2FV8A

The crystal structure of rhob in the gdp-bound state
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
187
structure length
180
Chain Sequence
YFQSMIRKKLVVVGDGACGKTCLLIVFSKDEFPFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQKRYGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rho-related GTP-binding protein RhoB
publication title The crystal structure of RhoB in the GDP-bound state
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 61
structure length 180
sequence length 187
ec nomenclature
pdb deposition date 2006-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2fv8A00
2YC4C 2ZE7A 4A82A 2CNWA 3MMPA 3QI2A 4M1MA 2O8EB 1P72A 2N1BA 3GJ3A 3KB1A 1PJRA 1Z3IX 2IHBA 4KVAA 1KSHA 2F43A 2IYTA 4LK2A 2AFIE 1UBGA 2WJIA 4AKEA 2UZ3A 3MAAC 3PUWA 1NIJA 4TTQA 1DAEA 5A0FA 1HY3A 1HTWA 1KMQA 1CU1A 2J3EA 3OIUA 1Z6GA 2NO0A 2W00A 4DWJA 1VIAA 3BH7A 1IOZA 1EWRA 2GAOA 1RJ9B 1D2EA 1Q21A 3N2EA 4IOJA 5SZJA 1ZP6A 5EZ5A 3VR3A 1OKKD 2HCJB 1ZIOA 3PUXA 3JZAA 4LGMA 1RZ3A 1AA9A 1G1MA 5AUNB 4LV6A 1OV4A 2P65A 1MR3F 4O25A 3R9XA 1D9ZA 4DEXA 4M4SA 1RE0A 4G5SA 4KYUA 1M2OB 2IHYA 4MH0R 5JBQA 4TZ0A 4Q4JB 1KJZA 3CLVA 1GILA 2WWGA 1K5GA 1E2FA 3EC1A 4Q19A 3SU8A 1CIPA 3BH0A 1NIPA 3PV0A 2E87A 1VIYA 3B1ZA 3NHAA 1G4AE 4IJMA 5GJBA 3A58B 3U3KA 4NE2A 2WKRA 2FGJA 4DDWA 3GPLA 1XPUA 2O52A 3I61A 5FI0B 4B6EA 1VKJA 3FMPB 4NP6A 2ZRBA 1E2GA 3K9GA 5C46F 4B3CA 1Z6XA 3RANA 3TE6A 2A5JA 4MGZR 1G7TA 3X1WA 3ND8A 4C2UA 2NMVA 1TF2A 1MABB 1UBCA 1N6RA 3BWDD 4HEJA 4QHTA 5FBWB 4JL5A 2CEAA 3PJRA 5BN5A 3A36A 1AKYA 3DPUA 3HWSA 2OXCA 1P5ZB 4GL2A 1R8QA 4YDSA 4ZDWA 3PVSA 3FMOB 1N5KA 1VYVA 2QG6A 4DC9A 3X1ZA 1I4TD 4KFTA 2WTUA 4UXJA 2QORA 2WKQA 4LZZA 5K8IA 5HKKD 2FG5A 5D3MA 3U7EB 3BFXA 2P6UA 3RYTC 3SZRA 2BKUA 4JLMA 3W6OA 2GK6A 2W2XA 1JXOA 2VTKA 1G7CA 1OIVA 3T15A 3ZYCA 4WZ6A 4AKGA 3LQQA 4AWXA 1DARA 3VR6A 1E96A 1ESNA 3AKYA 4I99A 1ZRHA 1JNYA 3ZJYA 1R0ZA 1UKYA 3BB4A 5B30A 1FTNA 1SVIA 3G5UA 1JJVA 4BQSA 3FTQA 3OIWA 1IM2A 2ERYA 3QUSA 4JVNA 4JLVA 4DDTA 1EX6A 1XXHA 4ZKEA 1U90A 5GJVC 3KTAB 1ZD9A 3CR7A 5K8LA 4V0NA 2X8AA 2HF9A 1X1SA 2JIZA 1E9FA 3E1SA 1SVLA 4BFXA 1CJKC 1PLJA 5FR1A 3K70C 1XEWX 2IYVA 2WSSD 3CX8A 4OBEA 2ZYVX 3THYA 3KB2A 1JAIA 3HYRA 5K8TA 2QA5A 5HR5A 1TTTA 4OI0A 4JYBA 1G6OA 1IAQA 1F48A 3FOZA 5EP1A 5KNBA 4NCKA 2HT6A 1G7RA 2CLCX 1LTQA 2HEIA 1GDDA 2QPAA 3Q5DA 3SNHA 1ZD1A 3QXJA 2OBNA 4MRNA 2ZS8A 3W90A 3WBKA 3L0PA 3FMIA 1KK1A 4Q48A 2OZEA 2XZLA 1NBMA 1UEIA 5KNDA 1Z0FA 2QMUA 4FCWA 4KITB 4LBWA 1KSFX 4DSOA 1BYUA 2B7BA 2C2HA 5DYGA 4TTRA 2JCSA 4CEHB 1DO0A 4QM7A 3HP1A 2EYUA 4LHXA 2JJ8A 4GP7A 1E9RA 4Q4HA 4PPQA 1G19A 3VX4A 4PQRA 2GRJA 2W0SA 5TVKA 1P6XA 4CEJA 1WBDA 1OHHA 2ZI6A 4W5HA 5BN3A 1W36C 2AFHE 1E98A 1MO5A 2BVNA 1LS6A 3QVVA 2ZRMA 1UFQA 3Q85A 4WZAE 4P0TA 2ZETA 5JECA 5LDDC 2YV5A 4EJSC 1U94A 4XWKA 1TEVA 3KFXA 5H70A 1FPMA 1LW7A 3LLUA 4JLOA 4E09A 1G16A 3DMDA 2OUKA 4JLDA 4MGYR 4Q02A 3H0KA 1R8SA 4LJ4A 5KNCA 2V6IA 2JLSA 3ZQJA 1H8EA 4HUQB 3OAAD 4DSUA 4BPBA 2IS1A 1IXSB 1KDTA 2V7QD 4C4PA 4PZZA 1A2KC 3I72A 1T91A 4B33A 3CKLA 2ANCA 3GLIA 3QPWA 4YMWA 2ZSBA 3SJZA 1AN0A 3DZ8A 3UMRA 1LFDB 2W2VA 1GNQA 5A5GA 3FE2A 3GMTA 1TF7A 2C9YA 4JYCA 5FPKA 1II8A 1NP6A 2H5EA 3NH6A 4WAUA 1GZSA 4KSBA 3U4QA 2WV9A 3X2SA 2WJYA 4YMUA 1KI6A 2VHTA 1ANKA 3ASZA 2ECKA 4QL3A 1G8PA 2QP4A 3AQ4A 4KO8A 2W6IA 3BC1A 3CZQA 4HAZA 4A6XA 2HV8A 4HAXA 3UIEA 4UNSA 1Q57A 2GNOA 2VP6A 2W6JD 3W3ZB 1D5CA 4LWZA 4G5QA 2AD5A 3W3AA 2BBOA 1EK0A 1P9WA 2H16A 2ZM5A 3BD9A 4ARZB 3WMGA 2XSZD 1N6NA 3TUJC 3CZPA 1GUAA 4CT4B 4ZDJA 4D4KA 4BRWA 4LDJA 4QHSA 5EUMA 2GESA 1L4YA 2I1VB 2C99A 1YZKA 1ZNWA 3F0TA 5BQ5A 3ZZ0A 1LF0A 4DCVA 3R8FA 2ZE6A 3RAPR 2D7DA 1Q1ZA 1TPZA 3P4XA 2AN9A 3QKSA 1EFCA 1ZVQA 1XDBA 3NVAA 2GJ9A 5EUQB 521PA 421PA 5KOYA 1E9BA 1R5NA 2WOJA 1YZLA 4Q4AB 2VBCA 3T1QA 1KAGA 3TBKA 4A2QA 1GL9B 3MLEA 2NZ8A 4R2IA 4QC2A 1F3OA 2QL6A 5BWMA 1QZXA 2WPDA 2PZGA 2XJ4A 4BLPA 1TQDA 4V03A 5CYPA 3BGWA 4EFMA 4A36A 1OFHA 5AR1A 3RABA 2FV8A 1DG1G 2Q3MA 5E3HA 1D6JA 1T9HA 3RWOA 2QSZA 2J41A 1PLKA 1VYTA 4V0ME 3GD7A 4AD8A 4B35A 4FD2A 1L4UA 3W8RA 2WIBA 4IOKA 3VR1A 1ZC3A 2FN4A 3WP0A 1RYFA 1S96A 4LBVA 3VHXA 2ZRNA 2IBMA 2DFLA 2OCBA 5L3RA 2OAQ1 1HT2E 3KKMA 2DYKA 3UMSA 3THOA 2P2LA 4P4UA 4V0LA 1QHHA 3WMEA 2ZI5A 1NN0A 2JLXA 4LHZA 1P7CA 4M9SA 1M34E 4H9GA 4RCYA 2IUTA 4NYIR 3AVWA 4AI6A 1Z0AA 1JPNA 5BN4A 1SVWA 1Z06A 2BM1A 3I8XA 3MFYA 5JI3E 1Z63A 4TN1A 1QHGA 4XVUA 2KBFA 5JSZA 4WZBE 2QBYA 4Z1MA 3IKJA 4IRUB 2A7QA 1Q44A 1NL3A 1ZIPA 4RFSB 1E9AA 3AP2A 3FFBA 1GRQA 5DLQC 1XEWY 3VX3A 2A30A 5AJZA 4TQ9A 1RW4A 3DKVA 1VMAA 3Q9LA 4MRPA 3NBXX 3U3JA 2IS6A 4RD1A 1ZM3A 4UKDA 4RZUA 4XTRA 1GRNA 2AXPA 2RGCA 3BRWD 5JWOA 5FUVA 2J7PA 3ZVNA 4DBLC 4ASUA 4TYPA 1VCNA 4D6PA 5LBIA 2B8WA 4PHTA 2K5UA 4IVRA 1KJWA 1KDPA 3C5HA 1Z0IA 5E7MA 4FN5A 3AF2A 2VP0A 3B85A 3T12A 1NMZA 1X86B 3I1FA 4NTZA 4GT1A 4RFVA 3A37A 1T5LA 4NCJA 1JEDA 5IRCD 2CHQA 3LQRA 5DH9A 5B57C 2EVWX 2Q9CA 2WJVA 3H86A 3LD9A 2QGZA 1J8MF 2QAGA 3ZZTA 1IN8A 2CJWA 1E2LA 3KUDA 3NKVA 4B34A 2FH5B 3DO6A 3D7MA 3EXAA 2CCKA 3I5XA 1Z8FA 5F3WB 2VHUA 3AH8A 3IIMA 4TLBA 3IPYA 4C0JA 3KJHA 2CLDX 2GZDA 3T5GA 4B73A 1FFHA 1TQ4A 3AVYA 2QPTA 2P0EA 3B1WA 3QF4B 5FL3A 2VP9A 2ATXA 1E0JA 5KU1A 2VP2A 1J7KA 2RH5A 3U7FB 3DM9B 1AZSC 1E9SA 2J7KA 2YHSA 3MWKA 1YQTA 2QPOA 3I8SA 2F43B 3KKQA 2LKCA 1SVKA 1UKVY 2OBLA 4TT3A 3ZGXA 2BBTA 2NZJA 3BFVA 4QKQA 1GFIA 2R6CA 4URWR 3P1JA 3AVQA 4DLSA 2ZREA 1NG9A 2B21A 1VG8A 2RKOA 2FEOA 3OEHA 4XVQA 5B58C 2CK3D 4NCHA 2IL1A 1F2UA 1JJ7A 1KI9A 4DJTA 5JRZA 4QRHA 3AVOA 1EX7A 2WWYA 1QG2A 3TMKA 3ZLJA 5KPDA 4NPHA 4WW0A 2QEQA 3D8BA 3EZ2A 3TAHA 1S1CA 1XWIA 2QU8A 3LWNA 2G83A 3BERA 3Q7PA 4LOAA 2GCNA 1VHTA 5FBVB 1ZBDA 2C9OA 2H18A 3AKEA 1Z08A 3RS7A 4DLYA 3EASA 2VIIA 4D4LA 2QRNA 1W49A 4KVGA 1MT0A 1NLZA 4EPXA 2YOHA 1XJCA 3TSOA 2FZLA 2JATA 4IFBA 1JECA 4A2PA 1DO2A 2H1LA 4LYAA 1JXMA 1FNMA 3NBZC 3NH9A 3UK6A 2F1RA 3NBFA 4KLZA 2HDNB 1COWA 4BFWA 4CGZA 1GNPA 4D0NA 4Q7JB 1UEJA 2I3BA 2OFWA 2ZRLA 4FXPA 1S9DA 5BYJA 4H1VA 4RKEA 1E9DA 2JLQA 3ZH9B 1TU4A 3EG5A 5CJPA 2VPPA 1G21E 4DLXA 1CR2A 3SJBA 3OFND 3OIYA 1NY5A 2E1RA 1KO5A 2HYIC 4KXFB 2OM2A 4PX9A 1KZGB 3ZIAD 1KSJA 5J5CA 5D3MB 1L7VC 4DCTA 1QHXA 5L8VA 3KQKA 1I2DA 1NVVQ 1OXTA 4NONA 2N46A 4PQYA 2ZUDA 3TLXA 5EE9A 1OT3A 1A2BA 2H8KA 2RGAA 2WMOB 3FYHA 3IDQA 3B9PA 4OK6A 3SJCA 4M1WA 3TKLA 3W5IA 4U00A 1S2MA 2HUPA 3ASYA 1Z29A 1EG7A 4D82A 4UQOA 1X8LA 2G9NA 4D0LB 3QPVA 3FKSD 4LHWA 3CNOA 3RC3A 4YMTA 1PV4A 1E2PA 4AYWA 1SXJA 2ZRHA 3KKNA 4BFYA 4BLSA 2PMDA 4BECA 5HPYB 1XXHB 3IHLA 4Q9JA 4X8HA 3K70B 2OE2A 2BMEA 2I1QA 2ZRGA 4ZPXA 4TL7A 4Q9HA 5E4FA 1SXJC 1TEXA 2HCBA 1E0SA 4AK9A 3GJ6A 3PQCA 1EFTA 3GFPA 1Q12A 1E1RA 1TMKA 2YJTD 4XJXA 3PIRA 1DAGA 4Q1AA 5KSZA 4LUCA 1P9NA 2TMKA 4GSYA 1P2SA 1IXRC 4WXPA 2XNDD 4HAVA 4I1OA 2AWNA 221PA 2JAQA 3ZS9A 3L8YA 3QVUA 1KY2A 1FZQA 3QIAA 5CIWA 1W0JA 3LXRA 2EU8A 1GAJA 5J47A 4GNKA 4NMMA 3BBPA 2FFAA 2Z5FA 2IYXA 5JJKA 4Q01A 3IO3A 5AUQA 5A4JA 4PXAA 3T1TA 5GVRA 1ESMA 1UKZA 3EPLA 1CS4C 1JAHA 5HCIA 4B76A 1XJ0A 4BWYA 1W36B 1OYYA 3WXMA 4Q4HB 2OCYC 3QENA 2KI5A 3U60B 2GA8A 3LAWA 2F9MA 1Z2CA 4DT1A 4CEJB 4LJ6A 2JLUA 2OT3B 3CRMA 2EFGA 2F3RA 3WHKA 1XCMA 4DCUA 2BOVA 3HPQA 5SZIA 4BFUA 3LH5A 4GZMA 2AXNA 3L82B 4DCSA 1DAMA 3DDCA 3ECCA 1N5JA 4P33A 2QE7A 3AGPA 3I4LA 1IXZA 1G64A 1N0WA 1ZU5A 1J70A 2WWWA 2BCGY 1G4UR 4D80A 1X8JA 1KO1A 3D3QA 4NL4H 1IHUA 2KB0A 1KKMA 2A9KA 3DOFA 2FX3A 5SZHB 2JDID 2G1JA 3LW7A 1NKTA 2PH1A 3GLIB 1LY1A 3EC2A 4WBSA 1I4LD 2ZI4A 3WMFA 4LV8B 1NJGA 2DWQA 2WWXA 2ZRFA 3NDBB 1XP8A 3HU3A 2XB2A 1II8B 2ONKA 4TLDA 2A5YB 3VU9A 3U4QB 2HT1A 2GZAA 3BIFA 2VRWA 3IGFA 1KI6B 5H68A 3OE7D 1LB1B 4GRAA 1Q20A 3B5JA 1DADA 2PZFA 2EFEB 2ZQ5A 4OI2A 5FBLB 2GF9A 1JEEA 2L0XA 3K0CC 4KSCA 1W0KD 1BO6A 1S9HA 4LJ5A 5DN6A 1KK2A 2J87A 2OCPA 4LRWA 1HH4A 1Q3TA 2BBWA 2RGNC 1Q22A 2CVHA 3CWQA 4O2RA 1FW6A 2AHOA 1OPXA 1IJEA 1E1QA 2OCAA 4TMTA 4JIMA 1FTSA 2W2TA 3PEUA 4JKIA 5DISB 2QMOA 4N0DA 1DEKA 1KNXA 2YVUA 4KFRA 2AK3A 1TQ6A 2PJZA 2YWEA 2H57A 4TZ6A 4HSEA 4DXAA 1FMJA 3VR2A 4E5UA 3EPKA 5EE3A 2REBA 1P75A 2RB4A 4HLUA 3G0HA 4LX0A 3QKSB 3C41J 3AVUA 4ESHA 5ELXA 3TGPA 2D74A 4EUNA 3UKDA 3AP3A 4QBFA 3LVQE 2ZJZA 2OLKA 2IXEA 2OSBA 3LLMA 2DPXA 2GDJA 5J4HA 5KSYA 1MH1A 2YZ2A 3K70D 2IC5A 5KSOA 4RSGA 3KJGA 2GWHA 3NWJA 4BFVA 2ZU6A 2XJ9A 1SGWA 4PHFA 4OJKA 4CIDA 3T1VA 1FP7A 2B8TA 3HR8A 1W4BA 5IDVA 3BK7A 4BLTA 4G5OA 1KK3A 3RS3A 3W6NA 1UAAA 1M7BA 2Q0HA 2CL7X 4GFDA 2G1KA 2Z0MA 1P3JA 3NC0C 4QBIA 1UBFA 2ZI7A 1XJQA 3IQXA 5E95A 4LSGA 3U44A 5LPNA 3I5YA 1CRPA 4EPVA 3FPAA 1W2GA 4MRVA 3R7WA 4FMBB 5C18A 3PUYA 2EQBA 1E9EA 1AGPA 3RDPA 4GMXA 2ANBA 2GJAA 3EW9A 4KODA 5EQTA 4M1SA 4KCGA 1QHHB 2ZSAA 5EJEA 3SBEA 3SI7A 4N1AA 1AS0A 2H17A 1DPFA 3EA0A 1XCGB 1OFUX 4HYYA 1SHZA 1G3RA 2WWIA 3KUCA 1W36D 5JSZB 2QBYB 1X6VA 1KI2A 1E32A 4I1UA 4GMDA 2EWWA 1BOFA 4QJ5A 3X1XA 1II0A 3TR5A 3I62A 1T5IA 3BOSA 1W44A 3C14C 1EFUA 4BLQA 4PSVA 4HUTA 1G3IA 4B47A 1EWQA 3CWZA 3BAFA 5HZKA 5G40A 1OH8A 1I2MA 3N70A 1IN5A 4YC7A 4US2R 1FP6A 1G8FA 4Q03A 2GVDC 1XBTA 1H8ED 2Z4SA 3K0FA 5AK0A 1YZNA 2ZR0A 2PMKA 5JMTA 5GJWC 5DHAA 5FL7A 3A6PC 3RS2A 4M1KA 3AVXA 2RGDA 1M6NA 4OQFA 3TK1A 2BC9A 3KJIA 1ODFA 1ZU4A 4CW7A 1ETUA 1HT1E 2WZQA 4YLGA 5CJ2A 4B48A 3IEUA 3RSLA 1FQJA 2QAGB 2RHDA 4B43A 5CIQA 4C0QC 4BE7B 5JFGA 1DBSA 2CJWB 2HLDA 3HJNA 1U0JA 2V1UA 1K6MA 1LV7A 4YONB 1KDOA 1T3SA 4DLUA 4D0GA 2J0QA 1A7JA 5FOTA 4KFUA 3W9YA 1GKIA 4HLCA 2QENA 1H8HA 2W6ID 3B1XA 5P21A 4X8MA 2QQEA 1G18A 5TDHA 3K9LA 3KL4A 4C3ZA 1E2DA 3QKRB 2QMEA 2BV3A 1CXZA 2IW3A 4QJ4A 3ZDQA 2RMKA 1VCIA 4QBGB 2OV2A 3A4NA 5TB5A 1UDWA 1XTIA 1SVMA 2KE5A 2GILA 2RGXA 3CF6R 3VNVA 2C98A 2FZ4A 3OEED 2P5SA 1A5TA 2ZI3A 4A0RA 1E99A 3UXMA 3ZS8A 1X3SA 4ILEA 1Q0UA 3IHWA 4L16A 1QRAA 2O0KA 3KXLA 1Q1EA 1JQLB 1S3SA 1F2UB 4IEIA 4Q7LA 4RD4A 5HZHA 3GEIA 1MKYA 3TW8B 1UF9A 3LFUA 1FMLA 5CLQA 3C16C 2VEDA 3GJ7A 1OKKA 2J0UA 4LPSA 3VMFA 4JBYA 2BKEA 1CJTC 2WPDD 1YZUA 5JS8A 3AVVA 3SYLA 1E79D 2H92A 1EFRA 2JGNA 2V9PA 3CUEF 4RZXA 5CM8B 2RAPA 4A0FA 1CEEA 1JQJC 5FOXA 1AQYA 2NOAA 5EE1A 5EP2A 2WICA 5EE5B 1R4AA 5JI2E 3NEYA 821PA 2G0NA 3SN6A 5G3ZA 3VQTA 2FA9A 5C4MA 3V4RA 3RHFA 2XXAA 1VYUA 2AKAB 2BCJQ 2Z43A 3O8BA 5JZVA 2OXRA 3CR8A 1P2VA 2V3CC 2IYRA 3F8TA 5J4YA 4EDHA 2KJQA 3GLFE 3RC8A 3UATA 4BASA 2ZJAA 4ZIRA 5HE8A 2XAUA 3W6PA 3U3RA 2F9LA 3BORA 4ACBA 2IYWA 1KI7A 2AKYA 3A1UA 5JEEA 1HQYE 4C7OA 1XPRA 2DWOA 4Z1MD 2ZI9A 2JLZA 4RD0A 4B75A 2D2FA 2JJ2A 3BB1A 3VAAA 5DE3A 2EW1A 1KIMA 2RGBA 4Z8XA 1YR7A 2NO7A 2WOOA 3MJRA 5G41A 5AJVB 4CVNA 3PCRB 3P26A 3PENA 3GLHA 3B8HA 2V1XA 4BLRA 2RGEA 4JLAA 1CR1A 2GZHA 5EP3A 3K1JA 4HAWA 2X2FA 2XGJA 2D4HA 4Q5IA 2B7CA 2LWIA 1DTSA 2J7PD 3AF0A 4JLJA 5LD2C 1PZNA 2ZANA 4NYMQ 4ASUD 2MMCA 1KAOA 3K8YA 4KU4A 3TAUA 2OFOA 4HDCA 1SULA 4MUBA 2IYYA 1SXJB 4QG7A 4JSYA 1NMYA 5CK5A 2OO7A 4PZYA 1CR0A 2A2ZA 3DL0A 1K8RA 2BJVA 3B2EA 4KYIB 3O8DA 4ZI3A 3PXGA 3C15C 2OLJA 1LVGA 4US0R 1QBKC 2BBSA 3CONA 3IBYA 2Q6TA 5GJCA 1S4QA 4TTPA 2D06A 2JJ1A 4IEEA 3H1TA 1OSNA 3U7GA 1V5WA 4HB2A 4OK5A 4E07A 2WSSA 4NCNA 4ZV4A 1C1YA 2GCOA 3UWKA 3KQUA 3A4LA 1W7AA 2O8BA 4LBYA 1WP9A 4A8JA 1Z47A 1TNDA 2BJWA 2FDCA 3T1OA 5F2EA 2DR3A 3T61A 4OI1A 4II7A 2IXGA 4JSTA 3WHLA 3SQXA 4WA7A 4KHZA 1W46A 2IK8A 4TT3D 3KDSE 5J40A 4IW3B 4JLPA 4NZYA 4Z51A 4ZCIA 1G5PA 4FWIB 2YWFA 1ZCAA 3D6TB 3MJHA 4GOXA 4IHQA 4O0MA 2ZXUA 4FMCF 2PEYA 5EXSA 2GBLA 3OEHD 4NU0A 4I1SA 1GG2A 1NLFA 4WXRA 4ZCMA 2CE2X 4DCNA 2W0MA 4DT1B 3QXSA 4FMCB 2CL6X 4B32A 1XF9A 5FI1B 4P31A 2PEZA 4EPRA 1HYQA 4IDPA 1KHTA 4BGDA 4Q1FA 1N2CE 4C30A 1F60A 5TMPA 2P3SA 2GK7A 2NTYC 4IOMA 4BZQA 5KSPA 1TU3A 3W8NA 4M22A 5FPTA 3VNUA 1N6LA 2C77A 3GFTA 2GXAA 2O0JA 4JJKA 5DSZA 2XITA 2ZITA 3BS4A 4RKFA 4B3DA 4A2WA 1M7HA 1Z07A 2QP9X 3QY0A 3LY5A 3I92A 2ZYUX 1AM4D 3QG5A 4L4UA 4JZKA 3GEEA 3GEHA 4MKHA 5FOUA 4DLZA 4DUGD 2FPLA 3GLGA 3A1TA 2HXSA 4UJ3A 1P73A 4JBWA 2IF2A 1OE0A 3CO5A 1P61B 1TX4B 3EARA 2J46A 2R6FA 3ONWA 3PEWA 3DKPA 2QUZA 5H8WA 3GJ4A 3VU9B 3KX2A 2A3RA 1R2QA 4Q18A 2F55A 3Q3JB 4KLNA 4A92A 4QGFA 2WSMA 5FTLA 5DNYB 2WBLC 2FMXA 2EFCB 1CKEA 1W4RA 4PO8A 1AS2A 1YU9A 1RIFA 4OKSA 4PFSA 4TMZA 2A78A 4AURA 3CF0A 2CBZA 2F1JA 4DIDA 4P32A 1DVRA 3BXZA 3CPJB 4B74A 3OF5A 1FQKA 2XB4A 5F98A 4JVLA 1KI3A 1QHNA 2ORIA 3GJXC 4XD7A 4EQ6A 4ZDKA 3RWMB 5AJXA 2QAGC 4F92B 4B44A 1AZTA 5CITA 4LJ8A 2XSZA 3LVRE 2REOA 4C0AC 5FH9A 4S35A 1OB5A 3P4YA 4XIGS 2ZTSA 1BH2A 4MKGA 3B6EA 4R2HA 4MYTA 3CB4A 4TYNA 2O8CA 1U8AA 2X1VA 4DLWA 2D3WA 4NKRA 4EPYA 1XX6A 1Z22A 1U9IA 2DFKB 2G88A 2WMNB 4MKFA 4UXIA 1KSGA 2P5TB 4IFEA 4G3XA 2DB3A 1NVVR 1SXJD 1R7RA 4M21A 3UWOA 4H1UA 4CRWB 2F1IA 4JL6A 1KKLA 4UJ5A 1XD2A 1SHKA 1Y3AA 2GAAA 3BH6A 1ZUHA 4LJYA 4TL9A 4TL6A 1E1RD 1Z2AA 2R62A 1U0HC 1E4VA 3WNDA 1XRJA 3A1SA 3H4MA 3U3MA 3QNUA 4EKDA 4M1OA 3CRRA 4US1R 2R6DA 1TF5A 5KHOC 1CRQA 2ATVA 4LC1A 1XD9A 3LXXA 3U44B 2EYQA 2C5LA 2V4ZA 4PC6A 2ZSFA 3R7WB 3MWYW 4PHHA 4QGAA 2D7CA 5KUTA 1T3LA 1XTRA 4LY6A 5FBRB 4TMKA 2ZIAA 2IWHA 4A6PA 3AVPA 1VCOA 2ZE8A 2O8DA 1G41A 2CCGA 4HB3A 5DI3A 3EAQA 2ZSEA 1KI8A 2QGNA 2ODBA 3FWYA 5FTJA 1TUEA 1U81A 2GKSA 4FCTA 3BB3A 1S1MA 4CDGA 1YZGA 5JHHB 3AVTA 4I81A 2GJ8A 3OZXA 4ERNA 4JJZA 4IDHA 1E2JA 4IDNA 5DHFA 1SKYB 4K81B 5FFMA 3UG6A 4C0LA 1FL9A 4PC7A 3WRXC 4OHWA 2G77B 5AJWA 2VLIA 5E7IA 3P32A 5JCPA 3LRPA 3EPJA 4DRZA 2Q3FA 1R5OA 1ZUNB 2X2EA 1N6KA 3LX8A 4L5BA 5F9HA 1YZTA 3K0AA 5IF9A 1D2MA 1ZM9A 3ZVLA 3J81k 4TYQA 1JR3D 1RVDA 2EFHB 3K09A 8OHMA 4MDFA 2QE7D 4XSHA 5FUYA 1DELA 2QM8A 4LJ9A 1DOAA 121PA 4ACAA 4POAA 3K0FB 3AEZA 1AJEA 3V9PA 1NKSA 1OXSC 1QG4A 3LX5A 4EAQA 5EE0A 3R9WA 1WF3A 1T0JB 2QI9C 1OW3B 1ZNYA 1KI1A 1EXMA 4HATA 1OF1A 3X1YA 3VR5A 4Q1DA 1II9A 3RRNA 4URVR 3ADDA 3B1VA 2QNRA 2CHVA 2VHCA 1VCMA 3PEYA 4XWAA 1M1YE 4M0LA 1QVRA 2C78A 4L8GA 3SDZA 3WP1B 1RPZA 1F2TA 2FFBA 1OFIA 1MO4A 4IXNA 5L3SA 2FPMA 5B2ZA 1U8ZA 1NVWQ 1GNRA 1RKBA 4LHVA 4JBXA 4YXWD 1L2TA 1KYIA 4DB4A 3WY9A 4D25A 3IIJA 4TLEA 2FNAA 2VP4A 4HLQB 5IHPA 1WDTA 3THWA 5C4GB 2GEDA 1W4AA 3CNLA 2FFHA 1E4YA 2F3TA 2CHGA 4NDZA 4A0HA 2HF8A 3WRYC 2NPFA 2VF7A 3THYB 1WXQA 1E1QD 5IK2A 4OQLA 2LCFA 4I1VA 4WIAA 4W5JA 2HJGA 2JLYA 2FSIA 4R7ZA 1BMFA 4HZUA 3TQCA 1T0HB 1N6IA 2BEJA 5JWHA 2O8FA 1GWNA 1AGRA 4O3MA 4Q66C 4FW9A 4XTCS 4Q00A 2CNWD 2RHMA 2XTZA 4Q21A 2IA5A 1TL7C 4F4CA 5M04A 1B23P 5CLLA 4ZO4A 4F7WA 4Q7MB 3CIOA 1US8A 1T4GA 3N5CA 3M0EA 3LDAA 2J0UB 3OIVA 4F4JA 1ZM2A 3K9NA 4YMVA 4DSTA 2PT7A 1FOEB 1OH7A 2J0SA 4TSFA 1G7SA 4F38A 3EZFA 2A5DA 5FOSA 4DLTA 3AF1A 1E2HA 1DAHA 2IUSA 1QDEA 4ABYA 1YR6A 3QEOA 3AB3A 2QAJA 4AKHA 1U98A 2PT5A 4M53A 4QNRA 4MITA 2XXAB 1XCPA 1H65A 3TRFA 1KY3A 4HB4A 2G0TA 1ZD8A 4PPFA 4TL8A 2V54A 2JLVA 2NO9A 2NPIA 3KZ1E 5EZ6B 2BHRA 5IT5A 1XPOA 5CDFE 2JEOA 1XD8A 3BJIC 1E2EA 3WYGA 4TWZA 4DB2A 2WAYA 1WBBA 1W2HA 1Z0JA 2E9SA 2FJUA 2DFNA 2MSEB 3SC3A 4C7OB 5BW8A 1N6OA 1I4DD 3FDIA 2YNMA 4B3XA 1WRBA 4LYHA 3QXXA 5AWFC 3ETLA 4XSGA 1S8FA 3L2OB 4FINA 3RVBA 1WE2A 4D4JA 1NSFA 2IS4A 3ZD6A 2IEZA 3IUYA 3GLHB 3EWSA 5LD2B 3ZIAA 1NNEA 5JS7A 1YR8A 1NVXQ 3KXIA 2ZRKA 3NEJA 5BYKA 1J2JA 3PEVA 1ZNZA 3IEVA 1GSIA 1VTKA 5H1YA 3RLFA 3B7GA 4ZCLA 5TARA 3SFVA 3QKTA 3ICQB 5FL7D 1NY6A 1CULC 3ADKA 3U2QA 5AUOB 1OH5A 2J5XA 3A8TA 5KDOA 1JB1A 4PR0A 4TMWA 2ZPTX 3PFIA 4S2EA 1XTQA 4JLKA 1VHLA 5DO9A 2ZRJA 4HAYA 1W47A 5KDDA 2JLWA 1IJFA 2XTNA 1VG9B 5TV2A 1GIAA 2VO1A 4G0NA 2HLDD 3MSXA 2HXYA 4HZIA 3VHLB 3ZZUA 4BFSA 3QF7A 2IEYA 4UXHA 1NRJB 3GLFA 2ORVA 2ODEA 5FTKA 3FHCB 4EPTA 3O8RA 4NBSA 3B60A 1XTKA 1H8HD 2GCOB 4HLUC 4GOJA 2XOKA 1Z0KA 3X1DA 3MWLA 4KBGA 2Q9BA 1J8YF 3T34A 4EFNA 2O8BB 1XU4A 2XNDA 3TW4A 2JIZD 4IXMA 3H2YA 1N0UA 4LC0A 3CH5A 3CX6A 3TH5A 2BEKA 1ZAKA 4B2PA 1HQCA 1N5IA 4U02A 4U7DA 1NG1A 1XFAA 3G82C 2ONJA 3GJ8A 4X8OA 1IN4A 3VKWA 1E2QA 2FU5C 5L3QA 4CF7A 4W9MC 3U6KA 1CJVC 4DEYA 5GVSA 4QXAA 2PZEA 2FEMA 3Q7QA 3GFOA 1S0UA 1IQPA 3CPHA 1NBMD 4X8LA 2B92A 5J4VA 3U7HB 1KJYA 2IF0A 4IDOA 4GBMA 2MSDB 3O47A 5DI9A 2P6NA 1RRCA 1KMHA 1DAIA 5FPYA 1P2UA 1EFRD 2J45A 4GZLA 3QBVA 1NN1A 2GCPA 3Q5EA 1OHHD 1ZUIA 3EWAA 1XNJA 1D9XA 4LV5B 3L0IB 3QPUA 3FHTA 1V43A 2NGRA 4RD6A 4IVQA 2DHRA 1NF3A 4CEIA 4HAUA 4OHVA 3GLGB 2NQ2C 4NCIA 4JKYA 1OXUA 4MYUA 1JBKA 4RCZA 2J1LA 1SXJE 2GXQA 2JDIA 3ADBA 1UADA 1M8PA 4IVPA 2JASA 2GXUA 4URZR 1OLOA 3UG7A 4OQXA 1N5LA 4FIDA 4OYHA 1GITA 3RNLA 3KXKA 1XMIA 4C0BA 1ZNXA 4D81A 1W5TA 3O8CA 1IY1A 2QQ0A 4V0MA 3SR0A 4HLDA 3HU2A 3IQWA 2Z6VA 2ZRDA 3OE7A 1LNZA 5G3YA 3U5ZB 2FWRA 4OK3A 4Q7KA 3VR4A 2XZOA 1ZC4A 2DWPA 2JJ2D 3K0EA 1MOZA 2ZAMA 2DFTA 4YQFA 2C96A 4EQ6B 4MGKR 4P4SA 4TLAA 2QT1A 1SVSA 4PAOA 4ON9A 1W0KA 4G5GA 2IYQA 3K9HA 1TUIA 4KFSA 4A0GA 5FTMA 2QROA 3CPEA 4TQAA 1RRGA 1YRAA 2YC2C 2ZSDA 4B3GA 4WOPA 1AK2A 4MKIA 4IDQA 1KGDA 4F93B 2ZRPA 1UBEA 5D3QA 4JLBA 5FOVA 1W48A 4B3FX 1QVAA 2O8CB 3L0OA 4PAMA 3TUIC 3T35A 1CTQA 1VG0B 3WYFA 3EIHA 4JS0A 4DDUA 621PA 4FWTA 2WJGA 3KKOA 1IY2A 2VQSA 1AQUA 1XEXA 4KI0A 3M6AA 4QFMA 1XD2B 1HA3A 4LYJA 5JRJA 1JR3E 2CMKA 3AKCA 4NYMR 2PX3A 3TVDA 3RS0A 2W83A 2ZRCA 3LA6A 2JJ1D 3UPUA 1E0AA 3R8CA 5B64A 3FMFA 2C04A 2MSCB 1X1RA 2AX4A 4O2LA 1UDXA 1PUJA 2IS2A 4Q47A 1AS3A 1ZM4A 4R71A 4YDHB 4P4TA 1RRPA 1SVOA 3LV8A 3ZVRA 2ZEJA 4JVMA 1AKEA 4W5WA 1RC8A 1NLYA 3CRQA 5SZKB 3BE4A 3NIBA 2YOGA 3MUFA 4KBFA 1CP2A 3EIQA 2CE7A 4ZKDA 5DYIA 2UKDA 2O8DB 3CRVA 3SEAA 2FF7A 2ZYWX 1X8KA 5DI3B 1TADA 1DAFA 1OXVA 4M1YA 1TAGA 4TMXA 3B78A 4TMVA 4HI0E 4UNQA 2D62A 4JT2A 5HCNA 1Z6TA 4MA4A 1E9CA 1KDRA 3SE0A 2OESA 2OFXA 2IUUA 1OIXA 1Z6YA 1A1VA 4AY2A 1M74A 2Z83A 3SHFA 5FR2A 2PL3A 2GTPA 2IWRA 4XH9B 4Z8YA 5FPSA 3C8UA 1D2NA 1JI0A 3HYTA 1E2KA 2QY9A 1GKUB 3LBHA 1O87A 4XWOA 1C4OA 5CYOA 4QJ3A 4EJSA 2VL7A 3DM5A 1VECA 1B0UA 5EXTA 4AC9A 4DZZA 2BMDA 2OEPA 1FX0A 2VHJA 3K0AB 1ZM7A 2HJVA 1KZ7B 2O0HA 2WHXA 3FB4A 3I3SR 5AJYA 1E3MA 4GP6A 4N0EA 4F91B 3V4FA 4RZ2A 2YOFA 1KO7A 1BYIA 4Q1CA 2CCJA 1G17A 2GEUA 2SHKA 4PTLA 4BEJA 1G3UA 4B3BA 3ADCA 2OAP1 1KK0A 3FVQA 3HDTA 1KO4A 3RRZA 1P62B 4MYHA 1PLLA 3TIFA 2B6HA 5HKKA 3DZDA 3MG9A 4URUR 3GJ0A 4LHYA 4C0HA 3ZD7A 4W7SA 1G8YA 3AM1A 2YYZA 2ZJ2A 3IBGA 3SYKA 3LNCA 1GOTA 4PAQA 2YINC 3THXA 4FI3C 1P60A 1F2TB 1HUQA 1ZINA 3SFZA 3QEJA 4ZI2A 3CNNA 2BMFA 2QT0A 1XMJA 2KWIA 1VG1A 1KNQA 3S1AA 5L3SB 1N3BA 1MRSA 2R8RA 2EFDB 2VSXA 1UJ2A 1ZCBA 4DVGA 2DY1A 1YKSA 1XEFA 3QQ5A 1WQ1R 1YHNA 4OI4A 1SZPA 3THWB 4Q9KA 4LJAA 2GHIA 1Z6AA 2FGKA 2UZIR 2GXSA 3DMNA 5JLJA 1YR9A 2CL0X 3MRSA 4RD3A 3TUZC 4CYMA 3A4MA 4XD7D 2BMJA 1VDZA 2PLRA 3RSOA 2WWHA 2NO6A 4MRSA 3IILA 1NI3A 2WKPA 2GETA 3NBYC 2Y8EA 3GCGA 1ZMXA 1E0KA 2WJJA 3H84A 2PCLA 2QRZA 4L9SA 2ZROA 3B13B 4QBHA 2WM9B 1U0LA 4HZUB 4BUJA 3OEEA 3SBDA 1MRNA 2O5VA 1G5RA 2O8FB 1QF9A 2JLRA 2PCJA 2ZR9A 4PC1A 1SKYE 2R9VA 2AWOA 1DAKA 2P6RA 3FHOA 4MYCA 3EZ6A 4P3YA 1OYWA 1HE1C 1US8B 3K53A 3SQWA 1PUIA 2PX0A 2R6AA 2O8EA 4RD2A 4A8JC 4LI0A 2Z4RA 4RY2A 1M7GA 5C1BA 1QHYA 3SOPA 2KSQA 5CB8A 3TNFA 2CVFA 1R6BX 4QHYA 3AUXA 1U99A 5JWRA 3GQBA 2XZPA 1E79A 2GBLC 1J90A 1HEIA 3EX7C 1RJ9A 1NJFA 2FOLA 4UNPA 5ANRB 3CH4B 3ZQ6A 3QOFA 1G5TA 2VH5R 1XTJA 2C9CA 5FUXA 1BIFA 5HTKA 1F5NA 2J9RA 2QSYA 2BWJA 2AL7A 2ZS9A 3WBJA 4OHYA 2WIAA 4D26A 1TQ2A 2F6RA 5KTYA 2ZS7A 2N42A 4M2LA 3TQFA 3RRYA 1J99A 2MMGA 4PSKA 1XB2A 1CJUC 4LYFA 4Q4JA 1G9XA 3OAAA 5BXQC 2R65A 1RFLA 5FBQB 2V7QA 1W4CA 1R5BA 1L8QA 3A1VA 2ZVQX 3REFA 1Q3HA 3NTUA 4BZPA 4N3NA 3JVUA 3WNBA 3EZ7A 2R44A 3L43A 4G1UC 1XXHE 3TSWA 2KBEA 1UPTA 1COWD 3U3OA 1GVNB 3AKDA 1OB2A 4EPWA 2ORWA 5F9FA 5J4KA 2BM0A 3OESA 4R98A 1IBRA 2Q21A 3Q8XB 3TVTA 1E69A 4BFZA 4E03A 4EFLA 2VP5A 4OQNA 1MV5A 2ZUCA 4ZDIA 2WJHA 1P2TA 3WYAA 1MABA 2FPKA 3NXSA 3B1YA 1WA5A 3UANA 3A1WA 1RYHA 4KJZA 1OXXK 3F5FA 3HR7A 2W6JA 3LO5A 2QMHA 4V0OA 3KQNA 3M1IA 1IN7A 1P9RA 3QBTA 2ZJ5A 1OIWA 3LW8A 3AGQA 2QP3A 1FUUA 1T8UA 1NBME 4BLOA 4QM6A 4MUAA 4JT4A 4BFTA 4MGIR 2AD1A 2GEVA 4UNRA 1NN3A 2Q3HA 4JVSB 4PPGA 3SS8A 1IN6A 3VFDA 1GL7A 1G3MA 1WCV1 2IYZA 4TYYA 1FUKA 1T8TA 2IYLD 3GLFB 4KV9A 1ELOA 4HDQB 5CDFA 2VA8A 3R20A 3R9IA 4LBZA 1MO6A 2V55B 3TJZA 4M9XA 1R0YA 1KTVA 1Z28A 1U9IC 4OHZA 5TXGA 2UVQA 4PZLA 3RS4A 4AYXA 3NG1A 2OILA 4RVCA 1KO8A 3KTAA 3QKRA 1DS6A 2GJSA 1CBUA 4K8OA 4NYJR 2QM7A 1XZPA 3FKQA 1OJLA 5IK2D 3JZMA 5L3VA 4GOKA 4Q1BA 5EXXA 4C0KA 2REXB 4AIIA 1GTVA 1GM5A 1BMFD 1N25A 3TR0A 4Y0AA 2G6BA 3GLIE 4NYIQ 1JALA 5K8UA 5LB4A 2XTMA 1E6CA 2XEXA 5L3QB 2ERXA 2YKGA 3N2IA 2C03A 4U5XA 4Y0VA 1W0JD 4OHXA 2ZE5A 1BS1A 2FSHA 2ODNA 3RRMA 4CZ2A 4G01B 5CB6A 3VTKA 3U6BA 4M8NE 4HDOB 4XVRA 1E2MA 1G6HA 3AV0B 3JVVA 4M1TA 2J0VA 4PO1A 3T06B 4DKXA 3GLHE 1JR6A 3AUYA 3ND9A 1ONBA 1KMHB 1NMXA 1C9KA 2P67A 4ITRC 3KKPA 4J0QA 4TSFD 5EP4A 2ZYTX 4QOSA 4IKEA 5JJLA 4CEHA 4DIEA 4TLCA 2ZUBA 1O3YA 4YMSA 1Y63A 2FSGA 1R10A 5UKDA 4M9ZA 1XTSA 1R0XA 1CLUA 2IT1A 2ZR7A 4A1FA 3NDPA 4CEIB 1YVDA 2NIPA 4B2LA 1GP2A 3Q72A 1YZQA 2GF0A 3IO5A 3LBIA 3QXCA 4DUGA 2LKDA 5J4LA 4R9UC 1N0VC 1AIPA 2VF8A 2GVZC 2HYDA 3SHWA 4I4LA 4URYR 4Q1EA 5FOWA 3K09C 3SJAA 2G3YA 1EFHA 4A4DA 4XOIA 1UKEA 4UNNA 4F4IA 4HUQA 1N6PA 4G5RA 4TYWA 3KFVA 1G291 1Q1QA 4PSAA 2CXXA 3EPHA 3IIKA 3E70C 4K46A 2NO1A 3QSYA 3PITA 4PPNA 5DGXA 2JA1A 3K0SA 5KPJA 4Q4LA 2CDNA 2NG1A 1WB9A 2R6GA 3P20A 1KI4A 4V0KA 2IYUA 4Q9LA 3M4YA 4B71A 2IXFA 2ZJYA 1ZW6A 3IPXA 3AF3A 4NYJQ 4P4SB 4PQFA 2ZVPX 2W58A 1YJ5A 2AR7A 2J59A 2V6JA 2ZRIA 3SYNA 3HPRA 3L8ZA 4NHOA 4QGHA 4BEBA 5C2JB 5JJIA 1E94E 1Z0DA 4DLRA 2XX3A 4PC3A 1HE8B 2IX3A 3W5JA 4RZ3A 2V8OA 4DSNA 3QG1A 3DEFA 4PHGA 4AKIA 1SQ5A 3V00A 2ASEA 1YRBA 1OH6A 4C9BA 2IYSA 5DN6D 3NC1C 1MO3A 4AG5A 1NN5A 3MD0A 3PR1A 1IONA 3PG5A 2BDTA 4LCBA 3NHBA 4L15A 1XEXB 1QHSA 2ZJBA 4ARZA 2QTFA 1IY0A 2DBYA 3FGNA 3WNCA 4DLVA 5KYKA 3F3YA 2BIFA 4AYTA 1GL6A 4FMDF 2C95A 1T3HA 3C4JA 1G3QA 1BKDR 4CT5A 3QE0A 1SKQA 3EA5A 5G53C 4FMDB 2GJKA 2CK3A 2PLFA 1G8GA 1Q1BA 1RRFA 3C5CA 2QN6A 1G8HA 2ZJOA 2ZU0C 5LB2A 3C7KA 721PA 1VPLA 2FSFA 5HE9A 4B2IA 5JCZA 2XOKD 3GLGE 4Q4AA 4RJLA 2PJRA 6Q21A 1K5DA 3I32A 1GKYA 1S3GA 1W1WA 1HURA 2R2AA 3LBNA 3QXHA 2OBMA 4OQMA 3D31A 5FUWA 1EESA 3E2IA 4JL8A 5CK4A 3AP1A 1EGAA 3B82A 2EWVA 2CLSA 3E5HA 2FFQA 3MGCA 1W5SA 2WAXA 2X19A 4A9AA 2AK2A 4MQBA 1T6NA 4GI7A 3REGA 4D4MA 3ICEA 4C2TA 1DG3A 3UMFA 1NVUQ 3MWJA 4C0SA 2PBRA 3CBQA 3EZ9A 3QKUA 5TY0A 3MCAA 4Q9IA 4B6FA 3U61B 2DCUA 1XMVA 2H7VA 3FFAA 1A82A 2QTHA 1ZJ6A 1N6HA 2ZRAA 2RCNA 2OHFA 4ZIRB 4M9QA 5FTNA 4EJSB 1A4RA 2QTVB 4URXR 5GADl 2WWFA 1P4SA 3KJEA 5FPHA 1FX0B 3HU1A 1GRRA 3EIEA 4JMPA 1HV8A 1XMSA 2Q9AA 1CR4A 1WMSA 4MRRA 4AG6A 4Z54A 5KDLA 1PVOA 1F6BA 3CM0A 3PUZA 1DE0A 4KAXA 1JR3A 2ODWA 5KO2A 3T5DA 4E22A 1NSTA 3TSZA 3OFNA 4RFSA 2X77A 2VSOA 3RS5A 3ZVMA 4PANA 4FCVA 1CJMA 2FE4A 1CF4A 2XNSA 2F7SA 4HB0A 3AF4A 1E2IA 4DHEA 3CRW1 1U2RA 1UM8A 1YE8A 2A5FA 3THXB 4GDFA 2VSFA 2VYFA 1XZQA 1KOFA 3S1AB 3PUVA 4OL0A 1OFTA 1R0WA 2ZAOA 4QNMA 4DDVA 4ESVA 4BRUA 2VHQA 5E7JA 4L9WA 3I73A 3DHWC 3KQLA 4JLNA 2C8VA 4LJ7A 3QJYA 4LPKA 4PC2A 2YWGA 5DIFA 3DOEA 3FKSA 4YXWA 5EXPA 3KQHA 3CW2A 3CF2A 3K0CA 1U8YA 4OJQA 4NH0A 3VKGA 1QHIA 2ZJ8A 3B9QA 3BFKA 2WVJA 2RGGA 2RGNA 1LF5A 4PO9A 5JEDA 1E2NA 4MDEA 3CX7A 3W34A 5JHGB 5CM9C 2OG2A 2I4IA 2YWHA 4GPTA 4V02A 5AUPB 1D8TA 4IOLA 3OHMA 4A15A 4D2IA 1FNNA 2F1HA 1Z5ZA 2A5GA 4WVFA 1Z83A 1LS1A 4TQUS 1G20E 3GJ5A 1ZYUA 4EIWA 3GP8A 4A8JB 2QZ4A 4BZXA 3DVLA 1JPJA 3QF4A 3VKHA 2D2EA 3P27A 3L0SA 4QGGA
chains in the Genus database with same CATH superfamily
1JVBA 4KIUA 3VZPA 2CNWA 4LYGA 3QI2A 3GJ3A 3KB1A 3M82A 3OJLA 5D86A 3F2VA 5HGXA 2QZZA 5LC1A 5TEVA 2DPLA 1XL0A 2GNAA 3ZZNA 1D8AA 1U2GA 1W88A 2XECA 2RGRA 2O19A 1DAEA 4YBRA 3ZQ4A 3D4LA 4EGFA 1KMQA 1CU1A 2FVXA 1IMOA 2G76A 2G9ZA 2C5AA 3COWA 4MJLA 2W00A 4LMAA 1L5NA 3EVBA 1P5FA 1NP3A 1IOZA 2VHEA 2VT2A 1MV8A 2Z2IA 5LXTF 1RJ9B 4K6OA 3AM4A 1Q21A 3N2EA 1ZP6A 1FTYA 3VR3A 1Y3IA 2I4NA 4YJHB 5CA1A 4CCYB 2IDJA 2CYCA 3F7MA 1IOWA 2JD1A 3S1LA 4CNQA 1SUSA 2JW5A 4RF5A 4EF4A 3LT1A 3BIXA 4BX8A 1TJ5A 5A06A 3CT4A 1IPHA 4M4SA 5KAPA 1ENPA 2XHEA 2LIPA 4G5SA 1U8EA 2JFBA 4PNZA 4XQEA 4AN4A 3UH0A 2XTJA 3R4CA 3ID6C 2IHYA 3EGVA 3LOQA 1DWOA 2EIXA 3LU1A 5JQGF 1T9KA 3CLVA 2Z4TA 1EUCA 4NJOA 4PLGA 4QYSA 5EIXA 4RPKA 1GQRA 1SUEA 1K7SN 1NIPA 5HEKA 4LF7B 3HNRA 3B1ZA 3RUDA 1DUIA 5GJBA 3PE3A 2I2WA 3HA5A 4LHEA 3EVZA 4NE2A 4YPOA 4MP3A 3I5UA 2JGIA 4XUGB 3BGDA 3VR4H 4PWYA 2G9UA 3UQZA 1PJLA 4G8DA 2ZRBA 1ISFA 2PH5A 1TO2E 2A94A 3EODA 3MJCA 3L1IA 3STVA 3ABQB 4QPCA 4X7MA 3CUKA 1VB3A 5EPEA 1JDBC 1G7TA 3GA7A 4EKGA 4JEHA 1YKFA 4Z2YA 5J3JA 4P35A 3IUEA 4HEJA 1QH9A 1VE9A 2YJ6A 5FBWB 1NAHA 3FJOA 5BN5A 4ZRDA 2XF8A 4E4YA 4JUIA 1VLLA 3BF7A 1VSTA 1Z56C 1I7QB 4QT4A 1P5ZB 1R8QA 2W8BB 4ND6A 4YDSA 1H5QA 1I51A 5DFAA 3FMOB 4MQEA 1ADFA 2CVPA 1L9XA 2QG6A 2FRXA 3QP9A 4DC9A 4KFTA 3H75A 5J23A 5JZOA 2QORA 4IQ0A 2WTUA 5DSTA 4L8YA 3I05A 3BWYA 3O2QB 1UINA 2FG5A 3D1LA 3IP3A 5D3MA 2IV3A 3G8AA 4HF7A 3RROA 2ZJ1A 5FKJA 1BKYA 3U7EB 4AO6A 4ZYXA 1QO9A 4R41A 3MS2A 1TDJA 4JLMA 4AG3A 4F3KA 1RYMA 2GK6A 2W2XA 4IIYA 5JAZA 2C54A 3WGNA 4AP5A 3T15A 3CVWA 4QUAA 3TSCA 2TMDA 3T54A 1PG0A 3RTAA 3VR6A 2A9VA 3S0JA 5B37A 3NHYA 4OGGA 1L1RA 3ZJYA 3FNGA 3KAQA 4JJGA 4MWBA 4PV7A 4F5DA 1FTNA 5HTOA 2ODQA 2Q7OE 3FTQA 2OXTA 3OIWA 2VRBA 3QLUC 1L5FA 2ERYA 3AC0A 3MUOA 3HH8A 1M54A 2PWPA 1EX6A 3VC2A 2B61A 1U90A 5GM1A 5KTKA 2QV7A 3A2LA 2H2IA 1J2RA 1ZD9A 3G7UA 5HM8A 1Z39A 2XYHA 3SSNA 4J4BA 2G40A 4MW0A 3K1TA 5JYCA 4YRTA 1NW7A 3AV3A 4I9GA 1E9FA 2E48A 2JH9A 3BTOA 3DF9A 2FVYA 4BFXA 5FR1A 2B0CA 1LLDA 1YQXA 2VR1A 2AG6A 3LT5A 3JAMA 1UAAA 2LP4Y 5JRDS 2F3QA 3VC7A 3KB2A 1JAIA 2ZK7A 1QCYA 4LS3A 4UEQA 5HR5A 2HW8A 4JYBA 1G6OA 1IAQA 3HA3A 4I4TF 5JJBA 3Q3VA 3FOZA 1WHSB 3I83A 5EP1A 4NCKA 4OQEA 1JYEA 1G7RA 2CLCX 3IYLW 1QORA 1K3UB 4NBLA 3SNHA 1VHWA 4GAEA 4RACA 4MRNA 1VLJA 3WV4A 1P74A 4WKBA 1PBTA 3M5PA 3W90A 4CM3A 2Z5GA 4Y6GB 5LOVF 3FMIA 2SCUA 1JDTA 1KK1A 4Q48A 2XZLA 2VNJA 3E35A 1HZZA 2PSHA 1UEIA 4L9AA 4ZEXA 2QMUA 2XDYA 1BVYF 1KSFX 1QP0A 2H7YA 2BDEA 3DVQX 5H3CA 1DXOA 1VL2A 2BEVA 1DCTA 2OGTA 4QM7A 3HP1A 4HS4A 3FPHA 2EYUA 3TDNA 3T3MB 1VPEA 2I9KA 5TVKA 1GPYA 2P9YA 4CEJA 5REQB 2Z1DA 4JJFA 4R3NA 5H59A 2AFHE 3CN9A 2BVNA 4UDOA 1JAYA 1LS6A 4Q4CA 4XLLA 4V2UA 1PYDA 1U94A 2ODPA 3NM5A 1TEVA 1HL7A 3WGVA 3LLUA 3ZW9A 1ECGA 1ZN2A 1VJ1A 3DMDA 4JLDA 1PQPA 2E0IA 1K89A 3OT1B 1UUFA 4YCDA 3ZQJA 3M6UA 1H8EA 2AN3A 2GBGA 1NVAA 4LZNA 1MG0A 2IS1A 5DWQA 3E23A 1GVHA 3TI7A 2DTXA 1XK6A 1WDLA 5IC6A 2QDXA 1UOOA 4B33A 3BREA 3VDXA 2ANCA 2P1DA 3QPWA 3QFSA 4P5PA 2QSUA 1NZFA 2NT4A 1N8KA 5A4KA 1HDRA 5EWJA 3G68A 2IOYA 4CXMA 1OD6A 3FPKA 2HA5A 1U2PA 3GMTA 2C9YA 2GN6A 4OH1A 1NP6A 3AT1A 4LN1A 4WAUA 2OZVA 5T4BA 2W7TA 1GZSA 4UVEA 3U4QA 4D5EA 3WGGA 2WU1A 3X2SA 1LD3A 3OIFA 3GN1A 3PL5A 4YMUA 3ZPXA 1TYDE 5AK3A 3KLNA 3THRA 3VXKA 2GD0A 1JEJA 1I4WA 5FFNA 1QFMA 3LKBA 2HO4A 4K88A 4KO8A 4DC0A 3G2OA 2HV8A 1P2BA 4UNSA 2BMVA 1CNEA 2GNOA 1USIA 3CF4A 1D5CA 3T7JA 1JN0A 3HE3A 3R76A 4DMCA 1KMNA 1ORIA 2I7CA 4W9RA 1P9WA 5JDIC 1H3EA 3INYA 3OA2A 1B15A 3DNPA 1XTVA 5T5QA 4BNLA 4DMLA 1ZAYA 1I7LA 2GHQA 1I2AA 3RARA 3RADC 5DBIA 3WGOA 3PI7A 4L4ZA 3VPCA 3WK8A 3C4VA 1U7ZA 3SKVA 2ZVDA 1OAAA 1YNOA 2K4MA 1WVIA 2PZMA 3JQ9A 3PVZA 4UREA 4BUZA 5AW4A 1GUAA 4ZDJA 3VJKA 3P9ZA 1HG0A 1EE1A 3NBAA 3N2KA 1EJ0A 1EK1A 1KQFA 2I1VB 4DGQA 5A5DA 4NABA 2HMAA 4LGCA 2FEXA 2WSIA 1Y1QA 2WA1A 2C4MA 3RAPR 3HTXA 1G8MA 1Q1ZA 1TPZA 2QW1A 4HTFB 1FP1D 2D7DA 2UUCB 1ZNQO 3V42A 5KOYA 4JB2A 4O4HF 5LIPA 1XMQB 1E9BA 1Z25A 1TEZA 1VBNA 5JXJA 3OCXA 5ALDA 3DP7A 1SEVA 1GL9B 4EZBA 5B7NA 1M1YA 3MLEA 3PKZA 3F4LA 4QC2A 4R2IA 5BORA 5JFTA 1F8XA 1ZG3A 1QZXA 5IYZF 1UXIA 2A1UB 1YS7A 3WIDA 2XJ4A 1XZHA 4QO7A 2HSEA 2QD3A 5IZCA 5HCUA 4GGMX 3FKJA 3HCRA 4A36A 2ZSUA 5AR1A 3RABA 1BXRB 2GT1A 4UCWA 4AJOA 3EOAI 2FV8A 3DEYX 4FOLA 3WVNA 5JAUA 5BV7A 1D6JA 3RWOA 5HDQA 1NMEA 4L51A 4KW7A 2ZJ7A 2XUKA 2J41A 1PLKA 3FMVA 4AD8A 4TOIA 4B35A 1BWSA 1FFDA 1NQXA 3QE9Y 3PC7A 3F6EX 1EU1A 1JTEA 1ZC3A 4RHEA 5CCBA 3WP0A 1RYFA 1P45A 1CF9A 1ZCZA 4KK4A 1I14A 2IIVA 1HT2E 2WQ7A 2GPWA 5CW1A 1UZUA 4UTZA 3QX8A 1NXTA 4QDTA 3D8TA 3DB1A 4LHZA 4M9SA 3DUFA 2IXAA 1ID1A 1N3LA 2IP4A 4RCYA 3AVWA 1QE5A 4AI6A 1HDZA 1NJSA 4MZXA 2WFLB 5C81A 3CH7A 4WZBE 3JWGA 1XNQB 3IKJA 5I51A 5CYFA 2EZUA 4OQYA 2PH3A 3AP2A 3FFBA 3HC7A 2W70A 3IR7A 5DLQC 3VX3A 4J6EA 2BD0A 4TQ9A 3DKVA 3T3IA 1O9GA 1VL6A 3Q9LA 4FZVA 3QKIA 4YJ2F 1THMA 5GOZA 4AECA 4J16C 5I5GA 3U3JA 2IS6A 4WK0B 4ALIA 3LS2A 2YY6A 1N75A 1GRNA 4CL2A 4ZVPA 4DJAA 1KZYC 2B1GA 2E4UA 1M72A 2OV1A 3ZVNA 4C03A 3EGOA 3FGZA 3C74A 4ASUA 4DPKA 1VCNA 3AHJA 5KJCA 3K20A 4CT0A 1JIIA 1U8FO 2V4MA 2H63A 4FE7A 1KJWA 3DVAA 4G36A 3C5HA 1M2KA 4MYSA 2EGGA 3SIPA 3TXAA 2B9VA 2VP0A 3T12A 2PMCA 4IDGA 3I1FA 1R0LA 4RFVA 4ND4A 4WI1A 1T5LA 4OOEA 4JI1B 4S2UA 3LQRA 4OIFA 3T3HA 3WC4A 4I2VA 1M1XB 2EVWX 2WJVA 2INGX 3IQFA 2D1TA 1VIDA 3M33A 2AV6A 1X77A 3P97A 1IN8A 2PBLA 4DNQA 1QOPB 4AWBA 2ETXA 3BWXA 4WPGA 4Y1EA 4Z3DA 5FX2A 3TZEA 1J8FA 1WSBA 3MC1A 2NUPB 4FOTA 5ETJA 2DKNA 3U7RA 2EJCA 1ADJA 5G1OA 2P5YA 4OHFA 3RRFA 1F0KA 1C5KA 4C0JA 3DXFA 4MMYB 1YS1X 1RYZA 2GZDA 3NIDB 4B3RB 4R84A 1C4WA 3JX9A 3RK0A 4AUEA 2GD6A 3HG7A 2GPBA 1CY4A 4Y18A 1AZWA 1ISSA 1TQ4A 3OLQA 1PL6A 4MV6A 4OP1A 5FL3A 3ANSA 2ATXA 1GPKA 4O4LF 2LPMA 3O91A 2RH5A 4CM8B 5KU1A 2HCFA 4LXGA 4XWYA 2IKQA 4UVDA 1EHIA 5U4QA 3MWKA 4AZ0B 2C29D 3CY6A 3W5SA 3D7KA 4N3CA 2F43B 1YFJA 4WH0A 2V6FA 3OBBA 1SVKA 1O5TA 2JCGA 2OBLA 2UUOA 1K4MA 3V34A 1BQEA 4NK4A 4YI5A 5K03A 1IIRA 4Y2TA 3G89A 1CIJA 1J1ZA 2Q5OA 3W9SA 4X64B 4AS3A 2B21A 1HYGA 1VG8A 2RKOA 3ZHOA 2J9ZB 5A3QA 4G24A 2EX4A 2IL1A 2MR5A 3QVWA 5EYPA 4QRHA 4JC4A 4U9UA 2WWYA 1QG2A 3HEMA 4UBIA 2E7ZA 1RQNA 2D0IA 4BKQA 3T5AA 3DA8A 3HK2A 1EIWA 2VYQA 4NPHA 4WW0A 1KEKA 3C87A 1E61A 3D8BA 3QYPA 1S1CA 4OCZA 2Q3EA 4R3WA 2FF5A 3GG9A 1C0IA 1ZJZA 2G83A 3R9XB 5JAQA 3A6JA 1SUFA 2C88A 5FBVB 2VNIA 1C9MA 3AKEA 3RS7A 4QXRA 2PSSA 3RKUA 2D0OB 1O4VA 1JHRA 2QRNA 5I47A 1W49A 5CIYA 5J2UB 1VE3A 2RHOA 3ZU3A 4RJJA 4QGSA 4A0SA 4AL4A 4BAZA 2ZWVA 5KYXB 4YQEA 4CKBA 3QVJA 1WPRA 3DDZX 3I6YA 2BFAA 3HKDA 4F84A 4DJFC 4DSAA 1NQ5A 4J7XA 1JXMA 1FNMA 4IGFA 4F3CA 2Z95A 2F1RA 4DV4B 4KGZA 5IABA 5CHEA 2XADA 1L5VA 3O7WA 4BRSA 1NW9B 2HDNB 5HXAA 3Q9UA 3SIRA 3H8VA 4CQJA 4BFWA 1PS0A 4UTVA 3K0HA 1JKXA 4C05A 2ID4A 4NS4A 1SFRA 2O2ZA 1WL8A 3O31A 1REQA 3GZNB 4KUGA 1QJCA 4ESOA 2GAFA 4DWOA 1AMOA 3TIGA 4A8TA 3VYSB 1T2UA 4EHBA 1K7EB 4HGYA 1ZGZA 3PHCA 3ZH9B 1ZJWA 3I5AA 4R68A 1S4MA 2P3OA 1TU4A 5SYMA 4RTOA 4Q3OA 2CVQA 4R6WA 2VPPA 3HUTA 4U9HS 5DM0A 3IDFA 4U2DA 1C14A 2YV3A 5AOCA 4RNDB 3OFKA 4P53A 5ELLA 4W1RA 4I1PA 3LKDA 3ZIAD 4M1QA 3FAKA 3HDQA 4NMXB 4BUCA 2Q4DA 3B3AA 2H65A 3IAM1 4DCTA 3KQKA 1K88A 1LH0A 2B25A 3AY6A 4XQCA 1QB8A 2WNHA 4RGBA 2JVIA 4OUDB 4RGVA 1TLLA 2JC3A 4IJ5A 1WPQA 1LBHA 1AH2A 2W8ZA 2YASA 3VZQA 1ECJA 3WICA 1X1AA 5IKOA 4Q7QA 5DM2A 2WMOB 1A9XB 1PFYA 5E38A 3VYRB 1AB6A 2J9GA 3BDVA 3ASYA 3T5MA 4JDUA 1WVMA 3OJCA 2RJOA 2WHEA 1VL5A 4NBVA 2JS7A 1KAMA 1Y8QA 3TFOA 5B3JA 4XASA 5HPYB 4N7JA 3VYUB 3PNMA 2CMGA 4ZN6A 1XXHB 2YVQA 3IHLA 2PGXA 3ZQUA 4X8HA 3UAVA 2OE2A 4RLSA 2QRKA 2ZRGA 4ZPXA 4TL7A 3WQSB 5CG2A 5CLHA 1JPUA 5I9MA 5E4FA 5BW6B 4AJJA 3QE4A 1SXJC 3UFXA 1L4EA 2XKKA 1V11B 3QHPA 2R7LA 1JMKC 4GE3A 4NDNE 3B3QA 3PQCA 5F1KA 4JI7B 4IH9A 2A4MA 4BO6A 1E8DA 1JXAA 1DAGA 5CH5A 5KSZA 2QUJA 4LUCA 1C8KA 3PXDA 1XHFA 2HC9A 3A14A 3L7BA 4GSYA 4AQDA 3RUHA 2O50A 2PX5A 5ICEA 3QSGA 5A6SB 1NR7A 3A7DA 3L8YA 3N2ZB 3QVUA 1RKVA 5HF8A 4E88A 1O96B 3QIAA 4NG4A 4R1TA 4FNMA 3R7DA 1PWZA 4Y30A 5B55A 1GAJA 1G9SA 2EP5A 5I4BA 4NMMA 3BBPA 1SN7A 4X93A 1HT3A 4CV2A 3RSSA 4PN7A 3VH1A 4Q01A 4BKRA 2CF6A 1JFLA 2NZ2A 4FFSA 2WY2D 4BQOA 4DM3A 4PXAA 3W2GA 5AIBA 3FNEA 3T1TA 4YRRA 3BMQB 4R2JA 5GVRA 5EZYF 1GQSA 1MB9A 3J81A 3EPLA 5HCIA 5C37A 4BWYA 2HNBA 1UBLS 5AO9A 1T4CB 1TGYA 3U40A 2F9MA 2L69A 2ZWMA 4WFJA 2OT3B 5DP2A 3I0NA 1MOSA 1P3DA 5EQJB 2V7GA 1ULTA 1V4VA 3CLSD 1KE2A 2WD9A 1NP7A 2ATCA 4LKRA 5DBOA 3RTEA 2G8LA 2OV3A 2VJNA 3KSDO 1J2UA 5EIOA 3EGXA 3L82B 2I2BA 4XDGA 1RJEA 4DCSA 1DAMA 3DDCA 3TB4A 3CVYA 1D0IA 1W9HA 2QE7A 3AG5A 3D81A 2VPWA 1SIWA 3E7DA 3I4LA 1J4AA 1T2AA 3ISJA 1JDJA 3NKLA 3OP4A 3VKVA 1QLWA 1G4UR 1QXSA 2XMBA 2P6PA 1ZR2A 7REQA 4FB4A 4LDZA 1JSLA 2B2NA 2H4FA 1QRSA 4AICA 1KXZA 1Q95A 1QRDA 5EA2A 3MZ0A 4F4FA 1H0HA 1KFEB 5LZ7A 2FX3A 3QPAA 3MUEA 4LNUA 4P08A 1E92A 2JDID 2Y1EA 3A05A 3LW7A 4QYIB 3GLRA 5EIWA 2UYYA 4CMIB 3AF6A 1QGZA 5U9CA 4I3HA 2ZRFA 3IQDB 4KIGA 1ST3A 2XB2A 4MQLA 3PXUA 4TLDA 5AVSA 2V4UA 5COBA 1Z5GA 1VRWA 2GZAA 2VRWA 3IGFA 5AK5A 5LMUB 3T7IA 4YBZA 3OE7D 2JFPA 5D8DA 5LN1A 1U3TA 4PNEA 1EUQA 2QRGA 2PZFA 3E5MA 4H3HB 1CFZA 2HHCA 2IYAA 2HSWA 3DPSA 2ZQ5A 1QGUA 4RQBA 5IC4A 4YJ3B 2F17A 3EZYA 1UDRA 1AD2A 1VJGA 3GV0A 3MRVA 1QE0A 4TV9B 2GF9A 2HHAA 2AC7A 1YBFA 2XB6A 3HN6A 4R1PA 4C5AA 1GAWA 2XZTA 4D6YA 1BO6A 2VJCA 4XA8A 5AKHA 1KK2A 1MLDA 4K9SA 4A5SA 4BMOB 4BB9A 9LDTA 3CWQA 2BBWA 2BFCB 1FW6A 4CL8A 3MF4A 3QU9A 4UDNA 1PJ3A 4AQYB 2OCAA 1C8LA 5THXA 3UK2A 2FQWA 3KKZA 2W2TA 1P4JA 2OAGA 3A9VA 4FLFA 2XOEA 4QQRA 1XMXA 3PT9A 1WULS 1LBTA 4B6RA 1KP3A 2PJZA 1ZW1A 3QRWA 4QUGA 2GLTA 4L8VA 1GUDA 4K9LA 2HU2A 4HSEA 2A1TS 4GR5A 5F3RA 3GLKA 3ZJ5A 4E5UA 3EPKA 1MTZA 3I2FA 1JLLB 2PHZA 4EBBA 3RIGA 1JI3A 4HLUA 4LX0A 1NUPA 4UTXA 4REMA 3AVUA 5ELXA 4GH5A 1GNTA 1A04A 4FZ5A 2BFEB 2VT3A 2IEBA 4HPJB 2IXEA 4IRXA 3LLMA 1ZH6A 4MGHA 4HDSA 1A8PA 4X65B 4L8WB 1RLJA 3PYMA 2ZUUA 4RSGA 5LYYA 5DX1A 3BMOB 2XJ9A 1SGWA 2EXXA 2F59A 1ODJA 3LBAA 3DLAA 3S99A 1MAVA 4PHFA 1FSSA 4CLRB 3CGGA 6CHYA 1UXGA 3DHEA 2DBQA 2B8TA 5IDVA 1W4BA 3ZY2A 5IAJA 1A3CA 3IXLA 3MOIA 4G5OA 3RT7A 1CQJB 1J0CA 2QMYA 1M83A 2A14A 4GFDA 5CDUA 4QBIA 2G1KA 3FNRA 1P3JA 3O1JC 4CPDA 3EVAA 3IQXA 4LSGA 3U44A 1OFUA 3L4JA 2VK8A 3AYZB 3UMYA 2WP8J 5AVXA 3I4CA 4OQDA 4EPVA 4MRVA 4OA8A 4FMBB 5C18A 3PUYA 2I8CA 3ZWWA 3QZUA 1E9EA 5BUCA 3UA3A 3FCYA 3L84A 3RDPA 2BKXA 1BHSA 3LGXA 3Q7TA 1U3VA 4QDUA 3VPFA 1JBQA 5AXAA 4Z3KA 3FOBA 4LZAA 4QFCA 5H3HA 2XI4A 5HIKA 4NE7A 2HRRA 5FF9A 2FOIA 1IK6A 1JU4A 5KQMA 1VMKA 2C7QA 1XCGB 2WTNA 5EINA 1XNGA 2B7LA 3KUCA 5FP0A 3C3BA 5JBIA 2XDQA 4NV1A 5D51S 5EUCA 2I65A 4EECA 1JYSA 2IZ6A 1RHKA 3FOAA 4GMDA 4I1UA 2FYTA 1BOFA 1YB5A 5KU7A 2OGSA 2IOFA 1II0A 3X1XA 3ZWXA 4CIYA 4N41A 4ONEA 1V16B 4ZMSA 4UMEA 1EDZA 3FIUA 1R1DA 2Q4BA 1RE1A 4DR5B 3LNTA 3SVZA 5JALA 1R0KA 2PX4A 4CTNA 1Z8DA 3LK6A 4BX0A 1E3JA 2H31A 5AKJA 5AXBA 4U7FA 3L1JA 2HMWA 2ZIFA 5IJ0B 4FYXA 2ACVA 2GVDC 2B3TA 1MDBA 1SAYA 3F1KA 4BNNA 4MPJA 1H8ED 2Z4SA 1TC1A 4EUSA 4OB6A 1N1GA 2PMKA 1K6IA 1JA1A 5DHAA 3ESBA 5FL7A 4DQLA 1F6WA 1AGXA 2WINI 1UOEA 5DXJA 4FFPA 1M6NA 4OQFA 1X1TA 1J33A 1MFZA 3DE6X 1MN6A 3TK1A 4LF9B 1L7MA 3FYUB 3T1NA 3NANA 3PR2B 2WZQA 3C7AA 3O90A 4JQZA 3MTJA 4AW9A 4D9HA 4YLGA 3RK4A 3UZUA 2PFKA 4BN5A 5E1OA 3RSLA 1FQJA 2RHDA 3OM1A 1ZK2A 3RAFC 1DBSA 2CJWB 3HXQA 2HLDA 1P7YA 1S2OA 5AXCA 2ROQA 2HRBA 2UDPA 3F97A 3GMSA 2OZPA 3I58A 4X1KB 3U09A 3DBHA 1VI6A 3QU4A 1LV7A 2FWPA 1KDOA 4DLUA 2J0QA 3SXPA 1K1EA 3SVTA 1GKIA 1KMMA 3KPUA 3PXCX 4FP9A 3ROXA 3B1XA 2J08A 4F56A 1G18A 4BMSA 3FVVA 1AQLA 3QKRB 4V0SA 4RMHA 3IEMA 3HBFA 1JU3A 4G9EA 3HJFA 3ANLA 1RBZA 2DQYA 2RG1A 2RHTA 4FDVA 5LA6B 4LQDA 4FC6A 5KS2A 1B1CA 1GZHB 1KJ9A 1H9AA 2BF4A 3IJ5A 2OV2A 5TX7A 3Q8LA 1MJHA 2WTMA 3GY0A 3GD5A 3OCWA 1SO8A 3DTVA 2KE5A 2QD1A 4GI5A 4PZAA 1U63A 2UUBB 1F9EA 3VNVA 1Q0ZA 2O4UX 1PZHA 3D5EA 3MIIA 3OEED 2UVPB 2XLBA 1ORVA 3ND7A 2I9PA 4LX8A 4A0RA 2XT6A 2C83A 3RV4A 4EWLA 1HK7A 5F1PA 4X3PA 4FIZA 2V74B 1Q0UA 2AXQA 3IHWA 4NOMA 4XB1A 5AJTA 1QRAA 4CU2A 3IALA 4B3JA 4MB6A 3T7DA 2HBRA 5LM3A 2VHVA 2H1RA 4AF6A 2GNPA 4EUFA 5GTDA 2OV8A 3M81A 5K3AA 5KWJA 1G0OA 2ZGVA 5K45A 3SICE 4D3ZA 3ER6A 1KQNA 3LFUA 4FHEA 1Y5IA 4B0PA 3RIHA 3OKPA 4QJIA 4D79A 1ZFNA 3D0QA 1OKKA 1KYWA 2J0UA 4LPSA 4NEHB 1ZEJA 1BWRA 2ZDQA 1XAIA 4KDEA 1TM3E 3NWOA 3GR6A 1CUSA 4CLHA 4IUBS 2C84A 3WA7A 1HZZC 1YZUA 4IHJB 4CV0A 5JS8A 4UATA 3AVVA 1L5QA 3GUVA 3PP8A 1NBHA 1WCIB 2G67A 2JGNA 1DU4A 2COKA 2Q5IA 2VAPA 4Y3UA 5ENZA 3HCDA 4GBJA 1ZH2A 2CWDA 1AQYA 3OQPA 2Z58A 2WICA 1G42A 1POXA 1R4AA 1NXXA 1SCKA 3ONDA 1SU8A 3MINB 4G1FA 4GECA 4JELA 821PA 5JI2E 2ZYHA 5F9MA 1SC9A 2VTBA 3EIFA 3KTFA 3UMJA 4BVLA 3VQTA 4ALMA 5C4MA 3V4RA 3TW6A 2MTBA 5C32A 1DTEA 4GOLD 2XXAA 1FLAA 1LPNA 2Z04A 4JP2A 2XEDA 3G0DA 1G20B 2AKAB 5JT1A 4YJFB 3WLOA 2AOTB 2OXRA 2JIOA 3CR8A 3JQAB 5BUQA 3K4PA 2DBVO 4FS8A 1ADBA 1K66A 1XAHA 4WE3A 5EJ6A 3F8TA 4NZMA 4Q3AA 5AOAA 1B6TA 2ATEA 1J25A 2XCLA 3GLFE 4KPGA 1S6YA 3O3OB 1SBCA 5HE8A 2XAUA 1Y5NA 1Q0RA 1R6UA 3FHLA 3JQBA 1B93A 2ZT7A 1JWAB 3AU9A 4YCLA 1L7XA 5U1PA 5IT9A 3KU4A 4DYDA 1L3IA 4C7OA 2KS6A 3LG2A 1H85A 2I5PO 1TTQB 1DKQA 4EEXA 5KSWB 5K09A 1KKUA 2B8EA 4RTJA 1YIDA 4B75A 5DE3A 5EC8A 2PSFA 1YSCA 2WYWA 4UE6A 4FB5A 3QQPA 1GADO 4Z8XA 3A1NA 3MJRA 3K5HA 4GMHA 4LGYA 2CXPA 3UJHA 2O3TA 1X13A 3M5WA 1I8TA 5FCDA 4AMBA 2ZWIA 2FFJA 1UJBA 2GZHA 3D7NA 1D07A 3EXFB 1DX6A 4HAWA 2XGJA 4IYRA 5KAMA 5KOJA 3TRDA 4Q5IA 4BNWA 1YCHA 1OZAA 2LWIA 1DTSA 3AONB 2YWDA 4C43A 5LD2C 2G9QA 1LWNA 1MNAA 2GO1A 4FZJA 4ASUD 3KV1A 1WG8A 5AVZA 4HNVA 1XTPA 2DHQA 3K7EA 3PLRA 3DZCA 4GZ6A 4DUZB 2D3TA 2X0KA 3AZQA 2OKCA 1L4MA 3R40A 2VAWA 4LGVA 4U5QA 4NXNB 5T8KA 4MUBA 1C29B 1GNSA 5HJ7A 3R6GA 1P0QA 4PCAA 4QG7A 4JSYA 1VE1A 5CK5A 1HDOA 4PZYA 4R7TA 3IJRA 4ZAVA 4JUCA 3NX4A 3DL0A 4J03A 2EOAA 3HNOA 4KYIB 5A6VA 3PXGA 3C15C 1WR8A 3JQ9C 2OLJA 4TTTS 3ZY4A 2HLHA 2BBSA 2XUIA 2EJWA 3IBYA 1H1DA 1L7NA 3ILHA 5ALJA 5KX5A 4WKOA 3VKUA 3U37A 4IEEA 4PLWA 4DA4A 4H3KB 2VOEA 4G65A 3WB9A 3IUJA 1UK9A 1QLJA 1XZEA 1FDSA 3EE6A 2VUIB 4QYTA 1V5WA 4XR9A 5DM1A 4WOBA 1T0PA 5KYUB 4NCNA 2I22A 3F78A 5A3VA 2G5GX 2WJWA 3C8DA 3G6KA 4LVOA 2GCOA 2OCGA 4OAOA 5D3KA 5KOJB 1E3QA 5A4MS 3GFGA 4TZKA 1RIIA 3TTVA 3CUSA 1OBHA 3EF1A 3KAJA 1T43A 4LBYA 4BU1A 3AI7A 4MQMA 4UDXX 2BJWA 4AP9A 1Z68A 3T1OA 2FDCA 1FU8A 1SK9A 5F2EA 3JYLA 2DUMA 5K4HA 2FRDC 3Q10A 2W11A 2GGSA 3ND5A 5I9TA 3WHLA 4YCCA 3QEAZ 2YFKA 1ZHOA 4XJTA 4YAGA 5IZCC 2QDKA 1G5QA 1PQYA 4JLPA 4ZCIA 5IC5A 1DINA 3GT7A 4N3BA 3RHZA 1WZEA 3D6TB 4E5YA 2ACKA 4YRLA 4EYQA 5KC8A 4O0MA 2ZXUA 3HABA 1CZHA 1RI1A 3B6JA 3DAFA 2GBLA 1P44A 5EXSA 3UUWA 2WIJA 1U6IA 1NLFA 3K8ZA 5DTQA 2VXBA 4WXRA 3G2KA 4YGXB 5BT8A 2W0MA 2QD5A 1HDCA 5JLAA 1PFVA 1UBJS 1XF9A 3FLBA 4MS4B 1CHNA 2RHBA 5FI1B 1ND6A 2PEZA 1BX3A 1YFKA 1S7GA 2BJHA 3H2HA 3N39C 4IDPA 2OG1A 2P1ZA 2VDMB 2XQKA 4JNCA 1N2CE 1XVUA 4C30A 3REQA 4F60A 5HJ2A 2GK7A 1HO3A 2NTYC 5HOQA 3Q3GE 1NTOA 1S3IA 5ALGA 5ULLA 4EPYA 4M22A 1ECCA 3OTHA 2RFLA 5JZBA 5H02A 2M6LA 1N6LA 1NDQA 2RG7A 2H1FA 3KYCB 2O0JA 1L5ZA 1QZUA 3O6VA 1O95D 2QZPA 4I1RA 2WLSA 4JJKA 4M99A 4RF4A 1R74A 3MJSA 1TUBA 3WGJA 1ZS9A 4LSZA 2YJ5A 1FYVA 3IVCA 5EIHA 5KJ1A 1TKRA 3BL8A 2ZYUX 1AM4D 2PYDA 1XZIA 1X7XB 5JPDA 2R68A 1DQSA 3WIVA 4UJ3A 1P73A 3DVRX 4ICIA 3EMDA 1KVQA 4AZTA 4YCNA 1PT8A 1H0SA 2G07A 1EVKA 4ZV7A 3RIEA 3BYZA 6REQB 5FO0A 1YJXA 4H1HA 1V3QE 4OK3A 3RU9A 3GP5A 3F90A 5LZ2A 4BOYA 2D8AA 3VU9B 2CV2A 2A3RA 3FWKA 1L7BA 3GGPA 5CVEA 3Q3JB 1RAIA 5TJHA 5MGNA 3NVDA 4QU9A 4QGFA 4ZRMA 3EZNA 2WBLC 1AS2A 3EHEA 1VIMA 3FYTA 4OFXA 3JQCA 3TNDA 5AI8A 4Y9SA 2CBZA 1SCJA 3NHRA 2KMLA 1N5OX 2F1JA 3GLIB 4DIDA 1A4UA 2JF0A 2WIGA 3NTVA 3CPJB 4P32A 4Y1RA 3SZUA 5A4DA 4WK2B 2VDUE 2VS1A 2OL4A 1L5HA 1KI3A 3MM4A 4XD7A 3GJXC 4PX2A 1J8QA 1WQ3A 4HKTA 1ZSYA 3DBLB 1W0CA 3EVGA 3GYGA 4IKPA 4X7PA 3T3EA 1XVIA 1C1XA 3FM9A 4ZANA 2GFQA 4JBNA 1UJ5A 3ROMA 1DC4A 2F3SA 3HB7A 3GVPA 1CUXA 3I28A 1LEHA 2VBIA 1EX9A 1SZDA 3DD5A 3GG2A 3IKTA 1V48A 5IUKC 2ZTSA 1BH2A 4MKGA 4UUBA 3B6EA 4R2HA 1MIOB 5ES4B 3CB4A 1M75A 2X1VA 2X3UA 3IUPA 1N2HA 1XX6A 2G88A 2WT8A 3BILA 3EW7A 2WMNB 3ML1A 1DC3A 4G5FA 1KSGA 4LXQA 2P5TB 3U9SA 1SEPA 3C85A 3CSSA 2YS7A 3DLCA 4MVJG 3SDSA 1XFDA 3OTQA 4BNGA 1NVVR 4PCVA 5J9FA 5WRFA 3P2KA 4YV0A 2O5EA 2QAIA 5I5EA 1UK7A 4GD3Q 3B70A 1OASA 4Q9DA 1W94A 4BNXA 1FUIA 3H8WA 1AV6A 1USUA 3JARA 4QO8A 3JYHA 2MYNA 4GYYA 4TL6A 1Z2AA 1U0HC 3VVLA 1NNI1 3NIWA 4HQLA 1C50A 2HK8A 4M1OA 2C9MA 2HI0A 5GWXA 4ARAA 4QVGA 4RPGA 2X0RA 1RLIA 1CRQA 2VXYA 3PGA1 2QRUA 4K9MA 3TSAA 5ICSA 1QIJA 1VSUA 4MS3A 1KZ9A 3D1JA 4BJHB 2F3PA 4JEUA 1X1DA 4EHJA 5KUTA 3PFHA 2A86A 1XTRA 2F1OA 3F6YA 1SQSA 5FBRB 5AYVA 2ZIAA 4J0EA 1FNCA 3QGMA 4TMFA 1VCOA 2ZE8A 4B17A 3UH1A 5JAIA 2O8DA 4GKBA 4TKVB 2DETA 4MMZB 3WLRA 1NW8A 2ZSEA 4ID3A 4OFWA 3ZE1B 1FDIA 4JCOA 5A5VA 2YXDA 3FWYA 1B41A 5CAEA 2WD7A 3Q7EA 2G08A 1ZMTA 4O2BB 2QYSA 4K6MA 2P40A 4ZXFA 1C8BA 1NYLA 2GJ8A 3OZXA 3E7WA 5IWCA 4JJZA 2ZBUA 5KB3A 5ISMA 1OX6A 2GFIA 3ENZA 3UHPA 2QM3A 3CA8A 1I9GA 1SKYB 4PC7A 3Q3EA 4YMGA 2R3SA 2ZTHA 2VLIA 5AJWA 1ISGA 5E7IA 3LRPA 1YL5A 2KLBA 3EJ6A 3QUQA 2H8GA 4XYMA 4F9EA 1R5OA 3PNBA 4ZCSA 4L5BA 1DKPA 1PKXA 5M3BA 5REQA 2FUKA 5F9HA 2VQ3A 4YFYA 1V47A 1MZVA 3GUYA 4YAEA 5EJ8A 3K0AA 1HG1A 1ZM9A 3J81k 3C3JA 3N5KA 2PSDA 4DSZA 3K09A 5LLSA 1SHUX 4EHDA 2A9OA 4MDFA 1R66A 2QE7D 3NGLA 1BQ3A 4XSHA 3I53A 4MHOA 3HFGA 4G1MB 1EM6A 1W35A 4ZHQF 1DOAA 5HIMA 3N75A 1D2RA 4FFBB 1WCYA 4EA7A 4WNAA 2JRLA 3S1SA 1NKSA 3LX5A 2VQFB 1V8OA 2E4ZA 2QJTA 3B9RA 5EJMA 1T0JB 5DF1A 1OW3B 5L45A 1TYCA 1OF1A 3BWBA 2HIGA 4HDKB 4Q1DA 3RRNA 3T4PA 3D6HA 4MLCA 2VHCA 3QUBA 5HM6A 2JLCA 4M0LA 3SDZA 1I3LA 1VGRA 4FK8A 2Y1LA 1GLGA 1RPZA 5ALVA 2P4HX 3WFIA 1CIVA 2ZW9A 3K1YA 3H8JA 4BU0A 4PYRA 2FPMA 2XTAA 3GL9A 2Y77A 3JYOA 5A7HA 3I9MA 4PLYA 3AJ9A 2E6KA 4LHVA 4YXWD 3TLYA 1DBRA 2H00A 2ZFUA 3EUWA 4IJQA 2FDXA 4OGKA 2P8SA 4M76B 4RK6A 2FNAA 2NUAB 3WRYA 4LJRA 1WDTA 1CB7A 4QWWA 5C4GB 3HZRA 4YT4A 2CDAA 1AKUA 2B4YA 4MWGA 3DL2A 5FBKA 5I9BA 2GH1A 4R8SA 2GPSA 4BN0A 2NPFA 1FS5A 1YA4A 2VF7A 1TO6A 3A6EA