4L8GA

Crystal structure of k-ras g12c, gdp-bound
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
167
structure length
157
Chain Sequence
b'MTEYKLVVVGACGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase KRas
publication title K-Ras(G12C) inhibitors allosterically control GTP affinity and effector interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 58
structure length 157
sequence length 167
ec nomenclature
pdb deposition date 2013-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4l8gA00
3CX7A 1WDTA 1H8HA 1B23P 1E2FA 1E32A 2FG5A 1COWA 5LBIA 2AL7A 3KXLA 4JBWA 3R9XA 4ON9A 2HLDA 1Z0AA 1ZUNB 1G7SA 2O8BB 4P3YA 5KNBA 1G7CA 1WBDA 4YXWA 1R0XA 2ZI3A 3FHCB 2JJ2D 3C4JA 1A82A 3ECCA 2JCSA 3THXA 1G16A 4KI0A 3SHFA 3BORA 5GJBA 4XWOA 3D31A 3K0CA 3I5YA 2QBYA 3ZS9A 4BUJA 3TMKA 4WOPA 1Z29A 1F5NA 2A78A 4QM6A 1XEXA 1OXTA 1FX0A 1OIVA 4C0AC 2EFHB 3O8DA 4PFSA 1VG9B 5BXQC 2F43B 1FUUA 3MWLA 4EPTA 4Q7LA 2FPKA 3A6PC 3BGWA 2HJGA 3AKDA 3S1AA 2QMHA 2OCAA 4HEJA 3RC3A 3QPVA 2ZJ8A 2DBYA 3QPUA 3N2EA 3GPLA 4WIAA 1ZINA 4Q1DA 4QGFA 4QG7A 5L8VA 2K5UA 2F9MA 5SZIA 1OF1A 3KUCA 2GAAA 1XMJA 2WWIA 3IO5A 5EP1A 1OXVA 1UF9A 1G41A 4TMWA 4ZI2A 5KPDA 3ND8A 1XTSA 1RC8A 3HU2A 3U44A 4ZKDA 1U8YA 3BFXA 3ZVMA 3TBKA 2PH1A 4TLCA 3QUSA 2BMJA 2DCUA 2A5GA 4FWIB 1QBKC 2DWOA 3VQTA 2QG6A 3AKCA 1HURA 2GAOA 2FSIA 4JBXA 5FR2A 5J40A 3V4FA 4G0NA 1Q3TA 3MSXA 4RFVA 1E2IA 3SBEA 3H2YA 5JEDA 1HE1C 2H57A 1NVUQ 2GNOA 2CHGA 2D3WA 4IXMA 3SN6A 4JVNA 4QXAA 5CLLA 4DWJA 3I5XA 4IVQA 2Q3MA 1W46A 2IYZA 3C41J 2NO9A 4IEEA 4MRRA 4DUGA 4ZDIA 3GJ6A 4GOJA 4HB3A 4GBMA 3HYTA 1E2KA 5L3QB 4CEJB 1PUJA 2BMEA 2XZOA 1II8A 2B21A 5LB2A 1QF9A 4TLBA 4CEIA 1ZU4A 4O3MA 1SKYE 4KSCA 4C0KA 3RNLA 1AM4D 4LRWA 4M2LA 3KKOA 4PTLA 2CBZA 4CRWB 2AK2A 1U90A 1S9HA 1AQYA 1E4VA 1IONA 1IOZA 1S96A 3N5CA 4JVMA 3NH6A 4DC9A 5KPJA 2CXXA 2C99A 3MGCA 4F4CA 1TQ6A 3C5HA 2OV2A 3BB1A 1N6RA 4MKIA 2E1RA 2XTNA 1G291 2WKQA 4XIGS 1KI6A 1ZUHA 3IIKA 4JS0A 5FBVB 4Q4AA 1AKEA 2GJAA 3TH5A 3GLFB 3QKRB 3U60B 4EPYA 2F3TA 2YWEA 3GMTA 1KDRA 3I72A 4ASUA 1K5DA 4BWYA 3EA0A 1IN6A 2CLCX 3DO6A 2QZ4A 5CIQA 2IEYA 3VR6A 2OILA 3PXGA 4YC7A 1ZCBA 2C2HA 4LJ4A 4MKHA 3UMSA 4PQFA 1S8FA 1G8FA 1EX7A 5JEEA 2QTFA 1YHNA 4I1OA 5FBWB 4C2TA 2J46A 2RAPA 3PEYA 2FFAA 2ZS8A 3ZZ0A 1S2MA 4PQRA 2O0HA 3QXXA 4IOJA 1F3OA 3CX6A 3C16C 3MLEA 4CDGA 2RHMA 2ZRAA 2RGGA 3TR0A 2FEMA 2G88A 1IN8A 1GL6A 1U2RA 4QJ4A 3L8ZA 3ZJYA 2ZI7A 3NBZC 1LS1A 1GWNA 4LJ6A 3A8TA 1G5RA 4A8JA 1SQ5A 2ZRMA 4A0RA 1G17A 1YU9A 2D62A 2XZPA 3I8XA 3T5GA 4EFNA 5DI3A 5JJLA 1OIXA 4LJ7A 4US0R 4RFSA 2IYXA 3LXXA 1S3GA 2KJQA 1N3BA 2QA5A 4LJ9A 5F9FA 1CJKC 1GKUB 1KI8A 2OLJA 2REXB 3KKNA 2W2TA 1KJWA 4DIDA 1R7RA 4DXAA 2Q3HA 4LC1A 2AXNA 3KUDA 3AVTA 1F2UB 1IXZA 2BVNA 1ZIPA 4Q1EA 1AQUA 2ZI5A 1HEIA 1EFCA 2WKPA 1ZD1A 5K8LA 3C14C 5JECA 3Q5DA 2NZ8A 2VH5R 1AZTA 1T5IA 2YOFA 4IDOA 4ABYA 1UDWA 2ZUCA 4BLQA 3U7GA 2ZYVX 2PX0A 2OESA 4Q47A 3ZVLA 3WNCA 3DDCA 1AN0A 5DGXA 4C0HA 4KJZA 3LFUA 1NBMD 4UNPA 3C7KA 2RH5A 1YR7A 3THXB 5J4HA 1XMVA 2V9PA 1Y63A 2WSSD 5KUTA 3HU3A 1M34E 4JKYA 1XWIA 5TMPA 2QBYB 1U9IC 1HT1E 2WMNB 3CWZA 1T3SA 3GJ0A 2JEOA 3NC1C 1FP6A 4QBIA 4E22A 4AK9A 4ZIRA 2EYUA 2FDCA 2FH5B 2B7CA 2JJ1D 3CR7A 3LW7A 4IEIA 2P6UA 4A82A 1FX0B 2ZRLA 4WW0A 5EXTA 3RABA 2RHDA 2FX3A 3BS4A 2GF0A 1P5ZB 2V7QA 1OFTA 4HLUA 1ZNXA 2IYLD 3CH4B 4QNRA 3KQUA 1ONBA 3WHLA 2PEYA 4CYMA 3A1VA 3VHLB 1MT0A 2JLZA 2CCGA 2XXAA 1P2SA 1Q0UA 4B6EA 3PEWA 4TL6A 3I8SA 3B60A 1CRQA 1FPMA 3QG5A 4TMVA 4URYR 4A4DA 4AY2A 4R2HA 1CULC 1JNYA 1GL9B 1VCOA 2DFNA 1QHYA 4US2R 4R98A 2B6HA 3SQWA 3MWYW 3OAAD 2Z0MA 3K0FA 2QP3A 3AH8A 5FTKA 3WYAA 2AR7A 4ARZA 2C04A 3RVBA 2FOLA 1G21E 1VYVA 1D2MA 4M1YA 4QRHA 1HQYE 1IY2A 1GAJA 4TTRA 1JPNA 4DZZA 2Z5FA 4RSGA 2RGNC 4MRSA 1MABB 1GP2A 1Q1EA 2DPXA 2ZJBA 4JJKA 3ZIAA 4QKQA 2VSXA 1KSHA 4DT1B 4F4JA 1HT2E 2ONKA 2WJVA 1NN0A 3D3QA 3LWNA 3KTAA 1XEFA 2FA9A 2QTVB 2VPPA 2W6ID 3K1JA 2IHBA 1IAQA 1PLJA 5H8WA 2GZDA 4CEIB 1XP8A 3MWKA 2J59A 2A5DA 4NTZA 2YOGA 1KO1A 1R8QA 2O8FA 1FOEB 1SZPA 1HY3A 1OKKD 1Z2AA 2W2VA 4TL7A 2KI5A 1N5LA 3Q3JB 1SVWA 1FFHA 5FPHA 3SHWA 2WZQA 4TMZA 5DI9A 2D2EA 2V54A 2XGJA 2VTKA 1XRJA 1RYHA 4PHFA 4DDVA 1WMSA 1MKYA 4LYAA 1Z47A 2ZRKA 5TB5A 3TSWA 2WAYA 4D6PA 2UVQA 1ELOA 3BOSA 3LH5A 1KI6B 2P5SA 4RD6A 1NN5A 1VMAA 4FMCF 1OFUX 4B2PA 1DS6A 1ZYUA 3NWJA 1ETUA 3GJXC 4POAA 3EX7C 4TL8A 1D6JA 5BN4A 2QAGC 3F3YA 2W0SA 1E2QA 1ZNZA 4LZZA 6Q21A 1H8EA 1XZQA 1EK0A 1E0AA 1EXMA 2QE7D 3KFVA 3TR5A 3FKSA 2JATA 1DAMA 3W6NA 1Z3IX 3MMPA 2W6JA 4UJ3A 3JVUA 5FBLB 3VKGA 1COWD 1GOTA 1UFQA 3IPXA 4B33A 2D2FA 3CX8A 2VBCA 3OF5A 3CIOA 3AP2A 3B85A 3D6TB 3CNNA 1JR3D 2O8DA 4YXWD 1L4YA 4ZCLA 4LBZA 5FR1A 4KBFA 2BJVA 3KJGA 1NI3A 3U61B 4DB2A 4XWAA 4JLMA 1KSGA 1TEVA 4Q9JA 3NDBB 1YZUA 4G5SA 4OHXA 1OW3B 4GMXA 3IBYA 2RGEA 1NBME 3B1VA 1I4LD 2EWWA 1OB2A 3EARA 3GLIE 5DI3B 3EC1A 3PVSA 4RFSB 1KI9A 4OJQA 4FI3C 4DB4A 4LX0A 3I92A 2GZHA 3RDPA 521PA 5JI2E 2OFXA 3B13B 4QC2A 5GADl 1TUEA 3F0TA 3MAAC 4CVNA 4LHVA 5DNYB 4LBWA 2CL6X 5ANRB 1JQJC 2I4IA 3ZVRA 4OBEA 1JI0A 2WWWA 1E2NA 4II7A 1LNZA 2W2XA 2C78A 1LY1A 3LY5A 3NBFA 5JCZA 4Q9IA 2DHRA 2J45A 4BECA 1Z83A 4KVGA 2O8CB 1W5SA 2IT1A 5UKDA 4FCWA 3LLUA 2C98A 3ADBA 1XD2A 1FUKA 4JZKA 3PR1A 1Z0KA 5HR5A 4W5WA 3ZVNA 3PQCA 4KYUA 3TW8B 5FPTA 2ZJAA 821PA 1X8LA 2DY1A 4C30A 2GXQA 2OAQ1 3LBHA 1JJ7A 3OEHA 1P2TA 4DUGD 2YINC 2NO1A 4YQFA 2QT0A 3T5DA 3M6AA 5F9HA 5C2JB 1MO4A 4MUAA 2NMVA 1XXHB 1RFLA 4M1OA 2ZJZA 2NO0A 5CDFA 3OFNA 3KQLA 2QAGB 2V3CC 3DHWC 4DLRA 4M1MA 2D7CA 1PLLA 4FMDB 3RS3A 3ND9A 2J5XA 4BZQA 3A37A 2XXAB 1E96A 3EIQA 3QPWA 4A0HA 2IYTA 2R6AA 2AKYA 2ORWA 1CTQA 5G40A 4I4LA 1CR0A 2WJYA 2ODNA 4QBFA 2FU5C 2VF8A 1JB1A 3LA6A 4HZIA 2QMEA 3QI2A 5EUQB 3RS4A 1E9RA 1NKSA 3MJHA 1AS3A 4OQLA 1EFTA 2YVUA 3OEEA 3P26A 3REGA 3BH0A 1PVOA 2PLFA 4JL5A 4D0NA 3DOEA 4L9WA 4UJ5A 2WJIA 4TZ0A 1Z07A 1FNNA 4OI4A 3TSZA 5B64A 3X1DA 4ASUD 1G3RA 2NQ2C 4OI0A 1DO2A 3VR2A 4A2WA 4B6FA 4KXFB 1UKVY 4NCHA 1SKYB 1GFIA 3GEEA 2C9YA 4QHYA 2R8RA 1LF5A 2HCBA 4MYUA 2IUUA 2ZE5A 3UIEA 5JSZB 5BW8A 1GILA 2BDTA 3WNDA 2YYZA 1QHGA 3QEJA 3QVVA 4B47A 1MH1A 5KO2A 1NKTA 2J9RA 4NONA 1SULA 1W36D 2F43A 1UBFA 4IKEA 2O8FB 1G64A 2PMDA 1MO6A 2G9NA 5LPNA 1Z0JA 1XEWX 4Q02A 1SHKA 3W3ZB 3K70C 1TQ4A 1UAAA 1P75A 4JVSB 1R0ZA 4HUQA 4R2IA 3AB3A 1XPOA 1JR3E 5KNCA 2V8OA 1KTVA 3F5FA 2C8VA 1G8YA 1K5GA 4HI0E 3M1IA 1GIAA 2YHSA 3EAQA 4PO1A 3BD9A 4O2LA 4V0ME 5F3WB 3C5CA 3LBIA 3ONWA 5H68A 3KQKA 5FTMA 3T1TA 3AM1A 2WIAA 1Z22A 2GWHA 3VMFA 4Z54A 2XTMA 221PA 4LYJA 4DLTA 3CPJB 1DAIA 3W6PA 1W4CA 3CNLA 3RS0A 4LSGA 4V03A 1P60A 1C1YA 1IN7A 1LV7A 1TU4A 4PHTA 4BRUA 5L3QA 1D9XA 3X2SA 1QHHB 3LAWA 3SEAA 2JLUA 3SU8A 1KK0A 3QJYA 1XU4A 4DVGA 1HE8B 3DM5A 2VP4A 4O25A 2ZQ5A 5HKKA 4LC0A 3FMFA 3TVDA 2KE5A 3LX8A 1G3UA 4N1AA 4D4KA 1ANKA 2ZR9A 1QG2A 4L15A 1G20E 1E98A 1QRAA 2A2ZA 2V4ZA 3LNCA 2GJ9A 4TLAA 3LD9A 4A2PA 4AG5A 3X1XA 3E1SA 1TMKA 1E4YA 1K8RA 3NC0C 4BFWA 1TQ2A 2ATVA 4Q1FA 4TLEA 1E6CA 3H1TA 4MYHA 2V7QD 2WHXA 5KDLA 1MOZA 1ZIOA 4IVPA 3LLMA 3GLFA 3AF1A 2CMKA 3QKRA 1E0JA 5FOSA 3CB4A 3K9GA 3CR8A 2YV5A 4TTPA 4CW7A 2VP6A 3RYTC 1YVDA 3MRSA 1E9FA 3T12A 4TQ9A 3GQBA 3ZH9B 5SZHB 3SDZA 1A7JA 5IHPA 4UKDA 4TLDA 2BWJA 1KAGA 1GSIA 3U2QA 4DLWA 4KODA 1W5TA 4XVQA 3OESA 3FHTA 2J41A 3TJZA 3GJ7A 1FP7A 1P9NA 2FSFA 3CRRA 1NP6A 3HDTA 3TAHA 3OHMA 1KK2A 2JAQA 2QSZA 3NDPA 2ZETA 4WAUA 3SE0A 2QRZA 4ESHA 3K70B 2AD5A 4WA7A 2G83A 2G0NA 4DSOA 4V0LA 4LGMA 2FF7A 2ZRFA 5FTJA 2OM2A 5AUOB 4OQMA 5KOYA 1FNMA 2QQEA 2R6FA 3AUXA 3ZIAD 2QAJA 3WP1B 4ACBA 1EWRA 5C1BA 4PSAA 3Q7QA 5IT5A 1E9EA 4PSKA 1SXJB 4P4UA 2IA5A 3ZD6A 2PZFA 4K81B 1A2BA 1GRRA 1C9KA 3PG5A 3GP8A 5FPYA 2ODWA 4U5XA 5L3RA 1N0VC 2ZEJA 1IN4A 1HA3A 4U00A 3AQ4A 4UXHA 3BH7A 4TYWA 4OQXA 4XH9B 4M0LA 2QGNA 2JDIA 3N70A 2NIPA 1RRFA 4EJSC 3FFAA 4Q18A 4WXPA 1E9BA 1XCPA 4C0SA 1QDEA 2AWNA 3IDQA 4ZDJA 4PX9A 5JHHB 2HF9A 1KO5A 4RD1A 4NCKA 4FCVA 4RY2A 3QNUA 3A4LA 4WZ6A 1JR6A 2J7PA 4PAQA 1NVVQ 4I1UA 1KOFA 3U3KA 1WA5A 4NH0A 3CF0A 5EQTA 2QN6A 3L43A 1S0UA 4P33A 4D81A 1N2CE 4Q9KA 1JALA 4D4MA 3L0PA 1H8ED 3BJIC 1G4UR 4OL0A 1HTWA 4Z1MA 2Q6TA 1NY5A 1XMSA 1E2GA 2ZRPA 3FKSD 4JBYA 2CK3A 2P6RA 2ANBA 4D2IA 5JLJA 2W6JD 4GOXA 4GSYA 5LD2B 4N0DA 1D5CA 4MYCA 1CP2A 4MDEA 3UPUA 4BFTA 4ITRC 3FDIA 4IHQA 3OIUA 4A6XA 1CR2A 2J1LA 2CDNA 4CEHA 4JYBA 2F9LA 4TZ6A 3EZ6A 4QBHA 3KJEA 5FUWA 3R7WB 4B73A 1AKYA 5KDOA 4M1SA 2IK8A 4IW3B 4W5JA 3T1OA 4M1TA 4HUQB 2QPAA 3CUEF 5E7IA 3WYFA 5JMTA 4BLOA 1G5TA 2QUZA 3L2OB 5JJKA 2Q21A 2ZRHA 1WE2A 2ZSBA 4O0MA 4AC9A 1NG9A 1O87A 2C96A 4F38A 1S1MA 1TTTA 2MMGA 4F93B 4HAVA 2IF2A 4TT3A 4A6PA 3UKDA 5F2EA 5KSZA 2G77B 2CHVA 1R0YA 2ZR0A 1ZP6A 2GA8A 4AKEA 3NH9A 1ZMXA 3RLFA 1DPFA 1DO0A 3JZAA 5AJXA 1MABA 1MRSA 3L0OA 5A5GA 5SZJA 3HU1A 3NKVA 3UMRA 4DCUA 2IYQA 4OI2A 4DT1A 5ELXA 3IEVA 2WOOA 2YWHA 3BBPA 2BMDA 2ZIAA 4RD4A 2EU8A 2ZSDA 5GJCA 1IBRA 3Q9LA 5JI3E 1WF3A 1A4RA 2ZRGA 4ZV4A 2HXYA 1KZGB 4JLOA 4LYFA 3F8TA 4NHOA 1P2UA 4Q48A 4QL3A 3A1TA 3LX5A 5J4YA 1GM5A 1ZC4A 4MGKR 3OIYA 3QOFA 4JLKA 2ZE6A 2IWRA 2ZUDA 3BWDD 2OXCA 4M53A 1SHZA 3CF6R 3OEHD 1KHTA 1OSNA 4JLBA 3UK6A 3AUYA 3T61A 2L0XA 5E7MA 1RRCA 1W4AA 3I4LA 4MITA 4NPHA 2P6NA 1J99A 2FSHA 4QGAA 2GVZC 4MKGA 4B43A 4LI0A 4G5RA 3OFND 4Q21A 2BOVA 4FMDF 4RVCA 2R6GA 3EZ2A 1P72A 4G3XA 2BC9A 1SVIA 3UG7A 3EPJA 3IGFA 2IS1A 1U9IA 4EPRA 4CZ2A 2IYRA 1YZNA 4E09A 1XF9A 1IQPA 1P4SA 3J81k 4P4TA 5DE3A 4B32A 3T1VA 1CIPA 2WICA 1TUIA 2O0JA 5J4KA 1WQ1R 4MQBA 2IWHA 1ZD8A 2WOJA 1P73A 3OEED 1GKYA 1W44A 4HATA 3K9LA 2V1XA 3T34A 1R10A 1NVWQ 4PC3A 2GJSA 1BMFA 2I1VB 2VHTA 2X1VA 3GJ4A 5CB8A 3NTUA 3O47A 1UDXA 4S35A 4EFMA 3IQXA 1NY6A 3LVQE 3PUWA 1RYFA 4JSYA 3RS7A 3ZS8A 1TPZA 3WMGA 4DDWA 1UADA 2ZSFA 1YQTA 4FCTA 2OCBA 3A36A 1XTRA 3KKMA 1NF3A 5FOUA 2ASEA 1MO3A 4EPVA 5AK0A 5A4JA 2XB4A 3BK7A 4DLZA 3TUIC 1FMJA 4HDCA 2OE2A 1OIWA 1P9WA 1W47A 2ZRDA 3B1WA 2F1RA 1OH7A 2AWOA 3K9HA 1TNDA 4I1SA 5DSZA 1XTKA 2QGZA 4OQFA 2RGNA 1CJVC 1G3QA 4B3FX 3SYNA 2QL6A 3AVPA 4Q00A 5AWFC 5CM8B 2RMKA 3UG6A 3K09C 3R8CA 4CIDA 1ODFA 3B8HA 4G01B 2F1IA 3VR1A 3KKPA 3THYB 4NU0A 5LB4A 2N42A 3HR8A 5JS8A 2NTYC 1KI3A 2O8CA 5FOTA 1ZM7A 2DFKB 1FQJA 2A7QA 2AHOA 1VCMA 2GJ8A 3K0EA 3N2IA 1N5KA 4JIMA 1AA9A 4LV5B 3PV0A 3CH5A 3GEHA 4IVRA 4PQYA 2R44A 4LK2A 1W0JA 1UEJA 2FV8A 3HPRA 5GJVC 3WHKA 1HV8A 2D06A 3TLXA 2QU8A 3UATA 4OQNA 3GLGB 3IBGA 5CYOA 4M1KA 3ASYA 1J8MF 3P4XA 1XX6A 2GEUA 2PZGA 4ZO4A 3NXSA 1US8B 1MV5A 1NVVR 5FPSA 4BEJA 4NKRA 4DSUA 1OYYA 4X8HA 3AKEA 5DHFA 5EP2A 1XXHA 2MSDB 4M22A 4M9ZA 4Q01A 2HT6A 2REBA 2ZREA 3K0SA 4CEHB 1KY3A 1KY2A 2QAGA 1RJ9B 4PHGA 4XSGA 3RRYA 3W8RA 2VSOA 2Z6VA 4DKXA 4URVR 5BN3A 2QMUA 2JA1A 3LO5A 5HKKD 5DLQC 4XTCS 2ZPTX 2D7DA 2QI9C 2N1BA 2QRNA 4TMTA 3DKVA 1J90A 3NVAA 5K8UA 5AR1A 1GRNA 4B3GA 1OH8A 2EYQA 2O0KA 4B2IA 2NG1A 1JEDA 1AJEA 1TADA 1T5LA 4MUBA 5HE8A 3U3OA 4Q4LA 5AJVB 2E87A 1GZSA 1JXOA 2EW1A 3GFOA 2BBWA 3B1YA 3O8BA 1W36C 3P27A 3CPEA 1KI1A 5BN5A 3WBKA 2AXPA 4FIDA 5TY0A 4TYPA 4IRUB 2XSZA 4GL2A 2C9CA 5HPYB 3HR7A 3PUXA 1E79A 4Y0VA 2Y8EA 3CNOA 4NDZA 1L4UA 1G5PA 3B78A 2CEAA 4A8JC 2WJJA 4ZDWA 4M8NE 1IJEA 4TMXA 5JSZA 1D9ZA 1FW6A 1U94A 3IHLA 3R20A 4UXIA 3ZDQA 3DPUA 4BLRA 2RGDA 4KBGA 5JRZA 1P62B 1PZNA 3OIVA 3UWOA 4S2EA 2Q9CA 5CLQA 2VHUA 2NGRA 2REOA 3SC3A 3CW2A 1VIAA 1M6NA 2FEOA 3MWJA 3OIWA 4DLUA 4V0NA 3EZFA 2GCNA 4Q4JB 3U3RA 3WRYC 2ZXUA 3L8YA 3X1YA 1XJCA 2RCNA 4TN1A 5C18A 2GBLC 1YR6A 2GJKA 2H17A 4XJXA 1VYUA 2FZLA 5E95A 4YMVA 3V00A 2PX3A 1XPRA 4W7SA 4A15A 2UZIR 1TU3A 2ZVQX 4GDFA 5TVKA 1DG1G 2QT1A 4LBVA 3U6BA 1XPUA 3I62A 2IYYA 4BASA 1G19A 3OE7A 3CF2A 2ZVPX 3BE4A 4A92A 5JBQA 1N5IA 1V5WA 1E0KA 3A1SA 3KKQA 3EA5A 5IDVA 2FNAA 1KK3A 2QEQA 2IBMA 1G4AE 3RAPR 3VKHA 2IXFA 2H1LA 3WNBA 2XB2A 2ATXA 3W6OA 4BFYA 4DEXA 2JDID 1N0WA 3AEZA 1U8AA 4OK3A 5JRJA 3ADDA 3Q5EA 2J0SA 4HAUA 3BFKA 2XAUA 1H8HD 4MH0R 2NO7A 4QBGB 4J0QA 3LW8A 4RZXA 2HLDD 2GXUA 4DJTA 4MA4A 1I4DD 1QHHA 2OCYC 2GETA 3SQXA 1RE0A 4WVFA 5EE0A 4PPQA 2JJ2A 2RGAA 3FWYA 1VG8A 2ZSAA 1LF0A 1Z06A 3B6EA 4Z1MD 2DB3A 2YOHA 4B71A 3EG5A 2CK3D 2C77A 1XD8A 3ZZUA 4XVUA 2ZRJA 1DOAA 1K6MA 2R6CA 2ZITA 4OKSA 5A0FA 2NO6A 2WKRA 4C0QC 5JCPA 1UM8A 3ETLA 3EC2A 4MRVA 1XTJA 2PEZA 3PUZA 1ZUIA 1Z6GA 1NMXA 2FWRA 5FOWA 3EASA 3GLHE 4HB2A 1Z2CA 4NYMQ 4EIWA 4Q1CA 4RKFA 2GVDC 2C95A 4GP7A 5C4MA 4OHZA 5HE9A 1E99A 4DCSA 1M74A 5FUVA 2PZEA 4ERNA 2MSEB 1ZW6A 2H5EA 1YKSA 4KFSA 3B7GA 5B57C 4JL8A 2AFIE 3E70C 1ZCAA 2V55B 2WV9A 4LDJA 3UANA 2OAP1 4B34A 4AYTA 5JS7A 1N6NA 1M7GA 3KXIA 1MR3F 2ZU6A 2OEPA 5G3ZA 2ZUBA 4TT3D 2IHYA 1OYWA 2LKCA 3VAAA 5BYKA 2ZANA 4HZUB 4KFUA 1NLZA 2CL7X 2X2FA 1X1RA 4DBLC 1E1RA 1KKLA 5IK2A 3SJCA 5CITA 4P31A 2WIBA 4PSVA 3M4YA 4V0OA 4C2UA 4AWXA 4LHYA 3KFXA 2MMCA 3KB2A 2B92A 4C0LA 4GZMA 5L3SA 5EE1A 4F91B 4UXJA 1AGPA 1KAOA 1RKBA 5EZ5A 1SXJA 3KDSE 1BYUA 1ESMA 4IJMA 4D25A 2IYWA 5DYGA 4V0KA 1YR8A 2CHQA 1E2DA 3SZRA 2XOKA 4JKIA 3RWMB 3AVYA 2SHKA 1C4OA 1YZLA 5DHAA 1OE0A 4K8OA 3UMFA 4HAZA 2GESA 5KSPA 4C9BA 1X6VA 4PAMA 1DTSA 3AVXA 4U02A 2GK7A 2H16A 1KK1A 3ADKA 3AF3A 4RD0A 4BPBA 1IM2A 4G5GA 4HYYA 4YMUA 2JLSA 2YWGA 3TQFA 5C46F 5B30A 3CBQA 4F92B 4L16A 1CS4C 4PANA 5FUXA 1G3IA 1FMLA 1RRGA 1XZPA 2P5TB 3JVVA 2YC4C 3QXHA 4U7DA 4X8LA 4OK5A 1DAEA 3LRPA 3LBNA 5EXPA 5BWMA 3VR3A 1UBGA 2KSQA 2FMXA 3NHAA 2NPIA 2Q9AA 4GFDA 3B2EA 4AI6A 2PT7A 5KDDA 3IUYA 1VHLA 4Q7JB 2H92A 4DSTA 2Q3FA 2ZU0C 3T35A 2GHIA 4D26A 1ZBDA 1G7RA 1I2DA 1DAFA 2BHRA 1YZQA 1RIFA 2ODEA 2FFQA 2QMOA 1TF2A 1E9SA 2FPMA 2VEDA 1U99A 3CO5A 4Z8YA 3VKWA 2ZR7A 5CK4A 5E7JA 5G53C 1VECA 1NG1A 2GDJA 1SVOA 5EJEA 1EFHA 1BMFD 1EFRA 1JECA 1NMZA 3HYRA 4UNSA 4ACAA 1J7KA 1NLYA 1XTIA 3R7WA 4H9GA 4Q7KA 2JIZA 2BKUA 2W0MA 2Z4SA 1NL3A 3AF4A 4NYIQ 4PHHA 5FBRB 5JWOA 4R9UC 4LV6A 4CF7A 1Q57A 1AK2A 4GP6A 3EXAA 2BEJA 5TXGA 3QSYA 1WP9A 2F1JA 4BLTA 4Q19A 1EGAA 1E3MA 4IDQA 2ZYUX 2OXRA 4YMTA 3ZYCA 1Q44A 1U0LA 4TWZA 3VNUA 1KJZA 2O52A 4Q4HB 4B3XA 1RVDA 4BEBA 4PO8A 5JWHA 1SVSA 5HZHA 3WMFA 2CVHA 3FYHA 3SJBA 3NIBA 1Q1ZA 4IOKA 3RANA 5K8TA 1R2QA 3P1JA 4Q5IA 4P4SB 2A5JA 2PJRA 3B1XA 4B3DA 4M4SA 2GXSA 3VX3A 4PC1A 2YJTD 4DDTA 3QBVA 2GRJA 4QNMA 1P3JA 4Q1BA 4XD7A 4P32A 4PZZA 4NCIA 4H1UA 5AJYA 5FH9A 1QHIA 3B5JA 4E5UA 2V6IA 4A0GA 3GJ3A 1JBKA 4QGGA 2IYVA 4C4PA 3DZDA 3TGPA 5P21A 1BIFA 5KU1A 2OO7A 1CRPA 2IUTA 1G1MA 3B9QA 1W0JD 2TMKA 4B3CA 2QROA 1CR1A 1VTKA 2ZM5A 1I2MA 2G1KA 1X1SA 1G9XA 3GFTA 1QZXA 1S4QA 4M21A 2ZJOA 5BYJA 4EKDA 1FZQA 2PL3A 2VF7A 3GJ8A 2VP5A 2BM1A 1E2LA 2F7SA 4YMWA 2FPLA 4CT5A 3SOPA 3LQQA 4B35A 1DARA 4TYQA 3DMNA 3IEUA 1XEWY 1HUQA 1F60A 3UXMA 1XD9A 1E1QA 2GTPA 4IDHA 5FOXA 2X8AA 3IILA 4YDSA 2YNMA 1W2HA 1XTQA 721PA 3QY0A 4QJ3A 3IQWA 1FTNA 1LFDB 3EIEA 1W0KA 3NHBA 1NSTA 1EFUA 1R5BA 4UNQA 2XJ4A 2R6DA 1KMQA 3VHXA 3MCAA 4B76A 3T06B 2R9VA 1OT3A 2XX3A 4LPKA 1VG1A 1PUIA 4NYMR 2HEIA 3IPYA 1T4GA 1Y3AA 2IXEA 4IOLA 3VR4A 1LS6A 2XSZD 1M7BA 2J3EA 1ZM3A 1OHHA 1NRJB 2AKAB 3Q7PA 4KLZA 1E2HA 1E79D 4YMSA 4TSFA 4XWKA 2YKGA 2ORVA 4JVLA 4XVRA 5CM9C 3PCRB 5L3SB 3BXZA 4GNKA 5FL3A 1TEXA 2RGBA 3QKSA 1OV4A 2BJWA 2R62A 1L7VC 1JPJA 4IOMA 5EP3A 3IIMA 1T0HB 4B48A 3BB4A 4L5BA 1CBUA 1RW4A 5JZVA 2NPFA 1RPZA 4C0BA 1Z0DA 1LTQA 2YC2C 5TV2A 3HPQA 3PENA 2UKDA 1A2KC 2ZI4A 3U3JA 4NCJA 5DN6A 3BAFA 3FB4A 4EPXA 2CCJA 4URXR 3AP3A 4DEYA 3DM9B 3QG1A 4BZPA 3THYA 2PBRA 1R5OA 1UJ2A 1PV4A 1DG3A 5E4FA 5D3QA 3SNHA 1DE0A 4MDFA 1S9DA 4HAYA 2ANCA 3VFDA 1R8SA 2OSBA 3OE7D 3ZQJA 1AZSC 1DADA 1T91A 3KL4A 3QE0A 3UWKA 3TAUA 5KNDA 3PJRA 2DYKA 2EFDB 2BBTA 4G5OA 2CL0X 1NIJA 2CJWB 3A4NA 3PIRA 4QFMA 3BC1A 4RZ2A 1NIPA 2IS6A 2HCJB 4PO9A 2ZAMA 3GLGA 1T3HA 4D80A 2XNSA 3L0IB 2OT3B 4TYYA 1IY0A 4QGHA 1US8A 3L0SA 1NLFA 5TDHA 3I73A 2WWHA 1OJLA 1N5JA 4AIIA 4PZLA 4QOSA 5DO9A 1JR3A 3KJIA 1YZGA 1Z5ZA 3BIFA 1VPLA 1X86B 4HB0A 3TSOA 4D4LA 1RJ9A 2QPOA 1YRBA 3E2IA 4YDHB 1KI7A 1GG2A 5FTLA 1XFAA 3PITA 3QIAA 2IF0A 2QTHA 4AD8A 4XSHA 2RGXA 3QKTA 1M7HA 4NE2A 4V0MA 1VCIA 3RHFA 4NYJQ 3P20A 2J0UB 1KSJA 4MGZR 3RRZA 4JMPA 2R2AA 4TQUS 2GCOB 3KQHA 2CE7A 2KBFA 5EE5B 3QF7A 4KCGA 3P4YA 1ZU5A 2W58A 2P2LA 4NYIR 4BZXA 3O8RA 3EWSA 3MD0A 1Q22A 1X3SA 1P9RA 3LXRA 4JL6A 5HTKA 4GRAA 4JLVA 4PXAA 4EQ6A 3THOA 1XXHE 3DVLA 1QHXA 3I32A 3PUVA 1BS1A 5DH9A 2X77A 2DFTA 3CRW1 4BLSA 2GKSA 3W5IA 5EE3A 3WY9A 2VHJA 2ZJYA 1TAGA 3A4MA 1II0A 3KXKA 4CGZA 2VP0A 3AV0B 1CU1A 1E9CA 3GLIB 3EWAA 3D7MA 1E1RD 3MJRA 5IK2D 2QENA 3K70D 1NN3A 3IKJA 4Q4JA 2ZYTX 4JLPA 1JEEA 1KI4A 2MSCB 3TW4A 4HSEA 1WRBA 2WBLC 3K09A 4EJSB 3GLHB 1EG7A 4LHWA 1NNEA 1GNQA 2OLKA 4LCBA 1GVNB 2BBOA 2A5YB 1DVRA 1Z6YA 1SXJD 2O8EA 1VIYA 3AGPA 1GITA 3D8BA 3CONA 2WWGA 3LVRE 3TUJC 1DAKA 3LQRA 4LHXA 1B0UA 5AUNB 3ICQB 4KSBA 2H7VA 2ORIA 2XOKD 1Z6TA 2PCJA 1VKJA 2WJHA 2J87A 4HLQB 1DAGA 2QM7A 2CVFA 3DOFA 4AKGA 3AVVA 2JLWA 5CK5A 3ZQ6A 1L8QA 3K0CC 3SR0A 2HYIC 1KNXA 3ZGXA 2XTZA 1Q1QA 3NG1A 2HV8A 3CRMA 3EW9A 3T15A 3WYGA 3K0AB 2WWFA 1DAHA 2CE2X 2FE4A 1AIPA 1WCV1 1DELA 3CM0A 4MKFA 4A36A 2KWIA 4JJZA 1IN5A 1CF4A 3SS8A 3CKLA 3W9YA 1Q20A 5H70A 3B1ZA 1ZVQA 2JLQA 3W3AA 4ESVA 2G6BA 2YWFA 4DCTA 1SVKA 5KYKA 2B8TA 2EFEB 5DYIA 3TUZC 3AVWA 4EFLA 4BFXA 3RRMA 2F3RA 2GK6A 5FTNA 3PEVA 1F6BA 2P0EA 1CXZA 4RKEA 3U4QB 3TKLA 3EPHA 4C7OB 2ZI6A 3WBJA 3U7FB 5DISB 2RGCA 1UEIA 3QF4B 3QKSB 5F98A 4WXRA 2N46A 1T3LA 1XJ0A 2ERYA 1E2JA 3THWB 4I1VA 621PA 5KSOA 2HUPA 4PAOA 1EFRD 5FI0B 1GTVA 2C5LA 1M1YE 1RRPA 2QPTA 2ZRCA 2Z83A 2JIZD 3AP1A 4NZYA 2QNRA 2JJ8A 5CB6A 3FKQA 5IRCD 2IW3A 3FOZA 2FFHA 1IHUA 2YZ2A 4DSNA 2CLDX 2NOAA 3MFYA 1WB9A 3SI7A 4JLAA 2QP9X 2ZRNA 3GD7A 1YR9A 4HZUA 4LYHA 4DRZA 4H1VA 4MRNA 4E03A 3EPKA 2ZJ2A 1XB2A 1F2TA 1M8PA 1UBCA 3LDAA 3Q85A 2CCKA 2I3BA 2J7KA 5G41A 2OBNA 2GBLA 4WZBE 1IXRC 2IXGA 2OFWA 2V6JA 1YJ5A 2FGJA 1U0HC 4XD7D 2F55A 2ZI9A 1XMIA 4DCNA 1W2GA 3QXCA 1KGDA 4W9MC 1Z28A 3X1ZA 2WM9B 2G0TA 5B58C 1S1CA 1E69A 5KHOC 1HYQA 1N6LA 4GT1A 2GEVA 1II9A 2DR3A 2XNDA 4IDNA 4EPWA 3FMOB 1G6HA 3GCGA 3C8UA 2VIIA 3VX4A 1ZD9A 3RSLA 1G18A 2HYDA 2Z4RA 2AD1A 1J2JA 4LJYA 4A2QA 3CPHA 4GI7A 3QQ5A 2A9KA 4ILEA 5EP4A 2VHQA 4JLDA 1L2TA 1QG4A 1W49A 4YONB 4MGIR 5GJWC 4M9SA 5B2ZA 4OI1A 2DWQA 2EWVA 2X19A 5LDDC 1XEXB 5FL7A 1DEKA 4TL9A 2HDNB 3AVUA 3T1QA 5C4GB 3U7HB 4LBYA 2AN9A 3AVOA 3K9NA 3QBTA 4O2RA 1KO4A 1QHNA 1KYIA 5AJWA 3W34A 1E2EA 1KDTA 1E1QD 3S1AB 5J5CA 4BQSA 2IYSA 2CNWA 3G82C 3CLVA 4HLDA 2VYFA 3RRNA 1SXJE 1ZNWA 1KDPA 1Z63A 4EQ6B 1D2EA 2LWIA 3AVQA 1KO7A 4PPFA 4NYJR 1W0KD 2VP2A 4JLNA 5AJZA 5J4VA 2JLYA 1VG0B 1SGWA 1VHTA 2WSMA 4LV8B 3EZ7A 1GUAA 5CDFE 2VQSA 3U7EB 1G8HA 4TTQA 4OYHA 1XCGB 1KI2A 1ZAKA 2ZJ5A 1E94E 3U44B 4FMBB 4QHTA 5EXSA 2IYUA 4JT4A 2IEZA 4IFBA 1YRAA 2WPDA 3CRVA 1QHSA 3QXSA 1Z6AA 4GMDA 4PC2A 2FN4A 1OLOA 3HP1A 5JJIA 2PCLA 5TARA 1T8TA 4KU4A 2QM8A 1FQKA 4E07A 2VO1A 4M9XA 1OHHD 1P2VA 5D3MA 1CR4A 2JASA 2P3SA 4LHZA 1P61B 2KBEA 4RD2A 4BFVA 4ZCMA 4LUCA 4TSFD 3H0KA 3AF0A 5JWRA 1N6HA 1R0WA 1ZRHA 3PFIA 4XOIA 4PZYA 5L3VA 2O8EB 1II8B 2JLRA 2ZYWX 1MO5A 3TVTA 1NMYA 5JFGA 2H8KA 3R9WA 4Q4HA 4TQAA 4GPTA 2EFGA 4WZAE 2VLIA 3SFVA 3TQCA 2J0QA 3MUFA 4P4SA 1E2PA 1E9DA 2EQBA 2V1UA 4FW9A 5DN6D 5HZKA 1BKDR 1FTSA 1IXSB 5J4LA 1KMHA 2OUKA 3CRQA 3HJNA 3PEUA 3QENA 1NSFA 3L82B 3KX2A 1X8JA 4Q9LA 4X8MA 1G8GA 2BBSA 4LPSA 5CJ2A 4A1FA 1IJFA 1CKEA 4V02A 3H84A 2VSFA 3EIHA 3W5JA 2QP4A 2QORA 4DCVA 2J7PD 4IXNA 5CYPA 1X8KA 5EE9A 4Q4AB 2PMKA 4N0EA 4PC6A 1Z6XA 2RKOA 4IDPA 4HLUC 2B7BA 4LJ5A 4KITB 1OH6A 1NJGA 2GZAA 1U0JA 2C9OA 2VHCA 5HCIA 3RS5A 3M0EA 2QQ0A 4OJKA 4B75A 5E3HA 1SVMA 3ZZTA 1Q1BA 3K8YA 3HWSA 2XITA 1LB1B 1P7CA 2ODBA 2UZ3A 2WWXA 4JYCA 4XTRA 5AUQA 4Q1AA 1RZ3A 4WBSA 4Y0AA 1N6KA 4JSTA 4B44A 2ONJA 1XCMA 1E0SA 4M9QA 4CT4B 3KZ1E 2Z43A 3ZLJA 1OFHA 1XBTA 4ZI3A 1W36B 4L4UA 2X2EA 4LJAA 4Z51A 1KSFX 3BRWD 1S3SA 4PC7A 1KKMA 3C15C 3AKYA 3DEFA 4QJ5A 1AS2A 2I1QA 1Q3HA 4YLGA 2VA8A 5EZ6B 4JT2A 5BQ5A 4D0GA 1F48A 5M04A 1JQLB 1TL7C 3AGQA 1T0JB 2AFHE 1VCNA 4A8JB 2HXSA 4N3NA 3IO3A 1MRNA 4RJLA 1OH5A 4HDOB 2QSYA 4L9SA 1KO8A 4AYXA 1NN1A 1UBEA 4DLVA 2IC5A 1WBBA 3KQNA 2BKEA 4EUNA 3VTKA 1KJYA 2J0VA 1QVAA 4A0FA 1OFIA 4RZUA 1OPXA 3FVQA 4NP6A 3U3MA 2GXAA 4DDUA 4B2LA 1XNJA 4BLPA 5HCNA 1AGRA 1OXUA 1F2TB 4DLYA 2Q0HA 2D74A 3BB3A 2PT5A 4KVAA 2IUSA 4KAXA 4KV9A 4OK6A 3DL0A 2OCPA 1SVLA 2FZ4A 1G6OA 4X8OA 2ZROA 3QVUA 2WVJA 2ZSEA 3GLFE 1LW7A 4C0JA 1N6OA 3B9PA 4RZ3A 2BM0A 3K53A 2WJGA 1W7AA 3H86A 4FXPA 4UNNA 3Q8XB 2OHFA 5K8IA 1E9AA 3WMEA 3I3SR 4GZLA 3FMPB 3G5UA 3R9IA 1N6IA 3W8NA 5CJPA 1HH4A 3FHOA 2OFOA 4LJ8A 1W48A 3CZQA 3R8FA 4AKHA 3V4RA 2ZE8A 1GNRA 4ZIRB 2LKDA 2PJZA 3DZ8A 4B74A 1UKEA 5AUPB 121PA 4GOKA 2F1HA 3GFPA 4RCZA 2NZJA 3DKPA 1ZC3A 1J8YF 1N25A 1P6XA 1GNPA 1CJUC 2HF8A 4KYIB 3BFVA 1PJRA 1T9HA 3VU9A 2IX3A 4ZKEA 4FWTA 1OXXK 3W90A 1FL9A 3EZ9A 5CIWA 2CJWA 2EVWX 5FUYA 4OHVA 2A3RA 3TK1A 2OG2A 1G7TA 4BFZA 2CLSA 4I81A 4HB4A 1O3YA 1KIMA 3SJAA 4AYWA 2JLXA 1QVRA 4PPNA 3RC8A 4QHSA 4OHYA 3K0FB 3REFA 4ARZB 2O8BA 4L8GA 1UPTA 4Q7MB 3FPAA 1OXSC 1T8UA 1SKQA 1KZ7B 3CZPA 4BFUA 4DIEA 4R71A 3ADCA 3OZXA 3NBYC 3KJHA 1BYIA 5D3MB 4Z8XA 2C03A 4A9AA 5FFMA 1N6PA 1Z0IA 2G1JA 4URZR 4F4IA 1DBSA 3IHWA 1JAHA 2VP9A 2ZE7A 1OB5A 4C3ZA 1G8PA 4UQOA 2OBMA 1V43A 2J0UA 4TMKA 2W00A 3KTAB 3TNFA 3ICEA 4K46A 3SJZA 2FGKA 4FN5A 1JAIA 2GCOA 3GLGE 1UKZA 3O8CA 3U5ZB 1EESA 3WP0A 3WXMA 1TX4B 2DFLA 4ZCIA 1Z08A 2A5FA 2IS2A 3Q72A 2D4HA 3H4MA 1XDBA 1LVGA 2P67A 2BMFA 1YE8A 3GEIA 1ZM9A 421PA 2LCFA 1UKYA 1WXQA 3QXJA 2FSGA 4BE7B 4F7WA 2BV3A 5KSYA 2ERXA 1KMHB 3V9PA 4D0LB 1CEEA 2W83A 3WRXC 2GF9A 3I1FA 1AS0A 3FTQA 4RCYA 2ZRIA 1NJFA 1SXJC 4AURA 2HJVA 3E5HA 3QKUA 3LV8A 5G3YA 3SYLA 1ZJ6A 2WTUA 1ZM2A 4EDHA 1I4TD 2WAXA 3IIJA 1NBMA 2XJ9A 4OHWA 4BRWA 1CJTC 1ESNA 3B82A 3GLIA 3PUYA 3AF2A 3FFBA 1Q12A 1VYTA 2PLRA 4FD2A 2WSSA 1TF7A 2GILA 1XJQA 4US1R 2BCGY 2JGNA 4NCNA 4PR0A 3NBXX 4EJSA 3GLHA 3JZMA 4HDQB 1NVXQ 4G5QA 2JJ1A 1W4BA 2E9SA 1U98A 2BCJQ 2BIFA 2ZAOA 3FE2A 4CEJA 3SBDA 1R5NA 5DIFA 3TRFA 4KFRA 2KB0A 2XNDD 2O8DB 4MRPA 2DWPA 1GL7A 4KHZA 1W1WA 3GJ5A 4G1UC 3DMDA 3RSOA 1R6BX 4D4JA 4R7ZA 1GKIA 1GDDA 1Z8FA 4JLJA 4PPGA 5EUMA 2GEDA 2VRWA 2O5VA 3FMIA 1KDOA 2ZS7A 4P0TA 4KFTA 1TF5A 4I99A 5GVRA 2G3YA 3KB1A 5FL7D 2ZS9A 2AX4A 5FBQB 5LD2C 2GCPA 3K0AA 5JHGB 3I61A 5IF9A 2FFBA 3RS2A 3MG9A 3OAAA 3NEJA 5EXXA 2VL7A 1JXMA 4HUTA 2F6RA 1IY1A 4LY6A 2EFCB 1VDZA 2WMOB 4M1WA 1H65A 2CNWD 3NEYA 1W4RA 4B3BA 1A1VA 2IL1A 1BH2A 4BFSA 2OBLA 4AKIA 2FJUA 2XEXA 3BH6A 1CLUA 4Q66C 4D82A 4AG6A 3TE6A 1U81A 4LWZA 4URWR 2H18A 1BO6A 2Q9BA 1EWQA 5SZKB 1E2MA 4W5HA 3U4QA 2HT1A 4C7OA 3A1UA 4Q03A 3ASZA 4KO8A 3U6KA 1Q21A 2W6IA 1HQCA 4IFEA 3QF4A 4MYTA 2ZRBA 2WPDD 4HAXA 1Z0FA 3SYKA 1ZM4A 1JJVA 1XD2B 2OZEA 4NBSA 3X1WA 2XZLA 3CWQA 1D2NA 3A58B 4MGYR 3G0HA 3THWA 4FINA 4ZPXA 4KLNA 2A30A 4DLXA 4HAWA 4UNRA 1OKKA 4QM7A 4RD3A 2QY9A 1A5TA 4EAQA 4ZDKA 5FPKA 1R4AA 3VR5A 4NMMA 2IS4A 4HLCA 4TYNA 1ZNYA 3EPLA 2BEKA 1U8ZA 5FI1B 1T6NA 5J47A 2ECKA 3VNVA 1YZKA 4DHEA 2P65A 3BERA 1N0UA 1M2OB 1KNQA 4Q9HA 2RB4A 3P32A 4NL4H 4DLSA 3VU9B 1BOFA 2AK3A 4FMCB 4URUR 3SFZA 4BGDA 2WWYA 3ZD7A 1G3MA 2B8WA 2R65A 3RWOA 5KTYA 5FOVA 1F2UA 3FGNA 1TQDA 1D8TA 1EX6A 5H1YA 2ZTSA 2QE7A 2JLVA 3A1WA 5GVSA 1GRQA 8OHMA 1J70A 3TIFA 3QEOA 1CJMA 4LOAA 1YZTA 1PLKA
chains in the Genus database with same CATH superfamily
2CSUA 3BJZA 1H8HA 2C7BA 3CYFA 5M7EA 1A8IA 3OIFA 3OOJA 4FC7A 4FYYA 4TPKA 1E32A 4BN4A 3H2ZA 1M1NA 3KXLA 5CFMA 2PH7A 4ON9A 1UOPA 1Z0AA 3HEBA 2WIGA 1IOVA 4PXSA 1G7SA 3SYTA 4MX8A 3FDZA 5JSQA 4P5PA 2XIJA 4L5AA 2AEEA 4DA6A 2QZ9A 2EL9A 5CH5A 5DP2A 4YXWA 2XWBF 4R1UA 5LCXA 2F3SA 2JJ2D 3FRIA 4HXYA 2JCSA 3THXA 1G16A 4EYOA 2O9JA 4KI0A 3A31A 5GONB 3BORA 3PFWO 1SBHA 3SHFA 3V3TA 3UGJA 2QLFA 3I39X 3NORA 3TPCA 1X9IA 2G9QA 3OBIA 1NUQA 4MLCA 4DTIA 1O1YA 4J1TA 4BUJA 4MA5A 3UMYA 1B6SA 4R2JA 1X38A 3TMKA 1UK8A 2A78A 1YNSA 2BEWB 2H1IA 1XEXA 4QM6A 1CERA 1OXTA 1NF2A 2UYOA 1MAVA 3NHKA 3ME5A 3OQ1A 3Q11A 1JDTA 4ZP1A 3SR4A 1MQ9A 3NRCA 4M87A 2WF5A 4PFSA 1QP7A 2F43B 3A6PC 2YASA 3UAYA 3ZE9A 3EG9A 1DXQA 4JAVC 1BC5A 1UQTA 1T2AA 4R41A 2WLSA 3EJ6A 3D2CA 4QAQA 4MW7A 3GRYA 5DRYA 1E62A 3KOUA 4QGFA 4QG7A 5L8VA 3QPBA 2J4FA 1OF1A 2AZDA 3KUCA 3FZQA 1E1YA 1JFVA 1KP2A 3QVLA 4FOOA 4M46A 2WWIA 3IO5A 1Y7HA 2L18A 3SCZA 5H4GA 4ERXA 5KPDA 3RYCB 3HP7A 3E8SA 4C4OA 5ITZA 1XTSA 3BFJA 4P3NA 5LA6F 4ZKDA 3DLBA 3RUAA 2C0CA 2XUQA 4BTVA 4DV1B 2Q29A 1AQ6A 2XQKA 2YXPX 2J3MA 2DWOA 2YIJA 1LDYA 4CG1A 2Q6LA 3AKCA 4JBXA 1U2EA 1OTHA 2TS1A 2NU8B 4GNRA 1X7DA 4YRSA 3MSXA 3JQGA 3PLAE 3H2YA 4N03A 2ARKA 4YUAA 5AICA 1Z26A 3A70A 2GNOA 4DEVA 1JJBA 2D3WA 3R0QA 4W7HA 1DTWA 1E7SA 1UXIA 2NTNA 3AHIA 3H0EA 4NPCA 5JCXA 3C41J 3DBRB 4B3SB 1WIWA 1CUFA 4YJDA 4HB3A 1OBOA 3OIGA 2HSEA 3AQIA 4KR6A 2FDRA 3L7OA 3ZQ4A 1E2KA 3GZ4A 2JBHA 4U7TB 3WL7A 4KMOA 4HNUA 2XZOA 2IEAA 2B30A 2O5RA 4CL0A 3GAAA 2XUOA 3ITKA 1OWLA 4NPAA 1ZU4A 3SM9A 2HBRA 1C3OB 4WADA 3I2GA 4U7HA 3AEYA 5DWVA 3MERA 4KPYA 2QNBA 2GBIA 4G0WA 3QELA 3DOCA 5JPDA 3SSNA 4LQDA 1CZKA 5EMNA 4CRWB 1JR2A 2Q1XA 1AQYA 1XZBA 1YDGA 2XCLA 1Q92A 3RIHA 3LUPA 4NVRA 3CEHA 4QJIA 4GC5A 3N5CA 4UW9A 4D42A 1VMDA 2XQVA 3NH6A 1GCIA 5C7IO 3PUJA 1IIRA 1RPAA 3H8WA 3N8IA 3KR9A 2CXXA 4F4CA 1EP1B 3MGCA 3FPEA 2OV2A 1PL8A 3BB1A 4MKIA 1T0UA 2I7TA 3DC7A 4JP1A 1IB6A 1ZA2A 3LP6A 5LQAA 4QFCA 1ZUHA 1VLMA 4G0VA 4YRRA 2FRDA 2AMFA 1V4VA 4QTZA 4Q4AA 5FBVB 3DMTC 2JG3A 3EOAI 2A94A 4RHYA 2PYZA 2AOVA 4XARA 3SF8A 4RK6A 1IQUA 1ECCA 5FPQA 1TECE 1KDRA 3I72A 4ASUA 5CLFA 1K5DA 5F4ZA 1L7NA 1CQIB 1LJLA 2VWQA 2BUCA 2CLCX 5A6SA 3VR6A 5CIQA 1DTEA 3PXGA 5E2BA 2NP6A 1RHRA 2BKVA 3H0CA 3IQFA 1N2EA 1JG1A 4YC7A 5BPFA 3UMSA 1EX7A 4U0JA 1FBTA 3KTFA 3C8ZA 4PQGA 1I3NA 2J46A 4C2TA 4IG4A 5KX5F 1TT7A 1S2MA 4PQRA 2O0HA 1U6JA 3QUQA 2X7XA 3UKJA 3KT0A 1FSPA 1YI0A 4XX0B 1JL3A 1HG1A 2RGGA 2B5OA 1A8QA 2VQDA 2P40A 3ICCA 1U2RA 3TPFA 4JUIA 3GRCA 3VV2A 3W78A 4X1IB 1LS1A 1FTGA 1BDBA 1WDMA 4Q7EA 5B3LA 4FGZA 2OORC 5FA5A 1EVYA 4ZTBA 3I8XA 2WYOA 5MN6A 4EG0A 4NC9A 5DI3A 2I4MA 4US0R 3DGFC 4GX1A 1GTZA 5ADWA 2Y1XA 1JV2B 3JATA 5F9FA 1DEXA 4MEJA 1NURA 4U2EA 4N5DA 3SLGA 2W2TA 1KJWA 4NBWA 1U5CA 2REQA 3KUDA 4LA4A 1B0PA 1QUFA 1E1LA 1GL3A 2O2EA 5E9QA 2AI3A 1P74A 1GD1O 4F1WA 1ULAA 3B3FA 4E21A 3WLJA 1EFCA 2WKPA 5BSEA 2RFLA 3Q5DA 4YP6A 5KTMA 2I99A 1HI9A 1VBKA 2G70A 4PWZA 3V7UA 3KE9A 1DKUA 4JITA 2JF0A 1UDWA 3VSBA 3U7GA 2ZYVX 3CZ5A 4GUDA 3M5DA 4Z1OA 3LDFA 3OZSA 4OU4A 4EHIA 2F8SA 1SR8A 4PYKA 3TLZA 4F4UA 3DDCA 6CHYA 3ZBTA 4HTFA 4DADA 5LQKA 1YA6A 4MUNA 2FQQA 3GRKA 4CM5A 3LFUA 1CF2O 2CWWA 3OTGA 3C7KA 4I4CA 1OLXB 1XMVA 3BILA 2QUKA 3F71A 1DQNA 2V9PA 3OECA 4RMIA 3FRJA 1RHMA 3NETA 4LE0A 3UPTA 1CS0A 1P5FA 1RFGE 2XEDA 2ODAA 3UH0A 5I3CA 3GI1A 1HT1E 1NRIA 1SG9A 2PBLA 2EGHA 4CKXA 1U0SY 2JEOA 2EYUA 1FF9A 4NULA 4LVOA 4IEIA 2B7CA 2JJ1D 3KP1A 2FW9A 3LHSA 1OT5A 4NJOA 4P7JA 5EQDA 5EXTA 4CNQA 3H8VA 3D4BA 2HIGA 1XL1A 4IV0A 3RABA 3ROTA 2RHDA 3BS4A 2PXAA 4K9LA 4QQ8A 3R7SA 2AG8A 2GF0A 3QVGA 2V7QA 1SCDA 3QJ5A 3PKIA 2ZCUA 4IJ5A 4TUYB 1OFTA 4QNRA 1ZNXA 2ST1A 4G4SP 4MVYA 1MJNA 4U6SA 5D7NA 4YEDA 1IZ8A 4JNKA 3KQUA 1VHJA 3BMOB 4J94A 2JLZA 1EBFA 1FDOA 5AW7A 4GYJA 3AEQB 3IAHA 1Q0UA 4LXTA 2C4VA 1JLSA 4B6EA 4ZMSA 2ZSJA 3O3MB 1XO1A 1TZJA 3HA5A 4NFHA 4URYR 2DQSA 2Y71A 5L7WA 1DBQA 5TQ0B 4R2HA 4XCQA 1GL9B 5K8VA 5L45A 4KGVA 3GPIA 2XDAA 4QGSA 2QTRA 4EARA 5FEUA 4CU2A 4YB8A 3NTXA 1KY5A 2EX0A 4X6YA 2GYUA 1P3Y1 1QCYA 1V9SA 4CE6A 2Z0MA 3R23A 2QP3A 3AH8A 3U9SA 3N28A 4TRRA 2C04A 3COYA 4YCDA 1GLGA 1XKTA 3RVBA 1RADA 3DTTA 4GG1A 4QRHA 4D9CA 3QTBA 1GAJA 2FW1A 2IHNA 5BSWA 1QYWA 3P0IA 4RSGA 1UBRS 1YO6A 3OE4A 4J1QA 4QDKA 1YDWA 2V6MA 4HXEB 1MABB 4G0YA 3C0KA 3ECAA 1Q0PA 2ZJBA 3MJ4A 3K05A 5DBFA 4B6OA 1KZ4A 4FXOA 4ZREA 5I8WA 2R4UA 1H0KA 4DT1B 1HT2E 1SY7A 2ONKA 4QASA 3D3QA 4WKPA 5EPOA 1H2EA 4ZD6A 2DUWA 4DARA 5IC4A 1Q84A 1XEFA 2FA9A 2VPPA 1XIVA 2IHBA 1A7UA 1CIVA 4CEIB 3MWKA 4HSGA 4CHTA 3MELA 1ESZA 1JGTA 4ZCSA 5BVGA 2G25A 2HRCA 2QZPA 1MC5A 3CW9A 4A91A 2IUYA 2FPRA 1HY3A 4ZOLF 3HCCA 1OKKD 5FPHA 1N5LA 3QVTA 1FRZA 5KWIA 2DBRA 3AUSA 2WZQA 4TMZA 5K3CA 4NXMB 3O4RA 3SKVA 2E4VA 2VTKA 3VR5D 1RYHA 3H8SA 4PHFA 3REQA 2R8OA 4Z9YA 1MAAA 1Z8HA 4FKBA 5DYWA 2C8JA 2ZRKA 5TB5A 1KQ3A 2WAYA 2PZKA 2I2DA 3R7AA 1V3UA 3BOSA 2GVNA 3COSA 4BMNA 1BVRA 4DW8A 1VMAA 4B2PA 4RELA 2E85A 2PRSA 4YAFA 3GJXC 1EGHA 1X2BA 2HLPA 4HX9A 5EEGA 4IIFA 3EX7C 2DT5A 2QAGC 2QL9A 4L8LA 3X2FA 1E2QA 1T8WA 1ZNZA 3BE8A 4QDUA 3VVMA 3WAGA 1EK0A 1QVVA 2QE7D 4WFQA 2WUEA 3EIXA 5AOBA 3DZFA 1BQEA 1FMCA 4F0JA 4EY4A 4UHFA 5F7OA 1JA0A 4BV8A 3D2BA 4NFSA 4UJ3A 3JVUA 3PHBE 4MB6A 4BZWA 4Z4CA 1COWD 1UFQA 1J00A 2G76A 3CZ9A 4LRYA 4E2WA 3WIOA 2KLHA 3OF5A 1XDSA 4H35A 3AP2A 3B85A 4ZT5A 1PR3A 2CUZA 4KWIA 1J42A 5DJ5A 3CNNA 2G4VA 5BQFA 4FQ8A 4GZ6A 4Q12A 1V48A 2BUAA 3CGGA 5DM4A 2R84A 2HLNA 4WFKA 1PNTA 5FBKA 4UM9B 2NUBA 3NYQA 5G4KB 2O07A 3TPZA 4EMBA 2C83A 4JLMA 3ZU4A 1TEVA 3FM9A 3UAWA 2ZCJA 1RDFA 4JT8A 4Q9JA 3IUQA 4G5SA 3ZI7A 4X20B 3F2VA 2I78A 1OW3B 2X4GA 1X74A 3CLTD 2PGLA 5L6LB 2RGEA 3ZW8A 1PO7A 5ARDA 1I4LD 2QD2A 3T41A 2EWWA 4G9BA 4E0BA 3TRKA 3GLIE 2IH2A 3EC1A 2D8AA 5JNRA 2JNWA 4KQ6A 4X71A 2MOKA 3IUEA 4LX0A 5THKA 2GZHA 2A0UA 5EA2A 3RS8A 3OA2A 5JRJA 1B2RA 5A7HA 1UZLA 3ZG6A 4QC2A 2OTCA 2PD6A 3AZPA 3D6NB 1QH1A 3JTMA 4JQSA 4JI6B 3UUEA 1C80A 5LZ7A 3SEZA 5D85A 1DSSG 1RAAA 5DNYB 1GFSA 2NVOA 4J2HA 2CL6X 4MB0A 3VR6H 5ANRB 1JQJC 2ID4A 4MQ6A 3WB9A 2O3SA 3ZVRA 2V65A 4BNWA 3JRXA 1U0OC 3INYA 4LF9B 1HF3A 2QVBA 1E2NA 3WJAA 3ILVA 2H1HA 2W2XA 1TMYA 2ORED 5I8PA 4HVAA 3AI7A 3DAHA 4F7DA 1L4KA 1ZI6A 5LWHA 1DC7A 4KX3A 3ROGA 4BECA 3IMKA 1HZZA 3O9MA 4KVGA 1V1JA 1P44A 5IT9A 5UKDA 4B9AA 2O8CB 2ZSHA 5J1TB 3VDXA 2Z4TA 3IVGA 2E6KA 4K9RA 1XD2A 3DMRA 3S7TA 4JZKA 4O0LA 2X0DA 3L7KA 1PL7A 2OWEA 4W5WA 3ZVNA 2CSXA 3FCYA 2IJGX 3TW8B 1OI2A 5DGCA 2XF2A 1L7EA 3U26A 2XIQA 2RH4A 1KJ9A 1Q0TA 2FEWB 1U31A 3A0RB 3NT2A 3R6DA 1PNVA 3BWCA 3B36A 2OSVA 5ECGC 4DUGD 2RHRA 1PJ4A 4COKA 1U0EA 3BHIA 4JENA 4AN1A 3NOQA 5EIHA 5LQRA 2BKLA 2WK1A 4Q0MA 3T5DA 4DN6A 3FH0A 3LC0A 2JKZA 5GM2A 2IV2X 4UBMA 2EC5A 4UCWA 2D13A 1JLKA 1U3DA 4MUAA 4DF3A 3OSUA 1XXHB 2ORYA 4ZQFA 2NO0A 2WKSA 4GM0A 4RVNA 1T6BY 2QAGB 3TL6A 1MIOA 2Q4OA 3NTOA 3OM1A 2D7CA 2GTIA 1GG5A 4K9KA 3WRWA 3RS3A 1MA3A 2J5XA 3ND9A 2OCXA 4EA6A 2XXAB 3UHFA 3EIQA 3QPWA 1QQAA 1QX4A 5K05A 2R6AA 8MHTA 2ORWA 1MPXA 2ATCA 3D2LA 2WJYA 2ODNA 5I7SA 1D4OA 1SWWA 1JB1A 4HZIA 3V4VB 4BB0A 1Y4AE 3RS4A 3OJXA 3LHIA 4L27A 1AS3A 3K6SB 1AKRA 3OEEA 3L8GA 5AI9A 5KX5B 4B6RA 1PVOA 2ENWA 1XCLA 4H3HB 1N2BA 3HJCA 2P0YA 1EJ0A 2FMUA 2QYOA 4JL5A 3F7OA 4J43A 4NEQA 3WLSA 3ZCUA 1E7QA 4L9WA 3GUHA 4EFDA 1E5QA 2YZNA 1U1CA 3C3BA 4ALLA 3X1DA 5IAJA 1R50A 3TF5A 4N8DA 4JD5A 5GONA 4OI0A 1ZHHA 3RT1A 4KQKA 3EBLA 3PWTA 1CV2A 1HTBA 3BKXA 4IIUA 4AULA 1CPYA 2C59A 1LF5A 2XF8A 2PNJA 2ZE5A 1E6WA 1VP3A 1VZ2A 1HLFA 5JT1A 2BEWA 4JYPA 4DL9A 2PX5A 3QVVA 4DR4B 1UBKS 4R68A 1IDN1 2J9RA 4I3FA 3GLSA 4WFJA 1SULA 2O2JA 5LDGA 2DKFA 2YQ5A 1Y37A 2F43A 4RGBA 1UBFA 4M8LA 3L6DA 1TQHA 2DBQA 5CD9A 1JYSA 4PZAA 2O8FB 3O5AA 5LPNA 1MO6A 2G9NA 1HL7A 1Q1AA 4F6CA 2UYCA 3TD2A 4NMHA 3W79A 2RH9B 2CYAA 4FFNA 4OXRA 1SHKA 4D8XA 4YMLA 3DWFA 1E4EA 1OOEA 2X0KA 3BQ9A 3ICPA 3OLXA 3LKDA 2CXQA 3RK4A 5FBZA 2QKYA 3Q6IA 2JBWA 2UZ1B 1VE5A 1GNLA 2GZ2A 4DYDA 3RYCA 1SCBA 4MA0A 1OGYA 1K5GA 1EDZA 1FFXB 2DHQA 4KWHA 1S7CA 2VJNA 4GKAA 3VYWA 4JBIA 4HT3B 3EAQA 2O7RA 4LY9A 2IDZA 3BD9A 5K4HA 4KE9A 2GTHA 5DTMA 1CD5A 1RYMA 3LBIA 3PXBA 2NU8A 3IA2A 1FQWA 4RC9A 2WM2A 2F00A 1RMQA 1X77A 2Q3JA 4RKYA 1XQ1A 5JAIA 4ZI7B 2VYVA 3GVPA 1DZIA 1ODSA 4MV7A 2ON6A 3STVA 5C8YF 5BORA 3DBRA 1VJ1A 3MMXA 4KLAA 2XR1A 1HYBA 4HXFB 3X2EA 4YI5A 1P60A 2BONA 2GCIA 2H4HA 3SZ3A 4D3DA 3UFBA 3EVZA 1LV7A 3FETA 4BBZA 1RXYA 4M36A 5CW2A 3UMBA 4BIMA 2H0AA 1D9XA 4F5DA 2JFZA 3B51X 5EY5B 3LAWA 4J8PA 2JLUA 3LSTA 5GQSA 1W5AA 1XU4A 1C3OA 3FUTA 3WWOA 1XZIA 1XA3A 2QIOA 1HE8B 1JQ3A 4BE4A 1N2XA 3FPSA 4ZYZA 5IAEA 4B8WA 4BVHA 5HKKA 3RFCA 2JCBA 1RAGA 4LC0A 1BSVA 4FHEA 4C7XA 3ND7A 3UGQA 1ANKA 2NXJA 3KAJA 3G2PA 1ZVVA 4UUMA 4ZT6A 3G5TA 4AG5A 1ZJ5A 3F5DA 3WZMA 2QLMA 1X7WB 2CFCA 3QPDA 4IJWA 5BSHA 1E4YA 4MVJA 2JFXA 3NC0C 4P4GA 3A04A 2FFJA 3CSSA 2ATVA 4WZBB 1JHPA 1YCDA 3JQCA 1TMGE 3H1TA 3WZLA 3C87A 4H15A 1Y98A 2WHXA 2ZBQA 2VDMB 5KDLA 5KYWB 2Q5OA 1ZIOA 2HJRA 4MR9B 5FHRA 3TKYA 1DL5A 1T13A 4JR0A 2PIAA 5DLPA 1JG4A 1M54A 2WTXA 4E2ZA 3CT4A 2QM3A 3ASUA 3CR8A 4R1OA 3L1HA 4HEHA 4TTPA 4CW7A 5KTKA 1GCUA 2C92A 4KPFC 2UXCB 1SELA 1NP3A 1Z16A 3B20A 3MMZA 2QR2A 4MI3A 1GQQA 3T12A 1A7JA 2ZAGA 1O7JA 3EGDB 4F5ZA 8ABPA 3DYIA 1I7PA 2WU8A 4KODA 5EFOA 1A76A 3OESA 3GJ7A 4LF6B 1P9NA 1ADFA 4GI5A 2HA5A 4B7XA 1RBMA 1QVZA 2R86A 3IDSA 2VF4X 4KVFA 4XX0A 1KK2A 1UXKA 3HXQA 4LZOA 2XXBA 2ZETA 3SE0A 3L1JA 4ESHA 3P0JA 4DG5A 1B1AA 2XWSA 4WA7A 4WOJA 4E51A 1X7ZB 2G83A 2QRLA 4V0LA 2OM2A 4X1IA 1HM5A 2PMWB 2PSDA 2WB4A 1FNMA 1PJZA 4ACBA 1U8UA 3DKIA 4GX2A 4C3OB 1YKGA 4D97A 1EWRA 5AESA 5CDYA 3LA8A 3O82A 1E9EA 5IT5A 4D4GA 4YJ3F 3D6HA 2QX8A 2NQTA 3IEMA 1UFVA 2EEPA 1UEXC 4MJ7A 5EIOA 2D5BA 2Q8PA 5L3RA 1N0VC 2PRZA 1IN4A 2ZEJA 1VSTA 1P45A 5CB4B 2EOAA 3NP7A 3HO8A 4Q39A 4J0EA 4XH9B 4TYWA 3RYIB 1J97A 4ENPA 1JG3A 3MCZA 4WY5A 4UASA 2QGNA 5KQLA 3N70A 2NIPA 2P9BA 3OX3A 3IMFA 4WNCA 1RRFA 2OV8A 3FBTA 1E66A 1IATA 3FFAA 4X54A 2PPVA 2I91A 4Z7NB 3F46A 1KO5A 4GPEA 1DQRA 4O5OA 3AHHA 4RD1A 5CA0B 5A2QA 1VI2A 4WZ6A 2C0PA 2ZZKA 4J90A 3D3EA 1NVVQ 4UAVA 5K09A 1U1GA 1DC6A 3IOBA 1J2YA 2BFPA 1XZFA 3CF0A 4NH0A 3E5NA 3DV0B 3OEYA 3TLEA 5HOQA 1N2CE 4LF7B 4OO3A 1I1HA 4G1VA 1W19A 1W1IA 1DCKA 4D4MA 1OLXA 1I7QB 1TT5B 5H80A 1H8ED 5B1YA 1N34B 4XPZA 2YJ6A 4CM9A 1M2JA 1QF7A 2ZRPA 4JBYA 4I5IA 4M49A 2CK3A 4QXRA 4XLTA 2P6RA 4D2IA 4Q82A 1WLYA 3H7AA 1EUQA 3HBNA 4N0DA 4DIOA 3I05A 1WV1A 5TX7A 3PPIA 1KJNA 4LNUA 3WBFA 3LT4A 3T3NA 3WGTA 4A6XA 3DMTA 1ISMA 4ZU1X 4TUYA 3I6IA 2Q6OA 3HL4A 3E3AA 5K1ZA 2E82A 3EQ2A 2IPOA 3D6AA 5FUWA 3R7WB 3VI4B 3GLQA 4BJ5A 1I5OA 1N7JA 2IK8A 4M1SA 4RE5A 2UYHA 1M1UA 1JHMA 4M1TA 2BFAA 2P6OA 3AEQA 3PFGA 4ZRMA 1HMPA 3MRVA 2O23A 4BLOA 1JDNA 2AR0A 4C76A 2VQ6A 2V6GA 3DBVO 2ZRHA 5TQ0A 4K1XA 3VU0A 1JHAA 4ZIRA 2H63A 1O87A 4EHHA 4F38A 4CIWA 2MYUA 5IKXA 2MMGA 4F93B 1W85B 5IBPA 3IAM1 1XFDA 4A6PA 3UKDA 3VZDA 4F8YA 4B40A 4IIYA 3LJKA 3C97A 3DHNA 1R6TA 2XMDA 3O1LA 3C98A 2ZR0A 3RUEA 3NH9A 1RQ7A 4I1IA 3OQNA 4FNOA 4IDEA 4OOEA 2FZVA 3HV0A 4P4LA 5AJXA 4LFCB 2ASVA 2AEFA 1MABA 1EU1A 2OORA 5EZQA 2ZW9A 3HU1A 1W4LA 3NKVA 3S5UA 3DW1X 1IBMB 2A3NA 3MTJA 4H17A 3VTFA 4OI2A 4X00A 1UPBA 4DT1A 3IV7A 3W9BA 5GJCA 4RD4A 2BMDA 2LBPA 4LG1A 4MULA 2AFHB 5JI3E 1WF3A 3TCKA 1EB9A 2UYYA 2HXYA 1W25A 1CC1S 1KZGB 2OV3A 2GRUA 2WAAA 2X7HA 2B8EA 2HA7A 3EHEA 3KEMA 3QX8A 4LYFA 4QL3A 5J4YA 3LYUA 1QC5B 3BWVA 1FSGA 3ETCA 3M49A 4JLKA 2HFKA 3HMKA 1Z7EA 4K6MA 4ZC1A 2CLMB 3BQMB 2OXCA 1SHZA 4UMFA 5A3VA 4IIGA 3CF6R 4M0MA 2DQ4A 4JLBA 3V1UA 1O6CA 3LHKA 4CV1A 1J6UA 4NNJA 3DB1A 2EF0A 2W8BB 4C87A 2PMBA 3I4LA 3RAJA 5E1DA 3A6LA 4KQJA 4TGLA 1WMEA 3WMRA 2X6TA 4E5KA 4BNYA 5ICCA 2JRLA 1J99A 2P6NA 3F6RA 2O06A 4QGAA 2FZGA 4MKGA 4B43A 1LI5A 1FW8A 4B6PA 3COZA 3P8ZA 2BOVA 4LKOA 5ALMA 2VDUE 2AN1A 1R27A 4C5BA 4ZK2A 3KQMA 1AOXA 3DAOA 4H0FA 3U4MA 3DFUA 1LBHA 4A6DA 1LLQA 2VYNA 4ZVQA 3WJ1A 2WJ6A 3CFYA 3JAKB 1EXNA 4L4YA 2XUAA 4TSKA 1WW3A 3VTZA 1KMMA 1V4NA 2IYRA 4EPRA 1XF9A 4Q05A 2XV1A 4P4TA 3RTGA 1TUIA 5C34B 3FGOA 4IS2A 4DBLE 3HWWA 4MQBA 1MC8A 1ZD8A 1K9VF 2IQ5A 3R09A 1E6UA 2Z04A 2F4NA 1GKYA 4MRMB 4TTJA 1W44A 4CMIA 4CFYA 4D99A 3RJ9A 2VK8A 1NHGA 1NVWQ 3BKWA 2GJSA 1BMFA 4ZYVA 1CUSA 3HXPA 3V8MA 2VRCD 2QUAA 2RG1A 2ZIVB 3WYNA 1A71A 3D64A 3G8AA 4LGYA 3J81A 1QS0B 5G4KA 1H1LA 3LVQE 4B6GA 3CT6A 3JARB 4U2DA 4MHSA 2OKCA 4MWGA 4X20A 3C3CA 5FEMA 1YQTA 4MVJH 3RLIA 3M9XA 4RY0A 4BEWA 3A36A 4ME6A 2FX2A 3IIEA 4FI3F 3ZY3A 4O8CA 2ZZNA 5A4JA 2XB4A 3MGAA 1GY8A 1FLAA 2Q5CA 1WS6A 1M1ZA 2VF5X 2ZBGA 3KFLA 1P9WA 1W47A 2ZRDA 1IY8A 1YQGA 2A35A 4LF4B 1ORDA 1FY2A 2C07A 2HMSA 2OVBA 4I55B 4RTSA 1XQXA 4GKJB 1SMKA 1OH7A 3O2SB 3I12A 3QLVC 4I1SA 3C3WA 3T8YA 1JH9A 3BUSA 4ZMRA 1XTKA 1HK7A 2QGZA 4OQFA 1RACA 1CJVC 1G3QA 2ZTHA 3SYNA 4OQDA 2I7XA 1W35A 5CM8B 4I9GA 3R3HA 4H7PA 4WDQA 5AWFC 5HEKA 1V8PA 1ODFA 3JYNA 4CIDA 3IERA 5C8YB 2F1IA 3VR1A 3B38A 1M8KA 4HTAA 3WGLA 3ZWBA 3HR8A 3P5BA 3T9CA 1CSEE 2NTYC 1RM0A 4YP0A 1PX0A 1YQEA 1JDJA 2E37A 3A10A 3GAZA 3CNEA 2O8CA 2FN8A 4YA6A 3BICA 3N2IA 4JLSA 2V59A 2COEA 4BDTA 1N5KA 2ZBFA 3FHLA 1AA9A 3PZBA 3PV0A 4LV5B 3CH5A 4N0QA 4OH7A 2R44A 5J3JA 2FV8A 3HPRA 5T57A 1KDYA 5DM70 5GJVC 3TW8A 3PT9A 1DHRA 4BMZA 4NQZA 2D06A 4OA5A 3TLXA 2LP4Y 4GICA 3USES 1NAHA 3GLGB 5CYOA 4PFJA 1SO8A 5ALKA 1XX6A 5EYPA 3BWMA 1M33A 3EXHC 1I80A 4ZO4A 3O38A 1WMAA 1E1KA 2HL6A 4PS1A 3RBVA 4JR1A 3GROA 1YNOA 2LVBA 4F1JA 3AKEA 1Z2PX 4R0VA 1JU4A 1XXHA 2HWUA 1TIBA 4WBNB 5AKGA 4PG8A 2R1ZA 4I5DA 3HJAA 4Q01A 3ZEIA 2ZREA 4CEHB 3VISA 1A9SA 2QAGA 3D6VA 1RJ9B 4YHBA 1OLSA 1ZVJA 4URVR 1YOBA 1M2FA 2Z6VA 2VXYA 1KVQA 2JA1A 2Y3IA 4XTCS 4YN3A 4HKTA 3ENNA 2MYPA 2D7DA 2QI9C 1GEGA 3ZOKA 5EUBA 1E7MA 3DF9A 5BQOA 3T54A 1LBIA 3AESB 3FWPA 1FYWA 3NUGA 1CLEA 3T38A 5AFSA 3O3OB 5JASA 5K8UA 1Y80A 3DLIA 3NTQA 2PXHA 3TQRA 1T10A 3WK8A 2WHEA 4K3VA 4CU5A 4Q4LA 3E9CA 1DUIA 3O8BA 4KHPB 4F9EA 1W36C 1X14A 1P39A 1AC5A 2RK4A 3LCJA 1KI1A 1EZ4A 2PS1A 4PZPA 2WJ4A 5TPWA 1NR5A 1E77A 3ZCPA 4RHCA 4TYPA 4WNIA 2XSZA 4GL2A 4MEAA 2IPAB 2C9CA 1BU8A 3HSKA 5LP6F 5JAQA 1P8AA 3IR5A 2OL4A 1E79A 4RQAA 3W5IA 5JCJD 1B7GO 2Y8EA 1RAIA 1L4UA 3FLAA 3B78A 2CEAA 4CF6A 2YFQA 3NM4A 5J2TF 4A8JC 4ZDWA 3TM5A 1IH8A 1D9ZA 5K0LA 1BDHA 2C54A 2PZJA 1G4HA 1WULS 3IHLA 4ZT3A 1H2WA 4BNGA 4F12A 3TTWA 5EESA 5SY6A 3ZDQA 3DPUA 3EUAA 3RUHA 1PEAA 3DS8A 1IM8A 1L3CA 4GR5A 1T0PA 4E2FA 1J0XO 4RDXA 4ZVMA 2NGRA 2OK8A 1XV5A 2JVKA 3SC6A 5JQGB 1M6NA 1DX9A 2FEOA 1S8AA 3IUMA 3MPUA 3NWBA 1OD6A 3EZFA 4B0OA 2BELA 2C3PA 1XJCA 4TN1A 2GBLC 2H17A 2B3DA 1F12A 2OXFA 4G5YA 4CCAA 1HXHA 3HVKA 3T7RA 2UZ1A 5E95A 1TJPB 1IWBB 1JKMA 4H16A 1BXZA 3EDCA 1TU3A 3GZTB 4DC1A 4IICA 2YMLA 4DQLA 1FFXA 3U6BA 1XPUA 3FSGD 2B34A 5K3SA 3I62A 4R05A 2IYYA 2DWUA 2P62A 4ISCA 5C35A 3LYHA 1IRIA 1HQDA 1QAMA 4KV7A 3BE4A 3VPHA 1ATIA 5JBQA 4IM7A 2XADA 1GV0A 2J08A 4P3OA 4F04A 2VZEA 1PYDA 3KKQA 1H1DA 3BXXA 4UREA 3EA5A 4UVIA 1M9NA 5IDVA 1Y82A 4C1NA 1G4AE 2D5LA 2IXFA 2I3AA 2GHRA 5DMHA 2XB2A 1GU0A 2O57A 3JX9A 4ZI7A 3MS4A 2HHHB 3ADDA 1KJQA 3F6PA 3Q5EA 4AY3A 1ULTA 1AKQA 1UT8A 3EXHB 2WHRA 3MIIA 3V5NA 4QUDA 3TZ6A 4MH0R 2L69A 4W9NC 5CLIA 1LZLA 3IALA 3O03A 4J0QA 3LW8A 4RZXA 4XW2A 1A9TA 2NVUB 2HLDD 4JJAA 1Y48E 3CN9A 4DJTA 3T4PA 1I4DD 2OCYC 2X22A 1EXVA 3AW8A 4GKVA 1RE0A 1XCBA 4YT2A 1SUFA 4BNVA 1XTUA 1R4ZA 1T26A 2R48A 3NANA 4G23A 2ZSAA 2E48A 3TZBA 4Z4IA 1QP0A 1LF0A 3AILA 1Z06A 3B6EA 4DANA 1EM8A 3L7MA 3URKA 2H00A 1ZCFA 4R83A 3ZY2A 3TI9A 2QLNA 3N6RA 3WIEA 4Z1MD 4YY3B 2DB3A 3IURA 5AW0A 2H7XA 4S2UA 4J0KA 4MVCA 3HV2A 5CXUA 3KQPA 1DOAA 4EG1A 4L8VA 5LYJF 1EPUA 4E5MA 5JCPA 1T8PA 1UM8A 1CRWG 1R37A 1A96A 2ODTX 2PEZA 2PJUA 1G6Q1 3MVEA 1ULSA 4V3CA 4N9WA 4W1SA 1NX9A 1Z6GA 4YQYA 1IHYA 3AF5A 2ZUWA 3HDQA 3LWBA 4QU0A 3D59A 1H2YA 4OMCA 4MR9A 1J23A 3C43A 4RKFA 4WXEA 1WZIA 3C45A 2PGJA 3RUDA 3ZY5A 4YO8A 2K87A 2VJDA 3CEJA 5FUVA 4CT0A 1ZW6A 4UBKA 4EH1A 1QIDA 5B57C 4F72A 4BN0A 4D45A 3N9IA 1RQLA 3KDPA 5JJCA 2AFIE 1AUVA 2J3KA 3UANA 9ABPA 2OAP1 4AYTA 5EGSA 4PRKA 1BJKA 3EGDA 1M7GA 3L3BA 1M34A 1A9RA 1M0EA 1Q14A 1ZH8A 2P4SA 4TT3D 1K7EB 5JMPA 4JASB 5JNTA 1IZZA 5BYKA 2Y2VA 4D8YA 1EJ2A 1NLZA 2NU6B 3V2IA 4GQBA 4H60A 1LPMA 4MVJE 2CL7X 2RHHA 2X2FA 5LFAA 1CR6A 5IK2A 3SJCA 3I4CA 2DY0A 1PBTA 2XE6A 3B89A 1DIOB 2CKMA 2E4XA 4PLZA 1WXFA 4CCSA 1YI1A 4WNYA 3ML1A 2EKBA 4U5QA 3KFXA 4CKCB 5IBCA 2PUCA 4ZARA 5LIRA 2R0QC 5KVAA 5E2AA 1AGPA 1KAOA 1JFFB 1GGMA 2D2XA 5EZ5A 1J2UA 3L84A 4AG3A 3KDAA 3KDSE 4H77A 3FLMA 2AN5A 1GA1A 1ESMA 5FORA 4UHHA 1VSUA 4ZEMA 1S02A 2EJWA 1AMUA 3OLVA 5J9FA 3MTIA 2IYWA 4KIWA 5HIMA 3ELBA 4DLAA 3O6VA 1E2DA 4MW9A 3SZRA 5C1IA 4R8LA 3AVYA 5CB4A 2HD4A 4F21A 2NZVG 5IBQA 1BWPA 3RYIA 3TYXA 1QE0A 4HAZA 3I45A 2ZJ0A 4PAMA 3S2ZA 4TROA 4BDSA 1WX1A 4HX2A 3CNHA 4RIIA 4H7FA 2JLSA 2WC1A 5B30A 3GHYA 4MPJA 3CBQA 1T0BA 4L16A 3QV1A 3C85A 4MPRA 4PANA 5CA0A 4R3WA 5T6MA 2IPXA 2YFHA 3SEFA 1RRGA 1XZPA 2P9EA 3KO8A 1ORVA 4UVHA 2NUAB 2X0IA 1JDZA 4GOND 1DAEA 2HPHA 1M0TA 4K6OA 3TS1A 1BDIA 4X7BA 2ZXFA 4ZXFA 3VR3A 1U0NA 2MSKA 3I23A 5AJTA 5SYAA 1T6YA 5LJLA 1TT5A 4KWTA 1KWGA 2I55A 2Z2YA 1V71A 4C5AA 5EKSA 3E53A 5A06A 5KDDA 1UK7A 2O1XA 3IUYA 1XRLA 4HR7A 1Q3KA 1ZGBA 2ZU0C 4Q7JB 3EXEB 5EHGA 3T4XA 2GHIA 4DSTA 2BMWA 1G7RA 3GBSA 5TQ2B 1U0BB 3FPFA 1TW2A 1HDYA 1E9SA 1TF2A 3CO5A 4QOIA 4MYDA 2ETVA 3VKWA 4C4TA 1RRKA 3WSWA 3NVKI 4DM4A 5CK4A 5E7JA 2IXDA 5AXCA 4B6QA 1JMYA 2HF2A 3KZCA 4P86A 5KJ1A 3ORHA 1SVOA 5EJEA 1OMOA 4IJQA 1EHYA 1V5EA 1AUXA 2AUTA 5I8ZA 4NBVA 3HYRA 4UNSA 4ACAA 3R7WA 5B4UA 4Z0HO 2X5KO 4WINA 1V8BA 2FZCA 2JIZA 2W0MA 2Z4SA 3BTUA 3FIJA 2VNIA 1SHTX 4K6GA 3OF2A 1IZ7A 4NYIQ 4PHHA 4CF7A 2ZUEA 1JNXX 4J0JA 4I4TF 1C9YA 1Q57A 1ISJA 1DJMA 2ZYDA 5TXGA 2H1RA 4BLTA 1EGAA 1J22A 1YZ3A 3EOBI 4IDQA 5EPEA 5AVXA 4EGSA 2ZYUX 2B4RO 1S89A 2OXRA 3BX1A 1C29B 3H9GA 3WYCA 1N77A 3ABSB 1U0LA 3OOYA 4Y7CA 1W85A 1MUUA 3L7JA 2LE0A 2FPSA 1KJZA 4MUHA 4WFIA 5ALSA 1V7QA 3K31A 4YUVA 2EGGA 4D46A 4PO8A 3RM3A 5KYGA 1SVSA 5HZHA 4KKXB 2CVHA 4FWTA 2QRPA 1Q1ZA 5K8TA 1WOYA 1X1DA 1R2QA 4OHPA 2IVFA 3B1XA 2Q1TA 4B3DA 3CBGA 4BXOA 2I03A 4M4SA 4Y6PA 4PC1A 1HBJA 2LV8A</