2FV8A

The crystal structure of rhob in the gdp-bound state
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
187
structure length
180
Chain Sequence
YFQSMIRKKLVVVGDGACGKTCLLIVFSKDEFPFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQKRYGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of RhoB in the GDP-bound state
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Rho-related GTP-binding protein RhoB
total genus 61
structure length 180
sequence length 187
ec nomenclature
pdb deposition date 2006-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2fv8A00
1DELA 1X1SA 1VCIA 1F5NA 1NN3A 3I92A 4KBGA 4KYUA 4MRNA 3PUVA 3VHLB 3SI7A 4LSGA 1LTQA 1FNNA 1AZTA 4WZAE 1ZYUA 1R4AA 2FZ4A 4O3MA 3RHFA 1IBRA 2RAPA 4NCIA 5KPDA 3MWYW 1G3QA 4LI0A 2N1BA 3B9QA 5HZKA 1S3SA 1X8KA 2H57A 4L16A 1BMFA 3MGCA 4B76A 1CKEA 4Q5IA 2JJ1A 4DLTA 1YZNA 3LDAA 4PX9A 1T3LA 2JJ1D 2ZAOA 3IUYA 3FDIA 3IO5A 2NO7A 5H1YA 4CF7A 1EX7A 1ZUHA 4DUGA 1EG7A 3AB3A 4AG6A 5P21A 4PPNA 1TL7C 4TLAA 4DLZA 3CH5A 3VR1A 3U44A 1AS3A 3NBZC 3REFA 1LVGA 3K70C 2AK2A 3ZQJA 4I81A 1R8SA 2J5XA 4I4LA 4HB2A 2DWQA 4FMDF 5JFGA 4K8OA 3REGA 1PVOA 1DS6A 3ZIAD 4PZLA 2QMEA 3B9PA 4Q00A 4ACBA 2QTHA 5KDLA 1E9EA 2R62A 5FPHA 1ELOA 4JLDA 2OZEA 1T6NA 4II7A 4JT2A 5DYIA 2G9NA 5J4YA 2OV2A 1VG9B 1LS6A 4MGYR 1PV4A 3WP1B 4JVNA 1TMKA 2MMGA 1NN5A 5JEEA 4XSHA 1YVDA 2I1QA 3SHWA 3FPAA 4HAYA 2OESA 2FDCA 2IYQA 2ZR7A 1V43A 2J3EA 1KSGA 1G1MA 2XTMA 4FCWA 3K09C 4P4SB 4B74A 5J47A 2XZPA 1U8ZA 4FMDB 3QPUA 1KJWA 4BGDA 1KI4A 2D06A 4Q21A 5HPYB 5JSZA 4KFSA 5F9HA 1T5LA 3I61A 4NDZA 3MSXA 3FHTA 2O8DB 1M74A 4M1YA 1ZMXA 2FWRA 1N25A 1E0SA 1JALA 2BMEA 5FUWA 3TBKA 1XTRA 4ILEA 3CRQA 2AD5A 3K09A 3OAAD 1YZUA 2F3RA 3VHXA 4Z51A 2HLDD 2QBYB 4WW0A 1F3OA 4HZUB 4PHTA 3RRZA 1Z0DA 3QG1A 5ANRB 4P4TA 1L4YA 4B33A 2OXRA 4G5QA 2K5UA 1Q3TA 4HUTA 2QE7D 1MKYA 2WICA 2ANBA 3T1VA 3L82B 5FBQB 1OSNA 1FX0B 521PA 4C0LA 1ZD1A 1AGRA 4PQRA 4Q1FA 4V0OA 5JZVA 2GEVA 3LXRA 2OHFA 1G3UA 4Z1MA 3CM0A 5TMPA 1E2GA 3DMNA 2OXCA 2EVWX 4G3XA 4MQBA 5EE5B 4CEIB 3OEHA 1KIMA 1WA5A 2IXFA 2O5VA 3JVUA 3ND8A 3VR5A 1T8TA 2ZXUA 1SKYE 3CNOA 4AYTA 4U7DA 1E99A 3U3MA 1U98A 3HYRA 4WIAA 1CP2A 2VTKA 3EZ7A 4PHHA 1LFDB 4BZXA 2A3RA 4JZKA 1FUUA 4QRHA 3EIQA 4UQOA 2O8BA 2BJVA 2Q6TA 4RFSB 4Q4LA 2PZEA 5GJBA 2ZI9A 4QBHA 1K8RA 1AA9A 3OESA 1BKDR 2AWOA 3LO5A 1GOTA 4TYNA 4RZUA 2ERXA 2P6NA 3QKRA 3WNBA 1MR3F 2Q9AA 2NGRA 2IWRA 3TNFA 2WJYA 1O3YA 4PQYA 1NBMD 2ZIAA 3GFTA 1R10A 1LS1A 3CNNA 4HB4A 3K0CC 4M9SA 4ZV4A 2QTVB 4EPVA 3OFND 1NI3A 1D5CA 4JT4A 4PSAA 3H0KA 3UK6A 3WYAA 2FFQA 4E22A 4LHVA 1ZUNB 3H1TA 2WWXA 1OXUA 4MKGA 4BECA 3A4NA 4P3YA 3QENA 1GP2A 1M7HA 1O87A 3UMSA 2OLJA 2XB4A 4KVAA 4PAOA 3PUYA 4Q4AA 1HTWA 3EC1A 1COWA 1EXMA 3FE2A 2KB0A 3UWKA 3SBDA 2CHQA 4LBZA 3V9PA 5FUVA 3BOSA 4RD2A 1L8QA 1QHSA 4WXPA 4O25A 3VTKA 1RJ9B 2BVNA 3BWDD 2GDJA 3WRYC 1DBSA 1KKLA 4XWOA 3U3KA 2WZQA 1T3SA 1FMLA 3G82C 1E9SA 3B1YA 3EIEA 3C7KA 4V0NA 3E70C 3ZVRA 4GDFA 2JLSA 3SR0A 3WYFA 4D26A 2O0JA 3CRW1 5G40A 1FPMA 4S35A 5L3RA 1UPTA 4DSUA 2AL7A 1T0JB 1OV4A 2JJ8A 5C1BA 3MCAA 1DAGA 2BEJA 4URVR 3PVSA 5FOTA 2WSSD 2FPKA 2FF7A 2BMFA 3M1IA 1W47A 3TRFA 2B6HA 1OXXK 2ATXA 4B3GA 1XBTA 4DSTA 1ESMA 2PBRA 3R8CA 4LV6A 1G4UR 2QMUA 1N6HA 4M8NE 3PEVA 1OFIA 3QI2A 1IN7A 5AJVB 3SQXA 3LX5A 3LNCA 4AIIA 1KI2A 1KZ7B 2PZGA 2CLCX 3KQNA 1X6VA 3VKHA 1W4CA 4G5RA 2CEAA 3QKSA 2JLYA 5FI0B 5EP1A 1R6BX 1B0UA 2AR7A 4NBSA 1OIXA 4ZDWA 1Q21A 2WBLC 5CLLA 4PC6A 3Q8XB 5GJVC 2IYYA 4KFTA 3P27A 4M53A 1R0XA 4QHTA 3KJEA 1TAGA 1SVMA 5HZHA 2JIZA 4GT1A 1WXQA 2Z4SA 1G3RA 4Q7LA 5SZHB 2ZPTX 1VYVA 4RZ3A 2OFWA 4HI0E 4B47A 1OH7A 4HLCA 1M7GA 4N0DA 4QM6A 4FWIB 1DO2A 1YZKA 2REOA 2J7PD 3CR7A 4DLUA 1XJQA 3EX7C 1W36D 1E2DA 1WP9A 1A2KC 1JB1A 1RVDA 2ZAMA 3DZDA 3PUWA 4MGKR 4MUAA 4AKIA 2ERYA 4GMDA 2ONKA 1E2FA 5CYOA 2O8CB 2OILA 2ZJYA 5JEDA 3AVVA 3U4QA 5JJKA 3L2OB 2UZIR 5H8WA 2GCNA 5EE1A 4ZDKA 1XX6A 4D0LB 3AVWA 3I73A 1F2UA 2CE7A 3OE7D 2PLFA 4OHXA 5CM8B 3QEJA 1II0A 4QBGB 4XIGS 1CU1A 4RVCA 4BPBA 4JMPA 4C0BA 4GRAA 2YWGA 4PC2A 2VP0A 3DDCA 1GSIA 3IILA 2ZE7A 4GNKA 3GLFE 3A8TA 2DY1A 2W6JD 2IEYA 3A58B 5FOVA 3IEVA 1AS0A 1RE0A 2I3BA 2QENA 3LAWA 3QF4B 5JWRA 4DUGD 2ZANA 3M6AA 1HA3A 1KJZA 2FEMA 1Q20A 5CJ2A 1JQJC 2J7KA 1JR3D 2FFAA 3DM5A 3NXSA 3THOA 2HDNB 5KNDA 3N2IA 5JMTA 3K9NA 2IL1A 2XXAB 3NKVA 2D3WA 3T61A 1R5OA 3A1UA 2R8RA 3GFPA 4HB3A 2MMCA 1E6CA 5LB4A 4M1TA 1KAGA 3T1TA 1N6RA 2BBSA 3B1XA 1EESA 2O8DA 3U7FB 1N6PA 4GOXA 4Z8XA 3AVTA 2IS6A 4RD0A 2BM0A 1YQTA 3DZ8A 1XEXB 5DI3A 3O47A 3TE6A 2F1IA 4AKEA 3R9WA 4DB2A 4DLSA 4N0EA 3K0AB 3B2EA 1E2QA 1G5RA 4HYYA 4TMWA 1G21E 4CVNA 4A36A 1BO6A 4TQ9A 3H4MA 1MT0A 2LWIA 2WAXA 3KKOA 4PFSA 4M9QA 3LRPA 3TAHA 3RS2A 5FPYA 4MRVA 2RGAA 4NMMA 5TVKA 4TLCA 3SS8A 3B5JA 4EIWA 5LD2C 1AZSC 1LW7A 2BV3A 1X1RA 5E4FA 4JLVA 5G3ZA 1TUEA 3OIYA 4G0NA 4KSCA 1GNRA 1Q22A 2PJRA 4GZMA 3QXCA 2OBLA 4TWZA 3BH0A 1FP7A 3SJCA 1SVWA 5BYJA 1E2LA 4I1OA 4HDCA 2IT1A 1OPXA 4LPSA 4LHYA 2ZI4A 4NL4H 1ZCBA 4DEYA 2GXAA 3X1XA 2CVHA 4DIDA 4YMVA 1EWRA 4Q4JA 3W90A 4B3XA 1RKBA 4GP6A 1CEEA 2QG6A 3DOFA 4QBFA 4CEJB 2IK8A 5TARA 4TYPA 1OB5A 1NIJA 2BEKA 2VBCA 2W58A 3MMPA 1E2HA 2OEPA 5FR1A 1Z0IA 1H8HA 3F5FA 4NCNA 2ZU0C 4BZPA 3H86A 2XOKD 2JCSA 4MITA 4R98A 1DADA 1XPUA 2BHRA 5EE9A 3AP3A 5JECA 4IJMA 3TAUA 1JR3E 4JVMA 5CJPA 2V3CC 4NPHA 4IDOA 1XRJA 4AWXA 3F0TA 4IW3B 1X8JA 3TUZC 3KZ1E 1X3SA 2ZEJA 3VR2A 4TZ0A 4QGAA 4K46A 5AUOB 1ANKA 2B8TA 3QKTA 2HJVA 4DDTA 2ZRIA 3GLGB 1ZBDA 3KXIA 3LD9A 1US8A 1ZNZA 1R8QA 1J8YF 4DLXA 1K5DA 1Z2AA 2AFIE 3KB2A 1DAEA 1YJ5A 3TW4A 2OBMA 1W44A 1UDWA 4U02A 1M8PA 2QP3A 2WAYA 3X1ZA 3EA0A 2O8EA 3LY5A 2QGZA 5EZ5A 3GP8A 4L15A 2VHCA 1I2MA 1XJCA 4DT1A 1OJLA 2O8BB 2QZ4A 2CLDX 1VMAA 1WDTA 5AUPB 3ADDA 2GJKA 1SHKA 1AJEA 4IOMA 3FOZA 3RANA 2CNWA 2ASEA 4LJ6A 4EJSB 3D8BA 3A36A 1M34E 3SZRA 2DCUA 3WYGA 2WWIA 2JJ2A 1E69A 2RHDA 1R0ZA 1HE1C 2N46A 4ZIRA 3AVPA 3DVLA 2E1RA 1ZCAA 3QVVA 4D82A 2H17A 1U9IC 5DGXA 1ZW6A 3A1VA 1VKJA 1MABA 3CWQA 2GK7A 2FN4A 4UNPA 4B3FX 3O8CA 1HQCA 2QQ0A 5L3QB 4TLBA 1GTVA 5CDFE 4B73A 5JHHB 4G5GA 4KXFB 1OT3A 4L9WA 3I4LA 1QG2A 4AC9A 5KHOC 1ZAKA 1UADA 4B6EA 1UKYA 4O0MA 4Q01A 3TH5A 1GRQA 2QN6A 4TMZA 1XXHA 4AD8A 5CB8A 1N6KA 3R9XA 2H7VA 2A30A 4DKXA 3WRXC 1CR2A 2HEIA 1OFUX 3RS0A 1AKYA 4LJ9A 1HT2E 4JLAA 4Q9JA 4F91B 3MWKA 5TY0A 3LVQE 2NPIA 4HAXA 2BM1A 4C0JA 3QXXA 2IYWA 3PR1A 5EXTA 4ZI3A 1NLFA 1NL3A 1XEFA 2FOLA 2PEZA 3K9LA 5JSZB 3K1JA 4BRUA 5JRZA 1D8TA 1ZIPA 5IK2D 1IOZA 2ZI3A 3L0SA 5DSZA 3VU9B 4JBXA 3RC8A 4PZYA 1OKKD 1P2VA 4EPRA 5TV2A 4URWR 4WBSA 3WBKA 1NG9A 3KDSE 1J70A 1QHIA 3K8YA 1FZQA 1L4UA 1N5JA 3RS4A 1P9WA 1E4YA 1Q12A 1A7JA 4IEIA 5FUXA 1CJUC 2C8VA 2Z6VA 2FFBA 2GF9A 1GFIA 5K8TA 1FX0A 4MGIR 1FW6A 2R6DA 3PJRA 2GZDA 1N6IA 3RWMB 5LBIA 3GQBA 1HUQA 3DM9B 4WXRA 1N0VC 4L4UA 4BFSA 2ZJOA 3K70D 3V00A 1Y63A 1KKMA 4JLMA 1OE0A 2CJWB 2GVDC 4HSEA 5FTJA 5DNYB 1ZP6A 4BRWA 1WF3A 2RB4A 3C41J 4MGZR 1XCMA 1J2JA 4LC1A 4FD2A 2WJJA 4RCYA 2PCJA 3P26A 3KJHA 1TADA 3EZFA 3TQCA 4EUNA 2R44A 2QM7A 4WVFA 1XTQA 2ZETA 4KLZA 1U2RA 1XMSA 2C9YA 2QT1A 1NN0A 2FSGA 3K0AA 4LYFA 4XTCS 3ZQ6A 2MSEB 2JATA 3SFVA 1CR1A 4LC0A 3UWOA 2B7BA 2GF0A 2NOAA 2GETA 2ZS9A 4ZIRB 1W36B 1KI1A 1E9CA 1AKEA 4TT3D 4UJ5A 3PENA 4B2PA 1E2EA 1IHUA 3CLVA 1UBFA 3NHBA 1NKSA 4ZDIA 4EAQA 1AN0A 3PV0A 4XOIA 1JQLB 4UXJA 3KQKA 2PT7A 1ESNA 1VCNA 3Q3JB 2V55B 4MRPA 3BS4A 4EKDA 3PFIA 3O8DA 1W46A 1XEWY 1PLJA 1G291 1SGWA 2YWEA 3PITA 4BLPA 3MWJA 5CB6A 1R5NA 1CJMA 1TPZA 2A78A 2KI5A 3B8HA 2HLDA 4PTLA 4R2IA 5FPTA 5F3WB 1SKYB 2DFKB 4D4MA 1XD2A 1NF3A 4TN1A 5FL3A 3B1WA 5EUMA 1FL9A 5KU1A 3UANA 2P6RA 1S9HA 1Z08A 1A5TA 3AUYA 1E79D 4M1SA 3RABA 2REXB 4AK9A 2D74A 5CK4A 4DJTA 4GL2A 2ODEA 3EA5A 2KE5A 4B44A 2ZRNA 3SU8A 5E7IA 4D4JA 1G6OA 2OUKA 4BLQA 1ZD8A 4TMXA 4US1R 4HAUA 4YMUA 2F1HA 1GL6A 1VIAA 2IF2A 4TYWA 2PZFA 1NMXA 4FN5A 3K0FA 2VYFA 4P33A 2VHUA 5J4VA 1KMHB 2IYXA 4KV9A 3CF2A 1SKQA 4G01B 5EXXA 3VAAA 4JLJA 4DLVA 3CR8A 4YXWD 5L3SB 2JLVA 3VU9A 1S2MA 2F1JA 1ZIOA 4A1FA 1KDPA 4IFBA 4JJZA 4OK5A 1UBGA 1N6OA 1U0JA 3AF4A 3U7EB 4NTZA 4FIDA 3SDZA 4QOSA 2IS4A 1YE8A 3U3RA 3BBPA 1E9DA 4BZQA 2GWHA 4UKDA 1WMSA 1XZPA 4QJ4A 4H1UA 1TQ2A 2WIAA 2AWNA 1QHGA 2JGNA 1D2MA 4G5OA 1RFLA 5IRCD 1RW4A 3ZGXA 1G7SA 4PO1A 1R5BA 2ZRFA 4EFLA 2V6JA 4HDQB 3Q5EA 2P5TB 3IQWA 1MO4A 5B64A 1VYUA 2HXSA 1NY6A 3PQCA 2IUUA 2OAQ1 4NYMQ 1DEKA 4D4LA 1IAQA 4JSYA 4C7OB 4ERNA 5BQ5A 4GZLA 621PA 2W2VA 2XX3A 2RGNA 1W0JD 4QJ3A 1H8HD 2JASA 2ZSFA 2DYKA 2VHJA 4ESHA 2N42A 1LV7A 3AF1A 3WMGA 2D7CA 1NN1A 2CL7X 1Z83A 1D2EA 3F8TA 4DWJA 5FFMA 2WTUA 2DFNA 2PJZA 1L2TA 1TEVA 4F93B 1KY3A 4AURA 3CF0A 2DHRA 2ODBA 4D0GA 3QPWA 2ZJBA 2QM8A 4ASUD 2CVFA 2JLZA 4ZKEA 4LHWA 1P6XA 2XEXA 3DKPA 2AHOA 2W6IA 1KI9A 4GSYA 1PZNA 4DT1B 3F3YA 3KL4A 1Z0KA 4BE7B 4IDNA 1GIAA 2PMDA 5C2JB 1NIPA 5M04A 4YQFA 2QA5A 1A82A 1ZJ6A 3QF4A 1VIYA 1E96A 1T8UA 3U3OA 4Q9KA 1E32A 2IBMA 4WZ6A 2JLRA 3SQWA 1HURA 4NCHA 1IM2A 2C9OA 3LBHA 4KU4A 1F6BA 4OI2A 3ADCA 3WXMA 2UZ3A 1S1MA 3ZD7A 1CULC 2FG5A 3R8FA 3CH4B 2CCKA 1OKKA 4N1AA 4URXR 1G8HA 1EFUA 2H16A 2G88A 1XZQA 5DN6D 2EFDB 1GRNA 1XTIA 3P32A 4YONB 2UKDA 1VG0B 1CLUA 4QXAA 5ELXA 3U60B 4U00A 1Z6XA 4MA4A 3ZS9A 4CT5A 2HYIC 5FUYA 4HATA 1FTNA 2WM9B 1W4AA 5DHAA 3N70A 4TMTA 2E9SA 1LNZA 5GADl 3W9YA 2FEOA 4A0HA 1G7CA 1FQJA 2ZRGA 4URUR 3TVTA 3CBQA 2Q9CA 3V4RA 3ASZA 3I72A 1PUIA 4G5SA 3GLIE 1YR8A 3KJGA 4IOLA 2YINC 1HYQA 1OH6A 3TKLA 3SEAA 4A8JC 4GOJA 3BIFA 1JJVA 1E4VA 3N5CA 2ZU6A 2X2FA 3QJYA 1KNQA 2DFLA 3SJZA 3EPKA 1DAIA 1P9NA 2DPXA 5JRJA 1E2IA 1W0KD 3KXLA 3RRNA 2GXUA 3EW9A 3GEHA 3QEOA 3PXGA 3NBYC 1YZQA 5HCNA 3THYB 1ZU4A 4BFUA 1Z63A 2LKDA 4C0SA 3DHWC 1W1WA 4KI0A 3TUIC 1QVAA 4OHYA 3SFZA 4LX0A 2BWJA 2VHQA 2H92A 5B58C 4ABYA 1IXSB 2ECKA 4W5HA 4I99A 4UNNA 5IDVA 2ORIA 3LW8A 2J41A 4IDQA 4LV5B 1VG8A 2CLSA 1NJFA 1G16A 2NO1A 5SZIA 1NBMA 2JIZD 5CK5A 2ZUBA 4JBYA 3AF2A 5EP4A 2EU8A 1D9ZA 1NSFA 2EFEB 2FA9A 3WNCA 2QPTA 5IK2A 3BGWA 1Q0UA 3WHKA 4A92A 3BXZA 3I3SR 1NVUQ 3IHLA 3VNUA 5JHGB 1KO7A 1VTKA 1ZM7A 3SYNA 1BS1A 5CLQA 2JDID 421PA 5J4LA 5EQTA 2P67A 3L0PA 4ARZB 3ZIAA 4NE2A 1XB2A 2J0QA 1XDBA 3BK7A 5FI1B 3UG7A 1EFRD 2HV8A 3FGNA 4LJAA 3W6NA 3KTAB 3THYA 3GLHB 3MFYA 2VA8A 2P6UA 2FX3A 1KI7A 3IDQA 4MYUA 4WAUA 1P2SA 3WY9A 2C99A 3HU1A 2ZUCA 3TR5A 3U6BA 3KXKA 4X8OA 3FHCB 2WJIA 3MD0A 1Q3HA 3HWSA 3KUCA 2HF8A 4LUCA 1EWQA 1OLOA 4TL9A 2DR3A 3CRMA 1WBBA 4HZIA 2QQEA 4PHGA 4KFUA 5JS7A 1KY2A 1IY2A 2HCJB 2ATVA 3ZVLA 3NBFA 4AKGA 3AKEA 2FU5C 4OQNA 4EPWA 4MUBA 2KBFA 4LCBA 221PA 4LYAA 3X2SA 3HPRA 2FGJA 3BORA 2HT1A 2QPAA 3M4YA 3BH6A 1M2OB 3X1YA 4F7WA 1VECA 2NTYC 5DH9A 2X19A 4C0AC 4X8MA 1LF5A 4YMTA 4ZCMA 3GCGA 4E09A 1TQ6A 2YOFA 3EZ2A 2H8KA 2VP5A 2V54A 1KNXA 2X1VA 4E03A 2IYRA 4OQFA 5IT5A 2WKRA 3E5HA 2W2XA 2XZOA 3EXAA 4V0ME 3CWZA 4QHSA 4HUQA 4PANA 3SJAA 4Q4AB 2WV9A 3CPJB 4PC3A 5L3VA 2HF9A 2GNOA 4NYIR 4Q9LA 2QP4A 1KZGB 3QKSB 4EFNA 1COWD 3SYLA 1IN8A 2QORA 3DPUA 1CJTC 2G0TA 1H65A 4R2HA 1DG1G 2YZ2A 4EJSA 3EPLA 1II8B 2V4ZA 1RRGA 4M1OA 3X1WA 1GRRA 4A8JA 1DE0A 3DO6A 1XD8A 1KI6A 3AUXA 3CIOA 5CITA 3OZXA 3AKYA 3VNVA 1RIFA 1CS4C 1RRFA 5JJIA 2PH1A 4B35A 1OB2A 1E9BA 4C2TA 2NG1A 4HAWA 1ZNWA 2D4HA 1NVXQ 1XNJA 2B7CA 3O8RA 1CRQA 4L9SA 3T34A 1UAAA 3CRRA 3EWSA 3A6PC 3NWJA 5HKKA 4XH9B 1E98A 3TQFA 2IX3A 4GBMA 5TDHA 5HR5A 3MJHA 4Q1BA 3AV0B 3I8XA 2ZJAA 4I1SA 1HE8B 4W9MC 2GILA 5L3QA 3PUXA 2GBLA 2A5JA 4B48A 4B71A 3IQXA 1VCOA 1Z8FA 3KQUA 1W4RA 4PSVA 2ZRMA 1R2QA 2AK3A 2EWVA 4DDWA 1GITA 3TVDA 4AYXA 2QI9C 1DAKA 2OFOA 3B6EA 2P5SA 5DN6A 3K0SA 2BMDA 3HR8A 2QSYA 1XWIA 3SC3A 4HLQB 3ZDQA 5G41A 2GAOA 3FMIA 4M1MA 5KNCA 3ND9A 1G17A 2H5EA 4QGHA 2H18A 3CB4A 1NNEA 821PA 4JKIA 2WWFA 1RRPA 2RKOA 2OO7A 1Q1EA 2CCJA 3FTQA 3IPYA 4RJLA 4Q9IA 4LOAA 4A0GA 4PC1A 1A2BA 4IDPA 1XFAA 2CNWD 5KDDA 4JYBA 4RD1A 2ZRAA 4KJZA 4OQXA 4AI6A 2CL0X 1SXJA 4G1UC 4KITB 2ORWA 2BMJA 3BE4A 4W5JA 3J81k 1EGAA 2G1KA 1RPZA 2C77A 4CYMA 5J4KA 1P4SA 2VL7A 3GJ5A 4MH0R 1LY1A 1I4TD 5FOWA 2C78A 1OYWA 3IHWA 3RS5A 4RKFA 1TTTA 2EFHB 2G1JA 1HH4A 3Q85A 4W7SA 4HLUC 4CIDA 3U2QA 1QVRA 2XSZA 1KO4A 5CDFA 3CW2A 5JCPA 4N3NA 5F2EA 1J7KA 5E3HA 4JVSB 4Q18A 3LX8A 4LHXA 1S96A 2PEYA 5LDDC 1YHNA 3THWB 2P2LA 1ZINA 1W36C 2EYQA 4XSGA 1G5PA 1MRNA 5DYGA 3C14C 3I62A 5C4GB 1W7AA 1P9RA 2EQBA 4HLUA 2O0KA 4BFZA 4Q7MB 1G3MA 4UNQA 4YMSA 4NONA 4Q1EA 5LB2A 3EZ9A 4KO8A 1TF2A 4C9BA 2XTZA 3AVYA 3K9HA 2D2FA 1C1YA 2IEZA 4LJ7A 4M9XA 5A5GA 3IBGA 5DIFA 4H9GA 2ZQ5A 3SNHA 1I4DD 4DRZA 3Q72A 3NH9A 4ZPXA 3THXB 3CKLA 4JLNA 4C0KA 4RZ2A 4TMKA 5JWOA 1GVNB 3DMDA 5BN5A 4C0HA 4UNRA 121PA 1XU4A 4M9ZA 4C4PA 3B1VA 1J90A 2PLRA 1J8MF 3AVUA 4NZYA 5GVRA 1KMQA 3BFXA 2ANCA 3VR4A 4BLOA 3IIMA 5F98A 1UJ2A 2W6JA 4PO8A 5AJXA 5FL7D 1T3HA 2OLKA 1RYHA 1XMJA 3C16C 2IYSA 4PAMA 1XD9A 3LBIA 1Y3AA 2ZR0A 2IYLD 5HCIA 4QC2A 1G3IA 2OCPA 4ITRC 3WMFA 3NIBA 2IYVA 1NP6A 5DLQC 1J99A 4OJQA 4ZDJA 2XNDD 2DFTA 4ZO4A 2ZE6A 3HU3A 3I8SA 5IHPA 4H1VA 3FHOA 2Q3HA 1NLYA 2ZSEA 1I2DA 3T15A 4A9AA 1G8YA 1WB9A 2CL6X 4JLBA 5FPSA 3QKRB 2EW1A 4NYJQ 3BB1A 2XNSA 1SXJD 1DAHA 1DPFA 4JJKA 1G20E 3GJ8A 1A1VA 4M22A 3UIEA 1W0JA 1GDDA 2F43A 3K53A 1GNQA 4IXNA 1YKSA 1KO8A 5DE3A 2ODNA 4D25A 3AKCA 1Z0JA 4IOJA 1G8PA 1YR9A 4FW9A 4BLTA 4LPKA 2C2HA 3RSLA 4OI1A 4DBLC 2KJQA 1JPJA 4ESVA 3UXMA 4JBWA 4V03A 4RKEA 4XVRA 2RGDA 1Z06A 2FSIA 1QRAA 3FYHA 2HYDA 2YOHA 4PHFA 3ZZUA 4TL8A 4B3DA 4BQSA 1IY0A 2FMXA 1KDTA 5KYKA 2O8CA 1AQUA 4KFRA 1DO0A 3ZS8A 4D81A 3ICQB 2HXYA 2WSSA 1G41A 3NEYA 1IJFA 2XJ9A 2F9LA 3MJRA 5JI3E 3BJIC 1F2UB 1W2GA 1E9RA 3R7WB 1T4GA 2QL6A 3QNUA 2VSOA 4PC7A 4CRWB 4OBEA 2X8AA 5EE0A 3NC1C 2GVZC 4DXAA 2XGJA 3RSOA 4XVUA 4MDEA 4CEHB 4NYJR 3MWLA 4HEJA 1KOFA 2A5DA 3BAFA 3C8UA 2LCFA 1Z6AA 1E1QA 4IFEA 1MH1A 4OQMA 1Q1QA 2YWFA 2JLUA 1UDXA 1ZVQA 2GZAA 5FTMA 1GZSA 1IN5A 4M0LA 1DOAA 2X77A 2IYTA 4ARZA 6Q21A 5K8UA 1B23P 4XJXA 2IYZA 4P4UA 1OW3B 2FPLA 3B7GA 3LV8A 1ZD9A 4IEEA 3LWNA 1XTSA 3Q9LA 3MAAC 3HYTA 1X8LA 2VIIA 2CBZA 1UEIA 3O8BA 3QF7A 3GPLA 2ZSAA 2CHGA 2WHXA 3GD7A 5GJCA 5GVSA 1GKIA 1ZRHA 1HEIA 3UG6A 3HU2A 4B2IA 3K70B 2W00A 4C7OA 3L0OA 1TX4B 2BKUA 1XCPA 1JR6A 2OAP1 1BYIA 4RD4A 1EK0A 2WJHA 4B32A 2QNRA 3GJ0A 1QHXA 4Q1DA 2DWOA 5C46F 3VQTA 5H70A 1XJ0A 1WE2A 2J0UA 1OXVA 2EFCB 2Z4RA 4QKQA 5B57C 4QM7A 2BCGY 5KO2A 2V7QA 3TR0A 4JS0A 2Q9BA 4MKIA 2A7QA 2FSHA 1YZTA 1FNMA 4M1WA 1P7CA 3TIFA 4TLEA 3LXXA 3HDTA 4DSOA 4V02A 5FH9A 3QPVA 2BBWA 4HZUA 3OF5A 1SVOA 3ASYA 1CJKC 3VX4A 4A2WA 1SZPA 3RC3A 4QL3A 3NEJA 1UKEA 3B13B 1V5WA 4URZR 5BXQC 1RC8A 3SBEA 2RGGA 1N6NA 5FBRB 1R0YA 2WPDA 1TF5A 1CTQA 2BIFA 3GLIA 2CXXA 2JEOA 4I1VA 4P31A 4X8LA 3CO5A 3HJNA 4BFWA 1GAJA 3KTAA 3OIWA 1W0KA 3K9GA 2BBTA 1H8ED 3QXSA 2R6AA 2F9MA 3DKVA 4QNRA 4A0RA 1Z07A 2RH5A 1PUJA 3KFVA 4MRRA 1OF1A 2NQ2C 4PPQA 3TLXA 3P4XA 3FWYA 5TXGA 3W8NA 2ODWA 4LBWA 4M21A 1E1RD 4D0NA 1P72A 3OEED 2QAGA 2OFXA 1Z6TA 3FVQA 2JJ2D 5A4JA 2GZHA 3TSZA 1UBCA 3K0EA 3T1QA 1HY3A 1TU4A 2VF8A 3MRSA 4U5XA 3A1WA 2QAJA 2GCOA 3ADBA 1G18A 4FMBB 4WA7A 2C9CA 1I4LD 4GP7A 2C03A 4KSBA 4YLGA 3FFAA 3VKGA 5CM9C 3QKUA 5BN4A 4FINA 2QE7A 1D2NA 2ZE8A 4JL6A 1IY1A 2VEDA 3U7HB 1NVWQ 4Q47A 2Z0MA 2GESA 2YVUA 2YOGA 1CR0A 4BWYA 2O8EB 1JEDA 2ZRPA 4Q1AA 3NC0C 3C4JA 2P3SA 3Q7QA 3EG5A 1OFHA 3LH5A 1LF0A 2YWHA 4TTPA 5BW8A 4CEHA 1TEXA 2AKAB 1VHTA 4A82A 1WCV1 2R6CA 4TL7A 1KDRA 3T5GA 4RY2A 4AG5A 2HJGA 4YXWA 1Z29A 1E9AA 5AJYA 3D31A 1GG2A 1MO3A 1NLZA 1UM8A 3RLFA 4QJ5A 1NRJB 1VPLA 2WIBA 3OE7A 1Z47A 3W8RA 2HCBA 2WKQA 3N2EA 3V4FA 4EQ6A 1ZM2A 4F38A 4YDSA 1E1QD 2RCNA 4QG7A 1MABB 2J7PA 3SN6A 2JDIA 4NH0A 3LVRE 3E1SA 5FOSA 5KDOA 4JLOA 1F2TA 4J0QA 3QOFA 1W5SA 3AVOA 1QZXA 1S1CA 5EP2A 3S1AB 3TSOA 2VSFA 1G8FA 3BD9A 2R2AA 4MRSA 2ZRCA 1UEJA 4JVLA 1XEWX 1ZUIA 1KMHA 4XTRA 5AWFC 3DEFA 4FCTA 2W2TA 5E95A 4OHZA 3GMTA 3OIUA 3EC2A 2GJAA 2W0SA 4MYCA 1MV5A 4V0LA 3QBVA 4KVGA 1FP6A 4B3BA 3TJZA 2VHTA 3ZJYA 4CDGA 1EFCA 1UKZA 1ZU5A 3I1FA 3TGPA 2C96A 2NO6A 4A6XA 3BB4A 2JLQA 2G83A 1G8GA 2C95A 1CIPA 4FI3C 2MSDB 4Z54A 2V9PA 1S4QA 4OI0A 3WMEA 4IRUB 5LD2B 1XD2B 1YR6A 4DCTA 3VKWA 1YZLA 3BH7A 2IHYA 4IOKA 3C15C 2ZJ2A 5GJWC 2OCYC 3QXHA 1II8A 1JR3A 4LJ5A 4MYHA 4POAA 4JL5A 4DZZA 3OIVA 2CMKA 3WNDA 3A1TA 3KB1A 1N3BA 4D4KA 5EXSA 4PAQA 1NY5A 5KOYA 1VYTA 2WOJA 2W6ID 4B3CA 2H1LA 5JLJA 2QMHA 3U4QB 2ZRLA 3AEZA 1MOZA 2O52A 1NBME 4BFVA 2XITA 5K8IA 3BERA 3WHLA 3GLHE 2ZYTX 3B1ZA 1XCGB 4AY2A 2QAGC 3W3AA 4Z8YA 4A2PA 2VF7A 3GLGE 3LLUA 2GBLC 1ZM3A 2GEUA 3HPQA 1Q57A 1GKUB 1QHHB 1M7BA 1FTSA 1P62B 2J46A 3W6OA 4DCSA 5CYPA 4Q4HA 1S9DA 2NO0A 4KODA 4IXMA 3FMPB 2QT0A 4XWAA 1E2MA 1BH2A 2O8FA 1AIPA 4HB0A 2BJWA 5SZKB 4CEIA 1D6JA 3AQ4A 3CX7A 3QBTA 2ZJZA 4TT3A 4YDHB 1BYUA 1C4OA 3NBXX 4B6FA 1CXZA 1FOEB 1W4BA 1HV8A 2Y8EA 2OCBA 1P60A 3L8ZA 4LYHA 3ZLJA 3CF6R 1F2TB 2IC5A 3OFNA 3ETLA 1GL9B 5JJLA 2JA1A 3ZD6A 1F60A 1FFHA 4LHZA 1UF9A 5AR1A 1TQDA 1UKVY 5KPJA 5F9FA 4LJYA 1JXMA 2P65A 3FB4A 1G64A 4NYMR 2F3TA 2IHBA 2QRNA 4NCJA 2WJVA 1U8AA 4KAXA 3U7GA 1KAOA 3RRYA 4C0QC 5EZ6B 4BFYA 3IGFA 2R9VA 5KUTA 2Z5FA 2WVJA 1QHNA 2R65A 4KLNA 2ZS8A 2X2EA 3QVUA 3RYTC 1OIVA 3U61B 3GLFB 2KWIA 2WOOA 4L5BA 1GM5A 1PLKA 2GHIA 2ZI6A 4RFVA 2UVQA 5BYKA 2GTPA 2VP4A 5BN3A 1Z0AA 2YV5A 3ICEA 1K5GA 2WMOB 3SJBA 1KDOA 5A0FA 5B2ZA 2MSCB 2PX3A 1NMZA 3AF0A 5C4MA 1QDEA 1E1RA 4XD7A 2Q0HA 4TYQA 4OQLA 4V0MA 2B92A 5FOUA 2F6RA 2QEQA 4CEJA 3BC1A 1CBUA 2GAAA 2A2ZA 2G77B 1CRPA 1HT1E 3T5DA 4FMCB 3DOEA 3QXJA 4LJ8A 4QFMA 4D80A 3W5IA 3B82A 4KYIB 3GJ6A 3VFDA 4LRWA 2ZSBA 4B34A 1AM4D 2P0EA 5DHFA 2YC2C 5L8VA 2WWHA 4NU0A 2DB3A 1KHTA 3EPHA 3KJIA 4R71A 3PEYA 1KO1A 2FJUA 5AJZA 2DBYA 3CONA 4P32A 4BUJA 2IS1A 1IONA 3SYKA 3I5YA 4LJ4A 1E94E 3OEEA 1R0WA 4B2LA 1IXZA 2QU8A 3KFXA 1E0KA 2GJ9A 3JZAA 3BB3A 4QHYA 3L0IB 2BBOA 5G53C 4OK3A 5FTKA 4LWZA 2RGBA 4NKRA 1QHHA 2Z83A 1XTJA 2CHVA 3Q7PA 5HKKD 2GXQA 4HDOB 4PSKA 1KK2A 1XXHB 3SE0A 2OT3B 2AXNA 1GL7A 2ZVQX 4O2RA 4RCZA 4C2UA 3QY0A 5L3SA 2FV8A 2BKEA 1ZM4A 4UJ3A 1D9XA 1SVIA 8OHMA 1NG1A 1Z6YA 2AFHE 5E7MA 4CGZA 1XF9A 4EPTA 1IQPA 1QHYA 1T5IA 3LFUA 2QPOA 3ZVMA 3EIHA 4P0TA 1Z6GA 5D3MA 3JVVA 3PIRA 5J5CA 2AXPA 1XMIA 3AVXA 2SHKA 2PMKA 4CZ2A 4DLRA 2PX0A 2J59A 1TUIA 4M1KA 1IN4A 3VR6A 4E07A 2IS2A 2OSBA 2JLXA 1A4RA 4IVRA 2WWWA 2XOKA 2JAQA 3K0CA 3VR3A 3IPXA 3FKQA 1OFTA 2GCOB 2WJGA 3C5HA 4EQ6B 2GEDA 1OH8A 4JSTA 1XTKA 2GCPA 1OXTA 2ZRKA 1W2HA 2IUTA 1X86B 2IW3A 2ZYUX 3PG5A 4E5UA 3T12A 1GNPA 4TYYA 2ZYWX 2IXEA 4PR0A 4DB4A 4M4SA 3TUJC 1XMVA 1SHZA 3EZ6A 5FL7A 2YYZA 5UKDA 4DCNA 1GWNA 2A5FA 4JL8A 4LBVA 4O2LA 2IWHA 3LA6A 1MRSA 4GFDA 2G6BA 3BRWD 2ZITA 1KYIA 1NMYA 4Q19A 5DISB 5D3QA 4F4IA 1JAHA 5FPKA 3OHMA 3THWA 3IEUA 5LPNA 4S2EA 3AM1A 2QMOA 4MDFA 4JYCA 2GXSA 3KKQA 1NVVQ 1LB1B 1ONBA 1TNDA 2QP9X 1ZM9A 3LQQA 1TU3A 3A4LA 1DVRA 3TK1A 2VP6A 2CDNA 4LBYA 2ZE5A 3D3QA 2QRZA 4DDVA 1KSHA 2NPFA 5EUQB 3EPJA 2A9KA 1OHHD 2FFHA 2YJTD 4BFXA 1NSTA 3ADKA 2XZLA 4FWTA 4A2QA 1RJ9A 4C30A 2B8WA 5JS8A 3CPHA 3LLMA 3L43A 4Y0AA 3QG5A 5KTYA 2XB2A 3JZMA 1AQYA 3L8YA 3UMFA 1JJ7A 3QIAA 3RRMA 3KQHA 5J4HA 1U0HC 4ZCIA 2J0SA 4JLPA 1M6NA 3BFKA 1GKYA 1U0LA 4NHOA 3PUZA 2I4IA 5EJEA 3U5ZB 1KI6B 1CF4A 3FKSA 4WOPA 3GJ7A 2ZREA 4LZZA 3CZQA 2QGNA 3NTUA 3H84A 1P2TA 3KX2A 5B30A 3EARA 3FKSD 2QROA 1N0WA 1N5KA 4WZBE 2LKCA 1H8EA 1VCMA 4DLYA 4OKSA 1P3JA 2C5LA 2J87A 3BFVA 4QGFA 5JWHA 3UPUA 1NKTA 2NMVA 1FQKA 4TTRA 2E87A 2CK3A 2ZUDA 1WQ1R 3IIKA 4GPTA 4UXHA 4YMWA 4DC9A 1BOFA 2FE4A 1ETUA 1P5ZB 4MKFA 1PJRA 5E7JA 3NH6A 1BMFD 3OAAA 5H68A 4US2R 1JXOA 2PL3A 5FTLA 2AD1A 3CX6A 2G0NA 3CRVA 4LY6A 3FMOB 1ZNYA 4QGGA 2L0XA 2OM2A 3MUFA 4HUQB 2ZRJA 1F48A 4OL0A 3W34A 2VP2A 2RGNC 2G3YA 2ZVPX 1N6LA 4YC7A 4GOKA 1S8FA 2ZRHA 3ZZ0A 2CE2X 1KGDA 3A4MA 1CJVC 2ORVA 2ZR9A 3KUDA 1JBKA 2FH5B 1YU9A 4KBFA 4A8JB 4DDUA 2V6IA 2CJWA 1ZNXA 2V8OA 4DIEA 3P20A 1P75A 4OYHA 2AN9A 2IYUA 1YRBA 4GI7A 1EFRA 1KK1A 3M0EA 2D62A 4XVQA 3GJ4A 4IDHA 4URYR 4HAZA 5TB5A 3HR7A 2Z43A 2Q3FA 3A1SA 1G6HA 2B21A 2NIPA 3LW7A 4B75A 2ZM5A 2XSZD 3CX8A 3Q5DA 3R7WA 4RZXA 2GJ8A 5DO9A 2QTFA 2ZROA 1OYYA 1N2CE 2NZJA 3ZH9B 3B85A 1C9KA 2YHSA 2EFGA 5C18A 1G19A 1G7RA 3TW8B 1XP8A 4D6PA 4Q1CA 4Q03A 4TSFA 2OCAA 2ZRDA 1MO5A 4US0R 4I1UA 4XD7D 1Z22A 3E2IA 4QBIA 1YRAA 2ZS7A 1P61B 2Q3MA 5KNBA 2PT5A 1UBEA 2J0VA 3AKDA 4MKHA 4Q02A 2BC9A 1U81A 5FBWB 1RZ3A 1KTVA 3CZPA 3QQ5A 4IVQA 2OG2A 1JEEA 2WMNB 1L7VC 1R7RA 3P1JA 4D2IA 1KSFX 1NJGA 4PO9A 2O8FB 4ZCLA 3W6PA 2EYUA 5JBQA 1YR7A 2FZLA 2O0HA 3B78A 4OHWA 2WWGA 3THXA 4AKHA 1U94A 4K81B 3VX3A 1AGPA 3T1OA 3U3JA 4BEBA 1AK2A 4BLSA 3RWOA 2BCJQ 1E2KA 3VMFA 5BWMA 4TLDA 1E2JA 1TQ4A 2FSFA 3FMFA 2IXGA 1SVKA 1G7TA 1G5TA 1ODFA 5FBLB 4HLDA 2VP9A 1T9HA 1XEXA 5DI3B 1DG3A 1EFTA 2KSQA 2R6GA 3CNLA 3EASA 3LBNA 1SVSA 3IIJA 1Z28A 2F55A 4Q48A 2YKGA 2OE2A 3UATA 1SXJE 3RAPR 2QY9A 1U90A 2XAUA 2ZI7A 5CIQA 2VQSA 4JKYA 4BEJA 3S1AA 1GILA 1FUKA 2HT6A 3ZYCA 3GJ3A 5G3YA 2VO1A 2BDTA 3CPEA 3IBYA 3KKMA 2J1LA 1N5IA 3GLFA 5HE9A 4TQAA 3AP2A 4DHEA 3U44B 2GRJA 5HE8A 1U99A 2YC4C 2W0MA 1QBKC 4TZ6A 3W3ZB 5SZJA 4BASA 3G5UA 5FR2A 3ZZTA 4EPXA 1NVVR 5KSZA 3X1DA 1RRCA 3RS3A 2ONJA 4RD6A 3RS7A 1OH5A 1JNYA 2Q21A 3AGQA 1WBDA 4JLKA 1XPOA 4Y0VA 3GEEA 3RDPA 2FPMA 5DI9A 2RGEA 1T91A 1OHHA 2XTNA 5KSPA 2JLWA 1VDZA 4C3ZA 1DAMA 3DL0A 4EFMA 4F4CA 1Q44A 4LGMA 4NCKA 3NVAA 5HTKA 2D7DA 2J9RA 1IN6A 4P4SA 3KQLA 2A5YB 1Z2CA 3UMRA 2RGCA 2A5GA 5EXPA 4RFSA 4Q7KA 1IXRC 1EX6A 3NG1A 2QSZA 5FOXA 4A0FA 3FFBA 3WBJA 3WP0A 4B43A 1N5LA 2VH5R 1OIWA 2NO9A 4TTQA 4AYWA 2V1XA 2XNDA 4NP6A 1W48A 4ON9A 3T35A 1U8YA 1WRBA 5KSOA 3OEHD 4F4JA 3AVQA 3AP1A 3SOPA 1DARA 2ZTSA 4L8GA 1E79A 3T06B 4EPYA 3PEWA 2QUZA 2YNMA 3TSWA 3AH8A 2W83A 4TQUS 4EDHA 3GLGA 2PCLA 5D3MB 1OXSC 2BOVA 2VPPA 3W5JA 3P4YA 3ZVNA 4TL6A 4IKEA 3R20A 3D7MA 2F43B 2OBNA 5IF9A 3QE0A 4LYJA 4RSGA 1W49A 4FXPA 4V0KA 4DEXA 5FBVB 1VG1A 2AX4A 1DAFA 3ECCA 4PPGA 4OK6A 1SXJC 4Q66C 3GEIA 4Q4JB 5AUQA 1HQYE 3HP1A 1VHLA 5EE3A 3PEUA 1Z0FA 4A15A 2XXAA 3RNLA 1BIFA 3NDPA 1GUAA 2J45A 4TSFD 2HUPA 3I5XA 4LDJA 4PZZA 4Q7JB 3LQRA 3QSYA 1P2UA 1ZC3A 2REBA 3EAQA 4BFTA 4R7ZA 2WKPA 4DLWA 1G4AE 1E9FA 2CCGA 1KI3A 4PXAA 1N0UA 1QF9A 1SULA 1KK0A 4LK2A 3PCRB 1Q1BA 3MLEA 5FTNA 1E3MA 1U9IA 1Q1ZA 4MYTA 1K6MA 2WSMA 3R9IA 1TF7A 4UXIA 1FMJA 3SHFA 5KSYA 1JPNA 2ZJ5A 4CT4B 3MG9A 4A6PA 2J0UB 4GMXA 4HAVA 4ACAA 3KKNA 2DWPA 1RYFA 1S0UA 5J40A 4KHZA 721PA 3QUSA 1E0AA 1US8B 4LV8B 1QG4A 1E0JA 3G0HA 1Z5ZA 2GJSA 3GLHA 3D6TB 4Q4HB 1G9XA 1S3GA 4R9UC 4XWKA 4W5WA 1W5TA 4FCVA 1XXHE 1SVLA 5AK0A 1JECA 2VSXA 4Z1MD 2ZRBA 1Z3IX 2V1UA 2RHMA 1KSJA 2EWWA 4PQFA 1EFHA 1KJYA 2D2EA 2ZI5A 1IJEA 2ZSDA 2WWYA 2XJ4A 1P73A 3EWAA 1PLLA 2F7SA 3TMKA 2C04A 1JI0A 3RVBA 2F1RA 4KCGA 3GLIB 3NDBB 1KO5A 3C5CA 1DTSA 1T0HB 1UFQA 3CUEF 4DVGA 1SQ5A 2IUSA 1ZC4A 2RMKA 5CIWA 2R6FA 3U6KA 3ONWA 2QAGB 1KI8A 4FMCF 4DCVA 1E2NA 4F92B 1II9A 2I1VB 4PPFA 1JAIA 2VRWA 4DCUA 3K0FB 3AGPA 3KKPA 2IA5A 4TMVA 4EJSC 5K8LA 2GK6A 4A4DA 4OJKA 4OI4A 2C98A 4ZI2A 4JIMA 2TMKA 4BLRA 1SXJB 5AUNB 2FNAA 2ZJ8A 2NZ8A 4CW7A 2FGKA 2AKYA 1KK3A 4NYIQ 2VLIA 3B60A 4RD3A 2GKSA 3A37A 5JI2E 1M1YE 4OHVA 3UKDA 1XPRA 2QBYA 2KBEA 5EP3A 3NHAA 3IO3A 4ASUA 3H2YA 1MO6A 5JCZA 4UNSA 3I32A 4ZKDA 1E2PA 4IVPA 2CK3D 4QNMA 1YZGA 4Q9HA 2GA8A 2V7QD 2ZYVX 3IKJA 3GJXC 3AF3A 3GFOA 5AJWA 4IHQA 4M2LA 4X8HA 2WPDD 1AS2A 1CR4A 2RGXA 2IF0A 4DSNA
chains in the Genus database with same CATH superfamily
2YYAA 3O73A 1I9CA 3IPCA 3EZXA 5DMHA 3VYWA 1BSVA 1T8WA 1IZ7A 1SU8A 3F9IA 3KHSA 4UDXX 5D3ZA 3HUUA 2R5WA 5TF4A 1RHMA 3N86A 4QOHA 3TIGA 4EY8A 1Z16A 3QVGB 4WZAE 4O3MA 4NECA 4IFTA 4IJVA 2FAXA 2H3EA 3N8NA 4KWHA 4WN3A 5AW5A 2N1BA 4QDKA 1NZFA 1S3SA 1BMFA 3BM5A 4BJ6A 3OOWA 1MW8X 1YZNA 1PBTA 4AFNA 3ZY2A 3LDAA 1KS2A 3AIKA 3DLPX 3Q15C 5FJJA 4K86A 1IHYA 3FJOA 1QJCA 3G0BA 2NO7A 3KYJB 1CCWA 3NAQA 2AN5A 2A5LA 2IHZA 3KOWA 4FDMA 2Q2WA 5P21A 4DLZA 2KHZA 3VR1A 1DTWB 3U44A 1F8FA 1NHGA 1F06A 2AK2A 1M1NA 3PDCA 1G60A 2BUCA 2V3WA 4I4LA 4DJEC 5KYWB 1AB5A 2DQKA 3I0ZA 3T7KA 5GV7A 4FMDF 1RWNA 1HKUA 1OFUA 4EO7A 2VDVE 4AJ9A 1REQB 4YRIA 2H4WA 2QTHA 4Y6LA 2EF0A 2R62A 1EGVB 2Z09A 2H2IA 3HVJA 4RPGA 5EWMA 5L7TA 3CX4A 3OWHA 4JLDA 1USIA 3FGZA 3ND6A 4MWOA 5DYIA 2FB9A 2QK4A 4II7A 4ZVVA 1ICEA 1TA9A 1TD1A 3QVJA 1PV4A 2APJA 1ZHFA 2RIPA 3L92A 4M0CA 3WP1B 4E5KA 2MMGA 3KSDO 4TS4A 4ZVSA 3SHWA 3GAZA 2VDQB 2BI4A 3FPAA 5CHYA 4F97A 2VTBB 5FV4A 2VK1A 4FYWA 1KSGA 2XTMA 3D0OA 2VWHA 2W90A 4GUAA 4M6WB 4P4SB 2XZPA 4CMEA 3AKZA 1ZEMA 1KJWA 2OHXA 4PWYA 4QUHA 4R41A 3U3ZA 2H5IA 4YV2A 3OOSA 1WEHA 4R1OA 3H6GA 3MQFA 2IEAA 2Z9CA 3T7RA 4D0RA 6LDHA 4DGQA 5BVHA 1M74A 4YMLA 1AUXA 4M1YA 5T4BA 2G04A 1N25A 1JALA 1I6WA 2GBPA 3OLXA 2Z57A 1AQIA 1IUOA 5BWBA 4FDVA 1YTUA 1N7HA 2AD5A 5AKJA 4N3AA 4MWDA 1U9JA 1UR5A 3LDGA 3H1PA 5T64A 1HI9A 3EJWA 4INOA 5BWCA 5IH7A 1YI8A 4WW0A 1F7VA 4GMFA 3KZXA 4Q37A 3ZQ4A 5ANRB 2VQEB 4P4TA 2C9MA 2I5PO 1L4YA 3TAXA 2E82A 2WA1A 4DV4B 1HX7A 3P71T 2WG1A 1KJNA 2ZB2A 3JQRA 1U2PA 2M32A 1SZJG 2CF5A 2GD6A 3OE4A 1GGMA 3DWEX 4AY6A 3E82A 3JY6A 1H2EA 1Z36A 4B47A 2JFYA 1JHYA 1FX0B 1BHQ1 3JQ7B 2R48A 4N82A 2PNJA 3RBZA 4C0LA 3QLVC 4O4LB 2BSXA 1T2VA 3S99A 5LP6C 1PW7A 3LK6A 2HNBA 2OHFA 4B6GA 5JZMA 1G3UA 4Z1MA 1DV2A 5TMPA 3LHSA 4B9AA 4C04A 1VRCA 2NQ8A 1V71A 1XA4A 5FLEX 4JUCA 5E6SA 3PUKA 5DHQA 3JVUA 2NU7B 3VM6A 2A1IA 1KQ3A 3PSHA 2YN2A 2ZXUA 4IHJB 3BWEA 1T5DX 3H5WA 4AYTA 4F2GA 2D5LA 3HYRA 5KTSA 2QTWB 1QS0B 4G5FA 2CWWA 2UVPB 5FX2A 2DBVO 1P1BA 1LI7A 1GARA 2C20A 5IC6A 4U1RA 1LFDB 3OU2A 3GHYA 5E6RB 4INPA 4QRHA 3HU5A 4X5OA 3EIQA 1V11B 2XBLA 2Q07A 2YY7A 3CN9A 4OYYA 4Q4LA 3IMGA 2Q4BA 4FBGA 4EL0A 5CB4F 3OOHA 4QBHA 5CDGA 1X7XA 1V5GA 2QW8A 3PFGA 4JT9A 4LA4A 3H6KA 1JFFA 1L4GA 1DMSA 1A95A 2FPUA 2P35A 4DLBA 2WIFA 4KQXA 4MAFA 3K73O 4DN6A 1VOTA 3PTZA 5ARBA 1I8TA 2IWRA 1BZYA 1O3YA 3V6MA 5AW9A 4B09A 1NBMD 1O6GA 2AYZA 1PJQA 1PNTA 1TVKB 4RTMA 4GPEA 1R10A 5H3HA 3RK1A 1LS1A 5DU2A 2C5HA 1K4MA 1OROA 2QTVB 3NAMA 3SHTA 4Q4DA 3VVBA 1RQPA 2YMQA 4JT4A 4PSAA 3UK6A 1RKVA 2XA9A 3ST7A 1R9JA 2FFQA 4LHVA 4D42A 4E22A 5IWAB 3I01A 1HZZC 2WWXA 3FA2A 4MKGA 3F7TA 2QUHA 3A27A 3A4NA 1M7HA 4GLOA 2RHLA 4HAOA 3UMSA 2OLJA 1AKVA 4KVAA 3HI4A 4R2WA 2OORC 3PUYA 3MGKA 4FYXA 1DCMA 3NEPX 1XZKA 1HTWA 3N58A 1V48A 3AWDA 3KQYA 4W4TA 4PLHA 4C4YA 4DABA 4EKEA 1P7ZA 1TFRA 2EAUA 2JAXA 1ODKA 2Q50A 3L41A 3L0ZA 3CZ4A 4RMNA 4Y2JA 4Q82A 1ONSA 3BOSA 5EMJA 1DEHA 4RD2A 1L8QA 5FUVA 5HZGA 1THGA 2WT8A 4ECAA 1RJ9B 2BVNA 4COOA 4N65A 4QOIA 5A04A 4ZYLA 3WNQA 4BRZA 1T5SA 5K0NA 5F4BA 1KKLA 1CF2O 4PPYA 4Y6OA 2PGLA 2BGRA 3NGLA 4KRXA 2NUTB 3UB2A 1Z2EA 4C4TA 4XWOA 1FLVA 1VLQA 4EABA 4B3SB 2P4QA 1ZUWA 13PKA 3UB4A 5I01A 4GDFA 1ISGA 3B1YA 2XD4A 2TMYA 3QE3A 4LVOA 4AF6A 1RI4A 1FPMA 4S35A 5G40A 1QV9A 5D5HA 3L79A 3ESBA 2MR6A 1EJBA 4C7JA 2ZB8A 8ATCA 2IYNA 2RJ3A 4MB0A 2WSSD 2FF7A 3PD7A 4REQA 3RSSA 2QTAA 5CFOA 3N2YA 2F2TA 3V4SA 2I7DA 2EHDA 3DZHA 2AXQA 2AH5A 3E3OA 4BB9A 4EY7A 1OXXK 2ATXA 2B3TA 3L7AA 3KTOA 4DSTA 3FSGA 3LY7A 5CURA 1V39A 5HDBB 1G4UR 2IIQA 5JANA 2QMUA 5A6SB 2DERA 3RSQA 3TM4A 4E4YA 5AVKA 3E22A 1CHDA 5DJ5A 2OPBA 3SQXA 5FEMA 3KQNA 4XCXA 1DINA 4WCVA 4G5RA 5IH3A 5C5EA 5K3OA 3VYRB 5I4BA 5FI0B 4YECA 4IQ4A 2AR7A 5BOSB 2SBTA 3M83A 1Q21A 4DJJA 1H4SA 3ENWA 4PC6A 3Q8XB 5GJVC 1W75A 3ER6A 1NW4A 2IYYA 1WZIA 1I2CA 3NTXA 2AQIA 1K0UA 3EOAI 3ZD9A 1R0XA 4X44A 4P0QB 1TAGA 1Q7GA 3G5AA 2ZWOA 3U7RA 4GT1A 4H17A 2P9YA 4MUEA 4PZEA 4A5OA 3KQMA 2ILTA 5BSUA 1I30A 1X7XB 3EIFA 3IEPA 4HI0E 3ZCVA 8LDHA 2ZIXB 4ZQFA 2B25A 4QM6A 1FE8A 4QYIB 1W8DA 1YZKA 4G0QA 1O8BA 4P3PA 5EN4A 5A71A 1JTFA 3WGQA 4D9KA 2F4VB 3LI2A 3V46A 4PG5A 3VU8A 4CF5A 2G08A 3DDWA 1JKFA 4FHZA 4OSEA 3RUDA 1XJQA 2WJ6A 1I2BA 3TTWA 1QKJA 3ON5A 3EX7C 3FD8A 5F51A 4UHFA 1JB1A 2MDTA 3DZDA 4QIHA 3RIEA 4CLOA 1SBIA 1L8LA 2UYHA 4O8CA 4B3RB 4DQVA 4RDCA 3H9CA 1VJGA 4AZ0A 3HJBA 4GMDA 1LDNA 1E2FA 3R3UA 2OILA 2ZJYA 1KFBB 2GB4A 2P62A 2IY8A 1W88B 5JEDA 2JEYA 5JJKA 2F62A 3WLOA 1CB0A 4BVHA 4KMSA 3M7IA 3KAKA 5H8WA 4ZDKA 1EXNA 4B9EA 1ZJYA 1UXOA 2FY8A 3LC7O 2VXOA 4RH3A 1QRSA 2CE7A 3IH5A 5ICEA 2X7JA 1J8FA 1II0A 4XIGS 2R7NA 4GRAA 2EQ5A 5KVAA 3PCXA 3F74A 3ONEA 1TU0A 1FMFA 1GSIA 2ZE7A 4GNKA 2I3ZA 2CBXA 3NHSA 1CY1A 2W6JD 1MJ5A 3DUFB 1V1JA 4Q3EA 4BNGA 3WJ7A 5C0OE 1Y5RA 3LAWA 1XLWA 2Q1SA 2DUNA 4IH4A 3TOZA 4EYKA 3KV1A 5DBFA 4D9MA 4CLEA 2QN3A 1HA3A 1KJZA 1Q20A 2A0XA 1JR3D 2FFAA 1AQ6A 1NURA 2J7KA 3IUJA 2HDNB 1BJKA 5EZQA 5KNDA 3N2IA 1N0IA 3GG2A 2I55A 3QU4A 5KCZA 1TJ3A 2XXAB 3DNPA 3T61A 3OX2A 3A1UA 5DASA 1XJWA 2AIRA 2R8RA 1KAGA 3T1TA 3B1XA 1EESA 5BVHB 3GNQA 4ZI7F 3AVTA 2IS6A 1A9TA 2BGUA 2FW1A 4MI9A 4C4ZA 1XEXB 1K08A 5DI3A 1K75A 4G4IA 3WGLA 4F11A 1O96B 1UBSB 1ZH0A 2HA0A 1FJGB 4N0EA 1E2QA 3UENA 4TMWA 1P2GA 2IU4A 4TQ9A 3KOOA 3AFHA 4GS5A 1QF7A 1A04A 2LWIA 2ZSKA 1OAKA 3TAHA 2E55A 3E27A 5FPYA 4B85A 1G1AA 3T5AA 2Z9DA 3SS8A 5TVKA 4Z9XA 4FHCA 1J00A 4Q3BA 1Z4NA 4W6ZA 4QT0A 1X1RA 4JASB 5G3ZA 1N5MA 1R4NA 1TUEA 3V7UA 5I8PA 1Q22A 1YIOA 5AM0A 1T26A 4J07A 3BGVA 3BH0A 1FP7A 2AOXA 2YMPA 3SJCA 4BO9A 2YXLA 1FB5A 1UBKS 3SHVA 5BV0A 2YWDA 1U0OC 1XROA 2QD2A 3M2TA 1AKQA 5BNFA 2CLMB 1THZA 4JITA 3CBGA 3TR6A 5KB3A 4BAUA 2GXAA 5JJCA 1Q0HA 1V2GA 2G17A 1RI1A 2JI6A 3DAHA 2Y1CA 1OX5A 3KB8A 5K0LA 2PNFA 2OV8A 2VCHA 3E0QA 4M1ZA 4R1PA 1ZOOA 5A6VA 1VIDA 1RP1A 5I5GA 1DRJA 1EWRA 3W90A 4AS1A 3RVSA 3G02A 4HEQA 2PGIA 4DCJA 4CEJB 3G8AA 1HL7A 3MTAA 4G9GA 4C2AA 1WPGA 4ZVNA 3S5JA 2YX1A 3HP7A 4FZRA 3DUWA 1OB5A 3MMPA 3ROTA 4LJLA 1O77A 3LWBA 1Z0IA 4DA7A 1ADFA 3F5FA 3NASA 3R5KA 3H86A 2JCSA 1WDLA 4MITA 1XPUA 4QARA 3ZHUA 3TQRA 3RADC 2QOEA 5EE9A 4EG1A 3N53A 5JECA 3MYYA 3HFJA 1NLMA 4ZVUA 1O94D 1R37A 4IGFA 5KVVA 4U7JA 5CYFA 3CV3A 4UW9A 2R79A 4YV0A 2VG8A 5BW6B 4K26A 5KWSA 3F0TA 1N1MA 1X8JA 3C3YA 1VL6A 3EOBI 3N0TA 3L05A 2XF2A 3MJTA 4DCMA 2DKFA 3DLTA 2C8JA 1KDZA 4QGAA 2Q4RA 4AG3A 3GJQA 3KQPA 1ANKA 4C29A 4WA8A 2A0KA 1NJSA 2HJVA 4FZVA 3WO1A 1T5HX 3L01A 4UVDA 2RAVA 4IS2A 3EY4A 4NQZA 3KXIA 4XM0A 2FCRA 3F3SA 2QZPA 3PC8A 3B2NA 1JDUA 1WKVA 2AFIE 3VAZA 3NVKI 1DAEA 3DKIA 1RXYA 2PK3A 3ID6C 2Z8ZA 2ZKIA 4U02A 5F73A 3EA0A 1JMYA 4XGKA 2O8EA 3GP8A 2WM3A 1ABBA 3DE7X 5D8DA 1PS0A 4DT1A 4M0DA 2QZ4A 4NZMA 1WDTA 1QCDA 2B5OA 3MS2A 2GJKA 4X3CA 4BV3A 4IOMA 5B3AA 3RVRA 1ES9A 3P9KA 1GNTA 2J6BA 1BE0A 3RTDA 1EE1A 2G09A 3AMVA 2QZSA 2X0IA 2JIRA 2DCUA 3WYGA 4DSZA 1D4OA 2BF7A 4W99A 3UA4A 2JJ2A 5ALEA 3V33A 1JB9A 1E69A 2BFNA 2QQGA 1HE1C 2N46A 5C8VA 1T36A 5HKOA 1CSEE 1PZFA 2GN2A 3WZMA 4S04A 3I01M 3ZUGA 1NVMB 3WJ1A 1KYVA 5FULA 3WL4A 1LVHA 3BA1A 1JV2B 3IALA 5HFJA 2CXQA 3GH3A 3W78A 4EECA 2QTVA 1A0OA 2CDAA 1AZLA 3B3AA 3PX3A 1VKJA 1HG1A 4CG3A 1HDOA 3CVYA 3R7AA 2GK7A 3A0UA 1G6KA 3AF5A 2LGJA 2FN4A 3NHFA 6YASA 2D3TA 2QQ0A 3OCJA 2HRDA 3FZNA 4IIJA 1CF9A 3KG2A 4G5GA 2Z2IA 2WFMA 1R0RE 1XZCA 1ZXLA 2J6HA 3KKZA 5KHOC 3OSZA 1S2GA 1F14A 2AG1A 3GK3A 4ZYUA 2BGGA 1GRQA 1KFKB 3EGXA 2VPTA 3BDAA 4IEFB 4EUHA 1K6JA 3DCYA 5ITZB 2HHLA 3BIXA 1P33A 3VJMA 3M49A 1KC3A 2L82A 3DO5A 1O97C 3E6AA 4LXHA 4MI3A 1KZ1A 2ZUSA 3PGKA 3MTIA 3W06A 4LJ9A 3S1SA 1URPA 4LS3A 3CUSA 3R5JA 3ESAA 2JAUA 4GBED 4X41A 5EPEA 1R5JA 2FFRA 2Z3WA 2VDJA 4FYMA 3TW0A 3MWFA 4K7JA 1JWBB 4BYGA 1CY7A 3QXXA 3TXXA 4ZI3A 1JLKA 2FOLA 1XEFA 3WL3A 3HY4A 5GONF 1NW6A 1Y98A 4YCAA 3GZ4A 1OD6A 4WLOA 1RLJA 2QTRA 5JRZA 3VXKA 1NAHA 1LW6E 2ZI3A 1GPAA 2ZJ3A 4JIGA 4Y1RB 5KBYA 3DE4X 2D5CA 3VHRA 1WY5A 1LK7A 1JQAA 1A88A 3L6DA 4J75A 3PNQA 4OHOA 3U7JA 2OMEA 3OM8A 3ET4A 4LXGA 2K7FA 2FEPA 2Q8NA 4WBSA 2R6JA 2VS1A 3KDSE 1EX9A 5BN3B 5H83A 4UDYX 5G1OA 3K8YA 1MMFB 4BZZA 1WXGA 3WLKX 1KETA 2DCMA 4G67A 4XYLA 1E4YA 4M1EA 2PLWA 3H42B 3VVLA 1DXHA 2PD4A 4BMSA 3AXSA 3JD1A 3P5BA 1M1NB 2FFBA 3A1FA 2GF9A 2BTEA 3GCXA 2BTOA 2FMHA 5B12A 5JARA 4MGIR 4A91A 1ULBA 4EMUA 3P0IA 2BP7B 4R8LA 3UFBA 2BGWA 1QIDA 1Z5NA 2GZRA 3INGA 4NBTA 4PR3A 2CLKB 3BCRA 1ZOLA 3T5BA 1M2WA 4BVLA 1NQOA 1QYIA 1WCWA 1SPXA 2B37A 2DQSA 3GELA 3LPAA 3PU6A 3PWZA 4LE0A 2FMUA 3GQBA 4PSDA 3SQLA 3O4GA 4OLAA 3WDSA 1EHCA 2ZJOA 3K70D 2ZUVA 3T54A 1YXMA 1KKMA 1Z82A 3W3AH 4ETIA 1NNSA 1WF3A 4O4HF 2WE8A 1FJHA 3W8EA 4LXUA 2H54A 2AZXA 5D1NA 3V7YA 4CHTA 2XVZA 1C9EA 2OQRA 2QVGA 4DUPA 4DV1B 3ESXA 5JE8A 4FOOA 1WB6A 3KEGA 3KJHA 3RGGA 2QYTA 2QM7A 3VRHA 4HRXA 1BMDA 1BG6A 1MOQA 1K86A 3AUAA 2ZETA 1JVNA 1XMSA 2DBRA 3ZY5A 1NN0A 1QMPA 2FSGA 2W7TA 2XIQA 3BGSA 1Q0PA 1UDAA 3K0AA 4XTCS 4EELA 3ZQ6A 1F20A 2W11A 3SFVA 4EF6A 1U7XA 5FWYA 4O02B 1SBHA 3UWOA 1FNSA 3ZHYA 4XIFA 4M8IA 2GF0A 2NOAA 4EMTA 3F1KA 3DAGA 1KI1A 4B17A 1UQUA 1JG7A 3ZWYA 1TRHA 4TT3D 4WGFA 4HADA 3PENA 1UQTA 3T0FA 4DV7B 2EIXA 1NKSA 3HLKA 1E3TA 3H5AA 5AKZA 2O3RA 4GWLA 3NWOA 5AHRA 1OTYA 3QE4A 3M6UA 1D2AA 2FOIA 2NTVA 5HRUA 1L4EA 2X8JA 5DNDA 3LT4A 3PFIA 1PCXA 1W46A 1TO2E 4QA9A 1JAZA 5IXJA 2YWEA 5LZ8A 3QU2A 4N9QA 4CCSA 5K0GA 4N7MA 4JP2A 4OQZA 4WRRA 2KI5A 5C3MA 3B8HA 2HLDA 2XCTB 1Y4AE 4RA9B 4X63A 2G4VA 1B3RA 1XD2A 3BWXA 5IAAA 5JXGA 5FJIA 5THQA 4Z7NB 5EUMA 1FL9A 4HBGA 5LR6A 4ND6A 2P6RA 3WL5A 3ED5A 1GGVA 1G0OA 3AUYA 4D3FA 1C4WA 2REXB 5EG5A 5EJFA 2FG6C 5EWJA 2ODEA 3EA5A 2O05A 3H87A 3V1KA 1PF7E 4KL8S 2C2KA 3R3SA 1SCAA 5TQ0B 4FFVA 1OTXA 3SU8A 1B1AA 5H4HA 1G6OA 2YCLA 4MIOA 3CZMA 3ANTA 2DWUA 2FKAA 2I6SA 3UJBA 5A7FA 1AO0A 4WNAB 5K0FA 2HPHA 3K4QA 3DBOB 4X97A 3UGTA 3U7IA 2PZFA 3OSUA 4FN5A 4TYWA 3K0FA 3GT0A 4MAAA 1JIKA 3E5RA 4WT7A 2RG1A 4LF4B 2X76A 1KJJA 4CJXA 3CF2A 4FT2A 2OGSA 1SKQA 4TSKA 5CP8A 3GJRA 3KLBA 3FCSB 5CFRA 3T3IA 1MGOA 4ZAWA 5C80A 1CIJA 1S2MA 3SFTA 3RM3A 1ZIOA 5P8WA 4GE0A 4CU2A 2E89A 4A1FA 1KDPA 1XRNA 4P35A 2FLWA 1YVRA 4LNUB 2JH9A 1UBGA 1E8MA 2Q1TA 2J5BA 1Q0QA 1AB6A 5K6TA 5FLKA 3QKWA 4IDGA 3U17A 4IH9A 4NMWA 4J9VA 2F1OA 1E9DA 1SFRA 1XALA 3E8MA 1TRKA 1WMSA 4ALMA 1PWYE 1PR0A 1QRRA 1O0CA 2P41A 5I3CA 1LPMA 2BEUA 2JGNA 3JVDA 1D2MA 3T7TA 2PRKA 4D7AA 1RW4A 1RZUA 1G7SA 4QTYA 1RT9A 2V6JA 1A77A 1SUEA 4F3KA 1QZZA 4RQBA 2P5TB 3MTQA 2WV7A 3ZDFA 2PKQP 3L4SO 1VYUA 3NHUA 2HXSA 1NY6A 3O7WA 3ZXUB 2QD1A 4ALLA 4AVYA 4RTJA 5MHTA 1IOVA 2I65A 5KMGA 3ITEA 3AUFA 3UAXA 3C3EA 4MQUA 3RYHB 5DVZA 2VRCD 3EA4A 4UE6A 1THTA 3CKKA 3N0VA 5AVRA 4C7OB 2OVBA 4ERNA 3O2NA 1KORA 621PA 4JI7B 4NZPA 2UXBB 1A69A 2RGNA 1FU8A 3UWSA 4JK3A 3UT6A 2ZSFA 4IUBS 1NI4B 4EHKA 3PA6A 2ALJA 3B7WA 4OMFG 4CF3A 4ZHSA 1QGYA 5LYJA 2CSUA 4DWJA 1SAYA 4R2KA 4Q3LA 5AI0A 3WKDA 4DC0A 4MR9A 1H23A 5FFMA 1WCXA 2D1QA 5FQNA 1L2TA 3C48A 1XN1A 2XDQA 3TJRA 4KOAA 2OFPA 4AURA 3CF0A 1KZ9A 1W85A 5J58A 1JFSA 1NVGA 1RMQA 1DBRA 2AR0A 4ZKEA 4EG7A 2XTAA 4LHWA 5JOQA 1P6XA 4WN9B 1MG5A 2D0DA 2HADA 5AI8A 4ZCQA 1KI9A 3EFBA 1PI3A 3QOYA 4C20A 2GA9A 2VJLA 4NBUA 1OR8A 3V8QA 5LVAA 3BPSA 3M33A 1NIPA 5M04A 2C8KA 3E05A 2W37A 1IG0A 2RJOA 4MGHA 3VO2A 1E96A 4RHXA 5CA0F 2GAIA 2YYSA 4Q9KA 1KPIA 1QK5A 4FQ5A 4MV3A 2XUZA 3WIDA 4RULA 4EY5A 2SCUA 1M6VA 4WZ6A 2EP5A 4XIIA 2RH9B 2HCTA 3W9SA 1P1FA 5KOJB 5C51B 2OECA 4EJ2A 4FHEA 3E9QA 3ZHVA 2FX2A 1SD5A 4QRIA 3KPVA 1CJSA 1F6BA 3BWBA 3V1LA 1N2ZA 2PRZA 3D6JA 1BC5A 3I2HA 3WQBA 3OOJA 4QOJA 1E3WA 1OJ7A 3ZD7A 5D87A 1PRYA 3UT5A 1YBHA 2QHXA 2CCKA 4HN2A 1UPCA 1IY9A 3AI7A 5JAOA 2ZVJA 3EZYA 3IMEA 1QCCA 2XT9A 5EIXA 1EFUA 1C9YA 4IGAA 4DIFA 3EDMA 3UTCA 5DN6D 2AEFA 2DM6A 1C3VA 4WUVA 3UMMA 1WD5A 5CVJA 2IELA 3J80A 2C9ZA 1ZI8A 4D3DA 4LQ4A 5LQRA 4BGUA 5ELXA 4TS1A 3EQ8A 4LMRA 3SYMA 2D8MA 3UNXA 2WYOA 3DP9A 4PGMA 3VZBA 1A9OA 5AHWA 3ZS9A 5FUYA 5CLJA 1MTZA 2HA5A 1AT1A 1FTNA 2VJOA 4ND8B 5AM3A 1AU9A 1W4AA 5JQWA 2I99A 5DHAA 1PYOA 3DLHA 2CXPA 3AQIA 2RHHA 3TMAA 3NOVA 1E6KA 2AJTA 1MDBA 2HF7A 2FEOA 3PGVA 3W9YA 4DMCA 3AXTA 1MAAA 3TVTA 3TTXA 1F1BA 2Q3BA 1BWRA 1P74A 4PYMA 1N2XA 2Q9CA 3V4RA 2C7QA 4BQRA 3EVZA 5DIZA 5C1PA 1FYEA 5EHXA 2ZZNA 4EW6A 1C7ZA 1T1IA 3QOWA 4DV3B 1AGNA 4ZT3A 3KLOA 2QLBA 3N0XA 4YWHA 2VDUE 4E08A 5KNLA 2CUKA 4A8JC 2PY6A 4WACA 2VSQA 3BIFA 1TM1E 1YOBA 1JJVA 3OTOB 3EPKA 3L4BA 2FQYA 1HOXA 2P30A 1EX1A 3E9DA 5T3YA 1G6Q1 2PKRA 5F2KA 1DV1A 1W0KD 3KXLA 1TZBA 1TZKA 3AFOA 4WERA 1ZIXA 5DLEA 5FWYB 1DO8A 4C89A 4RPLA 2ODTX 3GEHA 3PXGA 3AETB 2Q99A 1FU7A 1ZU4A 1AF4A 5B53A 4N7JA 3A14A 3QVTA 4GVXA 1Q83A 2DHCA 3RPEA 1QVAA 5JAPA 1Y6FA 3SFZA 1WAMA 3H2GA 1YCFA 2OR3A 2VHQA 4YMIA 1IXSB 2HA2A 4W5HA 1DQYA 2AV6A 4B82A 4UNNA 1IOWA 3G8YA 4G8BA 4UM9D 3PLAE 3ONDA 2O2CA 4BEVA 2WD7B 1ZLXA 2JAHA 4Q4CA 5TPZD 2C54A 5CX4A 4HTFB 1G16A 4OV6B 5IXSA 5CK5A 2HMUA 3SQNA 4JBYA 2IBTA 3L0CA 2GFIA 4OJNA 3ZCRA 4LF6B 5KJ1A 3OM0A 1NSFA 2WYVA 1PFUA 1VL0A 3DD5A 3Q6IA 2QPTA 4BNXA 3DXXA 2C29D 1YA6A 4B7XA 6ADHA 4UREA 1SXIA 2HSWA 4YPOA 1KO7A 4EJ0A 2G9RA 1DWPA 1CQIB 1H6AA 1OZFA 5CLQA 1YL6A 2GD2A 4TLMB 4ZC8A 2PFGA 5CNJA 3VVMA 1ZD2P 2P2CA 3ZIAA 1S3IA 4F2HA 3VU0A 1IM5A 2VT3A 2XCOA 4Q6WA 2PWBA 1HC7A 4KDEA 5CAEA 3PHGA 4MQ6A 3W6NA 2HW8A 2R8BA 2H06A 1U5BA 3LLVA 4UUQA 3V55A 1WW3A 3ZBPA 5K05A 4AXXA 2VA8A 3ITDA 2FX3A 4CLHA 1NRIA 3AY0A 5CTAA 3T8YA 1GQOA 4DMFA 1CQPA 4ZI2A 2G7MC 1FS4A 4I2NA 3L49A 5LQJA 1KWKA 3UJPA 3U6BA 1TM7E 3FPHA 2FSUA 3KXKA 4YGXB 2EZUA 3RU2A 2QMZA 1NBAA 3FHCB 1P17A 4MQFA 2JLBA 2O23A 3HWSA 2HF8A 2NUAA 4OMUA 3GAFA 1OGJA 1RU3A 3JQ8A 7GPBA 3CMCO 1BWSA 2JNWA 3LG2A 2VTDA 4JC0A 4K9NA 3U16A 2RD2A 3DJFA 2Y71A 4CQLB 4L6AA 3FTNA 2HCJB 3VOTA 2ATVA 3WIVA 1P4JA 5J3JA 1TZMA 3NBFA 1SIBE 3ROZA 1VL8A 3AKEA 2XGOA 5F1YA 2AF4C 4DQLA 5KWVA 4EPWA 4MUBA 2I4OA 2PSEA 3HJTA 4PS0A 4YUWA 221PA 3ZN2A 3NS7A 5BW4A 5KKCA 3HL4A 2XCIA 3GAAA 5ICGA 3T0GA 1RACA 4EOGA 3ZNNA 1DKMA 1VBKA 2I34A 3DFZA 3I5AA 3OQHA 1XHLA 3O3NB 4NOKA 3O4FA 3X1YA 3RHZA 1K9VF 2C4VA 4HNRA 1UOPA 2PA0A 4XDHA 2YZ7A 3IAM1 3EXFB 2Y1WA 1Q3KA 3GCGA 2IRWA 4E09A 2YOFA 1YRWA 2O8NA 1QV7A 2V54A 2VP5A 1JXQA 3F90A 4OQFA 5BUSA 1M2HA 2FR1A 2WKRA 4XD2A 2DFDA 4X7PA 1Q1GA 4QHSA 4HUQA 3MC1A 1B8UA 4PANA 2P8JA 3JQ6A 4U2BA 4DXHA 1EDBA 2HF9A 2GNOA 1FXSA 1ZRNA 3K0KA 3TVYA 3VGPA 1Y6QA 4M0KA 3CGWA 1NVTA 4UNIA 1NUHA 5DYWA 5HJ2A 3ZLUA 3O94A 4EFNA 9LDTA 5L4LA 1P4AA 2WEKA 4BNMA 4YUAA 1ZSYA 3T1NA 4RELA 3X1WA 5JQGA 1K4YA 5KEIA 2WY2D 1WW2A 4QU9A 2PLAA 5TPWB 3J7TA 3SX0A 3AUXA 3CIOA 3FLAA 3OZXA 1KYYA 1ZK2A 2CDRA 3AKYA 3WWYA 1NMQA 5JS6A 1CS4C 2PH1A 4U7TB 3Q8WA 5KI6A 4GC9A 1M1YA 1C2YA 3HHPA 2XE7A 3SOZA 3ENQA 1VE9A 4HAWA 3HWX1 1NVXQ 4M83A 3AR2A 1XNJA 3UAOA 5J1SB 4L9SA 3S2UA 3T34A 3HCBA 4DM3A 3A6PC 5HKKA 1E98A 3TO5A 3KIPA 4MWSA 2IX3A 1PTJC 5HR5A 4IVNA 2CNBA 1CUFA 1YB5A 1NW9B 4Q1BA 4X1IA 3O4RA 3D8UA 2CDBA 1HNXB 1HE8B 4WINA 3IUSA 3KT6A 3HG7A 3QYJA 5L3QA 4U2GA 4CKWB 1DU4A 4B48A 4BJ5A 1IUNA 1DNPA 4XUGB 3T4EA 1B73A 2BUAA 3KQUA 1Z8FA 4IHAA 2D5AA 4PQGA 3VPHA 3CEMA 4PGFA 5JSHA 4U5QA 3HV2A 3ISJA 2JCVA 4Z0TA 2HU8A 4RDIA 3ZGYA 1VGRA 1QRTA 4RM3A 1JAYA 2P5SA 4RVSA 2QRQA 3TGWA 2GM9A 1TIKA 2XB8A 5K45A 3A6KA 1EG2A 1MVLA 2QSYA 4KE7A 2C61A 4CMJA 3R9XB 3SC3A 5E1MA 3PNYA 5KNCA 1DIHA 1VKOA 2OQIA 3LGSA 1C0LA 3QE9Y 2WWFA 3EB9A 3ZV4A 2OO7A 2CCJA 3FTQA 4RJLA 1XFDA 3DB1A 3MUOA 4H1HA 5DW3A 5FV7A 5K3BA 3RKRA 3CNBA 4J16C 3W4IA 1FNBA 1UOEA 3FUXA 3KZCA 4FGJA 4XYEA 2CNWD 3NIDB 3PYMA 5E9AA 5KDDA 1JILA 1Y33E 2ZRAA 5AMXA 5B6IA 1OFGA 3EF3A 3DAFA 3NV7A 1U7ZA 2CY0A 3A6EA 1IZZA 1EGAA 4D9IA 5CVTA 4XJVA 1EFAA 1BN7A 4F85A 3QGMA 4I66A 2DXIA 3PPIA 1UP7A 3NFRA 4QFDA 3RS5A 4JC4A 4MUFA 1TTTA 4RKFA 3OPXA 3O0DA 4AKTA 1VB3A 4XQCA 4L73A 2HPVA 3U2QA 3VSAA 4LKOA 3CW2A 3ENZA 2QW1A 4JVSB 3Q3VA 5DTJA 4J49A 5LDDC 2IPNA 3ISTA 1YHNA 3FYTA 2P2LA 1ZINA 3EY9A 3P9CA 4MMYB 5EZYB 4QGSA 1G5PA 4CCYA 5JAZA 1I4EB 3LDHA 1Y1LA 4YJ2F 1BS9A 1WDMA 2HX1A 2VTEA 2VJPA 3PQFA 2ARKA 3QBDA 3RBVA 2O0KA 1X7DA 4MZXA 3MUNA 3PR3A 4Q7MB 3JD4A 3TLCA 1M5TA 3NO4A 1MA3A 1U4OA 1T29A 1AKWA 4I4NA 1X74A 3ZU2A 5FOQA 3D54D 2R8ZA 4GP9A 5LKAA 1I3KA 1KEWA 2IDMA 3C98A 3K9HA 1QH1A 3NJ4A 4LJ7A 4MS4A 3CSUA 3IBGA 1IVYA 4H9GA 1K7CA 1O4VA 1U1CA 1I4DD 3EGVA 3IOMA 4GKBA 3ZI0A 1DEOA 3NH9A 2JI9A 1YACA 4FT4A 3RT1A 1KVRA 4NF2A 4U7GA 2OD7A 3THXB 2DJ5A 5LN1A 5CDTA 3RIXA 2C2MA 1ND6A 1R6DA 4WMLA 5JWOA 3DMDA 3UMYA 5BN5A 3C3AA 4DMLA 1DFGA 1OVMA 1PEAA 3IHTA 1ZGAA 3B1VA 3Q5GA 2PLRA 1E5LA 5CB4B 3DT9A 2BFCA 1PT8A 2H9AA 1M5UA 2DPYA 1RQXA 2VTVA 2E7ZA 3D4LA 1F17A 1UJ2A 4OY3A 3TLGB 4PINA 5TPZA 5FL7D 3ODPA 2ADFA 1Z4QA 1T3HA 4JX9A 1BDBA 4J76A 2JJQA 4KLRA 3OIDA 1M6HA 4AJKA 1FUYB 4BLUA 3TZKA 3L6EA 4KH1A 4FLMA 2QTMA 1CR6A 1XD9A 1Z5OA 2PV0A 3LBIA 4O2BF 4YCBA 1ULSA 5CEJA 1M1XB 2J5RA 2J30A 1JQBA 1X7WA 1XDGA 3OBIA 4JXKA 2FPGB 4AMGA 2HSEA 2I8LA 2W98A 2XNDD 3FGOA 3HU3A 4IIEA 1Z34A 2FWNA 4F6RB 1AHIA 3GDFA 4M99A 4OM8A 2ZSEA 4A9AA 4JJIA 2Q3CA 5FPSA 5DXAA 4R84A 3FUUA 1Y6GA 4DLLA 5EVJA 1YQ9A 5ARDA 2HSJA 1MAWA 3ZBQA 3BB1A 5AIAA 3HZHA 1Q7RA 1DPFA 4JJKA 4CKEB 4M22A 1U80A 2BH2A 5FYQA 1W0JA 4XYBA 3UQZA 5IM5A 1ZGJA 3K53A 4Y2HA 1UMKA 2ROQA 5AP9A 1V6AA 1ZI6A 2EBWA 1YKSA 1C30A 1Q7TA 3GGSA 4NJEA 1L7EA 2YV2A 1VQ1A 1GPH1 1E5VA 2QAIA 2XRYA 4IOJA 4BIIA 1CY8A 1JKJB 1F6WA 1G8PA 4QPPA 5CM2Z 3ETHA 2JGRA 1B43A 2RBEA 3L7BA 4FW9A 4QO7A 5IVIA 4DBLC 4OI1A 1U0RA 4K6OA 4GEGA 1JPJA 3IVRA 5TQ0A 4C4AA 1JPVA 2RGDA 4AO6A 3HCOA 4N5HX 1GG8A 5AHKA 3E4DA 1FFSA 1R0SA 2YOHA 4X93A 3Q7TA 4TL8A 1IY0A 1KJIA 5HS6A 1WCYA 2RBGA 2P8SA 2N3ZA 1RRKA 3K9WA 3N39C 4FJ2A 4BV2A 4KFRA 1DO0A 3N0WA 3ZS8A 1AVTA 4QOGA 5LYJB 4MINA 5ITWA 2NWQA 2WSSA 1G41A 5LNK1 3FYSA 3NEYA 1IJFA 3PQ8A 1FC0A 4H6PA 4PXYA 1ZN2A 4ZOLF 3VISA 4UUBA 3ZY6A 4JNCA 4HTFA 2X5JO 1DIOB 3QNUA 4PC7A 3DLBA 2QIPA 1ZL2A 2Z3ZA 4IDBA 3D4BA 3R5TA 4N0QA 4UOZA 5EE0A 5FHQA 4J1TA 2GVZC 4L8WB 2XGJA 3OFKA 1JLRA 3RSOA 4XVUA 2JVIA 4NYJR 1H0SA 3I6MA 4IDAA 4BNNA 5LMZA 4HEJA 1KOFA 2WHPA 5ALZA 3T9BA 2MWMA 1TEHA 3FPJA 4IFEA 1BD3A 3O38A 4OQMA 4DZTA 1N2HA 1VJRA 2HA6A 4Y9DA 3VSCA 2WDPA 2FW7A 3FTCA 5AICA 1QAOA 2GZAA