3Q85A

Crystal structure of rem2 g-domain -gtp analog complex
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
169
structure length
149
Chain Sequence
GVFKVMLVGESGVGKSTLAGTFGGLDTYERRIMVDKEEVTLIVYDIWEQDHCLQTGDAFLIVFSVTDRRSFSKVPETLLRLRAGRPHHDLPVILVGNKSDLARSREVSLEEGRHLAGTLSCKHIETSAALHHNTRELFEGAVRQIRLRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding protein REM 2
publication title RGK Family G-Domain:GTP Analog Complex Structures and Nucleotide-Binding Properties.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 53
structure length 149
sequence length 169
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3q85A00
2WBLC 4MRVA 3GLIB 1CEEA 2WAXA 3ZZTA 2QNRA 2IXEA 1FUKA 1F5NA 3KJGA 2QRZA 4LYHA 3AVUA 3VNUA 1JNYA 2QSZA 4G3XA 3WNBA 4BLSA 5CJ2A 4S2EA 5FTKA 1G7RA 3AKYA 4IOJA 3SYNA 3QKTA 4NBSA 3T1OA 5DHFA 2F3RA 5EUMA 5C4MA 2XGJA 4HI0E 1LW7A 3RC8A 4FI3C 4LHYA 2EW1A 3HU1A 4HDOB 4UJ3A 4DT1A 2GJKA 3W90A 1W0JA 2JLSA 4ILEA 3RRNA 4XVRA 4CVNA 4HAZA 2Q6TA 3BFXA 3EG5A 5DI3A 3IHLA 1H8HA 1ODFA 3WY9A 3AUYA 5TMPA 4EJSB 1M2OB 1L8QA 3DKPA 1FW6A 4IJMA 4B73A 4D80A 4ZI2A 4M1WA 2V55B 1T5LA 4MYUA 1E96A 3TW4A 1N0UA 4PANA 4OKSA 2X1VA 2IX3A 4YMTA 2EQBA 1Q12A 2VSXA 4JYBA 4NYMQ 2WWFA 4Q9JA 3DZDA 5F3WB 4BWYA 1R7RA 4Q1CA 4H9GA 4LX0A 1V43A 2AL7A 1JR3E 4V0MA 3TQFA 1XPOA 2FNAA 2C78A 4HLCA 4MA4A 3VX3A 1DVRA 3M6AA 2GAOA 3BBPA 1EXMA 2K5UA 5JEEA 3NDPA 1SVKA 3VR1A 3AF0A 1AGPA 1G1MA 1Z28A 5JWOA 1F6BA 3E2IA 3AP1A 3PUVA 4NYJQ 3F8TA 3LD9A 1KSJA 3U4QB 4C7OB 1XTJA 5KSOA 2ZRKA 4Q02A 4NYIR 1XJCA 5FL7A 1GUAA 3PCRB 3KQHA 1FMJA 1S0UA 1E0SA 4IDNA 4KBGA 4URZR 5J4YA 2HT1A 3TAUA 4LC1A 1JALA 4LJ8A 3H86A 4U7DA 3IIKA 1MOZA 4FXPA 1KMQA 2H57A 3ADKA 4QRHA 4TLDA 3EPKA 1BKDR 4KO8A 4Q1DA 3PUZA 3CRW1 1NVVQ 3CX6A 3IQXA 4PHTA 1FQKA 2ZUBA 4R2IA 1WP9A 4QJ5A 5FFMA 4MYHA 1LNZA 3SNHA 4GZLA 2QPAA 3B1ZA 5IK2D 2C5LA 3ZVNA 1U99A 2J0QA 1CLUA 5CB8A 4NMMA 4YDSA 3CW2A 3LO5A 2YKGA 3AF1A 1N6LA 1FP7A 2PMKA 2W6ID 4B6EA 2GJ9A 2W83A 1JAIA 2RGDA 2V54A 3PITA 2R6DA 2VYFA 1MV5A 2GCNA 1WQ1R 3Q85A 1P2VA 3IHWA 4KLNA 3R9XA 2ZI4A 4NCKA 1G7TA 3LVRE 4RFSA 4ARZA 4ZI3A 1LB1B 2WV9A 5HR5A 4JL5A 1ZW6A 4I1SA 2IT1A 2GESA 2UKDA 1E94E 1BYUA 1SVIA 3DMNA 3KX2A 2RHDA 1AKYA 1Q3HA 3D3QA 3PEVA 4GPTA 4NONA 3VR6A 5EE0A 1DPFA 2I1QA 3EPLA 3S1AA 2QL6A 4FMDB 4B74A 2LCFA 721PA 4DDUA 1KIMA 1AS2A 1PLKA 3FHCB 2WJIA 3VAAA 3W34A 4TSFD 1NNEA 3HWSA 5D3MB 1G8YA 4A82A 3CLVA 4CZ2A 1G21E 1OXUA 3U3MA 4A0HA 4DLZA 2IYWA 1J8MF 4EJSA 4DLWA 2DPXA 1XTQA 1GL7A 2D06A 1VIYA 3UKDA 4EPXA 5FUVA 5HZKA 1W49A 3WNCA 2ZJ5A 4D4LA 4HB4A 1F2UA 2QPTA 4HAUA 3K8YA 4JLJA 3CNOA 3U2QA 1B0UA 1N6PA 2YC4C 1JECA 4MRPA 1XTSA 2X2FA 2D7CA 2XNDA 2ZTSA 4G1UC 4HZIA 1ZVQA 4IVPA 4NCNA 3RS0A 2X19A 5LB4A 2EFDB 4Z1MA 4EPYA 3FMFA 4GZMA 5SZIA 4O3MA 1G8GA 1NLZA 3CKLA 3PJRA 3GEIA 1E9BA 2A30A 3U4QA 4C7OA 1XD8A 2AK2A 4C3ZA 5FL3A 4Q19A 2IXFA 5HE8A 1ZU4A 2FPKA 4KITB 5EJEA 5ANRB 1YKSA 2QRNA 3QXHA 1VHLA 2LWIA 2BKUA 3TLXA 4S35A 4A2WA 5DN6A 2IYZA 3NHAA 5GVRA 2XXAA 4TZ6A 4W7SA 5CM9C 3X1XA 4NCJA 3F0TA 3M1IA 3EARA 4LY6A 2GJSA 2F1JA 3I3SR 3EWSA 2IS6A 1F48A 2QMHA 1ZUHA 4F91B 4PSVA 2FPMA 1E2EA 2LKCA 5KDDA 2ZE6A 1G3MA 3NBFA 2FGKA 3LH5A 2ZR7A 4LCBA 5HZHA 2OSBA 3W6PA 1KMHB 1TAGA 5CLLA 2WJHA 1AZSC 2P6NA 1T8TA 1A2KC 2OESA 4WZ6A 3OFNA 4CEIB 4DCUA 4GOXA 4BRWA 5DO9A 1KI4A 3T1TA 3O8RA 1U8YA 3T5DA 2OO7A 4Q18A 3GFPA 4DVGA 4O0MA 3WBKA 5L3VA 1IOZA 1P60A 1CJUC 3LLUA 4LC0A 3BH6A 1WF3A 1G17A 1Y3AA 1YRAA 3QXJA 1ZBDA 3U6BA 1IN8A 5EP1A 3RC3A 2R8RA 1OXVA 3FVQA 2ZE5A 1US8B 2VBCA 4IW3B 4U02A 5AWFC 1XF9A 3RRYA 1D5CA 2XJ9A 3CPJB 1Q57A 3I62A 4OK5A 4UNPA 1MKYA 3RS2A 1XXHE 1W7AA 1M1YE 4QXAA 5L3QA 4C0QC 5D3MA 1RVDA 1N5IA 4PO1A 3ZLJA 1OB5A 2C2HA 4DRZA 4NCHA 4DZZA 1CU1A 3GJ8A 4TTQA 3TR5A 4URUR 5B58C 4QL3A 3Q5DA 1PV4A 2DWPA 1H8ED 1OIXA 2HV8A 2WWGA 3PG5A 5FUYA 3OE7D 4MUAA 4Q00A 1P72A 2N42A 3RLFA 5A4JA 1J99A 1RE0A 4TLAA 3VU9A 1ZD8A 2RGEA 1KAOA 1OIWA 2PZFA 4B6FA 1L2TA 1WDTA 1QF9A 2ZYWX 3PUWA 1UAAA 1E2FA 4BZQA 1HQYE 3QF7A 4FCWA 4IOLA 2XEXA 2CVHA 2FV8A 3SHWA 3DM9B 1EGAA 4L5BA 1NL3A 2VRWA 2YWFA 2RGAA 5LPNA 3OZXA 4DLRA 2ZXUA 2V6IA 2X77A 1OW3B 121PA 4UXIA 2NQ2C 4V0LA 4PPGA 1UBFA 3GD7A 3GJ5A 4D0NA 2CHVA 3NH9A 1ZYUA 3DHWC 4FINA 3GJXC 1GL9B 5SZHB 1IXZA 1LF0A 3CO5A 4MGKR 3L82B 4WZAE 3SI7A 2W6JD 4KU4A 3GLHA 5H68A 4IHQA 5BYJA 3G82C 5L3RA 1JEDA 1G8FA 4DCTA 4TYPA 1QHNA 2A5YB 4PXAA 4LBWA 3TR0A 2VPPA 1OXSC 3KKQA 2JJ8A 4YDHB 1XD9A 5A5GA 5LD2B 2PZGA 2JLZA 2BM1A 1DO0A 1Z08A 5HPYB 2WJGA 5FUWA 3QE0A 2ZYVX 4BE7B 4EPVA 3CBQA 5JWRA 5KSZA 5AJWA 2WM9B 3NVAA 3R8FA 1KI3A 3KTAB 5FBVB 2HYIC 3OAAA 1Z6GA 4C2TA 1FL9A 3LX8A 2J3EA 3SU8A 4PFSA 5JECA 4I1UA 1R5OA 4TLBA 3GJ6A 1E0AA 1PLJA 3KFVA 4K46A 2VSFA 2EU8A 2DWOA 1ZUIA 2REOA 3AV0B 4O2RA 2P0EA 2O8FA 4D6PA 1JAHA 5IDVA 1P2TA 2ZI3A 1KMHA 1ZIPA 2EFEB 1UADA 4TMTA 2EFGA 4EJSC 1DG1G 5CDFA 5F2EA 1IQPA 4QOSA 4TMXA 2ZRCA 1N25A 3H84A 3RWMB 4D0LB 4PTLA 2OLKA 2MMGA 1DAEA 4B35A 4L9SA 1T3LA 3BWDD 1KI6B 1SXJD 4Z8XA 3GFTA 3QXXA 4B2LA 3CX7A 4IOMA 1ESMA 3QG5A 4L16A 1OH6A 1YZUA 2V1XA 1Q1ZA 3VR5A 3NWJA 1CULC 2F43A 1SHKA 3K9LA 2IF2A 4NE2A 1US8A 4V0NA 5EE1A 1SQ5A 2GK7A 2JLYA 1KZ7B 4DLTA 4TTRA 5L8VA 3KQUA 1E9RA 2F9MA 1WMSA 1W36D 1Z0IA 3EASA 5EXTA 4CYMA 3I32A 4QG7A 3V9PA 2EVWX 2G0TA 3GQBA 4KSBA 4LRWA 3BFVA 1FNMA 3O47A 1COWD 3TRFA 1T4GA 1Z0JA 2AKYA 2ODBA 4LYJA 4BFYA 1XRJA 1FFHA 2IHBA 1NVWQ 1X6VA 5EZ5A 3K0CC 5M04A 1YHNA 1JBKA 1W0KD 2ZS7A 2ZYTX 5CJPA 2ASEA 4MQBA 4B76A 2QU8A 1M7GA 4KJZA 4B32A 2FF7A 3JVUA 4TT3D 3A58B 3KXKA 2VP6A 2O8BB 1W4AA 2H1LA 2HCJB 1I4DD 1CJMA 1E2HA 1G5PA 3B85A 3G5UA 3T34A 1N6OA 3D8BA 3BFKA 3RRMA 2O8EB 4JLKA 2ZRIA 2DY1A 3VKGA 3EW9A 3I61A 4FCTA 3DO6A 5J47A 4DLUA 4XOIA 1NSFA 2D62A 3LQRA 2IUUA 1NIPA 4BLQA 4GFDA 3B7GA 3QVVA 2BJVA 1D8TA 2MSEB 1AIPA 4A0RA 2VA8A 3I73A 1KKLA 2AX4A 1N5LA 1RKBA 1TPZA 3L8ZA 3ZZUA 5B64A 3GMTA 4M1KA 1AN0A 3I4LA 4KAXA 3SBDA 4CGZA 1AQUA 4I1VA 1KI7A 4ESVA 5AJXA 5KSPA 1U0HC 2VQSA 3KKNA 3UXMA 5JSZB 1L7VC 5JI2E 1KK0A 3EZ2A 5JWHA 3KTAA 4ZCIA 3PEYA 4AIIA 5JBQA 2IYQA 4US1R 4JT4A 4AG5A 4XSHA 4DUGA 4JLOA 5GJVC 2GK6A 2FPLA 3GEHA 4KFSA 1UM8A 2HYDA 2OAQ1 2QTFA 1OHHD 2ZRGA 2PJRA 3ND8A 1FQJA 3TUJC 4YMWA 2FA9A 4PZZA 3WP1B 1KDTA 3THOA 2AHOA 1TQ4A 2FMXA 2G1KA 3IIJA 2J87A 2W2VA 4ZCMA 1N5KA 2BBWA 4G01B 4GSYA 3AVTA 2W00A 4JVNA 1KDRA 4PX9A 5E4FA 2JCSA 4DC9A 1HT2E 2WIBA 2R6GA 4CEJB 5AR1A 3KXIA 3OEEA 4M1TA 1GZSA 3AF2A 4IXNA 4X8OA 2PCLA 4XWOA 4V0ME 2ZRBA 3SJCA 4AY2A 5TARA 3EIHA 1BS1A 3BIFA 1NBMA 2PEYA 2NO7A 3RANA 3NEYA 2FSGA 4B75A 3BH7A 1T6NA 2DHRA 3KQNA 2A5FA 3BH0A 3NBYC 1T91A 2NO9A 4GT1A 3GEEA 1KK1A 1KY3A 4Y0AA 5B30A 1FUUA 2TMKA 2DB3A 1UEIA 1Z0AA 2NO0A 2JAQA 2QP3A 2JJ2A 1GTVA 1EFHA 3MJRA 1XEFA 3WBJA 4B3GA 3AVPA 2CJWA 4ZCLA 2HLDA 2O0HA 2ODWA 5JCPA 2IWRA 3HR7A 4PHFA 2HXSA 2YJTD 2ORVA 2AFHE 4L8GA 2CE7A 3RS4A 3ZD7A 2NPFA 4PR0A 1ZM4A 2ZR0A 4A6XA 3W8NA 1KNXA 1X3SA 1XDBA 1P2SA 4RZXA 1QHIA 5DSZA 2IEYA 4LWZA 1ESNA 1T8UA 2C96A 2O8BA 1YZLA 2BBSA 4PPNA 4Q01A 4ZDKA 4UKDA 3T5GA 1NIJA 4HDQB 5JCZA 3H2YA 2O8EA 1Z5ZA 2CL6X 4HLUA 3CB4A 2VF7A 4GP6A 2ZANA 5FOXA 5J5CA 4RZ2A 1NRJB 1OFTA 4TMVA 2IF0A 1G6OA 2GZHA 2J7PD 2WSMA 2C9OA 3FMPB 3IBGA 4A6PA 1N3BA 2G3YA 2QORA 4JBYA 3I8SA 4M2LA 5FUXA 4CDGA 4DUGD 3AVWA 821PA 3NIBA 4B47A 2WSSD 1XEWX 4PSKA 5DNYB 3KUDA 3CRRA 4RD4A 5CB6A 1F3OA 5JSZA 1CBUA 3FFBA 2J41A 4TYQA 3Q7PA 3E5HA 1T5IA 1TEVA 3QVUA 3FKSD 1A7JA 4QGGA 3AEZA 4Q1BA 4EUNA 1AM4D 2ZAMA 1R10A 4BUJA 3B78A 4D81A 1VYVA 4HB3A 3CR8A 4LYFA 3PV0A 4IVQA 4BZXA 1EFCA 3UPUA 4HAXA 1TL7C 2FFHA 5F9HA 2J7KA 2P6RA 3ZQJA 2ZVQX 3AF4A 4HAVA 2NTYC 2RGNA 3R7WA 4RD1A 4RVCA 2XB4A 4UNNA 1KHTA 1N6NA 2JDID 4OL0A 2GTPA 2OBNA 3SE0A 1II8B 1W48A 2DR3A 4ZKEA 3ZVMA 3KB2A 2PX0A 3F5FA 2HLDD 3LNCA 2JLQA 4KFRA 3MWLA 4RCZA 2VIIA 4KYIB 5E95A 5K8TA 2P67A 1DADA 2QT1A 2W2TA 3IQWA 4GNKA 3UMRA 4ZKDA 4OBEA 4AKGA 1XTRA 3SJAA 1Z8FA 4AD8A 4XSGA 2JIZD 1FPMA 2B7CA 3A37A 1YZNA 2YWGA 2ANCA 4QBGB 3DKVA 3NTUA 1I2MA 5EXXA 1E9AA 3REGA 2BVNA 1GP2A 1GG2A 3BRWD 4ARZB 5IK2A 4DB2A 1N6HA 2ZQ5A 2NO6A 1T3HA 1NN5A 2BEKA 4PO8A 5LD2C 2XSZD 2FFQA 2IBMA 4I99A 2W6IA 4JL8A 1N5JA 1HQCA 2QP4A 1LFDB 1OPXA 3S1AB 1E69A 2G77B 4XJXA 1GL6A 3O8BA 3WYAA 5DGXA 4NPHA 4M4SA 1NLFA 3OESA 4LBYA 3VX4A 1N0WA 3M4YA 5KNBA 2IXGA 2A78A 1XMIA 2F1HA 2GJ8A 5BN4A 4O2LA 5FPYA 2OFWA 1GFIA 2J5XA 2PZEA 3ZVRA 1W1WA 4GP7A 1JJVA 4BFXA 5IRCD 5G3YA 3KQLA 1G6HA 2PCJA 5HCIA 4L15A 2ANBA 1KI8A 1MRNA 2C03A 1U8ZA 4TSFA 4B43A 3VMFA 1E9FA 1F2UB 2BMDA 3ZJYA 5KU1A 4HAYA 2NOAA 2ZI7A 2BEJA 4P4TA 1NG9A 4NL4H 2B6HA 3U3RA 3IILA 2BV3A 5SZKB 4MRNA 2WWXA 2PLFA 4TTPA 4X8MA 1X8JA 4EAQA 2GF9A 4B3BA 3AVVA 3LAWA 2OCYC 1GKYA 3ZDQA 1KJZA 4LK2A 2ODNA 1IXSB 2ZJBA 5TXGA 1PUJA 1SVWA 2RGBA 1U81A 5CM8B 4D26A 1DAIA 1P62B 4QM6A 3HYTA 1PZNA 4BEBA 4G5RA 1HUQA 3KL4A 2REBA 3P27A 4EKDA 3HYRA 2HEIA 4DHEA 2A7QA 4RCYA 2XXAB 2FEOA 2CCJA 1CKEA 4HDCA 1JXOA 5H1YA 2OG2A 1OXXK 1II8A 2FDCA 1UBGA 3NC1C 4I81A 3LY5A 1J90A 3NG1A 1GOTA 4GI7A 3IDQA 1E9DA 3O8DA 4OI1A 4PZYA 4PHHA 3HPQA 2VL7A 3GLHE 4DLXA 1UKVY 5JS8A 3GLFB 5EZ6B 4WIAA 4TMWA 4OQLA 4GOKA 2J1LA 1CJKC 2GHIA 3ADDA 3LQQA 4GRAA 3CRQA 4OJKA 1Q1BA 3EZ6A 5LBIA 4M9SA 3IBYA 1WB9A 4TYYA 1JQLB 1A4RA 1DAHA 1ZINA 1OV4A 3EIQA 1IN5A 4Q9LA 4RZ3A 3P26A 1OKKD 5J4HA 2DFLA 4HATA 4OI0A 2RCNA 3QXSA 2V3CC 4Q4LA 4YXWD 3VR4A 1YJ5A 2KE5A 2R2AA 1Z83A 3L2OB 2ONJA 1X8KA 4D4KA 1S8FA 3LXXA 3CWZA 2ZE7A 3U5ZB 4UNRA 3MWJA 2O8DA 3BB4A 3JZMA 1GVNB 2B8TA 1TQ6A 2OCAA 1U2RA 1E0JA 4N3NA 4C0KA 4DWJA 4F4JA 2C9YA 1SXJB 2PMDA 3KKPA 5L3QB 1EX6A 3AB3A 1X1SA 2OE2A 4HEJA 5CDFE 2VEDA 2ZSFA 3OIWA 4IEIA 5BWMA 2KWIA 3R8CA 3L0IB 2O0JA 4MGYR 1Q1QA 4BLPA 3VU9B 1P7CA 3AUXA 2RGNC 4Q1AA 3MSXA 3K0EA 5EE5B 1UBEA 3BB3A 4LHVA 5E3HA 1JR6A 4AG6A 5TY0A 1W36B 2PEZA 1XCPA 3GJ4A 4JLDA 1VMAA 5J40A 1YRBA 4QGHA 2G6BA 4LJ5A 3KUCA 5BN5A 2FGJA 2RKOA 2IYTA 2OXRA 1H8EA 3AP2A 3LW7A 3QKUA 3PIRA 1W5SA 1DO2A 3OE7A 3QUSA 3AH8A 1K8RA 1CR4A 1A5TA 1YR8A 3B60A 3GJ3A 1WRBA 4R9UC 5G40A 4LOAA 4P4SB 2ZJOA 3L0SA 2ZI6A 4LV6A 3TE6A 4C4PA 3QF4B 1WCV1 1QHHB 2ZUCA 4M9QA 2C04A 2QAJA 3OEHD 4C0JA 2D3WA 4JSYA 4FMBB 3C16C 4DSTA 3GLHB 3PFIA 1QVAA 3QIAA 1ELOA 1ZM7A 2C8VA 3UK6A 4FWIB 3SFZA 3N70A 3DOEA 4C0LA 5K8IA 4HB0A 3BJIC 3TUZC 4B71A 1G8HA 1VDZA 3WP0A 2RH5A 2RMKA 3VTKA 3PEUA 2FOLA 4ITRC 3HDTA 3X1WA 4KYUA 3K70D 1ZM9A 4RZUA 1E99A 1UBCA 2B7BA 1EWQA 4EPTA 5FR2A 1PJRA 1EK0A 1SKYB 2O5VA 1R2QA 2W6JA 2NPIA 2DFKB 4TQ9A 2O8CB 4Q03A 3CUEF 5JHHB 3ASZA 1GM5A 5KYKA 2CLDX 2OZEA 2ZUDA 2GETA 2ORIA 3TIFA 1NY6A 2DBYA 4OQFA 1LV7A 4XD7A 2F6RA 5KTYA 1IXRC 1JPNA 1KTVA 2OM2A 3MCAA 4I4LA 1E2GA 4HUQA 4OQXA 5AJZA 4LJYA 4LPSA 5FI0B 3GLFA 2O8FB 2YHSA 1OH7A 2QMEA 5CYPA 2BWJA 3BGWA 3BOSA 2VP2A 5FBLB 4MGIR 4D0GA 1VPLA 1H65A 4PC6A 3UWKA 1FMLA 3HJNA 1Z0KA 3QEOA 2CLCX 3FWYA 3K0FA 2OBLA 1XB2A 4ZO4A 2RGXA 2L0XA 2MSDB 2GCPA 1I2DA 2F3TA 1XEXA 4LZZA 1DBSA 4OI2A 4RKFA 1E2DA 1M7HA 1RZ3A 4OK6A 2KI5A 3CNNA 4Q7JB 2CXXA 3FMIA 5KOYA 2F43B 5AK0A 4FWTA 4MGZR 1G3UA 3E70C 4R98A 1P75A 2IYXA 4C0BA 1OFUX 1WBBA 1M7BA 1MRSA 4BFWA 3U6KA 2ZU0C 3HR8A 4JLBA 4PQYA 1KO7A 1SXJA 4MKGA 2IYVA 2F9LA 2Q9AA 1R0YA 4BPBA 1IY1A 1ZD1A 4NYIQ 1WA5A 5GJCA 2ZVPX 4DCSA 1ZCBA 3A6PC 3A1VA 3CPHA 3SN6A 1KI1A 2AXNA 4C0AC 1YVDA 4HLQB 1A2BA 1XEWY 1HA3A 2J9RA 3W5IA 1G5RA 3TGPA 3ND9A 1NBME 4CT4B 5F9FA 1G4UR 2Z43A 4Z54A 4W5JA 4XTRA 3SYLA 5TVKA 1CR1A 5IT5A 5HTKA 1NJGA 2GBLA 2H92A 3X1ZA 1R5NA 5D3QA 2QSYA 2YNMA 1XMJA 4AYWA 2J0SA 1ZP6A 2I4IA 3DL0A 4V03A 1K5DA 4FMDF 3ZH9B 4XTCS 2BMFA 3RRZA 2RGCA 2P65A 2P2LA 2A5DA 4XVQA 1COWA 2MMCA 4JS0A 3ZZ0A 3FMOB 3FHTA 1Z63A 2JGNA 4LHWA 1D6JA 1XCGB 3FDIA 4P4SA 3RDPA 1E9SA 1BMFD 3NKVA 1W0KA 3QF4A 1G5TA 1QHHA 2VLIA 2G88A 4B3DA 1N6KA 4EPRA 4IFEA 1R8SA 4TT3A 2ONKA 4C0HA 2GXQA 3U3JA 4B34A 4EQ6B 1Q22A 1QDEA 4OHVA 2DCUA 4F4CA 2H7VA 3SBEA 1ZC4A 4PAQA 1E1QD 3RAPR 1IJFA 5CITA 1Z6TA 2CK3A 4BLOA 5E7IA 4ZPXA 2H17A 3Q7QA 4XD7D 3FKQA 1FOEB 2C77A 1P6XA 4MKFA 3K09A 2XTNA 1TU3A 3DDCA 3W6NA 3WYGA 4BFSA 2ATXA 4M22A 1KDOA 3AVQA 1G7SA 2GKSA 1AJEA 5AUOB 4BLTA 3OHMA 4TMKA 3LBIA 1RRFA 4TMZA 1CRPA 2O8CA 1LS6A 1TF5A 3X1YA 3REFA 4II7A 1XPUA 2GCOB 1IM2A 2GXSA 3A4LA 2XZOA 2XOKD 5G41A 1VCOA 1SVLA 2AD1A 3SS8A 4F93B 1GNPA 5JJKA 2RGGA 2GXUA 1ZU5A 2OHFA 3Q3JB 4RD3A 4Q7LA 3W5JA 1HEIA 2QP9X 3KB1A 1KGDA 2FJUA 3C14C 4W5HA 2HF9A 3VR2A 2QM8A 3N5CA 1T0HB 1OHHA 5DLQC 221PA 3QKRB 5TV2A 2Q3FA 2ZJ8A 3BS4A 5K8LA 1HY3A 2BCJQ 3NXSA 1XBTA 3TVTA 3UG6A 3ONWA 1FP6A 5BXQC 2BMEA 2CVFA 2KB0A 2FZ4A 4Y0VA 4DBLC 4M9ZA 1QBKC 4JMPA 1NKSA 2WKPA 3SZRA 4Q21A 2ZJAA 3W3AA 5A0FA 1GILA 3MRSA 4JLAA 2ZM5A 2AFIE 1ANKA 4LUCA 2FWRA 3U7EB 2WKRA 5CYOA 1X8LA 4WW0A 3THYB 3CIOA 2QQ0A 2Q9BA 5B57C 1Z07A 3RWOA 4DDWA 3QI2A 5C2JB 3TVDA 1C1YA 1ZNZA 2FSIA 2IEZA 2J0UB 1I4TD 1JR3D 2CJWB 3U7HB 5FI1B 3B9QA 2WVJA 2ZS8A 3PR1A 4X8LA 1F60A 2ZROA 4JIMA 1KSHA 2ORWA 2WOOA 2FU5C 2UZ3A 1FZQA 4DIEA 2BBOA 3GFOA 3P20A 5DE3A 4TL8A 3DM5A 4OJQA 4C0SA 2AN9A 4IRUB 1ZIOA 1I4LD 1W46A 4LV8B 1W44A 2BCGY 4RD2A 3SJZA 4GBMA 1FX0B 2OCPA 4LV5B 2V7QD 3EAQA 4FMCF 4P32A 4F7WA 1FTSA 2JLUA 3AVYA 1CR0A 1E9EA 1JEEA 2HF8A 2JASA 1G19A 2V4ZA 1UKEA 2ZSEA 4JBWA 1U94A 2GVDC 1DEKA 2CK3D 3OIUA 1EWRA 4LPKA 1VCMA 2D2FA 1L4UA 2GA8A 4IKEA 5EP3A 4FIDA 1J7KA 2QTHA 3CH4B 4WZBE 2ZEJA 1D2MA 4ON9A 4JKYA 2NO1A 4UXJA 1O3YA 4WA7A 3MMPA 4B33A 1E2QA 3EZFA 2E87A 3QEJA 2H5EA 3ECCA 4EQ6A 1KJYA 2HT6A 2WWHA 2PJZA 4OQNA 5TDHA 5CLQA 3NEJA 4DDTA 2YV5A 1D9ZA 2JATA 4MRRA 2IYRA 3KKOA 2W2XA 5FPSA 4NDZA 4D25A 5KPJA 3ZS8A 1G41A 1R4AA 2GRJA 3RSOA 4XVUA 2AWOA 2J7PA 2JEOA 1ZJ6A 2VHUA 3IGFA 4IVRA 4AI6A 3BB1A 1YZTA 4TLCA 4M21A 1WE2A 2A5JA 2GJAA 4DLVA 2GCOA 3A1TA 1PLLA 2Q9CA 2JA1A 5JLJA 2WSSA 2YINC 1SXJC 1G9XA 1RPZA 3QKSA 4LJ9A 3HPRA 4PC2A 2Q3HA 1A82A 1ZUNB 2CCKA 3SFVA 1KK2A 4X8HA 1W5TA 1IN7A 4Q47A 4B48A 4BQSA 2G9NA 3R7WB 3FKSA 2C98A 3VHXA 1SKQA 4DB4A 2QI9C 3QKRA 5FOSA 1AZTA 2GBLC 5AUPB 2CMKA 4R71A 3LX5A 1W4RA 5FPKA 1YZGA 2FH5B 1HV8A 3A1UA 1AQYA 4URWR 2XITA 4M1OA 4A1FA 2XZPA 3CRVA 5ELXA 2R6CA 1Q44A 3OIYA 3AQ4A 4QHTA 2O0KA 5FBRB 2FFAA 1MO6A 3PEWA 2QMOA 3GLGB 2BOVA 4KHZA 4TN1A 2OLJA 3HP1A 4G5QA 1VECA 4NCIA 5EP2A 1SVMA 4ZIRA 2JDIA 3THYA 1UJ2A 3EC2A 4G5OA 1RRCA 1BYIA 4ACBA 3BC1A 4M8NE 1R8QA 2VHTA 2C95A 2J0UA 2HDNB 2IC5A 2R62A 1U0JA 2D74A 2OFXA 5J4KA 1A1VA 4IXMA 4LSGA 2ZPTX 3A36A 5EP4A 5HE9A 2UVQA 2JLXA 4AWXA 1HYQA 2PX3A 1IN4A 3P32A 1DARA 1GRNA 1MR3F 1G3QA 3K09C 1E1RD 2ZRFA 2JIZA 1LTQA 3EA0A 1MO3A 4QBIA 1CR2A 4MKIA 2QAGB 1ZRHA 3AVOA 1ZM2A 1FX0A 3LFUA 5KHOC 3TKLA 4B2PA 1KKMA 2OV2A 1Q1EA 2AXPA 4F92B 3BXZA 1RW4A 4R2HA 4HAWA 1XZQA 2XSZA 2EWWA 3TSZA 2X8AA 5FTLA 4F4IA 3AVXA 1KSGA 2HUPA 1AA9A 3ICEA 4YMVA 3SR0A 4Q66C 5GVSA 4A0GA 2KBFA 2VP0A 4OHYA 4ABYA 4LBVA 3K9NA 2P5TB 3L43A 3AGPA 4GMXA 5BN3A 1AK2A 1G8PA 1W4BA 4PAOA 5KDOA 1IN6A 1ZD9A 2OEPA 2QUZA 3THWB 1SZPA 4ZDWA 1G16A 1NN3A 4G5SA 2VO1A 1E2NA 2QGNA 3BD9A 3GCGA 4JSTA 4P31A 2IUTA 1HE8B 3CZQA 1P3JA 1P5ZB 2ZYUX 1KO5A 4HUTA 3B82A 3QBVA 2DFNA 3TMKA 5KNDA 4K81B 4DKXA 4XIGS 5EE9A 4BFZA 4P33A 3UG7A 4QNMA 3C7KA 2BBTA 2XJ4A 1ZC3A 3MJHA 4OK3A 3EX7C 3QPVA 1SVSA 5KSYA 1GNRA 3ZIAD 4URXR 4NKRA 2ATVA 2FG5A 1EESA 1NLYA 3T12A 421PA 1NN0A 4WBSA 3PQCA 1VG1A 1J8YF 2QPOA 1QG2A 4CRWB 3DEFA 1DAFA 2Q21A 4A92A 4IDHA 3SQXA 4JVLA 5JMTA 1U9IA 2W58A 4CIDA 4KVAA 5CIQA 2DWQA 5HKKD 3KQKA 2ZAOA 2ZIAA 4KFUA 1LVGA 3NDBB 5C4GB 2GEVA 3UANA 1XTIA 1Z0DA 1AS3A 4LYAA 4WAUA 3U3OA 3MGCA 4E09A 4XWKA 2IS1A 3U44B 2WPDD 3KFXA 1S4QA 3WHKA 1MO5A 5FBWB 4K8OA 3CWQA 1MH1A 1Q21A 1N0VC 3RNLA 3FYHA 1G4AE 3DOFA 4KFTA 4UQOA 1UF9A 4ESHA 2HXYA 2YOGA 3R9WA 2YYZA 1AGRA 2FEMA 2ZI9A 4FW9A 2F7SA 4Q1FA 3K70B 3WRYC 2QZ4A 3GLGA 3Q5EA 4QBHA 4ASUD 1CJTC 3K9GA 2CBZA 1XU4A 3MD0A 3N2IA 4A15A 3CONA 1Z29A 2C9CA 5J4LA 621PA 3AF3A 4CF7A 4PQRA 3R9IA 2QBYA 4V0KA 3SC3A 3I92A 5BW8A 4YC7A 4MRSA 3AKEA 1CJVC 2HJVA 2JJ1D 1TQ2A 1UFQA 2OT3B 2OXCA 5G53C 4BZPA 2HJGA 3AM1A 4HYYA 5FTNA 2ZITA 3IO5A 1UDXA 2WJJA 1Z6XA 3SDZA 2GXAA 1SULA 3VKHA 4J0QA 3H1TA 2VHCA 3NHBA 3MAAC 3QJYA 4KBFA 1U90A 4BRUA 5L3SA 4QBFA 1RRGA 1OJLA 2QAGA 2VP5A 3EZ9A 4R7ZA 3WMFA 5AUNB 3B2EA 2O8DB 1OKKA 1NG1A 3GJ0A 3QXCA 4IDOA 3GLFE 1OYYA 1KNQA 4Q48A 4QHYA 2YWEA 2J59A 1Z0FA 3UMSA 2CHQA 4YXWA 3WYFA 2G0NA 1E2LA 5CK5A 2GZAA 3QENA 3BAFA 1ZAKA 1TUIA 1E4YA 3TUIC 1G291 1KI2A 5GJBA 4N0DA 4OHXA 1G7CA 1RYHA 1DAMA 3T1QA 4L4UA 3QPUA 1NMZA 2GNOA 3JVVA 2QENA 1F2TA 4CW7A 1EG7A 3LRPA 3THWA 2QG6A 4FN5A 4C9BA 3UWOA 2WHXA 4KSCA 1AKEA 1JXMA 2F1IA 1ZNXA 4EPWA 3O8CA 1E2PA 3AGQA 3MG9A 1EFRD 1P9NA 5KDLA 4A9AA 3TK1A 4EFMA 1KK3A 4RD0A 3AKDA 1HURA 1SXJE 4IDQA 2XNSA 4DLSA 4P3YA 1EFUA 2IYYA 2QM7A 3U61B 1GSIA 1Z6YA 2RHMA 1CS4C 4NP6A 4P4UA 3ZVLA 2QA5A 2VHJA 4GL2A 2CNWA 2ZU6A 2NG1A 2QT0A 3B9PA 5B2ZA 4UJ5A 3EIEA 5DH9A 1XD2A 1E6CA 5JI3E 1KI9A 3L0OA 3C4JA 3A4MA 2CL0X 1QRAA 5UKDA 2XTZA 1VYTA 2VF8A 3OEHA 1BO6A 4Q1EA 2WAYA 4JLNA 1IY2A 4RJLA 3ICQB 1PUIA 3DVLA 1G3RA 4C30A 3KDSE 1MABA 3U44A 2A2ZA 3A4NA 3LXRA 3BK7A 4JZKA 4EFNA 2WKQA 2EYUA 1XJ0A 3R20A 4E22A 1ZMXA 4HUQB 4PO9A 4ZDJA 1XMVA 4HLUC 3PVSA 3TNFA 2ZSAA 3KJIA 2QE7D 4M1YA 2VP9A 1OIVA 5BQ5A 4YQFA 2GILA 3H0KA 4MKHA 3PUXA 4TQAA 2VTKA 2NMVA 1DTSA 3K0FB 4M53A 5DISB 1XNJA 1N6IA 3WNDA 1SKYE 2RB4A 1HT1E 4KCGA 5FOUA 5JJLA 1XEXB 4PC7A 2NGRA 2V8OA 4RSGA 1NMYA 3EWAA 4HZUB 3B1YA 4NHOA 3LBHA 3VR3A 1R0XA 3NH6A 1KSFX 1W4CA 2KSQA 4HLDA 1HE1C 3NBXX 4Q4AB 2EFHB 1DS6A 2ERXA 3TJZA 2ZRDA 5JJIA 1YU9A 1Q0UA 2ZETA 4LJ4A 4PPQA 4TZ0A 4UNSA 1OFIA 5H8WA 2P3SA 2BIFA 2PH1A 4G5GA 3VKWA 4GMDA 2BMJA 1DAGA 2G1JA 5C46F 1X86B 1GKIA 2MSCB 1RJ9B 5KPDA 1SHZA 1S2MA 1P2UA 1NP6A 2IA5A 3EPJA 3UIEA 4US2R 5KO2A 3RVBA 4AYXA 3GLIA 4JLPA 2QN6A 1NSTA 1FTNA 1W0JD 1U9IC 3FE2A 1H8HD 2V9PA 2WOJA 3CNLA 5P21A 1KO1A 3M0EA 3CM0A 1M34E 3WMEA 4JLVA 1P9WA 1Z2CA 4UXHA 2ECKA 2CNWD 2PT7A 3T35A 4U00A 1KAGA 5JRZA 1R5BA 3G0HA 1ZM3A 1EX7A 2JLVA 3KXLA 2WIAA 4TLEA 5EUQB 2IWHA 4KODA 4A4DA 1U8AA 2OBMA 2CEAA 1JI0A 2BDTA 2YOHA 1CXZA 1M74A 3EPHA 4JJKA 4DSUA 1VG8A 1JPJA 4JKIA 2OCBA 5LDDC 4A2PA 4F38A 4BFTA 2CL7X 2WWWA 2YWHA 8OHMA 1DELA 1Z2AA 2FSFA 1TQDA 1C4OA 2GF0A 1IBRA 3TAHA 4CEHB 2OFOA 3KZ1E 2I1VB 1XP8A 4OHZA 1E32A 2OAP1 2GZDA 3Q72A 4DIDA 1BMFA 2NZ8A 1P61B 2R9VA 5C18A 2ZRNA 4QJ3A 5FL7D 4LHXA 2GVZC 1Z3IX 3ADCA 2KJQA 4A8JB 2ZJYA 1KO4A 1FNNA 5FTJA 3B1XA 4PPFA 3W9YA 2QAGC 1E1QA 3T1VA 2CE2X 4B3CA 1B23P 4EDHA 2WJYA 2V6JA 2R65A 3MFYA 4WXRA 2B8WA 3OF5A 2HCBA 3T06B 2D7DA 2F55A 1N6RA 3CR7A 3OIVA 1G64A 4M9XA 2QMUA 1D2NA 1L4YA 5JZVA 4AYTA 2ZRMA 1N2CE 3Q8XB 3K0CA 3RS5A 1BOFA 1G3IA 1E79A 4KV9A 5FR1A 1E2JA 4MUBA 1LF5A 3MWYW 5FBQB 2N46A 2XOKA 3IO3A 5JEDA 1G18A 4KVGA 1VKJA 2DFTA 1X1RA 2FSHA 4HZUA 3I8XA 1Q3TA 3LW8A 4V02A 3CF2A 3U7GA 3IPYA 1NF3A 3QBTA 2WJVA 1IONA 4Q4AA 3TSOA 4DLYA 2N1BA 1II9A 2REXB 4DCNA 4KI0A 1E0KA 2ODEA 2ZRAA 3FPAA 4L9WA 1DG3A 4Q9IA 2P6UA 1QHGA 1Q20A 3BE4A 4I1OA 4BECA 1RJ9A 2CHGA 3SEAA 4Q9HA 5H70A 3PUYA 1GRQA 4V0OA 5HCNA 3CX8A 3V00A 4RFVA 1NY5A 1KOFA 1RYFA 4DSOA 4XWAA 1R0WA 5DI9A 1XTKA 2Q0HA 2Z4RA 4LHZA 4A36A 4E07A 4FMCB 5DIFA 3CF0A 2IYLD 4PC3A 1KJWA 3FFAA 1JR3A 3SQWA 3A8TA 2Z83A 1GIAA 4NU0A 5F98A 1OE0A 5J4VA 2BM0A 3QSYA 3K53A 4YMUA 3W6OA 1S1MA 4EIWA 4QM7A 4FD2A 2ZRPA 3K70C 3C5CA 3UATA 4POAA 2IYUA 2ZR9A 2BHRA 2XNDD 3CRMA 3RS7A 4DEXA 2VHQA 4Q7KA 2J0VA 1DE0A 1K6MA 3B13B 4ZV4A 2V7QA 4DCVA 1S3GA 3QQ5A 2GWHA 4WOPA 1ZNWA 5FOWA 2VP4A 4OQMA 5DYIA 4GOJA 4Z1MD 3MUFA 4H1UA 3PENA 3NC0C 4CEHA 4M1SA 3EC1A 5EQTA 2VH5R 1IHUA 1C9KA 1E2IA 2YC2C 1KYIA 5DYGA 2QGZA 2GEDA 1MO4A 2JLRA 3K0SA 4PZLA 2R44A 1P4SA 3QG1A 3RSLA 2QQEA 4A8JA 4N1AA 2YZ2A 3DPUA 4BGDA 4PC1A 5IHPA 4G0NA 1UKZA 5DN6D 5JHGB 4P0TA 3J81k 4Q9KA 1TU4A 1VYUA 4JYCA 3LVQE 1E79D 1D9XA 4AK9A 2ZJ2A 4C2UA 1S96A 1W47A 2NZJA 3X2SA 3B8HA 3QKSB 1WXQA 5CIWA 2AKAB 2XAUA 4KXFB 4E5UA 5FTMA 1IJEA 3VNVA 2H8KA 1HTWA 1TTTA 3MWKA 3JZAA 4TL9A 1RC8A 3TQCA 3TSWA 3ASYA 4D2IA 1TMKA 3FB4A 1VTKA 2AK3A 4PAMA 4LBZA 1NI3A 4JLMA 4AKEA 1RFLA 4H1VA 1HH4A 3ETLA 3OFND 3THXB 3EZ7A 3H4MA 1KO8A 3B6EA 1BIFA 5JRJA 3I5XA 1WBDA 2ZE8A 2QTVB 3QPWA 4D82A 3EA5A 4BLRA 1IY0A 5FPTA 4N0EA 4Q4HB 1XXHB 2WWIA 5K8UA 2D2EA 4IFBA 1OH8A 4ZIRB 4AKHA 1OF1A 4CEIA 1R0ZA 2ZSBA 3F3YA 2CDNA 1NKTA 2EWVA 1TF7A 4ACAA 3I5YA 3SHFA 2P5SA 4D4MA 4DSNA 3IEVA 2Y8EA 2ZRHA 3IEUA 1K5GA 2R6FA 4IOKA 4JVSB 2PBRA 1W2GA 1S9DA 1JJ7A 4IEEA 4LJ7A 1JQJC 3Q9LA 4MYCA 4BEJA 1ONBA 5FH9A 1II0A 4TL7A 1G20E 2B92A 3C15C 3GLGE 5KUTA 2Z0MA 3DMDA 4PSAA 4JJZA 3VFDA 3SJBA 4Q5IA 3SOPA 3T61A 1QZXA 2ZJZA 2ZRLA 3LLMA 3SYKA 2H18A 3FHOA 2A9KA 4QJ4A 1E1RA 2XTMA 3QOFA 2PT5A 3NBZC 2CCGA 2XB2A 3FOZA 1YR6A 2AWNA 4AKIA 4YONB 3K1JA 2Z4SA 1XPRA 3LA6A 4E03A 3C41J 2H16A 2BC9A 3C5HA 4LJ6A 4AURA 1P73A 4QHSA 1VIAA 4HSEA 1UKYA 3AP3A 4OHWA 4NTZA 5KNCA 1AS0A 1M8PA 3K0AB 2E9SA 1SGWA 3ZGXA 1W2HA 3FTQA 3DZ8A 4Q7MB 4DDVA 1E2MA 4O25A 1TNDA 5G3ZA 3CF6R 3BERA 3VHLB 2I3BA 1KY2A 1VG0B 4W5WA 3LDAA 2ERYA 1LS1A 1GITA 2E1RA 5EE3A 3MLEA 4M1MA 4U5XA 2G83A 1CRQA 3OAAD 2R6AA 1NVUQ 1TF2A 1QHYA 4WXPA 1KDPA 5E7MA 2YOFA 5FOVA 1U0LA 5EXSA 3KJEA 2WZQA 2EYQA 1J70A 3LBNA 4A0FA 3ADBA 3N2EA 4LDJA 1XX6A 4B3XA 1E9CA 2BKEA 2FFBA 4MITA 1E2KA 2QEQA 4M0LA 3ZIAA 5C1BA 4MYTA 3V4FA 2PLRA 2C99A 1OSNA 3W8RA 4QGAA 3IIMA 2KBEA 1W36C 1J2JA 3THXA 2GAAA 2D4HA 4PHGA 5E7JA 1NMXA 2IS4A 1GRRA 1GWNA 4LGMA 2GEUA 1NN1A 3FGNA 3ZS9A 1EFTA 4URYR 3ZYCA 4BASA 3GJ7A 4Q4HA 3WMGA 5FOTA 2X2EA 5BYKA 1GDDA 1YR7A 1OT3A 1Z6AA 1M6NA 5HKKA 1XXHA 1VHTA 3ZQ6A 1LY1A 4DJTA 1VCNA 2IHYA 2ZS9A 3D7MA 1OLOA 2WPDA 4YMSA 4LJAA 2QBYB 4MDFA 2A5GA 1SVOA 2FE4A 2J45A 1E4VA 2OILA 3B1VA 4Q4JB 1VG9B 3RYTC 3ZD6A 4D4JA 3I1FA 4NYMR 521PA 1KI6A 1OH5A 1S3SA 1RRPA 3HU3A 4URVR 1BH2A 4W9MC 2LKDA 1CP2A 3U3KA 1OYWA 4ASUA 1P9RA 3TW8B 3VQTA 2FN4A 2ZREA 2QY9A 2ZI5A 4JBXA 3IUYA 4B2IA 5GJWC 1OXTA 4A8JC 3RABA 3P1JA 5L3SB 1OFHA 4Z8YA 1KZGB 3PXGA 4GDFA 2XX3A 1XZPA 1UDWA 2J46A 2JJ1A 4NYJR 3LV8A 4OYHA 4RD6A 1NJFA 1MT0A 4BFVA 1R6BX 4EFLA 4Z51A 4BFUA 4TYWA 1CTQA 3C8UA 3P4XA 2F1RA 2OUKA 2IW3A 1NVXQ 1Z47A 4TWZA 4DEYA 4NH0A 3UMFA 1GKUB 3WRXC 4MDEA 2Z5FA 2IK8A 3X1DA 3V4RA 5JFGA 1E3MA 2Q3MA 1F2TB 1TUEA 3BORA 3LWNA 3E1SA 4TYNA 2O52A 3A1SA 3T15A 2DYKA 4IDPA 2WICA 1NVVR 4XH9B 3WXMA 1VCIA 2XZLA 3K0AA 4LI0A 4DT1B 4MH0R 2IYSA 2WMNB 3U7FB 3L8YA 5IF9A 1DOAA 3CPEA 3WHLA 2IUSA 3RS3A 4CT5A 2IS2A 5DI3B 2FX3A 1QHSA 4OI4A 4ZDIA 1V5WA 1XWIA 3QY0A 1XMSA 3GLIE 1ZNYA 3KKMA 1QVRA 4KLZA 5AJVB 1TADA 3KJHA 1YR9A 2B21A 1EFRA 4QFMA 4DXAA 3GP8A 3IPXA 1ETUA 1XD2B 4NZYA 4QNRA 1D2EA 5DHAA 2QROA 3TBKA 1T9HA 1DAKA 1TX4B 1CIPA 1QHXA 2AD5A 5GADl 2V1UA 1GAJA 1YE8A 2GDJA 3P4YA 4PQFA 5EXPA 3RHFA 4AC9A 2WTUA 2IL1A 1XJQA 1RIFA 1IAQA 1UEJA 2ZSDA 3QNUA 2BJWA 2SHKA 1T3SA 1MABB 2JLWA 5AUQA 5FPHA 3W3ZB 1GNQA 3OEED 4TL6A 4YLGA 1YZKA 1T0JB 1QG4A 3L0PA 2WWYA 1E98A 3A1WA 1NBMD 4FCVA 4QC2A 4QGFA 3D31A 1Y63A 2A3RA 2Z6VA 2VSOA 5CK4A 2NIPA 1Z22A 3B5JA 1XFAA 3U60B 4JL6A 4TQUS 2FZLA 1PVOA 4CEJA 1UPTA 3CZPA 3D6TB 1XCMA 1O87A 4Q4JA 2WMOB 1CF4A 1JB1A 2JJ2D 1Z06A 3EXAA 5AJYA 2W0SA 2CLSA 5JS7A 1OB2A 2AR7A 2QE7A 4JVMA 5SZJA 3IKJA 2EFCB 3K9HA 2PL3A 1S9HA 5LB2A 4B3FX 4RY2A 5TB5A 3CH5A 2RAPA 2W0MA 2UZIR 4US0R 3GPLA 3AKCA 1YZQA 4UNQA 1U98A 2ZRJA 1YQTA 1S1CA 3B1WA 4A2QA 4QKQA 1TEXA 4WVFA 4RFSB 4HB2A 6Q21A 3TH5A 4ERNA 3HU2A 4JT2A 1ZCAA 2YVUA 3I72A 4B44A 4RKEA
chains in the Genus database with same CATH superfamily
2WBLC 1K7YA 1XQ1A 4D96A 1YIDA 2WAXA 5JD4A 5JE8A 4C4TA 2ZWAA 3KJGA 4LYHA 3VNUA 2WQ6A 2FRDC 1SCUA 4G3XA 2HHCA 1SO8A 4YRNA 1HOXA 4JLWA 2GJ4A 3WNZA 2P9JA 5G0TA 3ROEA 3O74A 3SYNA 4R05A 1GU7A 4DJ5X 1L1FA 1OXMA 4IH1A 1FSPA 4ZYWA 5DHFA 4WCFC 5EPUA 4HI0E 1LW7A 4KXUA 1XIVA 3AG5A 3CQ9A 2EW1A 3HU1A 4HDOB 1HF3A 1XFDA 3AUSA 3GEBA 2PBLA 3A6KA 5JO0A 4U9UA 1Z82A 4ILEA 4YRTA 3U4CA 3HYSA 1EFDN 4HAZA 2BI7A 3PDIA 2Q6TA 4OFXA 5DI3A 3BHMA 4PYLA 4F9GA 1ORVA 1M2HA 1USGA 2VF5X 2GSWA 4IDDA 3RFTA 3WY9A 2O54A 1L8QA 3DTVD 1PNRA 3JD1A 3AEYA 4MDHA 4M1WA 1NXWA 1U2QA 1JP7A 1GA1A 4J0IA 1T5LA 4MYUA 1KVRA 3KEOA 4PANA 1RYMA 2FFJA 2IX3A 2BONA 4JI4B 5BQOA 1Q12A 3AJAA 2VSXA 5IMSA 1SHLA 4P3KA 5HDBB 5F3WB 4YREA 2WMDA 3KQMA 3E3MA 3L9WA 5BSKA 2C4KA 2RC6A 1QFSA 2R8OA 3AHFA 4GKBA 1KWKA 1JMYA 4WEQA 1JR3E 3R3VA 4JB2A 5FADA 4V0MA 1BC5A 3TQFA 1XPOA 3DOHA 4BTLA 4HLCA 4YUAA 3WSTA 3RHSA 1N32B 1SBQA 1Z7EA 2NUAB 1NAIA 2A86A 2K5UA 2O7NA 2NUTB 4RPCA 5IM5A 1SVKA 1AHPA 1STOA 4DM7A 3E2IA 4DPLA 4JYPA 4NYJQ 2E3JA 3OD1A 4K26A 5D6OA 1KSJA 1PK9A 2VT3A 3DE4X 4DCGA 1U7HA 4MWGA 2XH8A 5KINB 1P7WA 2I2CA 3SHQA 2CDAA 4Q02A 4K1LA 2H4FA 1Q0SA 1XJCA 4NYIR 5DLEA 4TTSA 4IDBA 3MHTA 3GIWA 3AB8A 5J4YA 1SK9A 1GPWB 4OLAA 1MAWA 2IE8A 3TPZA 4LC1A 4G8DA 1JALA 3OCYA 4LJ8A 5EIHA 3IIKA 3W2IA 1JKJB 1E1YA 1PGNA 4PRKA 2O59A 1KMQA 2WSYB 1RHMA 3ADKA 4QRHA 4TLDA 2IZ7A 4DQVA 2YW9A 4CCYB 3OZEA 4KO8A 4E21A 1IUOA 1NVVQ 5E8RA 3S99A 3VUEA 4B4OA 1FQKA 4DR1B 5HJ2A 1IWOA 2BEWA 1Q6YA 4FMPA 3EMBA 1LNZA 2FQYA 1U2GC 2QD3A 2GA9A 2ST1A 3IH5A 3OMLA 1UDBA 4HNQA 3RCBA 3ZVNA 2ID4A 3VPXA 1CLUA 2HO5A 1N1MA 1FY2A 3F49S 4NMMA 4OREX 5JYEA 1MB9A 3TI9A 3AF1A 3C6YA 2LCQA 2FWPA 2JAHA 2PMKA 7YASA 3QEBZ 2BGWA 2IPMA 2GJ9A 4WDQA 3G0DA 3PITA 4DLBA 4CMIA 1V8FA 5A9TA 1DUSA 3PXDA 1A9OA 1FXWF 1GHTA 1P2VA 2HSDA 3R4CA 1JXAA 1S01A 3QTTA 4JCCA 4NCKA 3UFXB 1G7TA 3U7JA 2IHUA 1ZCZA 1JQDA 4H27A 2R85A 3V1TC 3V3KA 3WVNA 4ZI3A 4MR8A 2D6FA 5HR5A 1SQSA 1SXGA 4H1TA 3BJZA 3SEFA 4I1SA 1YULA 3ZXIA 4DJJA 1C0KA 1IB6A 1TA9A 3BRSA 4GPTA 1MJ5A 1Q3HA 1UDRA 5EE0A 1DPFA 1YQUA 4DAEA 2E18A 2ZBDA 4EYOA 2QOEA 2QL6A 2IEDA 4IQ8A 4M8SA 3KEQA 4B74A 1VL2A 4N3BA 3E7PA 2HA0A 4X63A 721PA 3IP1A 4QQKA 3HB1A 3VNQA 3AILA 3DGFC 1KIMA 4UATA 3OURA 3PFKA 1U0RA 3TNLA 4RA9B 1DKUA 1M83A 3FHCB 5D51S 4RKRA 1Q15A 1UEXC 3I5UA 4KOAA 1C7FA 1JFVA 4JP1A 2CUTA 3RIGA 1EWYA 3CZRA 4B6PA 1DGQA 3FNHA 3KV1A 1WXEA 4QOJA 3U3MA 1U2EA 3FTDA 5E9QA 4EJSA 1NVAA 4HQFA 4JA2A 1JBEA 1DRJA 2DPXA 3UAZA 1SQGA 4FYHA 3D3EA 1GL7A 3GRYA 3IV7A 3Q3IA 4B40A 1VIYA 2FR1A 5C9ZA 3EODA 2JFWA 3GZTB 3KNZA 3UKDA 3I04M 5FUVA 5CCEA 4MP8A 1W49A 1BWSA 2C7BA 2Q27A 4RM3A 1OU4A 1F2UA 1GZUA 4GM0A 4HAUA 5JSFA 1QOPB 3GY0A 3R7AA 3CNOA 3QLUC 3SR3A 3U2QA 4L27A 4ZWNA 2QSUA 4H7JA 1JECA 4LCEA 2QR3A 1WCXA 4QTUB 3DHNA 4FOSA 1RACA 1PV1A 5LP6A 2WTXA 3G6KA 1TEHA 3NHKA 2CBGA 1KOJA 1L9KA 1I7PA 4MWEA 4DC1A 2J0EA 4EPYA 1G59A 3FMFA 4GZMA 1NLZA 1ESDA 1Z5GA 3CKLA 5KWVA 2H65A 3Q7TA 2QUHA 3PJRA 3GEIA 2A30A 3BL8A 5IJ0B 5FWXA 3E22A 1WXHA 2HNBA 3MCTA 2Y0BA 2IXFA 2CXRA 1WDKA 4KP7A 3KQSA 3SDSA 3WSWA 3OQIA 4F6CA 3BL6A 2C5HA 1XA0A 5ANRB 3IAHA 3QXHA 2Q1YA 2WHYA 2LWIA 2BKUA 3GIDA 1P2BA 2CXHA 4UU7A 5DN6A 2IYZA 4R3WA 3R1IA 3N7AA 5CM9C 3X1XA 1P0PA 4PZ9A 4ZODA 1X7YB 2V0NA 2SKEA 4AU1A 3F0TA 3M1IA 3DTYA 3EARA 3H9QA 3OT1A 1FBNA 3P45A 2F1JA 4LY6A 1ZL2A 2FMKA 5DOVA 4YRKA 4BWFB 5A04A 1F48A 2QMHA 4LZLA 1ZKDA 3IQFA 2BMAA 4RPKA 2FCRA 1E2EA 4KMSA 1IQ0A 5HTOA 2HIGA 2C97A 5HIKA 4LXUA 5I5GA 3T3HA 3R74A 2DETA 4N5NA 3WRVA 4CM4A 4HQRA 3E0QA 4YP6A 3NBFA 3Q5GA 4LMBA 3NU1A 4UPEA 2BUBA 4Z5XA 1R8YA 5HZHA 1WO8A 2OSBA 4DVGA 4INZA 1TAGA 1VJDA 2Q3JA 2JZNA 4IV0A 1ABFA 4E08A 1DLIA 3GRPA 2P6NA 2YZNA 1T8TA 2FW0A 3BMCA 3FR8A 4LNUB 4WZ6A 3UHFA 1D4AA 2I80A 3RFVA 4GOXA 3EAFA 1OI7A 4BUCA 3JYHA 3I0ZA 5JPCA 3T1TA 4NZMA 1WNFA 4X6YA 1GUDA 1LQUA 1ORTA 2OQ2A 3AUUA 2QB5A 3GFPA 2D1SA 4Q18A 1CUSA 1TK2A 3VZRA 2OO5A 3PYLA 3WBKA 5L3VA 4ME6A 2QY6A 5DWVA 4J0KA 4Y9TA 1LCIA 1WF3A 2OK7A 2PFGA 3G9ZA 1G17A 3ZZNA 1XAIA 1YRAA 2IHVA 3QXJA 3BKWA 2HADA 1AQ6A 1E18A 4J91A 3RC3A 2ZYIA 4TT8A 5LIPA 3OFJA 4QDKA 1OXVA 4DV2B 4JH0A 2ZE5A 3KVVA 3DDNA 1YB2A 5F4ZA 2PTHA 5E7QA 2VHEA 3WLLA 3EQ7A 3HTXA 4UBIA 4AZ3A 1A72A 1G8JA 4OXRA 1IAVA 1G5FA 1KZ6A 3SVTA 3RJ5A 3S6JA 3DC2A 1LJ8A 4OK5A 2AUMA 4UNPA 3RKUA 1WMFA 3KTOA 1MD9A 4EYGA 3CW8X 1N5IA 3OTGA 1YMQA 3ZTYA 1RR6A 2X0JA 4NCHA 4DZZA 1LBIA 4TTQA 2BRUA 2EKPA 4D74A 1Y7HA 2DWPA 1H8ED 1OIXA 3GVPA 3HWX1 1AXGA 1FA9A 3MUEA 5FUYA 2R97A 2WFLA 4DBVO 3IT3A 3OE7D 3C7AA 3L6DA 3MLBA 1C9NA 4Q00A 1RZRD 2X9GA 3VU9A 4O2AB 2NU6A 2RGEA 3F9CA 3IP3A 3KKZA 2PZFA 5KVCA 2OG1A 3PFFA 4WV3A 3JZDA 2ZYWX 3OC0A 3UO8B 4ENRA 2UXBB 4BZQA 5KX5F 1AZLA 1RRVA 3UVEA 4C0XA 5CT5A 3ZU5A 5FNVB 1R4NA 3NYRA 5IKPA 5M5BA 3ADPA 1CQJA 4FCWA 2BFMA 2XEXA 1ML4A 3HCCA 3ZC3A 4GPEA 1EGAA 4HBGA 3VAYA 2PWAA 2EDCA 1DRWA 2VRWA 4RTPA 3VSEA 1XCOA 1U0TA 2RGAA 4HDAA 2V6IA 2X77A 1OW3B 3ET5A 1L5HA 2NQ2C 3SBXA 2XV1A 4KO1S 4JDUA 2WD7B 4M9CA 4D0NA 5JZ9A 3NH9A 4N8EA 3JARA 1HYBA 3RK4A 1KYTA 4FINA 3GJXC 1M8GA 1PKXA 3CO5A 1JA0A 1C3OB 5JTTA 1JU4A 1EFPA 3VUFA 1B7GO 3PC6A 4REOA 1K5HA 5BYJA 3D3WB 5IBCA 1JEDA 4XQGA 3G1WA 2WRZA 1R0KA 4YUZA 1FVOA 1QHNA 1SC1A 3D7SA 4LBWA 4PXAA 4BFUA 1LDNA 1GNVA 1OXSC 2JJ8A 4GKJB 3G6WA 5LMCA 1QIIA 4LWQA 3SYRA 1C5KA 1ZDMA 2DULA 3CWCA 2FI1A 1XQXA 5KSZA 5FUWA 3QE0A 4NDAA 1WTAA 2O2EA 4II3A 1GCUA 1DDOA 4HNVA 1QM5A 4Y2HA 1KI3A 4OUDA 4Q82A 4UDNA 1SRQA 4D6XA 1A4UA 1GG9A 8ABPA 5FLEX 1F20A 1YC5A 2J3EA 2WWTA 1A0OA 3T7TA 4FFDA 2HU2A 5JECA 2DEUA 1KFEB 4FFBA 5D84A 4EMBA 1GGNA 1L4GA 2AG6A 1RT9A 1E0AA 3GEDA 2NT4A 4FLEA 1V16A 3K2BA 3KFVA 1CE8B 1GR0A 1NMSA 3UOAB 4RETA 2GZRA 2GN8A 1XNGA 4XX0B 4R1NA 4A5SA 2WIFA 1MQAA 4JNCA 2K6GA 2ESRA 1P2TA 2VYND 1KMHA 1UCFA 4L28A 4QVKA 1XA4A 3OU6A 2PUWA 5HCUA 5T8KC 3SZOA 1IQPA 1MFZA 1CQIA 1JSZA 2OLEA 2ZRCA 3ENZA 5CX1B 5G0UA 1T1IA 1N7GA 2KS6A 3A4IA 2GT1A 2YFHA 3OPXA 4H1HA 4N8SA 1C7ZA 3RWMB 1N2GA 3FVRA 1GAXA 1UK8A 2KLBA 4B35A 3TF5A 4AM8A 4RFLA 5TE9A 3JTEA 3QTLA 3K6KA 4N7MA 3BWDD 4JBGA 4IFTA 3IOEA 1QQTA 4KN8A 4Q37A 3VRHA 2F00A 1N8KA 1VIDA 2JW5A 4L16A 2OD2A 1OH6A 3PC8A 1Q1ZA 3NWJA 1CULC 1PL6A 4IH9A 1T9GS 4K5QA 1AKWA 4LMRA 2WM8A 1WXFA 4YQYA 4NE2A 3PTLA 1BU5A 1BRTA 1CD5A 2GK7A 3O0TA 9LDTA 4U6QA 1KZ7B 3DWIA 2EL7A 2HRCA 3J7TA 4H7IA 3GDOA 1DXQA 2Y1GA 1AUOA 4OATA 4DY4A 3EASA 5KNDH 1JDZA 4RGVA 4KSBA 1BQEA 3GRAA 3PE6A 2F3QA 2I7TA 5A7HA 2V7GA 4UTVA 1TXGA 1EAMA 1COWD 2GYYA 4ZAFA 4FR5A 4QEKA 1M2JA 2QLNA 2DG2A 2ZUEA 1O9HA 1NAHA 1LRLA 4RF2A 4RLQA 1XRJA 1M33A 5A0VA 1RCFA 4JWKA 5EZ5A 3V7UA 3OZDA 1YHNA 1E5XA 4P3PA 1NXQA 3C5VA 3SZLA 4MQBA 1WY5A 1H4VB 2XYHA 3G8CA 4KZKA 4X20B 1U9ZA 5FPPA 1DC4A 4LXQA 4E4TA 1YO6A 4TT3D 2VSNA 8AT1A 4WCVA 5BO5A 1Q7CA 2QTMA 3U13A 4BMZA 2VP6A 3P9IA 1GZ3A 2X23A 3HA5A 2YZMA 4V0SA 1YBAA 2Q1XA 2F48A 1E2HA 4B6GA 3B85A 3F6PA 5LN1A 4HX2A 3BFKA 3RRMA 4DMKA 2HOQA 2MU1A 2DY1A 4F6RB 1MVLA 4P92A 2C8JA 2D0PB 3EISA 2Q1TA 1T3ZA 5M29A 1ZISA 1DWUA 4UFPA 2IUUA 3NT5A 3RYHB 3H11A 3B7GA 2A9FA 2OP0A 4MVWA 4YYZA 5IK2D 3QVJA 1D8TA 5EQFA 4MS1B 1A7AA 3H8JA 2VA8A 1BE1A 2BDUA 4DVJA 1CUWA 1KKLA 2AX4A 1TPZA 3C2QA 2BFAA 1RQPA 3ZZUA 2Q29A 3F90A 1YMVA 3I4LA 3SBDA 2R48A 1XNRB 1AQUA 1QIHA 2WIJA 2YJZA 1N2JA 3E6AA 4R0NA 5AM2A 1CQZA 4ESVA 1GRCA 1SG0A 2C2XA 1C50A 2AQ8A 3TFQA 5JSZB 1L7VC 1PQ4A 2QTRA 3HY3A 4OSPA 3BK1A 2BF4A 4ZCIA 2FWAA 2XECA 3NVDA 4N41A 2PS1A 4US1R 3ZX5A 1VE6A 2YY5A 3IT0A 5JG7A 2J9FB 1LC0A 4RANA 3OVMA 2ZCJA 2YICA 5GJVC 1TTQB 4K8RB 4W82A 5AVQA 2HYDA 2ZRGA 3ZU6A 4E1VA 4X93A 1SUBA 1GGFA 4JOSA 2PJRA 1WPXA 2GPYA 3FMVA 1FQJA 2JRCA 3FETA 5EFOA 5BSGA 1I3KA 2V45A 1H2XA 1XG5A 4NMHA 4MQ4A 4OV6B 3TG8A 3T95A 3HVIA 9ATCA 3R8XA 4P2GA 3DLAA 4CPDA 2J87A 3HN2A 4ZCMA 1N5KA 2GCGA 3PXUA 4GSYA 5LYJB 3AVTA 2W00A 4NMLA 4PX9A 5E4FA 3RIHA 4X94A 3TO5A 4MHOA 2NZ2A 1YJBA 4YT5A 4CFSA 2XCOA 4U0KA 3PSHA 1QH8B 1BQ3A 5TQ0A 5IN4A 3OEEA 5ALWA 4XWOA 4XFJA 2C2GA 2EGUA 2XMDA 1CUDA 1NBMA 2J07A 3GBPA 3RANA 4FYVA 3SIPA 4D9EA 1PD0A 4E5NA 4FBGA 2O5EA 2DHRA 4N9QA 2O2IA 5IWCA 3NR2A 3ITNA 3NBYC 2VHWA 2QQGA 1SA0B 4BX9A 3GEEA 1KK1A 1TD1A 2O06A 2XWJI 4PEVA 2E82A 3CZMA 3NKLA 2TMKA 2VQ6A 3FCAA 3AU8A 3L0DA 4GM4A 3QP9A 5HDQA 1Z0AA 4YRIA 5ALQA 4GOND 2EHDA 3ECSA 3VHRA 1PE0A 3FYUB 1U8EA 3L4JA 4ABTA 1BMTA 3CUWA 1XEFA 2OV4A 4TV9F 3WBJA 4B3GA 2NQTA 3O7MA 4R1SA 4ZCLA 3VSAA 1XZEA 3Q6MA 1KEPA 4X7BA 3CVUA 3HZZA 3L1VA 4QT4A 2JKZA 2V6MA 4F6LA 3RS4A 5E1MA 3A04A 1BXGB 2QJTA 3RSSA 4BV2A 3ZD7A 1UDCA 3PE4A 4PBTA 4PR0A 2E4AA 2P1ZA 1ZM4A 4LISA 3PUJA 1R0BA 1KJJA 1N7JA 1NRWA 2OC9A 3W8NA 1CNFA 3HXQA 2PUDA 1VJGA 2JLAA 1AGYA 1QHIA 2H8GA 2Z5LA 3N6VA 3TLGA 2IZ6A 2MJLA 2VC2B 3V4SA 5CPBA 1K8YB 4PG5A 3HJCA 4HT3B 1Y48E 5BUSA 1B8PA 1P1JA 3EXIA 3T5GA 1WSAA 4M88A 1JTEA 2VJDA 1ARZA 5AKKA 1B0PA 3OO0A 5TR9A 4YP1A 1JVNA 2CLFB 5A5FA 5LMNB 2VF7A 4AMBA 1SBIA 5BN4B 5I9IA 2C4TA 1NRJB 3C6BA 1L5OA 1OFTA 2O6LA 4TMVA 4UARA 5TGDA 4ITUA 3RW9A 4FNGA 3THRA 2XMQA 2WSMA 2C9OA 2H00A 4KAFA 2CYCA 5EKTA 3UT6A 4EY4A 1CW2B 3ZQ4A 1DWQA 1H0HA 3I8SA 4RV4A 2MWMA 1NVKA 3TIVA 4EP1A 4N0QA 2VUTA 3IAAA 4KXXA 1W52X 4OMUA 3Q7RA 3ORQA 1A98A 1IMJA 1N4DA 4D56A 1JG6A 3KUDA 1JKIA 5IUKC 3CRRA 1MNQA 2RGUA 4RD4A 4TGLA 5C3UA 3DR5A 2UV8A 5J5VA 1PO7A 2XDAA 5H9WA 2EDAA 2YWBA 4PZ0A 1IWPB 1O1YA 4D9KA 3O4IA 5CXSA 1GCIA 2R8YA 4Z9FA 1T5IA 1TEVA 1ZGGA 3WL7A 3DOOA 3IB6A 3FKSD 4WBXC 3PIDA 3FZYA 3HEBA 3RAJA 3OSZA 4K9DA 4X1YB 1NSYA 3JAKB 4C2AA 2AFIA 2ZAMA 3OI7A 3ZZMA 1VYVA 4XVHA 2HDWA 3HABA 3F5MA 1VIMA 3G5TA 2ZSKA 3PV0A 1QHEA 2HCTA 4G26A 5FP0A 3A3KA 2VUHB 4HXGA 3UPUA 1Q0QA 4TKUB 2WV7A 4HAXA 1TL7C 2FFHA 1I3CA 5TPWB 3VJRA 2J7KA 4DPMA 1PJ2A 1TKCA 4IKOA 1NFRA 3QYAA 3ZHBA 3ROQA 3AJ9A 2MHCA 3QX8A 4C2BA 1J56A 4I9HA 4D99A 5BV2P 2XVAA 3PBKA 1UBNA 4UM5A 4FS3A 3DZFA 4F8YA 2XB4A 2B82A 4MJ3A 4MQFB 5DX8A 1IE3A 2H6EA 3OX1A 1XVAA 1FYXA 3AWDA 1KHTA 4IL5A 1GQ2A 1N6NA 2JDID 1NC3A 3C3MA 3TZBA 3Q6IA 4E4RA 2ZAIA 4M0PA 5T7BA 3Q8MA 5SYAA 1GFZA 1QYWA 1KE2A 3C85A 3O91A 3ZU2A 3ZXUB 1II8B 2P4UA 4EX6A 2LIVA 5K3SA 1U63A 4Q3LA 3Q41A 2JANA 2PX0A 3PC2A 3CA8A 2VWQA 3CJRA 4OXYA 2VIIA 4WESA 4KYIB 5E95A 2Z8XA 5K8TA 5FUBA 1ITZA 4LRQA 3ISVA 1OYOA 1FNCA 2BGIA 4GNKA 1TCAA 4IJQA 4OEHA 4YAUA 4AKGA 3PNKA 3DVAA 4L4ZA 3P52A 5IC5A 1DCTA 3A37A 2B7CA 2YWGA 1TKAA 4CV1A 4NATA 2ANCA 3IMGA 1Z25A 2A92A 3NTUA 2B83A 2P75A 2Q6OA 4J90A 3CKMA 1E3LA 2BVNA 3TZKA 3ZHXA 4BV9A 2OORC 2V6GA 2NO6A 3IP5A 3IUPA 3NT4A 3VVBA 2MSKA 4D4IA 1NN5A 1Y7IA 2P41A 3DEJA 1KQ3A 3GGPA 1LLDA 1T5OA 2XSZD 3OJ0A 1DUVG 4W5RA 1JPVA 2FFQA 3PA8A 4IIJF 1IIBA 5AK4A 3KPJA 3CX3A 4X61A 3L7NA 4FXOA 1N5RA 2RHBA 3D1LA 3TCKA 1XDUA 4E12A 1LFDB 1XDGA 1XRRA 2DTXA 2NSHA 5DWQA 3L8HA 4N0PA 2H1CA 1P77A 4DCMA 3GNQA 3FBTA 3Q11A 1F7UA 2QMYA 5EHIA 3MXOA 4RKWA 5F64A 1XMQB 4EO4A 3L7JA 2O7VA 3O8BA 5C8YF 1RQNA 4NPHA 4BMNA 3OESA 2QG4A 4LBYA 2WK1A 4UU8A 1K0UA 1G5IA 2I54A 3BXHA 4GECA 2A78A 1HDEA 1FTQA 3K4PA 3MTIA 4EA9A 3K6SA 1YFKA 2OFWA 4G4IA 5AVVA 2J5XA 3IKTA 5JSHA 4Y1RA 5KNDD 2B8JA 4IQ0A 4XE5A 5ALKA 2GTIA 2HEGA 3B1KA 5JBIA 4OPMA 2PCJA 4D5EA 1TEZA 2ANBA 2C2BA 1PR5A 3T7DA 3W5HA 3N9IA 5CBPB 1RJDA 2R6ZA 5LSAA 4TSFA 1DV1A 2D1TA 2RBGA 1E9FA 3ZJYA 3VH2A 1PJCA 1P45A 1USUA 4HAYA 4MIKA 2NOAA 2ZI7A 5U4XA 3SPXA 2BEJA 3JVIA 3PKIA 2CXUA 4P4TA 4O1MA 4TRNA 3RYFA 1M1NA 3GGCA 1Z2PX 2SBTA 2B6HA 5SZKB 3ZHRA 4HADA 2F8MA 2OP1A 4OOEA 1X8JA 4RMNA 5IDYA 4EAQA 3GMIA 3FPKA 3PHGA 4GRIA 4K88A 2FW6A 2O23A 4MWBA 4B3BA 2A58A 5HQJA 1ZSNA 4BO5A 16PKA 1GKYA 2QS9A 4JQYA 1C1XB 5CFQA 1EMDA 1BZYA 3DMHA 2O7QA 2ZJBA 4PGMA 5D8DA 3ABOB 3MNFA 2HA7A 3RYIA 3L6BA 4HYQA 1XMPA 2X8LA 1GPJA 4I9GA 1JL3A 1QXSA 4NJOA 2CUNA 3LDUA 3UAVA 1N1GA 4JI7B 1WU7A 2PBFA 2FZEA 2NVWA 1WW8A 3DBHA 3HYTA 4GE3A 2EZ8A 2REBA 5G4KB 4BVJA 1TIKA 3AFGA 3HYRA 1VRWA 3NBAA 3S81A 3LT5A 1GTJ1 3BDIA 3I53A 1KS9A 4DJEC 1KZYC 1NC1A 1P4RA 3LQKA 4JUFA 3LSTA 5AKXA 3KVNA 1L5FA 2WUGA 5ICFA 1G0OA 3CT6A 1GUYA 5H1YA 2JEZA 3P96A 1GZDA 1ZS9A 1UFKA 2ZUWA 4K1XA 1UBGA 2FDCA 1TD9A 3FR7A 4GMFA 2A1IA 1CB0A 2DCMA 5AIAA 2P11A 1LBSA 2ZJ0A 1E9DA 1QE0A 5D1HA 4YV2A 3ZJTA 4OSEA 1V7ZA 2C3OA 3USCS 3HPQA 4GXRA 2JA2A 4B79A 1ECGA 1UKVY 1FS5A 4MARA 1FDVA 3EXG1 1JLLB 4TMWA 2ZK7A 1U02A 1J5XA 3FCXA 4GOKA 5LNK6 3ADDA 3T3OA 4GSKA 3FYSA 4XGNA 3S8MA 4OJKA 4UMFA 4I3GA 3EZ6A 2XRZA 2P27A 4TYYA 1JQLB 4MVJH 4PE5B 3VTAA 2EX1A 1DAHA 1OV4A 3UMVA 3RADC 1IN5A 3N8DA 4YFYA 3P26A 2VCYA 1OKKD 4QE3A 3UC5A 2AOXA 2X14A 1HSZA 1MB2A 2ZDQA 3ZD8A 5LBUA 4NI5A 1VA4A 1EVLA 4RF4A 1S7CA 4Q4LA 2I29A 3HBNA 5FQNA 3GH1A 1ACJA 1T5TA 2R7AA 3VR4A 4DR7B 1NQTA 1YJ5A 1TJ4A 4EHHA 5I5EA 1L5RA 3CS3A 5ICSA 2YVQA 5JCOC 4HNSA 2I6SA 2WSIA 3NHJA 3HG7A 3Q98A 1LUAA 2BR5A 3IQGX 3MWJA 4JJ6A 4UNRA 1GUZA 3BB4A 2C5GA 3I2HA 1GR1A 1GVNB 2CDCA 4DM4A 3L07A 8LDHA 1CZKA 3MCWA 4N3NA 1E0JA 4L08A 4Z0TA 3VVMA 3WDSA 1L5VA 4IUDS 1SXJB 1EX6A 4DIKA 5CDFE 1NWCA 2YXDA 1Y9EA 3FG9A 4WLVA 4BP9A 1FPQA 4G86A 1JG4A 1WCIB 4QYSA 4EJ0A 1AKMA 3E1GA 1FK8A 4ZAXA 5SYNA 3DOUA 4HMQA 4GLFA 2HWXA 4IYRA 3L0IB 4L3OA 2IY7A 4OQDA 1DJNA 2FG6C 3N59A 5CUQA 1U3WA 3N39C 3AUXA 2QSJA 1EGVB 4AG6A 1JEYA 5FEUA 1KY4A 2CVZA 3GJ4A 3OOHA 2PKWA 2VTEA 1DJMA 4HDRA 1TCCA 1WZEA 4N7BA 5J40A 5DRTA 5BN5A 3RVNA 3R9XB 4Q3CA 4IR7A 1QYDA 2IYTA 2QLTA 3DEIA 3WQBA 3M4ZA 1NUQA 2BHLA 2OWDA 3AINA 2C7PA 1NR1A 2H07A 1GYPA 2D3TA 2I4NA 3QUSA 4X6UA 1A5TA 1U11A 3DQQA 3KOUA 3H04A 4H2DA 2QX9A 4LOAA 3ZCUA 3EGWA 4BBPA 3WFJA 4LVNA 2GFIA 4C4PA 3QF4B 2ZUCA 4M9QA 3VISA 3W7AA 4AZVA 1YRQA 1W9MA 3EH2A 2CYBA 1ORWA 2D3WA 3IAS6 4RS3A 4FD3A 1QIDA 3W05A 1AHNA 2G25A 2CUKA 1P0QA 3ICOA 1BCSA 1QVAA 2A0FA 4HF7A 2FUCA 5HNKA 4FWIB 4HG2A 3G0BA 3N70A 3SFZA 3WL4A 4DR6B 4C0LA 1AQLA 3FVWA 4HB0A 2HMUA 3A1DA 2FK7A 1NGSA 2Y66A 4IXWA 1VDZA 4FBMA 2RH5A 4AX8A 1CIJA 3L5KA 1YS6A 2FOLA 3MJFA 2HRQA 3PEUA 4Q3KA 1SC4A 2BZSA 3AR5A 1PR3A 3IVCA 3K70D 5MN5A 1ZM9A 4RZUA 5BRAA 2B7BA 1R27A 2VPQA 5FR2A 4FM9A 3KZOA 1EK0A 4XCQA 2UUOA 3DBLB 5CT8A 3UA3A 4D02A 2NPIA 3E05A 3FWNA 3ZE2B 4OMFG 2DFKB 3P2YA 1IHOA 4H3HB 3CUEF 5F9MA 3A1FA 2Y0CA 3IR6A 3ACBA 4JOBA 3S0JA 2DPGA 4W8OA 4CM8A 1H23A 1JHPA 2GETA 3TIFA 1PJ4A 2ZBEA 3RU9A 3WWYA 4B3TB 1S2IA 3P97A 4XD7A 4XASA 1YQ9A 4BEWA 4JK3A 4DZTA 3DC7A 4ZARA 1KTVA 1YVRA 2M6SA 3NRCA 3E35A 1E2GA 1N8NA 2G4CA 2EATA 2HBQA 4KMOA 2A3NA 1QO7A 4KWTA 4LJYA 1ZPDA 3LZDA 3CGGA 2YHSA 4N39A 1XUOA 3FD8A 4M9RA 3PPIA 4PIVA 5CYPA 2YV2A 4BBJA 5TVGA 2BL4A 3H5IA 4KE6A 4MGIR 3EN0A 4PC6A 3UWKA 1FFXB 2RHOA 4R40A 3UUFA 3HJNA 2Q4OA 1M9NA 1Z0KA 4GP9A 3S28A 3GCWA 1WY7A 1MAHA 1OUMA 1B2RA 1GPH1 1TM4E 1USIA 1XB2A 4HYTA 1YBVA 4CFZA 2RGXA 4GPAA 4D9HA 2X5OA 4WY2A 4BX8A 5IASA 3G49A 4D0RA 1L5LA 4KPUA 4RKFA 4FBLA 2IV3A 2Q5HA 2CNDA 4LNAA 3Q1LA 4X41A 3V80A 5U9CA 3FZEA 1G3UA 4MV1A 3E70C 4R98A 5EGSA 4GMGA 1P75A 3DNMA 2OY0A 1S2OA 3QV1A 3LDGA 4L5YA 1PJTA 3F74A 1Z4MA 4JLBA 3T7AA 3U6KA 1O6GA 4MCAA 4NFSA 2VXCA 3OTWA 5D6NA 3KOZA 5GOTA 2Q9AA 4HNGA 1R0YA 1LTKA 4NYIQ 2A0UA 3HKEB 2ZVPX 5KYNA 4PINA 3SN6A 3WE7A 1ZN9A 1XC7A 1IDN1 3IMCA 4R0VA 5CMLA 4NE9A 1HA3A 1NF2A 3TGPA 3ND9A 4W5JA 4Q9DA 1U8TA 4DLPA 4OMCA 2EQ5A 2H9IA 3ITKA 1R5NA 3Q3HA 2QSYA 4JC8A 5DT2A 2PGOA 4AYWA 3DMTA 4C08A 1K5DA 1JQ3A 4F96A 3RVRA 3Q0TA 1GZHB 3ILYA 2XRMA 3AR4A 5FWNA 3JQ7B 3UUWA 3ZZ0A 3HUTA 4IINA 3FMOB 3V1MA 1OREA 2C7GA 2I2WA 2JGNA 1QZTA 3HKBA 1JZSA 4LHWA 5TS3A 2HLHA 1QV9A 1U5BA 1E9SA 1BMFD 4NEQA 1W0KA 1F7VA 1QHHA 1J1UA 1U7WA 2PKXA 1Y6QA 3PPWA 2DGDA 3RM3A 1J33A 1GADO 4IFEA 1R8SA 3NHRA 4OIFA 4ZQIA 2H5JA 2ONKA 3HY4A 1TO1E 2JVIA 3ODPA 5FORA 3U3JA 1QDEA 4B34A 1NV9A 2O2GA 4RJTA 2W6ZA 4ETWA 1ECBA 1CEYA 3MIZA 1JLSA 4H4DA 4NOKA 4OQZA 4P34A 5E7IA 2NU8B 2H17A 4YO8A 2EZ9A 1JEQA 3U48A 2P0AA 1E3SA 3N7UA 2UYQA 3DDCA 3WYGA 4KWIA 3JQPA 2GKSA 1YCDA 4QX6A 5AUOB 1P74A 1E8DA 2REQB 1USKA 3AW9A 1PEYA 4TMKA 5AVTA 5K0BA 1CRPA 4R8KA 1CUYA 1LS6A 3HV2A 3OKAA 2BP7A 2ZB4A 4FJ1A 4GM1A 4GVXA 4IQGA 4II7A 1L5WA 2DT5A 2WU1A 4HH0A 5CYGA 1OJ7A 4MUNA 1ZIYA 1MJFA 4J0JA 4KACA 5L53A 1MEJA 2AKEA 1VL0A 1VCOA 4RIEA 5LWHA 1T9DA 4F93B 3HYLA 1GNPA 3JYQA 3OZFA 1JDUA 2RGGA 4R1UA 4RD3A 4WK2B 5B1HA 1W6UA 5ICMA 2IH5A 2HFKA 2B61A 5BMVF 3NHSA 2G09A 1V95A 1VRVA 5E9JA 3ZW9A 3N2KA 2B5WA 1GQRA 1L4HA 5CNJA 4ZCSA 3VR2A 4ZYZA 2H06A 3G8DA 1AZWA 5KVQA 4X92A 1J23A 3VHXB 4NENB 5HKLA 1MF7A 2ZJ8A 3BS4A 4RHYA 1L5MA 3WFIA 1QGYA 1NXTA 3NXSA 3RVOA 1XBTA 5FAKA 3VO8A 1I4OA 4ZRDA 3DVQX 5BXYA 3Q2KA 2NW6A 1NATA 1LDYA 2FZ4A 3A2LA 2AA3A 2GCIA 3QEMB 4Y0VA 2IQIA 4D3XA 1M34A 1QBKC 1NKSA 1WZNA 3DLCA 3EEBA 1VQ1A 2ZJAA 3HVHA 2A59A 3IP6A 2HX1A 1AURA 4GGPA 4JLAA 2AI3A 5F51A 1IOLA 1CCWA 5IEBA 1E8NA 1NQOA 2BZGA 3H13A 5D5QA 5FV7A 2E1PA 1YBMA 2QQ0A 1B43A 4KG7A 4TWJA 3ANSA 5EJ7A 2HCFA 3QI2A 3O2NA 1ZNZA 2FSIA 2G70A 2ZB2A 3NAQA 3GPDG 5F52A 4CJXA 5CXUA 2WVJA 3ZHTA 1WETA 3S5JA 3EGOA 3PR1A 4MVJD 3AI1A 2YCLA 4JIMA 4KB5A 2FU5C 3R3SA 4HQKA 4I1RA 5JJ5A 4UHDA 3LDHA 1DRKA 1GVHA 3AHHA 1SOUA 3FW1A 1HEUA 1Y8CA 2BBOA 2LIPA 1B14A 1UL1X 5DE3A 1WB5A 1VJ5A 4BS9A 4WN9B 4BB5A 1UP4A 4XYLA 1BHO1 1PI3A 2AN9A 2E2WA 2I4OA 3BGOS 2FDRA 1I4LD 3KB6A 4BY9E 4RD2A 1FX0B 2OCPA 4ML3A 4ZVMA 3EAQA 3BX1A 2C0CA 3AVYA 1FTSA 5GQSA 3WAKA 2JLUA 1CR0A 1JEEA 4Z53A 2YZGA 2JASA 2PAAA 3WYNA 1UKEA 5F5NA 4JBWA 4RIFA 1Z2DA 1ZH6A 1P7ZA 1Y0BA 2ZUSA 3OIUA 1KFJB 1I4WA 2D2FA 2Y6VA 1WQ3A 3ME5A 3KZKA 1LEHA 3EAGA 3R5HA 4IKEA 1XYYA 4YP0A 1OWLA 2EHJA 1E1KA 4G0PA 3AJDA 4PZEA 4JKYA 4WZBE 4UXJA 5EJFA 4F06A 2WE8A 3OQ6A 1O3YA 3K1AB 1J1ZA 2X9VA 1ZD3A 3A11A 3N1UA 4WA7A 1IRIA 3EZFA 1JA1A 2E87A 3QEJA 3F3KA 4LWPA 4WXEA 2W70A 4BAZA 1YS9A 3AR9A 2QJFA 3GX1A 1ML3A 2D7JA 3VZCA 1RC1A 1VLJA 4KOEC 4OQNA 5TLSA 3EOBI 4P53A 1GYQA 2NAPA 5TDHA 1FP1D 2O0MA 3Q7IA 2IP2A 1D9ZA 2JATA 3OLXA 4KAJA 4LZJA 4Y9UA 4R8MA 2IYRA 4NAVA 3AIMA 5DFAA 5FPSA 4NDZA 3DBIA 3JAWA 5KPJA 1MB4A 5M2QA 3CEAA 3C6KA 5E6UA 3A25A 2Q4TA 3VNSA 4GOLD 2RHJA 3IGFA 4XVUA 4ILKA 2Z04A 4FILA 4TLMB 4AI6A 3BB1A 4G09A 2VZ8A 4HDNA 4MW0A 4LSWA 4TLCA 1O8CA 1WE2A 1QFZA 1UT8A 4BGEA 1XTUA 3USZA 4CMAA 2D2VA 4U7PB 3WO1A 1UMDB 4UOQA 3A1TA 2XUIA 1PLLA 1MN6A 2Q9CA 2WSSA 1DJOA 2VSQA 4G36A 3IR5A