2FV8A

The crystal structure of rhob in the gdp-bound state
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
187
structure length
180
Chain Sequence
YFQSMIRKKLVVVGDGACGKTCLLIVFSKDEFPFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQKRYGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of RhoB in the GDP-bound state
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Rho-related GTP-binding protein RhoB
total genus 61
structure length 180
sequence length 187
ec nomenclature
pdb deposition date 2006-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2fv8A00
2G1KA 2WSSA 3B1VA 1G7SA 1W0JA 2MSDB 1J99A 3MD0A 1QHHB 1OSNA 1SVIA 2OHFA 4TL9A 1G9XA 2VHTA 3R7WB 4JIMA 1GWNA 1KI6B 1G4UR 2NO7A 3VR4A 1D2MA 4LZZA 3G82C 1AZTA 1KO7A 4TLBA 3JVUA 5FR1A 4Q4LA 3K0AA 5FPYA 2GRJA 2B7CA 2J3EA 2IUSA 1HE1C 1W4AA 1W46A 3FFBA 2V7QD 3EARA 4PSVA 1VCOA 1HE8B 1KHTA 4TYWA 3LNCA 5TDHA 4CYMA 4PHHA 4J0QA 2V4ZA 5J4HA 1L8QA 4YMUA 5FBVB 4QOSA 1XD2B 3KQLA 2BCJQ 4OKSA 2NGRA 4FINA 2FN4A 1E9AA 1U8YA 2JJ2D 4ACBA 1GIAA 3GEEA 1YQTA 4F93B 4QGGA 4XIGS 1Q3TA 2UVQA 2VSFA 3IO3A 3QPVA 1E9DA 2YWFA 4IVQA 4JL8A 1N0WA 1FP7A 1RW4A 4LC0A 3Q8XB 2LWIA 1OYWA 4MKIA 1ZW6A 2GCNA 2K5UA 1SXJB 4LHVA 2IW3A 3S1AA 1FW6A 2JLQA 3PR1A 1E2MA 2ZE7A 2QN6A 4GRAA 4XVQA 3E70C 3W3AA 2W58A 2R6DA 4I1OA 3ZLJA 1GZSA 3R9XA 1CJUC 4IXMA 4BLTA 1PLLA 1EFCA 1IJFA 4RD6A 5IK2A 2X2FA 5TB5A 2ZJYA 1EG7A 4YMVA 1DAMA 3WHKA 5JCPA 1P5ZB 1L4YA 2XZLA 3OE7D 4FD2A 3O8CA 4IFEA 4DLXA 3I1FA 3EZ2A 3RC8A 1QHSA 2R6FA 2FV8A 3QIAA 5EXSA 2J0SA 4HUQB 1K8RA 1G3IA 1TU3A 1OFTA 2Z43A 2GAOA 1UAAA 1Y63A 2EYUA 1IY0A 1Z0JA 3BC1A 1R0ZA 1M2OB 4PO8A 5LD2B 3BH7A 1T4GA 1XXHA 3GJ4A 5JJKA 4QL3A 2IXGA 1KJWA 2ODNA 4LSGA 3OHMA 1II0A 2I3BA 3D6TB 1A2KC 3CLVA 1FMJA 5IK2D 1Z22A 1US8B 3MJHA 1E1QD 5F9HA 1W4CA 3I4LA 3GLHB 2ZRLA 1KK3A 1KY3A 2NO1A 2VHUA 4I99A 3SC3A 3MUFA 4Q9KA 1AGRA 4NBSA 4XTRA 1W36D 5TARA 4MGZR 4P4SB 2BDTA 1ZC3A 2REOA 2IS4A 4M8NE 2QQ0A 1Z2CA 1AS0A 2WTUA 4KVGA 2V6JA 3FMOB 4OHVA 4OK3A 2HF9A 2CL0X 3A37A 2ZR7A 2ZANA 1F5NA 2CDNA 4LJAA 4YXWA 5DSZA 5JI2E 3AF2A 3OIUA 4MGKR 1L7VC 1NIPA 2FFAA 1JJVA 5LDDC 3KKQA 2A30A 5HKKA 2IHBA 1SVSA 2P6RA 3SR0A 4A6PA 1CXZA 1U0HC 2OSBA 1ZJ6A 2CCJA 4GZLA 3VKHA 1EFRA 2JJ2A 2HXSA 2W6JD 4GMXA 3SFVA 2PJRA 4XWKA 1E2IA 3AF4A 4HAXA 4LYFA 4G01B 5EE3A 2C9CA 2C98A 4A8JB 3VR6A 4CIDA 3WYGA 2F1JA 2RKOA 1W5TA 3GD7A 2IT1A 3B60A 2DBYA 1DADA 4PPQA 1XMIA 3ADKA 3W3ZB 3SDZA 3NDBB 1O87A 4TSFA 4QJ3A 2JLXA 1VG8A 2SHKA 3B1YA 2QBYB 2YOFA 1XD8A 3A8TA 1P7CA 3E5HA 4S2EA 3MWLA 4M1TA 3AGPA 3ZQ6A 1NL3A 2GTPA 2QPAA 4Z8XA 3X1DA 3BK7A 1KDOA 2WMNB 1NG9A 1Z0IA 2YC2C 1G5PA 4JLJA 5JZVA 3I8XA 1MO6A 1N0VC 2GK6A 4JBWA 1AN0A 5KDLA 1OH7A 1G19A 2XZOA 3PENA 1QHYA 1JI0A 4II7A 3IHLA 2DCUA 3PXGA 2AK2A 5L3SA 3GLFA 4QM7A 3DO6A 1SXJC 4D0NA 3FHCB 1MOZA 4IJMA 4C7OA 2JLUA 1KMQA 4EKDA 5TXGA 2WKPA 4MA4A 1H8EA 3KTAB 1Z63A 4FI3C 4EPWA 3IHWA 3GLFE 1NMYA 3ZYCA 1UADA 4RFSA 4PZYA 1COWD 2OM2A 4RCYA 1IXRC 4NL4H 3KX2A 4DUGA 3U3MA 3HU2A 1UBGA 1Q0UA 2ZRJA 4LY6A 3NBXX 4GBMA 1NLYA 2ZRBA 4DCTA 2HF8A 1MV5A 2XOKA 4OJQA 1LS1A 2P2LA 4V0OA 1KY2A 1H65A 2C9OA 2QEQA 2ZI6A 1NVVQ 3LV8A 5CDFA 1CR2A 3FMFA 4ERNA 4NE2A 3TIFA 4C0JA 3ZVLA 2DFNA 1PVOA 3K8YA 5BN5A 1NJFA 1U9IA 1KI9A 2QMOA 2VLIA 1BMFD 5LB4A 2BM0A 5GJCA 1QHXA 4IVPA 4DSTA 5KO2A 1ZU5A 3I3SR 4DT1A 2W6ID 5LB2A 4EFMA 5KSZA 5LPNA 1K5GA 1JR3A 3T34A 1R0YA 4B2PA 1XTKA 2P5TB 1W2GA 4FN5A 3QUSA 2FZLA 2RGAA 3PUWA 2W2VA 3GFPA 2YOHA 5KPJA 5JRZA 4Q9JA 4TYQA 5HE8A 3TSZA 4DT1B 4DXAA 1LB1B 4E03A 3QE0A 5D3MB 1VCIA 5K8IA 1G7CA 4FWTA 4B43A 2CVHA 3BXZA 4R7ZA 1BMFA 1DBSA 4MRNA 4TYNA 3AKEA 4Q1DA 3ND8A 2IC5A 4WIAA 3CRVA 5KNDA 4NONA 1KSJA 3GPLA 5F2EA 2GJKA 5KTYA 4OQXA 2GXQA 1UBFA 3EA5A 4LJ9A 1SKQA 4MGIR 1AZSC 2YWGA 3L0OA 4BFVA 3HR7A 4PQYA 5FTKA 3NBZC 5FBRB 4TQAA 3S1AB 2OAQ1 1VKJA 2IUTA 4ZCLA 2J46A 1I4LD 2GEUA 2J41A 2JLSA 2VA8A 2QAGA 3A36A 4LK2A 4RZ3A 2IXEA 3UMSA 1CR0A 2QY9A 2FA9A 4M9ZA 4ZPXA 4MUAA 3QKRA 3OIYA 1E96A 5EE0A 4A8JC 4TMWA 3THXB 1MO5A 2WJHA 3K53A 1IQPA 3AV0B 3C5HA 1II9A 1N5IA 1KO1A 4A6XA 3GCGA 1GM5A 2RAPA 2ZJOA 5GJBA 2ZQ5A 1AGPA 4RZ2A 4LHWA 3QVVA 5H70A 2BC9A 2FSIA 1LS6A 5BQ5A 2GBLC 3I5XA 2AKAB 5TV2A 1EFRD 4PZZA 2CEAA 4UQOA 3MG9A 1B0UA 3SS8A 2JLWA 3CX8A 2FMXA 3MSXA 2XJ9A 3HYTA 1Z0KA 1NVXQ 1SXJD 1NG1A 2RGEA 4YXWD 5K8UA 3BERA 4R2IA 4A9AA 3U6KA 2ASEA 4IRUB 1NN0A 2IF0A 1XZPA 4Q1BA 2G9NA 1TPZA 1JPNA 4TT3D 3GJ0A 5FPHA 5G40A 1VG1A 2PLRA 5JCZA 5CJPA 5DHAA 3TAUA 2WWFA 1RIFA 4C3ZA 4W9MC 4LHZA 1GNQA 2ONKA 2JDID 4EFLA 4F91B 2F9MA 3F5FA 2ECKA 1RZ3A 1ETUA 1HYQA 3MJRA 5P21A 1ELOA 4V0ME 4MYUA 1ZNYA 1ZUIA 2HEIA 3BJIC 4WAUA 2OBLA 1XP8A 2DB3A 1NIJA 1E9FA 1XDBA 1QVAA 2ODBA 5HPYB 2EW1A 2IUUA 3C8UA 3P26A 3W5IA 2P5SA 1EFTA 3REGA 3PVSA 2FF7A 2WOOA 3AF0A 3VMFA 3L0SA 1CJVC 1S9HA 1R4AA 3ZD7A 2DWQA 3T35A 1G1MA 1M7HA 1GG2A 4HLUA 3QF4B 2DWPA 4M2LA 4TZ0A 5FTJA 4OHXA 4NYMR 3QXCA 1E32A 3CM0A 2C77A 3IQWA 3T5GA 3B2EA 3KZ1E 2RCNA 1E1QA 4N0EA 3SBDA 5JJLA 1PZNA 1UBEA 5E7IA 4BFUA 3CO5A 3DM9B 1YR9A 1Z5ZA 4DLZA 2CLDX 4D0LB 3SOPA 4HDQB 3UXMA 4DSUA 2RGNA 4HDCA 2RMKA 2DFLA 1E9RA 5EP1A 3WNBA 4AKGA 4NYIR 1G6OA 3FOZA 1E2DA 2AXNA 5J4LA 4XJXA 4UXIA 1NBME 3L82B 3MRSA 4CEHB 3ETLA 2YV5A 4WVFA 5FL7D 4I81A 3BFKA 2D3WA 3OE7A 3RS0A 3LD9A 2D2EA 3VFDA 1RPZA 1M74A 2CE7A 2WMOB 2OEPA 3BE4A 4K8OA 3ZVMA 1E0AA 2C78A 4MGYR 2OFOA 2QPOA 4NH0A 1XMSA 4P31A 5CDFE 3D8BA 1I4TD 1NBMA 4F38A 4MITA 5DGXA 4V0KA 5JWHA 2HV8A 3NEYA 2YINC 1DO0A 4Q47A 2B6HA 4JT2A 2L0XA 3FKSA 1N6HA 4Q48A 4A0GA 1UEJA 1E0JA 4F7WA 4ZCIA 2CBZA 1FX0B 1OPXA 1UPTA 2QP9X 1P3JA 4RY2A 3DOFA 2KSQA 2Y8EA 4ZKEA 3MGCA 3FVQA 1YR8A 3NEJA 1CR4A 3U60B 3FGNA 3RS4A 3UG6A 2ZI9A 1GRRA 5H8WA 4JLMA 4HZUA 1E1RD 4DDTA 4DUGD 2R9VA 1P2VA 1ZNXA 1X8LA 2ZS9A 3O8RA 2OZEA 2ORVA 2BIFA 4P4TA 2QPTA 1P2TA 3CF0A 2OUKA 3WMFA 2ZVPX 3Q7QA 5ANRB 3VHXA 4DDUA 2ZE8A 1LTQA 2QP3A 2JJ1A 3B78A 1VECA 4KLNA 4W5JA 3DM5A 1Z0FA 621PA 2HUPA 3BGWA 2Z5FA 1TEVA 5IT5A 2H16A 1ZIOA 1G17A 4DIEA 1BKDR 3PFIA 3CBQA 1G8GA 4PAOA 3TW4A 2WWXA 4NPHA 5FTNA 3LVQE 1OFHA 2O8CB 2D62A 1P61B 3W8RA 4LWZA 1CKEA 3IO5A 3TW8B 4WZ6A 4KITB 3VNVA 2EU8A 3TMKA 1XCMA 2F6RA 2IL1A 3TBKA 4LJ7A 2VO1A 4HLDA 5JBQA 1FUUA 4LPSA 4DLYA 1P9NA 4TMXA 3OEHD 2B8WA 1U9IC 1ZINA 3TVTA 4HZIA 1KTVA 3QI2A 3SI7A 4B3BA 1GKUB 1Z83A 2DWOA 2QTFA 4DJTA 3AVPA 5JSZB 1F6BA 2WHXA 2GJAA 3DZDA 5EXXA 4NYJQ 4R71A 4RFSB 1JR3E 2OFWA 3MWJA 3TSWA 3B1ZA 3VAAA 1CRQA 2R6CA 2BBWA 4TLEA 2X19A 1DG3A 2BBOA 4ARZA 1HUQA 4OI0A 3K70D 2ATXA 5JHHB 4JJZA 4EPVA 1FQKA 1GKYA 2IYWA 1ZCBA 2IHYA 4W5WA 5CITA 3SJZA 1G8YA 1FOEB 2R6GA 2IEZA 4KFRA 3LRPA 2QE7A 3PCRB 3I62A 5F98A 5FFMA 3K0SA 1Z28A 4P4UA 1N0UA 5EJEA 3LO5A 4BZQA 5FOSA 1YRBA 2QMHA 1HT1E 4ZDWA 1IN6A 3BOSA 3T5DA 1CIPA 1XEXA 4GOKA 4YC7A 2W0MA 4L5BA 1WXQA 3NH9A 4DCVA 4E22A 2VP6A 3VU9B 3QKSB 4ACAA 1HTWA 1K6MA 2JJ8A 3T1OA 1G6HA 2OESA 1EWQA 4NCIA 4CT5A 3QBTA 4ON9A 4BLRA 3QOFA 3AP3A 4HB0A 1NSTA 1JALA 2C99A 3F8TA 1OXTA 1RRFA 5DE3A 1Q22A 1P4SA 3GJ3A 2WJGA 1ZM2A 4OI4A 3PEWA 1NN1A 6Q21A 3CONA 1KI7A 2H7VA 3EXAA 2P3SA 2HJGA 4A1FA 2XSZA 3VNUA 3ZVNA 3CH4B 4C0AC 5IHPA 5CB8A 3BB3A 3M4YA 4I1VA 2NIPA 3NC0C 3KKNA 2BJVA 3TUZC 1R5BA 4EJSA 1YZKA 3WNCA 3X1ZA 4HAWA 4ASUA 3SZRA 4TSFD 4IDOA 3RWMB 3H2YA 3DKVA 1T8TA 4TQ9A 4W7SA 3FB4A 2GKSA 2RGGA 2N42A 4PPFA 4Q1EA 2KI5A 2REBA 2PH1A 3NWJA 2XNDD 3CUEF 2J5XA 1E94E 5B64A 3SQWA 3Q85A 2ZI4A 3OAAD 4PO9A 4BFTA 1IN4A 4D81A 3SU8A 2IBMA 1DAFA 4QGAA 1Q1BA 2WM9B 4B6EA 5E4FA 3U44A 4BFZA 2WSMA 4Z54A 3MWKA 1ZM7A 3TE6A 1YZTA 3CX7A 2CNWD 1T0HB 3KJHA 2NZ8A 2EWVA 1JNYA 3N2EA 4MQBA 4MRVA 2RHDA 5GJVC 3ADBA 3EIEA 3A1WA 1NMXA 2ZYVX 4DLVA 3B1WA 3ZJYA 4BLOA 5JLJA 2ZSAA 2GXUA 3FKQA 1G3QA 4RD2A 2WOJA 1RVDA 4Q9LA 4PAQA 4URYR 4IKEA 2YKGA 5AUQA 3LBIA 2FFHA 1TX4B 3BFVA 1G20E 4GPTA 2GILA 4AG5A 1FUKA 2LCFA 1UFQA 2VSOA 3OEEA 3NVAA 4QNMA 2KBFA 4LGMA 1R8SA 5BN4A 2XNDA 2FSHA 3CWQA 4XH9B 3GMTA 5KUTA 2QMEA 4DB4A 1E79A 3QXSA 4F4CA 1FNMA 3GLGE 4LV6A 4F92B 4KODA 5L8VA 1XXHB 4QBHA 1OE0A 3SHWA 1BYIA 4C9BA 4LX0A 1R2QA 2HT1A 4RFVA 1PLKA 2QUZA 2GF9A 2QAJA 2J9RA 1KK2A 2PZGA 2OXCA 5JSZA 2WKQA 3AF3A 1IXZA 3DOEA 1KK1A 1Z2AA 1XU4A 1IOZA 4PQFA 4A4DA 1A5TA 4A2PA 2XSZD 1ESNA 3AM1A 1XX6A 4PC2A 2N1BA 1JAHA 5FR2A 5SZKB 4LJ6A 3U2QA 3UATA 3ZVRA 2WPDA 3EW9A 4C2UA 5HCNA 4M53A 3VQTA 1RJ9A 4IFBA 2FJUA 5JRJA 1C1YA 2PMKA 1E2GA 4OK5A 5HZKA 1Z6GA 1X1RA 3QKRB 3AP2A 3THXA 4BFXA 3KJEA 3CIOA 2CK3A 3PEVA 4UXHA 4DC9A 1KI1A 3X1WA 3ZDQA 4TMTA 4ZIRB 4LCBA 3GLIA 4A92A 1SHKA 2W83A 4MDEA 4GOJA 1MRSA 2GZAA 1VYUA 4V03A 3UMFA 1QHGA 2V6IA 4O0MA 4PPNA 2XTZA 5EP4A 1II8A 3IDQA 2OLKA 4K46A 4A2QA 3VX3A 4XSHA 4Q4HA 3T1QA 2QG6A 4AWXA 3AVTA 2GWHA 3LXXA 1CS4C 1SXJE 2HDNB 2NMVA 3CNLA 2IS6A 1NNEA 4ZDIA 4O3MA 2QQEA 3HU1A 2G77B 1BYUA 2ZYUX 4LOAA 1U98A 4HDOB 1S4QA 1M6NA 3CKLA 1N5KA 1Q1EA 2YOGA 3V00A 1SXJA 2J7PA 1W7AA 4KAXA 2ZSFA 3K0CA 3W90A 3V4FA 2PZEA 1R0WA 221PA 4L9SA 3K0FA 4XSGA 3IQXA 1D9ZA 4WXRA 1Q1ZA 1MO3A 1RE0A 5CK5A 4UKDA 3U44B 3BFXA 3E1SA 4KXFB 1S3GA 1RJ9B 4CEJA 5CLQA 1OB2A 1W36B 1PUIA 3MCAA 3NTUA 3RHFA 5DH9A 3OIWA 4URUR 4DIDA 4TL6A 4YMWA 4FCWA 1VPLA 1P6XA 4NYJR 4B34A 4Q5IA 4DCSA 2IYSA 1CLUA 2GEDA 1SVWA 3VU9A 4AYTA 1N6PA 2FU5C 3KUDA 3RSLA 4QHTA 3HJNA 1XEXB 1TF2A 4RD4A 1ZCAA 2PLFA 3SE0A 1XNJA 2HYIC 2F1RA 4CT4B 3T12A 4G5GA 1TF7A 3SNHA 1GITA 4HZUB 3I72A 5KSOA 2D06A 4C7OB 1E2EA 3U3KA 4GOXA 4HI0E 2PJZA 3HPRA 2Q9BA 3GLFB 1DO2A 3ZGXA 2CHVA 1XF9A 3CPHA 4M1YA 4OBEA 3TVDA 5JMTA 3LWNA 2JIZA 4CW7A 1JXOA 1E69A 4NYMQ 1WF3A 3K0FB 2FG5A 2I4IA 4TYPA 2NZJA 3EASA 2IWRA 3RS5A 2JATA 1GAJA 2FWRA 4Q9IA 3FHTA 4S35A 1FZQA 4DDWA 2NO9A 3CRW1 2YYZA 4POAA 4DRZA 2IYRA 4F4IA 1IN8A 1KAOA 3HWSA 3OESA 2Z83A 3W34A 1XTIA 2JLZA 4YDHB 2E1RA 2IA5A 5EXPA 1OH5A 4OQLA 2ZYWX 1XZQA 1E4YA 2V1XA 5F9FA 1IHUA 5GJWC 3TQFA 2C9YA 3A4MA 4AIIA 5L3VA 4N3NA 4QKQA 2G0TA 5K8LA 1VYTA 3EPJA 2AFHE 4OI2A 4RVCA 4M9XA 4RCZA 5FOUA 5C2JB 1W2HA 2QL6A 3EWSA 3NHBA 2C2HA 2BM1A 3HPQA 2OAP1 4Q4JB 3GLGB 1WBBA 4Q4AA 3IBYA 5IF9A 2X2EA 1ZM4A 1BO6A 3KXLA 4LDJA 3QENA 3EC2A 4CGZA 3U61B 4LBZA 2FEMA 2O0HA 1JQJC 5CM9C 5AWFC 4B2LA 2BEKA 1Z06A 3LQQA 1UF9A 4ESVA 4Q7MB 1I2MA 2ZIAA 2F43B 1KI6A 1XJ0A 3B82A 2FPMA 5DYIA 3KFVA 4IOKA 2O8DA 3K70B 3DL0A 2OE2A 3T1VA 4P32A 2ZR9A 1VIAA 1YZLA 1Z6AA 3G5UA 1NVVR 1W44A 3LAWA 4IEIA 4V0LA 3PUYA 4C0HA 2PCJA 1NSFA 3K0CC 5B58C 5C1BA 3CZPA 5L3SB 1XD2A 3DMNA 4JJKA 1L2TA 2H18A 1S1MA 2VRWA 1US8A 2F3RA 3OFNA 4PC7A 3TH5A 3GLHA 2CJWB 1LF5A 2UZ3A 2ZRHA 2EFEB 4C4PA 1JAIA 1TQ2A 1W4BA 2FGKA 3U6BA 1HQYE 1DS6A 2BMJA 2BWJA 3ZQJA 3RDPA 4IHQA 1VTKA 3B1XA 2AL7A 4I4LA 4GZMA 4B75A 2UZIR 2CHGA 4KV9A 2WIAA 1J7KA 3B6EA 1KO5A 2FSFA 4R98A 5BXQC 1D2NA 1CTQA 3CWZA 1TNDA 2AKYA 4FMBB 1LY1A 1FP6A 4HB2A 3BB1A 3T15A 4IDHA 5KYKA 1S9DA 4F4JA 4KFUA 4M1WA 4NP6A 4XD7D 3OZXA 2NPFA 3O8BA 1D9XA 1NVUQ 3P20A 1YKSA 5SZIA 1G41A 2N46A 1ZMXA 1FTNA 4MUBA 5JWOA 5FUXA 1TTTA 4RKFA 3IGFA 3IIJA 2VYFA 4C0KA 4G5QA 4JLNA 1U8AA 2CLCX 4ZO4A 1KGDA 1WE2A 4IEEA 3WMEA 1VYVA 1P60A 2WJYA 1KNXA 1C4OA 2OBMA 3FKSD 4H9GA 2VP0A 1G8PA 2YZ2A 4JKIA 3AUXA 4MKHA 4URVR 3LFUA 3RLFA 1Y3AA 4D4JA 3F3YA 1FNNA 2CNWA 2HYDA 4NYIQ 4Q1AA 4QNRA 1UJ2A 2CJWA 1V5WA 5HZHA 2DPXA 2UKDA 3WMGA 5L3QA 3LBHA 2QM8A 2Q3FA 1A4RA 4FMDB 1NN5A 2ZEJA 1JBKA 3OAAA 1E98A 1EX7A 2EVWX 3RAPR 3UG7A 4MYHA 1T9HA 4JLVA 3BBPA 2ZETA 3R9IA 1K5DA 4CEHA 2VHCA 1UKEA 3CW2A 4LYHA 3ASYA 2VF8A 1E2QA 2ZRKA 1JJ7A 3ZS8A 2ZRIA 2AWOA 2XX3A 4M1MA 3K09A 3TRFA 3FPAA 3T1TA 3KXIA 3FE2A 1Z29A 2ZAMA 3B7GA 5FBLB 2CL7X 5TY0A 3X2SA 1J2JA 2FH5B 1SVLA 2D74A 1RYFA 2XB2A 3ADCA 4O2RA 2QSYA 4EJSC 1OF1A 3GP8A 1YZGA 5K8TA 1CU1A 3RYTC 3TNFA 4PSAA 1ZD1A 2A9KA 3W8NA 5F3WB 2W00A 3P4YA 4URZR 1W1WA 2PT5A 2YWEA 2IX3A 4PPGA 4Q18A 2AXPA 2NPIA 3H1TA 4JL6A 1YE8A 4PHFA 1MH1A 3CRMA 1U81A 4LUCA 1L4UA 2OCYC 5FH9A 1UBCA 1SVKA 4P33A 5JWRA 1ZNWA 1I4DD 2QGNA 4B44A 2J1LA 2ORWA 1T6NA 3I32A 4IOLA 4JVSB 4UNSA 1KKMA 3DZ8A 1HV8A 3EIQA 1EESA 2QZ4A 2ZRPA 4Q1CA 1BIFA 1KMHB 1E4VA 1IBRA 4JMPA 5DN6D 4B3FX 2IS2A 1KSFX 3JZAA 3C16C 1WB9A 3LW8A 4A0HA 1AJEA 2NTYC 4D4KA 4HUTA 1HA3A 3R8FA 3R8CA 2EFCB 1Z0AA 1HT2E 2G6BA 5FPKA 5GVRA 3SBEA 1F2TA 2WJVA 3KXKA 1QDEA 3EWAA 4IW3B 5EXTA 5AR1A 2AN9A 1S96A 4OHZA 4Q9HA 5FOVA 2GAAA 1JECA 1EX6A 2A5GA 2ZSDA 5FBWB 1II8B 3C14C 4U5XA 1CRPA 2FFQA 3SYNA 2GXAA 3DEFA 3PITA 2ZITA 4E5UA 1G8HA 2WWWA 3AGQA 2QM7A 5EE9A 1UKZA 1W0KA 1DOAA 1ZYUA 3PEUA 3FWYA 4C2TA 3J81k 2IYXA 5AJYA 2LKCA 1BS1A 5GADl 4EPYA 1G3UA 3OEHA 3NG1A 4WZAE 1E2JA 4RSGA 2EQBA 4B74A 4U00A 5FOXA 3U5ZB 1F2UA 4I1SA 4TTPA 4Z1MA 1NVWQ 4AG6A 4JLKA 1IY1A 2VQSA 1OT3A 4JBYA 1QG4A 3THWB 4CEIA 3WXMA 2OBNA 1KAGA 4EQ6B 5JEEA 4OQFA 1PLJA 2YC4C 2WSSD 2TMKA 3LBNA 4B47A 1ZBDA 4FCTA 4DVGA 3QJYA 5CLLA 1IJEA 1TEXA 3WNDA 3X1XA 1YR7A 3I8SA 2EWWA 3SYKA 4GL2A 5AJVB 2GBLA 3H4MA 2LKDA 2QTHA 4B6FA 2XGJA 2QRNA 1R8QA 2ANCA 2WWGA 5H1YA 1GTVA 1TU4A 1W0KD 3O47A 3NIBA 3RABA 5A4JA 4D82A 4FW9A 4TYYA 2W0SA 1E2LA 4LBWA 4MRRA 4YONB 4ZV4A 3D7MA 1FFHA 2V54A 2OO7A 3I73A 1E1RA 4M22A 1E9CA 2ZXUA 1DARA 2ZAOA 3HU3A 3IEVA 2F9LA 3MFYA 5EE5B 2VPPA 4A8JA 3CPEA 2CMKA 4X8HA 3QSYA 4AKHA 5CIQA 2MMCA 2P67A 121PA 2PL3A 1P2SA 3VKWA 4KCGA 4LJ4A 4R9UC 2OILA 4AC9A 1V43A 2CXXA 1CR1A 3SN6A 4Z1MD 5DO9A 1TQ4A 1T91A 4DLUA 3KL4A 2W2TA 5EUMA 5J47A 3QNUA 1A7JA 4BQSA 4DEYA 4XVUA 4DKXA 1U90A 2ZM5A 1Q20A 4JVLA 3LY5A 1KO4A 4JYCA 4DCUA 4G1UC 1ZRHA 1G21E 1G8FA 2ZRDA 1N6OA 2WAYA 2YHSA 3PQCA 3PUZA 3WBJA 2W2XA 3TK1A 4EUNA 2FDCA 1D5CA 5JFGA 2VP4A 1VCNA 1ZP6A 2WJJA 1M7GA 1LW7A 2BOVA 3BH6A 3JZMA 3N5CA 3TSOA 4ZIRA 2R6AA 1T3SA 4ZI2A 4TWZA 1AQUA 4Q19A 1MKYA 2ZRCA 2ODWA 2O8BB 4QGHA 4L9WA 5DIFA 3THWA 3WRYC 4EQ6A 5FUVA 3P4XA 4Z51A 1DTSA 1GNPA 2GA8A 1RKBA 1AA9A 4D26A 3L0PA 4IDNA 4QG7A 3AVYA 2ZI5A 1S8FA 2DR3A 3NHAA 4KJZA 5AJXA 3AVWA 5B57C 2XZPA 3QXJA 3C4JA 5CM8B 2GDJA 3WP0A 3QKSA 5ELXA 1SGWA 1X6VA 2WBLC 3KJGA 4DEXA 4ZKDA 2VSXA 5G41A 3KUCA 1A1VA 3C15C 3LXRA 3ONWA 3L2OB 3Q9LA 4PZLA 4CZ2A 4MH0R 4QXAA 1H8ED 1RRPA 3QQ5A 4HB4A 1M7BA 1DPFA 2CHQA 2CCGA 2CK3D 1IM2A 2JLYA 1JR6A 1LF0A 4OK6A 1E0KA 2YNMA 3IPXA 4AKEA 2F7SA 4BZPA 3Q7PA 2G3YA 2GJ9A 1GRNA 1F2TB 2DHRA 4HSEA 5KNBA 3Q5EA 1DEKA 1W5SA 3Q5DA 2ODEA 2WPDD 5KPDA 4DLSA 1KSGA 2V1UA 1P73A 1AIPA 2JAQA 4ARZB 1MABB 4YQFA 1XEWX 3NBYC 2Q21A 4QRHA 1OJLA 2BMFA 2ZSEA 5BYJA 4O2LA 4KU4A 4RJLA 2GETA 4WW0A 4DCNA 2Q6TA 4BUJA 2D4HA 1XRJA 5FI0B 2ZJBA 1GKIA 3AVOA 3CPJB 4LYAA 4KSBA 3VR1A 3VKGA 2AR7A 4XTCS 2WJIA 2AHOA 1J70A 721PA 2BMDA 2RGCA 2FEOA 4TL8A 4OQNA 1N6IA 2MSCB 4LYJA 4D4MA 3OIVA 1ZNZA 2Q0HA 2IEYA 1VMAA 2J0UA 1E9EA 2ZSBA 2ZJAA 3NH6A 4KLZA 1JXMA 1EFHA 3KB1A 5IDVA 4B3DA 1IXSB 1FPMA 2GJ8A 2ZVQX 3U3OA 4CVNA 3ZIAA 2IK8A 3AVQA 3U3RA 1XPUA 3A6PC 3ZS9A 4JYBA 2J7KA 1OXSC 3N2IA 4A82A 2V3CC 4MKFA 2O5VA 5DI3B 5J4KA 4W5HA 2KJQA 4PC3A 1Q3HA 4R2HA 3THOA 3IIKA 3ZZUA 4QBIA 3NBFA 4IOJA 2JA1A 4EPTA 2GK7A 5J4YA 3K9HA 1OKKD 4US2R 1OW3B 3GJXC 1HQCA 5G3YA 1DAHA 3UANA 1OHHD 3C7KA 3ADDA 1GFIA 1CJMA 4P4SA 3IIMA 2OCPA 3ZIAD 2GESA 4E09A 4JS0A 4BGDA 3EPKA 5LD2C 2O52A 4XD7A 5HTKA 4NMMA 1KI4A 1GL7A 1YZUA 1ZC4A 5FL3A 1G18A 1SKYB 3UMRA 5JHGB 3KQNA 4A2WA 1G5RA 3KKOA 5DISB 2WV9A 4TMZA 3QBVA 3H84A 2NQ2C 1ODFA 2O0JA 2ZI3A 4US0R 4LJ5A 3KQUA 2WWIA 1TADA 1E2NA 2BKEA 1NMZA 4C0QC 3L43A 3I61A 2CCKA 2NG1A 4L16A 3PJRA 3FHOA 1TUEA 3ND9A 4KYIB 1LFDB 3KJIA 1PUJA 5D3QA 1N3BA 3L8ZA 3QKUA 1NP6A 1E2PA 1KZGB 1KOFA 3MAAC 2A78A 3QPWA 5UKDA 4QJ5A 4ABYA 4A15A 4A36A 1VIYA 4NU0A 4M9QA 4FMCB 4JZKA 4KFSA 1E79D 4OHWA 3AUYA 2Q9AA 4BE7B 1OFIA 1KZ7B 2VTKA 3TKLA 5HE9A 1AS3A 3K9GA 4LBYA 4G5SA 3RSOA 1HH4A 4UNQA 2QROA 5D3MA 1JEDA 4BRWA 4M9SA 4TZ6A 5DHFA 5BWMA 1TQDA 2R44A 5FUYA 2H1LA 3K9NA 5E7MA 5E7JA 2A2ZA 1TMKA 4B3GA 2FPLA 3LX8A 2BV3A 1ZUNB 4JLDA 4QBGB 4D4LA 1QHHA 1F3OA 2CL6X 5EUQB 421PA 3E2IA 4ZCMA 4AY2A 2GEVA 1AK2A 3QY0A 3R7WA 4BLSA 4BLPA 2GXSA 4XOIA 3U7GA 3NC1C 2IYQA 2BVNA 4PFSA 2ZPTX 2QE7D 4PHTA 5SZJA 2OCBA 5BW8A 4GI7A 4NZYA 2YVUA 1QBKC 1A2BA 1ZM3A 4H1VA 4GDFA 1QG2A 2A5DA 1N6NA 4G0NA 1DELA 4GMDA 1DAKA 1H8HD 5EZ6B 3THYA 3EAQA 2F1IA 2OLJA 3BAFA 5FPSA 5KSPA 2IYTA 2QTVB 1P9WA 3SJAA 3ICEA 2GZDA 4BFSA 1OV4A 2QAGB 4HLUC 3CRRA 3IUYA 2ZTSA 4H1UA 1G3RA 1KK0A 2WVJA 1YU9A 1SHZA 2ONJA 5FUWA 2D2FA 1T5IA 2WWHA 1AKYA 4OQMA 1G4AE 2FX3A 3AB3A 1AKEA 1LVGA 2ZREA 2OXRA 3K1JA 4LBVA 1CJTC 2WAXA 1OIVA 2V8OA 3I92A 1Z6TA 2GJSA 4I1UA 3ZD6A 5L3QB 5B30A 2GHIA 5CJ2A 5C4GB 4JSTA 1SQ5A 2FPKA 3SJBA 1NRJB 4YMTA 4B33A 3A4LA 3GLHE 2C03A 2FE4A 2FSGA 2J7PD 1E2HA 1OXVA 2P65A 4GFDA 2QBYA 4UJ3A 4NDZA 4B73A 1B23P 3BIFA 1M1YE 1UM8A 1H8HA 4M1SA 2WIBA 3LA6A 2XITA 3P1JA 2ZU6A 4AKIA 1N6LA 4KO8A 3NDPA 5AK0A 4BEJA 2VP9A 4NKRA 2O8FA 2ZRNA 2HCJB 1BH2A 2R8RA 3RS2A 3RS7A 5HR5A 1G291 1D2EA 1X3SA 4M4SA 1E6CA 3GJ8A 2HJVA 2GZHA 1VHTA 3KFXA 3TUJC 2H57A 5IRCD 3N70A 2AFIE 4JSYA 3SYLA 1EFUA 4ESHA 1KI2A 2XXAA 4BFWA 4FMDF 4IDPA 1OKKA 3A1UA 4LHXA 4PXAA 1UKVY 5HKKD 5FPTA 3DHWC 5J4VA 2VHJA 3KKPA 3B5JA 1QRAA 2HLDA 3DKPA 2P6UA 4HAZA 4UNNA 2B92A 3B13B 5JEDA 3UKDA 4PC6A 3RWOA 4AYWA 1XXHE 3GLIE 1YHNA 5AJZA 2WWYA 1TQ6A 4WBSA 2D7CA 1W47A 1YZQA 2ZU0C 3KDSE 5J5CA 1PJRA 2JCSA 4EFNA 3CZQA 2H8KA 3T06B 4NCKA 1F60A 2FGJA 4QHSA 1DAEA 3EG5A 2A5YB 3RRMA 4B76A 4TLCA 4AD8A 2O8BA 1XTQA 3K09C 4HAYA 3K70C 3U7HB 4DLTA 5DI9A 2PEZA 4WZBE 4OI1A 4TMKA 2X77A 3U7EB 3ZH9B 2QT0A 4NHOA 3W5JA 3TLXA 2ZYTX 3V4RA 5A0FA 4K81B 2O8EB 3I5YA 4O25A 1T0JB 4PSKA 4LJ8A 4Q02A 3QVUA 4V0NA 3SJCA 1KI8A 2BJWA 4FWIB 4HUQA 4L4UA 3LX5A 4CRWB 1XB2A 4LI0A 4LV8B 2EFGA 4XWAA 3TAHA 2BBSA 3PUXA 2A5JA 4URWR 4DHEA 2G0NA 1NF3A 5TMPA 2ZJ8A 2R62A 1S0UA 3ECCA 1X8JA 2FFBA 1NY6A 1U94A 1GOTA 5SZHB 3UWOA 2X8AA 4YLGA 4WOPA 1T3HA 5JS8A 1KKLA 1T3LA 4TL7A 2C8VA 2Q3MA 4MDFA 2ZS7A 3WRXC 2FOLA 2NO6A 4HEJA 4YMSA 2OT3B 1U2RA 3B9PA 2IYVA 3UWKA 2YJTD 1VDZA 1TL7C 1CP2A 5JS7A 1Z07A 3QKTA 2RB4A 3BORA 4TQUS 2D7DA 2JJ1D 1RRGA 2ORIA 2QI9C 2XAUA 4TMVA 3WY9A 2ZRMA 3U3JA 4AURA 4HAUA 3OF5A 2QRZA 5EQTA 3T61A 4BPBA 1CJKC 5JJIA 1SZPA 1VHLA 4EPRA 1WQ1R 2PX0A 2QMUA 1XMJA 2VBCA 3U4QA 1NBMD 3AH8A 1XMVA 1XCGB 3EZ9A 1YVDA 4ZDKA 2P0EA 2Q9CA 3CR8A 2B8TA 3G0HA 3TR5A 4C0BA 1EK0A 1IONA 1J8YF 1JQLB 3WP1B 1ZIPA 4RKEA 2V7QA 4DWJA 1P72A 3GJ6A 3AF1A 3ZZTA 1D8TA 3A1VA 2ZJ2A 3RRNA 1ZD9A 1ZD8A 1CEEA 3REFA 3AKCA 4B71A 2JEOA 3QF7A 1S1CA 3CH5A 4JVMA 4B32A 4M21A 3PV0A 3LLMA 3VR5A 3W6PA 4JLBA 4Q1FA 2GCPA 2VH5R 4BWYA 2QT1A 2Z4SA 1UKYA 4DSOA 1E9BA 2C96A 2QENA 1U8ZA 1W0JD 1Q57A 3FMPB 1XTRA 1KDRA 1MRNA 3D31A 1Z3IX 4FIDA 2KB0A 4Q4HB 1HURA 2JLRA 4MKGA 4KYUA 1GDDA 4TLAA 1JPJA 2ERYA 4QBFA 2OV2A 5KNCA 1SVOA 5FL7A 1U99A 2XJ4A 4U02A 2J87A 3AP1A 4BECA 2CE2X 2OCAA 4LJYA 1GSIA 2RH5A 2GCOB 3AVUA 4IVRA 1X8KA 2RGDA 1CBUA 2ZRGA 2H5EA 2NOAA 2DFTA 4GP6A 4YDSA 5FI1B 1NY5A 2MSEB 4HLQB 4EAQA 3UPUA 1GILA 2ZUDA 2C04A 3DDCA 1M8PA 1OXUA 1P2UA 1UDXA 1Z08A 1MABA 1KSHA 1YJ5A 2ZRFA 2Z0MA 5KOYA 1AS2A 1YZNA 5AJWA 3D3QA 4V02A 2JDIA 3CNNA 3R20A 4B2IA 4PO1A 4BEBA 1KJZA 2REXB 4PHGA 2E87A 4M1OA 4Y0AA 4DB2A 2IS1A 4HATA 4A0FA 1W4RA 1Q12A 4FMCF 4TTRA 4GP7A 2DFKB 3A4NA 5DN6A 2QGZA 1NKTA 3BB4A 1CF4A 1VCMA 3Q72A 2JLVA 2FZ4A 1MR3F 1OIWA 3TUIC 5E95A 3ASZA 1W36C 1Z47A 1KJYA 1N5JA 4XWOA 5AUNB 1XCPA 1QHIA 4NCNA 1YR6A 1RYHA 2HLDD 1WBDA 2XNSA 4HAVA 4V0MA 4UJ5A 5DI3A 4Q01A 5EP2A 1ESMA 3L0IB 4UXJA 1JR3D 4JL5A 1X1SA 3BH0A 5FOTA 3EA0A 4B35A 3FFAA 4DLWA 1EGAA 2QNRA 3B8HA 3KB2A 4UNRA 1J8MF 4LC1A 3KQKA 3BRWD 2J59A 3PIRA 2V9PA 4G3XA 2PT7A 3W9YA 3IILA 3P32A 1XEWY 1KIMA 5BYKA 1LV7A 1GRQA 4FXPA 2XOKD 3RS3A 4EIWA 3O8DA 3DMDA 4MRPA 4N1AA 2IYYA 3KQHA 3L8YA 3QPUA 1NN3A 1Q21A 3LH5A 2RHMA 3CB4A 1G7RA 3SHFA 3C5CA 2PMDA 3EZ6A 3KTAA 3M6AA 1NKSA 2WKRA 5BN3A 5CYPA 1D6JA 4B3XA 4AK9A 1R5NA 3BWDD 5EP3A 3GJ5A 4C0SA 2HCBA 5A5GA 3SEAA 1XTJA 1Z6YA 3KKMA 3QXXA 1G5TA 2RGXA 3QF4A 1E2FA 1XEFA 2PX3A 3EPHA 3ZZ0A 3IKJA 4PR0A 1GVNB 4BASA 1F48A 1U0JA 821PA 1KMHA 3HP1A 4RD0A 2A7QA 3PG5A 1R10A 1GL9B 2ZRAA 1Z0DA 3DPUA 1U0LA 4G5OA 4OYHA 1R7RA 2I1QA 1NLFA 2RGBA 3K0AB 5DNYB 2OFXA 1UEIA 5DYGA 1SVMA 3IEUA 4NTZA 4PX9A 4EPXA 2ATVA 1KNQA 1WCV1 1HEIA 2YWHA 1P62B 4JT4A 4Q7KA 4Z8YA 521PA 3EX7C 4AI6A 4PANA 2B21A 4KBGA 1OYYA 2WZQA 5B2ZA 3QEJA 2IWHA 3EZ7A 5CYOA 1NJGA 4DSNA 3SFZA 1XPOA 4JLAA 5CK4A 2O8CA 1ZU4A 3W6NA 3GEHA 2BMEA 1VG0B 4TT3A 2GVDC 5JI3E 2Z4RA 2AK3A 1LNZA 1OLOA 3ICQB 1GNRA 1KO8A 4G5RA 2O8FB 2W6JA 4JLOA 1HY3A 1IY2A 1BOFA 5G3ZA 3EIHA 5AUOB 4Q7JB 1M34E 1ZVQA 5FTLA 2GCOA 1MT0A 4EDHA 4GSYA 2VIIA 2VHQA 2WICA 4KVAA 1QZXA 2BEJA 2C5LA 2QORA 1P9RA 2XTNA 3FYHA 1R6BX 4ILEA 2EFDB 1N2CE 1R5OA 1ZUHA 1PV4A 2J0UB 3OFND 4B48A 2QA5A 4P0TA 3PEYA 2F55A 4HLCA 2PEYA 2JIZD 1FTSA 4RD1A 1G3MA 5CIWA 3VHLB 2H92A 4RZUA 2H17A 5HCIA 3QEOA 2DY1A 3RANA 2ZE6A 1GP2A 1JEEA 1FX0A 2G83A 5M04A 1AM4D 3HR8A 1A82A 1EWRA 4P3YA 4IOMA 2Z6VA 1N25A 3MLEA 4PC1A 4LV5B 1FQJA 1YRAA 5KSYA 1R0XA 2P6NA 3SQXA 1OB5A 2QU8A 2J0QA 3NXSA 2ZI7A 4AYXA 4DZZA 3UIEA 3H86A 3QG5A 2E9SA 3RVBA 3LW7A 1SULA 5KU1A 1WDTA 1WP9A 2A5FA 2ZE5A 5FTMA 4WA7A 2VP5A 1RRCA 3DVLA 3NKVA 4US1R 5H68A 4M1KA 3F0TA 3RNLA 1E9SA 1MO4A 2BHRA 1RC8A 3GFOA 2OG2A 1FMLA 2I1VB 3AVVA 1AQYA 1N6RA 2IYLD 4X8OA 4Q7LA 4QC2A 1OHHA 3CF6R 3AKDA 5C46F 1E0SA 3W6OA 4OJKA 1OH8A 1WA5A 4ZI3A 3JVVA 4XVRA 4D0GA 4BZXA 4EJSB 3GQBA 3Q3JB 2GNOA 4N0DA 3WYFA 4A0RA 2R2AA 3M0EA 5C4MA 2ZJ5A 1OFUX 2B7BA 3EZFA 4M0LA 4D6PA 4QFMA 4LPKA 4UNPA 4GNKA 4Q4AB 1KDTA 1EXMA 1VG9B 5AUPB 1C9KA 2G88A 2VP2A 2IXFA 2ZJZA 3LQRA 4D2IA 4JKYA 1QVRA 3LDAA 5EZ5A 2F3TA 3CR7A 5C18A 3WBKA 3CNOA 4CEIB 2JASA 3QXHA 3GJ7A 4QHYA 3R9WA 2GVZC 1ZAKA 5KDOA 1XJQA 4MYCA 2XB4A 3OEED 3VR2A 1TUIA 1FL9A 5G53C 3C41J 1ANKA 1TAGA 4FCVA 3U4QB 4ZDJA 1P75A 3AKYA 4HYYA 4D25A 1X86B 1COWA 2AD5A 3RRYA 3VX4A 4NCJA 2GF0A 2XEXA 3WYAA 3GLIB 4GT1A 2VEDA 4KBFA 3U7FB 2EYQA 1DAGA 1OXXK 1QF9A 3BS4A 4RD3A 4ASUD 1WRBA 4Q4JA 3GLGA 5DLQC 2G1JA 3EPLA 2F1HA 3A58B 2IYUA 1S2MA 1I2DA 3IPYA 4Q21A 1E99A 1G64A 3TQCA 4CF7A 2HT6A 3WHLA 2VF7A 2J45A 3A1SA 1RFLA 5LBIA 2KBEA 2KE5A 2ZS8A 3UK6A 2EFHB 4IXNA 3X1YA 2CLSA 2J0VA 3V9PA 1XFAA 3CX6A 2O0KA 2KWIA 2ZR0A 3CF2A 2XTMA 3A1TA 4KI0A 1G7TA 1KDPA 4ITRC 3IBGA 5TVKA 4C30A 3EC1A 2V55B 4JLPA 3VTKA 5JECA 3VR3A 2A3RA 3AQ4A 1GUAA 2JGNA 2C95A 4TN1A 2DYKA 4DLRA 2Q3HA 4BRUA 2O8EA 1Z8FA 2ZROA 4NCHA 1OH6A 3B9QA 4Y0VA 2PZFA 2ZUBA 1GL6A 2ZUCA 3TJZA 2BCGY 4QJ4A 4BLQA 5L3RA 5J40A 3PUVA 2BKUA 1Q1QA 1E2KA 3P27A 3GFTA 4CEJB 1IN7A 1T5LA 4L15A 4LRWA 1XWIA 4RZXA 1F2UB 1CULC 1XJCA 4B3CA 4U7DA 5KHOC 4CDGA 5KDDA 2F43A 2O8DB 4MYTA 4KFTA 3FDIA 3LVRE 4E07A 1DVRA 1J90A 1N6KA 1UDWA 1T8UA 1N5LA 1OIXA 4MRSA 4WXPA 8OHMA 1Z6XA 3LLUA 1DAIA 1W49A 4D80A 4OL0A 4Q66C 2X1VA 2ANBA 2FNAA 1Q44A 3RRZA 3B85A 1QHNA 3FTQA 5CB6A 4QGFA 3M1IA 2QP4A 4C0LA 1ONBA 2W6IA 3K0EA 5EE1A 2AD1A 3GEIA 5FBQB 4Q00A 4X8MA 4L8GA 4TLDA 3THYB 1XD9A 4Q03A 4OHYA 4LHYA 2QAGC 2XXAB 1NLZA 4X8LA 4KSCA 4JVNA 4IDQA 2BBTA 4URXR 2RGNC 3HDTA 1XPRA 2QSZA 4DBLC 3H0KA 2PCLA 3AVXA 1JB1A 1WMSA 4PTLA 3MMPA 4BFYA 2AX4A 2VL7A 3FMIA 1E3MA 2R65A 3QG1A 4PAMA 3HYRA 1XTSA 4PQRA 1KYIA 2IYZA 1KI3A 3MWYW 4TTQA 1NI3A 4DDVA 3RC3A 2MMGA 4JBXA 2PBRA 1XBTA 3K9LA 2HXYA 1S3SA 5GVSA 4KHZA 1SKYE 1O3YA 2NO0A 3AEZA 3TR0A 1IN5A 1W48A 5E3HA 3BD9A 1DE0A 1DG1G 3TGPA 5FOWA 2IF2A 1TF5A 1IAQA 1ZM9A 2AWNA 4HB3A 2ERXA 2CVFA 1G16A 4QM6A 3CRQA
chains in the Genus database with same CATH superfamily
1OX5A 2XB8A 2ADOA 3H8JA 3WGTA 4UW9A 1GCIA 3VPCA 1GAXA 1G7SA 3R0ZA 2AV6A 4BMYA 1SUDA 2H5IA 2V3WA 1NJ6A 1H22A 4CDNA 2JFBA 2Z6UA 2XRMA 1OBOA 2GEFA 3HG7A 3PRJA 4YAOA 5FYQA 3V3TA 2OHFA 2A5LA 4R1QA 2I4NA 3VSEA 3TXYA 4B82A 3RYHA 3SQLA 3WRWA 4HRVA 4QU9A 1KI6B 3EZLA 3KD3A 3SNKA 2NO7A 4QDKA 1D2MA 3VR4A 2QL9A 4JQZA 3MT9A 4AQ7A 3Q6MA 1C7EA 4IIBA 5GM1A 1AZTA 3RKRA 3FUTA 2XYHA 5A5FA 5FR1A 5CUQA 2RG7A 3K0AA 3CBGA 2B7CA 4YJ2A 4LF9B 1HE1C 3WWZA 3D8SA 1PT7A 4E33A 3HXMA 5IT9A 5HQ3B 3PIIA 3TSAA 1VCOA 4IR7A 1EE1A 5KCMA 2VTBA 1WJGA 4GD3Q 2FRVA 2WC1A 1ZZGA 3T3PB 3LNCA 3R5TA 2FPIB 4CYMA 3U7QA 1GLNA 1Q95A 3SHQA 4QOSA 3KQLA 4HN2A 4OKSA 3GGSA 4FINA 2R96A 1E9AA 1BXZA 2BEVB 4ACBA 4Q9NA 4G0ZA 3MAJA 4S1NA 1EM8A 2P4SA 3OPYA 4P4GA 3X3HA 4F93B 4HMPA 4QGGA 2HA5A 1Y42X 1GN8A 4XIGS 5H4HA 3PTAA 5HIIA 3RSGA 2SKCA 1GADO 2XQKA 2P91A 4UBIA 2VSFA 1Z8HA 1TZKA 3FF1A 1JFFA 5FWXB 2ST1A 3KLPX 5LL6P 4JL8A 4YAKA 1UCFA 2AFHA 1LWNA 3B1JA 4UPDA 1OYWA 1ADFA 1TVCA 2K5UA 3FTNA 3CUUA 1UK8A 4HYTA 5LA6A 2IW3A 3M5WA 3OJCA 3UGQA 4ZVQA 2ZE7A 4KXLA 2RIPA 3EXEA 4RDIA 2EIXA 3I5UA 4H59A 3NONA 3W3AA 1JHAA 3CVXA 2R6DA 5C8YB 2YY7A 1OVGA 4I1OA 2QSJA 4EGAA 4QGSA 3ZLJA 3DAPA 3R9XA 3U9LA 5KVSA 5BQFA 4Q6BA 2IGTA 3RK0A 3T7KA 4MMYB 1INLA 1E5VA 4BLTA 1IJFA 1C0EA 1NW6A 4RD6A 1WQ3A 2PZJA 4Y6OA 2ZJYA 3PCTA 5I47A 4OHZA 1JJIA 3DWFA 4J16C 1P5ZB 4TM8A 5DXFA 3WHKA 2GSDA 2XZLA 3DONA 2DVMA 3OE7D 1KU6A 1MVLA 2UV8A 3RGWS 4IFEA 1W59A 4YCSA 4FR0A 4HUQB 3RVKA 3AU8A 2GAOA 4FFBA 3NFYA 2EYUA 4EO4A 3I1YA 3OLYA 3B5IA 3BH7A 3P19A 5AKIA 4AJ1A 1K9VF 2GYUA 1GV0A 1KQNA 4DDKA 5JJKA 4QL3A 4QRDA 4MLPA 3KQVA 2IXGA 1KJWA 2ODNA 3Q1LA 5E6UA 1T6ZA 1FFBA 5K4GA 4G4SO 1II0A 2B78A 4F1WA 1TVMA 3D6TB 5ES3A 4H0CA 3UMVA 4WFJA 4L78A 1I1OA 1TPYA 3JAWA 3WLNA 4MVCA 1KK3A 1R00A 4XB1A 3BWBA 1CRLA 1T5BA 3A6KA 3EXG2 1H94A 3SJ7A 1AGRA 1XOIA 4NBSA 4XTRA 3TOSA 1W36D 1CRWG 4ZT7A 2BDTA 4K9SA 4IMIB 4DAEA 3F5SA 2P2SA 4INPA 1PX0A 3DLIA 3KKZA 1SA0A 2L82A 4E2XA 1VMEA 4LJAA 5DSZA 1IK6A 1U0OC 1YUBA 2V4MA 3AF2A 3OIUA 5JI2E 1L7VC 2VDNB 1NIPA 2FFAA 2VATA 1MD9A 2PLAA 3NM5A 4NJEB 1CUAA 1QDLB 3A06A 3SR0A 4BV3A 2MYPA 3O91A 2PY6A 2CCJA 2ZSHA 3VKHA 1WABA 2BM8A 2JJ2A 2C2KA 3SFVA 5DEOA 3JAKB 4HDSB 5CX1A 3SD7A 4XWKA 2B1RA 4O4LB 1T24A 1E2IA 4KEAA 2NYRA 4D43A 4QASA 4WNAB 3AZPA 4O2BA 1PTKA 3FYUC 4TXLA 2UXCB 1R3DA 2C98A 2CZCA 3A3PA 3EB9A 2I22A 3RG2A 1ZVJA 3TI7A 1DCMA 4CLDA 3NANA 3K94A 3TD6A 3L46A 2Y3IA 3WYGA 5B3AA 3ZE8A 4RVSA 2Y93A 1FDRA 1D6SA 1OTXA 2JAWA 2XI4A 2P2DA 3BF7A 3GA7A 3SDZA 2I6SA 4WBNF 2HQBA 3BILA 3EHDA 1MC4A 4N40A 4EF5A 4E46A 4F3RA 5JNUA 4BGVA 1E1NA 4ES6A 2SHKA 2D1FA 3FNFA 3LM8A 2PUGA 1RI5A 4QXMA 1XD8A 1L1RA 2NXCA 1IK4A 4S2EA 4CKBA 3VAYA 4CMIA 2G76A 3MWLA 1G55A 2D00A 3KR1A 2GTPA 3SQDA 1X80A 3X1DA 1P33A 1TZBA 3BK7A 4TWJA 1B8UA 5KYNA 4P7FA 2DPHA 1H1TA 4KBYA 1PVDA 1ZEMA 2WR8A 4XGNA 3OI7A 4ZTUB 3Q41A 4LQDA 1NG9A 2CUNA 4M0FA 1X7GA 1N0VC 1NXQA 4JBWA 3V1TC 1KYVA 5KDLA 3RNOA 1G19A 5ED4A 1OH7A 4UEQA 3U7QB 4JJ6A 4V0SA 2IHTA 1MQ8B 4IIFA 2AK2A 3ON5A 4P3XA 4TWAA 3VM6A 1SR8A 3B3GA 3PQ8A 3DEZA 2VJLA 1OZHA 2HHJA 1QH1A 1QGAA 3HFGA 4X60A 4QM7A 5A3JA 4BJ3A 4PWZA 3PVZA 4ID3A 1WUTA 1CC1S 2J48A 2AYZA 3G5LA 2CMGA 3O3NB 3Q87B 5KC8A 2PXCA 4COOA 1WTAA 4EVSA 1N5DA 4KYTA 1U3DA 4EPWA 3IHWA 3GLFE 3ZI4A 4IRXA 1UADA 1F17A 2C82A 5C37A 3L7MA 4AF7A 3HC7A 2HAEA 1EXDA 1OBCA 3KX2A 1YL5A 2VJOA 3HU2A 1GHTA 2QRUA 1DQNA 1R0KA 1N2ZA 1QGED 2WDPA 2ZRBA 2ZRJA 3NBXX 2XOKA 4GBMA 4OJQA 4Q7EA 1LRJA 3RKUA 1QRDA 2SICE 3V8QA 3ZCXA 2C9OA 4I9NA 1I5EA 3CT4A 4B6OA 3G1TA 1UWVA 5REQA 2R97A 1T1IA 3R5HA 3LV8A 1CR2A 4MWZA 4NE2A 1LU9A 3IEMA 2DFNA 2JBAA 3K8YA 1J7JA 2ECQA 1PKXA 2R751 4CCYB 3N28A 2OG1A 4TXHA 5LB4A 5BV1A 3V2HA 4IVPA 1DXYA 1KH3A 3ZH2A 4DSTA 5E9WA 3HZHA 3OCYA 5IAJA 4EFMA 1UINA 5LPNA 2H2GA 5HQJA 3T34A 3X2EA 4B2PA 2ZBPA 1F8UA 3E9QA 4NBRA 2JI8A 3ETGA 1AGNA 3PNKA 2FZVA 1S2IA 3WKCA 4FN5A 4P84A 3JATA 1V6SA 5PNTA 1ABFA 1QTQA 1E3IA 1Z34A 2AC7A 1XKLA 2J4FA 2PUHA 2RGAA 3MOIA 4WHMA 4QULA 4FFDA 5DNEA 5KPJA 2PVSA 1HQDA 1FS4A 1R0LA 2AQHA 4Q9JA 4C07A 4POOA 1UM9B 3QE0A 4GWGA 3RK4A 5D3MB 1JL3A 1P91A 3DKRA 4B6GA 1AX9A 2CVHA 3BIWA 3HFSA 3GRKA 1IJBA 4V1CI 2YASA 4BVHA 5IEJA 1BMFA 4TRMA 4PRKA 1DBSA 5HFNA 3L7JA 2DH6A 3LHFA 3IAXA 3ND8A 4WIAA 2YWBA 3CRVA 8AT1A 5F2EA 5DPMA 3NQ41 1Z25A 4OQXA 3ASVA 2GXQA 1UBFA 4UHCA 4ZICA 1YASA 2MT9A 3CGWA 4LE0A 1HFEL 16PKA 2D5BA 4ZTBA 1O6FA 2YWGA 3Q3IA 3NGLA 5HBGA 1WHSA 4BX9A 3GWZA 3F6RA 1VIVA 2OZLB 1GR0A 1L3CA 3D0QA 1AXEA 3HHEA 3IBFA 2PQ6A 2VDRB 1WY5A 2X1HA 5AHRA 4ZOEA 1VKJA 3S2EA 4B7CA 2GEUA 1IH8A 2VA8A 4AKTA 5AVRA 5LQDA 1L1QA 3QWHA 1L5KA 4BQFA 3JVEA 4M9ZA 2I3DA 4EMSA 4NEHB 5EJGA 3EHEA 3NJRA 1E96A 2B82A 1MO5A 4NDAA 5JD4A 4UDOA 2WJHA 3GDHA 1IQPA 3K0KA 3KK0A 5JZ9A 1AUVA 1II9A 1Z7EA 1NVBA 3E8SA 2C94A 4A6XA 1UEXC 2YBDA 2RAPA 5GJBA 4IQFA 4G41A 1V71A 2AC4A 3FOCA 2CGEA 2QUBA 2JFNA 1AO0A 1KRHA 1LS6A 1TYEB 1ZUNA 3H1FA 3NHSA 4J4TA 4ZOLB 4JI8B 1Y8ZA 1JR2A 3KLMX 3MG9A 4A91A 3NEAA 4G0YA 5IC6A 4RK7A 5IFKA 4B4DA 2FMXA 4L75A 5IBRA 1Z5NA 3ZXYA 5CA0A 2FVXA 4GXTA 2I6XA 5K01A 2EHDA 3VHXB 1BX0A 3DLAA 5IT0A 2RGEA 3I64A 2YNMC 5K8UA 1MAWA 1U1CA 2C31A 3SLKA 4A16A 4NFHA 1JKIA 3DBHA 1M6HA 1P9LA 2IF0A 3FZNA 1XZPA 2H2WA 4Q1BA 2G9NA 3S1LA 5FPHA 4D1YA 2PWZA 4ZRMA 1XAIA 4MUFA 4MEBA 2H9YA 3KU1A 1QYVA 4LKOA 5FAKA 4YMLA 5DHAA 2ZZKA 3CEHA 3NBAA 1T3ZA 4W9MC 4YFYA 1CUEA 3JS5A 2BGTA 4NBLA 3OA0A 5DV9A 1Z16A 1H2ZA 3UAOA 3QLEA 4Z4GA 3C39A 1ILEA 1EFPA 2IHZA 4I3FA 2CXQA 1QH0A 1ETUA 5HKBA 5P21A 3KCQA 1ELOA 4QBTA 4LF5B 3ZWOA 1JU3A 1ZNYA 1AV7A 2HEIA 2BD0A 4WAUA 3PYMA 2DB3A 4Z4HA 2XMRA 4Y1EA 3DWEX 2JFWA 3CW9A 1U28C 3FIUA 3AR9A 3VC2A 1EE9A 1U0TA 2FUEA 3IJ5A 3JQ7B 3P26A 2P5SA 3DZFA 3DFFA 3M4JA 1Z0SA 2GGSA 2JCXA 4RGQA 4QOHA 2WOOA 5IX8A 1L4HA 4U2EA 4JC8A 5JFTA 5TLSA 1CJVC 1S9HA 3I01M 3ZHOA 1TIKA 4OYRA 3T35A 2JFHA 2BI7A 5DX8A 1M7HA 3WWCA 4WCFB 3STVA 2GCEA 4J29A 2DPGA 1SCJA 3MRXA 1QQAA 4KDCA 1C30A 2WSBA 3E8MA 4OHXA 1U0NA 4Q3BA 5FTJA 5LQAA 3QXCA 3IQWA 1MNQA 2C77A 1QLJA 4EG8A 3B2EA 5KAPA 4H35A 4CE6A 3T9FA 1D7OA 1E1QA 2RCNA 4GVPA 1F7VA 1TIBA 5E7IA 4WLFA 1X7WA 3QMVA 3A6LA 3PNVA 1LPPA 4XRRA 1SFRA 1E0DA 4HDRB 4TWBA 3UXMA 4X1YA 2RGNA 3AFHA 4HDCA 4D99A 3BTOA 3FOBA 2DFLA 1IB0A 3MN1A 4C5AA 2P2NA 3ISJA 4YJDA 5JQGA 1JSXA 2XADA 2YHUA 5J4LA 4XJXA 3EXHA 4O3FA 2PT9A 4Y6QA 3VJLA 4DLLA 3EZGA 3L82B 3EVCA 3MRSA 1O9GA 2HKIA 3N2NA 2HK8A 2J6BA 2YV5A 3K16A 4QATA 2JFPA 5JTUA 4WVFA 3T8YA 2R8YA 4P4NA 1HGXA 1QWOA 4G1FA 4LRTB 3UWSA 1Q6YA 4HQ0A 4OXKA 1L5RA 3A3KA 3VFDA 2AN4A 1K6IA 1OWLA 3KXDA 3ORHA 4MVJG 4DMUB 5GZ3A 5G0WA 1ZJZA 1TCVA 3BE4A 1TMYA 3BG5A 5CYGA 3V33A 3Q3CA 4MGYR 5IAOA 1RSZA 1QOZA 2QPOA 4ZVMA 4JWTA 1OC2A 3MQ2A 2IOYA 4P31A 3LFTA 1QYRA 3Q9SA 4P2GA 5DP1A 4BQPA 3ABRB 2OV1A 1UWKA 4PLYA 4F5YA 4DR1B 2WE8A 1BSVA 3DXXA 4I6GA 3ZWWA 5IS2A 1BZYA 2H1VA 1L9XA 2HV8A 3EFOB 4EHIA 1DO0A 5SY6A 2HJ9A 1ZXBA 2C2MA 1ULUA 1KJ8A 4QUIA 2CMHA 4JT2A 3A27A 3FKSA 3V9AA 3H2HA 1GTMA 1LDYA 1GVHA 1UEJA 2BCEA 1NDHA 5DM0A 4KWEA 4RDCA 3HGQA 2Q8QA 3PWKA 4TSKA 3JQQA 2JA2A 1JEOA 3ECAA 5C53B 2XODA 2X5XA 4UOQA 4MPDA 2F4VB 3OOSA 2ZK7A 1YS9A 4WUTA 1VI6A 2Y8EA 2B1GA 3HCBA 1KY5A 5FULA 5HCUA 3QOYA 1YR8A 1V7PC 5A3QA 1A7KA 1GPUA 2FQXA 1TO6A 1NRWA 3EBLA 4QVGA 3U60B 4L6AA 1R0CA 4ZAFA 2ZI9A 3FMGA 5ALMA 1GGMA 2OCXA 3RKSA 4JLMA 1A27A 4JMLA 2G8LA 4GEGA 4DUGD 2R9VA 4QSMA 2YZMA 1ZNXA 4IQ4A 5KWEA 1H4VB 3PBKA 5KQRA 5I9MA 2OZEA 1XWFA 3C6ZA 3HB1A 4Z9YA 4IUCS 5BQXA 1B41A 2LDBA 2QPTA 4MMXB 4MQLA 2Q7OE 3WMFA 3VHXA 2VUIB 2B35A 1WDKA 2M1XA 3NHMA 1V1RB 3IOMA 3H18A 3RG8A 3ZWXA 1MC1A 4KLNA 4QFCA 4EKEA 4ISBA 4X92A 1I7SB 5DHQA 3UV6A 5A04A 1ESCA 1Z0UA 3M6IA 5DK4A 4OU4A 1G17A 2DUJA 3ZOZA 1VJCA 3PFIA 3U9TA 3TW4A 2ZZMA 2WWXA 3WIVA 5I45A 4M0EA 2O8CB 1BOOA 1ID1A 1P61B 3EXHC 3IO5A 1LQTA 5I7WA 2VHWA 4BOYA 3JAWB 2QZZA 3TMKA 3OWHA 3AEXA 5A2GA 4L28A 4OQDA 3AR4A 4K88A 5TIIA 2VO1A 1C9DB 1QAQA 1D4ZA 4HLDA 1FUUA 4LPSA 2ZB8A 4MIYA 4NWIA 1ZH2A 3KVNA 2VKQA 2C7OA 3C43A 5JTTA 3UAXA 3TVTA 1KTVA 3QI2A 1QG6A 4GNRA 3HVKA 4B3BA 5A6SA 2DWOA 2QTFA 5BUCA 2JRLA 3AVPA 3THRA 2AJCA 4HNTA 3BFJA 2UUPA 4AN1A 3E9CA 2GJAA 2OWEA 4EKGA 4R71A 3GZNA 4LSMA 4RFSB 4JJ7A 2A9FA 2NNLD 3UF0A 5IUJC 3O2NA 5BMVA 5LC1A 3KLNA 1PZFA 1HUQA 3GL9A 3T7JA 2XBMA 2GX6A 2OGTA 4AJKA 2DPYA 1K7EB 2NM0A 3A3YA 1DDGA 3O7WA 3WBBA 1LI5A 3EY4A 4OXIA 4JENA 1I14A 4N18A 2GASA 3KJQA 5FNVA 1FOEB 5J43A 3GAZA 4WACA 2IEZA 4DNXA 2R00C 2QE7A 4NU5A 2AF3C 3EIXA 1XXLA 3N5KA 2M6RA 3TEMA 3LHIA 4MULA 3LFHA 3WK6A 4J1TC 3L93A 3MWDA 3R6GA 2G5GX 4DR6B 2J30A 1HT1E 2QMHA 3I6IA 1CIPA 4K3UA 4EHLA 2TYSB 1CY6A 1EFKA 1NBWB 1WAMA 1ZGBA 3DLTA 1QKKA 2W0MA 2OTCA 3DXZA 3L0CA 4L5BA 1WXQA 2KMLA 4Q16A 4Y9TA 4CM5A 2VP6A 1ECPA 3NUZA 3UFXA 1YHYA 4EMBA 3ANYB 1BJTA 2JFYA 2VPXA 2OESA 4RA6B 3T1OA 1EWQA 3CSUA 1C8BA 4O5AA 4UCQA 3L0BA 1X1DA 4ON9A 4CT5A 3QOFA 4E2WA 2G9UA 2Q5EA 3CNBA 1Y8QB 1I4EB 1NSTA 2Q6OA 1QHEA 4RGBA 4LY3A 1U04A 2ZSKA 4H1WA 3RVRA 5CXUA 1ZM2A 2B1IA 3EEFA 4DRXB 4N41A 4TV8A 2X14A 3FDZB 3TBHA 1U65A 2H7VA 4ZGWA 4JXKA 2XSZA 2Q1SA 2JEZA 3AOEC 1WUKS 4I66A 4XYEA 5BSRA 1MMFB 5IHPA 5EZSA 3TX6A 4ZI7F 4N0MA 5LU8A 5CB8A 4D44A 1Q0ZA 4MRMA 3GPCA 2HF2A 2XBUA 4I1VA 5A3RA 3ZUPA 5EI5A 5MGBA 3KKNA 2BJVA 3CX4A 2OMEA 2I4TA 4I4TA 1KBQA 4PO3X 1Q11A 3DAOA 3X1ZA 4KR6A 3DR5A 3ESZA 4ZAGA 1PR9A 1WMAA 3AEKA 4Q9AA 5DZSA 5IKEA 4N7JA 5KYUB 2Q3LA 4U5QA 2H11A 1T8TA 4TQ9A 4W7SA 1QHFA 4CMEA 1JX6A 4BNTA 3MF4A 1L4GA 2RGGA 5F21A 2V7EA 3FCXA 1ML3A 4JHXA 4M0CA 3CKYA 4Q1EA 1PZEA 2KI5A 2C4TA 3HY3A 2PH1A 3F3MA 3L6OO 1H5QA 2XNDD 1MBZA 1OI2A 1TD1A 2J5XA 3S27A 5AK3A 5MN6A 2NU9A 4QE3A 1ZQ1A 5B64A 3HVIA 4MICA 4YV1A 5AVWA 4BP3A 3OE1A 3SQWA 4PO9A 4D81A 1RWNA 1JP7A 2G17A 5JNSA 4HTFA 1KY4A 2QUIA 1Q1BA 4FLMA 5E4FA 1SC3A 3QY9A 5I7FA 4G25A 2G71A 3MWKA 1ZM7A 2GBGA 1YZTA 3CX7A 3GLKA 1T0HB 3L0DA 3AB8A 2I2DA 1JNYA 3AK4A 3VKVA 3VR6A 1DSSG 3RHSA 4DXDA 3EIEA 2VQ6A 2F48A 5KYTA 4CNBA 2V96A 3A1WA 2VOEA 3LZCA 4Y7CA 3FGZA 5ARDA 4F4UA 3UJDA 1RBYA 3ZJYA 4URXR 2B0JA 5LQCA 2VQEB 1G3QA 4RD2A 1FJGB 3EN0A 2FSVC 2PNJA 4EB6B 3ENVA 4X1KA 2YKGA 4YAIA 1TX4B 4QBKA 3HDYA 1YA8A 3BFVA 3IP9A 3A28A 4NENA 3Q3VA 5ITZB 1G20E 1V96A 2O3RA 3EUAA 2XVYA 2VSOA 3IP3A 3NVAA 3ODGA 3RTBA 4LGMA 3DW3X 3TDNA 1O6GA 4IWXA 4KXMA 1Q1GA 4Y2RA 4DJ5X 2A33A 1CQPA 2XNDA 1TZMA 1E2UA 2BHNA 4LRQA 4F4CA 5IFLA 3DDZX 1FNMA 4F2WA 1T4DA 3DCNA 3HWRA 4WK4B 3KG2A 4PGMA 4C29A 3G0CA 1WVGA 3GRFA 5KREA 4D3DA 5L8VA 3OPVA 1OE0A 3ECSA 1BYIA 1DKRA 1H5UA 3SHWA 2MSLA 2H29A 4BB6A 1GZHB 3N2YA 4BMCA 2HT1A 1PLKA 4M7RA 2BFEA 5J3JA 3I0MA 4BPRA 2QD3A 2FDRA 1BROA 4ZHQF 4XFKA 5DASA 2WKQA 4OOEA 1VGVA 1NFQA 1ZN2A 2QQGA 3UW3A 4DV0B 3N05A 3FGPA 2BAGA 1EFVB 1R4ZA 1ECLA 1N75A 1RM3A 2X1MA 4C1NA 1IOZA 5JC1A 5GMOA 5G0VA 4BZZA 4N3AA 2PX2A 2V9CA 3T3DA 4YWHA 1DQYA 3OFVA 3OX4A 4B5LA 2QNIA 2WPDA 4P2BA 4M53A 2YJ5A 5EIOA 5HCNA 5KWIA 3SZGA 4BX2A 4AX8A 3KYDB 5JRJA 3PKZA 1RPJA 5JMPA 3MJ4A 4LRXA 3AP2A 2R85A 3HFRA 3THXA 2R86A 2GBFA 2RKWA 4JBLA 3SC6A 3M83A 4Y0NA 3AG6A 1KI1A 3ZCUA 5I9TA 1FMCA 4G0UA 4ZIRB 3GT4A 4QFDA 3WO1A 2W83A 1ZESA 4CIXA 4MDEA 3AJEA 5HJ5A 4QOIA 4BNNA 3IULA 1RXVA 4IHJA 2P4UA 2YZ7A 1KEUA 5EIBC 4E51A 3PC2A 4PY2A 1X7ZB 4LI3X 3HR4A 1B8VA 5AVJA 3IDQA 3B1FA 4K46A 4NF2A 2BP7B 5C4IA 3OLVA 2HA7A 1KORA 3NIDB 3M33A 2EX4A 1BXRB 2NPOA 4IIUA 1PT8A 2WUDA 1S2OA 4LNUB 5THKA 2I0FA 1JUDA 2JRCA 2G4LA 3GCZA 2UYQA 3LPNA 1L5OA 4B4VA 3FDZA 1T2UA 2GWHA 3QM1A 4L0DA 5DHUA 5E6SA 3TL2A 3CNLA 2IS6A 3PC8A 4RIFA 5AQ1A 3KS9A 4O3MA 2QQEA 2ZT5A 4FQ5A 5F7XA 1M0WA 5HM6A 1K9SA 3QTBA 1GV1A 1U98A 2OZVA 4HDOB 1IEVA 1S4QA 4RORA 3RVDA 4B8ZA 3TRKA 1T2DA 3CKLA 2ZKIA 1J9ZA 4ADSG 4WI1A 1QVWA 3V00A 1SXJA 1GXSA 3CA8A 3ZGYA 1ILWA 3DGFC 4KAXA 3A6JA 2JLCA 3K0CA 1L8AA 3S29A 4FFLA 2PZEA 1R0WA 3AEKB 4ND1A 4OTZA 4AZ3B 2C5SA 1XKXA 4NXMB 1K2WA 4QAQA 4KNYA 1Q0SA 3S40A 3IQXA 5K20A 4WXRA 4HV4A 1Q1ZA 1EUCA 1RE0A 1U0GA 2VVTA 1RPAA 3BGDA 3IOEA 3PRHA 5KTSA 1N1MA 5HP4A 2RAVA 4CR8A 4MW7A 4PNZA 3DT9A 5FBZA 4MW6A 3GU3A 1FMTA 1RJ9B 3SXUB 1OB2A 3P0HA 4CDRA 4KFCA 4CR6A 1PUIA 3HEMA 3NTUA 3Q8WA 5DH9A 3OIWA 3GJTA 4TL6A 5HKLA 3SDBA 2FEXA 3T7AA 4FCWA 1TKRA 2OPBA 5HDBB 2JCBA 2Y76A 5K0BA 1CLUA 2WZDA 5GOZA 2GEDA 3DH0A 3FJOA 4RSMA 4AYTA 4L5IA 3KUDA 3U4MA 1N7IA 4QHTA 3O4HA 3Q15C 2ZFUA 4AN0A 5EMNA 1P2FA 4LDAA 4KSYA 1JQKA 5TGDA 1NQOA 3ZWDA 3Q11A 4GQIA 5TEWA 4BV2A 4RYLA 4B6JA 4G5GA 4U7JA 4CGYA 5EWJA 2J31A 1LPAB 1T4MA 2C0QA 5CBPA 1E2EA 1U1GA 3LO8A 4HI0E 2CBXA 3LKDA 1FDTA 2P9TA 2XIJA 3HPRA 5IULC 3P9IA 5HKOA 1Y6FA 2JHPA 4NCAA 2OM6A 4MR8B 3CPHA 1J56A 3QVGA 5C32A 3K1AA 2JIZA 1YQEA 4CW7A 1FA9A 4H3HB 4EI2A 2ORED 1F14A 1E69A 2E5LB 3N75A 3K0FB 2DPLA 3FNQA 3NFRA 4TYPA 2NZJA 3EASA 4M0DA 4JBIA 4D41A 1GQFA 1JLLA 3HWX1 5J2UF 3AL0C 2LIPA 3O73A 2FWRA 1U7PA 4R3WA 3NP9A 4U1RA 3TLGA 3VNSA 4EYQA 3FHTA 4F4IA 1IN8A 2MOKA 3BWEA 2HSZA 4B17A 2YMPA 5CDSA 4MS4A 5BSFA 5EPOA 4ZVLA 5I3ZA 1RQLA 5EXPA 5KQGA 4FYVA 1IBLB 1P0IA 4OQLA 3HVUA 3WWDA 3WGJA 2VJCA 1UMDB 3A4MA 2ACKA 2XYPA 3ONEA 3CG0A 1HFJA 2G0TA 1JLRA 3OZCA 3EJ6A 4YIKA 2OP1A 5I8PA 1VYTA 4TN5A 4W1QA 3EPJA 5F23A 1NW7A 3ZKWB 1OZGA 2DKFA 1W2HA 3ABSB 2GO1A 2QL6A 4K2HA 3RVSA 2BISA 2PUAA 3G2HA 2GEKA 1YMQA 3GFVA 1M6VB 3ND5A 2C2HA 3LG2A 2Q41A 2W4QA 3FUWA 2IXDA 3NHBA 1UODA 1DKPA 3AHJA 4Q4JB 4QELA 1UM9A 4N8SA 1NX9A 1W2WB 2X2EA 1RXCA 1Z7WA 5IF9A 2PXAA 2PFKA 2JFZA 3KXLA 2WJ6A 3QENA 4CGZA 3QITA 1EM6A 1JDJA 3FJ1A 3ZQ4A 1PW5A 4I55F 2HC9A 5CM9C 4ZYVA 2BEKA 1Z06A 4L9AA 3LX4A 1UF9A 4ESVA 4OL9A 1E6EA 2OE2A 5C8XA 4XDHA 4RIGA 1Z6AA 1W44A 4KQFA 2PD3A 3AR7A 2BGNA 4V0LA 1E6WA 2JFXA 4OQQA 1NONA 1NULA 4LJLA 3MHTA 1ZJJA 4YP7A 5B58C 5C1BA 4DNPA 4J1SA 4BNLA 4YX9A 1RBQA 2YN0A 2ECOA 3FPGA 4KQXA 4W1SA 5EJ2A 5JJCA 1LDBA 3UGTA 4MPRA 4D9IA 1SUIA 3PLNA 1P5HA 2WMYA 1NFRA 4XEUA 1S8NA 2UZ3A 1LF5A 2XWPA 3ZV6A 2EFEB 2P6MA 4P7GA 3FWPA 5JAOA 3PJDA 3TQRA 4JV5B 3KR2A 4K2AA 3IXQA 4LY0A 3D6JA 2Y6VA 2DHCA 2YZNA 3T41A 1UAGA 2X9QA 4YH1A 3FDJA 3I1JA 4J2OA 3PC3A 2I2FA 3OM9A 4G86A 3QYJA 1J7KA 5LKRA 4IDEA 1D2NA 5KVCA 4FMBB 4RWZA 1FP6A 2MSWA 1R6DA 3BB1A 4HB2A 5CB4A 2I78A 2QMYA 1S9DA 5KINB 1DWPA 5AW5A 4BP1A 1MHPA 5F64A 4K6KA 3DF7A 2PRZA 1Z4JA 4GLOA 1T29A 4DR7B 2NU6B 1G41A 2PSFA 4P93A 4YAGA 2AMVA 3MK31 3EVFA 5JWOA 1CY4A 2GSWA 1N0HA 4ZO8A 2JFVA 2WYOA 4RKFA 1D4AA 3IIJA 2VYFA 4C0KA 3ZWPA 1XIVA 2A9JA 3HJAA 3T5TA 1GQOA 3BKWA 5COQA 2G5CA 1KPIA 3GLUA 4DFDA 3PGXA 4QA9A 5DLPA 1PGPA 4UD2A 2VP0A 4ZAXA 4CMCA 2D54A 4GR4A 5FF9A 4BWGA 1JDTA 3USCS 3W06A 1AUQA 2PR7A 1I2ZA 4OHOA 3D02A 2CNWA 2HYDA 4F84A 2NXEA 3NNNA 1MOQA 4OA8A 1UJ2A 2CJWA 3J80A 2JKVA 3VSAA 1C9EA 1XTBA 1DIAA 1VPTA 2UKDA 3PLRA 4GUAA 2ZYSA 5KYXB 3WLTA 3ZDFA 1AH2A 2REQA 4KR7A 2QM8A 4FMDB 1L6RA 4NAVA 3OAAA 3DMRA 3FY4A 1E98A 2EVWX 1T2NA 2W93A 1D3AA 2V97A 2WQZA 5D87A 2POCA 1HDCA 1K98A 2O23A 4ENTA 1NWHA 5F76A 4JLVA 5E1BA 4CLRA 5ALTA 3LSTA 3Q1KA 3R9IA 3MILA 5KSWB 4MIEA 3GNQA 3M89A 1UKEA 2BT4A 1M8JA 3KC2A 2N3ZA 4R0MA 3B9RA 1JJ7A 4HVAA 1JA9A 4JI7B 1GSHA 2ZRIA 1PJ4A 2NXJA 3OM8A 3LHDA 4JASB 3UGKA 2Q1WA 3HA3A 4WDRA 2CLKB 3PC8C 4CQMA 3Q8KA 3KXIA 4OIFA 3VZBA 1H2RS 3SF8A 2C2OA 2X2OA 2ZAMA 3B7GA 4O4HA 5FBLB 5TY0A 3ZY2A 5CFZA 1J2JA 1JG7A 1XE3A 2FH5B 3R6LA 4KQ2A 1SUCA 3TJRA 4CWAA 3BXHA 2Y1GA 3ADCA 1TA9A 2QSYA 4O2RA 4EJSC 1N36B 4ZO7A 3L7YA 3GP8A 2VNKA 1MZVA 4IIVA 5K8TA 5EPUA 1DUVG 3CC8A 3RYTC 3W8NA 2NXNA 5CDGA 3IR5A 4HO1X 2W00A 3EY9A 5EIBD 1SMKA 2YWEA 2HO4A 1T1RA 1KPHA 4INJA 4PAWA 3K9QO 4PPGA 3QVJA 2AXPA 2NPIA 4PHFA 4EGFA 2VK2A 1SCUA 1U81A 4LUCA 2IHNA 1L4UA 2XTJA 2WQ7A 5FH9A 3FLEA 2OY0A 1YCGA 3CUYA 4P33A 4HLNA 3GEDA 1ZNWA 4ID9A 4Y6GB 5BN1A 1WUIS 3OZUA 1EDBA 2ORWA 3REOA 4IOLA 4UNSA 5H5JA 3PX7A 1KDZA 1HV8A 1SHUX 4O59O 1EESA 2VTEA 4YJ2F 1DMSA 3CNQS 4JMPA 5DN6D 2W6MA 1BE1A 3JZAA 3C16C 4FILA 3LW8A 4A0HA 4DBZA 1WB9A 2RGUA 1QF6A 2NTYC 1E0AA 4HUTA 1HA3A 2XDYA 2ZJ7A 4KNVA 2D2XA 5L6MB 3L9WA 4BAUA 3RJMA 3R0QA 3S28A 1AE1A 4TLLB 1EFPB 4ZT3A 1U5AA 4N5HX 2BRUA 5KNDH 4EG6A 2Q3JA 1QDEA 3EWAA 4IW3B 4J0GA 5E0OA 4Q3AA 5AR1A 4A26A 4K40A 5A1JA 2QL5A 5FOVA 4CLHA 2GO7A 5FBWB 1FXSA 1II8B 4U5XA 5BNIA 5HQ3A 1AGXA 2Z9CA 3DEFA 2WIKA 3M1AA 1GTRA 3LS2A 2ZITA 4J3JA 1J06A 1G8HA 2G09A 5EE9A 4NMWA 1NDUA 1UKZA 1K08A 5FFFA 5DNUA 2I9PA 3FWYA 5BWCA 1PF7E 3FFWA 1MPTA 3QA9A 2LKCA 4DADA 1DG9A 2GPTA 2BFEB 3S3TA 5GADl 4XLTA 3B7WA 3L4SO 3OEHA 3ZV7A 4MPTA 3AONB 2ZKLA 1IM5A 2CHEA 2I1LA 3IDSA 1EVQA 5ICEA 1JKJB 2EQBA 4BIMA 1C3VA 1P7ZA 5FOXA 3U5ZB 1FLAA 1F2UA 1PJ3A 1GCUA 2B9EA 2O4UX 2P9QA 3NDIA 4I50B 4TTPA 5EXDA 4DG8A 5B6IA 1DCTA 4Z4IA 5JSUA 1IY1A 3S44A 1DTWA 1G6Q1 4IDDA 1H9BA 1QG4A 1EP3B 1YQGA 2WYWA 3BIJA 3GYBA 2OBNA 1KAGA 2YDXA 4FD3A 4S1OA 4URVR 5JEEA 2WSSD 1QG0A 2EL7A 3FMVA 3BXFA 1QV6A 1YQUA 1HL7A 1Q0TA 3F7MA 4EK9A 1AKWA 3U49A 4F06A 4RMJA 4MUNA 3X1XA 2X3FA 6ADHA 4HQOA 2JGEA 2B3TA 3SYKA 4GL2A 3HI6A 5AJVB 3H4MA 1TB4A 2QX7A 3EXHB 4M1QA 3GZ4A 1MIHA 2QRNA 1R8QA 4QYXA 2WWGA 5FI3A 4P54A 1GTVA 1TU4A 2CUTA 1D0IA 1W0KD 5EFOA 1C7IA 3NIBA 4M0MA 3PLAE 2LD4A 1EHIA 3ELYA 5JAIA 5LUBA 4MRRA 3ZNQA 1R18A 3PA8A 1E1DA 4M22A 4OHCA 4EJFA 3IEVA 1E9CA 2ZAOA 3HU3A 1ULZA 3VR4H 1LDMA 2J9FB 1JHZA 3L04A 4YRTA 4E3ZA 1QP8A 2C58A 5TSDA 4UVIA 3T3IA 4QOGA 3HA5A 1EGHA 2DOKA 2MYNA 5FQOA 2QL7A 4K28A 3PB3A 3DBOB 2CF5A 3PX2A 4KCGA 4R9UC 2OILA 3NS7A 4H31A 4IJVA 3TLZA 1EWKA 1NYQA 2BLLA 1WY7A 2XYRA 1AG9A 1T91A 4RGYA 4DOMA 1FNBA 5JYBA 1AKQA 3KL4A 5EUMA 2A9QA 1EQUA 1M1YA 3M2PA 4A6DA 4BQSA 2VRBA 3O92A 1WV1A 1U90A 1WHTA 1Q20A 1VKNA 2FWJA 3LY5A 2NWQA 5AJHA 3I2IA 3T3GA 2PK3A 2ZYDA 4KO3S 5KJ6A 1U7ZA 2Q29A 1ZRHA 2UVPA 2NO5A 4X6LA 4CQMB 3KTFA 1XNRB 1Q1NA 1U9YA 5BVGB 1CZHA 1MIOA 4Q12A 1SXPA 3MWEA 2PX5A 2VG8A 4EUNA 4DQKA 3MOSA 3GVXA 3SPXA 3OOEA 1ZP6A 3TSOA 1EJ0A 1WNTA 2BOVA 4XCVA 3KBBA 3QH4A 1VBFA 4TWZA 4ZI2A 3JD2A 4CDMA 3D4OA 3KEOA 3PZBA 4EATA 2ODWA 2IP1A 1N5MA 1QQ5A 3THWA 3VNQA 1Y9DA 5HHTA 4Z9FA 1KRXA 3JAMA 4G0XA 4GKKB 4Z51A 1GNPA 1M2KA 4RPLA 3LXUX 1QRUA 2C1EA 5CR9A 1NYTA 1FFGA 3PJGA 1FC0A 2ZI5A 4IDNA 4EP1A 1S8FA 3NHAA 4Z0HO 4B80A 4HWTA 1CNMA 1E6LA 2EJUA 5AJXA 3PPWA 5B57C 4KW7A 3HXPA 1LJLA 2RHHA 5CM8B