2FV8A

The crystal structure of rhob in the gdp-bound state
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
187
structure length
180
Chain Sequence
YFQSMIRKKLVVVGDGACGKTCLLIVFSKDEFPFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQKRYGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rho-related GTP-binding protein RhoB
publication title The crystal structure of RhoB in the GDP-bound state
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 61
structure length 180
sequence length 187
ec nomenclature
pdb deposition date 2006-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2fv8A00
3E5HA 4B2IA 3AP3A 2OBMA 3CRW1 2NTYC 4DEYA 1EXMA 1ZM7A 4Q7KA 5JI3E 2ZPTX 1XTRA 1GRQA 3VU9A 4CEHB 2QBYA 4D80A 5H1YA 2YOHA 1Y63A 3AV0B 1LTQA 3ZD6A 3K1JA 1NJFA 3EZ6A 4RD1A 1G21E 1Z2CA 1F5NA 1Q1BA 1Q3TA 3DEFA 2AR7A 3UKDA 5DI9A 1T0JB 4JLJA 4LI0A 1RRGA 1Q3HA 4QHSA 4P4TA 4OJQA 3FFAA 1ZRHA 1IOZA 1BS1A 2FZLA 2VQSA 3WHKA 4ESHA 2ZE5A 1CR4A 3QG5A 3QY0A 3CRRA 4QRHA 2PLFA 2R44A 5JECA 4GDFA 3GJ6A 5KTYA 5EUMA 1YR8A 3TMKA 3GJ7A 1IM2A 3HR7A 1DG1G 3KXKA 2ZJ5A 2VYFA 1CF4A 1FX0A 1UADA 1G5TA 1YE8A 3H2YA 3VX3A 5HKKD 4PHFA 1N5LA 4C4PA 4PHTA 2W6IA 3RDPA 1N0UA 3SYLA 3TW4A 3PXGA 1E32A 3CKLA 5J4LA 2ZRNA 4Q4HA 3Q5DA 3TLXA 2KSQA 2PCLA 4AWXA 2ZI7A 2X2FA 4E03A 1R5OA 2BBTA 3ZQJA 1ZD1A 4Y0AA 2ZUCA 5CJ2A 1HE1C 4UXJA 3SI7A 4OKSA 4QGAA 2O8CB 2IXEA 4BFTA 1QZXA 1HEIA 3IIMA 3OEHA 4Q4AA 4W5JA 5JS7A 3GLIE 1JBKA 1OIVA 3QXHA 4QJ3A 4DSTA 3SDZA 3ZDQA 2YYZA 2V8OA 3X2SA 1AN0A 4R2IA 1M7HA 3X1DA 4JS0A 5JHHB 4H1VA 4QC2A 1S1MA 1GOTA 4S35A 4BQSA 2JJ1A 2EYUA 3NH6A 4IEIA 4ARZA 3CPJB 2BM1A 5F3WB 3LXRA 621PA 2ZRLA 5DLQC 3CB4A 1SVKA 3FKSD 3GEEA 4LJ8A 2Q9CA 4DLTA 4C0HA 4CEIA 4KLNA 4A4DA 2J0QA 1E2HA 3NH9A 3HR8A 4Q9JA 4CGZA 4LC1A 4C9BA 3GCGA 1F60A 4FW9A 3KQKA 4URVR 3J81k 2GK6A 4LYAA 3AM1A 4HAXA 3SQWA 4IEEA 5HE8A 1WB9A 4GP7A 4BLQA 2CCJA 3ADDA 5AUOB 5IF9A 5FPHA 2VEDA 4MGIR 2ZRHA 4N1AA 4A36A 2FH5B 3QKTA 4P4SB 1KKLA 4D26A 1R0XA 4WZ6A 1ZJ6A 4MH0R 3U7FB 1N6IA 3T5DA 4MRPA 4D0NA 4ZDKA 4URXR 4LYHA 2LKDA 2IWHA 3NBZC 2X1VA 2I4IA 4WAUA 2JIZD 2ZRCA 1QHHB 5H8WA 2DFLA 3GLFE 3WBJA 2ERYA 3R8FA 4A82A 3PEUA 4A1FA 1PUIA 5BYKA 3BIFA 4O25A 3BFVA 3LVRE 4I81A 1OPXA 1TQ6A 3GFOA 4DLWA 2XGJA 1I2MA 3NBYC 2ZXUA 2VPPA 4OHVA 2CCGA 3E70C 4DB2A 2XNDD 4NBSA 2IA5A 4EQ6B 3W6NA 1GTVA 3ICEA 1E69A 3O47A 4XJXA 2CHVA 1CJVC 1CRQA 1KAOA 3U3JA 2GKSA 4FCTA 1GILA 3F8TA 2ZSBA 4CDGA 1GG2A 3V4RA 4RZUA 5FBVB 4OK3A 4PAMA 1F6BA 3VR3A 4DIDA 4XSGA 1XEWX 1ZM9A 1RW4A 4NKRA 4LPSA 2IL1A 2ZI5A 1G291 4LV8B 3AVUA 1XPRA 4RY2A 2W58A 4B34A 1XTSA 3PUWA 3LQQA 3TR5A 5CDFE 1E79A 3QXSA 4R2HA 5B57C 3PEWA 1P2SA 1W4RA 1ZMXA 3LW8A 4Z8YA 3JZAA 1P6XA 3UPUA 1JR3D 4DVGA 4M1YA 4PSVA 2WSMA 2PT7A 3FTQA 1ETUA 1Z22A 1KSGA 4LSGA 1UKVY 2ZR9A 1V43A 2NPFA 2KB0A 4DHEA 3PEYA 1VTKA 1TU3A 1D5CA 3G5UA 3N70A 1G20E 2EW1A 2DY1A 3QXCA 1QF9A 5KDDA 3U44A 1Z63A 1JAIA 3A6PC 1Q1ZA 5J40A 4HLUA 5FOVA 1ZC4A 2ATXA 2W6JA 5KPJA 2JJ2D 2O8BA 3SFZA 4FMDB 2XZLA 4PHGA 1G5PA 3Q8XB 2AL7A 4LJ9A 3WMEA 2VHTA 3MG9A 4B6EA 4ZDJA 1E2QA 3CNNA 1M7GA 3UK6A 2XSZD 3G0HA 3UMRA 5AUQA 5AJYA 1T3HA 4M22A 4PSKA 2VP2A 2QZ4A 1T8TA 3KXLA 4GZLA 2QBYB 5K8IA 3B9QA 3FFBA 3WY9A 2Q21A 4KI0A 1KKMA 3GP8A 1AJEA 2GCPA 1EFUA 4E5UA 4AKHA 4AYTA 4BFVA 1S0UA 5B64A 1F2UA 1ZNZA 4QBIA 2ONJA 4EAQA 1SVMA 1MOZA 2WPDD 4BPBA 3FDIA 5EP1A 1XMVA 4URUR 4MDFA 5FPKA 3ZZ0A 3MSXA 3THXA 4Q7JB 4X8OA 1EGAA 1IN7A 1ZUIA 4I1OA 3VR6A 1XDBA 4FN5A 3K0SA 1ZC3A 3MCAA 1KO4A 2QI9C 4KODA 4P32A 3NXSA 3O8RA 4Z1MA 3CIOA 3CW2A 1U99A 2ZYVX 3TIFA 4URWR 2WKQA 5LD2B 5JCPA 2ZEJA 1W36B 2ZRIA 4PC3A 4RSGA 1KI3A 2J0UA 1DVRA 2Z0MA 2OCAA 2WJGA 1FX0B 2XOKA 1HYQA 1QDEA 1JEDA 1FTSA 2GK7A 1QRAA 4BECA 1YU9A 1FNMA 4OL0A 1KI8A 1YZQA 4EUNA 2D74A 4MRRA 3BB1A 3RAPR 4PSAA 4AKEA 1T4GA 4DKXA 2ZYUX 3C14C 1H65A 2WIAA 3AVXA 1N3BA 1OT3A 2CBZA 2RGNC 4Q4AB 3NC0C 3C5CA 5B2ZA 4ABYA 4CEJB 2D62A 4M0LA 3W8NA 3BBPA 4HDOB 4TL9A 3ZJYA 1NBME 3WNDA 3L43A 1NN5A 2G88A 5FTJA 3C8UA 4FINA 3AH8A 1RE0A 3AB3A 1G8YA 1B0UA 3H0KA 4P33A 2C04A 4TYWA 4QBFA 4ARZB 1TQ2A 4TMTA 3IIJA 4PHHA 3VNUA 3AUYA 3KKMA 4OI2A 4CW7A 1N2CE 3HYRA 1TX4B 5JEEA 4TT3A 4OQNA 1XXHA 3P4YA 1M8PA 2X19A 5BN3A 2WKPA 4JLVA 3W6PA 2QORA 4B3GA 3DZ8A 4JL6A 3IBYA 2RGAA 2WM9B 3L8ZA 4QNRA 2XJ9A 4FXPA 3SS8A 2WOOA 4DCVA 3EASA 2GCOA 1G16A 1MKYA 1KJYA 2W0SA 3DOFA 3Q7PA 2QRZA 5AWFC 3SHWA 3QI2A 1A4RA 4NCJA 3N2IA 2PMDA 3B1VA 2CL6X 3SJZA 1HV8A 4HATA 3CF2A 2ZJAA 1RRCA 1W1WA 1QHGA 2V9PA 4D82A 1R0ZA 4DLYA 2O8DA 3TUIC 1SHKA 2B21A 2CHQA 2ZUBA 4Q18A 5K8TA 4MRSA 1N6HA 4GNKA 3FHOA 3SBEA 2CL7X 2OV2A 4C2TA 4NL4H 4Q1BA 1VPLA 4GPTA 4GMDA 2IXGA 4FWTA 3P27A 1IXSB 4PZZA 2H17A 5FL3A 2JLXA 5SZIA 1U0LA 1R7RA 4LJ5A 3FMIA 3RS0A 1E96A 1XCGB 1IN4A 3IPYA 1U90A 2B7CA 2J7PA 2YWFA 4JVSB 3NDPA 1II9A 1U8ZA 3MLEA 4YMUA 5JRJA 4UNPA 5FR2A 3UATA 1IONA 5JBQA 4PPQA 1ZM4A 1HH4A 2Z4RA 1KO8A 1DAHA 1TTTA 4A0GA 4IXMA 1SXJA 1XZPA 2V55B 2ZJ8A 3LW7A 4QJ5A 4D4JA 4DDTA 1IAQA 4DXAA 4LJ7A 1XWIA 2ZREA 2GF9A 2GETA 5SZHB 2ERXA 5KPDA 1OJLA 3BGWA 2RGCA 4DWJA 3B9PA 4QM6A 1W4BA 2KE5A 3BH0A 3LLUA 4NDZA 2BBSA 1M1YE 2P5TB 3B82A 2W6ID 3MJRA 2FNAA 4Q00A 1ZM3A 2P6UA 3GJXC 4RFSA 4YMWA 5EE1A 4PO8A 1BOFA 2FU5C 4WOPA 3ZQ6A 3SJBA 3AF0A 5EZ6B 5FOSA 2BBWA 1XEXA 3W9YA 2HXYA 2VBCA 4IVRA 4KFUA 4KU4A 3TW8B 1KI7A 4B43A 1P2TA 3OEHD 2XB2A 4CRWB 4TN1A 3QEJA 3LO5A 1YZKA 3U44B 4DEXA 2PZGA 5E95A 4ZIRA 1N25A 2ZR7A 2C9YA 4AK9A 1KI4A 1OH7A 1N0VC 4DUGA 3GLGE 2JJ1D 4PANA 2DWPA 3RS3A 2O8BB 2PZEA 4BRUA 2ZI6A 3OE7D 2WJJA 3OIVA 2B6HA 4JVLA 4P3YA 1W46A 5JJLA 1KNQA 4BE7B 1E1QA 5JI2E 4A6XA 2QG6A 1N6OA 2CK3A 3MWYW 4B75A 3HPQA 3GD7A 5EE0A 1T91A 1SQ5A 1YZGA 3A1UA 3TUJC 5A4JA 121PA 1G6HA 3K0AA 4BWYA 4CT4B 1E2DA 5CYPA 1BMFA 2MMGA 2H16A 2XNDA 4M1WA 4C2UA 4K8OA 1G3IA 2PEYA 1S96A 3EARA 3IILA 4UXHA 1EG7A 4QNMA 5C1BA 4KSCA 1TL7C 5FTNA 2TMKA 2NO6A 3MUFA 1Z5ZA 1N6NA 4BZPA 4ZKEA 1N5KA 2JA1A 2R6AA 3KX2A 1AM4D 1G64A 5GJBA 3OFND 2GILA 2B8TA 3THXB 2ZS9A 3DHWC 2A78A 1UKYA 4AD8A 2GAAA 4JBWA 4PPFA 1XRJA 3I32A 2QE7A 1KMQA 4AKIA 3IO5A 4D81A 3EPKA 3LVQE 5D3MB 2X8AA 2KJQA 1RYHA 1O3YA 1P75A 3GFTA 2F3TA 4W5HA 4LHXA 1OYYA 1RJ9B 1S9DA 1ZYUA 1K6MA 4HLUC 4XVQA 4DLZA 3U4QB 1L4YA 1IY2A 2QQ0A 4C0KA 5HE9A 3L8YA 3OF5A 1LY1A 2AN9A 4TYQA 2DB3A 1W5TA 2KWIA 5AR1A 3E1SA 3AKEA 4LV6A 1DAIA 2YWEA 4PO1A 4TZ0A 1N6PA 1US8A 3Q9LA 5GJWC 5SZJA 4M9XA 5GJVC 4PTLA 1VDZA 4DCTA 2ZJBA 3IEVA 5FBQB 2GJAA 2JLWA 1ZNWA 3ADKA 3MD0A 1IHUA 3TH5A 2FPMA 1Z0AA 2UZ3A 2VRWA 4Q7LA 3EZ7A 3F3YA 1BYIA 1A2BA 3U60B 3CF0A 1WBBA 4GOXA 1E79D 1KDPA 2W2XA 3EIQA 2XTMA 1OW3B 4Q66C 2X2EA 1VCNA 1H8HA 1EFRA 4KFTA 1IXRC 3SR0A 5KHOC 1NVXQ 5BQ5A 1NL3A 2V54A 2YINC 3U7HB 4K46A 3ZS8A 2O52A 1CJMA 1XXHB 3VR5A 4WXRA 2HT6A 2NZ8A 2BMDA 1KZ7B 3BAFA 1TQDA 2GWHA 1Z0JA 5A5GA 5KSOA 4U7DA 4IDHA 5JSZA 1J8YF 3W3AA 4KXFB 4WW0A 3V00A 5C18A 1NMYA 2RKOA 2HXSA 1WA5A 2Q6TA 4JSYA 2NZJA 5TB5A 3O8CA 3PQCA 1Z83A 5CIQA 4B6FA 1YZNA 1P73A 1X86B 2W6JD 3ECCA 3WMGA 1MRSA 1Z6XA 2FSFA 1OKKD 1N6RA 2F9LA 2VP6A 4QGFA 4ZCIA 3AVVA 2O8DB 4HB2A 2F1IA 1DARA 4DDUA 5KUTA 1E3MA 3MAAC 3GLIA 4D25A 4TQ9A 1MO4A 1J70A 2Q0HA 3AQ4A 2OCBA 4B3DA 3P20A 3T35A 1FFHA 2CEAA 2YZ2A 4IDNA 3JZMA 4KJZA 1WCV1 2G77B 1OH8A 2W83A 2QM7A 1G5RA 1LS1A 1WF3A 2IYUA 4BFXA 3FMFA 2PBRA 4PC6A 4BUJA 4A8JB 2K5UA 3C15C 3QVVA 5KSPA 2NPIA 2YV5A 4K81B 1C4OA 2WKRA 4TLEA 2BEJA 4PQFA 1MT0A 2C78A 3KUCA 4DZZA 1Z0DA 2WTUA 4V0KA 1TEXA 3WP1B 1GNPA 1CR1A 1W2HA 5LBIA 1E9FA 4CT5A 2DWQA 2ZAMA 4AURA 4XWKA 4ESVA 2AD1A 2G6BA 5IK2A 3QKUA 1MO3A 5UKDA 5JRZA 1DTSA 4Z1MD 2FZ4A 2KBEA 1FP7A 2NOAA 3OIWA 1IXZA 1S4QA 1GL6A 4WVFA 4B71A 5E7IA 4IXNA 2RGBA 3KKNA 1JXOA 2FFBA 1QVAA 2XOKD 3NVAA 2C95A 2IYQA 2C9OA 2WOJA 2ZIAA 3AKCA 5HCNA 1X6VA 2O0HA 3OEEA 2RGEA 2JCSA 2HT1A 1NIJA 4ZI2A 3GLFA 1CTQA 2VP0A 1FMJA 1KY3A 1XEXB 2VP9A 4HI0E 2QROA 3QKRA 2PH1A 1G7TA 2D3WA 2R2AA 1WRBA 1LF0A 1E2NA 1YQTA 2VP5A 5F9HA 4MUAA 1R0YA 4DLUA 4OQXA 3X1ZA 5J4YA 3QXXA 4OJKA 5JFGA 3AKYA 2ZSAA 2R62A 3QF4A 3TNFA 4ZIRB 1G7CA 5DISB 3NBXX 3VR2A 1Q21A 2J1LA 4IOJA 3FHTA 5FBRB 1JALA 5H68A 3RYTC 1KIMA 2FSHA 2GVDC 2CDNA 4GMXA 2WJYA 3EPLA 1G3MA 3IIKA 1RYFA 4GOJA 4FMCB 1TPZA 3H86A 1NN3A 2HYDA 4MYHA 4TT3D 1E0SA 4KSBA 4I4LA 3RSLA 2YWGA 1OFUX 2FX3A 1JR6A 1YJ5A 1II8A 2DHRA 4LZZA 3CRVA 3DZDA 4JL8A 3K0AB 3P32A 1AGRA 4V0ME 4NPHA 1SXJC 3C16C 1R6BX 3S1AA 2IS6A 3LBHA 5CDFA 2ZRMA 1GRRA 1SHZA 4UJ3A 2C8VA 2V6JA 3GJ3A 2VTKA 2IF2A 3FE2A 2OFXA 4JT2A 3U7EB 1TADA 5J4KA 1BKDR 2RGGA 3M6AA 2F43B 1N6LA 5EUQB 3K0EA 1J8MF 1ZIOA 3B1ZA 5KNBA 1NF3A 4FMDF 3BJIC 3GJ8A 5TDHA 3CX8A 3TRFA 4IJMA 3AF4A 1IY0A 2ZE8A 1GL9B 2G0NA 1DPFA 2ZS8A 1OXTA 2J59A 4MGKR 3BD9A 1W0KA 5EXPA 3AUXA 1S1CA 2WWYA 2WAYA 1L4UA 3NBFA 1XJQA 4MRNA 5C2JB 4KV9A 3SHFA 4DCSA 2OT3B 3T1TA 1E4VA 4IHQA 1MABA 2J7PD 3X1WA 1ZVQA 2A5GA 2EFEB 4A15A 5DI3A 4UQOA 2ZSFA 1ZD8A 3DO6A 3ZS9A 2MSDB 3LWNA 1OH6A 3P26A 4PAOA 2CHGA 5CITA 2YHSA 3PIRA 1Z2AA 1CBUA 5L3VA 4IKEA 3U3RA 1TU4A 1SXJD 4HAUA 5DYIA 3W6OA 4C7OA 2Q9AA 2QMEA 2GEVA 2GEDA 2L0XA 1E0JA 1W2GA 1KMHB 1Z47A 2QSYA 4QHTA 2JLRA 1OFTA 1G9XA 4NH0A 4TSFA 4YLGA 2I1VB 2PEZA 5JZVA 1YR6A 5IT5A 2FJUA 3UWOA 3L0PA 2VP4A 4TYPA 2QPTA 5TVKA 3ONWA 3OE7A 4AI6A 2JLVA 1A7JA 3NHBA 2R6FA 2PX3A 2ZRJA 1IJFA 2BWJA 2JLUA 4ZPXA 4JL5A 1G41A 2WJVA 1LW7A 3LX8A 4BFSA 2NO9A 3I62A 1KI2A 2A5FA 1YZUA 2ZRGA 3EA5A 2H7VA 4EIWA 3I72A 4LHWA 3RHFA 2BOVA 3EX7C 1HQCA 2J45A 3IHWA 2EWWA 2J46A 1XEWY 4V02A 3QXJA 5L3SB 1QHIA 2A5DA 4DLRA 2PLRA 2X77A 1UAAA 4TL8A 4BLRA 2QT0A 4DUGD 3GJ0A 1NSFA 1IN5A 4KFSA 3SNHA 2QGZA 2IYYA 3KB2A 3QEOA 3KQUA 3JVVA 2QUZA 3EA0A 4TTRA 4WBSA 3UWKA 1GRNA 3OFNA 4DT1A 1KAGA 4XH9B 3SU8A 4MKGA 1E1QD 1Q57A 4YMTA 1U8AA 3UG6A 2CK3D 2AXNA 4RD6A 2XXAB 3AVYA 1QG4A 4AYWA 3PUVA 1NBMA 1VYVA 1V5WA 1XCMA 4MKHA 5GVSA 2D7CA 2ZSEA 1BMFD 1EFCA 4AG6A 4NYIR 1O87A 1M2OB 1KSFX 3WMFA 2A2ZA 3A1VA 4BFUA 1GIAA 1LB1B 3B1XA 1XEFA 4BZXA 4TLCA 2EFCB 2J0VA 3F0TA 1IJEA 4L8GA 4UXIA 5JLJA 2CLSA 4OYHA 3CRQA 3EIEA 3B85A 5GJCA 4L5BA 3C41J 3CBQA 2LWIA 3HJNA 2GCNA 3K0FB 4BFZA 4A6PA 2WJIA 4RCYA 4FCVA 2FSIA 1CS4C 3RS5A 2ZRDA 2OESA 3FHCB 3LD9A 1FTNA 2Y8EA 3PVSA 3BB3A 4LUCA 5F9FA 4G0NA 2QE7D 1MO5A 1KJZA 4C0SA 5SZKB 5KYKA 2VO1A 2C98A 3K9LA 1KY2A 2BJVA 3EZ2A 4MKIA 4B74A 1XD2A 4RD0A 2AWOA 1DAMA 3BH7A 3L0OA 4TTQA 4HLQB 4Q5IA 4X8LA 1AZSC 2QSZA 3EZ9A 1Z29A 2ONKA 3CR8A 2VF7A 1T8UA 1KZGB 5FFMA 3GLFB 4RVCA 1GDDA 2VL7A 5EE9A 5AUPB 1XB2A 3I5XA 4EPXA 3VR4A 2OFWA 3QKRB 4J0QA 3RVBA 2HCJB 3WNCA 4H9GA 1X1SA 3HWSA 4KHZA 4PO9A 4F4IA 2FDCA 4M4SA 4WZBE 3QF4B 2OHFA 4OQMA 3ZVRA 2IYSA 1DEKA 3HU3A 1MR3F 5EXTA 4Q1CA 4NYJR 1OKKA 2P6NA 2XX3A 2FEOA 2V1XA 1N5JA 1H8HD 1EFRD 4RD4A 2IS4A 1N5IA 3T5GA 3QQ5A 3PV0A 1JJ7A 2HEIA 1OIXA 2XAUA 2ZITA 4M53A 3TKLA 3TQFA 2H8KA 4PC2A 1R5BA 1CR2A 1KSHA 1P2UA 1OFHA 4TMVA 1E9CA 3VU9B 1DADA 1JQJC 2Q3FA 3SC3A 5FBWB 3PENA 3PG5A 1WE2A 4FWIB 4Q9LA 1NMXA 3I3SR 4TMXA 3S1AB 4PQYA 4DLVA 3A4MA 821PA 2GHIA 3BS4A 3GEHA 721PA 3THWA 5L3QA 2A9KA 2QPAA 1P60A 2W2TA 1Q12A 2Q9BA 3SE0A 2YKGA 2CCKA 3WP0A 4A2PA 4CZ2A 2NO7A 5F98A 4LBZA 4Z51A 2VSXA 4OI0A 3UMFA 1QG2A 4M1OA 2QAGA 1AS0A 1OXXK 2JLQA 3BOSA 3M0EA 4LGMA 2EVWX 3ZLJA 5FUVA 1NG1A 4GL2A 2V7QA 3HPRA 4PPGA 3U7GA 4YMSA 4LJYA 5BN4A 1UJ2A 2ZI4A 5KO2A 3THYA 3EWAA 4P31A 3GLGA 1ZW6A 3TSOA 3AF2A 1PLKA 3KQLA 4JLNA 2JEOA 4QKQA 2FA9A 2QA5A 1ZAKA 2ZRPA 3CZQA 4HEJA 3SEAA 4DLXA 4Q4HB 5BN5A 4A0HA 5J4VA 3R9IA 2BCJQ 1BYUA 5KDOA 4ITRC 1CJKC 2OG2A 2YWHA 3EW9A 1T3SA 1XFAA 1XTQA 3A1TA 3IDQA 2MMCA 3RABA 4M21A 1ZU4A 1FOEB 1GNRA 2YVUA 4N0DA 4ACAA 4OQLA 1HURA 5IK2D 5TY0A 4CF7A 4MGZR 1E2IA 2J41A 3WRXC 1GZSA 3CNOA 1KK2A 3LLMA 2IUSA 1G6OA 2PT5A 4WIAA 3RC3A 1D2NA 4BASA 2ZJYA 2GZHA 4TLBA 1TAGA 1ODFA 2G1JA 4KLZA 2JLYA 2QN6A 2V3CC 2E1RA 1PLJA 2YC2C 2WJHA 4CEIB 1KI6A 4LC0A 3D8BA 4KFRA 2YNMA 5E7JA 5J5CA 2O8FA 1E0AA 3RWMB 2FFQA 3KL4A 2LCFA 4LCBA 3OEED 1G3QA 3GLHE 1TMKA 4US1R 2O8EA 1UBCA 2FPKA 1K5GA 5TMPA 4NYMR 4IFEA 5DHFA 1D2MA 2OCYC 2RAPA 2ZANA 5J4HA 2ZETA 2UZIR 4XVRA 1E2GA 3BC1A 1VHLA 5DN6A 1KO5A 4LRWA 4GBMA 2OAP1 4KVAA 3PR1A 3I8SA 1VMAA 1SKYE 2FEMA 1GVNB 3RRYA 4QOSA 4JZKA 2YOGA 4HAZA 3IQXA 1CEEA 3SJCA 3M4YA 1W47A 2QEQA 2BIFA 1E0KA 3I73A 3KFXA 4DT1B 2GJ9A 3KKOA 4A0FA 4FMBB 1LFDB 4OHWA 1G3UA 4S2EA 4R71A 4G5SA 4EJSA 3BERA 3VMFA 4PQRA 1Q44A 3DDCA 4PZLA 1FPMA 2WHXA 1NG9A 2AFIE 4LHZA 2J0SA 4HZUA 3RSOA 1HQYE 2OXCA 1SVOA 2ZRBA 4F38A 2WSSA 1UBGA 2IUTA 3HP1A 1P5ZB 1Q1EA 2QP3A 2QRNA 3K53A 5FPSA 2VH5R 1KDTA 4PR0A 3KUDA 3HU1A 1IY1A 4XIGS 3F5FA 1KSJA 1WQ1R 3R9WA 1XMJA 3CRMA 1RPZA 2IYWA 1NRJB 4DBLC 1Z0IA 4TL6A 4QM7A 3OIUA 1HT2E 1GP2A 1UF9A 1U0JA 3A1WA 4W5WA 3X1YA 1UDWA 1IN8A 1W0KD 4DIEA 2GXSA 4B76A 3H1TA 3K9NA 4W9MC 1T5LA 3DL0A 1KDRA 1OXVA 2VLIA 2J87A 1DAKA 2OO7A 2CE7A 3LFUA 5FL7A 1D6JA 2IS1A 4YQFA 4DSNA 1Z08A 5DIFA 1XX6A 2D4HA 4B32A 1CKEA 3B1WA 4I1UA 4JKYA 4C3ZA 3SZRA 3VTKA 3U6BA 2GBLA 1RFLA 2ZJ2A 4ILEA 3C4JA 4KCGA 3K8YA 3IGFA 3MMPA 4TQAA 2OEPA 2IW3A 3BFKA 1XTIA 3PJRA 4TSFD 3VKGA 1G8HA 2F9MA 4PZYA 4O0MA 5FOWA 2NMVA 2CMKA 3SOPA 4XSHA 2IF0A 4LY6A 4GZMA 3DMNA 3EPHA 2OUKA 2VF8A 2HF9A 4M1KA 5CYOA 4G5OA 1ZP6A 3SN6A 2RGDA 5FUXA 2Z83A 2PL3A 4DRZA 1WXQA 5P21A 4IRUB 5E4FA 3CWZA 1OE0A 1DG3A 3ZH9B 1P61B 1E1RA 3RRNA 3AGPA 2XZOA 1VCMA 5DSZA 2V1UA 5DYGA 5G3YA 1F3OA 4GP6A 1DAFA 4RZ3A 1Z6GA 1AS3A 1UKEA 2VHCA 4PC7A 3SBDA 1F2UB 1S3SA 1XJCA 3QE0A 3QENA 5EXSA 4B73A 1COWD 1D8TA 4M1TA 3BXZA 1E2MA 1XMIA 3ICQB 1P4SA 1Z8FA 4JBYA 1CU1A 4IFBA 4ZDIA 1EWQA 2IHYA 2NO0A 1VG9B 2EFDB 1TF7A 4O2RA 3CX6A 1ZBDA 4RFVA 4D0LB 1OHHA 4RKEA 1A2KC 4N0EA 4US2R 4FMCF 2XJ4A 1NBMD 2IYXA 5EP3A 3QG1A 1C9KA 2XNSA 1G1MA 4Q1AA 5EZ5A 2CE2X 2J0UB 3ZD7A 2RHMA 3THYB 4JYBA 1CXZA 1ZUHA 2B7BA 4V0LA 3L82B 1EESA 4JJKA 5FPTA 2WV9A 1Q20A 1DE0A 2WMOB 1HA3A 2DYKA 3DOEA 4V03A 1X8LA 3WHLA 3QPUA 5AK0A 3PUXA 2G9NA 4HDCA 3MJHA 3REGA 4B35A 2CL0X 2H18A 1YR7A 1D9ZA 2J3EA 3FYHA 3W34A 3B60A 4V0MA 4DLSA 2JLSA 2XTZA 3U2QA 4XTRA 3NWJA 2PCJA 4B3FX 3PCRB 3LNCA 4OI1A 2P65A 1CRPA 1UKZA 2QTFA 2W2VA 1H8EA 4B2PA 4AG5A 5EE5B 1RKBA 1UM8A 3IQWA 1JI0A 3TVDA 4XD7A 1MV5A 2NQ2C 3VAAA 1U94A 2WAXA 3U5ZB 1RC8A 2AKAB 4OHZA 3N2EA 3VHXA 3CPEA 3QPWA 4Q21A 1K8RA 1C1YA 4M9ZA 4A0RA 1S8FA 1E2FA 4TQUS 2HDNB 3K70C 2QAGC 1OH5A 1UEIA 2AK3A 4IOKA 3CLVA 5JWOA 2QTHA 2GCOB 2RH5A 5LB2A 3B1YA 5CLQA 4D4KA 3QNUA 3MWLA 2NGRA 1U9IA 1NVVR 2O5VA 3DM9B 4U00A 4Q9IA 3ZVLA 3GMTA 4WXPA 1YHNA 4UNSA 1UBEA 3AVPA 4F92B 2GTPA 4GRAA 3TAHA 3GEIA 4HSEA 1NJGA 1LS6A 5HTKA 5KU1A 2ZUDA 2IYLD 4JLPA 4EJSB 3I92A 1CIPA 4ZI3A 1FZQA 2C96A 2XITA 3A8TA 5EE3A 2EWVA 1E9EA 4MRVA 4NCKA 5HZHA 3B78A 1ZUNB 3THOA 3A4LA 2QM8A 2RGXA 4M1MA 2QGNA 2HJGA 2IX3A 1L2TA 4PXAA 1NVUQ 2ZYWX 5DH9A 3E2IA 3UG7A 5FTLA 4Q4JA 3FOZA 2WWHA 1P9WA 1PVOA 3KJGA 1RRFA 2GZDA 1AQYA 3AF1A 1VKJA 1XF9A 2IC5A 2ZI3A 4TLDA 2KI5A 2ZSDA 3LH5A 3RNLA 4CYMA 2HV8A 2FGJA 3LBNA 1OXUA 3SYNA 3K70D 1J2JA 3FB4A 3U6KA 1WMSA 5EQTA 1OLOA 1SXJB 2VSOA 2ZRFA 2ORVA 2V7QD 1AS2A 2O0JA 2QENA 2Z4SA 2C9CA 2QP4A 2ZU6A 3I61A 3FVQA 3IPXA 1VCOA 2JDIA 2C77A 1QHNA 2WWGA 3A36A 4C0LA 3ZVNA 2OFOA 4F4CA 3T34A 1TEVA 2REXB 1AGPA 5FOTA 3MGCA 3VQTA 2OBNA 4JLBA 2ANCA 4I1VA 4RFSB 3TGPA 2R65A 3CH4B 3LA6A 3LXXA 4RZ2A 1NKSA 3D3QA 2F1RA 3EZFA 4HB0A 3T1OA 1R8SA 4BGDA 5FUYA 1ONBA 1RZ3A 4B2LA 5HPYB 5JMTA 4ASUA 4R7ZA 1TF5A 2QQEA 4JKIA 3WYFA 5HR5A 2ZM5A 2CLDX 3QBTA 4G5RA 3QUSA 1KI1A 1OB5A 3NTUA 5J47A 4I99A 4EJSC 2R8RA 3T06B 2DCUA 4URYR 1M34E 1XZQA 2IYZA 3QF7A 4JJZA 2R6GA 3CX7A 2GXAA 4LPKA 3W90A 1IBRA 3G82C 4R98A 4QGGA 1K5DA 4NE2A 4HUTA 4Q7MB 1OB2A 2GVZC 5D3QA 1U2RA 2REBA 4QHYA 2RMKA 2Z43A 3B2EA 4MQBA 3U3KA 1CR0A 5JCZA 1ANKA 3GJ4A 1S9HA 1SVLA 2QL6A 3TE6A 1W5SA 3Q85A 5C4MA 4XOIA 1Q0UA 1M6NA 2AXPA 1YKSA 1XP8A 4Q02A 4Q9HA 4LDJA 3I8XA 4UKDA 1DBSA 3T12A 2QY9A 3UIEA 1JR3E 2ZVPX 3FMPB 4QG7A 2IBMA 5DN6D 2YC4C 2D2FA 3PITA 3DM5A 5KNDA 1W4CA 5TARA 4D4MA 3CH5A 4Q1EA 5DGXA 2QMHA 5FOUA 2F6RA 5G40A 4NYIQ 1I4LD 4OBEA 3SYKA 1I4TD 3BWDD 3KXIA 2UKDA 1G3RA 3IBGA 3GPLA 2OCPA 4NCNA 3LQRA 4NONA 5AJZA 2GJ8A 1W0JA 4AY2A 4HAWA 1G8PA 4EFNA 2CXXA 5KOYA 5DNYB 1B23P 4LOAA 3T1VA 4JLDA 1JB1A 4PFSA 2CVFA 4UNRA 4P0TA 1NLZA 2FGKA 2GBLC 1DAGA 3NKVA 4IVPA 4C30A 1KO7A 2HF8A 4AKGA 4G1UC 1ZCAA 3Q5EA 4TMKA 3GJ5A 1JXMA 2ZJZA 1XMSA 1FUKA 1HTWA 3IKJA 4H1UA 4NMMA 4BFWA 3O8BA 2N1BA 2WSSD 4LWZA 1NIPA 1BH2A 4L9SA 2EQBA 4RD2A 3Q7QA 4F7WA 1XJ0A 2N46A 2WWWA 2VHJA 3ZIAA 2WWFA 3RS2A 5JHGB 3KFVA 4I1SA 1M7BA 2P0EA 1JPNA 3B8HA 1US8B 2FPLA 5CLLA 2C2HA 1QHSA 1UDXA 1PZNA 2JAQA 1P2VA 2XZPA 5FI1B 2WVJA 3I4LA 5AUNB 4X8HA 1CULC 5C4GB 3WNBA 1CJUC 1JECA 1G8GA 3RRMA 4IOMA 2FN4A 5JS8A 221PA 4JLAA 5FL7D 4JLMA 3ADCA 1VYTA 1OF1A 2BKEA 4XTCS 4CEJA 2N42A 1JQLB 2BEKA 4NYJQ 4PC1A 4ZDWA 3VFDA 3KJEA 1NVWQ 4LYJA 2R6DA 3UXMA 3R20A 3K09A 1VIAA 2OE2A 3CZPA 4HLDA 3CNLA 4P4UA 5E7MA 1W4AA 5JSZB 2BC9A 1KK1A 1U0HC 3U3MA 1UEJA 2BMJA 3CUEF 4NZYA 2DFTA 3OHMA 4YC7A 4C0AC 3CWQA 2I1QA 4AYXA 3K0CA 1COWA 5TV2A 1QBKC 5KSZA 4GFDA 2IUUA 4JSTA 1SVSA 1IQPA 1KTVA 3FGNA 1Q1QA 3NIBA 3NC1C 1M74A 3CR7A 2H57A 4QFMA 1L8QA 5L8VA 1XTJA 3GLIB 4LJ4A 2BJWA 1E9RA 3HU2A 4NCHA 2CNWD 5FR1A 4B33A 3PEVA 1EX6A 1KNXA 4EPRA 4RJLA 1E1RD 3RLFA 1KI9A 5B30A 1R4AA 4TYNA 3OESA 3MWJA 4HB3A 3LBIA 2GZAA 1LVGA 2MSCB 2ZROA 5KNCA 4HUQA 2SHKA 4Q4JB 2ODBA 2OILA 2P67A 2YOFA 1XPOA 2F3RA 1OSNA 1E4YA 3GLHA 1R0WA 3IO3A 1TUEA 2DWOA 1KO1A 3KB1A 1FQJA 2ATVA 3FMOB 4MYCA 3W5IA 1I4DD 4TZ6A 1OHHD 4II7A 4RKFA 3RWOA 1ZINA 2G0TA 5CIWA 4HAYA 1GUAA 2QAJA 1VG8A 1OV4A 3HDTA 4LJ6A 2J5XA 3A37A 2W00A 4JIMA 5L3RA 1E9AA 2E9SA 4DDVA 5BWMA 1BO6A 1MO6A 3VX4A 2GRJA 5E3HA 521PA 2ORWA 2I3BA 1U9IC 3ZZTA 2ZRAA 3I5YA 4LBYA 1FNNA 1SZPA 2VIIA 3LX5A 2GJSA 2BHRA 3NHAA 2ZE6A 3VHLB 4EFLA 1DELA 4G3XA 2BBOA 4EKDA 2GJKA 4BLPA 4DB4A 2QPOA 2FF7A 2Z5FA 1D2EA 4MYTA 4NYMQ 4Y0VA 1Z6AA 1R8QA 2JJ8A 4UNNA 5EXXA 4E07A 1FMLA 4Q47A 5GVRA 4OHXA 1WBDA 2BMFA 4LX0A 4NP6A 1H8ED 4WZAE 2F7SA 3NEYA 2A5YB 3VR1A 2EFHB 4M9SA 2AWNA 2D06A 4XD7D 4MA4A 2GF0A 3LDAA 1SGWA 2GESA 1VECA 5ELXA 3QPVA 1P62B 1N6KA 5LDDC 2C03A 4US0R 1II8B 1E2LA 3ETLA 2BVNA 5C46F 4B47A 2IHBA 1JNYA 1AK2A 1YR9A 3RS4A 1PUJA 2ZAOA 4B48A 1WDTA 1XCPA 3R7WA 1MRNA 1KK3A 1EFTA 2WWIA 5AJXA 4O2LA 1SVWA 2PJZA 2IWRA 2HUPA 4XVUA 2ZS7A 3TSWA 4IDOA 3A4NA 2NG1A 3SFVA 2F55A 2BKUA 1G17A 1FW6A 3BB4A 2AFHE 1CLUA 2WBLC 2JGNA 1F2TA 4YDSA 1NI3A 3W3ZB 4DC9A 4O3MA 2BDTA 2A7QA 3Q3JB 1KDOA 2JATA 3VKWA 2DPXA 5AJWA 3B7GA 4GOKA 1XD9A 4YXWA 1Z28A 4Q1DA 2WZQA 3R8CA 2FMXA 4KITB 3A58B 4BLSA 1U8YA 4M1SA 3QOFA 3KTAA 2OAQ1 1J7KA 2ODWA 2OLJA 1W7AA 2DBYA 2QMOA 1NNEA 1JPJA 1MABB 3LY5A 421PA 1ESNA 5FOXA 1XTKA 1TUIA 2KBFA 5DI3B 1I2DA 1NN0A 2DR3A 2GNOA 1NLYA 5H70A 1NMZA 2A5JA 2CJWA 5FBLB 4A2QA 4FD2A 1Z6TA 4POAA 1IN6A 4U5XA 2GAOA 5JWHA 1ZNXA 1ZU5A 1ELOA 3OZXA 4C7OB 5D3MA 1YRAA 3KDSE 2OM2A 3QBVA 3P4XA 1RJ9A 2HLDA 1EFHA 2VSFA 4EPYA 2RCNA 5HZKA 1AZTA 1LF5A 3U4QA 1E2JA 2FSGA 5JWRA 2H1LA 4ON9A 3EAQA 2JDID 1J99A 4Q03A 3REFA 3BH6A 2OBLA 3P1JA 1UPTA 1GWNA 2W0MA 3KQHA 2QNRA 3KJHA 4KAXA 1YVDA 4G5QA 3TBKA 4M2LA 2QMUA 3B13B 2CLCX 2H5EA 3I1FA 2OZEA 1QHXA 2EU8A 4Q01A 4C0BA 4RCZA 5HCIA 3LV8A 3EXAA 2G1KA 3TJZA 3C7KA 3QKSA 2P5SA 4ASUD 3L2OB 3WRYC 2OSBA 3DKVA 3T1QA 4JBXA 1P9RA 3OAAA 1R5NA 1NLFA 3U3OA 4OHYA 3ZVMA 2FOLA 1GITA 4XWAA 2IEZA 3FPAA 4JMPA 4NHOA 2D7DA 1KOFA 3EC1A 4L4UA 1W44A 4AIIA 4PPNA 2GXUA 2QT1A 4UNQA 3K9HA 4MYUA 1NN1A 4FIDA 1OYWA 4QBHA 2ZTSA 1D9XA 2XTNA 3WBKA 2V6IA 3KZ1E 1VCIA 5FPYA 2ZU0C 1VG1A 2IS2A 1FUUA 1W48A 3MFYA 1OXSC 3Q72A 4OQFA 4YDHB 4OK5A 2FE4A 1KK0A 1NY5A 1VYUA 4JLKA 2GA8A 2R6CA 1E98A 2O0KA 4PX9A 3TUZC 5LD2C 1W36C 2GXQA 4LJAA 4UJ5A 1GFIA 4W7SA 5JJKA 1KGDA 1Z07A 2ECKA 2ODEA 1X8JA 4BEJA 6Q21A 2FFHA 1P3JA 1LNZA 4HUQB 3LRPA 4D2IA 4QXAA 2EFGA 2Q3HA 4C0JA 4CIDA 5FTKA 1EK0A 2LKCA 3K9GA 3O8DA 4MKFA 4URZR 2OXRA 3N5CA 3GLHB 2CVHA 3NDBB 1KYIA 2FFAA 1W0JD 1G4UR 2FG5A 5EJEA 4KO8A 4LK2A 2GDJA 3GFPA 4C0QC 5HKKA 3AP1A 3K09C 4A8JA 5AJVB 2ZQ5A 3KJIA 1XBTA 4Z8XA 1Z6YA 4BRWA 2V4ZA 1VIYA 4Q19A 2REOA 1E6CA 1SKYB 1XD2B 3GQBA 4IOLA 5EP2A 5F2EA 3TK1A 1PLLA 4EPTA 3U61B 3EG5A 1CP2A 1DS6A 2E87A 3RRZA 1G7SA 5CM8B 1T5IA 3K0CC 4HB4A 1MH1A 3NEJA 4TL7A 5TXGA 5JJIA 4GI7A 1OFIA 3ZIAD 1ESMA 1E2PA 3QVUA 4NU0A 4TTPA 5CM9C 1HT1E 2RHDA 1HE8B 3IHLA 4LV5B 1VHTA 3FWYA 3M1IA 4QL3A 1WP9A 5G3ZA 1NKTA 1S2MA 1GSIA 4ZO4A 4EFMA 5M04A 3ADBA 1W36D 1HUQA 3WYGA 4IDQA 5BXQC 3FKSA 2DFKB 2WICA 3DMDA 3H84A 1J90A 4IW3B 4Q48A 4X8MA 5IDVA 1QVRA 2P2LA 3A1SA 5IHPA 1A1VA 3TQCA 2WMNB 3B6EA 4DDWA 1P7CA 1BIFA 2JLZA 3RC8A 1TQ4A 3AKDA 2G3YA 1G8FA 2ORIA 2WWXA 4A92A 2AHOA 3CPHA 3W8RA 5FTMA 1NVVQ 3CF6R 3AVOA 4EPVA 2IYVA 2AD5A 2CNWA 2A3RA 3KKQA 4LBWA 5A0FA 3FKQA 3AVTA 4D0GA 3TR0A 1W49A 3IUYA 1X3SA 5ANRB 1JEEA 2BM0A 3D31A 3R7WB 1AA9A 4DSOA 3WXMA 5B58C 2JIZA 4E09A 4B3BA 2JASA 1GAJA 2MSEB 3CONA 3ZZUA 4QGHA 1Z06A 5L3QB 1CJTC 3THWB 4KVGA 4YONB 4BLOA 2Z6VA 1JJVA 4GT1A 2C99A 4ZCMA 1P9NA 2IYRA 1G18A 2ZYTX 5DO9A 4BLTA 1F2TB 3WYAA 1KJWA 4CEHA 3K70B 2QAGB 4DCNA 3X1XA 3BFXA 5G41A 4WA7A 4E22A 2C5LA 5KDLA 4Q9KA 4HZIA 3UMSA 2IK8A 4KBFA 1E2EA 1XPUA 1E9BA 1X8KA 2QP9X 2OLKA 3PUYA 3T61A 4MUBA 4EDHA 5LPNA 3KTAB 2PMKA 4Q4LA 1XD8A 4L15A 3GLGB 2J7KA 5CK4A 4QBGB 1XXHE 1YZLA 2F43A 2HCBA 2QTVB 2BV3A 5BW8A 2A30A 1GKYA 4FCWA 2IXFA 4B3XA 2G83A 3ASYA 1E9SA 3SQXA 1AIPA 2CJWB 5FUWA 2P6RA 4ACBA 4OK6A 4TYYA 4LHVA 1RVDA 5FH9A 2F1JA 4L9WA 1VG0B 4IDPA 4B44A 3TAUA 1JR3A 1YRBA 4LHYA 3PFIA 4ZV4A 4TMWA 3H4MA 2B8WA 1FL9A 4MDEA 4JT4A 2O8CA 4G01B 1KI6B 1E99A 2H92A 2Q3MA 5CK5A 3DVLA 4DJTA 2O8FB 1GKIA 1PJRA 4M9QA 3ZYCA 1TNDA 1X1RA 4QJ4A 3VNVA 3EPJA 2O8EB 4F91B 1GKUB 2HYIC 3AVWA 3AEZA 2XEXA 5LB4A 4A9AA 1KMHA 1LV7A 3DPUA 4KBGA 1T0HB 1Z0KA 3QKSB 4V0NA 2JJ2A 2YJTD 4JYCA 1A5TA 4AC9A 3AF3A 2DFNA 3KQNA 1JAHA 3BK7A 1TF2A 4BEBA 5DHAA 1XU4A 2IEYA 1EX7A 3ASZA 2UVQA 1E9DA 3ND8A 3RANA 2PJRA 1NY6A 1Y3AA 3EIHA 2XSZA 5CJPA 3EC2A 3MRSA 4D6PA 2D2EA 4G5GA 3MWKA 5CB6A 2GEUA 2HJVA 2VHUA 1SXJE 4EPWA 4JLOA 3R9XA 3L0SA 1SULA 1II0A 1G7RA 3DKPA 1RRPA 1T9HA 4IVQA 3B5JA 1GL7A 4ZCLA 3UANA 1AKEA 2J9RA 2ZJOA 4U02A 3SJAA 5L3SA 2P3SA 1Q22A 4P4SA 1P72A 2PX0A 4TWZA 2VHQA 1F48A 4NCIA 3RS7A 2WPDA 3BORA 4Q1FA 3TSZA 1EWRA 1YZTA 2AX4A 3AP2A 3D7MA 4HZUB 1FP6A 1SVIA 4B3CA 2F1HA 1AQUA 2ODNA 1DAEA 1U81A 1ZNYA 4D4LA 1QHHA 4M8NE 4A2WA 1U98A 2EYQA 2RB4A 3ND9A 1A82A 3BRWD 4LYFA 4MITA 2B92A 4DCUA 3NG1A 2ZRKA 5K8LA 2ZI9A 1ZCBA 1T3LA 2FV8A 2WIBA 2XXAA 5EP4A 3ZGXA 4F4JA 2BCGY 1Z3IX 1R10A 3TVTA 5JEDA 5IRCD 4JVMA 2XB4A 4BFYA 3EWSA 4HYYA 2ZR0A 2R9VA 4EQ6A 3BE4A 2NO1A 2ZE7A 5DE3A 4YXWD 2ANBA 4HLCA 2QU8A 5BYJA 4TLAA 3IEUA 1E2KA 1HY3A 1XNJA 4ZKDA 4CVNA 1L7VC 4MGYR 4ERNA 4F93B 4RD3A 2BMEA 1E94E 3K0FA 3OIYA 3QJYA 2AK2A 4Z54A 1UBFA 1OIWA 1DOAA 1GM5A 1ZIPA 3QIAA 4NTZA 1G19A 5CB8A 1ZM2A 3L0IB 5G53C 3JVUA 3CO5A 1QHYA 2NIPA 2FWRA 3LAWA 4GSYA 5GADl 3V4FA 4RZXA 4HAVA 4JVNA 4BZQA 1DO2A 3D6TB 3PUZA 4YMVA 1R2QA 3V9PA 5K8UA 2PZFA 1NSTA 3CM0A 2HLDD 4L16A 4KYUA 4OI4A 3QSYA 1PV4A 4FI3C 3T15A 8OHMA 1GNQA 4LBVA 4DSUA 3AVQA 2ZVQX 3VKHA 1NP6A 4R9UC 1SKQA 3C5HA 1G4AE 1RIFA 2ASEA 2IT1A 4PAQA 4TMZA 1N0WA 3KKPA 1ZD9A 4N3NA 4HDQB 3W5JA 4XWOA 5KSYA 2IYTA 4V0OA 1Z0FA 1DO0A 1KHTA 2AKYA 1T6NA 1UFQA 3OAAD 1AKYA 1S3GA 3HYTA 1FQKA 2RGNA 2VA8A 4KYIB 5FI0B 3AGQA 4A8JC
chains in the Genus database with same CATH superfamily
4BKPA 3E5HA 4G1MB 3D3WA 2JIPA 3WB9A 1OLSA 2NTYC 4DEYA 1M6EX 1UP7A 4Q7KA 4QYXA 3VKVA 3IVXA 4UHEA 1HMYA 1MRZA 3Q9UA 5GPBA 4CEHB 1GRQA 4AZVA 5FX2A 4D80A 1ECBA 2Y1GA 1HEYA 3BSYA 5G1PA 3I2IA 1Z5PA 2H5IA 3KU4A 1Q16A 1YBHA 2AEJA 4GSKA 2YCBA 1PJQA 2P3LA 3HN7A 1G21E 1RRVA 4RENA 2BHLA 3IUPA 4HGPA 4ZVKA 1BSVA 1VXRA 1IC6A 1TYEB 3DEFA 3VVCA 1M2JA 3R3XA 1T34A 2XCQA 4O1MA 4XX1A 5E9AA 1B6TA 2B78A 2WNIA 1Q3HA 4G86A 4K2HA 4ONEA 4P4TA 2O2DA 4YGXB 3ZIDA 1IOZA 3NT4A 4MWCA 2OGZA 3ZCRA 2BGKA 2G40A 4BLVA 4MUGA 1CR4A 2ILVA 3E2PA 3QG5A 5CBPB 4QRHA 2PLFA 1IHXA 5JECA 3KL2A 1PNRA 4BQPA 1ZD5A 2EW8A 4HDAA 3GJ6A 3U9TA 2P8SA 3DUFA 3FPCA 3ZEAA 1YR8A 2A0FA 2DFPA 3TMKA 3NIWA 2Q62A 3LHIA 2CB9A 1AB6A 1E5VA 2CGEA 3N2LA 4LOKA 1V9CA 4LGVA 4YP7A 1TA4A 2CLLB 1RYYA 3BSFA 3G59A 1FX0A 1GTG1 3GGOA 1YE8A 5HKKD 2QJWA 3H2YA 3VX3A 4GBGA 1JSCA 2QOEA 2O7SA 2W6IA 2FPWA 4BLWA 1N0UA 1E3JA 1V2GA 4CMGA 2A7XA 3KG2A 1T9BA 3CKLA 5J4LA 2FPPA 2ZRNA 4LHEA 4PIVA 4AWXA 2X2FA 1A95A 1DX6A 5CJ2A 2D4AA 3F71A 4BO1A 4JXXA 1J06A 3MOIA 4BFTA 3IIMA 3QBEA 2PYIA 2VK8A 4HLNA 4W5JA 5JSHA 4DMGA 2CUZA 4F0JA 4AY4A 2ZQYA 4HGNA 2ZTUA 2V8OA 5BT9A 1Q7CA 4HF7A 4R2IA 4E2ZA 1QKIA 1M7HA 1M67A 2C2KA 3DWFA 1UPFA 4JS0A 2VP3A 2VRBA 2PRIA 3C39A 5J3JA 3QEKA 1Q1AA 3PQ8A 4O5OA 1VJDA 1LW6E 1W8DA 2JJ1A 4KKXB 1BQ3A 3RSCA 4BQSA 1BTOA 3NH6A 2CWWA 1YIAA 2VPTA 2ZBQA 4E21A 2ZRLA 2Y66A 1O4WA 5DLQC 1ZMTA 4D9HA 2BFAA 1TMYA 2M2IA 4H4EA 2FEXA 2JKVA 4YCSA 3RVSA 1A5ZA 2QG9A 4IGAA 4BKMA 2R3SA 4ZT6A 1QH1A 4NBTA 1DGQA 5BWCA 4G24A 4LC1A 4NZ9A 4C9BA 1MF7A 3D8HA 1F06A 3EDMA 4U7HA 3J81k 2GK6A 1ENPA 3FYCA 2PWPA 3T3IA 3R9XB 1A4XA 2CCJA 3KSUA 3NHKA 4RWEA 5CTJA 3CU5A 4IJUA 4XJVA 1QIMA 3NP9A 1TD9A 2DQ4A 2OO5C 2XNHA 3L5KA 1ODCA 3PQEA 4JBLA 4HNRA 3PI7A 1H5QA 1C3XA 1M1ZA 3CKMA 1KKLA 4JCCA 2O3TA 4D26A 1JQAA 1R0XA 1VL5A 3L7CA 3B6ZA 4BBJA 2OQIA 2H1RA 1RIIA 1DT3A 4ZDKA 1GD1O 1E3WA 3ITDA 2IWHA 1ZOOA 3NU1A 4BO2A 3BSWA 1HC7A 3IPRA 4QSMA 2ZRCA 1G0NA 2DFLA 4J3JA 3WBJA 1WSBA 4B6GA 2C2XA 2P4UA 3VAZA 2YWJA 5BYKA 4QUGA 3OETA 1BXRB 2J3JA 2CVQA 1JH9A 1Y1RA 2BFDB 2H4YA 5KYUA 3V4PB 3FFTA 3OQOA 2PGLA 2XGJA 1MW8X 1X80B 3NBYC 4LZJA 4K6HA 4RXUA 1WM1A 4NBSA 4H18A 4F8JA 3W6NA 1E8DA 1DCKA 1G8AA 1Q15A 1EINA 1EUCA 2OTCA 4PINA 4DV6B 4WN9B 1ONSA 2PWZA 3O47A 8ATCA 2YV1A 3KWMA 1CJVC 2EDAA 2ONCA 2E82A 3U3JA 3M2TA 2ZULA 1PWEA 4MRAA 4GLBA 1GILA 3F8TA 3QH4A 4ZCQA 2ZSBA 1IHYA 1RJGA 5DM4A 2AC2A 3V4RA 2PT6A 1RXWA 2C1XA 5E4YA 5CT4A 1VSTA 2G5PA 3PC8C 4PAMA 3VR3A 2YV2A 4TWAA 4XSGA 4Z2YA 1B6RA 1Z4PX 3KKKA 1B6SA 3G85A 4Q3CA 3INGA 1TT7A 2P62A 3HJBA 4LV8B 5D8DA 4B34A 2B4YA 2H0RA 2NYVA 2DBRA 2WHPA 3CN7A 3PUWA 2QIPA 3E9QA 5EMKA 4EJ6A 5CB4F 5L4NA 1KYYA 3P2KA 4TV8B 5KYTA 1APBA 1DC5A 4QD3A 4MSUA 1B3BA 3EEQA 3QXSA 2Z98A 4UCQA 2VXCA 2P35A 3QWIA 4WN3A 1EDZA 2W2KA 4XE5A 3VPHA 3JZAA 3VDNB 3EMBA 4MS1A 3PRKE 4CQLB 4RWZA 1JR3D 3RT9A 3T1HB 4DVGA 1K08A 4XVCA 4PSVA 1FSPA 1JHMA 4KR0A 5IHXA 4RACA 4RFLA 4HNHA 4NJOA 4OH7A 3SICE 4LSGA 2BLLA 1V43A 2NPFA 1RWMA 2KB0A 3F6SA 3RPEA 1RDFA 5CCEA 4ER3A 4YR7A 1VTKA 3TNLA 1LDMA 2P7HA 2G5GX 3IMFA 4PLVA 2ZWOA 1UQTA 3CZRA 3QXCA 1QF9A 3KE8A 4HDKB 1RAIA 10MHA 3NQ41 1YV9A 4QFCA 4G23A 3A6PC 2X13A 2PU5A 4BFLA 1GZ4A 4OHCA 3RC1A 4PE5B 3KBBA 1K4YA 4K3UA 1PUXA 3F7OA 4BJ3A 4EHDA 5KPJA 5A3QA 2J9ZB 3FVVA 4W6ZA 3SFZA 3CLSC 1NJ1A 1J5XA 3UB2A 5HJ7A 2NU7A 1V7QA 4LJ9A 4QNNA 3VU8A 1THGA 5JU6A 4FZVA 4X6YA 1GNVA 1E2QA 4G65A 4L51A 4TQGA 4OY3A 1R64A 1Z73A 3CNNA 3INTA 5IC4A 4ZK2A 6ADHA 3GUYA 3LL7A 1XZEA 3UK6A 2O7RA 1T2DA 1JILA 3TQQA 3VR5D 3RNOA 4LGYA 4RSHA 1KF0A 4OBXA 3BTVA 5AJYA 5E2BA 3BGVA 1L5MA 3GDGA 3ZE7A 2QZ4A 1RC1A 1T8TA 2X9QA 1VLHA 3Q2KA 1CZUA 1Z15A 3ZHCA 4DRYA 5K8IA 1L7BA 3PXEA 4HEA6 1AJEA 1M5UA 2B2XA 2RIRA 1M5RA 3H87A 5LQSA 3M6UA 1FY2A 3H42B 4AYTA 4BFVA 1S0UA 3ZWBA 2FR1A 1F2UA 3AT1A 4E2FA 4WZBB 2EP8A 4XUEA 1H9CA 3EVDA 5C8YF 3BE8A 4EAQA 2ODQA 1SVMA 1MOZA 2WPDD 1YONA 4CG2A 5KOIA 1Q77A 1GGEA 1MC8A 2NM0A 2Z08A 3HVKA 4QUEA 5FPKA 3F1KA 4ZCPA 5NULA 3ZZ0A 2J4CA 2NZXA 2NXNA 2OV8A 3E18A 3GP3A 3JASB 3OJ0A 3SVTA 1QU2A 4X8OA 4D9BA 2ZB8A 5E8JA 2JFGA 3G7SA 5IZCA 1MJGA 2GUGA 1SK9A 1BQEA 2H2GA 3MCAA 1GEEA 1HXHA 3MN1A 4PN7A 1F4VA 1JXQA 4UQLA 1X7WB 3CIOA 2G9QA 2N9UA 3CW2A 2ZYVX 3JWJA 3TIFA 1PK7A 2WKQA 3PD7A 2A4MA 5C37A 4REQB 2ZRIA 1ODSA 3ZCXA 1SM4A 2CLOB 4E12A 5EJ9A 1ZCZA 2BKXA 4W7HA 1PHRA 2OCAA 1ONOA 4UEJA 2WJGA 4UUAA 1V8BA 5D2CA 3QLTA 4LW8A 3WLIA 5DV9A 3KHKA 1M2HA 1GTRA 2GK7A 5L51A 1L6RA 1QRAA 5BQOA 5SY4A 1CQZA 3I2JA 4BECA 2UUPA 1UANA 1ES9A 5CXUA 4MRRA 3BB1A 1GCOA 4TUYA 3IIEA 4DKXA 3JYQA 5GZ1A 5EMJA 2I78A 3OCCA 2YMPA 4CEJB 3I6IA 4RLQA 5K0NA 3VZPA 2NU9B 1NBME 4ND3A 1CUBA 1UP4A 3BRCA 3O1HB 3L43A 1NN5A 1SB8A 5FTJA 4BMCA 4FINA 1U0OC 3SX0A 1U2GC 4H7PA 4WCFA 4PLPA 3H0KA 4P33A 5JD3A 5AW3A 4LAFA 4NNPA 2B7LA 3ZGNA 1G8SA 1I4EB 4QBFA 4CM4A 1TQ2A 1BMTA 3JD0A 4C89A 3WDMA 4TMTA 2YICA 5G0SA 3AUYA 2QU7A 3KKMA 3AFNA 4J43A 1QRRA 3UJHA 2G09A 1C3VA 1ZITA 1TX4B 4Y7CA 2CLFB 3RC2A 3A6JA 1M8PA 3CUTA 2X19A 4YJHB 2H65A 3IUMA 2XT9A 3NGLA 2ALJA 4NCXA 1FDUA 2QDXA 3FVWA 4RPJA 3BTOA 1RCTE 4G0VA 1FF9A 2E4AA 3W5SA 3DZ8A 4JL6A 4XASA 3TX2A 5LL6P 4QVIA 4B3GA 3L8ZA 1PL7A 4QNRA 2XRZA 4MA0A 2GBGA 2WOOA 3KALA 4DAEA 4G1VA 3PNYA 2ZCUA 4HO1X 2BFCA 5AVRA 4DR5B 3H9QA 1NW7A 4LOLA 4Y6GB 1TM2A 2CZGA 5J63A 2ISCA 1PU2A 3QI2A 5I8ZA 5KEIA 1HT0A 3L7NA 3N2IA 1U28C 1CUAA 2CL6X 2WAAA 1DOZA 3TL3A 1HV8A 4O4JA 3UXHA 4Z4QA 1W1WA 2EP7A 1ORDA 4J7AA 2V9PA 1JHVA 4WLOA 3WK8A 5D1HA 2NXJA 1SHKA 4MW1A 5K8TA 2UVDA 4PRYA 1N6HA 5G2OA 4C22A 1Q11A 4ZYTA 1NU8A 1OAOC 2X6TA 4XEHA 4YJ2F 4OQEA 3CR3C 1H4TA 1KXJA 3KTDA 4NL4H 5B1YA 4JWTA 4DXHA 3O93A 4GPTA 4J0KA 4HXYA 2ZUVA 4AUMA 4FWTA 4OMDA 4PZZA 4EGFA 4XB2A 1T2NA 4YS6A 1OXBB 1SXIA 1E96A 1XCGB 4KQ2A 5FYDA 1J42A 1LQTA 1MG0A 1D4OA 1M33A 1U90A 2J3DA 4L8VA 4CKBA 2Z2ZA 4HWKA 2J7PA 4L3WA 3ZWWA 2OPHA 3O8QB 3EIFA 1N9GB 2PNFA 1PJ4A 2Q0SA 5DCUA 4U6SA 3NDPA 4E94A 1KJJA 1OX4B 1YQWA 1VIDA 3MLEA 5AP9A 3MW8A 3WBFA 3UATA 1PQPA 4BNJA 5BO5A 5F2NA 4PPQA 1B74A 2P4QA 4KO2S 5EKXA 3AUUA 1KO8A 1DAHA 1X0XA 3I0NA 4QICA 1SA0A 3N0RA 5LDGA 4A0GA 5A9SA 4CIAA 2H4XA 2H63A 1TTTA 1XZPA 4FYIA 1G4HA 1L8AA 1L7OA 3KEMA 3QA3E 1IAQA 4D4JA 4LJ7A 1AHPA 2FMFA 2ZREA 4J8PA 5ESXA 2Q45A 2JL1A 2GETA 1P5JA 3MXOA 3NW9A 5HMMA 3WGJA 2B4RO 4MQ5A 4MVJD 1IK4A 2FB9A 4DBZA 5I5EA 4DWJA 4G89A 1JMVA 4AWAA 3B9PA 2YWXA 2KE5A 3BHMA 3LLUA 4RZIA 1QGUA 5AW1A 1XDSA 2C1EA 5E3JA 1U5BA 1JLHA 3QZUA 1BWQA 1C50A 4RFSA 4ZAZA 1BOFA 4CG0A 5KVCA 3AF0A 1V8PA 2BBWA 2HJ9A 1XEXA 4PFKA 4AS3A 1VE3A 2HXYA 2WHRA 2VBCA 4IVRA 4KU4A 2GOYA 1KI7A 4B43A 1C8BA 1E61A 1R6UA 1GXSB 3DWGA 4HN2A 3LO5A 4QYWA 4TN1A 3U26A 4CRWB 5AJHA 2PZGA 3NATA 3L6RA 4ZIRA 1DP4A 1J2YA 2Q6VA 1N25A 3F96A 3KWLA 3RF7A 3IR6A 2C9YA 4GX2A 1KI4A 3CNBA 1G55A 1N0VC 2QTWB 3I12A 2IY7A 2KHZA 3KAJA 4FYXA 1KR2A 4G8DA 1ZGJA 4B7XA 4DUGA 2A92A 1L5QA 3OUTA 3VRHA 1WV0A 4CLOB 1SUPA 4R7TA 1BVUA 1ZMRA 2QM0A 5LBUA 3ZHQA 4BRUA 1T36B 1H2RS 4KPUA 1MV8A 4EHAA 4FGKA 3FPHA 3M9LA 3M6IA 3OE7D 4IMIB 4JP5A 1D0IA 4RJKA 1I4OA 2WZDA 4BE7B 2A57A 2OYSA 1E1QA 1LSUA 1VA4A 2Y0PA 1O9GA 4A6XA 5AVQA 5K01A 2CK3A 3MWYW 5DHSA 4FGUA 1RI1A 3HPQA 3FGPA 3QMMA 3TRJA 1OA0A 5HM8A 5EE0A 5FLXA 3ZGZA 3KZVA 1H3FA 1SQ5A 3A1UA 1Y9DA 4GM4A 1IQRA 3H97A 3Q7TA 1G6HA 1SH7A 2Y71A 3K0AA 3R0IA 5GV8A 4BWYA 4CMKA 2H9AA 2XNDA 2C92A 4UAUA 3PC2A 2PEYA 2WIGA 5ISMA 1F7UA 5JJCA 1EG7A 1YC5A 2ASVA 3NBAA 3DBLB 3LUJA 4CIXA 4U2FA 4POOA 5BPHA 4U3JA 2A4KA 2NO6A 4RGYA 3SHTA 3EDRA 4NOJA 1Z26A 4PG8A 3LLSA 4ITVA 2OYCA 1DJQA 2QL7A 1N5KA 2R6AA 1CNMA 3KX2A 3MJVA 4PPYA 4CM9A 1RYZA 3D8SA 1R8JA 3OFND 2GILA 4RL4A 5GJBA 1A9RA 4HQ6A 1PL6A 4UM5A 4HTFB 4JVOA 4FR2A 3HCNA 3B36A 2XVXA 2OWEA 1XRJA 1MEJA 3L6DA 1BRTA 2CVOA 4W5TA 3O83A 3TLYA 2ZVDA 1JR4A 3IO5A 1Z18A 2RI6A 4QEKA 5JISA 3DXXA 3NP7A 4EB3A 1CQXA 3EPKA 4A7PA 3FUVA 3OP1A 4JC8A 2JG3A 4UNIA 3KR9A 2D00A 3RS9A 4LHXA 1S9DA 1TEHA 4HLUC 4I9HA 3ZK9A 2FR0A 1I7PA 3BWEA 3I6BA 3H8SA 1UPBA 3BWMA 4S1NA 1FP1D 2AN9A 4PYIA 3JWPA 1U1DA 3AZOA 3SF8B 4FKZA 2ZIEA 4LV6A 1BS9A 3G8DA 1US8A 3PFCA 4PYMA 3Q9LA 4OCZA 5SZJA 4M9XA 5TS2A 4ZJUA 4FHEA 1G6KA 4R8SA 3IEVA 2LZ0A 5KKCA 4BO4A 2L42A 3BL8A 5IBPA 3ADKA 1IHUA 2IP4A 2FPMA 5BYBA 3RFCA 4W5NA 2GMWA 2VRWA 4ZK6A 5CDUA 3EZ7A 3NC4A 1RYNA 3V1MA 3CF0A 1A9QA 3VBCA 4OEHA 1U1IA 1LEHA 2W2XA 2JAPA 1H4SA 2F59A 2B99A 4JUFA 1XE3A 2JGJA 1H05A 3RUAA 4Q66C 3I37X 1TM7E 1VCNA 4OJYA 2C97A 3SMVA 4F1KA 4UHFA 5E7QA 4EVRA 1DQYA 4ECAA 1KP3A 4UFPA 5LJLA 2O52A 3C85A 3FDJA 4WXRA 4FZ5A 4GRIA 1EK1A 3TTVA 2D1QA 4HQNA 2NZ8A 2WR8A 2VJMA 3ONDA 4C87A 1T2UA 3QE2A 5KVSA 1KZ7B 2AJCA 3BAFA 4F85A 3PJFA 1IXYA 3LDFA 1TQDA 3S0JA 4CU5A 3CMCO 1HGXA 4C6HA 4L5YA 4RLSA 4INJA 3GIWA 5JUWA 5KSOA 3PEEA 3LKBA 4IDHA 3W5UA 4KUGA 1Q3KA 5JSZA 3DPSA 3V00A 3GPBA 5C18A 2CYAA 3CZAA 2JIOA 2ZKIA 3O8CA 1DB3A 2HK6A 2Q6TA 3TGLA 1C29B 4F84A 4JLUA 1ZK0A 3U1BA 3MC1A 4LMRA 4P83A 4WEOA 2XYQA 2OHOA 2W6JD 1U31A 1JVSA 1X86B 2Y6UA 3GEMA 4J07A 2VVTA 1JNXX 2FSFA 4M46A 2YDYA 2ZSHA 1G9TA 1N6RA 4D3DA 1NC3A 3KEOA 3JYPA 5K0SA 2O8DB 2GCGA 3MINB 2I71A 1DARA 3TKAA 3HJFA 3A6KA 4JJ4A 1B8VA 4C7VA 3GLIA 4II3A 3K96A 5CT6A 4ZEWA 1PZXA 3AQ4A 5AJUA 3AUKA 2J08A 5KTKA 3VJKA 3N8DA 4KQ9A 4KLAA 3VOBA 3JZMA 3N8IA 1U63A 3R6LA 2G77B 2W83A 1X15A 2AN5A 3TLZA 1T4MA 4K9SA 2IYUA 3FMFA 4HH1A 2IU3A 2PBRA 1IWBB 2ZFUA 2E21A 3K15A 1HRDA 4JH0A 1IJBA 5AXBA 5BVHA 4ZP1A 1KZ6A 4C5CA 2QYSA 4TLEA 4E4TA 1AH2A 2BEJA 3DJYA 5DHTA 2C78A 3KUCA 4FDUA 2Z30A 3FNHA 3G1WA 4DR6B 3C97A 1H94A 3DAGA 3IOBA 3TTXA 3WP1B 4YCCA 1U9JA 3JQ6A 1ILEA 1RTKA 4MYSA 1E9FA 1RCUA 3VZCA 3WB2A 2DWQA 3SQLA 3L92A 4QJBA 2J3KA 3S8MA 4ESVA 2NNWB 2G6BA 3P9QA 1UBUS 3QKUA 1MO3A 5JRZA 2WF5A 2C59A 4G41A 1SBQA 2NOAA 3OIWA 3USZA 5I3ZA 5IM4F 4MQ4A 4IS3A 4S1WA 4WVFA 4F21A 2CN1A 4CKEB 1OBVA 4JROA 5EJIA 1M6VB 3O2SB 4DA6A 5DTIA 5GONB 4A3SA 4B82A 1P4RA 4X24A 2EHDA 3I30X 4ZREA 1V37A 3NVAA 2OWDA 3AF5A 2YMQA 1FXUA 2C9OA 2ZIAA 3AKCA 5HCNA 5K0LA 2HT1A 3WK4A 1V8OA 3PNQA 2HY7A 4XPIB 4CF4A 1EU1A 3C70A 4ZI2A 2HMYB 3GLFA 1WLSA 5HX7A 4HTAA 4F8EA 4HI0E 2PH1A 2D3WA 2GN8A 1LF0A 3CNQS 1YQTA 4KJXA 4U7PB 3NASA 3A6EA 3EOBI 1R0YA 4DLUA 1NF9A 2XGOA 3QUBA 4IKOA 3NWOA 1KFKB 1OTYA 4OJKA 4OQXA 5KYVA 3KSDO 2HQBA 2R62A 1V1RA 4MV1A 1T1RA 2C0QA 3JTEA 3PFFA 4YJGB 3E7FA 5DISB 1P80A 1Q21A 3NANA 3CT6A 1ZOPA 3COVA 4IOJA 5T64A 3T9BA 2OCLA 2WILA 4MVCA 4E5SA 3OZTA 5FBRB 4EO7A 2PUHA 3QUCA 1GA1A 1Z4OA 3WGIA 1ISPA 1KIMA 4BNIA 2HDHA 4NARA 2JI9A 2WJYA 3EPLA 4C88A 1G3MA 5DM0A 4TV8F 2IW1A 4GOJA 4AZ3B 4FMCB 1TPZA 3H86A 3QU2A 4MYHA 4TT3D 4OQ4A 2C9ZA 3H5RA 2GFQA 4FE7A 4M8KA 2M6LA 2A5LA 3P8ZA 5KYWA 3O95A 1YJ5A 1JLMA 1JR6A 3G1TA 1RXYA 1XVUA 1QIJA 1IATA 2OCKA 3GRYA 5G02A 5BMVF 4RGQA 3DE7X 1AGRA 1QIKA 1H6AA 1BVHA 3OSUA 3RUCA 2RAFA 4FUTA 1E7WA 5F3DA 3VNRA 3C16C 5AW9A 3LBHA 1MC5A 3SCZA 1B41A 4P7KA 1J9EA 1U7ZA 1UBTS 3UJDA 1G60A 2V6JA 2PKEA 3ABRB 1F2VA 3GJ3A 2VTKA 4JP3A 1NNUA 2OFXA 1Q0SA 3LNTA 2UV8A 1MZVA 3K2EA 3DGEC 2RGGA 1SAYA 4I6EA 4GPAA 1JBEA 4IIBA 2C29D 1V6CA 2D5IA 2QN2A 2F43B 3ZI4A 4R54A 1P6UA 3B1ZA 3KZNA 2XOEA 1NF3A 2NXCA 1WWKA 3BJIC 3EK2A 3GEBA 3GGJA 2FWAA 1IY0A 4FGZA 5J2TA 1GL9B 4LYYA 1DPFA 4RMHA 2ZS8A 1G20A 1OXTA 2DKFA 2J59A 3UCEA 4ZZ3A 1W0KA 4V39A 5EXPA 1EJ2A 2COUA 2AGVA 3RJTA 4OREX 2WWYA 1IVSA 3VPCA 4INZA 2I7XA 1WZEA 5C5DA 2H1WA 4YUXA 1A7UA 5FLYA 4MRNA 4HDRB 4JB0A 1XLWA 1SUAA 3EXHC 2IYPA 3SHFA 4DCSA 4E5MA 4HDNB 1MABA 2AEMA 2YZNA 3LUHA 1GNTA 4L2IA 3HBLA 4YUZA 2A5GA 4Z2AA 4HH0A 1PQUA 1LA2A 3PFWO 1KOGA 4A15A 1JQEA 2AS0A 1OH6A 3P26A 5JNRA 3VH3A 4EH1A 5DNCA 4D96A 3D5QA 1SXJD 4C7OA 1CY2A 2GEVA 5U1PA 1MQSA 1E0JA 1W2GA 2E6UX 1Z47A 2L0XA 4NJEA 4QHTA 2VBGA 4TXLA 4TSFA 3VNSA 1HLDA 1FS5A 3I0ZA 4UDNA 5U4QA 3WLSA 4J2TA 5IT5A 2BGGA 4RM2A 1X9IA 4I5DA 3L7JA 4LHSA 4BNMA 4MUIA 4TYPA 4D98A 5TVKA 1QBGA 1R1DA 3E4CA 3MTJA 4BWVA 2JLVA 4MZDA 1A7JA 5T41A 4RU1A 1KDVA 5JCOA 4WZZA 5K3CA 3V5NA 5K5EA 2QRHA 5DXAA 3AOEC 4PSDA 3WICA 4C29A 2E18A 2JLUA 4JL5A 2ZVJA 2VEOA 4V2IA 2ZRGA 2A5FA 1YZUA 1ZJJA 4MI1A 1IAVA 2AOTA 1CS0A 2VNHA 5BN5B 1XV5A 2J45A 4LECA 5JIBA 4P0QB 5J2UB 2J46A 3ZV7A 2AJBA 3TOCA 5L3SB 1KVRA 5A4FS 4RA9B 4MUMA 1UAAA 4LRQA 4R9VA 4ZCTA 5IDWA 1EP9A 2G4LA 5H3CA 3QYAA 4TV9A 2MCFA 1LJLA 5JSFA 2XZTA 3JZIA 4FPXA 2VYCA 3KQUA 4TTRA 3E3MA 5DTRA 4WBSA 4A2CA 4DQKA 1HR0B 3WGLA 4TKLA 3UHJA 1G66A 1ZO8A 2UZ1B 4K1LA 4MKGA 4XH9B 4BO7A 4L4YA 3A04A 4ROSA 2WB4A 1Q57A 3G23A 1E3QA 1U8AA 3KPUA 4FFMA 5D3KA 1K4KA 4R9NA 3UG6A 2AXNA 5KQMA 3W5BA 4GXQA 4KH0A 3QVTA 5EJGA 3AVYA 1QG4A 1MAHA 1CUJA 4AYWA 4AG3A 1YT5A 2MR5A 1VYVA 3D5TA 1CIVA 2OKGA 4AO6A 5C1OA 1QV7A 2V7EA 1A9XA 4QDTA 1U0NA 3L9XA 1VOTA 2EZ8A 2Y99A 4L6CA 1K8XB 2AVDA 4NYIR 1O87A 3BZUA 3TG2A 3B1XA 2VDUE 1P0QA 2NACA 4N49A 1KERA 1EP3B 3L1VA 3V7FA 2C57A 3IXQA 4IQ8A 4JNCA 4L8GA 3BMQA 3FYUC 3CRQA 4OYHA 1UBNA 3CPSA 1E6KA 1REQB 2GA9A 1SU7A 3B85A 3CISA 3FM9A 5LIRA 5LOVA 3CBQA 1R4MB 4EY4A 4HRXA 4MR8A 3ZKWB 3IUEA 4DYDA 4A6PA 2BI4A 2OP1A 1RLIA 4XKJA 2V5UA 2FSUA 4RCYA 5KNLA 1SIWA 2FSIA 2QXYA 4IWYA 4MAAA 1GFSA 4FX5A 4XGRA 3RS5A 2BHNA 4AZWA 5KQGA 1PNVA 1SBHA 4E5NA 1QGAA 1D07A 2QLFA 8ABPA 1GG9A 1OGYA 3IQDB 1QTRA 3HUEA 2E4XA 4DV7B 1EWVA 4D97A 3ZCSA 4BO3A 4B74A 5CT9A 3T0GA 3AW9A 3BH7A 3L0OA 4NBUA 4Q5IA 3WFZA 1AZSC 4LF9B 1TMOA 1EZ1A 3G3EA 1JSLA 2ONKA 1K88A 2VF7A 3DEJA 4I2NA 3IJRA 1T15A 1KZGB 2I62A 3AOGA 1XZDA 2DQZA 5EE9A 3BL5A 1X1DA 3CEMA 2RK6A 5A5EA 5AUPB 5D84A 3VR4A 2OFWA 3QKRB 4J0QA 4RV9A 3RVBA 1XTBA 3WNCA 3OZWA 1SCUA 5DWVA 3WSVA 4BNLA 1C9NA 1BKSB 1MOQA 5B6JA 4HADA 4N0MA 1XZHA 4LNUA 3QHQA 4HQFA 3C1OA 3A0RB 4M89A 2VNKA 3M5WA 5EVCA 2FFJA 1O97D 3RIXA 2BHTA 2Z57A 3HJCA 3L02A 3KQPA 1DEKA 1MN6A 2HFKA 2JW5A 3HU3A 3OECA 1O2DA 1Q83A 2YN4A 3IDAA 4IV5A 4Q1CA 5EXTA 4ZZ1A 3ENZA 5JTUA 3GJQA 4TSRA 1Q7TA 3LE8A 1R0RE 3C6BA 5AVKA 1D1SA 2V1XA 1PT6A 3EIOA 4I19A 5KWJA 1LSOA 1LPPA 5BNFA 2VAMA 1NFQA 5FD8A 1QO9A 3ONVA 4IX9A 3T5GA 1EK5A 3FPSA 2O3QA 1RZUA 3DCYA 1KMCA 3RD5A 1OIXA 3OX1A 3TNDA 4M53A 4ZWNA 3TKLA 2MWMA 3ZQJA 1L7RA 1Q6ZA 3LYAA 4EY6A 1PR0A 3DONA 2CXQA 2I7VA 2YBEA 1DADA 4AY3A 5BQXA 1ZHOA 2V6BA 1I6MA 3PENA 4JYPA 1E7QA 3H2SA 3VM6A 4FONA 2Q3LA 5E0OA 3SJ7A 4XEUA 3HN2A 3LGXA 4BS9A 3S1AB 1IY8A 1YCGA 1EGVB 3QFCA 5ULLA 3W5HA 2QNIA 3K5PA 1ZMOA 3ZHZA 4C4RA 4PZCA 2H4FA 3BS4A 3GEHA 4GL4A 4ZZ2A 1QUEA 1DKQA 4H59A 721PA 3ZVKA 3THWA 1ZFNA 2QQ5A 3SE0A 3AHIA 1SB9A 4W82A 1M54A 1EJ0A 2J3LA 4ALIA 2CCKA 2AI1A 5F98A 5IT0A 4LBZA 4Z51A 2VSXA 2WUGA 3KZXA 4H7HA 2X7HA 4M1OA 3UMFA 4MVJM 1KAHA 1OXXK 1THZA 3ETNA 5LQMA 1PR5A 5I01A 1P3Y1 4YECA 4IH1A 3QELB 4GL2A 3MZ0A 4AJNA 4X6UA 3WTCA 3M82A 4AECA 5B3LA 4TKZA 1OYVA 1JHQA 1NI4B 2K2WA 2WJ4A 5C3MA 5AK6A 3DEYX 4RXTA 4WSOA 2HWKA 1CUDA 3RIYA 4F72A 4AO8A 3H8WA 3EH1A 4WLUA 2NZ2A 4R3NA 3WWYA 3V33A 1NRIA 3TSOA 2ECQA 4Z99A 5T57A 3KQLA 4JLNA 1NUAA 3JARB 3K5WA 1D2GA 2XAAA 1VL1A 2ZLBA 4QKQA 3CZQA 4X91A 2Y0CA 2O1WA 4Q4HB 5J4VA 2IY9A 5ALFA 1BYUA 1KY5A 3CNHA 3EG9B 3KZKA 4NLLA 3B7WA 1ZJ4A 4U2CA 4ZVUA 5TEVA 2YWHA 1JFSA 3I4CA 1T3SA 2FAXA 1E4EA 5JYBA 1DX9A 2MMCA 2VLBA 4WK4B 4DIMA 4LWPA 3PWTA 3M6LA 1YH3A 3HLYA 3LRXA 3O4FA 1EUYA 1HDCA 3C7AA 4OQLA 3WQRA 1U7XA 5AI8A 3PF9A 3HJUA 3HB1A 4U6QA 1HURA 4AY5A 4Q9AA 4CF7A 3M6MD 1IBSA 4OIFA 3WRXC 2D6FA 1QU3A 2IUSA 1QCCA 4KUHA 2RAVA 1D2NA 1ECJA 3ZD7A 2V3CC 4PLCA 3G5TA 1P29A 4DLLA 2JLYA 2IZ0A 2YC2C 4TKVB 4XJSA 1Z4LA 2B4QA 2GB4A 4KFRA 4LC0A 1WNTA 3H11A 3R7FA 3HYSA 3UUFA 4YHHB 3OEED 4GEKA 4UAJA 3WXBA 3GLHE 1QFYA 1JLLA 5DMXA 1UBCA 2FPKA 3FJOA 1QJCA 3H6HA 3TQSA 3W2GA 5E1DA 5DHFA 2HBZA 1WY7A 2RAPA 1P0MA 5CLJA 3CZ9A 1T3ZA 1TIPA 1E60A 2J6HA 3B53X 1L1FA 2L82A 4D9IA 1J0DA 1P0FA 1WMBA 1LNQA 5E2AA 5IJWA 5CG2A 1GCGA 1DBQA 2VJOA 1Z39A 4GBMA 1EQAA 1QIGA 4LRWA 4LYEA 1J0CA 1P1JA 2FUG1 3PR1A 1L7AA 4JUDX 3MELA 4B87A 4UU8A 3UHFA 3PTLA 2FEMA 4TOIA 1GVNB 4UDYX 1X19A 4HAZA 3JD3A 4HS9A 4MCHA 5AKLA 3U1TA 3D6FA 2IHUA 1V7CA 1NVFA 3AJAA 5IYZA 2Y0BA 1BGXT 1NFFA 2BIFA 2QJOA 4DT1B 3DT6A 2P11A 1RE1A 4MA5A 2GPJA 3I0MA 4R0VA 1G3UA 1GU0A 2VFAA 4OUDB 3OLVA 5ALPA 2Y1EA 2OKCA 3F2VA 3HCBA 3VKUA 4JQYA 3M6FA 4J0IA 4PQRA 1J1ZA 2W6QA 2XIQA 5E6UA 5IVHA 4FD3A 3DDCA 1DKUA 1MDBA 1Y4ZA 2GN9A 2YY6A 2WHXA 3JRXA 4N3CA 3CN9A 3LPDA 4P08A 5EKUA 5EHXA 2AFIE 3ZWVA 1CV2A 4LHZA 2Z56A 3EDCA 2Q1YA 4F38A 1B16A 1B73A 4FJ2A 4CV2A 1Q1EA 1QWOA 1A4IA 2QRNA 4RK7A 2R6JA 3AK4A 4ES6A 3E6AA 3S2GA 1VLLA 3OPMA 1NT4A 3UJCA 3HU1A 3JTMA 4BCBA 1IY1A 1K2WA 1U7DA 2OB1A 3LCRA 4XIGS 4ZI7F 1DLIA 1PSZA 5K6TA 2PD4A 1RPZA 2CXUA 4FI3F 5KNBD 1EVKA 2DC1A 4R68A 4J49A 1JIIA 4YAOA 3WYDA 4B83A 3P9NA 3MA0A 3OIUA 4OHOA 5CFLA 1JQ3A 1U0JA 3A1WA 4D3ZA 1U3TA 1IN8A 3UBMA 4DIEA 1N0IA 1P18A 3H1TA 4W9MC 2BFFB 4WLNA 1T5LA 1RWKA 1ACJA 3ROXA 2VDMB 1KDZA 3KSAC 1KDRA 2OXIA 1PK8A 2JGAA 1KMMA 5DZSA 3WMWA 2CLHB 5FFFA 3TZCA 3JY6A 1DAKA 5A2GA 3ER9A 3G2MA 4OXYA 4F2HA 3IUBA 2DXIA 3TOVA 3LFUA 4CM3A 4PZEA 2AT1A 2PUWA 3BMNA 4L3VA 4HVCA 2I9PA 2IS1A 2BE9A 2D4HA 3DF9A 3TVYA 4OP1A 1CKEA 4OMUA 4QUBA 1IZ9A 3A27A 4F2WA 3TQIA 3H3XA 4I1UA 3STVA 2CHFA 3H83A 3W8FA 5AKHA 2JCVA 1QO7A 2GBLA 1OLUB 1RFLA 4ILEA 4LWQA 4NFLA 4DDKA 4EP1A 4TQAA 2W8ZA 3Q2OA 4G9EA 5EERA 5IDXA 2PYDA 3EOZA 5FWDA 2OEPA 3KLOA 3QVMA 2B25A 5KC8A 3BFKA 4WCDA 3D43A 4UM7A 2ZBRA 1SXPA 1D4ZA 1H2EA 4J4BA 4CQMA 4LRUA 4JXJA 4GC9A 1OD6A 3IAUA 5ENDA 3FDFA 3L6EA 3SOPA 2Y2VA 4PG6A 4FQ7A 4NXMB 1FDRA 4GZMA 4ZMBA 4X44A 2XV1A 2HF9A 5CYOA 5BSGA 3GQVA 1ZP6A 1ORTA 3GP5A 1E9VA 4EG5A 2RGDA 3DAOA 2HDOA 2Q9UA 3T52A 2VAVA 4AJ9A 4KDCA 1R3DA 2A0WA 2SKEA 5LQNA 3ZQUA 4DRZA 3KOZA 1A97A 1MPXA 1KC1A 2C1ZA 5IBRA 4TKUB 1OE0A 3HBAA 4WD3A 1YA6A 3F3MA 1KEUA 4JQCA 1VL8A 4IUCS 3RRNA 5BRAA 1JDNA 3OT5A 3AUAA 1VCMA 1NQTA 4L8LA 3ORHA 1SOWA 5DSZA 1AV6A 4GP6A 3NYWA 5C31A 1DAFA 4RK5A 5EY5B 3OPYI 3U0BA 2NV6A 2VXOA 5JCJA 4DQXA 4RELA 4B73A 3MBOA 2EBHX 3P2YA 3QM1A 1COWD 4L8YA 2ZIGA 3CUKA 1D8TA 2EERA 2OAGA 4G9GA 1B4DA 5ILQA 3U19A 4UTNA 1KZ4A 3R3YA 2NYUA 4M6WA 3IAS1 4JBYA 4BZWA 5JZOA 1MNAA 2EZ9A 3E48A 3NTRA 5CLHA 4EFKA 3E27A 3JZFA 1Q2UA 1TCBA 3G7UA 1VPTA 3B8EA 4ISBA 4BCCA 1RBMA 1XQXA 3D1VA 4RKEA 1X7ZB 1XZNA 1A2KC 1X1EA