H8KA 4WGGA 4XB6B 4JGIA 2WYOA 3P9CA 4N76A 2X3UA 4EY3A 2VAWA 1CP2A 3ZQKA 3ZR4B 2M1ZA 1XZ8A 4QDXA 1H1LB 2WSIA 2H17A 4TTJA 3ELDA 1W88B 4FFDA 1P5RA 3R4VA 5C35A 2QV7A 2O20A 2IEIA 3IT0A 1CJBA 1CUVA 1NUTA 1OXKB 2VHUA 3FWYA 5AW1A 1HE8B 3WB2A 1O8BA 3EA0A 2BD0A 2I55A 2HRQA 1IY8A 1O1YA 3NYIA 2AFHA 1Y3CE 2Q62A 2DUNA 1GPJA 1DUSA 3V2HA 2VYQA 3UHFA 4UE3S 4CHGA 3T3IA 2HL6A 5D6OA 1DBPA 1OIWA 4AZVA 4BQFA 4S04A 4U7GA 1OR8A 4FYMA 3P9YA 1N2HA 1C7FA 4FHDA 2B5WA 4TT3D 4EHNA 1JZSA 2Q4TA 4RX1A 1SXPA 4KQHA 3UFXB 4M38A 3EEYA 1WSBA 5B3LA 2R84A 3NUZA 1UJ2A 1TT7A 1P8AA 2Q5IA 1V16A 2NW6A 2HXSA 2XSZA 3NC0C 4OBWA 4QQNA 3KD3A 4Z99A 1YB4A 5LZ8A 4J3FA 2Y6UA 3KKNA 1EPUA 1EZZA 2AMJA 4W1QA 3KYJB 4FYXA 1GZVA 1KMCA 2MSKA 1KK0A 4RXUA 5ERXA 4H3SA 1T4CB 2ZIXB 3LRTA 4L3WA 2O2HA 1H6AA 2WWIA 4Z8YA 2IS4A 5BNZA 4BS9A 1EDOA 3N0VA 2QRLA 4IVNA 4D7AA 1T25A 2GMWA 2IYLD 2OCAA 1P1CA 4H1TA 1I2DA 4KQEA 1N0HA 4U4AA 4RA9A 2R8PA 5JHGB 1J39A 1PX2A 1EAMA 3P19A 1DEHA 1YZKA 5HG0A 2G5CA 4QXRA 4CIWA 1W49A 1C0EA 2HPVA 3IOCA 5EJ4A 4C9BA 1PF7E 4LGCA 4NS4A 4A0QA 1XC7A 3N2GB 4J7XA 4YAOA 3I9FA 2I2BA 1Y4ZA 1JR3D 2HN9A 2X8LA 5DYWA 3LP5A 2R6DA 2FPPB 3FTCA 3KXPA 3AVWA 5SZJA 3NWEA 5GGXA 3DNPA 1EK5A 1G8JA 3B78A 1Y0BA 2FPXA 3TAHA 2JGFA 3TZ6A 1AUVA 3K20A 1QVVA 4BV8A 3O2JA 1YCFA 4II7A 1NYRA 1UIRA 3R6LA 3S8EA 3D3JA 3MCVA 4M60A 4NCXA 5HW0A 4Z4GA 1SIWA 3OA2A 2QL9A 1RRKA 2BWJA 3K0FA 4U6QA 4YONB 4DNOA 1FFXB 2QYHA 3FGZA 3WWCA 1USKA 5K8TA 2G9VA 1T3HA 1TKRA 4MS3A 1FRQA 4IQFA 3CSSA 2QG4A 3FHCB 3HI6A 1XNGA 2AOTB 4IKOA 4RY9A 4YYZA 2RGRA 4U2BA 3K4HA 3BERA 4KXLA 5H4HA 5AVVA 1X8KA 1T15A 1DQSA 1T6XA 3QXHA 3IVXA 1E96A 4NMLA 1FRZA 2FUNB 3QIAA 2TMGA 1AO0A 3QVTA 2LKDA 3EAFA 5KNBA 3SC2A 4JLJA 2ZS7A 1DWQA 2CXTA 4EK9A 3FFBA 3UQZA 3ROZA 1DKRA 4LY0A 4L4XA 1Z4NA 3ORHA 3QENA 3HZOA 5LLSA 1X3SA 3LQKA 1GCIA 4CIXA 5JQWA 4LXUA 1KMHB 3KR9A 1SG0A 3AFOA 3E2IA 2GVNA 2XE8A 1ADBA 1PNRA 3JTMA 1L5KA 4BE7B 2HIAA 1ZINA 4JB8A 1ETHA 2BEVB 2NTYC 3GLVA 3W2TA 3OZWA 2NXEA 1J8DA 2OHXA 1VJGA 1VIAA 2EX4A 1NURA 1E0DA 4R2XA 2RI0A 4X3OA 1GYRA 4L8GA 1C0LA 1MH1A 2R96A 3SSMA 3EXIA 3RK1A 1L4MA 5CYGA 1CUZA 4MQBA 2GBLC 4UCQA 1OYWA 3OO1A 5ALMA 4AMGA 3PUWA 5ICSA 2GRJA 4ZVUA 2YV3A 3SLGA 4ND6A 5A62A 1H6DA 1X7ZB 4NBUA 1HL3A 3HCDA 4JT2A 4B4UA 3FVVA 3WGUA 1XRSB 2Z8YM 3B5JA 2EZTA 5EIBC 1JB9A 5FLEX 4BY9E 4EHIA 4YLYA 3UK0A 1IAQA 3LDFA 2XF2A 4J7UA 5ALEA 2V7GA 1QX3A 1XN4A 3DOHA 1P2TA 5IU6A 3NVKI 2P1ZA 3U0VA 1J09A 3ILHA 2QJWA 5CT8A 1I3MA 1F17A 2H5JA 5AKHA 5AM2A 1QO0D 1MAVA 1R2QA 1TEHA 3C41J 1CQXA 3FPEA 3ZCPA 4KN8A 3MEQA 3NTUA 4XYGA 2IYAA 3H5RA 4MVJP 5CDUA 2TSYB 4XFDA 4P38A 3C8MA 3LL7A 5EZYA 1P9OA 3B7WA 5CVVA 2W0SA 3IP7A 3MINB 3HFGA 4KRXA 4RW0A 4MW2A 2ZUSA 2QN7A 1UAYA 3T5CA 1E18A 3FDZA 1S8AA 4MTCA 4WN3A 5AVUA 4CKXA 3NAGA 4MAFA 3D2CA 1AXEA 3A3KA 3AESB 3I1YA 3NYWA 4R9NA 5ALSA 3VM6A 2HDWA 4NH4A 2XMRA 2H18A 3HVKA 4ZT7A 4C1NA 3UK2A 5A9SB 3KWMA 5JCZA 1P1RA 4JODA 2OESA 3FGNA 4UDOA 5D00A 3TZQA 5HIIA 1KVTA 4H0NA 2R4TA 2EHJA 3CLRD 1GDHA 1ZA2A 5TGZA 1TF2A 5ALWA 2JEOA 2PUWA 3SSAA 4HDKA 3MG9A 2Q5FA 1E98A 3BDIA 4M36A 4GVPA 5C1BA 1IM8A 4O8CA 4L07A 2QP9X 3RFXA 1H4TA 4I19A 4HPWA 2RH9B 2E5FA 1Q84A 1KH1A 1CDDA 4V3BA 3OQMA 4CNQA 2FX3A 3CRMA 3U4IA 4YDRA 3GGCA 4LY6A 1BA3A 3DEZA 1A98A 3EN0A 3G68A 4D3DA 1NT2A 5FOWA 1VCNA 5EVCA 3R6DA 4ZZ1A 2HRRA 1VB3A 2ATXA 2GZSA 2W2KA 4QJBA 3IQGX 3R7NA 4EJMA 3BJZA 4Z1OA 4ZDKA 1L2TA 3DXYA 2QYSA 4KVAA 2V7QD 3EQ2A 4QARA 1R8XA 1QOQB 1CUXA 4RKWA 1IJEA 1L7DA 3F46A 4E5VA 5SYAA 2GEKA 2ZYSA 4A73A 1NJ8A 3AZOA 2W2LD 3QLUA 2CYCA 1PL0A 1X1RA 3F7NA 1GUYA 1R0KA 5BSVA 2XQKA 1CS0A 1FU4A 4MV6A 3CF4G 2F90A 2YX1A 2GSWA 3EXHC 1PLLA 3IXLA 4BBPA 3NT5A 4EA9A 1OA1A 4DXDA 1YQ9A 2WWRA 3CNNA 3IDSA 5JZVA 1NP3A 3MRSA 3O84A 3KHSA 4TV9A 3U3ZA 4PZZA 2WICA 5IUJC 1WB4A 1Q1QA 2OFPA 3AJ9A 3MTAA 1KKUA 1ODSA 3ET5A 4OH7A 4RMHA 4BTVA 1W36D 4RTRA 1JT9A 3NKFA 3ZDBA 1ZNZA 4IIEA 1UZLA 3A1EA 3K9CA 4N3GA 5D7NA 3KWLA 2JFHA 1U2PA 4S35A 3OH8A 5EY5B 2FETA 5HCUA 4QXPA 2K2WA 5JXGA 4XVQA 1QFJA 2PKEA 4IJ6A 2FRXA 1FFHA 3A9UA 4JX8A 2FQYA 4LVOA 3HA3A 1BIFA 4A5SA 4MB6A 4HXFB 3S29A 1N6KA 2BMAA 1Q0QA 2E6UX 1GR0A 2HQBA 3L1HA 4IJQA 3WMRA 5A4IS 5BV2P 3FF1A 1TVMA 1QR6A 4M8NE 2PGNA 2ZIEA 3W2EA 4DQVA 3OQIA 5DYGA 5I47A 3J80A 1INLA 1ODKA 4Q01A 5D2CA 3THYA 1T4DA 3A4YA 2BTOA 2GN8A 4FMCF 4G9GA 1VC2A 4FNAA 4UZSA 3U3XA 1XDGA 4CFYA 3GLGB 2AIRA 4C1BA 3CPEA 3EGIA 4IGIA 3II6X 3W8EA 4E32A 3DL0A 1R27A 3E82A 3GV0A 4QYMA 3D2LA 3MMZA 1L4UA 2OB1A 2P0EA 5GOTA 4GLOA 1N0IA 1FTWA 3HDJA 2C59A 5F7OA 4U0JA 1GGJA 4B71A 1IEVA 2XUAA 2FEMA 1OQAA 3PFWO 1R12A 3H18A 3OP1A 4IF6A 4QOSA 2JL1A 1SQFA 3QMWA 2E4WA 2I8CA 4BNVA 1BKSB 1UR5A 3K0AA 1GUDA 1DO2A 1Z0AA 1GRCA 2P7IA 4BUJA 1E0JA 5IXSA 1HNNA 3PA8A 2PZFA 1H1DA 3QEMA 1J2RA 2X6TA 3DUWA 1EWVA 2NYAA 2OKCA 3FNRA 3G0CA 3JQAB 4C05A 4E5PA 1DBQA 1O6ZA 1P7CA 2VTDA 3IMKA 1U0SY 4HTAA 3RUEA 2QM8A 4GWGA 4BTEA 2IYRA 3UM9A 2H9YA 2P62A 1P2FA 1Z2NX 5IKXA 1K6EA 1TF5A 3OIYA 3E7DA 2JFOA 3LYUA 2QS9A 4NBNA 3R3JA 2Q07A 4Q1EA 4XOUA 1CR1A 3KZ1E 4F5EA 4Q7EA 4Z9FA 5AJWA 4FT4A 4EMSA 1FQJA 2J0VA 4Z1MD 4WZZA 5JJIA 2EZ4A 1MC4A 3UT6A 3QVGA 2N1BA 5IFKA 1M2GA 2X3YA 2AMLA 4N1AA 4MRPA 4P3XA 3CEJA 1U2EA 5AI6A 3VJKA 3WIBA 3S2SA 1IZ8A 2HRCA 4NNOA 1NE7A 3R9KA 3TMYA 4MI9A 4Y67A 3RSOA 2CXXA 3H5WA 4BO7A 1LWNA 1EGVB 5BVHB 4KQMA 1EVLA 4C08A 3U31A 4PLCA 4KBFA 1AZLA 5J5CA 1N78A 2FMUA 1Y98A 5C37A 4RVSA 4IHJB 2NU7B 4QOFA 2VBFA 2NVUB 2Z1NA 2J09A 5AKZA 2JGRA 4X95A 5JG7A 5LIPA 3V9PA 1V71A 4FDMA 3T5TA 3VVMA 1FDTA 1DJMA 1NFFA 5BQXA 2NGRA 4KAXA 5AK6A 1P72A 1IZYA 4O5AA 5F51A 4X66B 2IYFA 4QNMA 1B93A 1UWVA 3V7FA 4LHYA 2CLDX 4L76A 1HT1E 4BQNA 1D5WA 1QGDA 2FUKA 3TLCA 4LSGA 5ED0A 3OI7A 1IUKA 3IAXA 3UKJA 3UOGA 4EYOA 2CFIA 1U0RA 3ZHOA 4JR2A 1JHAA 2IH4A 2CE7A 1CVLA 3FLEA 3KSAC 2UUAB 3G0DA 5K8JB 3EEOA 1XAJA 2V5VA 4B3JA 5FH9A 2JARA 3FCUB 1JR2A 3AW8A 3F97A 4L0QA 1NP6A 3N75A 1Q7RA 3JD0A 4V38A 4V39A 5CT4A 2FUCA 6YASA 3ZYCA 1W35A 1P73A 3PSAA 3VTFA 3O7WA 2VDVE 2V8BA 3R77A 3ZTTA 2F1RA 1T2UA 1FZTA 2UU9B 2X0NA 1I2ZA 4ON9A 2M6SA 3U4AA 3AUAA 5AI8A 4C2BA 3OA0A 5H02A 1DC6A 2QN1A 3DLBA 1P62B 1FJXA 3IQWA 2BEWB 3QBTA 1DQPA 1U1FA 1XZQA 3AJRA 4QLBA 5GOZA 1JEDA 1L4KA 1YJBA 1FK8A 1ZMXA 1NN3A 2AA3A 4UU1A 1K98A 3ZCVA 5EWLA 4DMRA 5DGXA 3O0TA 5IDQA 1GUBA 3B1YA 3NHSA 4XIFA 3UOAB 3UXMA 1DBRA 2LCIA 5LQUA 2VAPA 3CF4A 1G8PA 3W2IA 3U5ZB 3RVQA 1NDHA 1J5EB 1I13A 2FWBA 3JZAA 3TRHA 2IZ1A 1QJCA 2FMFA 4KFSA 4KSYA 4MWCA 3WHPA 1KDRA 3CVJA 1Y5IA 1Z7EA 2P5SA 1UC8A 4RTLA 3GNTA 1R6XA 4MPPA 1NLUA 3H3JA 3N59A 2XUDA 2W11A 1SN7A 2H2DA 4A23A 1BROA 2NO1A 5ENZA 1VKOA 2F7SA 4C04A 4CKWB 3PHBE 2WINI 3PQCA 3TZKA 1KI9A 1W85A 2C4UA 3LUAA 5IG2A 1ISJA 1L5QA 3FUXA 3L6DA 3DR5A 1GZ4A 2FTKE 2VF2A 3STWA 4ZYZA 5K6AC 5CH3A 1MNAA 1FUEA 5DPMA 2C58A 3O8NA 4X94A 5HJ2A 1M3SA 3JQCA 4U7WA 3WHLA 4BLOA 1HDEA 1H1TA 5HEKA 4HB0A 1QRUA 1YULA 2F4NA 2JIRA 4XARA 4EHHA 4I66A 4OAOA 3GNSA 3G89A 3ZDZB 2CHVA 1NQWA 5ARDA 4ZXFA 2NPFA 3UJ8A 3ILYA 2GLTA 5EJ9A 1MB3A 2O07A 3FX2A 1W4LA 3OAAD 4H77A 4MVJI 1Z2EA 4PQGA 5EJGA 2FZLA 1SPBS 2PO7A 1SULA 5KYGA 4CLHA 3WDMA 2DSTA 2FPGA 5GM1A 4ASUA 1OLXA 2I7VA 3FN4A 4JT9A 4QPZA 4WBNA 4P31A 3QTLA 3LUCA 1Z4LA 5B30A 5DBIA 2G1JA 3KZNA 3CBQA 1J23A 2ODAA 4YEDA 3PPWA 5FIUA 2WWXA 3BQNB 4FM9A 4ZI3A 1O5OA 1HG1A 1F0PA 1V3UA 1XHLA 3F5QA 3VR5A 4DIDA 5HJEA 4X41A 2Z5LA 3E1KA 3EF3A 1IXZA 2IHBA 4DN6A 1M7BA 4BQIA 3FNFA 4IIYA 2Q5OA 2D5BA 2F1OA 3DE4X 2ZRDA 4KPUB 5L40A 2CWWA 3H6KA 1Y5NA 3EW9A 1P3DA 5LYJF 1UAGA 2ZI3A 1XVUA 1ZP6A 2ZTLA 4UAVA 1SZDA 3TIIA 5I01A 4NV0A 2NPOA 5DNCA 5A6SB 4YFVA 5DBEX 2EP8A 4YACA 1GCAA 3NW9A 2DHCA 3AJEA 4UUBA 4HYYA 2GN2A 3AEUA 5D1NA 4JH0A 4L8WB 3S4YA 3UAXA 3U9LA 4DDWA 2C9MA 1AS0A 2AG6A 1BEUB 1E2UA 1Z63A 2OVBA 4K5QA 3K9WA 4OH1A 3M0EA 1X8LA 1WXIA 1E60A 2XNJA 3L8YA 1L5WA 3AJ8A 3D6UA 3OEWA 2N47A 4Q1VA 2JBAB 4RC9A 4YRPA 2PKCA 3Q11A 4BLPA 5CBPA 3ZD7A 3LV8A 4BMCA 2QHXA 4F6LA 2HQRA 2DCUA 4MQ6A 2Z6AA 1D03A 2GHQA 3MIIA 1G8AA 7MHTA 1CV2A 5IJ9A 1K86A 2ADOA 4A36A 3KXLA 1QU2A 3GAZA 2ESRA 4CGYA 1QE3A 2CBGA 4RY0A 4TN1A 1VG1A 2WFMA 2I7CA 3FA2A 3O4HA 4AO6A 4ZK6A 5I8WA 1L1FA 2JFZA 1GLNA 4DCGA 2WHQA 3F3SA 1MO6A 4C21A 5KVVA 2J59A 3BKWA 3D3KA 2OAP1 1DEOA 1JSRA 2PXHA 3QX8A 1MB2A 4YAEA 5EERA 3NX4A 2XMGA 3AERA 1A5SB 4GZ6A 4A8JB 4EB3A 2VHCA 1TLFA 4YP9A 1JHQA 2NVBA 3LYHA 1R4MB 2CL6X 2PWPA 5C31A 5CHYA 1WD5A 2A86A 3N74A 2HWWA 1IEWA 2Q5QA 4J7AA 1V11A 4ZRDA 2Y05A 1ZM3A 1F4LA 5FV7A 1UP4A 1KEPA 3JPWA 3AU8A 1M2KA 2OXEA 3DHVA 4F8YA 1WS6A 2OP0A 3B6IA 5DISB 2X9NA 4Q9KA 3RYFB 4GWLA 1YA6A 5K8UA 3K6RA 4BNIA 1V8ZA 1YVDA 4B75A 5BR4A 1XRRA 2FG7C 4K26A 3F1KA 3I12A 3IB6A 2DBYA 1Q1EA 5ADUS 2QSUA 4JLOA 3GJ8A 3EH2A 1YE3A 5CJ2A 3TG2A 1F14A 3PWTA 1VSBA 2EG5A 4RH3A 1V4BA 3SIXA 4ARSA 3LMKA 1P0MA 4FEGA 1KS9A 1QIHA 1YZYA 3W5JA 3OU7A 2HK8A 3HEMA 3WP0A 3CWCA 4RDHA 1WETA 3ZKWB 1FNCA 3WLHA 4BNTA 4NMWA 4C76A 4CF7A 1N6PA 2J9YB 4PCLA 4BX8A 3FBWA 1VXRA 3I32A 4Q00A 1WOYA 5CX1B 1WXWA 2VHEA 1KVSA 2ZQZA 1A7KA 4JI0B 1FMCA 2WJIA 2DFPA 1L7RA 1N5RA 3P9NA 2HU8A 3CHYA 1LSSA 3W9UA 1VSVA 2HV9A 5JMPA 1GUAA 2OCDA 4KE7A 4YI5A 4DR6B 1E4YA 3D0RA 4BQSA 1ZU4A 1XA0A 1ZOLA 3PEEA 2CBXA 1B6RA 1UUFA 1W47A 3S2ZA 4O4JF 4R2JA 1GAEO 2ZRKA 2H8GA 5KNBH 3KKLA 1EWRA 2EVWX 1EEHA 3AUXA 4QJIA 3ZV7A 1JH9A 4TZ6A 5EHQA 3CXRA 3QEOA 4XTRA 4AJLA 3AEQA 2R1TA 1LFAA 2ZUWA 4DY6A 5FYQA 2HOQA 1FEZA 5A04A 1FBNA 2OHHA 2Z3VA 2ZWMA 3U7RA 4Q12A 3VA7A 3R7DA 4LXXA 4XIIA 3CVVA 3UG6A 3ESYA 4XWOA 2AR0A 4KR6A 3R1IA 2ACKA 4OPMA 1Z7BA 3SC3A 3U7FB 1UINA 1N4DA 2D2EA 4LRXA 4QUEA 4WA7A 2P9JA 1Y8ZA 1NPYA 2IF0A 3IIJA 1P44A 3HUEA 4IHAA 2Q9AA 1X86B 4KW7A 4M9QA 4YT2A 3CR3C 3U1TA 2H57A 3K09A 3PC4A 5IYZA 4FFVA 1RBQA 3HR4A 1NWHA 3HCNA 1ZHHA 1VJ5A 2GM5A 4LZZA 4RK6A 4PHGA 1VLMA 2PXCA 3TDNA 1YAHA 2YCBA 5BNTA 2JLUA 4RWEA 3GCXA 5DLDA 2PNJA 1IHXA 3NH6A 4Y9SA 3V4FA 2O14A 4H08A 4JU9A 4TSRA 5CB8A 1G5HA 1H0HA 3BFKA 1IG0A 3D8TA 5KNCH 5F5LA 4EJSA 5GV8A 4E0BA 2RGWA 2FZ5A 4PNEA 5CJJA 3LBAA 5EWJB 1XU9A 4IG9A 2SICE 3LT4A 4FBGA 2UDPA 4FB4A 1G38A 1RRGA 1CT9A 1KSFX 2CC2A 1OX4B 1R4NA 3JAKB 4LCJA 3FWPA 3W4JA 2XI4A 2EKBA 1J49A 2P1RA 3CIOA 3S5UA 4DA6A 3QSGA 2PGDA 3X43A 2PX2A 1IBKB 4OX9Y 2X8AA 4EHKA 2I1VB 1AHIA 1G3QA 1K7YA 4OATA 1TQ6A 3SC6A 3JALA 1M6EX 4QRDA 5F64A 3CW2A 1ZQ1A 3IESA 4FQ7A 4LWOA 4OO3A 4RS3A 5EPEA 2UXBB 3THRA 5DYNA 3L0ZA 2VEDA 1Z28A 1F1BA 4WTOA 1YS6A 1ABBA 4HN9A 2CV2A 3D81A 1UKVY 3CX8A 1EUDB 4G1CA 4MKGA 1VBKA 2F9LA 3EVZA 5J2TF 3ASYA 3R7LA 3RUDA 1M6VB 5KU7A 5F2NA 1WEKA 1TADA 4WJKB 4EFNA 4FHEA 4UTNA 4MR7A 4JBWA 1T35A 2HSJA 1DAFA 1DJLA 2LP4Y 4V02A 4BO5A 5ADHA 1PVDA 1T36B 1PI3A 3M1LA 1G7RA 2XE6A 4NFYA 3FJYA 4AICA 4GLLA 3CKMA 4P84A 3KXKA 1IULA 3Q3GE 4TLDA 4RD6A 4YRBA 3RTGA 2ZB3A 2EX0A 4F5WA 2XNDA 4AJJA 4LXQA 4JLNA 3AEYA 4YUWA 5INTA 4J16C 3RKRA 2R00C 1JWLA 4JP2A 3FNIA 1ONSA 5EUCA 3RANA 2G1UA 3QW4B 3SHOA 2Q46A 2ZRNA 3BXEA 3U3OA 5CB0A 5L8VA 3HVHA 2YVQA 4QQ8A 5HFAA 4FDVA 2JAWA 1DX9A 2EC5A 4ZQBA 3D9QX 5TJHA 3EOAI 4BNDB 1E9FA 2YQ5A 1EX7A 4HZUA 3WRWA 5DTIA 4HTFB 5DTEA 4KH0A 2XMSA 1E3JA 1DKMA 1O57A 4E13A 4QQRA 4A6EA 5J23A 3EBOA 3MLBA 5HUHA 5AHRA 3BA6A 4F4DA 1C9NA 1W36C 2R5WA 3I64A 3LLMA 5IH3A 4DIMA 1KFKB 4HGNA 2P41A 2VJPA 4IZ6A 3I0MA 4MQMA 4U5XA 4TLMB 5EFZA 4B8YA 3T5MA 5KO2A 3KLPX 1AGNA 2PAAA 3PV0A 1V6SA 2WV7A 4P3KA 4QU0A 3VR6A 2EQ5A 3QFSA 5I8ZA 1ZRNA 2VT7A 2Y1CA 4FCCA 1DJOA 2J7KA 2PTGA 3CRZA 4WLNA 4F12A 4OHXA 4UVGA 4E09A 2OCGA 4IPTA 2VJMA 4TTRA 5D3MA 5A03A 5JYCA 3MTDA 5FF9A 2JFYA 3AHIA 4L73A 3SZMA 1KDPA 1USGA 4FDUA 4Q18A 1AOXA 5KBYA 2IEYA 5H7XA 1LH0A 2W0MA 2XUHA 4R4JA 3UC5A 4ICIA 3TOSA 3QVVA 4HQFA 3V8RA 2QMOA 1PR9A 4I4TF 5D86A 1ZXLA 5CB6A 3WLRA 2FSVA 2CY0A 4GKAA 5HE9A 3FDXA 4CMEC 1UM8A 3INNA 4OIFA 3W77A 4I55B 5HCNA 4JLBA 3JQBA 3HNPA 5K2MA 4OHBA 3EC2A 5KVQA 4A6DA 9ATCA 1XPUA 2J6HA 3WKDA 1OU0A 2FE4A 1E7RA 3SJZA 5CDGA 5JS8A 3ECAA 5F98A 1E9BA 4XD7D 3GJ5A 4G07A 4Z51A 2XOKD 3SFVA 5E6UA 3SF8B 5TC4A 5K8IA 3UCXA 3F8SA 3WA6A 2Y92A 2XWPA 2BFFB 2OQVA 2WG1A 3DFIA 4P3PA 3GLSA 2WMDA 4HO1X 2BMDA 2OLEA 4QBGB