3Q85A

Crystal structure of rem2 g-domain -gtp analog complex
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
169
structure length
149
Chain Sequence
b'GVFKVMLVGESGVGKSTLAGTFGGLDTYERRIMVDKEEVTLIVYDIWEQDHCLQTGDAFLIVFSVTDRRSFSKVPETLLRLRAGRPHHDLPVILVGNKSDLARSREVSLEEGRHLAGTLSCKHIETSAALHHNTRELFEGAVRQIRLRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding protein REM 2
publication title RGK Family G-Domain:GTP Analog Complex Structures and Nucleotide-Binding Properties.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 53
structure length 149
sequence length 169
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3q85A00
3DKVA 2OXCA 2Z6VA 2IC5A 3AUXA 3EZFA 2IK8A 2FWRA 4FD2A 2VHCA 3I3SR 5FPKA 2X19A 2QAGA 4DEXA 1VHLA 1XCGB 1T3SA 1YZGA 1R10A 2G0TA 5FFMA 4NYIR 3NTUA 4JJKA 4Q18A 2FSGA 4IXNA 3RRMA 2P6RA 3PCRB 4XTCS 1W0JD 3W5JA 5KSYA 2IYQA 1T3LA 2IEZA 4Q7LA 2Q6TA 4OBEA 3NH6A 1CR2A 1NRJB 1S96A 3JVVA 3KDSE 1G41A 2KE5A 1XBTA 1XD8A 2Q3FA 2WWHA 3EWAA 1E2DA 1F3OA 4TLBA 5HPYB 3A6PC 2ZRHA 3MUFA 3U44B 3CR7A 2GCPA 5EP1A 3WMGA 1ZD9A 4JKIA 2WJHA 1P9RA 2VHQA 5TDHA 3CF2A 3B60A 3LD9A 2DFKB 4TMXA 3MFYA 1W36B 1QHYA 2QBYB 2SHKA 4F4IA 3CONA 3THWA 2L0XA 1JPJA 1NJGA 4N0EA 4Q03A 3B2EA 4Q66C 4KBGA 2VQSA 1U0JA 3C14C 4IJMA 3CRVA 4V03A 2ZYUX 4QKQA 1DEKA 1TEXA 4KITB 4WOPA 2WTUA 2OAQ1 2FOLA 5KU1A 4IFBA 1EFHA 1BKDR 4G5GA 3K9NA 3OHMA 4B47A 4X8OA 4CT4B 1BO6A 1GRQA 1J7KA 1MO6A 1H8HD 3LX8A 2OFXA 4URWR 2REXB 2ZSAA 4TMVA 5DHAA 4A2QA 1KO5A 3KXKA 4B3XA 2YOGA 4Q1BA 3QXSA 3D6TB 3OEHD 2JDIA 4WZBE 2CNWD 3IUYA 5AUOB 1WA5A 3EX7C 4BASA 2BMFA 2HLDD 3CPEA 3QXCA 2CBZA 2QTFA 3CB4A 4IOKA 4L8GA 4H9GA 5FPYA 2VIIA 1AM4D 3K0AA 2MSDB 3LX5A 1OXVA 1W5TA 1Z6AA 3FVQA 4Q1CA 3ONWA 3NBZC 3SQWA 1SKYE 1KAOA 2IWHA 1G3MA 3ICQB 5AUPB 2P65A 2IYLD 1RYFA 4GRAA 4UXJA 1ZU4A 2ZXUA 3QENA 4GOKA 4DUGD 4WAUA 3SI7A 2EWWA 3K0EA 4PC1A 4TT3A 2AKYA 2G0NA 3HYTA 3NVAA 4URXR 4OHYA 3GMTA 2VO1A 1N6NA 3BD9A 3LO5A 4DT1B 3W3ZB 4HAWA 3U3KA 4Q1AA 4KU4A 4XWOA 5IT5A 4JT2A 4QGHA 4DC9A 2VP2A 4EFLA 4FCTA 1E0KA 2NO7A 5AUQA 1CTQA 1JQLB 4PPNA 4KFSA 3UATA 1X8JA 2BIFA 2G1KA 2XSZA 1R5NA 3PENA 2NG1A 4Z8XA 5C1BA 4XWAA 1I4DD 3M1IA 2F3TA 4RD0A 4G0NA 5FOWA 5JBQA 2NZJA 2FPMA 2YWFA 2Q3MA 2JA1A 2ZRKA 1SXJA 821PA 4LC1A 221PA 1Z08A 3A4NA 3E5HA 3LRPA 4KLZA 3MD0A 5JJIA 4BEBA 4AYTA 2J7KA 4XIGS 2GHIA 2V1XA 2WKPA 2PEZA 3SFVA 3AUYA 1YVDA 3VR2A 3RANA 3ZD7A 4TLCA 4YMWA 4KJZA 2AWNA 1TQ6A 2R44A 3VR3A 5DYGA 1C1YA 2FU5C 2B21A 2XX3A 1NIJA 5K8UA 4FWTA 5F98A 2XNDA 1IQPA 3OFNA 2RAPA 1E3MA 1OFTA 4G5RA 3VHLB 4XWKA 1SVWA 1ZM7A 2CHGA 3EARA 2GETA 1HT2E 3ETLA 2VHUA 3R8CA 2DFNA 1ZM4A 3L82B 1SVSA 4WVFA 3TSZA 2ZYVX 4HLCA 1DAEA 3FKSA 1U0HC 2XJ9A 1NVVR 1XF9A 1G7RA 4JSYA 4KFRA 4WA7A 3WNDA 2G6BA 3WYAA 1G3RA 2O0JA 3H86A 2W2VA 4TYQA 2ZVQX 3ADCA 1N0WA 5FR1A 3UG7A 1U90A 5EUMA 4H1UA 4TTRA 4A8JA 1KI8A 4DHEA 1Q0UA 2DFTA 1KNQA 4KYUA 3WHLA 3QPUA 4WZ6A 1AGRA 1TF7A 4TMWA 3W8RA 1KI2A 5EP3A 3IHLA 5EXSA 5KO2A 3WNBA 1QF9A 1GZSA 1PZNA 1CS4C 1SKYB 2ORVA 4DKXA 4D0NA 5C2JB 2H1LA 4D4KA 4P33A 1NSTA 1TMKA 1R8SA 2F6RA 4O0MA 2B7CA 4FINA 4JIMA 4PC6A 4PPGA 2XGJA 4IOJA 1ZYUA 5CK5A 4MKFA 2CVFA 3T1TA 4PPFA 1KDRA 1ZUNB 2ZS8A 3AKEA 3RRZA 1LFDB 1E79A 2CE7A 2ASEA 2GJKA 2JGNA 2WKRA 2WOJA 1DO0A 4PHHA 2P6UA 3EC1A 3ZIAD 4GL2A 3SJCA 2CLCX 3FE2A 1CR4A 1R6BX 1FMLA 3K9LA 1UBGA 1G6HA 2XTZA 2JAQA 2IX3A 2XTNA 5JJLA 3QPWA 1FOEB 2JJ2A 1L7VC 1HUQA 5FL7A 3EPKA 2WWIA 4L4UA 3K0AB 4EPWA 3B7GA 2RGNA 3I72A 3ZVRA 3ZQJA 4V02A 1XEWX 2GJ9A 1XX6A 3MJHA 1KO4A 1MOZA 1Z8FA 2IS6A 4F4JA 2FEOA 2GJSA 1T5LA 2MMCA 4Q02A 3K0SA 3P26A 3AKCA 3NEJA 2HEIA 1NBMA 2WSSA 2ZJ5A 2YC4C 1VG1A 2QAGC 3A1TA 4D4MA 2FX3A 2WJJA 4F7WA 2OBMA 2ZJOA 5K8IA 2KWIA 5C18A 4IEIA 4XSGA 3RWMB 1FQJA 1KI6A 2WBLC 1NN1A 4XSHA 2ORIA 1ZU5A 2VH5R 3CO5A 1RZ3A 1UEIA 3W9YA 4DIEA 2QI9C 1G8PA 1HEIA 2ZAMA 2F1JA 3ZZ0A 2C78A 1YKSA 5SZIA 4B3FX 3FGNA 3K1JA 3AVOA 4OK5A 1L8QA 1E2PA 4LV5B 3KXIA 1YU9A 2F1IA 4ZCLA 5KDLA 4CZ2A 4TLEA 4BGDA 5J4VA 1WXQA 1E9EA 5DN6A 2JJ1D 1U99A 1SXJB 1G4AE 5CIQA 1XJQA 4NBSA 3KUCA 1Z6GA 2G1JA 1AKYA 4LYAA 5HTKA 4C4PA 1XEXA 4FI3C 1OYYA 2QL6A 2XOKD 2VP0A 1NBME 2GCNA 4LJ6A 4DB2A 4D25A 1N0VC 4NP6A 2BOVA 1CJVC 3KXLA 1KMHA 3IDQA 2XNSA 1NG9A 4B3GA 4M9ZA 2EFCB 1KY3A 4QG7A 3WRXC 3LY5A 2W6JA 3J81k 2ZI3A 4YLGA 4FWIB 2NPFA 1HE1C 2GAAA 3BH7A 2EFDB 3P27A 2UZ3A 1YHNA 4UKDA 4JSTA 2HF8A 2V4ZA 3IQWA 2IHBA 2BMEA 1GKYA 2V7QA 3ECCA 1HURA 1ETUA 2O0HA 4C3ZA 4DB4A 1CU1A 5DH9A 4A92A 4B44A 1XPUA 1TU3A 2HT6A 3F8TA 4OK6A 5L3RA 1E0AA 4UNRA 4RVCA 4CIDA 3FPAA 3VFDA 5KTYA 1AKEA 1XCMA 2AR7A 1NY5A 2H17A 2HXSA 2ZIAA 4M1MA 3SYNA 4ACBA 4BFXA 4CVNA 2ZE5A 3AP3A 1ZCBA 3GLGB 3UWKA 1Z0FA 4FMBB 2CJWA 4LBYA 3CLVA 3MWYW 4CDGA 2OCBA 4HB4A 2QPOA 4KI0A 4Q48A 3ZS9A 1JR3E 3HU1A 1G19A 5J4LA 3FMIA 3AM1A 4QBIA 3OIYA 2D7DA 1QHSA 4JYCA 1Q12A 4M53A 1J90A 5JWOA 1VDZA 4MYCA 4QBFA 1ZBDA 5DGXA 3IBYA 1RC8A 1P2TA 5TVKA 3X1YA 1OHHD 2F9LA 1E4YA 2R8RA 3BC1A 2QMEA 1RIFA 3PG5A 2YVUA 1XFAA 3DMDA 3MWKA 2FF7A 2XZOA 2O0KA 2VPPA 4NYJQ 4G5QA 2AKAB 1SVKA 2ONJA 3DVLA 5EXTA 1M2OB 1FP6A 2HXYA 1W46A 1VMAA 4EPYA 1KGDA 3KQUA 1SULA 2BMDA 3DKPA 4DCNA 4R71A 3K9HA 5E7IA 1OXUA 3QF7A 4V0KA 2BEKA 1QBKC 4D6PA 4LGMA 1KI1A 5BN3A 3RABA 4B48A 3I4LA 1F2TA 1W0JA 4TZ6A 5D3MA 4Z51A 1TUEA 2PCJA 1ZM3A 3ZYCA 5JRJA 4PC2A 3IKJA 3DM5A 3AP1A 3C7KA 5SZHB 2BVNA 1Q1BA 1U9IA 2GF0A 3A1VA 3U7GA 1COWD 1OIVA 3AVVA 4R7ZA 2GEDA 4Q19A 2PT5A 4QGFA 4ZPXA 3UPUA 2V54A 4WIAA 1UPTA 3CWQA 4EFMA 4HUQA 1T4GA 3U3RA 4FMCF 4JLNA 5BYKA 5TARA 5HR5A 1AQUA 2EFGA 3E2IA 3GQBA 3GLFA 4AI6A 3RVBA 5KHOC 3HP1A 4M1WA 1KI6B 5DLQC 2D2EA 2DR3A 1RRPA 4HSEA 1E2NA 4BLTA 2V6JA 1YZKA 1JEEA 3HR8A 3KFVA 4NE2A 1LF0A 3AF3A 3I8SA 3LLMA 1BMFA 1IY0A 3LV8A 2HF9A 3X1XA 1VG0B 1L2TA 4NPHA 4A8JC 2GXUA 2ZRPA 2XB2A 2OUKA 2CXXA 2O8CB 4Q9LA 4YDHB 621PA 4X8HA 1H8HA 3TMKA 2ZR0A 3IEVA 3D31A 3SYKA 2NGRA 1NP6A 3VNUA 1TX4B 2QQ0A 1IHUA 2ZRBA 4BECA 2IS1A 5FR2A 5CDFA 3P4YA 1VCMA 1JEDA 2CEAA 3IIMA 5FOXA 4K46A 1VCNA 2RHMA 1ZUHA 3QG5A 4P4SA 2B7BA 1E2IA 2PL3A 1OH6A 3CPJB 3CX8A 2HLDA 3SDZA 1KMHB 1S8FA 3IILA 1II0A 2QTVB 1RRCA 3NG1A 3GLFE 2FPLA 1ZVQA 1KYIA 3PUXA 4Q00A 3SZRA 1DPFA 4PC7A 4GSYA 1P4SA 1M6NA 3A1UA 4KSBA 3ND9A 2EYUA 1GNRA 4LV6A 4B43A 1CJMA 3A1SA 1KIMA 2QRZA 1W4CA 4I1VA 1LY1A 1US8A 2OXRA 1XTJA 4C0SA 2BV3A 1NIPA 1EXMA 3I73A 3X1DA 3VR4A 2PMDA 4DLSA 3O8BA 3SN6A 1G17A 1L4UA 2JEOA 3BORA 2JIZA 4HLDA 1X8KA 5CJPA 2RGNC 5CDFE 4OJKA 1XMJA 1W7AA 2J9RA 3RSOA 1E2MA 3X1ZA 3ZJYA 1OB2A 3BFKA 4YQFA 4LI0A 2OO7A 1PV4A 3B5JA 3WP0A 1XXHB 1OKKA 4O25A 5CM9C 4Q01A 5HZHA 1ZNXA 4X8LA 1WE2A 2WIAA 1UBEA 1GRNA 2FZ4A 2OFWA 2O8FB 2ZUBA 4D2IA 1XB2A 1KSHA 4PQYA 2VYFA 4TSFD 5L3SB 3LAWA 2GVDC 4Z1MA 4U02A 4PO8A 4JLDA 5LD2B 4Q9HA 3QSYA 1UDXA 4A0HA 5CB8A 4P0TA 1E1RD 5GVSA 3N70A 4EPVA 1SVMA 4AWXA 4B6FA 4DDWA 3KKPA 5GJVC 5JCPA 1Z63A 2F3RA 2ZRJA 5D3QA 1JAIA 1MR3F 2HJVA 4MKHA 1K8RA 1M74A 4NCKA 4PXAA 4TQAA 3SYLA 1Q57A 1KI4A 4PSKA 3PXGA 4Q1FA 4Y0AA 4NTZA 4DLVA 5L3QA 4XVUA 3ZH9B 2G3YA 4URUR 2R6DA 4JL6A 1W4AA 4F92B 1R0YA 3EPLA 2AHOA 2VA8A 2GZHA 3AEZA 1F2TB 3W6PA 4GZMA 2QE7D 3Q72A 3GEHA 4EPXA 3AVWA 1KMQA 5FTLA 1O3YA 1TU4A 5TV2A 4QM7A 4DCUA 1Z6TA 5KPDA 3AVUA 1CR1A 3I61A 1A1VA 1G16A 4UNQA 5FUYA 3S1AA 2GK6A 3DPUA 4HDOB 4NYJR 1MRNA 2PH1A 5EUQB 1Z06A 1GSIA 5CYPA 4YMSA 1DAMA 5DYIA 1BYUA 4BZPA 1E0SA 1YJ5A 4M1OA 4HAYA 4AY2A 1MO4A 2A2ZA 2NO9A 3EPHA 2WJYA 3ZDQA 4K81B 3CNNA 5JSZA 3UKDA 3ICEA 3VKGA 1IXZA 2IYZA 4QHSA 2V9PA 1GRRA 4IVQA 2PZEA 2H7VA 2WWXA 1Y63A 2FDCA 3EXAA 1M34E 3H2YA 2J41A 5JWHA 3RC3A 1XWIA 1G8HA 3W8NA 2AL7A 2QMOA 3N2IA 4RSGA 3UXMA 2B6HA 3C16C 1WQ1R 1NN0A 4B3BA 5LDDC 3K70D 2QP3A 1E9DA 1Z2CA 1IJEA 1EG7A 2EU8A 3A36A 3I62A 3Q3JB 1XMIA 4DEYA 2IL1A 1WMSA 2QGNA 3AQ4A 3TQCA 3RC8A 2RB4A 2NZ8A 2ZE7A 3OEEA 2IYXA 2GAOA 1YR7A 2GA8A 3TRFA 5EZ6B 1DARA 4B74A 2GDJA 4DCVA 4HZUA 4BRUA 4EDHA 3THXA 1GL6A 5KPJA 4D4JA 1YRBA 4Q4LA 1F6BA 1Z29A 2ANBA 1EK0A 4AKHA 1HYQA 1M7BA 1GNQA 5LD2C 4BFYA 1DAHA 2N46A 3PUWA 1S3GA 4W5WA 3R9WA 1ZCAA 3BGWA 4BFTA 2IYSA 4CT5A 2G88A 2PLRA 2JLRA 2RKOA 5J40A 3TE6A 1EGAA 2C2HA 5FBQB 5G53C 3A37A 1TF2A 3RNLA 1ZD8A 4TL9A 1VG9B 4A4DA 2Q9CA 4RZ2A 2OAP1 3PR1A 3WXMA 3DEFA 2BM0A 1NNEA 3B8HA 4KCGA 4P32A 4JLAA 4GZLA 1ZIOA 4FW9A 4PAQA 4RD2A 4RZ3A 3W5IA 3FMOB 5IDVA 2MMGA 2O8DA 4KBFA 1U0LA 1E9FA 2QPTA 2W0MA 1U9IC 3B85A 1GUAA 3GP8A 2ZSFA 1KO8A 4IVPA 2GXQA 4TLDA 2QT0A 4ZDWA 3RAPR 4DCSA 3U3OA 4QOSA 2OEPA 4E03A 5BW8A 1OFIA 5IF9A 1J8YF 3I1FA 1KTVA 2Q0HA 4TMTA 2B8TA 3SE0A 2EW1A 5HZKA 1FP7A 3GD7A 5JFGA 2GCOB 2HJGA 3TVTA 2D62A 4DLUA 4CEIA 3DO6A 2GRJA 1GKIA 1H65A 3GJXC 4PQRA 3AV0B 3LNCA 3QBTA 4M9SA 5EE9A 1KKLA 2YZ2A 1AZTA 3UMRA 1OIWA 2FSHA 2WPDD 1SZPA 2XOKA 3A4LA 1KSGA 4L9SA 4R9UC 1XTQA 1NVXQ 4AC9A 2P3SA 3LW7A 1KJZA 4AIIA 2XJ4A 1N0UA 5F3WB 1VPLA 1IN8A 1BOFA 2FPKA 4G5SA 2D74A 2BWJA 4JBXA 8OHMA 4RFSA 1KZ7B 2C98A 4W5JA 3D8BA 4Q4JA 2Q9AA 2X8AA 4PSVA 4URYR 4YXWD 4JL5A 4POAA 2R6FA 4WXRA 4JL8A 4HEJA 1X1SA 4JZKA 4MYTA 2JCSA 1XTSA 3S1AB 3TW4A 1G18A 1YZLA 2KSQA 4PFSA 2ZEJA 2ZI7A 4D0GA 4QXAA 2FNAA 3G82C 1DG1G 2IXEA 2ODEA 2VLIA 4DWJA 4JLOA 3G5UA 3O47A 4KHZA 1GVNB 3N5CA 4V0LA 2YINC 2EFEB 4D82A 4L5BA 4BE7B 3V4RA 3QF4A 3R7WA 2BDTA 3TH5A 2WZQA 2VBCA 2VRWA 3OE7D 4W7SA 4D80A 3SR0A 3TGPA 4M1YA 2H5EA 4ACAA 2G83A 3CM0A 4BLPA 2D4HA 5JSZB 1GFIA 1N5LA 1RKBA 2C8VA 1Z0AA 1F5NA 4NKRA 1OHHA 2ERXA 3KB2A 4EJSA 4ERNA 1D5CA 1G8FA 2OFOA 2DFLA 1NN5A 3U4QA 1CF4A 3KKMA 5FBWB 1P2UA 2A9KA 2AXNA 1MKYA 5E7MA 3AKYA 1FTSA 1FNMA 4K8OA 4ASUD 1HE8B 3CW2A 3DOEA 1NSFA 3U3MA 3GPLA 4FXPA 1UKEA 4C7OB 1NMXA 4ZCIA 1N6HA 2BKEA 3QBVA 4Y0VA 2R6GA 4HAUA 4DBLC 5FBLB 4N0DA 3HWSA 4JMPA 4HZUB 3LBNA 5HKKD 3THXB 4MGZR 2BKUA 4PAOA 3HYRA 3NDBB 3H84A 4DRZA 2AD5A 2G9NA 1FPMA 2VSXA 1JNYA 2OBNA 2Z4RA 2IYVA 2IW3A 5A5GA 2J5XA 3G0HA 1CIPA 1WCV1 1FTNA 1TQ4A 3K09A 1J70A 4PPQA 4AK9A 2R62A 2J7PA 4NDZA 1M8PA 1R0ZA 4ZI3A 5FTNA 1P62B 5EP2A 2O8EA 2WJGA 1H8ED 4OHZA 1QDEA 4BLSA 1FNNA 5GJWC 5JLJA 1IN5A 2NIPA 2NPIA 3T61A 1JAHA 4GP7A 3O8CA 2ZM5A 4P4UA 1XD2A 4A6XA 1XCPA 4LHXA 1FL9A 2BC9A 4PX9A 3LBHA 3V9PA 2GEVA 4XD7A 3K8YA 4NCJA 4Q9KA 3CNLA 3DL0A 4MDEA 4LHVA 3GJ8A 4OQFA 4AG5A 2EWVA 2JATA 3H1TA 1W0KD 2OBLA 2OESA 1QVAA 2QAGB 2W6ID 1HA3A 2O8DB 4O2LA 1E2KA 3MGCA 4WXPA 2GESA 3A8TA 1RRGA 4LYFA 1HH4A 1S0UA 1N3BA 1Z0IA 2ODWA 4YONB 4GOXA 2E9SA 1XDBA 2GWHA 2B8WA 3PEWA 1EWQA 4HYYA 1KSFX 3L43A 4HLUA 3OAAD 4IW3B 1WP9A 4LRWA 2VP9A 1W36D 1UEJA 1VCOA 5JI2E 1JB1A 2ZPTX 4BZQA 1BH2A 3AP2A 4CEIB 3KJIA 4G3XA 4P3YA 4PHFA 4M8NE 3TBKA 4QJ3A 4PSAA 4C0HA 1ZM2A 2HYIC 3CH4B 4QRHA 2ZE6A 1D2EA 1FMJA 2GVZC 4C0QC 4EAQA 4TMKA 3AF1A 2KJQA 3THWB 1HV8A 3TIFA 1WB9A 2O8BA 5K8TA 4GI7A 5LB4A 2GNOA 3NHAA 4LHYA 4KFTA 3AVTA 4EIWA 3SJBA 4Q4JB 3V00A 2CMKA 2OCPA 1KI9A 1GM5A 5GJCA 4X8MA 2W0SA 4PC3A 4FMCB 1X8LA 3ZVNA 5FPSA 4B73A 1TPZA 1MH1A 2A5GA 1VIAA 1IBRA 2RCNA 2Z5FA 4TQ9A 4A0GA 2ZRNA 4M9QA 2TMKA 4W5HA 3ZZUA 3C8UA 2A5JA 4LX0A 4A2WA 4OHWA 1IM2A 4ITRC 3Q7PA 3GLIA 3GJ6A 2IYWA 1OW3B 1RW4A 3K9GA 2WJIA 4DSUA 2DB3A 2A5DA 5LBIA 1NLYA 1QZXA 2A30A 1YR9A 3QF4B 3R7WB 3MJRA 2F1HA 1JALA 4UNPA 5EJEA 4TLAA 4LK2A 4JVNA 4UNNA 2P5TB 4LOAA 1CRPA 2XXAA 2RGBA 3T1OA 1II8A 2PBRA 3CR8A 3U4QB 4II7A 4MKGA 2R9VA 5LPNA 1E1RA 1G3QA 1VG8A 4NHOA 1LV7A 2GILA 3VKWA 1ZP6A 1JPNA 2J3EA 1ZC4A 2BM1A 2WVJA 4GNKA 1U98A 4UJ5A 2ZI5A 2QTHA 1R0WA 2GK7A 3GEEA 3NBFA 4OI4A 1Q1ZA 5ANRB 1SVLA 1R4AA 2CLDX 3GJ5A 2FJUA 1GL9B 3M6AA 4KVGA 4URVR 3VKHA 4S2EA 3QVUA 1OLOA 2LWIA 3GLIE 4V0ME 2FE4A 1FUUA 3Q5DA 4TTQA 4MRSA 2H8KA 4OQNA 4AURA 4TYYA 1P7CA 3NEYA 2QE7A 1M7GA 1TQDA 1KJWA 1Y3AA 2ZRCA 2WHXA 2ZETA 2ZJYA 1RJ9A 1Q21A 5JS8A 4E09A 2KB0A 3FFBA 2CL7X 2HYDA 2O8EB 5JHGB 3LQQA 3T1QA 2ZYWX 4LJAA 1SGWA 4DCTA 1FQKA 1JI0A 2V6IA 5FOSA 3KKNA 1MABA 1XD2B 4M1KA 2VEDA 1JR3A 2W00A 3R20A 1ANKA 2UZIR 4KYIB 1S3SA 3KX2A 2XZPA 3VX3A 1EWRA 2ZU0C 3VQTA 5KOYA 2C77A 1KK3A 2FN4A 4UQOA 5JHHB 5IK2A 4LJ9A 5K8LA 1IN4A 2VSFA 4XJXA 1RRFA 1DADA 1Z0KA 5CYOA 2ZJAA 2WSMA 4TWZA 2O52A 4A8JB 5DHFA 3EIQA 1ZNZA 1DAIA 4FIDA 4BUJA 1E9BA 2XB4A 4P31A 5GADl 2YNMA 1W4BA 2GZDA 2CL0X 4EJSC 3MWLA 1NVWQ 3TUJC 3EC2A 3B1VA 2ZU6A 2OLKA 2O8BB 4MKIA 1G1MA 3WYGA 4HZIA 3E70C 3FMPB 1WRBA 2IBMA 2QG6A 4ESHA 3KTAA 3WMFA 5KSPA 3I5XA 2QY9A 3QJYA 4FCVA 3KQHA 5KDOA 4RD6A 2CK3D 1DOAA 4A2PA 3VU9A 2C99A 3ZVLA 2EQBA 3MSXA 1ESMA 1OF1A 2ZRMA 3Q7QA 4JLBA 3RLFA 3TAUA 2YJTD 1W49A 4A15A 3VNVA 1Z47A 1E2FA 1KI3A 1E94E 4LDJA 4QBGB 3K09C 4EUNA 2EYQA 4KAXA 1VIYA 2JASA 2PJZA 3B1YA 3GLIB 2RGAA 3UK6A 1X3SA 1ZJ6A 4NZYA 1SHKA 2ZRLA 3T15A 2K5UA 2CDNA 2GTPA 3SBDA 2JLVA 1NI3A 4BFZA 4Q1EA 1UKZA 2ZS9A 4ESVA 2G77B 2QPAA 3THOA 1C4OA 3BBPA 5SZKB 1Z22A 2V1UA 4M22A 2XXAB 1DAKA 4HAXA 1II8B 2JLQA 2R2AA 4IDPA 3BS4A 1G8GA 5G41A 4LBVA 3LXRA 2QRNA 5FOVA 4N1AA 2ZJ8A 1A82A 1BIFA 2ZJ2A 2GBLA 3NBXX 2OZEA 2RGEA 6Q21A 3QKRA 1GP2A 3M4YA 1FX0A 2IXFA 4KLNA 2XSZD 1E1QD 2DCUA 5J4HA 3PUZA 3ZLJA 4AKIA 4HLUC 5E7JA 2GF9A 1FW6A 2QSZA 2Z43A 2QUZA 1SXJD 2X1VA 4MDFA 3FWYA 3LW8A 2ZI6A 4DSNA 1CLUA 3DHWC 3GEIA 1J99A 3C4JA 3VHXA 3X2SA 1UM8A 1R7RA 2WIBA 1TQ2A 2BMJA 2KI5A 1RJ9B 2Q9BA 2JLXA 2IYTA 1ZUIA 2ZR7A 2C96A 3EIHA 4U7DA 3UANA 5DNYB 4DVGA 5JMTA 2ERYA 3RS0A 1Q20A 1E6CA 2WM9B 3HPQA 3ADBA 5DI3A 1P2VA 1XEXB 4LYJA 4RJLA 4TQUS 3O8RA 3I32A 3MAAC 1NF3A 3NKVA 3OEHA 2CNWA 4MRNA 4DLYA 1WF3A 3QKTA 3HPRA 3D7MA 2ZVPX 5B2ZA 4KVAA 5GVRA 3B9PA 5CIWA 3U61B 1JJVA 5KNCA 4ZO4A 4IOLA 4A0RA 1RPZA 4GP6A 521PA 4WBSA 3FKSD 1N5KA 2A3RA 4FMDF 1T0JB 3I8XA 4AG6A 3THYA 121PA 3V4FA 5E3HA 5JJKA 4D4LA 1XTIA 3Q9LA 4PHTA 1GIAA 3BFVA 1QRAA 2NO1A 2XITA 2FSFA 3EASA 3P1JA 3PUVA 4KV9A 1MO3A 2HCJB 3DM9B 4LPKA 4Q4HA 4B2PA 4DUGA 5JRZA 1KO1A 3L0PA 2BBOA 4ASUA 3DOFA 4ABYA 2KBEA 1BYIA 1F2UA 3AB3A 5DE3A 2C9YA 3BIFA 1CP2A 1JXOA 4HB3A 4I1SA 5KUTA 2CL6X 2J0VA 3L8ZA 2DPXA 4LJ7A 2IYRA 3TW8B 4US2R 1T5IA 2Z4SA 4EPRA 2W2TA 4NCNA 5CM8B 1YZUA 2CJWB 4B71A 1N6KA 2PT7A 2ZJBA 1D9XA 4JYBA 1U8YA 3TSWA 1Z28A 5FUXA 1P6XA 3OZXA 1AK2A 1E79D 3KTAB 4CW7A 3W6OA 1F48A 3CZPA 1O87A 1UF9A 1Q44A 3QVVA 5AJZA 4A0FA 1OT3A 2I3BA 1D2NA 4PR0A 3ASYA 4WW0A 4OI1A 3VU9B 4TZ0A 4UJ3A 5EXXA 2JJ2D 1S4QA 1R2QA 1QHXA 2FEMA 3LLUA 2OILA 2V8OA 3BAFA 1U94A 1MT0A 2AFHE 1G4UR 2WWFA 3EZ6A 1E32A 1W1WA 1G9XA 1SVOA 3GFPA 1XRJA 3TUIC 2NTYC 1MRSA 1I4TD 4M0LA 2F55A 3ZS8A 1JJ7A 1IXRC 2IYUA 3D3QA 1G5PA 3IIKA 4HB2A 1UFQA 4MRVA 1S2MA 4TYPA 3U44A 1F60A 3KFXA 5D3MB 3RDPA 4NU0A 1OFHA 4CGZA 2IS2A 3QI2A 4BEJA 4OL0A 3IGFA 1G20E 2A7QA 4IFEA 5CLQA 2QBYA 1KK1A 4MYHA 3KQKA 2OCYC 4I99A 4TN1A 5J4YA 1A2BA 3L0SA 3TVDA 3VTKA 1OFUX 2AK3A 1DELA 2ZJZA 1HQYE 3FB4A 2QMUA 2VP5A 2F43A 3TK1A 1P2SA 2WWGA 2BJWA 4HUQB 3OIVA 3WYFA 3QKRB 1G291 5FOUA 2N1BA 1FX0B 1I4LD 4BZXA 4DLXA 3TR0A 3GLFB 1OH8A 2IUUA 1E9RA 4OQXA 2D06A 4RY2A 4HB0A 1NY6A 1U81A 3B1XA 4JLJA 4JLVA 1WBBA 3REGA 3AVXA 4JS0A 3IHWA 5DN6D 2QM8A 1DAFA 1PLJA 4B3CA 2FA9A 1XTKA 2ECKA 3EZ7A 1KAGA 3EA5A 3T34A 1G64A 5ELXA 1G21E 1S1MA 4B34A 2YWHA 3PIRA 4QJ5A 5L8VA 4ARZA 1OSNA 3QQ5A 2UVQA 2BBTA 1G7SA 1E99A 2IF2A 2VF8A 3KJEA 2AWOA 4UXHA 3KQNA 4IOMA 4HAZA 1KDTA 3F0TA 3HR7A 5AUNB 5A0FA 1N6PA 3DZ8A 3FFAA 1E69A 4M1TA 5B58C 1GILA 1GAJA 2IEYA 3K53A 1D9ZA 4EKDA 3KKOA 2WWWA 4EQ6A 3ZIAA 2W83A 4P4SB 2MSEB 5H70A 4ZI2A 2NO6A 2ZR9A 1LF5A 3JVUA 4QC2A 1QHIA 2VHTA 4IXMA 2XZLA 1UBCA 3MWJA 3B82A 2GZAA 4I81A 4I1OA 2BEJA 4BQSA 2XEXA 3GJ7A 3JZMA 2XAUA 2BCGY 1DS6A 1S9HA 3NXSA 2YOFA 1ODFA 2YYZA 4XVQA 3THYB 2IS4A 1QG2A 1T3HA 2PX3A 3IIJA 4B35A 3CWZA 4AKEA 1TF5A 2IWRA 4ZCMA 1PVOA 1US8B 4KFUA 3KKQA 1R8QA 4Q4HB 1Z0JA 2AN9A 3WNCA 2EVWX 2DHRA 5JS7A 4PO1A 2C9OA 3AGPA 3IQXA 1E9AA 1F2UB 1FZQA 2CE2X 4B6EA 1E2EA 2WAYA 3QEJA 2ZAOA 1DO2A 4ZDIA 1W2HA 3N2EA 4DDTA 4DLRA 1GWNA 4QGGA 4MGYR 3SJZA 4DXAA 1S1CA 2J1LA 4CEJA 1NMYA 3RWOA 1E9CA 1OE0A 2LKCA 4OKSA 4JLMA 2ORWA 3WP1B 5KSZA 3VR6A 1KK0A 4L16A 4DIDA 2GBLC 1CEEA 2QAJA 2WKQA 2ZREA 3KL4A 5BN5A 2JJ1A 1AGPA 4QHTA 1NL3A 3B1ZA 4RD3A 2BCJQ 1CJUC 2ZITA 4MITA 5F9FA 3NWJA 3HJNA 5TXGA 3QE0A 3U3JA 4AYXA 1GITA 1EFCA 4GFDA 4NMMA 4U5XA 3W6NA 2GXSA 5J47A 1IOZA 1LS1A 3ADKA 3MRSA 4V0NA 5EE1A 3VX4A 2IYYA 3OF5A 1DVRA 2A5YB 3EWSA 1E0JA 5FTMA 3GFOA 5L3QB 1R5OA 3IEUA 3QPVA 3P4XA 5B30A 2J0QA 1VTKA 5KNBA 3NC1C 3F3YA 4XVRA 2DWQA 3B9QA 3SJAA 4RKEA 4NYMQ 3SNHA 4JBWA 3LBIA 3EIEA 3BB1A 2QROA 1VYTA 3SHFA 5KYKA 2QSYA 5B57C 4LBZA 5B64A 5F2EA 5TB5A 1W5SA 5FI1B 3CZQA 5DI9A 4TL6A 5G3YA 3CKLA 1XZQA 2CCGA 1ZNWA 2VSOA 2F43B 3ADDA 5FI0B 1TEVA 2AXPA 1HY3A 2REOA 3BH0A 4H1VA 1TADA 1BMFD 2P6NA 1KKMA 1ZIPA 2C5LA 1D8TA 2AX4A 4URZR 3WY9A 4QM6A 4IDNA 1JR6A 3LQRA 3UMFA 3AVYA 3U6KA 1OH7A 3VR1A 3CRW1 2FMXA 1T91A 2CHQA 4O3MA 4ARZB 3RRYA 1NN3A 4QBHA 2CK3A 2YWGA 3KQLA 2QNRA 5TY0A 4DDVA 2R65A 2Q21A 5FBVB 4W9MC 1CXZA 3ZD6A 2OG2A 1SQ5A 3KJGA 2VTKA 1Z83A 3DMNA 3JZAA 2RHDA 3HU2A 1A7JA 3FYHA 5JWRA 4F38A 2HT1A 4TTPA 1YZNA 4EQ6B 3R9IA 5KNDA 1K5DA 2VL7A 2HUPA 1G3IA 1ZC3A 4GBMA 4PZZA 5FTJA 3PV0A 2FSIA 1KOFA 5H68A 1PLKA 4Q1DA 4DJTA 3Q85A 4QNRA 1DG3A 5BQ5A 4M21A 4Q7JB 1AJEA 2DBYA 2UKDA 3BERA 2BHRA 1NLZA 2EFHB 1G6OA 5L3VA 5BWMA 4B33A 1GG2A 4LJ8A 5EXPA 2IUTA 1AA9A 5BXQC 1IJFA 3TAHA 1DTSA 3BXZA 2FG5A 2JIZD 4ZKDA 2QZ4A 4US0R 1Z07A 2CLSA 1COWA 3RS3A 1AS3A 2WV9A 3LVQE 2ZUDA 5FPHA 5C4MA 2BBWA 3P32A 3TUZC 4PQFA 1G7CA 3CNOA 3GJ4A 4LSGA 4OJQA 1TL7C 3GCGA 1EFRD 3FOZA 4RZXA 3EG5A 2JJ8A 5CLLA 4G01B 3LH5A 1E1QA 1OKKD 1KK2A 1N5JA 4MRPA 2Z0MA 3KB1A 5AJXA 5FBRB 3AVPA 3T06B 2BJVA 3R9XA 3IO3A 3BFXA 1QVRA 3F5FA 2J0SA 4BFSA 1YRAA 1W36C 2DWPA 4Z1MD 1S9DA 4CEJB 1E96A 4Q5IA 4E07A 4G5OA 4B2LA 2RH5A 3NBYC 4US1R 2QM7A 4QJ4A 1G8YA 4IVRA 3UG6A 3X1WA 2HV8A 1KY2A 5EE0A 3FKQA 1UKYA 2H92A 4HAVA 4A6PA 2WOOA 2QU8A 4TYNA 1GOTA 3SOPA 4C0BA 3SS8A 2IUSA 1XEWY 1A4RA 2OSBA 1KO7A 3U6BA 5IRCD 1XPRA 1PJRA 1T8TA 3OESA 1ZD1A 4OI2A 3TJZA 3VAAA 2QP9X 1P60A 2IT1A 3BJIC 4RCZA 1U8ZA 1W4RA 5HCNA 2JLYA 5AJVB 1WDTA 3RS2A 2B92A 4LV8B 3PEVA 4Q4AA 5E95A 3AKDA 3EZ2A 4LZZA 1CRQA 5LB2A 3IO5A 5P21A 1LTQA 3FHOA 4F93B 1YR8A 2YV5A 4RFSB 3K0CA 1T0HB 2NQ2C 1KNXA 1SXJE 2C9CA 2J46A 4C9BA 2RGCA 4DDUA 4ILEA 3AVQA 4MQBA 4IRUB 1R0XA 3ND8A 3GLGA 5JEEA 2C95A 4BPBA 2ZI9A 3OIUA 1ZW6A 2QA5A 4QL3A 1ZNYA 4CYMA 1QHNA 1CR0A 4JVSB 2H57A 2QEQA 2V55B 4LHZA 3QKUA 5FUWA 5H1YA 2ZQ5A 2QP4A 5HCIA 1OXSC 1Z0DA 4DLZA 5J4KA 2ZRDA 1NKTA 4V0MA 2QORA 1YR6A 2ODNA 4MGIR 3WBKA 4E22A 2PEYA 4RKFA 3TQFA 1ONBA 1W2GA 2FZLA 3LWNA 4YMUA 3QY0A 1U8AA 3SHWA 4KSCA 5JI3E 2VP6A 4GT1A 4YMVA 3QUSA 4TSFA 5IHPA 2P67A 2PX0A 3L0OA 3PEUA 4NYMR 4EJSB 1A2KC 3R8FA 4R2HA 3OEED 1XJCA 4OYHA 3T1VA 4BFUA 1OXXK 4QFMA 4XOIA 3TSOA 3CX7A 2RGDA 1P3JA 3IBGA 1UAAA 5DIFA 4DSOA 1DE0A 3GLGE 3OIWA 2H16A 1NLFA 4FMDB 1ESNA 3K0FA 2IF0A 1T9HA 2OHFA 4D26A 2YC2C 4QHYA 1FFHA 1UJ2A 3QOFA 3BE4A 4AKGA 3PEYA 1XNJA 3BOSA 1GL7A 3B6EA 1Q1QA 2NOAA 2PMKA 3KZ1E 2HDNB 2P2LA 4A9AA 4HDQB 1XD9A 4IEEA 1XJ0A 2OT3B 2ATXA 3AF0A 5FL3A 4C0AC 4DLTA 4PANA 1M7HA 2A5FA 1Q22A 3AGQA 1IONA 2F7SA 4P4TA 3TR5A 4B75A 4LJYA 2D7CA 2YOHA 1OB5A 4NL4H 4TL8A 4YMTA 1P9WA 3NHBA 1Z6YA 4JKYA 5FOTA 2PJRA 5KSOA 1VHTA 3PFIA 1AQYA 1YZTA 3Q5EA 1NMZA 2P0EA 4C0JA 5JEDA 2A78A 1NVUQ 2OM2A 1EESA 3WMEA 4G1UC 2O8CA 3REFA 3ZVMA 3P20A 2X2FA 3TKLA 3TLXA 1E2GA 2GJAA 1KJYA 1XP8A 3LXXA 1DBSA 2GKSA 3AH8A 3CBQA 3CRQA 4LPSA 4V0OA 4Z8YA 2E1RA 4C30A 3IPXA 421PA 3U60B 3T12A 1EX7A 4IHQA 4A1FA 1YE8A 3QXXA 1QG4A 4HUTA 3LVRE 4IKEA 2ZE8A 3QXJA 2YWEA 3KJHA 3EZ9A 3IPYA 2OV2A 2I1QA 4D0LB 4HATA 2DWOA 3WRYC 1E9SA 3MCAA 1J2JA 1X6VA 4LYHA 5UKDA 1OV4A 4KO8A 3WHKA 1LVGA 3BK7A 1PLLA 2W58A 1I2DA 2OCAA 3ASZA 1VYUA 5JCZA 4Q7KA 4PHGA 2ZSDA 4HI0E 4CEHA 1KDPA 2FGKA 1XZPA 3A58B 1RE0A 2J45A 5G40A 1E2LA 3RYTC 4Q4AB 2AD1A 1GDDA 1N5IA 4L15A 5FH9A 1TTTA 2ZSBA 5C46F 4OI0A 3C5CA 1QHHA 2JLSA 2NO0A 2RGGA 3QNUA 1EX6A 2X2EA 5CITA 1RYHA 3MG9A 1XPOA 5FTKA 1OYWA 5TMPA 1IN6A 2GXAA 2XTMA 1N6LA 3UWOA 5EZ5A 2MSCB 1P9NA 4JT4A 4C0LA 2JDID 4N3NA 1RFLA 1E4VA 2KBFA 1N6IA 1AIPA 2GJ8A 3UMSA 3VMFA 4LUCA 5H8WA 3C15C 2QMHA 4RD1A 4GMDA 1XXHA 2REBA 1P72A 2WMOB 2WWYA 2ODBA 2WAXA 5JZVA 2R6AA 1EFUA 4NH0A 2O8FA 2BBSA 2VHJA 5DISB 4BFWA 2FGJA 3GJ0A 3LDAA 4PZLA 1CJTC 3GFTA 3SQXA 4BWYA 5L3SA 4OQLA 2C03A 3O8DA 4JLKA 1XEFA 2F9MA 1Q3TA 3MLEA 4LCBA 4D81A 4AYWA 4C2TA 1GNPA 4A36A 4KXFB 2WMNB 2Z83A 1T6NA 4MGKR 1N6RA 1IAQA 4TT3D 1LW7A 4Q47A 1LS6A 4CRWB 2FH5B 5AK0A 3SU8A 3LFUA 1K6MA 1CKEA 4MYUA 1CJKC 4PTLA 4MUAA 1VECA 1Z2AA 4GMXA 3M0EA 4OQMA 1PUIA 2ZROA 4MA4A 4Q7MB 4J0QA 3ZGXA 4HLQB 1D2MA 3SBEA 4TL7A 1AS0A 1SXJC 1VCIA 2HCBA 2WPDA 3QXHA 4NONA 1UADA 3KUDA 2OE2A 4UXIA 4EPTA 1B0UA 3EAQA 1P73A 2ANCA 5FUVA 3T5DA 3DZDA 3K0FB 2J0UA 2CVHA 3RS5A 1U2RA 3B1WA 5E4FA 4XH9B 1XXHE 1LNZA 2J7PD 5AWFC 4Z54A 4BRWA 3B78A 1E98A 5JECA 1UKVY 4R2IA 3U5ZB 3U7FB 1MO5A 3CX6A 2ATVA 2J87A 4O2RA 4RCYA 2WICA 4YXWA 1EFTA 3GJ3A 3L2OB 4C0KA 3I92A 5SZJA 2VF7A 1NG1A 4QGAA 4U00A 4GOJA 4M9XA 4XD7D 1KZGB 1V5WA 4BFVA 4JJZA 1GKUB 2XNDD 3W34A 1OH5A 3OFND 1L4YA 1UBFA 2IA5A 1MABB 3BWDD 1I2MA 4LHWA 3K0CC 1SVIA 2FFHA 3SEAA 4RD4A 5HE9A 3BRWD 2IHYA 2ZANA 1ZM9A 4S35A 2Q3HA 1ZRHA 2PZGA 1PUJA 3OE7A 1BS1A 1E2QA 4DLWA 1W47A 1OPXA 1G5TA 5J5CA 1IY1A 3L8YA 4GDFA 3FHTA 3QKSA 1P75A 1DAGA 5GJBA 2QGZA 1XTRA 2LKDA 3B13B 4PZYA 1N25A 3PVSA 1G5RA 3BB4A 1XMVA 1CBUA 5AJYA 3PUYA 3HU3A 5F9HA 1OXTA 2LCFA 3K70B 1IY2A 2OLJA 2I4IA 2Y8EA 1XMSA 1K5GA 2D3WA 4FCWA 4ZV4A 1C9KA 4UNSA 3WBJA 4NYIQ 1ZAKA 1OJLA 1B23P 4WZAE 2FV8A 4BLQA 4M4SA 5DSZA 5HKKA 4CEHB 2W2XA 5EE5B 1JXMA 2ZRGA 2E87A 1G7TA 1SHZA 1A5TA 1VKJA 1Z6XA 3H0KA 1JECA 5C4GB 4JBYA 4EFNA 1QHHB 3SC3A 3GLHA 3CF0A 3CH5A 1N6OA 5CJ2A 1YZQA 3W3AA 1HT1E 4QNMA 2O5VA 1H8EA 4B76A 3ZQ6A 1JBKA 5DO9A 4ZIRA 2J59A 3CIOA 3MMPA 1T8UA 4R98A 3FDIA 2GEUA 1ELOA 1LB1B 3CRMA 3FMFA 4IDOA 1IN7A 3NIBA 3U7HB 1EFRA 2I1VB 5FL7D 1NJFA 3UIEA 3PQCA 2WJVA 4M2LA 5M04A 4OK3A 5KDDA 3QEOA 1W44A 4JVMA 2ZRIA 2JLZA 2FFAA 5CB6A 3CF6R 1W0KA 1TUIA 3NC0C 2W6IA 4Q9JA 2NMVA 3EA0A 1X1RA 1CULC 4OHVA 5EP4A 3T5GA 3CUEF 4OHXA 3T35A 2GCOA 2AFIE 4AD8A 4I1UA 1AN0A 1NBMD 1FUKA 2WSSD 3C5HA 4BLRA 4GPTA 3L0IB 4B3DA 5BN4A 2RGXA 1OIXA 3OAAA 4ON9A 4DZZA 3RSLA 1Z5ZA 4PAMA 3GLHE 1XU4A 2ZS7A 1IXSB 2FFBA 2ZRAA 3CPHA 3NH9A 2ZRFA 3AF2A 3LA6A 3W90A 4HDCA 1HQCA 4BLOA 2ZTSA 1QHGA 1YQTA 1HTWA 2N42A 3TNFA 3CRRA 4LWZA 3AF4A 2PZFA 2QQEA 3RHFA 1Q3HA 3VR5A 4RFVA 3BH6A 2J0UB 2ZI4A 3H4MA 4Q21A 3K70C 2AK2A 2RMKA 4MH0R 4MUBA 1Q1EA 3C41J 1TAGA 1ZMXA 1G3UA 4JLPA 4IDQA 1MV5A 1D6JA 5AJWA 4TMZA 2ZSEA 4ZKEA 1UDWA 3BB3A 2ONKA 1ZINA 2JLWA 2C04A 4KODA 4YDSA 4F4CA 4ZDKA 5EQTA 3EPJA 5AR1A 1JR3D 1P61B 5A4JA 1WBDA 4M1SA 2YKGA 1KI7A 2QT1A 2X77A 2CHVA 3A1WA 5DI3B 4L9WA 2W6JD 3U2QA 1GTVA 4FN5A 3PJRA 3DDCA 3QG1A 1W48A 1V43A 4NCIA 4MRRA 2R6CA 4YC7A 4Q9IA 5IK2D 1KSJA 2V7QD 2YHSA 4LJ4A 4NCHA 3SFZA 2DYKA 2F1RA 5CK4A 3QKSB 2QENA 4LBWA 3U7EB 4DT1A 4PO9A 3PITA 4TYWA 4C7OA 3HDTA 1M1YE 1AZSC 4C2UA 4XTRA 1RVDA 5EE3A 4B32A 1SKQA 3FHCB 2P5SA 4ZDJA 3A4MA 3RRNA 2VP4A 4E5UA 2CCKA 1NKSA 1TNDA 3Q8XB 3EW9A 4LJ5A 1E2JA 2D2FA 3ZZTA 1J8MF 5HE8A 2IXGA 2PLFA 5G3ZA 3RS7A 1P5ZB 2DY1A 4IDHA 2ZYTX 1AS2A 1JQJC 1KDOA 4CF7A 2V3CC 2FFQA 5FPTA 2CCJA 721PA 4A82A 1NVVQ 4LY6A 1II9A 1X86B 3NDPA 3E1SA 1R5BA 1Z3IX 3RS4A 5BYJA 4LC0A 3GLHB 2ZUCA 1E2HA 2QN6A 4RZUA 3FTQA 3I5YA 4F91B 3QIAA 1N2CE 1KHTA 4B2IA 4DSTA 2H18A 2JLUA 4JVLA 2PCLA 4ZIRB 4I4LA 1VYVA
chains in the Genus database with same CATH superfamily
3GUYA 3PQEA 4H4DA 1T9GS 2IC5A 4CR7A 2IK8A 1QQ7A 2W5UA 2YIJA 4IDGA 4OYRA 2B61A 2QAGA 2XRFA 1Z26A 1LLQA 2PYDA 3HY4A 3IE0A 5FFMA 5DBEX 3EGIA 3NTUA 4JJKA 3H3JA 4PCUA 3DV0B 3DFKA 5ETJA 1W0JD 2ZWMA 1C3VA 3W5JA 5KSYA 4Q7LA 1FK8A 2Q6TA 3E3NA 3UBMA 2E4YA 1G41A 3FBTA 3KDSE 1XBTA 1GV0A 1XD8A 1ZHFA 1JZQA 3EWAA 3WTCA 2C4TA 2JD0A 2VCYA 2VC2B 1F3OA 3H9CA 3LUHA 3HBJA 4IVNA 4JQYA 1O9GA 4MIEA 4L0DA 4TV9A 1JHVA 4LVNA 4WZBA 2JFQA 3AM3A 2YW2A 2HNKA 2MWMA 4TRRA 5KB3A 4Z2AA 5EP1A 5ENDA 4CV2A 1ZD9A 2F3QA 2ZYDA 4WLVA 2VHQA 2X1LA 3MIZA 3C85A 4FBMA 4EHAA 2R2GA 5JC1A 1MX5A 1QHYA 3LL7A 5K0ZA 4F4IA 3H2GA 5AVZA 4UU7A 4JUAA 2DLDA 1JPJA 1LRKA 2CB9A 1X80A 3B2EA 4Q03A 4Q66C 4M86A 4TRMA 3W8DA 2QLTA 2VQSA 2PX4A 1RWXA 4KXVA 2N75A 4RIHA 3PNLA 2BGJA 5K4GA 2II6A 1LI4A 2WTUA 2OAQ1 5KU1A 4TVBA 1EFHA 4JB8A 3D4IA 2PUVA 3OHMA 4B47A 2A1UB 4HGPA 1B42A 5K6AA 1MO6A 4KG7A 1VJCA 1NOJA 1LPOA 4J0DA 2A9PA 3AL3A 3TXYA 3HP7A 5IKMA 3BWXA 1RABA 4BV9A 2PFSA 3PC7A 1KO5A 2Q1YA 3KXKA 4CMEA 4Z7QB 3F1LA 4B3XA 1DKUA 4GX1A 4RACA 2YOGA 2WFZA 4BGUA 4H3KB 5FXMA 2VDPB 2YDXA 4CKEA 2CNWD 3IUYA 3PQ6A 5AHOA 3ZKWB 2JLCA 5ALZA 4ZK2A 1L7NA 3AY7A 1EWVA 4ER5A 5F2NA 3QXCA 2CXPA 4X84A 2V6GA 4H9GA 4HNGA 5FPYA 2VIIA 1AM4D 5DHRA 1G5IA 3LX5A 1GT6A 3IPAA 3FVQA 5JBNA 4P34A 2XCSB 2IDZA 3KZCA 3QQPA 4CM4B 1DC7A 3OCUA 2H2IA 2IWHA 3WGHA 1H0KA 4KO4S 1E64A 5IT0A 2IYLD 5C8DA 1T4CA 3SKVA 1YZFA 2NNLD 1QOPB 1A5ZA 1I9CA 1V4VA 1WXXA 4J0GA 3QENA 2ZXUA 4WAUA 3V8BA 1EI9A 2Y1FA 3BGOS 4RK0A 3C8DA 3ZBUA 5BVHA 2XUDA 3I04A 3TTVA 1N6NA 2MU1A 1RHQA 3LO5A 3T7EA 4EVRA 2OPBA 3HR4A 2BE9A 1UC9A 3IKVA 4XWOA 4KNVA 2PSFA 3O1IC 3ZE7A 1PF7E 3U3ZA 3EQ7A 4KI7A 3SM9A 3OO1A 2JGDA 3O4HA 3K6SA 1S2IA 4FCTA 2DR2A 4G65A 5AUQA 3UKJA 1ADFA 1K3FA 2JCVA 1Y7HA 2WJPA 3MPOA 3AWIA 4AMBA 1RLJA 3RKUA 2BIFA 3EWNA 2XT0A 2R8ZA 3GIDA 2ZW9A 3UK0A 4YGYA 2ZT5A 3M1IA 2DBRA 1V37A 2F3TA 2HFKA 4RD0A 1TXGA 1SC3A 2FMUA 1KZHA 4YRNA 5JBQA 5C1IA 4X94A 2FPMA 3ETGA 2XYVA 4IMIB 4G8BA 3A4NA 4E1AA 5JYDA 2ZTLA 1AT1A 4YRRA 4AYTA 2CC2A 4I50F 2J7KA 1K6IA 4RVSA 4XIGS 2GHIA 3SIRA 2V1XA 4YUAA 2PEZA 3W79A 5JMOA 2PUWA 1YVDA 3VR2A 3ZD7A 2MJLA 2AVDA 1J39A 4I4NA 4XASA 2NLOA 4KJZA 1CQXA 5SY9A 1HM5A 4RV5A 2V74B 4FR2A 1ECBA 4CKYA 2XX3A 1OV6A 3E8XA 3DTVA 2VEOA 1IQPA 3OFNA 2JGJA 4LDQA 4WY5A 3T94A 1E3MA 3VHLB 5FNVF 4OLBA 4G4SP 5CW1A 1YQWA 1U04A 4KQWA 2CHGA 5AW3A 8ATCA 3H0CA 4D6XA 4K88A 3VJKA 1Q0SA 4IINA 4OSOA 3EARA 3WLAA 3W5AA 1HT2E 2ZUUA 3IULA 1I3CA 4OVKA 3R8CA 4HC4A 1J2EA 1VCHA 5LP6A 1I7QB 5CDTA 1SVSA 4WVFA 3TQIA 4F4HA 2XB9A 2ZYVX 1KTIA 3HYNA 2PIDA 3DMFA 1O6FA 2H6EA 3G2QA 4JSYA 2M6LA 1DO8A 3WNDA 3R2JA 1ODLA 3B36A 4TV9B 2O0JA 3E03A 4O59O 1JTFA 3OOWA 1T3TA 2ZVQX 4N6NA 4K26A 3ADCA 3L07A 1J33A 5FR1A 1OWPA 2VJLA 4Z9AA 5EUMA 4TTRA 2MINA 1KI8A 1Q0UA 2DFTA 4R3UC 4WZ6A 4WQMA 2QXTA 3LFHA 4LCEA 4X1KA 5ALGA 3W8RA 4JXZA 1KI2A 4GZ3A 4RK5A 4QGBA 2CXNA 5EXSA 3WNBA 1QF9A 2RFLA 1FDRA 3KHSA 4ID9A 1X80B 2AV6A 4JJ7A 3VPBA 1SKYB 2VQ3A 4R7GA 4D0NA 5MDHA 4DABA 3OSZA 2XUGA 4YRTA 2PWBA 4LOJA 1Y1RA 1NSTA 1TMKA 1Z7YA 4MPTA 2B7CA 4EY4A 4C4SA 4JX8A 1PJBA 1FYWA 3UMBA 4CCSA 3FWPA 4PPFA 3RRZA 1ZUNB 2FEKA 3UMJA 1E79A 3MTEA 2GJKA 1T1SA 3S2FA 3PSAA 1DO0A 1EDOA 1SNYA 4YP7A 4E6EA 1I30A 1PWZA 2P6UA 4EHIA 1B26A 2WWVD 4BMXA 3NTVA 1TTHA 2PWPA 4KK4A 3FE2A 2CUNA 3D3JA 4XXHA 4NDNE 3DBIA 3EE6A 3K9LA 5J2TF 1G6HA 2XTZA 3HWX1 3QPWA 2YHAA 4P6VF 4RYLA 5LUAA 1L7VC 5FL7A 3CC8A 3T1NA 4RHEA 2IPOA 1R0LA 4WNIA 1RWKA 2VR1A 4UU8A 4D97A 3QWIA 1CY6A 4N7JA 1DJMA 3IAUA 3EXHC 3R5XA 2GI4A 3ZVRA 1SOUA 4V02A 1P4GA 1VDMA 2GJ9A 1PYDA 4NZ9A 4Z53A 1XK7A 1N2EA 1XX6A 2I7TA 3C43A 4UCQA 3EQ8A 1Z8FA 3ROGA 2FEOA 2GJSA 1T5LA 2A9RA 2MMCA 3ZW9A 3K0SA 4JBGA 3L7KA 4YX9A 1EFLA 1ONNA 5EGSA 2YC4C 3A1TA 1JG3A 1H2EA 3DR3A 2WJJA 2ZJOA 5K8IA 4NPCA 2ENUA 3WL5A 3HJRA 4C03A 1N8TA 1QDUA 1BXRA 1PYOA 3X3HA 1FQJA 3LCVB 3PR2B 1X7WA 2ORIA 1ZU5A 4D8WA 1UEIA 2WE7A 2XZTA 2QI9C 3L46A 2JGDB 3W9YA 3BVPA 1G8PA 3HY3A 3LDFA 2CVPA 2ZAMA 2HMAA 4BJ1A 1GZHB 2C78A 2G40A 4HH0A 3MELA 3JWPA 3KYDA 4MGEA 5JY6A 3MMNA 2FUEA 1K8XB 3E9DA 3MJEA 3H75A 3K1JA 4MRMA 1WZCA 1PGPA 3AVOA 1L8QA 4WK2B 2QD2A 5DX0A 4DIFA 2C8JA 2ZXEA 1YU9A 2H0AA 3KXIA 4LV5B 3FIJA 5JAPA 5KDLA 2QN1A 2BGIA 2IHVA 4ZAZA 3D4LA 3OJCA 3WWZA 1PWHA 3E9MA 2AJLI 5DN6A 4CZ2A 4BVGA 1U99A 4BGDA 2GM5A 5ICSA 3ZU6A 5IBPA 2XMBA 4MMYB 3KUCA 4IIBA 5CNJA 5ICCA 1GQQA 1BJTA 1AKYA 2P0YA 4OBXA 3QW4B 2G72A 1R3DA 3SR4A 4ZTUB 3IUSA 3V7NA 4OP1A 1D4AA 3BMOA 1P9OA 1WZNA 5FHRA 4MQ6A 1TUBA 5B1SA 1K6XA 1N36B 2V96A 4OV6B 2CDAA 3NHSA 3PGMA 1Y3HA 4EEXA 1VP9A 1IYZA 4EJ6A 4OBBA 3AUAA 1X1BA 2E4WA 4FW8A 3U09A 3HBFA 5BUCA 1NG9A 4B3GA 4QVIA 1FXUA 2EFCB 1KY3A 4NABA 3LY5A 2ZJFA 3AHHA 3ZHYA 5TPZA 5ALQA 4OCZA 5KNBD 1HE1C 4L5JA 4P53A 2EFDB 3P27A 5BT8A 2PIAA 2XW6A 4NY1A 2IBTA 4X6LA 2NZWA 1ZMOA 4UKDA 3V7YA 2NTNA 3FZQA 1B2LA 2IHBA 2OXEA 4MR8A 4DEVA 3GA5A 2V9ZA 4EX6A 1ETUA 4DB4A 1SZCA 4DLNA 4G81A 1NP3A 1KJIA 3R7DA 2HT6A 3F8TA 4FZ3A 1Z5VA 4OK6A 5L3RA 4HBGA 3TIIA 1TLLA 3EDYA 3UB2A 3PX7A 1G5FA 4E11A 5KTYA 4GR5A 2GA9A 4BO9A 4ACBA 4BFXA 3EZGA 3PLRA 4YJKA 5L3SA 2ZE5A 5BYAA 1V25A 1LD3A 2J6CA 7ABPA 3BL8A 3PWKA 5DMXA 4TYMA 4HVLA 2CJWA 2OCBA 4Q48A 3L05A 3T5PA 1TEZA 1D4OA 2OPHA 2XCTB 1G19A 3DE2X 5J4LA 3AM1A 5ALDA 3BX1A 1QHSA 5CA0A 3RTEA 1J90A 1AHHA 2D7JA 1VDZA 1JH9A 1JHQA 1ZBDA 4S04A 5TVKA 5J23A 4EKEA 3KPYA 2F9LA 1E4YA 3KSDO 3MW8A 1RIFA 1KYXA 3V2IA 1PD1A 3A25A 1GG5A 2SKEA 4L6IA 5F51A 2VPPA 3OCWA 3QVGA 1LSUA 2BAGA 2E4XA 1PX2A 1GL3A 2CXTA 3NANA 4G5QA 4K03A 4NYJQ 5EXTA 5FA6A 4BJHB 1J1UA 4L74A 4I9UA 1AMUA 4IZIA 1FP6A 1BMDA 1PE0A 1W46A 4G9EA 3ZVKA 2CFRA 4EPYA 1OGJA 1SULA 2FZKA 4UVDA 3KLBA 1E62A 3IP3A 5JCJA 5I7WA 4DV6B 4UUAA 1QM5A 1Y42X 1ILWA 4UE6A 5CB0A 4DW8A 1OXUA 4RJKA 4QATA 5JZOA 2XQKA 1QBKC 4D6PA 4XB6B 5IC4A 3GI1A 3Q3CA 1KI1A 4ZAYA 3RABA 5EJMA 2JRCA 3N2YA 3AR2A 3E48A 4GX5A 1A76A 1YJQA 1R9NA 3PZBA 3CHYA 2X6RA 3R3UA 3GZJA 5HFAA 3OUUA 1C0IA 5AVWA 1U0FA 4P0QB 1OFUA 5JD3A 4LIPD 2C1EA 3DD5A 3G8CA 4AJ1A 4EHKA 2QRVA 4PC2A 2C42A 5JRJA 1D04A 3OCVA 2R8OA 4JUDX 1THGA 3LC1O 3A1VA 3R77A 3W5DA 1COWD 2OV1A 2M98A 5EXEA 1SBHA 3ADPA 5K0JA 2JZCA 3HVUA 1D4FA 1BFKA 1P1RA 4KIUA 4CL3A 2GEDA 1W4ZA 1MO2A 3UPUA 4AQYB 1U0BB 1UC8A 4XB2A 5LZ4A 4I5FA 1C7ZA 3L01A 3H5OA 2AOUA 1JT2A 4FMCF 1AQUA 1YE3A 2AE1A 2BHTA 4JLNA 4ND8A 5KX5A 1BXRB 2H29A 1L9XA 3D0QA 4AN0A 4F06A 3I0MA 2WZCA 1X7WB 1RRPA 2A9OA 3LUBA 3H19A 2Z04A 3HLTA 1GEGA 1F9AA 1I32A 4YFYA 3S1LA 3OIGA 5A9TA 4BLTA 5A3JA 3WG9A 1PGOA 2V6JA 4PYIA 1OTYA 1Y1KE 5JSQA 4D9EA 3HR8A 1DCMA 1WDWB 3OM8A 4FOTA 1IY0A 1WXEA 3X1XA 1Q84A 1ISRA 2DHCA 3G5AA 3ORYA 4MRMB 1YVUA 1L2TA 3VTAA 1C3JA 4A8JC 1PBTA 2VPTA 3V4SA 4FTWA 1GJRA 4PWYA 2CXXA 4DA6A 3SEZA 1MX1A 4R8SA 4D8XA 1PQUA 3TMKA 2WT8A 2ZR0A 3ETNA 1MQSA 3OBBA 3PHCA 1HT0A 1NP6A 2PO7A 2ZRBA 4L0QA 5BSFA 2IS1A 2WTAA 5FR2A 4WKNA 4DMUB 5CDFA 3P4YA 1JEDA 3RYIA 4TTVA 2DE0X 3PJEA 4EECA 4F9GA 3AHCA 2EG5A 3BMOB 4MCIA 3LP5A 2C54A 1JVBA 1Y1PA 1TUBB 1O03A 3CX8A 3HN7A 3KSRA 1G8AA 4KVFA 1OD6A 4LOKA 2HLDA 3Q8LA 3EVNA 1XAIA 2VDOB 4LHEA 3S2EA 1YQ9A 3IILA 1II0A 3WL4A 4CKXA 1A8PA 3EBPA 5BSTA 3UAVA 1TJ5A 3NG1A 3GLFE 4R4JA 4CLDA 2FPLA 4L3WA 4JROA 2I78A 3JQ8B 1IN1A 4Z7NB 4PYOA 1DPFA 3T95A 3RUPA 2BFWA 2AOTB 5IDQA 4PY2A 1M6NA 4UEJA 2JCGA 4JWTA 1GNRA 3NUGA 5CPFA 4YALA 4EVQA 4JJAA 4YDRA 5FORA 4KXMA 3SF8A 5CVVA 1BH6A 1GZ7A 3D1JA 3KQPA 3QTBA 4W7HA 1TCBA 4LI3X 1FYEA 4C0SA 1IC6A 3JSXA 5D3KA 5IC5A 1WB6A 4NH4A 3X1DA 3AHGA 3VR4A 4CUJA 3O8BA 4DLSA 3SN6A 2JEOA 2R84A 4C08A 1BDJA 2XMRA 4HLDA 5JASA 1RYZA 1RBZA 2DETA 1Z0SA 2CHUA 3STHA 2C9ZA 2WI8A 1XR3A 2VCHA 3KLMX 3S68A 4XX1A 3E0QA 1WQ4A 4Y9SA 2FB9A 4KPUA 3U1BA 1LWOA 3QGMA 1YHZA 3HH8A 3IFSA 3ZEIA 1NQTA 3IT3A 2HGSA 3T4EA 2DPLA 1AGYA 2H1RA 2AEEA 4LI0A 4GI1A 1DJQA 5B3LA 3T3IA 3BK2A 4O25A 4ZXPA 4Q01A 4O2AF 1ZNXA 4UMDA 3M2TA 5CA0B 1WE2A 4FLEA 5HZHA 1IWOA 1JP7A 4TSFD 5TMBA 4PYMA 1DQNA 3N0RA 4JQCA 4FFSA 4XDZA 2B1JA 2QX4A 3LU1A 1OXMA 2VDJA 3I9LA 5E3IA 1Z2DA 1BSVA 2JAHA 2PKXA 2VUHB 1H2HA 3QVGB 4A0HA 3PI7A 5J2UF 3HWWA 4C06A 3CCFA 1LH0A 3CE9A 2JIPA 3COYA 5KOHA 5EMJA 2C8LA 1GPLA 2J6HA 2JIOA 5AOBA 1E1KA 1G2QA 2F3RA 4WI1A 5D3QA 3RPEA 4H3SA 4DC1A 4MKHA 2A8YA 4NCKA 3SYLA 5KNBH 1GKKA 5T4BA 3RARA 1FS4A 4NTZA 4ZHSA 4CKWA 5L3QA 3G5LA 4TKUA 1GG8A 4DZRA 3ZH9B 3SY8A 4BO5A 4P4GA 3I6BA 3MVEA 1JI3A 2P2CA 2R6DA 4MIKA 4LDAA 3ZBPA 1CG6A 2HIMA 1V6CA 2DBVO 1BGWA 2AHOA 3HP4A 3OU2A 3TLMA 4F71A 4ZGBA 4CKCA 3S2YA 2QE7D 3U39A 2A57A 1AHNA 3JQDA 3AVWA 5FTLA 1BHJA 4DCUA 3BXGA 2QRVB 3K9FC 2Q4DA 1A1VA 1XVVA 3QP9A 1JIJA 3V55A 4U9HS 4PTYA 3DPUA 5L9AA 4RAOA 5AK4A 4XI9A 5DMHA 4EGFA 2C0PA 2PH1A 1H3NA 3VJMA 4AKSA 3I1JA 4YV2A 2GTIA 1L5WA 5CYPA 3B3FA 3JYNA 4DPLA 1C7JA 1F14A 1CWUA 1Z34A 4O29A 4BZPA 2JNWA 1L7EA 1YJ5A 4ND8B 3ZE0B 4AO7A 4M1OA 1RLIA 4HAYA 3HXOA 1SD1A 3BKXA 4WSOA 2HMYB 2R60A 1NHGA 3GLUA 3WZLA 3K71B 4WZAB 2GNAA 1EZ1A 3ESDA 5F12A 3ZWDA 5EPOA 2QR5A 1BJRE 3O91A 1UPFA 1F4VA 5JSZA 4I50B 2D2XA 4JNCA 2NUTB 1IXZA 2IYZA 1AV7A 3G1WA 1GRRA 3GCZA 3N8HA 1IDN1 2H7VA 2VT2A 4NBLA 1P1FA 4XIYA 4GX2A 3V8NA 4Z6KA 3EXAA 2G17A 1V45E 1IY8A 1LX7A 4KL8S 1XWIA 1C0KA 4OHMA 1G8HA 1UXOA 2JEYA 4KXUA 1M2FA 3UXMA 1YAJA 3OTQA 4C89A 3O2JA 1N2CA 1NN0A 3E05A 3QUQA 1K7SN 1V16A 2QP3A 1E9DA 3A36A 1IJEA 1EG7A 1Z45A 4Q9NA 2W70A 3WLKX 1E3EA 5HGJA 4KLRA 3CT4A 1PKEA 2JHFA 4EZIA 3OIDA 3QLTA 5FWDA 1SIOA 3RYIB 3TJMA 3TQCA 2NZ8A 3RC8A 2ZE7A 1PFQA 4DR6B 1CSEE 3OEEA 1L4MA 2IYXA 4YECA 3ZZNA 1K8YB 1O94D 2A9QA 4AJOA 5KBYA 5DEIA 2GA8A 4IIHA 2AH5A 2EL9A 4WLUA 2MIIA 1E20A 4GOOD 5KPJA 5T4HA 1NW8A 4HADA 3PC4A 2HPAA 3ZY2A 3R8XA 1EK0A 4RDHA 1HYQA 3PPWA 1GNQA 3PD0A 1UK6A 3D4BA 4RORA 4BFYA 1KEEA 1RFGE 4W5WA 3WZ2A 1B41A 3R24A 4BFTA 2EX0A 1XXLA 2AFIB 3P0EA 4IV8A 4B8ZA 2PT6A 3F74A 5J40A 3FSRA 1STOA 1E1LA 3PNBA 3LGSA 3A37A 1PJLA 1ZSYA 5G53C 1UMDA 5AXAA 3SF8B 4A4DA 2HJ9A 2Q9CA 5JAUA 4RZ2A 3ZWCA 5EWMA 1M1XB 2OAP1 5DX8A 3N5KA 3KCNA 1GNLA 3WXMA 4B5KA 4V1CA 2NSYA 1IQ0A 1UJ4A 2IZ0A 4P35A 4HYQA 4P32A 3BSSA 3HKCA 4JLAA 4FW9A 3DVAA 2O59A 4KRGA 1L4GA 2H4YA 2D1RA 2PQ6A 4NG4A 3RFCA 4UTRA 1JFFA 1XDWA 5DW3A 5IDVA 5BMOA 1ENYA 2O3RA 1P1JA 4KPUB 3D3KA 3REOA 3RAFC 4B2YA 1F12A 4O8CA 1E9FA 3W9SA 4YYEA 3KEQA 3E4CA 1U9IC 4M7OA 1QFSA 1ZGHA 2AB0A 2O7SA 4U6SA 1GUAA 3IPLA 2ZSFA 1KO8A 2JPDA 3PFKA 4L73A 4TLDA 4ZDWA 3RBZA 3RAPR 1QQBA 2HBRA 4E12A 5BMVA 2HBYA 4LE2A 3LDHA 5DXJA 4WKCA 3BWBA 4YRSA 1J8YF 1IHYA 1B1AA 5E1DA 2NVUA 1Y8QA 2JL1A 2X4GA 1UBOS 2OSVA 1CQPA 1TZKA 3A06A 3GD7A 3UOAB 3UWSA 3IP5A 4E15A 5JFGA 4CEIA 3RIYA 3PCXA 4EA7A 1EGVB 1IRXA 1GKIA 1D2CA 1H65A 4LW8A 4LYEA 3QBTA 4Q9AA 2YZ2A 5AKGA 1AZTA 2FZCA 4JWKA 5DNEA 5KOHB 4YIHA 1KSGA 1Y3CE 2BI4A 1XTQA 1NVXQ 4LVOA 2FQQA 1V8PA 2PMCA 1A72A 4R1MA 1O0BA 4AC9A 1JQBA 4MHSA 2VOJA 1X14A 1N0UA 4F3TA 2ZSHA 3LHSA 4CKWB 1VPLA 4TKUB 4JBIA 3VGJA 3C3EA 4F1KA 1TJ4A 5IPFA 5CEEA 2BWJA 4JBXA 2ILVA 5EMKA 4ZHQF 1KZ7B 3IQZA 2I54A 4W5JA 1U1IA 3D8BA 3FNQA 4LHSA 4NZMA 1KP2A 3WB1A 1LFAA 4CKCB 2BKAA 4PSVA 1J6UA 1T6ZA 1D1QA 4FB4A 2R6FA 3QJ5A 5A6SB 3GARA 3WRXA 5AI0A 4MYTA 4CTJA 2PJUA 3V1NA 1XTSA 3VKVA 3TW4A 2FXVA 1G18A 2KSQA 3E7WA 2HMWA 4GWLA 1JLSA 2ZEJA 4D0GA 4MX8A 1YC5A 1Y98A 4QXAA 4ALNA 4DADA 2PVPA 3A7DA 5I5GA 2IXEA 4F2DA 2BDUA 3G5UA 3O47A 1GVNB 2YINC 5KNCD 2BISA 2ZCVA 2BDTA 4K2AA 5AXCA 1JDNA 1N78A 5TGTA 3BA1A 2D3TA 1N8SA 2HA0A 2VRWA 4W7SA 3W4KA 2H5EA 3MOGA 3NU1A 2JVIA 2G83A 3OQVA 2JG3A 5D3ZA 3RRJA 2D4HA 5JSZB 1GFIA 2YBEA 4B3RB 1U11A 3AQIA 1OHHA 2D5AA 3KB2A 1PJ3A 4EJSA 4ERNA 2NQTA 3TPFA 2Y1CA 4MB6A 1GQRA 2AI1A 3KKMA 1JQKA 5FBWB 1N2CB 4DV2B 1E5TA 2AXNA 3HNOA 1IH8A 4K8OA 3QX8A 5FUBA 1NSFA 3U3MA 1MGPA 3GGPA 3G2KA 3E2MA 4J9VA 4EATA 4YRQA 2H1VA 1HZZA 4R9RA 2N9UA 3V4LA 1XNRB 3DDHA 4G85A 4NBKA 4U2CA 4MVYA 4KPEC 1T3GA 3QBVA 2R1TA 1RHUA 2R6GA 1KF0A 1XE3A 1ZXBA 4HAUA 4QVGA 3HWSA 3ROXA 1V3VA 4MGZR 3OJOA 5ALTA 4AMVA 2FCRA 1OYVA 3OOHA 4DRZA 3URMA 3OMXA 2AD5A 2XY4A 2ACEA 1FPMA 1YDHA 2VSXA 5K1ZA 3JTEA 3VDQA 1FYDA 4GUAA 3G0HA 4I36A 4EKIA 1OYOA 2IFTA 1KEEB 1TQ4A 4IDAA 5DTQA 4AK9A 5F9MA 4LY3A 4G2TA 5BSUA 4L4RA 2OZVA 3L18A 5LQDA 1ORHA 3W3AD 4ZI3A 5F64A 5EP2A 1UFVA 2O8EA 2IEDA 2FR8A 3ESXA 1F0KA 3NTXA 3HVRA 4HQLA 2ES4A 3LJKA 5GJWC 3UT6A 2BZSA 5ITZB 1RJDA 1PX0A 2DLNA 5AXBA 3B1KA 3LTEA 4JEIA 4YRIA 1AO0A 4TKZA 2ZM5A 4PX3A 2GN6A 4V1CB 4LHXA 2X42A 1SBNE 4RPLA 3K8YA 4PSUA 4MUKA 4NCJA 2M9MA 3HKCB 2I9KA 1UWVA 3CNLA 2I34A 2ZKLA 1GPKA 4AG5A 1HDIA 2GX6A 1JFFB 5CB4F 1W0KD 2OBLA 4GQAA 3WGOA 1QVAA 1Z75A 1BG6A 1I01A 4J94A 3DLHA 1WHSB 4WXPA 1E2KA 4KQMA 4N5DA 1RAFA 1IL0A 1RRGA 2P27A 1OGIA 3C1TA 1HH4A 4QASA 1N3BA 1Z0IA 2ODWA 4YONB 5K6TA 4GOXA 2NUAA 4LFAB 3BRWA 2OGSA 5A4FS 2WWTA 4ETMA 5BMVB 4RHYA 1FIUA 4Y2PA 5A0TA 3WGZA 5HILA 1BDIA 1TI7A 2OWEA 4HLUA 4JYAB 1R6UA 3IYLW 4DR4B 1RM4A 4IW3B 4R6WA 2NVUB 1Y8QB 1ZONA 3VC3A 1ADJA 1M72A 1JB1A 4MTLA 1XTPA 4X6XA 4EO4A 5JI2E 4CEIB 4HPWA 3EXIA 2EP5A 3KJIA 1FUIA 4PHFA 3IOYA 4IV0A 3TNJA 3CH4B 4QRHA 2HYIC 2PH3A 4D9MA 4Z86A 1FMJA 1GLVA 1J9GA 5ESRA 3UK1A 1NFFA 2DH6A 2G8LA 3AY0A 3TIFA 2O8BA 3O3CA 3A0UA 4EEKA 2Y67A 4CCYA 2IIPA 3BTVA 3H1EA 2FZEA 2I55A 1ZJWA 4N5LA 1ICIA 2JIQA 4DV7B 3EC7A 3CY6A 3QJGA 4OP3A 4YQYA 1KFCB 4LHYA 1U2PA 5LB4A 3EXFA 4R2JA 1GRVA 2W2MA 4MCJA 3V00A 1QSGA 5I7SA 1T24A 5GJCA 5LM3A 2IHZA 4PC3A 4FMCB 1APBA 4IQ8A 4OXRA 3DMTC 1KEVA 3EDOA 2PK3A 3K7EA 4TGLA 1MH1A 2A5GA 4FN4A 1Z15A 1Q7CA 4LG1A 5DULA 5HYVA 8OHMA 1S7GA 4B3TB 3Q87B 2Q8NA 4L4ZA 4H16A 4M9QA 3WYBA 1MJHA 2OZKA 1N8NA 4YO7A 2YICA 1F17A 4G8CA 4A2WA 2R1VA 4RCVA 1IM2A 4YUZA 5GZ3A 3WKCA 3BRSA 4GIBA 3Q7PA 2PUAA 2QSUA 1U2SA 3W4IA 1QGOA 5F7XA 3IOEA 3NTOA 3OMWA 1POWA 1V4NA 1VFNA 3ZZMA 1S2OA 3GUCA 4L6CA 1J9ZA 1NLYA 3L7JA 4GSKA 2A30A 1YR9A 4HK4A 1NNUA 2JJQA 3EIUA 2OENG 1XLUA 2P68A 3WZMA 3LP6A 4RPJA 3AOEA 3TF5A 2PH7A 2IHKA 2GAFA 4DY4A 1L5ZA 2N1MA 2WEKA 3DLTA 2ZWVA 4AO6A 3ESBA 4YRKA 3T1OA 2P7HA 4EQZA 3CR8A 2REQA 3R5FA 4EABA 3H83A 3ISVA 1V4BA 4MKGA 1L5HB 1E1RA 2A3NA 3DWGA 1VG8A 1W87A 3ZWBA 1LV7A 4UHKA 2CEKA 1ZP6A 1JPNA 2GUWA 1ZC4A 2MSWA 4GZ5A 2BM1A 2WVJA 3EVTA 4GNKA 1U98A 2ZUVA 4DQKA 4ER3A 2ZI5A 2NV2B 4RADA 3MQ2A 1JIKA 4XQ9A 1CUVA 1IDOA 2EJWA 4KXWA 4GWKA 4HH3C 3CMCO 1HNNA 2R1TB 2UZ0A 2FJUA 1GL9B 2QZZA 3GJ5A 4KVGA 4R1PA 4A3SA 3ZZ1A 5EQDA 5HNKA 2RKBA 3B9RA 3P2EA 2LWIA 4V0ME 2FE4A 1Z62A 2C9MA 1OZ0A 4EY6A 4OPMA 3UGKA 3U49A 3KSZO 4KTTE 3ZU2A 1KS9A 3JQ9A 3TWOA 5FFFA 3ZBTA 2HGZA 5JANA 4HVCA 2ZRCA 5BQPA 3WLLA 2PQ0A 2WHXA 2ZJYA 3WV5A 1Q21A 3I39X 2TMYA 1O8BA 3PNPA 4QOJA 5I6DA 1HPLA 4GE0A 4A5SA 5LXTF 3FFBA 1UQRA 2CL7X 5IDXA 2O8EB 4CKBA 1W35A 3PIDA 2PYZA 4QVKA 3V34A 2V4UA 2X58A 1K4YA 1NVGA 3T3PB 2AE2A 3GFRA 1JI0A 5FOSA 4J1QA 1NW4A 2CVZA 1EB8A 2OHIA 3HL0A 1OLXA 1BA2A 3ZCXA 2C58A 4O2AB 4ILKA 1MIOA 1VIMA 4BTEA 5ED4A 4ENWA 2YUTA 4CUKA 1PU2A 1DPGA 1NJ8A 1TKBA 4IHAA 5A3RA 6ABPA 4INAA 3WGQA 3DT9A 1SC6A 1S3SA 3A7EA 4HTAA 1QAMA 1HE2A 2WJ6A 1BZYA 2C7GA 2PS0A 4O1HA 4YCLA 4CL2A 4ATNA 3WKEA 2YXLA 3ZR4B 5HFNA 4K3VA 4K9PA 5J2UB 4DILA 3G0CA 1JJIA 2D1YA 1O2DA 4V1CI 4NQZA 1JQEA 3SX2A 5BWOA 4IP0A 4PINA 2ZAIA 1Z5GA 2V58A 5LBTA 5KYWB 3UQZA 4LJ9A 1U7XA 2CUTA 4J4TA 4OBWA 3IT1A 3OZFA 4IJWA 4EELA 4KMSA 1OAOA 2OD9A 2X7XA 4PSCA 3ZHTA 1NOKA 5CYOA 4ARUA 2WSMA 2X2OA 1O6ZA 2BP7A 4TWZA 3M9LA 3EXIB 4I14A 5T8KA 4Y6GB 3IMCA 3I05A 4TT8A 3R5HA 4E3WA 2WY2D 4REMA 2GZMA 1FP1D 1YJXA 3E9YA 1E9BA 2XB4A 3ITNA 1YA4A 2J6IA 1NZDA 4W63A 5TGZA 4F5ZA 4GPEA 3NHPA 3EXEA 4U63A 3W3AH 3D0KA 2O8BB 3S2SA 2EKLA 4CCYB 3AR5A 4LEIA 5D5HA 5F5XA 3W05A 3IE1A 2J0EA 4BOYA 2QG6A 4RY0A 2PSEA 3KTAA 4FYYA 1JB9A 1UJMA 3I5XA 2ACWA 3RFFA 1PW5A 1YI8A 2C4KA 1GNTA 2J4FA 3GN2A 5KDOA 3KQHA 1KOGA 3IC5A 5I9NA 5M3BA 1PGNA 1DUIA 3Q1KA 1EX9A 1LPBB 2X6TA 4A2PA 2C99A 1JW9B 3UT0A 1QFXA 1ESMA 3B51X 4N3BA 1Y1QA 4ZREA 1GCUA 2ZRMA 3D5TA 3BTUA 4M37A 4YRGA 1EHIA 5GMOA 2BF4A 3HM2A 2QR2A 5SYNA 1CHDA 3ZTTA 5LZ2A 3S6JA 4HVAA 3KWLA 4IH9A 2G5CA 3K09C 4GMKA 1QZUA 2P3OA 4KAXA 3B1YA 3PXAA 2ZB7A 3C0KA 3IDOA 3R7FA 5IH7A 1X3SA 3LKBA 1IUKA 1ZKDA 1RD4A 1T3ZA 2C9DA 2R3SA 4O1MA 3T15A 4F8YA 5BPFA 1E8MA 1YKGA 2GTPA 5IAEA 5KYGA 3DO8A 3M1YA 2FPIB 4LECA 4YT8A 4OXNA 2DHEA 3FCCA 1UKZA 2B78A 4RF5A 2QT9A 4LC9A 4H18A 2NU8A 2R47A 4QTZA 2IZZA 2P4SA 5KWIA 1C4OA 1Z22A 4D3DA 1GDTA 4M22A 5KJCA 3FUVA 3O74A 3QFHA 2DBZA 2JLQA 4IDPA 1G8GA 2FG6C 1V2GA 3LXRA 3UXHA 2ET6A 1XP5A 1VI2A 3K6JA 3TVYA 3O9MA 2Z2YA 3WL8A 5HUQA 1X2EA 5KJ1A 1CB7A 3WO0A 3NKLA 1SCIA 5DYWA 3KR2A 1FX0A 3RHZA 4W6ZA 2HF7A 2W8ZA 1SD5A 1Z5NA 5AW5A 4D9IA 3PUZA 1DQRA 1OMOA 3FETA 3GFQA 3TZCA 1Y6FA 2Z6QA 3QMWA 4GAEA 5BQOA 3U48A 1FW6A 3FZEA 5IKOA 3BDAA 4EMSA 3GG9A 4MDFA 3PDWA 1Z68A 3FWYA 4UU0A 3HKBA 2ZI6A 2J07A 1UPCA 1CLUA 2DX7A 2XV1A 1J99A 1MB2A 3OKFA 3VHXA 5AKJA 5CFOA 1UM8A 1R7RA 2CF5A 3P2OA 4EA9A 1FXWA 3DDZX 3IELA 1TQ2A 1ZCJA 2BMJA 3MJ4A 4HP8A 1MB9A 3BGVA 3L0YA 5KOJA 1EA7A 3MRSA 4RK7A 4BNYA 2ESRA 5HJ5A 5KKCA 5DASA 5IKPA 4MRAA 4EL0A 4R51A 4WN9A 4TQUS 3FCOA 4EEZA 3I32A 4S24A 1NF3A 3RRFA 3K2IA 3UAWA 3ZNPA 3T7TA 4DLYA 3CZ5A 3IPCA 4LXIA 5B2ZA 3PNKA 4KVAA 4R6XA 3FZNA 3ULKA 3U61B 4ZO4A 2W2OA 3E84A 4ND5A 4YHHB 4GP6A 4YDQA 4OKNA 1GUYA 1M2HA 2I7DA 3G0BA 3N9IA 3GROA 3PHJA 4WBSA 4EM6A 4DS3A 4AT1A 1G42A 1U1FA 2A3RA 4FM9A 3NT2A 2H4HA 4FMDF 3HJTA 3I8XA 4AG6A 3THYA 4KYVA 4WGFA 5JJKA 1LEHA 4Y9RA 2IGTA 5IABA 1DIHA 3BA6A 3NLLA 5JDIC 3M81A 4DMLA 2DRIA 2G1AA 4PHTA 1PS8A 3BFVA 3P1JA 5BP7A 2FSFA 3DTTA 5JCXA 4UVGA 1OFGA 2QUKA 3DM9B 4Q4HA 5JRZA 2ZUWA 4W5TA 4FPXA 1PR3A 2HWWA 3HCBA 2ZDHA 3MUNA 4HPXB 4KQGA 1WW8A 2BBOA 3QE4A 1L7XA 3ZHVA 3RUAA 1ZGGA 1BYIA 4JOBA 5DE3A 1GG9A 2A4KA 1XMPA 1Q6ZA 2BSAA 2BP7B 3KQYA 1CP2A 1JXOA 4HB3A 1E5DA 2JHGA 3L8ZA 4LJ7A 4RE6A 2IYRA 1QB8A 4F5EA 4N65A 1INLA 1DQYA 3BXOA 3JYHA 1KQ3A 1CRLA 1R0CA 2Q6IA 4UUQA 3LGXA 4EPRA 2VJYA 4CIVA 1D6SA 4K9DA 2QLBA 1SCUA 4L4YA 4XUDA 4DMHA 3T0IA 3WMRA 2ZJBA 2IVZA 4QU0A 4OHCA 3WLMA 3T4UA 1R6AA 3TEJA 2YXNA 1O0CA 1EM8A 1EYZA 3TSWA 1R9GA 4ID3A 5K09A 3OZXA 1LCIA 1E79D 1E3TA 1HETA 1RNLA 1XNHA 2DU8A 2YXPX 3DEIA 1WUKS 3KTAB 4PIPA 8ADHA 4XJTA 1WKCA 1GD1O 1SCKA 1UF9A 2P11<