3Q85A

Crystal structure of rem2 g-domain -gtp analog complex
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
169
structure length
149
Chain Sequence
GVFKVMLVGESGVGKSTLAGTFGGLDTYERRIMVDKEEVTLIVYDIWEQDHCLQTGDAFLIVFSVTDRRSFSKVPETLLRLRAGRPHHDLPVILVGNKSDLARSREVSLEEGRHLAGTLSCKHIETSAALHHNTRELFEGAVRQIRLRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding protein REM 2
publication title RGK Family G-Domain:GTP Analog Complex Structures and Nucleotide-Binding Properties.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 53
structure length 149
sequence length 169
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3q85A00
1DEKA 1SKQA 3U44A 1E96A 3P32A 4LHVA 3KFXA 1OF1A 1Z47A 3K0CA 1II8A 1PLLA 3N2EA 1HE1C 3DL0A 2GHIA 3B1YA 3L8YA 4PC2A 4BLSA 4RD1A 3U4QA 5J4YA 1YQTA 4EPYA 4LDJA 1R8QA 1G19A 2GESA 4IDNA 5EXXA 4DLWA 3BIFA 4G5OA 4RFVA 1U81A 2ZJAA 2QPTA 3QEOA 1E9RA 1KO7A 1LTQA 4HDCA 3AVOA 3C4JA 5AJVB 1ZRHA 4FINA 1ZIOA 2QAJA 2QP4A 2XTZA 2V6JA 1EGAA 821PA 1Q0UA 3RS2A 5JS7A 1AS2A 1S9DA 4FMCB 4Q9KA 4IW3B 3K9LA 2LWIA 5FBRB 5K8TA 1JEEA 2ANCA 4KYIB 3PUXA 1G291 4XWKA 2VH5R 1A82A 4DLTA 1G5RA 3I4LA 4D2IA 2IYZA 3EG5A 1OSNA 4DCSA 5CJ2A 1Q20A 3R9WA 2WPDA 2BM1A 3VKHA 3QXSA 2CL6X 1IJEA 3AUXA 4W7SA 3BERA 2BCGY 1VG9B 4I1SA 3UWOA 1BYIA 2ZJBA 1G1MA 2SHKA 1TU4A 2WOOA 4IXMA 4PANA 4AI6A 3K0FA 4U5XA 1S8FA 2YVUA 3DZ8A 3HJNA 2C03A 2GCPA 3QPUA 2GXQA 2IS1A 1E32A 3AGPA 2VP0A 1W0JD 1KO5A 4B3DA 2IEYA 3CRW1 5K8LA 4PPQA 4OHYA 1SVOA 2BBWA 2ZU6A 3NC1C 1BMFD 4B71A 3TGPA 1XU4A 5F3WB 1S3GA 3KZ1E 3SFZA 5L8VA 1OH8A 5KPDA 2PJRA 4LJ5A 2BJWA 2UZIR 3CNLA 3T34A 4AIIA 4B76A 4Q9IA 1LB1B 3PEUA 1CBUA 1WCV1 621PA 4TWZA 3OF5A 2ASEA 2ONKA 4NYMR 2EQBA 1CF4A 2PZFA 1NBMD 1IN7A 3FHCB 1FL9A 3L0OA 4QGFA 4R2IA 4C9BA 2IS6A 1AQUA 2ODNA 3LBHA 4KO8A 3VR5A 2ZSFA 5EP4A 2DYKA 3SBEA 3ZDQA 1E0JA 3T1TA 2XSZA 1NF3A 4M4SA 4DWJA 4ESVA 3AP2A 5AJWA 3LY5A 3AP3A 1UEJA 2Z5FA 5E4FA 4G1UC 2QEQA 3GJ0A 3QI2A 4B73A 3IO5A 1GAJA 2G77B 1HEIA 2WJGA 5JMTA 1YZKA 4BE7B 2Q0HA 5EXPA 1EFRA 2QAGA 1KJYA 4OYHA 3FDIA 4TTRA 5F2EA 2UVQA 2HT6A 1ZP6A 1L4UA 1D9ZA 3AKEA 4RZUA 4ZKEA 2W2VA 5AR1A 2QP3A 2VLIA 5HE8A 5TVKA 4JMPA 2H8KA 2RMKA 4N1AA 1G21E 4AD8A 1NIJA 4BGDA 3OEED 2A2ZA 3ECCA 3BJIC 5FUWA 4FCWA 1NJFA 4Q9HA 4V0LA 5LB2A 4N0EA 3CONA 1PLJA 3LX8A 2O8BB 1XTRA 2BMJA 2NTYC 4B75A 5KNBA 5C4GB 3LQQA 5FL7A 4Z54A 1IBRA 4Q4LA 2BMEA 1NN3A 3N5CA 1LF0A 1S9HA 3PFIA 2VP6A 2CXXA 3D7MA 1OFIA 4G01B 5D3QA 3QKRB 5FBLB 2IC5A 3DVLA 1W5TA 2R6FA 1X86B 4S35A 1VDZA 2GXUA 2XITA 2ZUCA 2ZI5A 4M2LA 4NYJQ 1RFLA 1SVMA 1OFTA 2GBLA 2AXPA 3SYLA 4ZI3A 1GG2A 1XCGB 1YZGA 4M9QA 3PJRA 2BCJQ 2KB0A 1G6OA 2EFEB 2O8DA 1SQ5A 1Z0FA 4DC9A 2ZSDA 2PX0A 2ANBA 3CX7A 4LSGA 3GFPA 2QMHA 1ZJ6A 1QRAA 1X8KA 3LLMA 1DO0A 2ZRGA 5CLQA 3VNUA 2ZJOA 4AYTA 4N3NA 1W4RA 2OESA 3W6OA 4PO9A 4OJKA 2QROA 3REFA 4KFUA 3LW8A 1GM5A 1AKYA 4C2TA 1KI6A 3SYNA 3IPXA 5FTKA 3VQTA 2D7DA 1CRQA 1IY1A 3ZD7A 5KNCA 4BLRA 3B9QA 4MA4A 3K9NA 3WBJA 2IYUA 4CDGA 5GJVC 2FJUA 4KU4A 3TMKA 1XEFA 2RGBA 4NTZA 5DN6A 5HE9A 4QG7A 4KVGA 2G1KA 2OCBA 4DSOA 1KI2A 2NPIA 3IHWA 4KI0A 3C7KA 1E2MA 1XTKA 4AWXA 4MYHA 1T3LA 2W6ID 3GLHA 4NHOA 4PC7A 1MOZA 4O3MA 5KYKA 1TF2A 3QKTA 4RKFA 1TADA 1MRNA 3R9IA 4QKQA 1GNPA 1R0XA 1RJ9A 5HPYB 2ZJ8A 1RIFA 3KXLA 4XVQA 4YLGA 4TZ0A 5K8IA 4EIWA 2GZHA 3TQFA 4JLOA 1RRPA 1P5ZB 5AUOB 3NIBA 4TMVA 5C46F 2CE2X 1TQ4A 1N6NA 2WWXA 4DUGD 1ZNWA 5P21A 2FSFA 4Q18A 4JBXA 5FH9A 2LKDA 1GKUB 2ERYA 1UBCA 2CLCX 4R7ZA 4DT1B 1AZSC 3AKDA 2OM2A 5CM9C 2W0SA 2GCOB 1W0KD 2QY9A 2JDIA 2QP9X 4BFZA 2C77A 5JSZB 4TSFA 4HAZA 3FMIA 4HUQA 3KX2A 4OQFA 4PHHA 4XH9B 4XSHA 4BRWA 2DFLA 3E70C 3CNOA 2C2HA 3OHMA 1KO8A 2D3WA 2V54A 3MG9A 1JAIA 2HJVA 1Q1QA 5C18A 4B3CA 3TNFA 2IT1A 1GL6A 1E1QD 4V0MA 4P31A 4DIDA 5JHGB 4C7OB 4I4LA 2V7QD 4MDEA 3AKYA 1KIMA 3I8XA 3CH5A 5E7IA 3QUSA 1XPOA 1OHHD 1P2SA 1P73A 3IQXA 4MGYR 1R4AA 1PV4A 4DRZA 2AK2A 2WSSA 5FFMA 2R9VA 4D6PA 2RGNA 2KWIA 2WWWA 3I1FA 1XD2B 3RRYA 1CJVC 2A5JA 2ZE5A 1DOAA 4JLDA 2GTPA 1RZ3A 2RGAA 4N0DA 4F93B 2A5FA 1CKEA 2BIFA 1ZD9A 3ADCA 4BPBA 1YE8A 2RKOA 2YINC 3GLFA 2GCNA 4CVNA 4EDHA 3WMEA 3RSLA 4EFMA 3THXA 1YZQA 2FX3A 2AD1A 2B7CA 4Y0VA 1Q1ZA 1WE2A 1ZIPA 4URZR 1JPJA 3BFVA 2ZRCA 1T3HA 4D80A 3TK1A 3GJ4A 2HF9A 2IYRA 5EE9A 2OBNA 1NSFA 2MSEB 3BD9A 3R7WA 4FWIB 2VF8A 3MMPA 1TPZA 1E4YA 1ZUHA 1W36B 3L0IB 4HLDA 2CDNA 1CLUA 2NOAA 2V6IA 1LVGA 2F55A 1AN0A 4DEYA 1P9RA 8OHMA 1JJ7A 2ZRAA 2ORVA 1DBSA 1XEXB 1Z6AA 2W58A 4LWZA 2FEMA 5IK2D 2JASA 2ZRNA 3UIEA 5E7JA 4V03A 2ZE8A 2LKCA 4MGZR 3LH5A 1DO2A 1Z2AA 2QRZA 4Q9LA 1NP6A 4Q1AA 5EXSA 3NTUA 1MO5A 3GCGA 3HWSA 4L5BA 1XMSA 4NKRA 1P3JA 3CM0A 1AIPA 1IXSB 3PR1A 3HU1A 2F1RA 3FOZA 4LHZA 5FR1A 4B2IA 2WJYA 1OJLA 3X1XA 2OV2A 1N2CE 4V0OA 3QKSB 4K8OA 2Q9AA 3AVXA 1F2UA 3W34A 2X19A 3QOFA 4HEJA 4V0KA 1Z0KA 3EZ2A 1Z6GA 4DDVA 2CJWB 5CITA 4LV6A 1KTVA 2QPAA 3AVVA 1U99A 2D2EA 3IO3A 4LPSA 5G53C 1DAIA 2FEOA 2NO6A 3NH6A 3TW8B 3NHAA 3C5HA 4IFEA 1LS6A 2GA8A 2NG1A 4BASA 2JLQA 4P4TA 2DFTA 2WZQA 2F43A 1IN5A 2L0XA 1R5NA 2GF9A 3KJHA 3KJGA 5JEDA 1GVNB 1XMJA 3AF1A 1T8TA 3U3KA 2AWNA 5EQTA 1MO6A 1FQJA 3ICQB 2A5GA 3EW9A 4RCYA 3I62A 4XVUA 1NY5A 4P0TA 2BHRA 1OT3A 1ZCAA 4NL4H 4DDUA 3KTAB 1VKJA 4EQ6A 1Q1EA 2FN4A 2ZRPA 2V3CC 4KODA 1EG7A 5G41A 2GVZC 3ZS8A 3CO5A 3SHWA 3B2EA 3FHOA 5FOVA 4NYMQ 5EZ6B 4D4JA 4RKEA 4ZIRA 1ZD1A 3VMFA 3HDTA 4RVCA 2ZR0A 4AURA 1QVAA 4A2QA 3UWKA 1I4LD 4NE2A 4FW9A 3EWSA 4JBWA 4JT2A 3L0SA 1SXJE 2Q3MA 2NMVA 1R6BX 1NLYA 2QMOA 2ZITA 4G5QA 1G3RA 5CM8B 4Y0AA 4IVRA 4DEXA 3MLEA 5JI3E 2NO0A 4TT3D 1WMSA 1Q21A 4C30A 1XWIA 2WAYA 4OHZA 1MABB 4JIMA 4JYBA 4L9SA 5TXGA 3QJYA 3NH9A 5AUPB 1Z83A 4YMSA 1OH5A 5FR2A 3PQCA 3SE0A 1Z3IX 2ZYVX 1R8SA 3VX3A 1W0JA 2BJVA 2J7PD 1LY1A 1A4RA 5UKDA 1NMXA 2QT0A 1GZSA 2GK6A 4GSYA 4PAQA 3J81k 3HYTA 521PA 3OE7A 4GMDA 1NMZA 3L43A 4KFTA 4LBWA 3UG6A 5CIWA 4OJQA 4EPWA 2FZ4A 4B2PA 1NBMA 4MRNA 2XX3A 2VP5A 4QJ3A 1CJMA 4LC1A 3PIRA 4HB2A 3ZQ6A 4MYCA 2JJ2D 2ZPTX 4NYJR 4Q19A 1G20E 2JLZA 1JQLB 4OI0A 1KI4A 5G3YA 1UKVY 4A0FA 5C1BA 3CF2A 3RABA 4YMVA 4RJLA 3PEVA 5JFGA 1Y63A 2PBRA 4HSEA 5JS8A 1JNYA 1ZM3A 1E9DA 3A1TA 3SJCA 4CF7A 1I2DA 1DELA 5C4MA 3RNLA 4LJYA 2PJZA 3ZVLA 2HDNB 3CWQA 3VR3A 1E0AA 1KK2A 2E87A 3IUYA 2IS2A 5IRCD 3FTQA 2P65A 4Q4JA 2EW1A 2WAXA 3BXZA 1OIXA 3QXHA 1Z6TA 3OEEA 3BB1A 4IOJA 4Z1MD 1EFHA 2EFCB 1SKYE 3JZAA 3QPWA 3JVUA 4B6FA 3BS4A 3QVVA 2ZRDA 4A9AA 2OSBA 2ZJ5A 3M6AA 3H0KA 5CB8A 1F48A 3UMFA 1SVKA 1E98A 1F2TB 3GFTA 2A3RA 4MYUA 1S1CA 1UADA 1WBDA 1T5IA 2HCJB 1ANKA 2PX3A 1NRJB 3M1IA 3P1JA 2A7QA 1H65A 5KSOA 3EPLA 4XVRA 3A4MA 2O8EA 1KJWA 3I92A 4GPTA 1N25A 3NBFA 1OXSC 3RS5A 2WVJA 3VNVA 3B60A 1FPMA 4HI0E 3BBPA 4Q7LA 3BRWD 3O47A 4URWR 3EZ9A 4JLJA 4Q03A 4U02A 5GJWC 3VR6A 4PHTA 3OEHA 1PUIA 1M7BA 3BOSA 2XJ9A 4MYTA 3SOPA 3MSXA 3B13B 3H86A 4QBFA 2EYQA 4FWTA 5JLJA 1V43A 3K09C 1OPXA 4YDHB 4ASUA 3IIKA 3GLGB 4ARZB 2EU8A 3K0FB 2ZVPX 2ZEJA 3X1YA 3CB4A 2FU5C 3DKPA 4Q48A 1X1RA 2A78A 2UKDA 4P3YA 4WIAA 3U3MA 2FH5B 2ZI9A 4MUBA 3WYFA 1SKYB 2XZPA 4R98A 3RS3A 2WTUA 2FPKA 4QXAA 2NPFA 1U94A 3A37A 3FMOB 3TH5A 2J0SA 1B0UA 3K0SA 1HH4A 3WHKA 1FX0B 1Z28A 1W4AA 2ZI4A 3PCRB 4GL2A 3FMPB 4ZDJA 3V00A 1GRQA 4OI1A 2YWEA 3PUVA 4TMZA 1KNQA 1QHGA 3W5IA 1KO4A 3PUWA 2F6RA 5D3MA 3AVQA 1P2TA 5DHAA 4Q4AA 2VA8A 3AUYA 1P9WA 1Z6YA 1UBEA 2WIBA 4QBHA 2B8TA 1XMIA 2YNMA 721PA 4IEEA 3U5ZB 4JS0A 5H68A 1M74A 2AKYA 4JJKA 4Q47A 2H1LA 2WIAA 2W6IA 3VU9B 3WNDA 3U3OA 3BFKA 2ATVA 3ZVNA 1UF9A 2NIPA 1E1RD 1KSGA 4R2HA 3MWJA 3OIVA 4M0LA 4EJSA 5A5GA 1GUAA 4CEJB 1HA3A 1M34E 3A36A 3KQKA 1D2NA 3KXIA 5BYKA 1M7GA 5L3VA 1YZLA 3VR4A 2IS4A 4KSCA 4DUGA 3WYGA 3W9YA 3T12A 4DLZA 1G16A 1OH7A 1T0HB 1P4SA 4LV8B 2FNAA 2IWHA 3CPHA 3LV8A 4PO8A 4XD7A 1NG1A 1QF9A 2WKQA 1KKMA 2YOHA 1JB1A 1UKZA 1G4AE 1YHNA 4MQBA 1DG1G 1W0KA 3C41J 3HR7A 2NZ8A 1OYYA 3WNBA 3AM1A 2VBCA 3BORA 4ZPXA 4TL9A 2IYXA 1UDXA 3MD0A 1M6NA 4QGGA 3QQ5A 3GJ6A 2CL0X 1QHHA 3IBYA 2ODBA 3EAQA 5DI3A 4R9UC 5KSPA 4ZV4A 1J7KA 4KXFB 2W2XA 1CR4A 1DG3A 4G5RA 3Q8XB 3DM9B 4IDHA 1AA9A 4UNPA 1GWNA 2V7QA 1R5OA 4CW7A 4IOKA 2XXAB 1KDPA 3KQNA 2QBYA 3B1ZA 2RHDA 5DGXA 2RGDA 2F9MA 1OHHA 1ZBDA 3RC8A 3GLHE 5JHHB 1TMKA 2RGGA 2WMOB 3HYRA 4DKXA 3UXMA 4LOAA 2FF7A 4B43A 1Q12A 2WWYA 2C98A 2OBMA 3AVTA 3X1DA 4BFSA 3AVYA 2IEZA 1RC8A 1R2QA 3ZLJA 1SULA 2CMKA 2JLWA 3D31A 3BFXA 2D62A 4MGIR 3NDPA 1NNEA 1VTKA 4C0KA 2IF2A 4KFSA 1OE0A 1W2GA 3TVTA 1KI6B 2G1JA 3FFAA 3A8TA 2QTFA 3TAUA 3OFNA 4WZAE 2X2FA 5ELXA 3IIMA 5CK5A 1XB2A 1FNNA 1JECA 1OXUA 4G3XA 4BZPA 3WHLA 3LFUA 2REXB 1JR3D 2BEKA 4D0GA 3O8RA 3RRMA 1C1YA 4AKEA 2HYDA 3EIQA 2ZS9A 4JLPA 2R6GA 3ZH9B 2H16A 3S1AB 1KHTA 1H8HD 3PITA 1KK0A 4ABYA 1AJEA 2JLVA 1VECA 1XP8A 2CHGA 2EVWX 2XB4A 4BZXA 3V9PA 1A2KC 2IA5A 2OAP1 1CTQA 1W4BA 4QGHA 3F0TA 4D82A 2J9RA 4AKHA 3VHLB 2W2TA 1ZC4A 2IK8A 4FCVA 1H8ED 2YC4C 4LBZA 4WXRA 1UM8A 4P32A 3TBKA 3FFBA 4JSYA 2IYQA 1KY3A 2BWJA 2ZR9A 5HKKD 5DNYB 1ZYUA 3ADDA 4DZZA 4TQUS 2J0UB 4E09A 4CEHB 3GLFE 2IUSA 3C5CA 1FUUA 1XX6A 3TVDA 3B82A 1E2PA 3O8DA 3SS8A 4JL8A 1IN4A 3QF4B 5KSZA 3Q72A 2GWHA 1VHTA 2OFWA 3NEYA 4LJ7A 4KSBA 2JLRA 1KMHB 1GRRA 1VG1A 3CR7A 3DMDA 4Q21A 4LI0A 3E2IA 3SNHA 3NC0C 4D25A 4FIDA 2JEOA 3AGQA 2VYFA 4M8NE 1JPNA 5L3QB 2A30A 4OBEA 1NN5A 4BFXA 2KBFA 3C15C 3FB4A 1O87A 5JJIA 1YJ5A 1N0UA 1V5WA 2B7BA 4D26A 4M9SA 2O8FB 1J8MF 2HV8A 3QBVA 1UFQA 1XPUA 4L15A 4H1UA 1T0JB 2DPXA 3PG5A 2P0EA 2O0JA 1XF9A 2YV5A 3CX8A 5BYJA 1RKBA 3KJIA 3CH4B 4A2WA 3RDPA 1SVSA 2JJ8A 4R71A 4Q4HB 3H1TA 1FUKA 4JLVA 3SR0A 1N6OA 2CLSA 1KSHA 3WY9A 1T3SA 5HTKA 1Z6XA 5AUNB 2VRWA 1XCMA 3BGWA 5J4VA 2WJJA 4FMDB 3GLFB 4GOXA 2O5VA 2QZ4A 3VAAA 4TYQA 4FXPA 2DWPA 5JWRA 1W36D 1Z2CA 4BECA 3THXB 4GNKA 2F1JA 4OK3A 2ORIA 1NI3A 3WMFA 2REBA 4Z8YA 1VG0B 1RRFA 2IYVA 2ZE6A 4HLCA 4UNNA 5GJCA 2G9NA 1OH6A 4QM6A 2F3RA 3G0HA 4TL8A 2ZI3A 4I1OA 4MRSA 2W0MA 3GMTA 1LFDB 4YONB 3BWDD 2D06A 3HU3A 4ITRC 4BUJA 1QHXA 4B34A 1Q3TA 2W00A 4B47A 5J47A 1K6MA 4X8HA 4XTCS 1KJZA 4PQRA 4PPGA 4A0RA 3WNCA 1KSJA 3I32A 2AFIE 4RFSA 4BFTA 4TT3A 2GEUA 2CHQA 3CBQA 1W36C 2FFAA 1E4VA 2IXEA 4BWYA 2FFBA 2WBLC 5AK0A 3SJBA 2WWHA 2J7PA 3LWNA 4NDZA 1IAQA 3SN6A 1TF5A 4P4SA 4EPRA 5JECA 4M1MA 1II9A 4MH0R 3Q85A 5FBQB 2ZUDA 1XBTA 2OHFA 3GFOA 2YC2C 3BE4A 4O0MA 1CULC 3IGFA 4NCJA 4ACAA 1L2TA 4TYWA 5JCPA 4C2UA 3EIHA 2I1VB 4JJZA 4EPTA 5FTMA 2ZI6A 4DLYA 4OHXA 3CRVA 1L4YA 5KDOA 1Z63A 4WXPA 4G5GA 1FFHA 4DLXA 5KNDA 2ZTSA 2CK3A 1E2QA 1JEDA 1QVRA 4PC3A 4TTQA 5HZHA 4M1YA 3U7FB 1CR0A 1DAMA 1LF5A 4Q01A 2VP2A 2DY1A 5KUTA 2JATA 3LRPA 1MO4A 4W5JA 2IW3A 2QTHA 3GEEA 4TLDA 1EESA 4LCBA 2PMDA 4Q1EA 1XXHA 1IQPA 3AP1A 1M1YE 2V9PA 1I4TD 2QQEA 2C99A 1L7VC 1JI0A 1G3UA 2ZU0C 1UBGA 1X6VA 3TUJC 1YR9A 4Q02A 3VFDA 1U2RA 4RZXA 3SQWA 4GFDA 3HU2A 3OIUA 4IKEA 4WVFA 3QXXA 3B78A 1US8B 4Z1MA 5CJPA 5L3SB 1F5NA 5CK4A 3FYHA 3UG7A 5BN5A 2FG5A 2REOA 1GFIA 2QUZA 4WA7A 2ZRLA 1NKTA 2ZAMA 1NBME 4MITA 1E0SA 3AF4A 4PTLA 1T8UA 1G8PA 1XMVA 1U9IA 4UXIA 2I1QA 2JJ1D 1XEWX 4C0QC 2HEIA 3WBKA 1GKYA 1QHSA 3RANA 4HLUA 4GOJA 4A6PA 1IJFA 3KB2A 4URYR 2OFOA 3AF0A 2R6AA 1X8JA 1P60A 5E7MA 1LS1A 2PLRA 3IDQA 1JR6A 4HLQB 1COWD 4D0NA 1PVOA 2FPMA 3WRXC 1D8TA 2PZEA 2NO9A 4YQFA 1ESMA 3SFVA 4LYHA 5SZKB 2Q3HA 4GT1A 3LD9A 1OXVA 3TUIC 5CYOA 2PL3A 1TUIA 3Q5EA 2IYYA 1YRBA 5TDHA 3C16C 4ZCIA 2ZSEA 3SHFA 1EFCA 4DLSA 4YC7A 2V8OA 3JVVA 4BLPA 4YMWA 1CRPA 1F60A 2ZM5A 1RRGA 1AS0A 2ZRKA 1FZQA 4KV9A 4DB4A 1TAGA 3QNUA 1QHNA 4DJTA 3PV0A 4A8JA 1ZU4A 1Q1BA 1AKEA 4M1SA 3A6PC 4ZO4A 4A36A 2QU8A 1HV8A 2AX4A 4JT4A 4NCNA 3ZGXA 2BKEA 2WKRA 4DB2A 2QNRA 1RRCA 3KUCA 1N5LA 4I1UA 3JZMA 3EA0A 4LY6A 1DPFA 4UJ5A 2G0NA 3BB4A 3AVWA 4F91B 1P2VA 2WICA 1ZD8A 3TSWA 2OXRA 4PR0A 4KHZA 1CIPA 3D6TB 3AKCA 1E1RA 1SXJC 1Z29A 3B7GA 4NCHA 2R8RA 3DEFA 3TRFA 1WXQA 2I4IA 4KBFA 3T1QA 1G9XA 2YOGA 4OQLA 4Z8XA 3GLIA 4PPNA 4C0HA 4J0QA 2O8BA 2VHTA 4M21A 1WP9A 4B2LA 2ORWA 4LJAA 5FL3A 4BLOA 4Q4JB 4RSGA 5CB6A 2ECKA 5DIFA 3K0CC 4TMWA 5GVSA 2BM0A 1A7JA 1O3YA 2FV8A 3QKRA 5DHFA 2P6UA 2WWFA 2K5UA 2GNOA 4QRHA 2QE7A 4DLVA 3SU8A 1KK1A 2H17A 2EFDB 5DYIA 3T15A 3E5HA 4RD0A 4HAYA 5FUYA 3U7GA 1X1SA 1N6IA 2JIZD 4OK5A 1XTQA 3EPKA 1FMJA 2ZSBA 4Q7MB 4QGAA 3VR1A 4LK2A 5IT5A 4TQAA 1KI3A 2WPDD 1NN1A 1DAKA 5FI0B 3ZVMA 4I81A 3ZZTA 1KI7A 1G3QA 2IYSA 1YR7A 2P6NA 3IKJA 1GKIA 2IWRA 5H1YA 1DTSA 2J0VA 3IQWA 5EE5B 3THYB 4OL0A 1E9EA 3AH8A 3FKQA 2F9LA 4HDQB 5FTNA 3K70C 1E9CA 1EFUA 3KFVA 2N1BA 2J59A 3FE2A 2GK7A 2YHSA 4QHYA 3M4YA 4Q1FA 2LCFA 2NO1A 2QORA 4WOPA 4UXHA 2IXFA 3B1VA 1GRNA 4FI3C 4TMTA 4AG6A 5F98A 5B57C 2QSZA 3NG1A 2OLKA 1ZUNB 4EKDA 3TUZC 3UPUA 2WV9A 4PHFA 4DCUA 3NDBB 4CEIB 3LVQE 3RWMB 3RS4A 3K0AB 1ZNYA 1WBBA 1N0VC 3CR8A 3P4YA 5EP2A 2IL1A 2PT5A 1SVIA 2IXGA 5SZHB 4C4PA 1MV5A 2VF7A 3LW7A 1Z5ZA 5B58C 2DWOA 2F1HA 3MCAA 2VHQA 2ZJZA 2A5DA 2XEXA 4PQFA 4POAA 4TL7A 3CPEA 3HP1A 4IVQA 2V1UA 2RHMA 2PEZA 1BIFA 1SHKA 2EFGA 3KKPA 5D3MB 3ZD6A 2X8AA 1KY2A 1JR3A 2OZEA 1NLZA 3DHWC 4AYWA 3QPVA 2O52A 1EX6A 2AD5A 2GILA 4MUAA 3TJZA 4C0AC 4DBLC 1VIAA 3UANA 2IHBA 3C14C 2JLXA 2V55B 5KU1A 2IYWA 3IHLA 4BQSA 1UAAA 3GEIA 1RVDA 2VP9A 2V4ZA 3BH6A 5BW8A 2RGCA 1KO1A 2IUUA 4XTRA 5BQ5A 3A1SA 5EE3A 4HZIA 2VP4A 5DSZA 5HCIA 2R6DA 1S3SA 2GZAA 3P27A 4QC2A 4Q7JB 2VSOA 4E5UA 1T6NA 4OHWA 2GCOA 2XNSA 3MWKA 5TMPA 4D0LB 1HE8B 1FOEB 3NXSA 2Z83A 5JSZA 5AJXA 1E69A 1FQKA 3CW2A 2GAAA 1FTNA 1XNJA 4MKIA 1R5BA 2QAGC 1W48A 4NCIA 2CNWD 4OQNA 4BLQA 1BMFA 1ONBA 3NBXX 3KUDA 2KI5A 5TARA 3THWB 2D7CA 4LZZA 5EXTA 4B35A 4BFVA 4C7OA 3QIAA 2CVFA 4JVLA 2OXCA 2PEYA 5KO2A 2QG6A 2R65A 3I5YA 1EWRA 2FOLA 3LAWA 4AKGA 1NSTA 1IM2A 5FI1B 1CS4C 4IXNA 1YR6A 1ESNA 2HLDD 3UMRA 4M9XA 1YU9A 3TQCA 3U6BA 4AK9A 1XD2A 421PA 1F6BA 1SXJB 5F9FA 2I3BA 5FUXA 1KSFX 4I1VA 3U6KA 3U44B 3LNCA 4LBYA 1YZNA 3GJ3A 1GP2A 2VHJA 2QM8A 4QNMA 3UMSA 1CXZA 1VCMA 1G5TA 3CF6R 3Q7QA 2QI9C 2C9OA 1II8B 4LJ9A 2GBLC 2FE4A 1Z0IA 4ZKDA 2ZANA 1KNXA 2ZXUA 5HZKA 4WZBE 3U4QB 2BC9A 1GOTA 1TQ2A 4IVPA 5LPNA 2FDCA 4HYYA 2ZRFA 2VSXA 4Q1BA 2P67A 1G8GA 1PLKA 4IJMA 4ESHA 4E03A 4GOKA 5FPHA 1P9NA 3NBYC 4PO1A 4AKIA 3ND9A 3C8UA 1M8PA 4LHWA 2XOKD 5EP3A 3FKSD 5DN6D 1HQYE 4A1FA 3M0EA 2JLUA 3CKLA 1T9HA 4URUR 3DOFA 4PQYA 1KI9A 3K8YA 3LBNA 4D4KA 3K0EA 2AKAB 1TQDA 3SBDA 3PXGA 3DZDA 4IDPA 4UJ3A 4I99A 4PC1A 1YKSA 1XTIA 4BLTA 1XEXA 1OYWA 2EWVA 1G8HA 3K70B 5BN3A 4CZ2A 1VYVA 3VHXA 1KOFA 3PUZA 1YRAA 3AF2A 1D5CA 2KE5A 5FPSA 4LJ4A 4Q9JA 3KKMA 1E2HA 3QG1A 1T91A 1E2DA 3W3ZB 2GVDC 2OFXA 1E2KA 5GVRA 3RC3A 5CLLA 1RYFA 4XJXA 2BOVA 2QGNA 1LV7A 3TE6A 2B21A 1RPZA 1J90A 4HZUA 3GJ8A 4CYMA 1U0JA 1HURA 1GNRA 2JDID 4YMUA 2RB4A 2O0KA 3AVPA 4GRAA 4TSFD 2IF0A 1J2JA 2XNDD 4F92B 1L8QA 2YWFA 3RRNA 2ZETA 3ADKA 2CCJA 2G88A 3DM5A 5JEEA 1XZPA 2X1VA 3QKSA 4BZQA 5JWHA 5G40A 5JJLA 2ZE7A 4M1OA 3I61A 2Z4SA 1ZC3A 5DISB 5F9HA 5J4KA 2H7VA 1W4CA 3WYAA 1IONA 1AGRA 2CEAA 3CRQA 4RZ2A 2H18A 4FN5A 4H1VA 5FOTA 1P6XA 3CIOA 1MKYA 1N6KA 2QGZA 3KXKA 2BMDA 3SZRA 1W1WA 1X8LA 4LYFA 2WSSD 2OG2A 2YWHA 1E2LA 1KZ7B 4PSAA 3DKVA 2OCPA 5IHPA 3HPQA 3H84A 4EFLA 2O0HA 2W6JD 2GETA 2P6RA 1VIYA 2AK3A 4IDQA 2GEDA 3MFYA 1E2GA 1Z0DA 2AWOA 1YZUA 4KYUA 2QAGB 3I3SR 4OK6A 5AUQA 1HTWA 4A0HA 4MDFA 2O8CA 1BS1A 1ZUIA 1AS3A 3DMNA 1B23P 1WDTA 3OIWA 4V0NA 1EX7A 3F3YA 1JQJC 1ZAKA 2C9YA 5EE1A 2OE2A 4MRPA 1JBKA 4PPFA 1IHUA 2RGNC 2JLYA 2BBSA 5LBIA 2QMUA 1NMYA 3CLVA 3ND8A 4F4IA 4HUTA 2HYIC 1R10A 1E79D 1TTTA 2NZJA 2DWQA 2ATXA 4GZLA 1EFTA 1VPLA 3P4XA 3X1ZA 2FGJA 4LHXA 3IILA 3W8NA 1BYUA 3MUFA 3I73A 2HXYA 2QN6A 4JKIA 5GJBA 3T06B 1NVXQ 2J5XA 2ZS8A 3KKOA 5H8WA 1BOFA 1MABA 3CZPA 4JLBA 3THOA 1SVWA 1GSIA 3ASYA 4RD2A 1TQ6A 2WWGA 1E1QA 3T35A 2D74A 1COWA 1HYQA 4B3GA 2WJIA 1A2BA 2O8DB 4M1KA 1AM4D 2RAPA 1E2EA 4WW0A 1S96A 3GPLA 1N3BA 4XWAA 4IEIA 1VHLA 1XXHE 2AHOA 2GJKA 2RCNA 3EIEA 2RH5A 1P72A 4KLZA 2WKPA 3AVUA 1UPTA 2YJTD 1SGWA 2WM9B 1QZXA 3TR0A 5J4LA 1AK2A 4XSGA 3EC2A 4FD2A 1QBKC 4HAUA 2DFNA 2FPLA 1ODFA 1CU1A 1E9BA 1NL3A 3GJ5A 1D6JA 4PSVA 1VCIA 1XTJA 1KYIA 5CYPA 1E3MA 1GITA 3B9PA 5DH9A 4W5HA 5TV2A 4A4DA 4CIDA 4E07A 4TN1A 1FTSA 1M7HA 3W90A 1Q44A 1TNDA 1G3IA 1M2OB 1ZM2A 3ADBA 3EWAA 3F5FA 1VYUA 1PZNA 4IOMA 4NU0A 4O25A 1CR1A 1G7TA 2AFHE 4ILEA 1DARA 4X8MA 5HCNA 4TYYA 3ZJYA 3MGCA 2V1XA 1EXMA 2C5LA 2ZRMA 4V0ME 4MRVA 4QOSA 1K5GA 3FPAA 2GAOA 3ZZUA 2CE7A 1XXHB 1U8ZA 3GLHB 1IOZA 3DOEA 2VO1A 4JLAA 3CUEF 2Q9CA 2H5EA 3IEVA 3NEJA 1XTSA 4TMXA 2C8VA 1F2TA 1RJ9B 5IK2A 5CIQA 1RW4A 3EA5A 3ASZA 1OKKD 5JCZA 1XJ0A 3AQ4A 2Q6TA 2J1LA 4NYIR 3T5DA 3U7EB 3U3JA 2ZR7A 2C78A 2Z0MA 3B1XA 5LB4A 4PAOA 3RS7A 6Q21A 5JI2E 4GP7A 4TZ6A 4QJ5A 2IUTA 3D8BA 3NBZC 3P26A 3Q9LA 5IDVA 3UKDA 4AYXA 1DAEA 3R8FA 1UJ2A 2ZQ5A 2JIZA 3EASA 1PUJA 1II0A 2G6BA 3EARA 1CP2A 3IIJA 3CX6A 1YVDA 3KDSE 4UQOA 3PENA 2P3SA 3NHBA 4HUQB 5CDFA 3HR8A 1T5LA 1JXOA 4QL3A 3HPRA 3GLGA 2AXNA 2MMCA 4ARZA 4M53A 4LUCA 4A0GA 1QHYA 1CJUC 5E3HA 3OZXA 1OIWA 1IXRC 1MT0A 5JWOA 2J41A 3RAPR 4DCVA 3AB3A 3CWZA 1K5DA 3OE7D 4US0R 3L2OB 1Z0AA 3B1WA 3U3RA 1GL7A 1FX0A 4M1WA 3GLIE 2N42A 4Q1DA 4DCTA 3BH7A 2QL6A 4RD6A 4FMCF 3EZ6A 1P2UA 5FTJA 5LD2C 2QENA 2GDJA 1NVUQ 5EE0A 3R20A 2ZYUX 3DO6A 4JKYA 5AJYA 1XPRA 1E94E 3R8CA 4EUNA 1W47A 1G7SA 5EP1A 4KCGA 1A1VA 3QE0A 4A8JB 1GTVA 2OO7A 4QFMA 1G17A 1G7CA 3VU9A 5JJKA 1SZPA 2JA1A 1UKYA 1U0LA 4NPHA 3W5JA 3PUYA 3R7WB 2TMKA 3VKGA 1Z8FA 4XOIA 4F38A 4CEJA 1ZNZA 2IHYA 3BC1A 3L0PA 3CNNA 5LDDC 2QT1A 2W83A 3Q7PA 2GXAA 2ZUBA 3BK7A 3LVRE 1YR8A 2PH1A 4KLNA 121PA 4PAMA 3LXXA 3BAFA 1XDBA 5FPKA 1UKEA 3GLIB 3CRMA 3OESA 4QBGB 1S0UA 5KSYA 2F7SA 3TW4A 1DVRA 2DB3A 1CR2A 5FBVB 2ERXA 2J7KA 2MSCB 4IOLA 2ZRIA 3F8TA 4KVAA 4IFBA 2ZYWX 3MWLA 3SQXA 3KQUA 2CNWA 5FOSA 2JLSA 4BEJA 2DHRA 2VIIA 2CHVA 2G3YA 3WXMA 5IF9A 1ZW6A 2Y8EA 3GJXC 3PVSA 1NIPA 1N5KA 2QMEA 4UNQA 3QXCA 4B44A 3OEHD 1ZINA 2ZSAA 2XXAA 1R7RA 1TL7C 3B8HA 2QPOA 3FGNA 3SC3A 1I4DD 2DR3A 2IBMA 4M22A 4ON9A 5A4JA 2AR7A 3CZQA 2J87A 2FZLA 4ASUD 2HLDA 3RLFA 2JJ2A 1F2UB 1JR3E 1E99A 3K1JA 4PHGA 1U0HC 2G0TA 2ODWA 3GEHA 4M1TA 3TKLA 4QM7A 2F1IA 3KL4A 3FMFA 3REGA 1E2IA 2H57A 1U98A 1DS6A 2WJHA 3LLUA 4HB4A 4FMDF 1GILA 2HUPA 4U7DA 4E22A 5KTYA 1JJVA 2BEJA 3MWYW 1X3SA 2RGXA 2WHXA 5FTLA 2NGRA 5SZJA 4KJZA 2FWRA 4IDOA 3CF0A 5DE3A 2C04A 4GMXA 2F43B 3E1SA 3IPYA 1NY6A 4XWOA 1OB5A 1U8AA 1XD9A 4LYJA 3WMGA 2CBZA 1F3OA 3T61A 2HT1A 2XOKA 4QBIA 1UEIA 3FKSA 2VHUA 5KPJA 3TAHA 4IHQA 1NKSA 3KKQA 1A5TA 3ZIAD 3R9XA 2D2FA 2H92A 3K09A 4EQ6B 4ZCLA 3S1AA 4LV5B 3ETLA 4WAUA 3H2YA 3OAAD 1NG9A 4YXWD 1KKLA 2OCYC 3LXRA 3GJ7A 4A6XA 4ZIRB 4M9ZA 2ZJ2A 2GJAA 1NVVQ 4ZDKA 1E9AA 4PSKA 2WJVA 1VG8A 5FUVA 3RRZA 3T5GA 2QTVB 2NQ2C 4RD4A 3U7HB 4JYCA 1NN0A 1EK0A 3ICEA 1HQCA 3TLXA 5L3RA 5HR5A 2J0UA 4XD7D 4B74A 2N46A 4CEHA 3ZVRA 4PX9A 1WA5A 5K8UA 1N6HA 3W6PA 5LD2B 4MKHA 2R62A 3QF4A 2R44A 1RE0A 3PEWA 2FFHA 2XNDA 1T4GA 1XJCA 2FSGA 1FMLA 4JLKA 4L16A 4QHSA 3RWOA 3NWJA 4UNRA 2YKGA 1KMHA 3KQLA 2HJGA 4B48A 2VL7A 3EXAA 4EJSC 2GRJA 4HATA 4Q1CA 3I5XA 1KI8A 5G3ZA 2JAQA 4ACBA 2VPPA 4ERNA 5BWMA 2R6CA 4JVSB 5BN4A 5L3QA 2DBYA 1WB9A 4LYAA 1SXJD 1FP7A 5FBWB 2FSIA 3ZQJA 4L9WA 2OT3B 3ONWA 3GQBA 1CJKC 3L8ZA 2O8FA 4U00A 1G64A 4G0NA 4OQMA 4A82A 1KZGB 1UBFA 4Z51A 4A92A 2ZVQX 1R0WA 4A2PA 3A1WA 1VCNA 2ZJYA 1G41A 1GL9B 1P7CA 3GD7A 1U90A 2J45A 4Q4HA 3SI7A 2W6JA 4GDFA 5H70A 2FFQA 5B30A 4X8OA 3W3AA 1G8YA 4LRWA 3PEYA 4RCZA 2C96A 2BBOA 4KBGA 2WMNB 4BFWA 2Q3FA 4TYPA 3RHFA 5FOXA 2HF8A 2VSFA 3OFND 4HB3A 4NONA 3QSYA 1Z0JA 3LX5A 3X1WA 4W5WA 2WWIA 3LDAA 4URVR 4C0LA 1KI1A 2WOJA 3K70D 1DAGA 1KMQA 4KFRA 1S2MA 2C9CA 3A4LA 1E0KA 3QF7A 2QRNA 5EZ5A 3AV0B 1W46A 1E79A 1MO3A 4JZKA 1FP6A 1IY2A 4OI4A 3QVUA 1KGDA 3A58B 3AF3A 3OIYA 5KHOC 3B85A 1WRBA 1W49A 5ANRB 1QG2A 2VTKA 3UK6A 3FHTA 2XZLA 1YZTA 1MRSA 1DADA 1BKDR 3Q3JB 2O8EB 4K46A 3GP8A 5J4HA 2JCSA 3CPJB 1Q3HA 3SEAA 2CLDX 1SHZA 4DSNA 4JLNA 1SVLA 1HY3A 3IEUA 5DLQC 2J46A 3I72A 4EPVA 1AZTA 4OKSA 1IY0A 4DDTA 4HZUB 1ZMXA 5JZVA 1CEEA 3D3QA 2IYTA 2MMGA 4UXJA 3QENA 1E6CA 3NKVA 5EUQB 2ZYTX 4TMKA 4NZYA 2OLJA 4BEBA 2PCLA 4O2LA 4MGKR 4QNRA 4TLAA 2B8WA 3TIFA 1QG4A 2CCKA 1FW6A 4NYIQ 2XSZD 4JVMA 1QDEA 2FA9A 4F4CA 4XIGS 2DCUA 3KQHA 3MJRA 4S2EA 5BXQC 4DDWA 4TTPA 5JBQA 4MKFA 5E95A 2BKUA 2HXSA 2VQSA 1G18A 4V02A 1S4QA 3RS0A 1IXZA 2RGEA 3DDCA 4FCTA 1G7RA 2ZREA 1EFRD 3ZS9A 3A1VA 5FOUA 4G5SA 1ETUA 2ZRBA 1G6HA 4Q66C 4Q4AB 1G3MA 4F4JA 3QXJA 2DFKB 2J0QA 2QM7A 2E1RA 4NMMA 4LJ6A 4GBMA 2GJ8A 4BRUA 4W9MC 2A5YB 3U60B 1US8A 1N6PA 3FVQA 1H8HA 3K9GA 3MAAC 4CRWB 4TLBA 4JVNA 5L3SA 4NBSA 2YZ2A 4H9GA 4P4UA 2HCBA 2O8CB 3TSZA 4EJSB 4DT1A 3QG5A 2OUKA 1GDDA 3O8BA 2BVNA 4D81A 4EFNA 3QEJA 4EPXA 2YYZA 1U8YA 1OKKA 5FL7D 3U2QA 4B6EA 1E2JA 4ZI2A 4C3ZA 2FMXA 2BBTA 1H8EA 3MRSA 1I2MA 3G5UA 1J99A 1ZU5A 2ZI7A 3K53A 4MRRA 4OI2A 4X8LA 2OBLA 3ZZ0A 4D4MA 1RYHA 5HKKA 3P20A 1KDOA 4HAXA 4JBYA 5J5CA 1ZCBA 2ZRJA 4GP6A 3EC1A 4US2R 4YDSA 1TEVA 2E9SA 3KKNA 2OCAA 1OXTA 1TX4B 1DAHA 1XCPA 2BMFA 2ZRHA 3A1UA 2IYLD 1GNQA 3QKUA 3L82B 2PT7A 3T1OA 1N6LA 1G4UR 2X77A 4CT4B 5KDLA 1J8YF 2WSMA 4QHTA 1QHHB 5DI3B 4Q00A 4F7WA 5EJEA 4P33A 1AGPA 2OAQ1 2IX3A 4EAQA 3VX4A 4ZDWA 4DXAA 2GXSA 1BH2A 4KITB 2GKSA 2JGNA 5AWFC 3H4MA 3WP0A 2AN9A 1N0WA 1K8RA 2C95A 2QBYB 4PZYA 4AG5A 1J70A 2EWWA 2Q21A 1Q57A 1NLFA 2NO7A 1ZVQA 4TL6A 3SDZA 5C2JB 1FNMA 3B5JA 2UZ3A 3N70A 2GEVA 1W5SA 2QA5A 1G5PA 2GF0A 1W7AA 4L4UA 1OFUX 2VEDA 3I8SA 4URXR 1JXMA 1LNZA 4RD3A 2ONJA 5KOYA 2CK3D 4CGZA 3SYKA 2ZAOA 4DCNA 1HUQA 1Z22A 2OILA 3VTKA 4JLMA 4NCKA 3EZ7A 1N5IA 1EWQA 2QSYA 2R2AA 1WQ1R 3SJZA 1Q22A 3IBGA 4B3FX 3TR5A 2X2EA 4KAXA 4BFYA 2B92A 5CDFE 4O2RA 4QJ4A 4CT5A 2Z6VA 4IRUB 4BFUA 4LJ8A 5JRZA 2G83A 2PCJA 4JL5A 2XAUA 3GLGE 3LQRA 1NVWQ 1CJTC 4A15A 4B3XA 4LBVA 4NP6A 1E2FA 2XJ4A 1MR3F 1Z08A 4C0BA 4LPKA 1IN6A 2GJSA 1OLOA 3UATA 1D2MA 2P5SA 4HDOB 1N5JA 3VKWA 4C0JA 2PLFA 4D4LA 1S1MA 1Z06A 1LW7A 2ZIAA 1HT1E 1MH1A 2AL7A 2XTNA 4HAVA 5B2ZA 4LGMA 5B64A 1XRJA 3V4RA 1R0YA 1XJQA 4L8GA 4B33A 2P2LA 2F3TA 1KAGA 3TSOA 2FGKA 2KBEA 3THYA 2ZS7A 1IN8A 5TB5A 2EYUA 2GZDA 3EZFA 2D4HA 1OW3B 1Y3AA 2CJWA 2YOFA 2ZROA 4FMBB 4Q7KA 3LBIA 4OHVA 5M04A 4YMTA 1AQYA 2CVHA 1NVVR 2Z4RA 4UKDA 3O8CA 3Q5DA 1DE0A 1TEXA 1VCOA 1HT2E 1TU3A 4DLRA 5FPTA 1W44A 3QBTA 4RZ3A 5DI9A 3FWYA 3RSOA 5J40A 1OXXK 2OEPA 3KB1A 4HAWA 4B32A 1P75A 1W2HA 1U9IC 3RYTC 4LX0A 4DHEA 1BO6A 1JALA 4CEIA 1ZM4A 2QQ0A 1KAOA 3K0AA 2CCGA 3NVAA 3LA6A 4HLUC 4UNSA 4PXAA 4WBSA 4WZ6A 5DO9A 5KDDA 5EUMA 4LHYA 3AEZA 4DSUA 3U61B 2XB2A 4JSTA 4RY2A 2Q9BA 1OB2A 5SZIA 1JAHA 4GZMA 3KTAA 3A4NA 2GJ9A 3T1VA 1E2NA 3B6EA 3WRYC 4K81B 1ZM9A 4PZLA 5DYGA 5FPYA 1XEWY 2MSDB 4DLUA 1OV4A 1TF7A 1OFHA 1P61B 3X2SA 1D9XA 4HB0A 1KK3A 4II7A 2PMKA 4PZZA 3W6NA 4ZCMA 3ZIAA 1R0ZA 1ELOA 2XTMA 4PFSA 1D2EA 2Z43A 3MJHA 1N6RA 3SJAA 4AY2A 1WF3A 1GIAA 1XFAA 4OQXA 3OAAA 3RVBA 4YXWA 1VYTA 2CL7X 2PZGA 1G8FA 4B3BA 4TYNA 5AJZA 2JJ1A 2ODEA 3BB3A 3W8RA 4DSTA 1QHIA 4Q5IA 3K9HA 2P5TB 2FSHA 1NJGA 4A8JC 2A9KA 2BDTA 5JRJA 1ZM7A 1C4OA 4TQ9A 4AC9A 2VHCA 1KDTA 1UDWA 1ZNXA 3G82C 1E9FA 1DAFA 1KDRA 2KSQA 4RFSB 5FOWA 4MKGA 1PJRA 3EX7C 3EPHA 2QE7D 3THWA 3KJEA 221PA 4US1R 2KJQA 3DPUA 4GI7A 1E9SA 4C0SA 2EFHB 3BH0A 2B6HA 5A0FA 4JL6A 4NH0A 3QY0A 3VR2A 1XZQA 2J3EA 4TLEA 3CRRA 3ZYCA 3LO5A 4ZDIA 3EPJA 5GADl 4DVGA 4P4SB 3N2IA 4DIEA 4PC6A 1P62B 2YWGA 4LC0A 1XD8A 5TY0A 2XGJA 1OIVA 4TLCA 2XZOA 1Z07A 1VMAA 1SXJA 3V4FA 1C9KA 1TUEA 2BV3A 3WP1B
chains in the Genus database with same CATH superfamily
2FLWA 1SKQA 3AHJA 4LNAA 1AHIA 3P9NA 5HIIA 4YDQA 3P32A 2H7YA 4QASA 3KFXA 1Z47A 3K0CA 1DEXA 2JFZA 1U1IA 4G81A 1PLLA 3LT5A 3DL0A 3L8YA 3B1YA 2YZGA 1Y1LA 3DOJA 4JBGA 3RREA 4KN5A 4FGWA 4DMUB 2PNFA 1HR0B 1AQIA 3N87A 4XI9A 4LDJA 4GQAA 2HSGA 1DP4A 2NQTA 2PIDA 5AXCA 2GESA 5C32A 5AKKA 3CC8A 5F7JA 2O0LA 4CQNA 1RLJA 1WMBA 2ZJAA 3OBIA 4BATA 1T5BA 3PQ3A 3DNMA 1DJQA 1LTQA 4HDCA 2ZCVA 1TT7A 3AESA 1SKMA 5LZ9A 2XUZA 4FINA 2PXHA 1ZIOA 1NVMB 1XMXA 3LC7O 1FC0A 3N6VA 3PLRA 5E9JA 4DXHA 4BS9A 5L51A 3EIXA 2XTZA 4QJBA 4RA6B 3TRHA 2PKRA 3L9WA 1Q0UA 821PA 3RS2A 5JS7A 3QW2A 4QQRA 2QD2A 1QP0A 3DZIA 4IW3B 4B40A 4E5YA 4FB4A 5B6PA 1V9SA 3R5HA 1Y1QA 4NK4A 1U2TA 1B4DA 4QSHA 5K8TA 4C4OA 2QYSA 3OG9A 4I55B 4ETNA 2QRPA 4PRZA 4OSEA 3GW8A 4OD0A 3TDKA 3PUXA 3R3YA 3MS2A 3DYVA 2QI9F 3OU6A 4HTFA 3RKSA 2ZJ1A 4BYGA 4F2PA 4G6ZA 5CLGA 5LOVB 4FHZA 1RD4A 1Q20A 2PFGA 3BXPA 1D0IA 1RHQA 2YX1A 3VKHA 2CL6X 1IJEA 4W7SA 1RWMA 3UWOA 1G1MA 4FNAA 2P9YA 2V4MA 1ISSA 1WB5A 4FZRA 3TQRA 4O8ZA 5L7TA 1GG8A 3HZOA 4OXIA 3WVNA 1TKCA 1TRKA 1Y3HA 1E32A 1O03A 2VP0A 2ZIUB 3H3XA 4M8LA 2GT1A 4H0NA 3AHDA 2ZU6A 5F3WB 2PGIA 5MN4A 5CAEB 2ZKIA 5KPDA 2Y27A 3PT9A 3OF5A 1GTL1 2J9ZB 4D8VA 5K0GA 4QGFA 1FL9A 2A7XA 3VR5H 3Q8KA 2IS6A 4HSGA 2MIIA 1YI0A 3LBHA 3UK1A 1VE3A 1XXLA 5EP4A 3SBEA 2W6CX 3ZDQA 4RL4A 2NPOA 5HKAA 2OECA 1TU0A 3A28A 4M4SA 3U1VA 1JVSA 4HP8A 5AJWA 2NXEA 3LY5A 3M2TA 3STWA 5KI6A 5CVJA 5DTRA 1I4OA 1UEJA 3DMHA 3DZCA 1E63A 5E4FA 5K8VA 2QN7A 2E5LB 1PKXA 2RJ3A 2P62A 3GJ0A 1YD7A 2AIRA 3DA8A 4MMYB 2G77B 4RH1A 1ATZA 5T8KA 3HABA 2WJGA 3JATA 5HNKA 3O84A 2Q0HA 2R00A 1EFRA 1A97A 3GJZA 3P9QA 4OYHA 1IRXA 5HK9A 2UVQA 2AJDA 2HT6A 1ZP6A 2TRSB 4C7BA 1NJSA 2GN0A 2QP3A 3VR3D 3G9UA 4TT8A 1ZXLA 4WN9B 5CVDA 4CV0A 3LPMA 3Q3GE 5TVKA 5FPQA 4F4UA 3EH1A 3V9AA 4PIPA 2H8KA 3F5DA 5B3LA 2H1HA 4OSOA 3V8PA 2O8NA 4K6MA 1USKA 3OEED 2XQVA 1VZ3A 1XO1A 3GAAA 3MD9A 4YEDA 2IU3A 2YVKA 2O2DA 3CONA 4JFAA 4PGHA 1BGXT 1JAZA 3EFOA 4F85A 2BMJA 4QFDA 3AUKA 5KNBA 1Y5NA 1NF8A 1RHUA 1UKAA 4YAEA 1AG9A 1MQ8B 1ZICA 2JD1A 4Q4LA 4DHWA 3SXUB 1S9HA 4IYJA 3L7YA 3TLBA 5I5EA 5D3QA 4XQ9A 2I66A 3QKRB 2IC5A 3BA1A 3I9JA 1W5TA 4MJ3A 4KVFA 5DNAA 2XRZA 1L5HB 1P5JA 3PU6A 5AP9A 4QDKA 2DJIA 4KO1S 3BQNB 2IV2X 3VU0A 2PD3A 4ZI3A 1MQAA 2GBLA 1HO3A 3SLGA 1GG2A 4C87A 2R6R1 1ULSA 2NWQA 4NLLA 3H8SA 4JCCA 1M0TA 1ZVKA 2FUG1 1JIVA 1Z0FA 5BMVA 1JL3A 2WMYA 1MC4A 3DB1A 2XCSB 1RDFA 1OXBB 3EC7A 4NMHA 5J1TB 1QRAA 1I94B 1JTFA 7REQA 1YO6A 1DO0A 2HSZA 3I9KA 3LLMA 1P2BA 3DBIA 1Z75A 1Y6GA 3MIZA 5JDIA 4AYTA 5HIMA 3TZEA 1QIEA 2G9VA 3TXXA 3TTYA 2BRUA 2JI7A 3ZWAA 4PO9A 2YJZA 3OTQA 3C24A 3QVJA 3NJ8A 4OMFG 1GM5A 1Q1NA 1VSQA 2O2YA 3PWZA 4R1PA 5TGTA 4R1QA 1TM3E 2XODA 3SAJA 5K3EA 4C2TA 1TIPA 1EWTA 4XVCA 3SLKA 1XK6A 1IY1A 2ADFA 3KB8A 5EJMA 3UVEA 2I7CA 3FJ1A 2D7DA 4YRNA 1I10A 3B9QA 2HIMA 4OBXA 2O5CA 3K9NA 1NQXA 2Q1TA 2IYUA 3NKLA 4YYEA 4CDGA 3AUUA 4IF4A 3I9FA 3N2GB 4R51A 2VHEA 1T24A 2PA3A 1TYBE 1Q11A 3L93A 1WTCA 1FX1A 4QG7A 5HE9A 3INRA 4CLEA 4ESOA 3V1UA 4OX9Y 3VBCA 1V6AA 3AY6A 3IHWA 3T9CA 3WL4A 1XWFA 1TM5E 1GHTA 2ZT8A 4RQUA 4DILA 1W2WB 1N1DA 1BVYF 1E5TA 1T3LA 3IDAA 2QSUA 3AB8A 3DHNA 5CVEA 3JD2A 4YRCA 3GDFA 4JK3A 2OHHA 3NYIA 3KXLA 2WTEA 4MV6A 3GCWA 1HDRA 2B3TA 4XVQA 4BVFA 1X8XA 3H2HA 4EIWA 4M0FA 1RZRA 1RRPA 5AUOB 4F86A 5C46F 1M2EA 2CE2X 2HJHA 3AR4A 4HHEA 4PQGA 2MYTA 3WDMA 5B1DA 3T7EA 2FUKA 3MWFA 3OX1A 2X9GA 1BVHA 1BDHA 4JBXA 1NVFA 3ZHOA 2A57A 1GKUB 1N2JA 2BMAA 1O08A 2QTNA 4M6WB 5DVZA 5JZ9A 1MAAA 2POQX 2HOQA 1YDFA 2GCOB 3BWEA 1W0KD 4ND8A 1LI4A 3QEMA 4BFZA 2C77A 4MDHA 3IL2A 2AYYA 4HAZA 1U7OA 3FMIA 3CRZA 1ZR2A 3S4YA 5CA1A 2NV0A 2RHTA 4WFIA 4G65A 3FYCA 2I8AA 3OHMA 3CNOA 2G9UA 3W1VA 3PYLA 1FRNA 1CY7A 1QKKA 1HRKA 1OWMA 1Q1QA 1WZEA 3TOCA 2C0CA 4B3CA 1E1QD 4V0MA 4YS6A 1RPNA 3SQMA 2I6UA 2V7QD 1SUBA 4I4LA 3U37A 4MDEA 3BTSA 1WZCA 3NVDA 3U7JA 4IIBA 5E7IA 2IPXA 2J9FB 4KWIA 4D5GA 1ZN2A 1XPOA 4RVFA 1LWNA 1SU6A 4HWOA 5EC8A 1PV4A 4DRZA 2AK2A 2AMLA 1JNXX 1AGNA 1MG5A 4R2MA 1JFRA 1KIFA 1PV2A 3M34A 1XD2B 1OAKA 3DUFB 1HETA 1WCIB 3JWIA 2BGUA 4Y2SA 2NTJA 3FTCA 1IOLA 1XDZA 2HPHA 2OPBA 3GPCA 4N0DA 4RM3A 5JE8A 1VXRA 1ONOA 2NLOA 3TCKA 1EJ2A 4HN2A 1U5BA 3W3AH 3GLFA 3L1JA 1D1TA 1JDSA 1E0DA 2X9NA 4CVNA 2Q0SA 1JFFB 4D8YA 2RHRA 1NYRA 1YZQA 3ELBA 4MVCA 4D8XA 3KUUA 5AK4A 1GLGA 1WE2A 2PH3A 4C21A 4BX2A 1GYPA 1V8FA 2IUEA 1BMTA 1E5VA 2MSEB 1M6HA 1BG6A 2OBFA 3D6MA 3J7AC 2PU5A 2O19A 4RIFA 3L07A 1I3CA 4E94A 1IY9A 1TD9A 3OFKA 3DVAB 4HLDA 5A3QA 1GGNA 1LLUA 1CLUA 2CDNA 2NOAA 2UUOA 4WSOA 5JH7F 4PTYA 4M86A 1P1CA 1K92A 3I6QA 4YAIA 1YK0A 1FB5A 1I5RA 4DEYA 8OHMA 1KC3A 4REMA 4CPDA 2ZRAA 1FFGA 3G1TA 4DYVA 1Z6AA 5FT9A 1HFJA 4LWZA 1XVVA 3F8SA 1J8VA 4LWOA 3S27A 4E4TA 3JQ6A 4J3FA 5FWYA 2OO3A 3LMKA 1W88B 2I4MA 4V03A 2ZE8A 3CB2A 3H5OA 3KM0A 3LH5A 1HT3A 3R6GA 1Z2AA 4MGZR 5JCJA 4Q9LA 3PGLA 2HQOA 1P18A 2B36A 3OTHA 3ETCA 4CNBA 5HVNA 5JC1A 3HWSA 2BEUB 4BX3A 5BP7A 5H9WA 1UOOA 4NKRA 2DERA 3HTXA 1AIPA 1H4VB 1RADA 2B2XA 3SVZA 1IXSB 3H11A 3PR1A 4X20A 4NQZA 3EF1A 1DPGA 1EVEA 2LR0A 4KXNA 4QUEA 5FR1A 4HQKA 1PR1A 1TLLA 2WVAA 3NR2A 1U8FO 3L8HA 1QC5B 4AJJA 3DQZA 3NHZA 2YRXA 3DZHA 3RU9A 1TTHA 3DWEX 3D4IA 3OOHA 4CUJA 3FPKA 4GPBA 5A4MS 4Q7EA 3ZV7A 4M7OA 4JGIA 1CNEA 1F2UA 3W4KA 3W34A 4L6CA 1OFUA 2BZGA 3QPAA 1SZJG 3ZI0A 1KTVA 1ULBA 4NU5A 2D2EA 3IO3A 2DULA 2OGZA 2IGBA 3GEDA 4NU8X 1QGYA 5J59A 2J33A 3BM5A 1AV7A 3OIFA 3ZHRA 1PQWA 2NO6A 3NH6A 2J6BA 1MJNA 1PT7A 3NHAA 2FR1A 2H4JA 3C5HA 4GLLA 3NRJA 2ZTUA 1LS6A 2HX1A 2DJ5A 1T6BY 4PAGA 4IUBS 2G70A 2JLQA 1PO7A 2DFTA 1V6SA 1L0BA 3IP5A 2PUWA 3BSSA 1Y0BA 4O1MA 3D5EA 1WEKA 3CF4A 1W94A 5CPFA 4XB1A 3HVRA 1R5NA 2R1VA 3KJHA 5KC8A 5JEDA 1GVNB 1XMJA 5KYUB 2PUVA 3O82A 1T8TA 3U3KA 1GAQA 3EW9A 1JHRA 4RCYA 4XVUA 2BHRA 3NYQA 2WYUA 3AL2A 3UQZA 4CHTA 3UB4A 3KTAB 1VKJA 3AI3A 4CTMA 2FN4A 2HZBA 2ZRPA 1SBZA 1Y8RB 4X54A 5CU7A 3CUKA 4EW1A 3Q88A 3CBGA 2NZXA 4MVJE 2UZ4A 3SHWA 2RC6A 1SIOA 3IR7A 4RXMA 4D4JA 4KIFA 4ZIRA 2VN8A 4AULA 1U3DA 1FEZA 5KOIA 5K4AA 1E4OA 1QVAA 2W6QA 3B20A 1I4LD 3H5RA 2VHVA 2BPOA 4BCBA 4JT2A 2O06A 3NPMA 2Q3MA 2NMVA 4KXYA 3HRHA 1Z16A 1U1CA 2H2GA 4KO3S 3CEHA 1FLDA 1FU8A 2BDEA 3Q8WA 2PUEA 4O4JA 1AB5A 5DT2A 2Y4NA 3L7CA 2NO0A 1Q21A 1OASA 3WL5A 3LSYA 4DR6B 1M1YA 4FUQA 1K06A 1TJ5A 2C7PA 4R9VA 4IO0A 5TXGA 2JEYA 2B0JA 4ZT2A 2AQKA 5FQOA 4NBKA 4UHJA 3SE0A 4BO3A 3RU2A 2ZYVX 3QU9A 1AKWA 2BJVA 5HRAA 2QQFA 2C97A 2WA1A 4II2A 2X4DA 2X9QA 5UKDA 4GVLA 4NOJA 1RJGA 3ZWXA 1BJTA 1DDOA 4PAQA 1ORWA 4Y30A 2IU4A 3AEQB 1T29A 2MJLA 3ELUA 1YB7A 3OE7A 2H29A 4FX5A 4CQJA 3C7AA 1NMZA 3DXFA 4LBWA 5HQ3B 3AI2A 2ZZNA 5DNDA 3IV7A 1MX9A 5CLIA 4B2PA 1GT91 4DV3B 2IXDA 2VTEA 4PFQA 3UXHA 1R37A 4QJ3A 4RQAA 1CJMA 1GCGA 4DDHA 2H1VA 3R3ZA 2JJ2D 1Z15A 1UOEA 4O2AA 4NVRA 5KNDD 4ZO7A 1L5OA 2C92A 3GJYA 3MTJA 4K9RA 4B79A 4QUKA 1MN6A 2C07A 2JARA 2RG1A 2VKTA 4I6GA 3HV2A 5C1BA 4QD3A 2R7KA 2UUBB 2QRJA 3E84A 3EGDA 3R7SA 3I23A 5TEVA 3QFFA 3RABA 3PEVA 2QW8A 4IJ5A 1AKTA 4MR7A 1CUCA 4JI0B 2VUTA 2ECOA 5IAEA 3LP6A 4TZ6A 1DKRA 3BJRA 4S2UA 4K2AA 3RNLA 2IH2A 2N3ZA 1OZ0A 2HDNB 1ENOA 4Z86A 4B3SB 5JFOA 3VR3A 1N2HA 1B1AA 4EW2A 4P22A 1EFVA 2FG6C 3CGWA 1FP2A 2Q5QA 3FTQA 2D4AA 5IT4A 4MI3A 2ZUFA 1TK3A 1XEAA 2G5GX 3FYUB 3BXZA 3L6BA 1CQIA 3GZ4A 3NAMA 3WK6A 1DKLA 3IVMA 4YY3B 4DM3A 3OEEA 4K8RB 1NPYA 2EX4A 1EFHA 4YBZA 2PMBA 3QPWA 3RT7A 1XCJA 2YY6A 3EULA 3BS4A 3QVVA 2ZRDA 3MJTA 1KJJA 2OSBA 4TV9A 3ZU3A 3OCYA 5C3MA 1UXKA 2AFRA 3AFHA 2AEFA 1L7QA 3D02A 4ZTBA 4BFCA 4MYUA 4JDPA 1IJBA 2A1UB 1QOPB 3I58A 1T5IA 2HCJB 4I7EA 4IILA 1NRJB 3MS7A 4OXRA 3OD5A 2ZWIA 3UBMA 3DEZA 2PGOA 5T6BA 1KJWA 4HQLA 5AXBA 2QNIA 3HB4X 4YXFA 2Z9CA 1MQ9A 3KWLA 3PDWA 4DMHA 2G4CA 2W8ZA 4XZ3A 3M4XA 4TPKA 4U39A 1RJFA 3CLHA 2HMWA 4JLJA 2DHDA 3O21A 5GJWC 1F0YA 2P41A 4MQFA 3K2QA 1BNCA 3HCDA 3B1FA 1WKCA 4MV0A 1XA3A 3H86A 3ML1A 5AI8A 5IBQA 2C54A 5ALVA 3WJ1A 2IBSA 4JBNA 1OPXA 4R84A 1T10A 2CUTA 2DSNA 4IGAA 3AXTA 5K3AA 1I36A 2ZVPX 2X6QA 3MB5A 2FEAA 2PS1A 2ZEJA 1T4BA 3ZHBA 3EYWA 4ZTZB 1UP7A 4ZOQI 5BW5A 2FH5B 2DEUA 3WGMA 2WR8A 1B7GO 4IV5A 3G8BA 1QFXA 4QXAA 5CNIA 3GVXA 1U94A 1B0UA 2J48A 3CG4A 4JUCA 1HH4A 4OM8A 3AJ8A 1FJHA 2NADA 5LVAA 1W4AA 1G8MA 2AJ8A 3PCRB 1D2CA 5JS1A 1RYBA 4MAAA 5DTMA 4MUJA 1GRQA 3PC8A 1N1EA 1T4DA 1LQUA 4NC9A 1KNQA 1QHGA 4J3JA 1AZWA 2OENG 1ZKDA 2F6RA 1ZOOA 3PUWA 4JLSA 2QVXX 1P2TA 1VHJA 2VLBA 3ITEA 3N6XA 1YCHA 2Q3JA 4L3WA 4OHBA 2WT9A 3P9SA 2WIBA 2B8TA 4G86A 4ES6A 4L0DA 4ZK6A 4PR3A 1K2WA 1XP5A 2O0MA 1AQ6A 2YJ6A 3GEMA 3PIDA 4R83A 4JJKA 4Q47A 3WNDA 2ZQYA 4EKNB 5IYZA 3ZK9A 1BZYA 1UF9A 4GOND 1KSGA 2AZDA 1JG6A 4R2HA 3MWJA 1V0JA 1WV1A 3EEBA 4ZOAA 3LT2A 2H4YA 3H99A 1Z34A 2B30A 1WZ2A 2AEMA 3ECAA 3TB6A 1OLXB 2JPDA 3TG2A 3UAVA 1GQOA 1M7GA 2OO5C 3ANXA 1HNZB 1YDMA 3GC6A 5LYJA 3WYGA 5J2TF 4DLZA 5KTPA 1CE8A 2ZBDA 4K6GA 4EHFA 4N7MA 2GEKA 1P4SA 4AZ0A 2IWHA 4QLAA 1LRJA 3MOGA 2JHGA 3DMRA 3HB1A 3P96A 2QV0A 5EQFA 3A4TA 4ENPA 1BXKA 1G4AE 1YHNA 3TJMA 4HADA 1DG1G 1W0KA 1PP4A 4M98A 3QWAA 2H54A 3BORA 2HMTA 4ZPXA 3U4GA 1PR4A 1C50A 4TL9A 3VH2A 3HCWA 3AYXB 1GQQA 1V35A 3R76A 5TEWA 3GJ6A 1PWEA 2FP4A 2RK3A 2YV4A 4H7IA 5K09A 3DFZA 2FOXA 3UJDA 4R9UC 1IUNA 3HLYA 2Y9MB 5KSPA 2R25B 4ZCRA 3CLKA 4GGMX 5T4BA 3F73A 2H0RA 1CR4A 2IOFA 3HK2A 2QJWA 1KE2A 1XQXA 1QYIA 4LKRA 4UNPA 2D1QA 1GWNA 2V7QA 4JB8A 4UM9D 4KNVA 3DVQX 1P1IA 3O3NB 3OA0A 3D3WB 2PH5A 5FKJA 2RHDA 1VSBA 1W8DA 1EDDA 4FGJA 4OKIA 4F5DA 1RWKA 1Z5NA 3GLHE 2RGGA 3HYRA 4GMGA 4MYRA 2LP4Y 2G07A 3KCQA 4U2DA 3SX0A 1Q12A 1EQAA 2V96A 3H9QA 3HNRA 3DD5A 5T3UA 2UV8A 4GQBA 4IJ6A 2QB5A 4NQRA 4RPCA 1RC8A 4CLXA 3LX4A 4C03A 1ODCA 1ZMBA 2CMKA 2Y76A 4G1EB 5IARA 4R1TA 3AOEC 1JIQA 4IRMA 4CDNA 4ECAA 1NNLA 3S44A 2D62A 3OURA 3LCRA 3WA7A 3D8TA 1VTKA 1NNEA 1I7PA 1XZNA 4AUNA 1M2KA 3DBHB 1ZSYA 1R3DA 1V11A 3CTPA 1W2GA 3OWOA 1VIDA 1KI6B 2APJA 2G1JA 2IHTA 3FFAA 2QTFA 3DP7A 3QV1A 1SG0A 4MUMA 3TN7A 4D43A 1SFRA 3QMWA 2W2MA 5KQSA 4KR2A 1V3UA 1XSEA 2H0AA 3I2YX 1NUTA 4L0MA 4PX3A 4D6XA 5CK5A 1XB2A 4O8CA 1FNNA 1M5TA 3K16A 5K4GA 4BZPA 4H3KB 3LFUA 3ZK7A 3DEKA 3IJRA 1Y48E 4OYLA 2IXBA 5DULA 4DMGA 2YCBA 2UUPA 2FEKA 2BEKA 1IEVA 2L17A 1TVCA 2B69A 3I0MA 5GOTA 4CL8A 4D9MA 1EK1A 3IAUA 1C1YA 1KERA 2B1QA 1PAUA 4MPTA 1NVGA 4NH4A 5ESDA 2IUYA 2W6OA 4LXYA 2YN4A 1YZ3A 1K7XB 3U3ZA 1J8DA 4PLWA 5DP2A 3CGGA 2I67A 3I9LA 5K1ZA 2PUCA 2FPGB 1EIZA 3PITA 1CY8A 3HQ4O 1AJEA 2WYVA 1FRQA 4MS3B 2EVWX 4XE5A 4KQMA 4RSRA 4Y67A 3JY6A 4KVZA 4TTIA 2XB4A 1E92A 8ADHA 4MO2A 3F0TA 2J9RA 2WTAA 2C9DA 3LWDA 3AW8A 3ZY3A 3E3MA 1CLEA 1ZC4A 3DR3A 2P91A 1H8ED 3ZNNA 5DNUA 4MB6A 1O6ZA 5KWSA 3VA7A 4R81A 5DNYB 5CHEA 1B3RA 4E5DA 3V8VA 3HFRA 2DKNA 3IQGX 1JWBB 3GRVA 1XU9A 5C5DA 4E09A 3EQ7A 1CJBA 4M8KA 5DM1A 3UT0A 1XX6A 3ET4A 1R6DA 3HKCA 1Z56C 4GI5A 4UUBA 4JL8A 4RV4A 3UPDA 1IN4A 3QF4B 1MFZA 1R0KA 1VBKA 5KSZA 2O59A 1O96A 1U6IA 2GWHA 3Q72A 4IWXA 3V3TA 3ZDXB 4Z99A 1F3LA 2DQ4A 3VUFA 4EO4A 1OROA 3SNHA 4MUEA 3B2QA 3DUWA 3FW1A 1ZRNA 4FIDA 4G0OA 4UU1A 2H2DA 1YVRA 2VYFA 1RQ7A 2HO4A 4FOSA 5BN4B 4HDKA 4JNKA 4MQUA 1VBMA 1Y6JA 3MELA 1UJMA 3PR3A 4OBEA 4CFYA 1BVUA 1NN5A 3IMCA 2KBFA 1UL1X 3I2GA 4I50A 3AY7A 3CO0S 4MB0A 4WLVA 4BJ3A 4M9SA 2HGSA 4C0SA 1J8MF 4A6DA 3QBVA 3T9BA 3A2KA 1XPUA 3AHIA 4H1UA 1Q0LA 3JQGA 1EXVA 1W75A 2YV5A 4KL8S 4CBVA 3H2BA 2D2IA 2PUFA 3CH4B 1CVLA 1JN0A 1W87A 4QXMA 3RROA 1FXWF 3H1TA 1DUIA 3SR0A 1N6OA 4U0KA 3H83A 5JD4A 4BE4A 5C53B 4QQ8A 3LYLA 3Q12A 5FF9A 1GTRA 4HAIA 1XCMA 3LC2O 3S1LA 1ZJZA 3TTUA 2DLNA 1E3DA 3QPDA 4I55F 1EAYA 1VLMA 4YVFA 1W36D 4FXPA 2DWPA 1QRSA 3NVKI 3THXB 1VB5A 3ZEIA 3I9NA 3WMFA 4MB2A 4Z8YA 2FUCA 1M8FA 4TS9A 5KNBH 4BMYA 4UM5A 1WEHA 3NT5A 1OH6A 1Y34E 3OHPA 2WY2D 2ZI3A 4WNIA 2W11A 3W4JA 1AKVA 1EHYA 2F4NA 2W0MA 5KB3A 1LFDB 1YRWA 3CXUA 3OPYB 2F8MA 2YY7A 4TXMA 3TIGA 4MUGA 4BPRA 4C04A 2YQ5A 3EUAA 3BA6A 4FYPA 4RS4A 3BWDD 4ER7A 3W5AA 5CBPB 2AOWA 4ITRC 1G5FA 5TF0A 4IIXA 1Q3TA 4F8EA 1K6MA 1XQVA 2VAVA 5TS3A 1YBAA 2PBFA 4JBHA 4JU8A 4XASA 3UMCA 3VNBA 4UAGA 1ZGAA 4A0RA 2WU8A 2CVOA 3WAGA 5FFNA 3HHEA 4J75A 4GI2A 2VA9A 4UU8A 3WNCA 5KVVA 1OU0A 2AFIE 1LX6A 1GPH1 2YJNA 3R5JA 4MP6A 4QYIB 4CR8A 3P2EA 1G98A 1FYDA 3CBQA 5BSWA 1W36C 4HFRA 1FBNA 2FFAA 1OVMA 3UAWA 4K9OA 4R1LA 1BSVA 3EXHC 4UUAA 4EDFA 2UVPB 2WBLC 1REQB 5DN9A 4G1MB 2Y1DA 3NBMA 3TD9A 2QHXA 2WWHA 3GGDA 3LWNA 3TIXB 4P4SA 4EA6A 1LDMA 3N3AC 4ARIA 1LNQA 4RF5A 3UJHA 3WKCA 5ALKA 1X80A 4WE3A 2YC2C 3G5TA 3ITKA 1E2UA 5EJ8A 4NCJA 1QFSA 4WK0B 1L2TA 1DKPA 5CDGA 3WWZA 2PWZA 3GA7A 4IR7A 4BV3A 2I1VB 3GGCA 3Q3EA 4EPTA 1V45E 4L73A 5EJAA 5A1JA 1XJ5A 3VKUA 3H1BA 4NBNA 1AV6A 4Q6WA 1CUUA 4C1BA 3C8ZA 2N47A 3HCFA 3PD7A 4XJSA 4WXPA 4CI9A 1Z63A 2NVOA 2HHAA 3GRKA 4YRFA 1SCNE 2GN1A 4B6OA 4DLXA 5KNDA 5LLDA 3S8EA 4ZVRA 2RI6A 3OZAA 1R0LA 1FDWA 4RMJA 3N0VA 4Q01A 2QUIA 1HMPA 4KW7A 5EA2A 4AN4A 1NR7A 1P0QA 1MO4A 4QU0A 2AOXA 3KR0A 3R40A 1NI4A 4TLDA 4LCBA 2VSNA 4Q1EA 4F9FA 5B2FA 5I48A 2V9PA 1J09A 5EN4A 1UBNA 3TTXA 3O4RA 4ZYVA 3WDKA 5LL6P 3PXCX 3NDJA 5CURA 1ORIA 1YZHA 2FLVA 4K86A 2I78A 1KP3A 1S89A 5EWMB 4ND3A 3VVCA 4E21A 2RONA 1VC2A 3C8HA 4H4DA 5E2BA 1X6VA 1JG1A 3TUJC 1Y3CE 1YR9A 2DQYA 5J43A 1ECFA 2DTEA 4IX9A 4TTTS 1JDBC 2EJUA 3SIRA 1TMOA 4E11A 1XT6A 4X66B 1D03A 1US8B 3BMCB 3TQTA 5H7XA 4NZZA 1CDEA 4HFJA 4TKMA 3T54A 3STYA 3UB3A 1SIWA 3KTFA 4H18A 1QK5A 3WLMA 1GCUA 1LLQA 4D9JA 3U7IA 1Y89A 2REOA 1GFIA 1MAWA 3CJRA 1FDOA 1PQUA 3W7BA 2E4XA 4NMWA 3MMZA 4WA7A 2AN1A 2CJFA 2ZRLA 3DFMA 1PNQA 2CVQA 4DM7A 3K71B 4I1PA 1E58A 1E0SA 3ZZNA 1G63A 3OLWA 2EBHX 2PTHA 2PBLA 4BMOB 2HEIA 3WBKA 1QHSA 4CF3A 1MG0A 3EZXA 1GRCA 4DIKA 2C88A 3FTPA 4GOJA 1IJFA 1U02A 3C4QA 3FGOA 2UZ1A 3NBQA 2WVGA 1VJTA 4DPLA 2NUAA 2NAFA 2R6AA 2WILA 3PZBA 5E7MA 3TIVA 3UMJA 3VTZA 1Z36A 1E6WA 2PLRA 1GZ4A 2ID9A 3IDQA 1U1FA 4K6FA 3ZBPA 4XEHA 2CJYA 2XRFA 2FPOA 3ZJTA 1DXQA 1QLWA 3V32A 1WXGA 5INTA 3K96A 3C6MA 1PVOA 1X7XB 5KJCA 1Y42X 2P4QA 3L6EA 1FTQA 4TV8B 1WMAA 3I4CA 4YQFA 3OKPA 4LYHA 3ZZMA 4J4HA 4DIOA 5C8YB 3FI0A 4EG7A 2GPYA 3WZ2A 5CYOA 4WEOA 4BNZA 2YL2A 1TUIA 5TDHA 1YRBA 4JWTA 2ZAYA 4X5OA 3ACCA 4R69A 1HL7A 2DCMA 5ALRA 5LQJA 2B0CA 4Q1VA 2FK7A 2LPMA 3JVVA 4GR5A 1JHQA 3VO9A 3A3KA 1ECCA 2ZM5A 5IKPA 3DFIA 4UCQA 1YRLA 4EWLA 4IDEA 3ZNQA 1R4MB 4XM0A 2VBFA 5BNFA 5IAOA 1TGYA 2QYTA 3H5NA 4EG1A 3A26A 2A59A 4TUYF 4W99A 4A8JA 3ZCUA 4YRMA 2D54A 4KN8A 4LXGA 4HEA1 2Q7DA 5SY9A 3EQZA 5DMHA 2BKEA 3FKJA 4TKVB 1CEXA 2W6NA 4FZVA 2X5NA 1PS8A 3OMXA 3E81A 4I1UA 3EA0A 4LY6A 3X43A 1B6SA 2BCEA 1HPLA 1MGOA 1P2VA 2B4AA 2Y67A 4I9NA 4W6ZA 4YDRA 1V3VA 1JKJB 2HADA 2XUJA 3GCDA 4FFOA 1Y8ZA 3AFGA 2MYNA 3AKCA 1Z29A 3TRFA 5TJ9A 2PY6A 2R8RA 3PWTA 1WXQA 1YJQA 4HX9A 1FDUA 2HRBA 4LNUB 4RY8A 4XIJA 5EZYB 4J0QA 1VGVA 1A9QA 3OOSA 1BS9A 1ZEJA 3V2IA 3B6ZA 4B2LA 4LJAA 5T41A 2EL7A 1AB6A 4P82A 4Q4JB 4RSGA 4QBTA 3FYTA 4F5YA 4I6JA 3OD1A 4DMMA 1T2UA 2JH8A 4U7JA 2K5UA 2JFGA 4LF5B 2QE7A 3G2IA 5FUYA 1OQAA 3KWFA 3WQQA 1KMMA 5J2UF 3E8MA 4OK5A 1O7JA 5E4YA 2XYRA 4QGAA 1TC1A 1O5IA 1TKAA 4NG4A 3TX6A 4H6WA 4TQAA 3TS1A 2OZKA 5A7FA 1NN1A 3FTDA 3GV0A 2XGGA 3K4QA 5FI0B 5BSKA 3ZZTA 2ONYA 4YRPA 2IYSA 3U19A 1ZVJA 1BX3A 3LLSA 5H1YA 3PDJA 4PIMA 4U2EA 5EE5B 2GUWA 4UHFA 4CETA 4OL0A 4NZ9A 4X7PA 4CM1A 1KXJA 4BP8A 4R9NA 3KP1A 1WIWA 1E9CA 2BFCA 2Q62A 2Y0PA 3AG6A 3IOYA 4R8KA 3FE2A 2PKQO 2XA9A 1N3LA 2YHSA 4RF4A 3DO5A 2NSYA 4C0WA 4P7BA 1SC9A 1U8XX 2NO1A 4AJLA 3DTYA 4ML3A 4BO4A 3OCWA 4UXHA 4WOPA 2G7ZA 2IXFA 2R87A 1TT5A 3B1VA 4MMXB 4FI3C 4EVSA 1L5KA 2QSZA 1KRXA 2OLKA 1EK6A 2BY4A 3KT3A 4PHFA 4OP2A 4DCUA 5FV7A 3L7JA 4CEIB 2O05A 4MV9A 4WCFB 5CA0A 3NDBB 2OP1A 3OI7A 2JAHA 4EGFA 1WU7A 3CR8A 3W1WA 1TI7A 1TEHA 1JVBA 2D1YA 2IL1A 2VVTA 1L3IA 1SVIA 2X14A 3SF0A 5SZHB 3VKVA 2B5WA 2OQIA 4Q6BA 4C4PA 1WUIS 1MV5A 3EXG1 4O63O 4RJIA 1NGSA 1DKMA 4YRRA 5HKLA 3WE7A 3LW7A 1Z5ZA 1QF6A 3AHGA 1K7FB 2VHQA 1B16A 2ZJZA 4F9EA 1O57A 1NUUA 3CZ5A 1UPAA 4GL4A 1NE2A 4HNRA 4RACA 3ANYB 1JT9A 3GMDA 3VC3A 2HSEA 5IVKA 1KF0A 3F7TA 4XB2A 5D3MB 5FUBA 2FOIA 2C58A 1VFNA 2M32A 4BNDB 4ZAWA 3RT9A 2XKKA 2OZEA 5EOVA 3OCXA 3CLTC 2O52A 2AD5A 1E7WA 1XZBA 1AKMA 2FR0A 5BVGB 2REQB 3V7WA 2IHBA 5E9WA 3C14C 4AY5A 4M0EA 2V55B 4V38A 5D1HA 3VDQA 1T5TA 3WL8A 4B3RB 5BW8A 3BFJA 1DTWA 1GZ3A 4NFSA 1DKQA 1I32A 5HCIA 1ABEA 1Q7EA 2R6DA 5K2OA 2J3IA 4OMCA 4C0XA 2LTAA 1B00A 1M3SA 4QC2A 4Q7JB 3FYDA 4OHWA 4E5UA 3RB8A 1JDPA 1WU8A 5TMPA 2O2ZA 4D0LB 2E5FA 1FOEB 4OO3A 2Z83A 3DO8A 3MK31 1E69A 1ACMA 4DANA 3FOBA 4IGFA 4QUIA 1IMOA 3CVXA 2J30A 3N07A 2C4WA 2GRUA 2Y1KA 4IFIA 4FYWA 1C30A 1VRWA 4DG8A 1GXSA 3CV3A 3NDIA 1ZY2A 3PFCA 5B3JA 2QE6A 4G9GA 4E88A 1VPWA 1ARZA 1BMFA 3VZDA 3JWPA 3THWB 1Z88A 1N9GB 2EP7A 5LWQA 3FPSA 5EXTA 1LK7A 3KLPX 1FYFA 2O9JA 4F4HA 3S6JA 5U9CA 1M33A 5KO2A 3NT2A 1PZGA 4PAWA 4BVJA 4R5MA 1NF9A 4QUAA 3K0KA 2E5WA 2NU8B 1EWRA 4DVJA 2Q1UA 3LAWA 3K32A 4E2YA 3I5YA 4AKGA 4A15A 1LDEA 4KAAA 1DBIA 4IXNA 3R1IA 4YP5A 5FWXA 4PINA 4QUJA 3TQCA 3U6BA 4CMKA 2VHWA 421PA 3HL4A 5BR4A 1VLLA 1U2PA 4O5OA 4HS9A 2C9BA 1KSFX 2CUZA 5FEUA 1TZCA 2I80A 3R3VA 4F3CA 5CM2Z 4LBYA 3HVUA 4L0CA 1DJPA 3M5CA 5H0IA 3VYVA 4RGYA 2H4HA 1PTJA 2NV2B 4MKXA 1AY0A 3KS9A 3EIUA 4MUNA 4RV5A 2QI9C 2EW2A 4LJ9A 1GG9A 1Z0IA 2ZANA 1KNXA 4MARA 4NATA 1W8IA 3GL9A 3ZGOA 1Q2UA 5GV7A 3BMNA 1GOTA 1P7VA 1RLOA 4KE9A 3UMVA 5ALQA 3HB5X 5G1OA 2P67A 4BGUA 4W9NA 4AMZA 4IJMA 3ETNA 3NBYC 4MVJG 3Q3IA 1NT4A 2CFOA 3AESB 3IXLA 5CX1A 1HQYE 1QE0A 4WA8A 2GLTA 5ICFA 1BU8A 3M0EA 1HOTA 2QDKA 4PCUA 5A2QA 5HTOA 1UDCA 1U2GA 3PB3A 4URUR 3DOFA 4PQYA 4PZUA 1KI9A 4R1OA 1Z6QA 4GICA 2AG0A 4G5HA 4UTPA 1A8PA 1YDWA 2A58A 3HN6A 4UBJA 4I99A 4PC1A 4X44A 1XTIA 1P7YA 2O2JA 1OYWA 2HNBA 3DHYA 4OGFA 3SFTA 1G8HA 3NB0A 4DBLE 5BWBA 2X42A 4LZPA 2MCFA 3F4LA 4X45A 3D8NA 2G25A 4CZ2A 1NDUA 1AE1A 3FZNA 1LX7A 1G4HA 2CDAA 4I9HA 2QJOA 4HVCA 3KKMA 3QG1A 1CRZA 1ATIA 2PX2A 3VPXA 5JVDA 2H65A 2OFXA 1EBFA 1W29A 5GVRA 5CLLA 1DGQA 2EXXA 2GCIA 1W581 3ABZA 3UQYS 4HPWA 3ETHA 1HNNA 1NJ2A 5B7GA 4HZUA 3K1ZA 1C9YA 2F3PA 1JJAA 1PWYE 5HG0A 2XGOA 2L19A 1HURA 3M3PA 3TWOA 3ZCPA 3HXTA 4UARA 3E3OA 5T67A 2BR4A 4FJ0A 4A91A 1HE4A 1MW9X 1RPJA 4MVJF 2FWBA 2FHSA 4K6CA