3Q85A

Crystal structure of rem2 g-domain -gtp analog complex
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
169
structure length
149
Chain Sequence
GVFKVMLVGESGVGKSTLAGTFGGLDTYERRIMVDKEEVTLIVYDIWEQDHCLQTGDAFLIVFSVTDRRSFSKVPETLLRLRAGRPHHDLPVILVGNKSDLARSREVSLEEGRHLAGTLSCKHIETSAALHHNTRELFEGAVRQIRLRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title RGK Family G-Domain:GTP Analog Complex Structures and Nucleotide-Binding Properties.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords GTP-binding protein REM 2
total genus 53
structure length 149
sequence length 169
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3q85A00
5DIFA 5CK5A 2IYRA 2CNWD 1C4OA 1G5RA 3L82B 3WP0A 1ZNYA 1IN8A 3FHOA 3IO5A 1FMJA 4GZMA 4RZ2A 1D8TA 1QVRA 1XJ0A 5CYPA 4BFSA 4MYUA 4D4LA 5KUTA 1X8LA 2PJZA 3C15C 2ZRMA 1P62B 1DARA 4CEJB 2FFHA 2G6BA 4G5OA 4PO8A 1COWA 3ZLJA 1AGPA 2L0XA 4V03A 2W2TA 1GNPA 3U7EB 3LDAA 4XOIA 2DWQA 4TYPA 1KJZA 3SOPA 4YXWD 2WICA 4UNNA 2OT3B 5FPTA 2ODNA 3VQTA 2IT1A 3OIUA 1Q3TA 1UKZA 5JRJA 1PLJA 2GVDC 4GOXA 3QPUA 1OFUX 3C5HA 5CJPA 1RRFA 4YMWA 3CPEA 2QPOA 4UNPA 4KITB 3GPLA 4JLJA 5FUYA 1YZTA 5FUXA 3RRZA 2R44A 4RFVA 2GEUA 4Q47A 4TTQA 1DPFA 1XP8A 4HSEA 1PLLA 1DTSA 1XF9A 4AC9A 2ZANA 3LVRE 3ZIAA 5JECA 3UATA 2B7BA 2GZHA 2RAPA 3O8BA 5GVSA 4US2R 2MSCB 3QNUA 3B85A 3QBVA 5GJWC 2Z83A 3SS8A 1D6JA 1YR7A 4JLNA 2IEZA 3X2SA 3LY5A 2B8WA 4I1OA 4F4JA 1FNNA 2GHIA 1GNQA 1S3SA 2V6JA 1PV4A 2CXXA 2GCOA 4Q4HB 4OI1A 4YMTA 3N2IA 4JVSB 1TQDA 4CIDA 2CLCX 1M7BA 2JLZA 4B6EA 3K70B 3CNLA 1OKKD 2ZYWX 1F2UB 3R8CA 3SDZA 3VTKA 3EPLA 1XX6A 3I5XA 2QPTA 2JLRA 5C18A 4Z8YA 4IXNA 3OESA 4B75A 2GNOA 4DDVA 1TPZA 2R62A 5L3QB 2WZQA 1NLYA 4X8OA 1Z0KA 1QF9A 4YONB 1KSHA 1NF3A 1IAQA 1YQTA 1E2GA 3FPAA 1CJMA 5TARA 1Z83A 3QF7A 4IFBA 3THXA 3K1JA 2VSFA 1D2NA 3BIFA 3X1XA 4L5BA 4MRNA 4JL5A 3WHKA 1GKYA 1HE1C 1ZIOA 4ACBA 3GFTA 2QU8A 4RD1A 4A6PA 1AZSC 1XD8A 3NVAA 5BN5A 1KI9A 4TTPA 3QIAA 2P6RA 2QEQA 1MRSA 3SU8A 2WJYA 4BZPA 4D2IA 3THOA 4KO8A 3W3AA 1NNEA 4KHZA 5FTLA 2ZS9A 4M9QA 2OFOA 3KFXA 3CF6R 3SC3A 1MT0A 4MGYR 1AN0A 4S35A 1N5LA 4GZLA 2JLVA 1N0VC 2CL6X 3KB1A 2FE4A 1KKMA 4EFMA 3VNVA 4ESVA 1KMHA 3B1VA 1E79A 3NC1C 4RCZA 4V0MA 4F4CA 1IXSB 3AP3A 1W7AA 3OEHD 2G77B 3VR5A 3A1WA 3I92A 5FPHA 4OI0A 3P1JA 3W9YA 4WZ6A 2GTPA 3RS2A 1IQPA 2BBWA 4LX0A 2F55A 4M9XA 2W2XA 5HKKA 4Q21A 1ONBA 4HB2A 4CT4B 1XXHE 3MG9A 3B1ZA 4FI3C 2IWHA 2A30A 3DZ8A 4EQ6B 1UBEA 2LKDA 4GT1A 4Q9KA 4Q4JB 2BBOA 1TADA 2OBNA 3LNCA 3MWKA 2XSZA 1G4AE 2ONKA 1MO3A 1RPZA 1W49A 2OBMA 2R6GA 4M1TA 1CR1A 1R7RA 4H1VA 2BJVA 3RS0A 4IVQA 4Q9IA 4YC7A 2RGGA 3SQWA 1OW3B 1GG2A 1NG1A 2IX3A 2DYKA 2WJIA 3FMOB 1RJ9A 1TU3A 5JMTA 1HV8A 2C78A 1NJFA 3CNNA 1XEWY 2OCPA 2W6IA 2KJQA 3L8ZA 1W36D 4KSBA 3MWJA 3LW8A 4HUQB 4Q1BA 1NMYA 5GJVC 1YHNA 3A4NA 1KJYA 3ZIAD 3SEAA 4ZPXA 2EU8A 2IF2A 4DJTA 2B7CA 1SGWA 2O52A 2DPXA 4PR0A 1Y3AA 2R6DA 1US8A 3TUZC 2Q9BA 4HLQB 1CLUA 4EPYA 4LK2A 1MV5A 1II8B 3AVQA 4NCJA 3WYAA 2IW3A 4EFNA 2QE7A 4TL7A 1UM8A 3JVVA 4NYJQ 3C14C 3TE6A 1AKYA 4US0R 2ZE6A 3THYB 4FN5A 1CTQA 1DAMA 3ZZ0A 2J0QA 4HB0A 3VKGA 4QGHA 1UBGA 4FINA 1G21E 2GCNA 2ZRIA 4M1MA 4XVUA 1U9IA 4TLEA 2HJGA 1WF3A 2HEIA 4YDHB 5AUOB 1KI3A 1W0KD 4OK3A 1TQ6A 2R9VA 4A36A 2FN4A 3LFUA 2HXYA 1W2HA 2PCLA 5DN6D 2QAGA 1X1SA 2HUPA 2WBLC 4IW3B 4Q4AA 2X2EA 5JWHA 1QRAA 3KXIA 3REGA 1M74A 5EXSA 4M8NE 3TH5A 3LX8A 3I72A 5FTMA 2HLDA 3TVTA 5E7JA 3BB4A 5KYKA 3W6PA 1R10A 3QXCA 2C98A 5JRZA 4L9WA 4OK6A 4DLWA 3NKVA 3KJHA 3FOZA 5AJVB 1KTVA 4EPVA 3EARA 4P32A 4RZUA 3O47A 4TLDA 4TTRA 5FOXA 3M4YA 1XU4A 2VH5R 4MQBA 1PZNA 2PEZA 2FPLA 4JL8A 2F9MA 3NWJA 1XTQA 5CM9C 3WXMA 2CHQA 3Q7QA 1YR6A 5DE3A 4BFXA 1OXTA 5KTYA 3K8YA 4OHWA 3CX6A 2GVZC 3CKLA 4P4SB 1GL9B 5ELXA 2BKUA 4PHTA 2REXB 1J7KA 4BFVA 1LF0A 2V1UA 5FTKA 1ZBDA 1L4UA 1ZNWA 4ZCLA 2ECKA 1RYHA 2BBSA 2A5YB 3JZAA 4D6PA 1E9FA 1FPMA 3SJZA 1ZCBA 4TLBA 2ZSDA 3KQUA 2BDTA 1E2MA 3ZDQA 4QJ3A 2FSHA 1SXJE 4QM6A 1GILA 2YJTD 4Q4JA 2VSXA 5BW8A 1M2OB 4JLOA 4Q03A 5FI0B 2WWWA 4DLZA 4LRWA 5FPKA 1XEFA 1BYIA 1BS1A 3VHXA 5JHGB 1Q57A 3OIWA 4PAOA 1P2TA 4QKQA 4D0LB 4B73A 1WXQA 4Q02A 1ZM3A 1E2HA 5JCPA 4MDFA 1GL6A 3PUXA 2Z4RA 3MWLA 5TY0A 3W6NA 3PCRB 2WMNB 1Q20A 4IJMA 4DBLC 1NIJA 1DBSA 2WVJA 3SJAA 1KO8A 4IHQA 2WPDA 3EZ9A 4W5JA 1ODFA 1QBKC 2GWHA 3AF3A 2X2FA 5EP4A 1JJVA 4B34A 1COWD 3F8TA 3FE2A 4IOKA 5KU1A 4EPTA 3HJNA 3R8FA 2CCKA 4P3YA 3HU2A 1XEXB 4Q7JB 4C0KA 4EJSA 1UDWA 2GCPA 2ORVA 4XSHA 3C5CA 1IOZA 1T5LA 1JI0A 3UXMA 4CEIA 5L8VA 3C41J 4B44A 1E9BA 1CR2A 4DLYA 1Z2AA 2XITA 2YWFA 2ZXUA 4BLPA 3AVOA 5EE0A 5JWOA 3OAAA 3DM5A 3UIEA 2AXNA 2JLYA 3I32A 1AKEA 3EC1A 3VU9B 4Q1CA 1R5BA 1QG4A 3CZQA 2NO7A 2AWNA 2ZUDA 2W6ID 5B30A 4G5RA 1EWRA 1L7VC 4PPGA 2OXRA 5EUQB 1S1MA 5AJYA 4MKHA 1KYIA 3TK1A 2WIAA 4GNKA 2ZRDA 3OEEA 2WTUA 3FMFA 1NBMD 2P6NA 2FH5B 4G01B 1DAIA 1U94A 1KJWA 5P21A 3X1WA 2P6UA 1MABB 3QKRA 5G53C 3FB4A 1YZLA 2QE7D 3RRMA 1KK1A 4ILEA 4MDEA 4UNQA 3IUYA 2EWVA 2ZVQX 3KQLA 5K8IA 2O8FB 4LV6A 1D2EA 1VIAA 4HAVA 4IDOA 4LJYA 3WMEA 4PHFA 4KXFB 4CYMA 1ZCAA 2RGDA 4N0DA 4PHGA 4PZYA 3WP1B 4WBSA 1WB9A 1Z07A 2PCJA 5UKDA 1O3YA 3K0CC 5CIQA 4MRPA 2QROA 3FMIA 4C0HA 1UEJA 4JBXA 2IYTA 5EP1A 4G5SA 5EUMA 2XXAB 1UBFA 1YZQA 2KBFA 1VG1A 4GDFA 4I81A 5FPYA 1QHSA 2CHVA 5EXTA 1NG9A 3R9IA 1F2TA 4OHXA 2DWOA 3K70D 2FFAA 3TBKA 2J0SA 1AM4D 3F5FA 5H8WA 2XZOA 2A5JA 4B32A 4XD7A 1YRBA 2GXSA 1G3QA 2FZ4A 1HT2E 3AVWA 4LBVA 3T06B 5M04A 1E2EA 5FFMA 2A5FA 2CCGA 4HLUA 3K0FA 4M53A 5SZJA 4LHVA 5D3QA 1Z0JA 2E87A 3LX5A 4FMCF 2HV8A 3DOEA 1PVOA 1QHGA 4LJ7A 1RW4A 4PQRA 4QGFA 4PO9A 1BYUA 3BFVA 3W34A 1CJKC 4A82A 4OQLA 4DVGA 5LPNA 4B3CA 3CWZA 5FOVA 2SHKA 4PPNA 1W48A 3UMSA 1LB1B 4DSOA 4FXPA 2QBYA 2O0JA 4CF7A 1KK2A 1W44A 1TMKA 1AIPA 2FMXA 5E7IA 2NO6A 3ZVRA 2QQ0A 5J4LA 3Q5DA 1CULC 4RD2A 4V0NA 2XB2A 1TNDA 3EG5A 5TVKA 4R71A 3TQCA 1E9AA 221PA 1IJEA 2V7QD 2HJVA 2BJWA 5LB4A 1Z0AA 1UADA 4QOSA 3THYA 1PJRA 4C2UA 3ZVNA 1GZSA 1TF7A 2ATXA 3FWYA 3DPUA 2XSZD 3CX7A 4G3XA 4LC0A 2IXEA 4DWJA 4XIGS 5FR1A 1A82A 2C96A 2PX3A 5IT5A 1NMZA 3HR7A 2VF8A 1W0JD 2OCBA 4ESHA 1XTRA 3AF4A 1RKBA 2ASEA 3H86A 3U2QA 1KAGA 2WWIA 5AWFC 2QP4A 3EASA 4RY2A 1GKUB 1II9A 3DHWC 4UXHA 1JAHA 1G5TA 5KNBA 3GEHA 4AYTA 2NO0A 1NSTA 2ZSBA 3NC0C 4B3FX 3WNBA 2E1RA 1UF9A 3D3QA 1CKEA 2AD5A 3T61A 3U3RA 2ZI9A 3V9PA 4L9SA 4POAA 1Z29A 5K8TA 1XPOA 1RVDA 4M1SA 1TU4A 1KNXA 3R9WA 1U0HC 3M0EA 2X19A 3FVQA 5F3WB 4C30A 3MGCA 1Q1QA 4Q9JA 3IO3A 3VX3A 3LO5A 2ZQ5A 2ANCA 4NDZA 1MO6A 4YMSA 1V43A 3U60B 1UPTA 5JJKA 2GK6A 4TQAA 2V3CC 4G0NA 4H9GA 1R8QA 1VCIA 2UKDA 1SVWA 2X77A 2ZUCA 2VRWA 3IHLA 1BIFA 3GMTA 3QUSA 4PC1A 1F2UA 1T9HA 1KHTA 2ATVA 5BWMA 5J4HA 3L0PA 1OXVA 4QBFA 3RABA 5KSZA 2YZ2A 3PV0A 3SR0A 1KI7A 4MYTA 2WWYA 1W2GA 4R2HA 2CMKA 4C0JA 2XGJA 1KAOA 1J90A 5J4KA 3NIBA 1NY6A 2F3RA 3BRWD 5FBWB 1AS3A 1GL7A 5KNCA 1IXRC 4OQMA 3DZDA 4GOJA 5DN6A 5J4YA 2GXUA 4TL8A 3BOSA 4LHWA 3MMPA 1T0JB 2IYXA 4DT1B 1M6NA 3U7FB 3HPQA 4QHTA 3I8SA 2GESA 1J8YF 1OJLA 1F2TB 2RGBA 1KMQA 4MKIA 1P7CA 4WW0A 4LBZA 1Z63A 2QORA 2Q6TA 3U4QB 4CRWB 2FU5C 3ASYA 4HAUA 2P3SA 3A1UA 3NXSA 3WHLA 4W7SA 4F91B 5C46F 1GKIA 1W36B 1ZD8A 4C2TA 1U99A 2RB4A 4KV9A 2JA1A 3BH6A 2HF8A 3PUWA 3A6PC 4QRHA 3A4MA 1IHUA 1E4YA 1Q21A 1VHTA 4HI0E 3SHFA 4I4LA 2IBMA 2ORIA 4RZXA 3R9XA 4PHHA 2N1BA 3NG1A 3CRVA 1SKYE 3CF2A 3EPKA 3QKSA 4LV8B 2ODBA 2WSSA 2XJ9A 1QHNA 3I8XA 5EZ5A 3TSZA 4EJSB 2FWRA 1E3MA 3QKTA 2YINC 5HE8A 4TZ0A 4HDOB 3PENA 4JL6A 3AVTA 6Q21A 4RD6A 3O8CA 2B21A 3L0OA 3A4LA 2H18A 2PBRA 2QGZA 3CH5A 3EA5A 1HEIA 1RFLA 4X8HA 3L2OB 4PSKA 3U3KA 5EXXA 3SHWA 3TRFA 2EWWA 1G4UR 5G3YA 1BMFA 2W00A 2BKEA 4TQ9A 1CEEA 1VYVA 2GK7A 1NKTA 3BB1A 2XTNA 2YHSA 3TGPA 1Q0UA 4JLAA 4AKEA 1FQJA 1YZGA 2H5EA 1SKYB 2JASA 2D3WA 4OI2A 3BJIC 5FOUA 1LV7A 1U81A 3CB4A 4AK9A 2ZS7A 5G40A 2ZSAA 3P26A 1OV4A 2QPAA 1BO6A 4AKIA 2GETA 2GJAA 1P73A 3FFAA 4D81A 1N0WA 2AKAB 3K0AA 3LW7A 4JYBA 4BLQA 2A5GA 2BCGY 2W0MA 3VNUA 5BYKA 2I1QA 2WSMA 5TDHA 1Z2CA 2CLSA 4A2PA 1II8A 2ZS8A 4KFUA 5J47A 3CPJB 4A8JA 4RJLA 4D4KA 1N6LA 2CE2X 1S0UA 5KSYA 2FV8A 1SULA 2UVQA 4O2LA 3AEZA 4ZIRA 4DCVA 3PEVA 1C9KA 1E1QA 3RC3A 3HU1A 4NKRA 4HYYA 4ERNA 1E96A 3E1SA 2GEVA 3MSXA 4ZDIA 1M7HA 1G291 2XJ4A 2F43B 1GWNA 4C0QC 1NSFA 4JLDA 3GJ4A 3B8HA 2AXPA 1R8SA 1E4VA 2QTVB 3UKDA 2BBTA 3G0HA 2OM2A 1IN6A 2FFBA 1ZP6A 3U7HB 5F98A 1NBME 2NOAA 2OZEA 4AIIA 5DO9A 4NPHA 1X86B 2J7PD 1ZU5A 2I1VB 3AVUA 3THWA 1G7RA 4RD4A 2ZAMA 3NHBA 5AJWA 2CL7X 3QE0A 2RHDA 1LY1A 1FX0A 1ZMXA 4NH0A 2VA8A 1TUIA 3I1FA 2EYQA 1DO0A 4Q7MB 2O8DB 5EQTA 2C99A 4LYFA 3CF0A 4EKDA 3THWB 2GJ8A 3WY9A 4XWAA 2JJ2A 1JECA 5ANRB 3W8NA 1KDPA 1Z0FA 2CBZA 2ZIAA 3RSLA 2E9SA 4JYCA 1M7GA 3QPVA 4LPKA 3AM1A 4PFSA 2YWGA 2ZE5A 3FMPB 4KBGA 3ETLA 621PA 1GRNA 1KI6B 1VYUA 5JHHB 1S8FA 1K5DA 3VR6A 4CEHB 3V00A 3CO5A 4PQFA 3QKRB 3LBHA 4AY2A 4GP6A 2QN6A 4CT5A 1V5WA 4KBFA 1G7TA 4FMDF 3QKUA 2XOKA 2RH5A 3DMNA 5JZVA 4HLUC 1JR3E 3HR8A 1JPNA 2VHCA 1XMSA 2NPFA 4MKFA 2F1RA 5DH9A 1G18A 1P6XA 4V0LA 4JKYA 3QG5A 3W90A 3AGPA 2OE2A 4TMXA 1E2KA 3C8UA 4GBMA 4CEJA 4FW9A 1S96A 3ND9A 3CR8A 3GEIA 3QI2A 2CCJA 1UJ2A 4N1AA 1SXJD 3FGNA 4JIMA 2O0HA 4BFUA 1YZKA 1Q1ZA 1ZU4A 1DAKA 4OHZA 1Q12A 1XEWX 2V55B 2ZSFA 3M1IA 3MCAA 3PUYA 1G1MA 3QEOA 4P4TA 1SXJB 2BEJA 2ZR7A 2GDJA 2JLSA 3PG5A 3VR1A 2QNRA 2RGCA 2FGJA 2ZTSA 1P2UA 2V9PA 3B9PA 3PITA 4RCYA 2C2HA 4KVAA 1OH7A 1IXZA 4MITA 2RMKA 2RCNA 3S1AA 1MH1A 3OEHA 3ZD6A 1HTWA 1JXOA 1SHZA 2OCYC 3KXKA 1I4DD 1P9NA 2WOOA 2WSSD 4KSCA 1E2JA 5EZ6B 4HDCA 2PT5A 3T1TA 5LD2C 4KLNA 3SNHA 1XRJA 1EX7A 1CJTC 1Z6AA 2FSGA 3T12A 3HYTA 5D3MB 1FP6A 3HP1A 2F6RA 1ZUIA 3K53A 1GDDA 4LI0A 3QEJA 5IK2A 1G3IA 4FD2A 2ZJZA 2OESA 5JSZA 4GOKA 2JJ1A 4I1UA 4ZV4A 2IA5A 4WA7A 3T35A 3FTQA 3KKOA 4TSFD 5G3ZA 2FEOA 3CM0A 3FKSA 1KZ7B 2F43A 3QXSA 3I5YA 1G19A 1GTVA 3TW8B 1UFQA 2YWHA 4GSYA 1TX4B 5HCIA 2QAGC 4O3MA 1VHLA 5JBQA 2O8CA 1IN7A 1AZTA 4M1KA 1G5PA 2JGNA 3LRPA 1EG7A 2W0SA 3QOFA 3NDPA 2WWXA 1CR0A 2ZETA 4F38A 2G1KA 3I3SR 1TQ2A 3B2EA 4YLGA 1ZC3A 2XZPA 4HUQA 5F9HA 3ZQ6A 2PZGA 2G1JA 4LBYA 1OH5A 4LYJA 3DMDA 4ON9A 3CUEF 4GI7A 2H1LA 1P4SA 3ZYCA 5CB6A 3BWDD 1OFHA 1T0HB 4MUBA 1E2DA 2D74A 3IPXA 2GBLA 4LJ5A 3EIQA 2PLRA 4F7WA 5B64A 1RZ3A 2O8FA 4GMDA 1NVUQ 4NYIQ 1XCPA 3QF4B 4R9UC 3DEFA 1JNYA 1LFDB 3DVLA 3ICEA 3T5GA 2ZRHA 1CJVC 1MO4A 1KMHB 4IDQA 2NO1A 3KZ1E 1E9DA 1SVSA 3IDQA 4BFTA 5KNDA 2EYUA 4QGGA 4TQUS 4U5XA 2IUTA 3K9NA 3CW2A 1S1CA 3LBIA 4PXAA 3B1YA 2AWOA 1YVDA 3BGWA 4BRWA 3EPJA 4A0RA 4B3DA 721PA 1MO5A 4K81B 4QGAA 3SBDA 4NZYA 2C5LA 1FUKA 1W5SA 1ZC4A 4IOMA 3KJIA 3GJ8A 3PUZA 4URXR 4O25A 2YWEA 4XVRA 4LY6A 4C7OB 1OT3A 1SVKA 1UKEA 4MYCA 1WDTA 2QM7A 3AF2A 3UK6A 4UXJA 1E2FA 2WMOB 4NCIA 4TLAA 2BHRA 1HYQA 1E1RA 4HEJA 4JVLA 4DEYA 3UWOA 3K0FB 5TB5A 3R20A 3GLIE 3LLUA 1JBKA 4QBIA 1E0KA 2RGEA 2VP6A 2XB4A 4A2WA 5IF9A 1KO1A 4QHYA 1X8KA 2X8AA 3CR7A 4A15A 4LHZA 3U4QA 1N6OA 1U8YA 3BD9A 2F7SA 4QHSA 2BEKA 1EX6A 3EZFA 1D9XA 4A6XA 1CR4A 2LWIA 2QM8A 3RLFA 2DWPA 4RZ3A 2NPIA 4LC1A 4ZO4A 3GQBA 3KTAA 4NONA 2ZJYA 5HTKA 4BFWA 2XOKD 3J81k 4B2PA 4JLKA 4M22A 1XMIA 3RANA 3N5CA 1ANKA 3A1VA 1WE2A 2D06A 3U61B 3ADDA 2KB0A 3UMFA 2FJUA 4TYYA 4URYR 1XTSA 2VF7A 4JBYA 5L3RA 3R7WA 3DL0A 5SZHB 3GP8A 1OFIA 5EP2A 2N46A 2EFGA 3SFVA 2WKRA 2EFDB 1QVAA 3K0CA 4M9SA 2DB3A 4IOLA 5IK2D 3Q3JB 4V0ME 2J59A 4A2QA 1ZD9A 4AURA 5DLQC 4C3ZA 3BXZA 3ONWA 3RDPA 2IYUA 4TSFA 1M34E 1EGAA 4XSGA 5CLQA 2ZU6A 3G82C 4XVQA 3DKVA 3UWKA 5H1YA 2IUUA 3VMFA 1G3RA 4QM7A 1AGRA 2O8BA 3AVYA 4EIWA 2F1HA 3D8BA 4L4UA 5BN4A 2DBYA 2UZ3A 3BERA 2O8CB 3T1OA 4NMMA 3H84A 3MRSA 4JT2A 1U0LA 1IM2A 1EFRA 1P61B 2H57A 2J0VA 4CVNA 2P67A 3EA0A 2W6JD 3F3YA 2DR3A 3U3JA 2QT0A 3IPYA 5HCNA 5FTNA 3JZMA 4Q9LA 1T3SA 2AD1A 2FA9A 2KSQA 2FGKA 4A0FA 2W83A 2WPDD 3NBXX 4Q66C 1JPJA 1VIYA 4HLDA 1RYFA 3AGQA 2YNMA 2YV5A 3WNCA 2QRNA 1GFIA 3ZD7A 1WRBA 5JLJA 4XTCS 2Z6VA 2IXGA 1EWQA 4ZI3A 4HZIA 4QNRA 2C9YA 2CEAA 3QPWA 2XX3A 3FKSD 3EWSA 2J0UB 2ZJ2A 3AQ4A 2IL1A 3NBFA 1GOTA 4WZBE 4N0EA 3CZPA 4RKFA 3LA6A 1EESA 2IYZA 5AJXA 1KK3A 3GLIB 2C9CA 4MRVA 3AV0B 4GPTA 1II0A 2AK2A 3PFIA 2ZJBA 3GJXC 2IF0A 2OAQ1 2CLDX 2W58A 3TNFA 4HAZA 1N6IA 4NYIR 3RYTC 5C1BA 1MRNA 2QTHA 2Z0MA 3OEED 3TUIC 4DLXA 1VG8A 3JVUA 4TMKA 2Q3MA 1Y63A 3T1QA 2YOFA 5A0FA 1KI1A 1K8RA 1I2DA 5FOWA 3K9HA 3Q72A 4XD7D 3I73A 5H70A 1I2MA 3AVPA 2CVHA 3VR3A 2O8EA 4UXIA 1KIMA 3CRMA 4DUGA 4DSUA 5KPJA 3DKPA 2IS2A 1U0JA 2VHUA 4KJZA 3UMRA 2FEMA 1JEDA 5FBRB 2WHXA 2VP9A 4ZDKA 2VHJA 3Q85A 1UKVY 3OIVA 4YMVA 2AHOA 2QQEA 3M6AA 3D7MA 3SQXA 1Q44A 2JLXA 1SXJC 1OKKA 2O0KA 2ZREA 1KNQA 4NL4H 4OKSA 1OFTA 3LBNA 1KKLA 4GMXA 4B3BA 2OILA 1EFCA 3KDSE 1M1YE 1WCV1 2BMDA 3LH5A 2MSEB 2XXAA 3B6EA 3HU3A 4Q19A 1VECA 5AJZA 1DAGA 1W1WA 1A2KC 4LJ6A 4D25A 2Q3FA 1DEKA 5JSZB 1I4LD 3K70C 3D31A 5HKKD 1TEXA 3GLFB 2QL6A 4II7A 4DCNA 2AFIE 1N6NA 4LBWA 1CXZA 1XTKA 2GF0A 4ZDWA 3ZZUA 4DCTA 1L2TA 4LJAA 2C03A 4M2LA 3HWSA 3A36A 4HDQB 1AA9A 1VPLA 1ZAKA 3GJ7A 2GXAA 1QHIA 2JAQA 3KJEA 4KFTA 4FMBB 3AUYA 2F3TA 2OLJA 4LV5B 4NCNA 2Q21A 3KTAB 3PXGA 4IDPA 3TKLA 4B3XA 4NHOA 4ZCIA 2G0TA 2JDID 3O8DA 1ZNXA 1G7SA 1Z06A 3BH7A 5FUVA 5FOTA 2WWHA 1ZIPA 3AVVA 1EFRD 4HAWA 4RFSB 2QG6A 3SFZA 3EWAA 4OK5A 4B71A 5J4VA 2OG2A 1OXUA 2D7DA 1OYWA 2HCJB 2C9OA 3H0KA 4QJ4A 2ZSEA 3TQFA 3AKCA 4MA4A 3SI7A 1XFAA 2IEYA 5CITA 1XXHB 1K5GA 1NKSA 4K8OA 4KYIB 1LVGA 1P9WA 3P20A 5CDFA 2V7QA 4JS0A 1VG9B 4M1YA 1EXMA 1ZJ6A 3FFBA 2EFCB 2J0UA 1Z0IA 1RC8A 1X1RA 3SYLA 1XZPA 2ZI4A 3GLGB 3LAWA 3W8RA 4FMDB 3F0TA 4EFLA 3IIKA 1Q22A 1U9IC 1N5KA 3Q9LA 3GFOA 1DE0A 2Q0HA 3NBYC 4LSGA 5DI3B 3AB3A 1FP7A 1B0UA 4DLRA 3OZXA 2ZU0C 1AQYA 2VHQA 3THXB 1IY1A 1MOZA 2HF9A 4TMVA 4KI0A 3RRNA 2JEOA 1FNMA 3P27A 1PUIA 5HPYB 2D7CA 1EFHA 1KK0A 1XB2A 3K09C 4JVMA 1CU1A 2REOA 3O8RA 2WJJA 1G8GA 1KI6A 1Q1BA 4JSTA 3W3ZB 3X1YA 2JIZD 2G3YA 1RE0A 5BXQC 2FOLA 1KDTA 1T4GA 2QMUA 1RJ9B 1HY3A 3A8TA 1N6HA 2ONJA 2ZVPX 2OV2A 4DZZA 3BH0A 4PC2A 4OQNA 1ZUNB 5AR1A 4QFMA 1I4TD 3VR4A 4DT1A 5JWRA 1LF5A 1J70A 4TT3D 4P0TA 1B23P 1X6VA 1C1YA 2XAUA 2ZJOA 2ZJ8A 3VHLB 3T5DA 5JEEA 5EE9A 1FZQA 4MRRA 2FF7A 5E95A 3KJGA 3NH9A 4W5WA 1QZXA 3GLHA 3RC8A 2D62A 2IYYA 3WBJA 2JJ8A 4JKIA 4DLSA 4MUAA 1NVXQ 4B3GA 2P65A 5F2EA 1OPXA 1R0YA 521PA 3ZZTA 3WYGA 3K09A 2VIIA 4Q1EA 5CLLA 1VG0B 1E9EA 4R7ZA 4NTZA 3OE7A 3KKMA 1R5NA 2ZR0A 5IRCD 2DFLA 1N5IA 1VCMA 2QTFA 1AJEA 2R6CA 2H92A 3PIRA 1Z6GA 3REFA 5C2JB 2ZRPA 4AI6A 3TR0A 3U44A 2BMFA 1E2NA 3GCGA 4HZUA 3LQRA 3AKYA 2A2ZA 2KI5A 2J46A 3MFYA 4BLTA 5KPDA 1Z6TA 4LZZA 4U7DA 1U2RA 2IYQA 4JLVA 4HAXA 4A8JB 1BMFD 4DB4A 4DB2A 4EPWA 4TLCA 2O8EB 4PAMA 1T5IA 1XDBA 2I4IA 2ZJ5A 1GM5A 4QL3A 3E5HA 1F48A 2VO1A 1W4RA 1U98A 4LHXA 3FHCB 4RD0A 4W5HA 1TEVA 1SZPA 2ZAOA 4BZXA 1E94E 4CZ2A 1DOAA 2A7QA 5JJLA 4LWZA 3IEUA 3NH6A 1E79D 2HDNB 4L8GA 4BECA 4JSYA 1XTIA 4CEHA 3MUFA 2LCFA 3U3MA 3GJ5A 4MGKR 1UEIA 1GVNB 4NBSA 2Z4SA 1U8AA 2J5XA 3ND8A 2G0NA 3SJBA 1BH2A 2QA5A 2NMVA 2F1JA 2BIFA 2WV9A 2ZI5A 3AH8A 2AX4A 3LLMA 2H16A 1QG2A 5DNYB 2O8DA 1Z28A 1XEXA 4XWKA 5DSZA 2OLKA 3C7KA 1RRCA 1XD2A 1N3BA 1CRPA 3C16C 3A37A 4EDHA 2YOHA 1G8PA 5HZHA 5C4MA 1X8JA 1JR3D 1NMXA 2J7PA 4DHEA 3NDBB 2J3EA 1WBDA 1SVMA 2ZRNA 2FDCA 3AF1A 3Q5EA 1E2LA 2J9RA 3GLGE 3BK7A 2W6JA 3BBPA 1R5OA 1G6OA 3MJRA 1E98A 1Z22A 5JS8A 1DAEA 1XMVA 4DDTA 3U7GA 3KL4A 1XTJA 1YJ5A 2PT7A 2IS1A 4ASUA 2QAJA 1WQ1R 1WA5A 1XBTA 3IIMA 4IOJA 4Q1DA 5E4FA 4KVGA 2V8OA 2HT6A 4BLSA 1G8HA 2G88A 3RWMB 1HE8B 4M4SA 1EK0A 4TT3A 1L4YA 2Z5FA 5CYOA 4PTLA 3RSOA 2BWJA 5KHOC 3U6KA 1U90A 2QMOA 4DRZA 1VYTA 2VP4A 2IWRA 4GL2A 5SZKB 3E70C 2CJWB 3CRRA 3PEYA 3ZS9A 3RS3A 4RVCA 2ZRFA 3PEUA 2QSZA 1G8FA 2BCJQ 5D3MA 3TVDA 2B92A 2BVNA 5KDLA 1P3JA 2J87A 2VHTA 3B78A 3QJYA 3OE7D 1K6MA 1E6CA 4KFSA 4GFDA 1ZM9A 4H1UA 5KDOA 1VMAA 1D9ZA 5L3SB 5CDFE 1G64A 2DFNA 4BFZA 4URZR 1CF4A 2JJ2D 3CBQA 4LJ8A 3H1TA 2NO9A 1CIPA 1KO4A 2XEXA 3CNOA 5DYGA 4M0LA 4Y0VA 2YC2C 4KYUA 2A78A 4NCHA 2J41A 4US1R 3ADCA 4ARZB 2OHFA 4MKGA 2ZRKA 4QJ5A 3VX4A 1P2VA 3UANA 4D82A 3OFND 1H8ED 4ZIRB 2XNDD 4Q1FA 1OIXA 1E0AA 1XXHA 4YDSA 3EZ7A 1TL7C 4TMTA 3Q7PA 1ESNA 4JBWA 3W5JA 2QP3A 3U5ZB 1FFHA 2GJSA 1BOFA 5FBLB 1SHKA 4NE2A 5TXGA 4DXAA 1E0SA 1UAAA 1GSIA 2NTYC 1NN3A 1N0UA 5L3QA 1ZW6A 4O2RA 1NVWQ 1SQ5A 2CNWA 1GUAA 2OBLA 4JVNA 5GVRA 1T8TA 3TSWA 2OUKA 4Z8XA 5AUNB 5DYIA 3ADBA 3IILA 5FPSA 4B2IA 1VKJA 1SVIA 1O87A 2V6IA 2ZE8A 4HB4A 1FTSA 1N5JA 4B48A 2MMGA 5CB8A 4KAXA 3SJCA 1JB1A 4DEXA 3TAUA 3AP1A 2GA8A 3D6TB 4LUCA 2ZM5A 3CX8A 2C04A 5B2ZA 3WBKA 5GJBA 5K8UA 1UKYA 2A5DA 4BWYA 4D0NA 1W0JA 1CJUC 4I1SA 4MGIR 4HZUB 3TIFA 3ICQB 5CK4A 4B74A 3LXRA 1W47A 1SKQA 4AKHA 2J1LA 2ZI3A 5HE9A 1P60A 2RKOA 2VP2A 2BM1A 3KKQA 4IEIA 1NIPA 2EW1A 2FFQA 4FCWA 4LYHA 2RGXA 4JMPA 1A5TA 3I4LA 4B2LA 5DI9A 1GP2A 3U6BA 5FH9A 3EAQA 1E9RA 2ZE7A 4ACAA 2BMJA 5JFGA 4IFEA 3PUVA 4DKXA 4BASA 1P75A 3GLHB 1LS1A 4KU4A 1ZYUA 3H4MA 4BPBA 1FOEB 1R6BX 4EPXA 5IDVA 4QBHA 3WNDA 4BLRA 3T34A 3B7GA 1P72A 1TUEA 4YXWA 3RS7A 1U8ZA 5A5GA 2AKYA 2ZRBA 3GJ6A 1Z8FA 2Q9AA 2WWFA 4KODA 1HA3A 5KSPA 1Z47A 2OFWA 2NQ2C 2YYZA 1NY5A 2BM0A 5BQ5A 2CJWA 4WIAA 3R7WB 4ABYA 2ZITA 2FZLA 2KWIA 5HR5A 8OHMA 1NLFA 3BS4A 1KI8A 4TMZA 3BE4A 2P2LA 5EXPA 2JIZA 4Q5IA 4Y0AA 2IYSA 2D2EA 2YC4C 2K5UA 4X8MA 4A0GA 4WZAE 4OI4A 1FL9A 1NBMA 1RRPA 3CONA 1Z6YA 4ASUD 2PMDA 2V54A 1F5NA 1OXSC 1YE8A 4PC7A 3RVBA 4C0AC 5KDDA 3IIJA 4OHYA 1E2PA 2WKQA 5DGXA 1JALA 3IQWA 4JZKA 3GLFE 3P32A 5F9FA 5C4GB 5FL3A 5H68A 1KY3A 2J7KA 4O0MA 1ZD1A 3ASZA 3QF4A 1D5CA 4HUTA 1QHHB 1DVRA 4EUNA 3RRYA 2H7VA 4Q7LA 4OQFA 4PANA 3T1VA 1DG3A 2QP9X 1XPUA 4FMCB 3NTUA 2DHRA 2PX0A 2HYIC 1XWIA 3AF0A 1E0JA 4BQSA 2R6AA 3SE0A 1JEEA 2NZJA 2VBCA 4IDHA 3EXAA 2VLIA 3KB2A 2FSFA 4JT4A 1G8YA 3MD0A 4CGZA 1NLZA 2RGAA 2PJRA 3W6OA 4AWXA 4PZZA 3FYHA 1OHHA 3T15A 1IJFA 3QVUA 3B1XA 3MWYW 4BGDA 4TWZA 3LV8A 4QC2A 2IS6A 4R2IA 2ZEJA 4A9AA 4R98A 4QXAA 3AUXA 1DAHA 1T3HA 4URVR 1H65A 4V0KA 1E99A 1MKYA 2ZRLA 3EIEA 2XNSA 3IQXA 4TYNA 2NIPA 3A1SA 4RFSA 1XPRA 5FUWA 3X1ZA 4MGZR 3RNLA 2GZDA 2VPPA 1NVVQ 1RRGA 2CK3D 1W4AA 1ESMA 4DDUA 2FSIA 3CRQA 2LKCA 3OF5A 1E9SA 1LW7A 2WAXA 2H8KA 3V4RA 2B8TA 2GBLC 1J99A 1JXMA 3BFXA 1HH4A 3QY0A 2VP0A 2B6HA 4BEJA 4C0BA 1KSJA 4EPRA 3ZH9B 3QENA 2YKGA 4ITRC 3SYKA 2C77A 4G5QA 5EE1A 2IC5A 4CDGA 2ZRGA 1ZM4A 4DDWA 1MABA 1KSFX 4EQ6A 2AFHE 4OQXA 4LPSA 2IYLD 3LD9A 2MSDB 3UG7A 2IHYA 1KY2A 1US8B 3OHMA 3Q8XB 2IYVA 3HDTA 1E1QD 3K9LA 3RHFA 2WJGA 2CL0X 1JQLB 3CWQA 2ODEA 4ZCMA 5L3VA 3GD7A 1JAIA 2CHGA 4QG7A 1YZUA 3LXXA 3MAAC 1LS6A 1CP2A 1HT1E 2ZJAA 4K46A 1WBBA 4M21A 4C9BA 3PQCA 3A58B 4ZKDA 3QXXA 1IN5A 1P2SA 1BKDR 4EJSC 4B76A 3QXJA 2GJKA 1YR9A 4V02A 2OAP1 3VKWA 4PSAA 5BYJA 4G1UC 1NN1A 3KXLA 3L0IB 4OYHA 2EVWX 2WOJA 2PEYA 4BZQA 2GEDA 4UJ5A 3S1AB 4Z54A 3QG1A 1QHXA 1OF1A 1ZVQA 5A4JA 1KI4A 1KDOA 1T3LA 2QUZA 5JS7A 1W46A 4XTRA 5TMPA 2RGNC 3LVQE 1FQKA 1NN5A 1W36C 1QHYA 2UZIR 4LHYA 4TL6A 3CLVA 1IN4A 1F6BA 1G6HA 1T91A 1TF2A 4LGMA 1JQJC 5CIWA 4B33A 3E2IA 4HAYA 4E5UA 4N3NA 1QHHA 4HLCA 4XJXA 4B47A 4JLBA 1E32A 3EZ2A 3KQHA 2GCOB 4Q4HA 3WYFA 2DCUA 1W4BA 5FI1B 1GAJA 2C95A 1Z6XA 1NJGA 2FPKA 2W2VA 4Z1MA 4PX9A 4IRUB 4Q48A 4IDNA 2A9KA 2ZYTX 1KO7A 4LDJA 4NU0A 1G3MA 2EFEB 4DCUA 5AUPB 1VDZA 1YU9A 4XH9B 1W0KA 3QVVA 2I3BA 2WJHA 4Q4LA 4UJ3A 3SBEA 4B6FA 4FCTA 4W9MC 2BMEA 4IKEA 3CRW1 1FW6A 1ZM7A 4AG6A 1ZINA 2IYWA 3IHWA 1JR6A 1OHHD 4WOPA 2OFXA 2QENA 2HLDD 1T6NA 4B43A 5JCZA 1OXXK 2F9LA 1XJCA 2HCBA 2R2AA 5JI3E 3QQ5A 4M1OA 5LBIA 4DIDA 5L3SA 3GFPA 2IS4A 1N2CE 3OIYA 4RSGA 3WMGA 1H8HD 4IVPA 4YMUA 4Q01A 4Q00A 4ARZA 1R0ZA 3AKEA 4UQOA 3IBYA 1FTNA 2MMCA 2YOGA 4DC9A 4DLTA 2IXFA 821PA 4U02A 4YQFA 1KOFA 1E2QA 2A3RA 4PPQA 4RKEA 4PPFA 2VP5A 4V0OA 2CK3A 4P33A 1IY2A 1HQCA 3C4JA 2QRZA 3UG6A 1XCGB 5KOYA 2ERXA 4F4IA 2ZUBA 5BN3A 1OH8A 1A1VA 1OLOA 1TTTA 2VL7A 3RWOA 5FBVB 3KQNA 3KUDA 2VEDA 1TAGA 1R0XA 2PLFA 3CIOA 3GLFA 4IXMA 2HXSA 5FTJA 3G5UA 5HZKA 4M1WA 4TN1A 3EW9A 5FBQB 1NRJB 2G9NA 3RS4A 4Q4AB 3GJ3A 1SXJA 4JLPA 3NHAA 4B35A 1N6KA 5G41A 1AS2A 3EPHA 4S2EA 3HPRA 5EE3A 4LJ4A 4AKGA 3ZGXA 5EJEA 3EC2A 2H17A 1XCMA 1ETUA 3TMKA 3VU9A 1J2JA 2V1XA 3GLIA 2ZYVX 4PZLA 4D0GA 2Y8EA 1Z3IX 1ELOA 5CJ2A 2FPMA 1E69A 3BORA 4NCKA 4F93B 4CEIB 2YVUA 3BC1A 2WKPA 5B57C 4NYMR 3UPUA 5DHAA 3TUJC 2DFTA 3GEEA 4A0HA 3K0AB 1TF5A 4TZ6A 3DDCA 5DHFA 3V4FA 5LD2B 2P5SA 1S9DA 1L8QA 5LDDC 3LWNA 5GADl 1P9RA 3N70A 4KFRA 2GRJA 4A8JC 5FR2A 2P0EA 2D2FA 4IEEA 1GIAA 1KO5A 2NG1A 1N25A 2PH1A 1W4CA 5EE5B 5FL7A 4C0SA 4AG5A 4E07A 3NEYA 4WVFA 5E3HA 4OL0A 1AQUA 2QY9A 3WMFA 2CDNA 5E7MA 4JJKA 2D4HA 2PZEA 4EAQA 1KZGB 4NYJR 4LJ9A 1OYYA 4I1VA 4C4PA 1FMLA 2VYFA 2ZRAA 4AD8A 3VAAA 3OAAD 4G5GA 1AS0A 4GP7A 3U3OA 1A7JA 4A1FA 1Z5ZA 2N42A 5J5CA 1UDXA 3EIHA 2O8BB 3ECCA 1A4RA 1OSNA 2ORWA 4KLZA 1OB2A 1DO2A 4FCVA 4F92B 3PEWA 1FX0B 4FIDA 4WXRA 4FWTA 4BEBA 2VSOA 3SZRA 1OB5A 3ZVMA 1VCOA 3W5IA 1YR8A 2Z43A 4HB3A 1KSGA 3TLXA 4MH0R 1E1RD 4LCBA 1GITA 2ERYA 4OBEA 121PA 2R6FA 1H8HA 4U00A 2QSYA 3VFDA 3NEJA 5IHPA 3WRYC 2X1VA 1DAFA 4J0QA 5EP3A 3IKJA 1EFUA 3P4YA 1XNJA 1F60A 1G16A 2KE5A 2JLUA 1YRAA 1M8PA 2FX3A 4D4MA 1Z0DA 3K0EA 4D80A 1S2MA 4I99A 1ZNZA 1IONA 2ODWA 1WP9A 5LB2A 3FKQA 3B5JA 4XWOA 4PQYA 2GXQA 3QSYA 2NGRA 4URWR 4OJKA 2J45A 3PVSA 1DG1G 3RS5A 2IK8A 1F3OA 1HURA 2AL7A 1PLKA 4AYXA 2WM9B 4P4SA 4A4DA 5SZIA 2HT1A 2AN9A 4X8LA 1WMSA 1N6PA 1FUUA 1YZNA 1A2BA 1Q1EA 1N6RA 2ZRCA 3A1TA 1S4QA 1MR3F 2PMKA 2QGNA 5J40A 4PC3A 2QMHA 4MYHA 1KI2A 1NI3A 4ZDJA 2EQBA 4PAQA 3K0SA 3TW4A 2JJ1D 1CRQA 1R0WA 4BRUA 1P5ZB 4MRSA 1Q3HA 4TMWA 4ZKEA 2QAGB 3AP2A 2WAYA 3B13B 4BFYA 1DS6A 3ZJYA 4D4JA 1SVOA 1GRRA 3AKDA 3EZ6A 2CE7A 3BB3A 3KFVA 3VR2A 4L16A 2OO7A 2PL3A 4RD3A 4OJQA 3TSOA 1LTQA 2PZFA 4Z51A 2JCSA 2OCAA 2XZLA 3KUCA 1G9XA 4WXPA 2CVFA 4Q18A 2GAAA 3IBGA 4LOAA 3GLGA 1NN0A 4PSVA 1ZUHA 3QXHA 4JJZA 2Q3HA 4E22A 1D2MA 2ZROA 3EX7C 3I61A 4DCSA 3TAHA 2AK3A 3QKSB 4E03A 2WWGA 1OH6A 2DY1A 3B82A 1CS4C 2OXCA 2QI9C 1HUQA 1OE0A 4D26A 5TV2A 4GRAA 3H2YA 4CW7A 1G41A 2GKSA 1HQYE 1UBCA 3DOFA 3LQQA 4UKDA 1G7CA 4E09A 2JLWA 5JJIA 3PR1A 4OHVA 3BFKA 421PA 4DSNA 2FG5A 3ZQJA 1ZM2A 3MLEA 4NYMQ 2BV3A 4ZI2A 3FHTA 1JR3A 3SYNA 2WJVA 4BE7B 1XZQA 4QBGB 1VTKA 3WRXC 1IY0A 3ADKA 1X3SA 2EFHB 5DISB 3U44B 3QBTA 3L8YA 3CPHA 2OEPA 2DFKB 3X1DA 2GJ9A 2XTZA 3MJHA 2BC9A 2OSBA 2R65A 1JJ7A 2R8RA 2JATA 2ZR9A 3AVXA 2HYDA 3B1WA 1DELA 2GAOA 3B9QA 2VQSA 2F1IA 3VKHA 2IUSA 1XMJA 2REBA 2VTKA 2GILA 1W5TA 1G17A 4AYWA 2TMKA 2ZPTX 2ANBA 3HYRA 3I62A 2QMEA 2C8VA 3L0SA 5JI2E 1LNZA 3KKNA 1E2IA 4JLMA 2G83A 2GZAA 1NL3A 2Q9CA 5FL7D 1G3UA 3FDIA 3TJZA 4LYAA 4M9ZA 2JLQA 2RGNA 4IVRA 4C0LA 2WIBA 1AK2A 3N2EA 2FNAA 1S9HA 1J8MF 1XD9A 1KDRA 4TYQA 4Z1MD 5JEDA 2V4ZA 3B60A 1YKSA 5B58C 1H8EA 3P4XA 2P5TB 4PC6A 2QT1A 4Q7KA 1E9CA 1GRQA 2ZRJA 4TL9A 4UNRA 2KBEA 3BAFA 3DO6A 5DI3A 5KO2A 3ZS8A 3KX2A 2GF9A 2XTMA 3L43A 4Q9HA 4UNSA 5K8LA 3KQKA 1S3GA 1EFTA 4DSTA 2ZI7A 5KSOA 1KGDA 1OIWA 4DIEA 3GLHE 1TQ4A 1OIVA 1T8UA 3CH4B 3IEVA 2AR7A 4NP6A 4DLUA 1RIFA 1ZRHA 2O5VA 4P31A 1GNRA 3RAPR 3ZVLA 4PO1A 3KKPA 5AK0A 4BUJA 2NZ8A 5GJCA 2RHMA 4DLVA 1QDEA 1R2QA 1Z08A 4TYWA 1XD2B 2BOVA 4L15A 4WAUA 4C7OA 4KCGA 1SVLA 2IHBA 1IBRA 1NVVR 4DUGD 2QZ4A 3PJRA 3DM9B 4FWIB 4P4UA 4Q1AA 1VCNA 3NBZC 5FOSA 4QNMA 2ZYUX 1G20E 3GJ0A 1R4AA 1XJQA 1PUJA 3OFNA 3IGFA 4HATA 2XNDA 5CM8B 2JDIA 4A92A 5AUQA 1CBUA 3TR5A 4BLOA 1NP6A 4URUR 1DADA 3SN6A 2ZI6A 2QBYB 3K9GA
chains in the Genus database with same CATH superfamily
1YH3A 2G67A 4RH3A 3WP0A 1ZNYA 3BJEA 3EDCA 1XRRA 4TQGA 1FMJA 3AWDA 4DARA 2XLCA 2AOUB 1D8TA 1QVRA 4JB8A 2BDEA 3SF8A 5IXSA 2XCSB 1YBFA 3JVIA 4BFSA 5A4DA 5KUTA 2MYTA 3ZBUA 1P62B 1DARA 1RR6A 1QE0A 1NXWA 3DMFA 3R5JA 3FPHA 2HMUA 1YV9A 1COWA 4HFJA 2XMGA 4V03A 2TSYB 2PGJA 3K2EA 5EIBD 1UWVA 1M0EA 1DQPA 5AKEA 4C4SA 4TYPA 2D0PB 2GPWA 4EFDA 2Z3WA 3SQLA 1L4LA 4RSMA 1Q3TA 1UKZA 1L7EA 1O97C 5L53A 1UC4B 2IHZA 4UEJA 1SB8A 3G0GA 4DCMA 4L7VA 4LKOA 4HX5A 1RRFA 5BN4B 1TPYA 3WKBA 1H2AS 4HGRA 2B4KA 3GPLA 5KYYB 4AECA 1P0IA 2Z58A 5B37A 3RRZA 2LVBA 3IAS1 1DKLA 1ZGAA 1XP8A 4HSEA 4C3OB 4X1YB 3IE2A 3IVXA 1NDUA 3LVRE 4FPXA 2YWRA 3VPAA 3LFTA 2B7BA 4O4IF 3O8BA 2I65A 1NNSA 1ISFA 1T5HX 4YLEA 4LXIA 3R8XA 5I7HA 1HI9A 4KFCA 1X7WB 2MSCB 1C0LA 1ATIA 2PPVA 4AY4A 4F12A 4ZCRA 5KTPA 3A0RB 1Y7HA 2M1ZA 1XOIA 2ORED 3PTAA 4IUBS 1NJSA 5DSTA 2WT4A 3NP9A 3SS8A 3X2SA 2IEZA 4LGVA 5FAKA 2B8WA 5JCOA 1RHJA 2POQX 3UHFA 1FNNA 3DMRA 2GHIA 1GNQA 2FMHA 4OIMA 5EJ4A 3M6UA 4KWHA 3TOZA 1TO6A 3LZ6A 4F9EA 2P5YA 4OI1A 1E77A 2QN3A 4KXVA 2F1KA 1WY7A 1V71A 3BWEA 4NLLA 3DE1X 1QMPA 3LHKA 1ZW1A 4XCXA 4CMGA 3I1JA 3AR5A 1N2XA 1ZLYA 4IG4A 3A3NA 4JVSB 5DV9A 4CIDA 2CLCX 1FFWA 5CFMA 1RBMA 3K70B 1OT5A 1SHLA 3VVCA 1IBMB 3CNLA 4HKTA 1SHUX 1F2UB 2ZYGA 3SDZA 1JP7A 4W8HA 1QM5A 3BJZA 1DP4A 3VTKA 2YBDA 2JLRA 2P4HX 3AOGA 4Z8YA 1GPAA 4IXNA 1PR5A 5JZSA 4W5NA 4RTJA 1WSAA 1BHSA 3H11A 1Q2UA 1QF9A 2O3QA 1YUNA 1NF3A 4CKCB 1E66A 2RIPA 2AN1A 3LX6A 3HTXA 5TARA 5J2TF 1M5UA 2FCRA 1D2NA 1POWA 4GECA 2UYOA 1B41A 2YMQA 1NONA 1RJWA 1GGEA 2JVKA 3L5OA 5ALDA 2R8EA 4YRAA 1AA6A 4G24A 2WJWA 1TZMA 1FVHA 4GSLA 3ABSB 4UBKA 1CUDA 4IZIA 1YL5A 5FYQA 5JOQA 4P3NA 1OXBB 2XH8A 4YBZA 1JIXA 2PWYA 1X9IA 1JHXA 2P6RA 2H5IA 1FYDA 2DHQA 3HJCA 3H9GA 4UUNA 4X93A 3OM1A 4BZPA 1UZMA 4D2IA 2C5FA 4HO1X 4NQRA 4EG0A 4KHZA 1NNEA 4QQFA 3B6MA 2A9JA 4MRMA 3HUFA 3OX2A 2POCA 1RM3A 3HZOA 3NGLA 2MSWA 5LC1A 7AT1A 1N5LA 1SC9A 2CL6X 1QCZA 2ZIXA 3VNVA 3P9XA 2VKTA 3UOAB 5BOSA 1ZXLA 5K0FA 1LQ2A 4ESVA 1E79A 3NC1C 1AB6A 1W7AA 3AP3A 1UXGA 4P1ZA 4WN9B 4DMMA 4G56A 4ZQEA 3WLMA 5FPHA 4IPTA 3EFHA 2W6MA 2X8BA 4XDGA 3RS2A 2BBWA 2YXNA 3UICA 2CUZA 2AC4A 3LGSA 3PK0A 5AOCA 4P98A 1QGUA 1Y8AA 3DV9A 3AONB 3JCZA 3R5XA 1M1ZA 3W05A 4FI3C 2IWHA 4X3OA 3JQ8B 3AINA 3AESA 4S1TA 1DHRA 1TJNA 5KI6A 4HVLA 2WP8J 2LKDA 3S44A 1QZTA 4Q4JB 3B8EA 3MWKA 3RUPA 2XSZA 1G4AE 3EH2A 2QOEA 3QZUA 4E70A 5I7WA 5CFOA 2DLCX 4BBPA 3ENKA 5REQB 2NNLD 4BRSA 1R7RA 4H1VA 3A14A 4BNVA 4RJKA 4IVQA 1FNDA 4Q9IA 2RGGA 2DBVO 5E3JA 3GGJA 4L6AA 4E1AA 2V8BA 3MJDA 3OT1B 4LZOA 1R00A 4GICA 2PQMA 3OIFA 3FMOB 1FC0A 1RJ9A 3GUCA 4XUEA 5JMTA 2H07A 3QFTA 2OCPA 1GHTA 1ZSYA 2FPOA 3L8ZA 3GUVA 1W36D 1SG0A 3NJRA 3WS7A 4PYMA 2VRNA 4MI1A 4HWTA 5DM2A 5GJVC 2EKZA 1XCOA 3RYFA 3UO8B 4JHLA 3FY4A 2EU8A 3M7IA 2IF2A 5BOSB 4PR0A 4MR8A 2DPXA 5J5AA 1NFRA 4ZHQF 2FFRA 3U80A 5CVTA 1GTSA 3QU5A 3QI7A 4IBOA 1DFIA 2EGGA 2Q7XA 1QFYA 2JAHA 3AVQA 1GY8A 5ESXA 2IW3A 1C8LA 4HWOA 5LLSA 5FA5A 2AOTB 2ZIUB 1U8FO 4IFIA 2R25B 4NYJQ 3C14C 2UUAB 3TE6A 3ZTYA 1CDEA 1AKYA 1GCOA 3G9QA 5DK6A 5DLDA 3GQVA 4M55A 2A14A 5BMVF 4US0R 2ZE6A 4CV0A 1QIKA 3PZBA 4Q4CA 4C76A 5AW7A 3Q8WA 2X7XA 1XAHA 3MTJA 1Z6PA 2HRDA 5T67A 3H3FA 1ENOA 4BUZA 1EZ1A 3AR4A 1EWTA 3TB4A 1Y9AA 4CF5A 3A6FA 5AUOB 4RIGA 4AMVA 1NI4B 5GM2A 4QYSA 2H4XA 1PL0A 2H1VA 3BWMA 4A36A 1LRJA 2DPYA 1FFBA 3GIDA 3THRA 4XIJA 5B3JC 2PCLA 3C7TA 3ESAA 1RE1A 3CYFA 4Q4AA 3REGA 1O5IA 1QRAA 3KVRA 3KXIA 4ZGWA 1PJSA 5EXSA 5BV2P 2WM3A 3LX8A 1FJHA 4HQNA 5FTMA 3T54A 4DVJA 5LVAA 1ZI9A 1TW3A 3FWHA 3OJOA 3BB4A 4HBZA 3W6PA 2F59A 4BCCA 4OK6A 2DWCA 4KQXA 2LIPA 5CXQA 1TC2A 3ONEA 1N1EA 4LYGA 2D5BA 2ZIWB 3I2GA 3FGOA 4YCNA 2AUMA 3HDVA 4DM7A 4P32A 3SHQA 4H27A 4NG5A 2QUKA 1XC7A 5K2MA 4O4IB 1RJDA 2FPLA 4PGAA 4CFYA 1KEWA 1XTQA 2JNWA 1Q1GA 2JEYA 2XGGA 2CHQA 2G5PA 1BQEA 3IBFA 5DE3A 5KWVA 1JG7A 2D1YA 1ZK0A 5IAKA 2EQAA 4CN8A 3LCCA 4OHCA 5KTYA 4OHWA 5EWLA 1ZN8A 5H7XA 2C5HA 5LZ2A 3V1TC 2R47A 4P4SB 4K26A 2M6SA 3SEZA 1MW8X 1MJ5A 1G0OA 3PXCX 3E27A 2D59A 4BFVA 2Q6IA 3NHFA 4QYXA 3MGBA 4KI7A 3L40A 4LNUA 4ZCLA 1U3UA 1FRQA 1OZFA 2A1UA 2R60A 3AR7A 2HIGA 2YWBA 1R4NA 2QB5A 3GJSA 1HL7A 1USWA 3QMVA 2FN8A 1YCFA 4QUGA 3ANNA 3WX0A 5TF0A 1Y3CE 1Y7TA 2AYXA 4CBVA 4F9GA 4AG5A 4QJ3A 3F1KA 4CCYB 3HHEA 3S68A 4DY4A 1DRUA 1GFZA 5DGIA 4QM6A 1GILA 2IOFK 4YRNA 4RTNA 4Q03A 4JLOA 2PGAA 2E4UA 3RFXA 5T6BA 1L4MA 2AOXA 1BYIA 3VR2D 1PNTA 1V96A 5LWQA 1ILWA 3VHXA 1AK9A 4QKQA 3SAJA 4B73A 1G5IA 1MFPA 4WOBA 2JRLA 1LK7A 4MDFA 1DQZA 1J20A 3PUXA 3DDHA 2LV8A 4NDAA 1Y9JA 5DCUA 4LTNA 2HMYB 3H4VA 4P83A 3ZHSA 3STHA 1Y4DE 1YIOA 2XWPA 5JIBA 1JKIA 1QV6A 2VHEA 2WPDA 4GE0A 1XL1A 1QBKC 2GWHA 2UZ1A 1JJVA 3GRRA 4B34A 1COWD 5B1DA 3KTOA 3RVOA 2QE6A 4NJMA 3AV3A 4ARAA 5BRNA 2CCKA 4P3YA 3R8FA 4FOLA 2YCLA 2PZ8A 3NHZA 4HDKB 3SM9A 3C5CA 4CFZA 4ALIA 1RRVA 3GFSA 3LUPA 3GAZA 4KIGA 1E9BA 1CR2A 2OO5C 4OAOA 4OL9A 3JPYA 1G63A 2Q7OE 8LDHA 2XITA 1HE4A 1XKXA 2Q2QA 2G5TA 3GGCA 3HU5A 3OAAA 2JLYA 3PXUA 1X7GA 5G4LA 1AKEA 3EC1A 2P9GA 4L9AA 1NX9A 1PJLA 1I94B 2AWNA 3VSDA 1GV1A 2H8GA 3IMFA 1XWFA 2ILVA 1UKCA 3N2KA 1EWRA 1QGYA 1ZHFA 2OXRA 3QX3A 1S1MA 2P6OA 2QG9A 5ICGA 1KYIA 1RM0A 2HA5A 3GDGA 3ILSA 3FZYA 4LJLA 2OSVA 3OEEA 2WTUA 4LS3A 3EHDA 3GWGA 3FMFA 1NBMD 2HZBA 3RUAA 4J76A 3DZIA 1B1CA 3FDZA 3KJQA 1U94A 3QY9A 4XD2A 2Z1MA 4BRZA 3IS3A 1F8FA 5BSVA 3N7AA 1E5TA 1Y1TA 1Z2EA 4YJFA 4JYPA 3DWEX 2WZDA 4QVIA 4P3KA 1KTIA 3PYMA 1ZO8A 2PTGA 2YVQA 2EKLA 5D84A 4UQLA 4YJ2B 2ZVQX 3M6WA 4B5KA 3KQLA 5M3BA 5KX5B 2O8FB 2XCRB 1M6WA 4LJYA 1B2RA 1GA6A 3I3OA 3UAVA 4JI7B 3I76A 1Q7CA 1C7ZA 4JIGA 2ACVA 1W88B 4GX5A 4HCJA 3A0UA 4W9NC 1WB9A 1MAWA 1QBGA 5T4HA 4EYGA 4YP1A 4AZSA 4KH1A 1C9MA 1KZ6A 2P6PA 4C0HA 4OYYA 5LZ9A 2JI9A 5CCXA 1N33B 3TQSA 2QL9A 1ODKA 1UBFA 1YZQA 4OB7A 1ZGGA 3G2OA 4M37A 2YHBA 1P2GA 1ZGHA 4GI5A 4W82A 4WZAB 3W9BA 2XGSA 4MVWA 5D2CA 2WK1A 2PYDA 3WLLA 1F2TA 1TJ4A 5TS2A 1D1SA 3IT2A 4EJFA 4WNIA 4K03A 4F5WA 1Y9EA 2XT0A 4G65A 4OLHA 4PCUA 1PVVA 1AM4D 3GDHA 3TBKA 2J0SA 2HA4A 2XZOA 2Q41A 4JJGA 4XIYA 3D1LA 3I12A 3TRDA 3H8VA 1G3QA 4L2IA 3RB8A 4MV9A 2VJQA 4I5EA 4RDCA 4K6CA 3AI7A 2OTCA 3M6VA 1KMMA 2A5FA 1NJ1A 2CCGA 1QGDA 2OORC 2MU1A 2X2OA 1RLTA 3DR3A 2HM7A 4LEIA 5K05A 1ZZGA 5DW0A 2YJZA 1GUZA 4ZQGA 2IHVA 3AJRA 3O8NA 1CZKA 1HQDA 1F6WA 1ZN2A 4KE7A 1CJKC 3DWIA 4HGYA 3U0VA 4E0BA 1R0SA 4F4UA 3HABA 2ZIZA 1RC0A 3HLKA 2SHKA 2BW0A 2IOYA 3E8MA 3KYDB 4RIHA 1DRWA 1LB1B 1OI3A 4MW9A 1DKQA 4FXPA 3K5PA 3DUFA 3KUXA 2QBYA 3UXEA 4RNCA 1KK2A 1W44A 2G9UA 4U3JA 2EBWA 2HJ9A 3ZVRA 2AJLI 1I1NA 3CSDA 3RUCA 5JV5A 3Q5DA 3MQFA 4OGKA 2EX0A 4RD2A 3C8DA 1U4SA 2X2PA 4V0NA 3RFVA 3DE0X 4DG9A 1V2GA 4RXUA 5C4IA 2CNLA 2IU6A 4O4JF 4PZCA 5AI8A 1R88A 3TM4A 3S55A 2P4EA 2XSZD 1BOOA 1X39A 4G3XA 3ELWA 4GLBA 4J7AA 4LC0A 4E6EA 1OFVA 3A6EA 1T6XA 4HXEB 4KAJA 1GYPA 2VJCA 5FR1A 1D0SA 1ZOLA 4A27A 1GPWB 2O8NA 1PI3A 1WWKA 3CUSA 1PR2A 3AF4A 3F9CA 1RKBA 2PX8A 3IUQA 3JX9A 1KAGA 2O6HA 2I2BA 1OFGA 2QP4A 1GKUB 5K3OA 1II9A 4JI8B 1ECCA 1IBSA 3OJEA 3E9NA 3QGMA 4R40A 2XYRA 2WG0A 1SCQA 3L8MA 2Q45A 3ID6C 1NSTA 4AYTA 3ZWAA 1QS0B 3CVJA 5IH7A 3D3QA 3RRXA 2AD5A 2QVCA 2VCYA 3E8XA 1Z29A 3X43A 1HZJA 1ZGBA 2I80A 1TU4A 1KNXA 1MJGA 3HJUA 2EEPA 3MYYA 4BO4A 4EG1A 4KOAA 1DG9A 2REQB 4C30A 1Q1QA 1JWAB 3IO3A 4WKGA 2WU0A 3VX3A 1C9EA 2Y4OA 2BFNA 3KOWA 1ULBA 2G25A 3N53A 2RH9B 3VNRA 3VPXA 5C9ZA 3BQMB 2XTJA 4V2IA 3JQ7A 3ZC3A 3AHFA 2D8MA 1VCIA 3C1AA 3ZI0A 1XL0A 4B6SA 1MZVA 5I9MA 3F2IA 1GUFA 2X77A 1CWUA 2ZUCA 4NU8X 3VR5H 4A6XA 3A1EA 3U19A 1T9HA 3DFFA 1KHTA 2JD0A 4P86A 1JIJA 3RABA 3BM5A 3GRKA 4G8DA 1Y4SA 2YZ2A 3N8IA 4IIBA 4J3JA 4P22A 5A5FA 2P2ZA 2X5KO 4YV0A 4MYTA 1GD1O 2WWYA 1I3LA 2SKCA 4LDPA 1PVDA 3P0EA 2WMYA 1AKWA 2H4WA 5F77A 1J90A 4C0JA 1LRKA 1HRDA 1N2SA 5KYWA 3BSYA 3PHCA 4F5YA 1FU8A 5C51B 4ETWA 4URHA 5KNCA 3DB1A 5TT0A 3U1VA 3MWFA 3HB5X 4BNTA 3HA7A 2HK8A 4P7JA 2GXUA 1PFVA 1LVUA 4G1CA 2B2XA 4TL8A 4WH0A 3K31A 1T2FA 3OTHA 3HK2A 2FPIA 1ZUNA 1J0DA 2PBZA 1KXZA 5GGXA 2XKBA 4NULA 3DVAB 4UCXA 4LJRA 4HDMB 1DJQA 1P7CA 4MKIA 5ARBA 3W78A 4YXFA 3VR4D 4AP6A 5T3YA 2BGWA 4B3SB 1ZI6A 5EA2A 3OU2A 2HHAA 3EMBA 2FU5C 3ASYA 3EQ2A 3QP9A 4PZDA 4Q34A 5HF6A 3OCVA 2YVAA 5G2OA 3W5HA 5BQFA 2IEAA 4DV2B 1U99A 3AK4A 3GFGA 2RB4A 3N2NA 3K5HA 2RG7A 4FYYA 4OJTA 4XE5A 3UN1A 2BYTA 5K2OA 1IOLA 5K03A 3A6PC 3VU8A 3FTFA 2QSUA 3A4MA 3JQAA 1VHTA 3F5MA 3NAZA 5JVDB 5LNK6 3CINA 4JGIA 4I4LA 4D44A 2IBMA 5HX7A 1PFUA 2KHZA 2QRUA 2LGJA 3BZUA 2G8LA 3K72B 3DS8A 4GEKA 3ZHTA 4TVSA 3CF2A 5L7YA 5K6AA 4INPA 1P91A 2Z9CA 3I45A 4PCVA 1KP9A 2NVOA 2XJ9A 4YJHA 4BP9A 1KEUA 2H1IA 1E3MA 4NICA 3LUBA 3QKTA 5ICFA 3QE2A 4X1IB 1RC1A 1NNI1 4HDOB 3CNHA 2HLNA 3PENA 4QUBA 4AO7A 4UEWA 1OBVA 1EBFA 1OWNA 1DIBA 1RKXA 4RD6A 3O8CA 1QH1A 4Y3UA 3UHPA 3CUYA 3UBMA 4EHHA 3UUEA 3J80A 3DE2X 4X8HA 3EGWA 1SC1A 3QV1A 3U3KA 3TRFA 4L74A 2VQ3A 3QW2A 2D1SA 1SBIA 1YKGA 4TQ9A 3UB4A 3M2TA 3E3LA 3AWIA 2V7VA 3NDRA 4B82A 3T3DA 5KWIA 4HLNA 1IEVA 4OI2A 2D3WA 2GN2A 5L4SA 1UMKA 1C9YA 4L85A 1T5TA 2ZSAA 5G40A 1RRKA 2DU8A 4EMUA 3QVOA 5F35A 5MHTA 3GFFA 1WPGA 5AKYA 1A72A 1NV9A 5SV2A 1Q0TA 3WTBA 1PGOA 4E4YA 1T1RA 3FFAA 4QD3A 3NLLA 4RK7A 2AKAB 2EV9A 2ICAA 4UAVA 4D81A 4DA9A 3LW7A 1AOXA 1H1DA 3T0FA 1PS0A 2BCGY 3WGTA 5BW5A 3ORFA 3VNUA 2UYGA 2WSMA 3DR5A 3M49A 4CLOB 4RF3A 2XDAA 4NMHA 1T2UA 2DHEA 1JH9A 4A2PA 1NR7A 5JAPA 1QYCA 2ZS8A 2QUBA 4OFZA 4EG7A 1O6ZA 4RJLA 4D4KA 1T2EA 3BBLA 2GHTA 1S0UA 1U6IA 5CT6A 3BN3A 2B2CA 2QMZA 3K73O 1QFMA 1NXTA 4G85A 4O2LA 2NT3A 3F74A 3GL9A 4M8SA 3RC3A 2QVGA 1WZCA 4NKRA 2FR1A 4HYYA 2I62A 4TKLA 1E96A 3K4PA 3L8CA 5DM4A 4GYYA 3V1NA 4DPKA 5JMOA 1UMBA 4I5FA 1M1NB 4ZDIA 3GLKA 1D1PA 1G291 4TTSA 2PA0A 1CHDA 4PZPA 3GRYA 3T7TA 2OOSA 5GGYA 3B8HA 3TGLA 1UIRA 2QTVB 3BGOS 3UKDA 4KNYA 1V11A 1N9KA 1PRYA 4LE0A 1IN6A 1D4OA 1YASA 4IG9A 4U9HS 3AX6A 1X1QA 3U7HB 1E4EA 1PL6A 4RHFA 3ROXA 4F1WA 1Y33E 5B36A 1B74A 1ZU5A 1IFXA 1QO0D 1WU7A 2E1PA 3AOEA 3THWA 3AVUA 1YI1A 4OD0A 3WL5A 2O2IA 3A25A 2RHDA 1AX9A 1RP7A 2IPOA 2ZOSA 2WQ7A 3HFJA 4NPAA 2FR8C 1FX0A 2WIKA 1BGXT 1YR1A 4YH1A 4GVXA 5KNBH 1T8SA 3DHYA 1J8DA 2EYQA 3NPAA 4A2CA 2YS6A 4B9EA 4K6MA 3ZW8A 1IYZA 2YZMA 3NWEA 5E6SB 1H42A 3CF0A 4KRXA 4WACA 4S1PA 3ZU3A 5JCXA 2JJ2A 2LXNA 3TSYA 4X5OA 2E9SA 4MW7A 1GZ5A 4JYCA 2NLOA 3QPVA 4LPKA 5CEJA 4PFSA 4PYJA 3AM1A 5JFOA 2F64A 2PGNA 3ETLA 4WNAA 5DW3A 3QELA 5HS6A 3UZUA 4Z49A 2HU2A 1RADA 4G5XA 4KQCA 3MIIA 1IJKA 3VR6A 5FYDA 3EBOA 1QQ6A 3ELYA 3WO1A 2YUIA 1BA2A 3MWDB 4R8LA 1A9ZA 1HO3A 5BPFA 4M0EA 5BR7A 2PWAA 2GBIA 3HCWA 4AJ2A 4DREA 2AFRA 4KBFA 5HBGA 2Y27A 3E9CA 4XB2A 4ER6A 4MLZA 4J0DA 4HLUC 1JR3E 5JUWA 1JPNA 3N58A 1BX1A 1I7LA 1W29A 1G2IA 5JJCA 2C2ZA 2QZ9A 2Y76A 1P6XA 3NS7A 4V0LA 2FPXA 1K2WA 3QG5A 4JKYA 1ZSVA 4OGWA 5FWYB 2OE2A 4R4JA 5FPQA 4LF8B 4PF1A 1QVZA 5ES3A 1UR5A 5FXMA 3PHHA 4RDXA 3TBHA 5A3VA 1SNYA 4UUBA 3P9SA 2HPAA 3PXXA 3NTQA 3O9MA 1SK8A 2NADA 4G9GA 4BFUA 2VQFB 2WHYA 1Q1ZA 3ABQB 1KH3A 2XW6A 3KEOA 1D09A 1XEWX 1JLSA 2ZKIA 2ZSFA 3MCAA 3N6VA 1BRTA 5EKUA 2X4LA 1KQGA 1H93A 4J2OA 1UMCB 1N9GB 1BXRA 2A7XA 1CDZA 2YICA 1RAIA 2JLSA 2ZUVA 3ITKA 2RHJA 2RDMA 3COJA 2I29A 4ZK2A 4AJ1A 1FDWA 2ADFA 4NHEA 3HYLA 4I50F 1YRHA 4H35A 1U5CA 5JSHA 3HVHA 4WXYB 1O77A 1SC6A 3UBTA 3A2LA 3CLHA 3VPHA 3M33A 3UTDA 1FMFA 3VISA 1HTWA 1JXOA 2OCYC 4GX0A 4X61A 4EOGA 2WOOA 4JT8A 2YXBA 4CE6A 3FVTA 1C4KA 1NTRA 4P92A 4FONA 4BVBA 3WJAA 3MRTA 5LD2C 2OC9A 4GIBA 4KGXA 4RUKA 2AYYA 1Z6AA 2FSGA 3C6BA 4UMDA 1RI3A 4ENPA 1GN8A 3KWMA 3W2HA 1NF8A 2DBQA 4XW2A 1KY4A 3TI9A 3HP1A 3NRBA 2CFOA 1ZUIA 5E4YA 3OZSA 4KR7A 1RQLA 2CFTA 2FZKA 1UXHA 4ZOLF 5IK2A 2GD6A 2ZJZA 3D5QA 1KY5A 4FHDA 3T5BA 1QIFA 2G6TA 1IU9A 2BAGA 3LL4A 1O08A 3ICCA 1Q7TA 3EIOA 1TW2A 4RQTA 3U4DA 5J63A 1KZ7B 1L7DA 2BM9A 2F43A 3G2PA 1GTVA 4IF4A 4BNMA 3I5YA 1MV8A 1E3SA 2QX8A 2XCLA 3WA6A 1UFQA 3FOCA 1EB8A 4O3MA 1T15A 3BSWA 4G4GA 4A8PA 1IN7A 4EHKA 4HP8A 2FPIB 5JBQA 5LM3A 2FSPA 3MTIA 3NXKA 1C8VB 1N3YA 1EG7A 3GEPA 4HTAA 5IF3A 3ER6A 1JT2A 2CUKA 1AHPA 1V2HE 4F38A 4HDRB 1TQ2A 3B2EA 3NCTA 1JIIA 2XZPA 4ZVSA 5HQ3A 2N3ZA 2OUIA 2PHZA 5IW8A 1E1LA 1E1DA 3EQ6A 1MAHA 3T95A 1FDOA 1M6EX 2G1JA 1BWRA 4LYJA 2XVMA 1AJEA 3D2BA 1CYDA 1WZIA 2F17A 4GI7A 3E48A 2H1LA 2CXPA 1P4SA 1RIIA 3ZYCA 3W7VA 1OFHA 3DGFC 1RCFA 3DTVB 4MUBA 1DWPA 3NFRA 5JXJA 2AIRA 1YI8A 3ZXXA 3EIQA 4KB5A 3OQJA 3ZYZA 4F7WA 3QHQA 4GMDA 1D6SA 1TVCA 2P77A 3HA2A 2QTTA 4NQZA 3TIIA 3IPAA 4WOKA 5EJ7A 3OZBA 1JDSA 5LQNA 2JGLA 1U1FA 5CEFA 2ZRHA 3QIVA 2Q5HA 4RMIA 4EDFA 3QQPA 4YN3A 3UHOA 4BVGA 4L8YA 1XRNA 3KWFA 4BFTA 1ZJ5A 2XE7A 3ST7A 3MVEA 3Q7RA 3LF2A 2VWQA 4N5DA 4QGGA 4OAQA 4TQUS 4YI3A 2AZDA 3WWPA 4F9FA 1CUYA 1DJNA 3B1YA 1J22A 2PRIA 5C7OO 3IV9A 5F73A 2WDZA 2IZOA 1GRVA 4I0WB 3SBDA 3VYWA 4CQMB 3S2EA 2PXAA 1FUKA 4RULA 4DV6B 1XROA 4LRUA 2GSWA 3OOWA 3V8QA 4URXR 2X0JA 1RACA 1FFAA 3JWPA 4KGDA 3D6MA 5IVIA 2PKRA 1JDBC 1QO9A 2CEKA 5EMLA 1WDTA 2QM7A 3E05A 1QVVA 2NO5A 4WK0B 4IXTA 2R66A 2P90A 4PGMA 3UK6A 4N18A 4UXJA 1F7VA 1QX3A 2W6NA 4NCIA 4QULA 4XGNA 1V95A 3G2QA 2OGTA 2AZ4A 3DSRA 2AEEA 1Z8HA 4EA9A 4UULA 1XDDA 2BGTA 3GI1A 4JVLA 4DEYA 4HAIA 4K1XA 1BH6A 3K0FB 5TB5A 3FJYA 4BL5A 4QBIA 1Z2DA 4EUKA 1BMQA 2XB4A 4L4YA 4XYEA 1KBZA 1V35A 2HGZA 2IOQA 2Y4NA 3CR7A 3PR2B 1FZTA 4LHZA 2QDKA 1N6OA 4QJBA 5FNZA 2F7SA 3PHGA 2BGMA 1I1OA 1BW9A 1GTMA 1MW9X 3EVEA 4JJ4A 5DFAA 2PUGA 2IOHA 5ADVA 2PBFA 2QM8A 2LWIA 3RLFA 3VI3B 1W85B 3UGTA 4EHBA 1Y8ZA 4ZO4A 4PGHA 4QU8A 2HA6A 4NONA 5EIEA 2O3SA 4DTCA 3RSGA 4BFWA 1GFWA 2XOKD 1RJGA 3CGGA 2L17A 3ER8A 4GKJB 1ANKA 2G9ZA 4ZHQA 3OTWA 4FHCA 2ECPA 2D06A 2DFVA 2JHAA 3FR7A 4JJ6A 3ADDA 1I9GA 2FJUA 3ZXIA 2AF4C 5EESA 4CM4B 4KN5A 4L8FA 3FXAA 4URYR 3ZCRA 1XTSA 2VF7A 3LHFA 4JBYA 3R7WA 1DCTA 1G5QA 3E5RA 3F3MA 1TXGA 2NUPA 1E4EB 1OFIA 5EP2A 3SF8B 4KQ1A 3MFQA 1QVAA 1RWMA 2B9VA 4M9SA 5CGQB 4DIKA 1QP7A 4LRTB 4V0ME 1Q0RA 2I66A 5F1PA 4A2QA 5BNIA 1RXYA 1UT5A 3MT0A 1JDUA 2YV4A 3BXZA 3ONWA 4MS4A 3RDPA 1UCFA 4TSFA 1GQYA 1QTIA 2L82A 4X60A 3TCKA 2IXAA 2HF7A 2JKVA 4XVQA 5DP2A 3WICA 3UWKA 2IUUA 3VPGA 4DAEA 5B1YA 2I6SA 2O8BA 1PNOA 2F1HA 3D8BA 3H3XA 5G1OA 1KYYA 2WT9A 3R6WA 5HGXA 2BFFB 5FI3A 2O8CB 2QVLA 3M9WA 2ZAGA 3H84A 3MRSA 2HV9A 3JARB 1T8WA 1O95C 1IM2A 4CF4A 2J09A 3PNVA 1Q74A 1YSCA 2E18A 4P5PA 5JD3A 3TL3A 4U2KA 4DM4A 1U02A 3EA0A 2I78A 4EO7A 2RAUA 4UDOA 3LZCA 4ITVA 1PDVA 4ZI5A 3IPYA 4YAFA 1E60A 3T94A 2I7DA 2OP0A 3EPPA 4N7MA 2C3PA 5CHEA 2XLBA 4CIVA 1J0EA 3LUDA 2W83A 3MT7A 3RIGA 2WPDD 2ZYHA 2PRJA 4LY0A 3N2GA 1A7UA 1NPDA 4FU0A 5EJMA 2I33A 1RYFA 2PGLA 4YV2A 3RTDA 1OX4B 2PZLA 1WRBA 1ACLA 2PMBA 3UT5A 1WSDA 2IXGA 1EWQA 1PS9A 4QNRA 2C9YA 3AFOA 4EA6A 3CZCA 2PZBA 2IQ5A 3KLNA 4MDYA 3FKSD 3AQ4A 2ZJ2A 1KYWA 4JVOA 2Q2WA 2XD4A 2FQQA 1RZVA 3FLBA 2XKAA 2E6KA 4W1SA 1GCAA 2OHIA 5AXBA 1N3LA 1WUYA 1RXUA 3DGEC 1ZGJA 3I4CA 4HXFB 4KIJA 4CL0A 1KAQA 2PTHA 3QV2A 2Z2IA 3PFIA 3OETA 1CFJA 2C9MA 4RO0A 4NYIR 1EJ0A 4MJ3A 2YJ6A 3B70A 3OCWA 1WHSA 2YXDA 2Z0MA 3OEED 3GW8A 2UUCB 5CUQA 4P35A 2BTQB 2AH5A 2YOFA 1QOQB 4GPAA 2DXIA 2HL6A 3OURA 4MI6A 2I4TA 4XGRA 5FOWA 5E6UA 3RARA 4KXQA 1PNQA 2OZKA 2QLNA 1P29A 2J07A 1KFBB 4X54A 2Z6UA 1JRLA 1DHTA 4O0LA 2O8EA 4UXIA 1KIMA 4DUGA 5KPJA 4RK4A 3LE8A 3DKPA 4AULA 2IS2A 10MHA 4Y2SA 2FZVA 1IBCA 1QFXA 1SFRA 3FCSB 4Y9DA 2FEMA 4FGWA 5FBRB 1X7ZA 1QYRA 1R0KA 2C2XA 3COVA 3W7AA 1Y6GA 4YMVA 3O73A 4BQPA 3S2YA 1M8GA 1YACA 4HD8A 1IK4A 3A4IA 2Z95A 2WJ6A 2GTHA 2HY7A 1LZKA 3NGXA 1KOLA 2PWBA 1P74A 5EPUA 4BX9A 1OFTA 3WLJA 1KKLA 4RHCA 4I66A 2YZNA 3FDJA 5IZCA 5BNFA 5U1PA 2BMDA 3LH5A 3O95A 2YHUA 1VZ2A 2YRXA 4LJ6A 2Q3FA 1IB6A 5ERGB 4EUSA 5L7TA 3C3WA 1LDEA 4DR4B 2YQ5A 3QWIA 1I4LD 2DC1A 1RM5A 3AHDA 3D31A 3MM4A 3GLFB 4BJ1A 3KYJB 4JUFA 1U8XX 5EINA 2AFIE 3ILHA 1KYTA 3MCVA 2VBFA 1CXZA 2MIIA 3KOYA 3A1FA 3DLCA 4YEDA 5LCXA 4C4YA 5ICEA 5GINE 2AS0A 2QLTA 4NNJA 3HWSA 1CVIA 4H1WA 1MAUA 2B37A 1XQXA 4F1KA 5JROA 1X80B 2O7QA 3GJ7A 3UPTA 2GXAA 4M6WA 1CY1A 4V1CI 2G7MC 3G9UA 3AUYA 1HWYA 3ETCA 2F3TA 3FFXA 3KAJA 4GWLA 4LV5B 3GFQA 1D2RA 4NCNA 5JPIA 6LDHA 4YDQA 3IP3A 4I2NA 3NASA 1PEAA 3A32A 3BXXA 3D8TA 5EYPB 2A33A 1L7RA 4NHOA 5I7EA 3K4QA 5K3DA 1PV1A 2G0TA 1Z16A 3O8DA 4B4WA 5ALUA 1Z06A 5FUVA 4KK3A 2WWHA 5FOTA 3LHIA 5D6OA 4C0XA 4DQKA 3UMCA 1JU9A 5EIOA 5HK9A 2VSYA 3C3XA 4HAWA 5EHQA 1TT5A 5EY5B 4ZC8A 3J7AC 2PVPA 3NNSA 4FGKA 2B5OA 4K5QA 3R24A 3EWAA 1CS0A 2Q2OA 1J5XA 4DLBA 3L7KA 4IDBA 2GKGA 2Q6VA 1GNTA 4PWZA 3SNKA 2HCJB 1RXWA 3H0KA 4CG3A 3BMXA 3DPIA 1X13A 2CXTA 1Y5LA 1V6SA 1XFAA 3PE6A 5F9MA 3ROQA 3Q3EA 4K8OA 4U2FA 5EZYB 2PH7A 1XA4A 1ZUD1 2EHJA 2OV3A 3QM1A 1TYAE 1Y48E 5LYJB 1EXMA 1ZJ6A 1UC5B 2EFCB 2XZTA 1WCYA 1Z0IA 3MWEA 3MTBA 4KIUA 4MVJG 1EVYA 2WWVD 1RBQA 1X1RA 5EOVA 1BE6A 3JD2A 4YWHA 1YJCA 1QTRA 3W8RA 1Q22A 3N75A 3OZ7A 2E4YA 3OLCX 5AP9A 1CUWA 2V96A 2WFLB 1FP7A 3GIWA 1B0UA 2X3FA 3R3ZA 4YJFB 4WKPA 2CMGA 3AVTA 3THXB 1O5TA 1IY1A 5DGTA 4TMVA 1SQGA 4BWGA 1A27A 3IJRA 1WNFA 1EFHA 1DC4A 1KK0A 4JVMA 4Z7OB 3RVDA 4X65B 1CU1A 1TECE 3E9DA 4JSTA 1YVRA 2G3YA 4CL8A 3CEHA 3O93A 1T2VA 2JFNA 5BXQC 2C9BA 1KDTA 1RT9A 2QMUA 3BRSA 2JC3A 4ZHSA 3K1AB 3WKDA 2XHZA 1EXVA 3V4SA 1W8DA 2BUCA 2I4RA 3C8HA 1K8QA 2IJGX 5BWBA 2JFWA 2UU9B 1K2VN 1ZIYA 1XYVA 4FNOA 1SUFA 3VR4A 1LF5A 3H99A 2GFQA 1J70A 4R1UA 2XY4A 3NYIA 4K2AA 1X6VA 2XAUA 2JJMA 3H0CA 3PDHA 5B7NA 3TE7A 3R5TA 4DUYB 2OVFA 3FTCA 3Q3GE 2FF7A 3M89A 4NE9A 3KL2A 4BBZA 1N1DA 1KF0A 4AXXA 1QZXA 1CF9A 2PS9A 3GLHA 1UXJA 1Z5GA 2IYYA 4ZEMA 5I8PA 1G38A 1ONPA 2R1TB 3ZCTA 3HRKA 4Z0HO 5BNWA 2QD3A 4N82A 1OPXA 5DTRA 1H2BA 2N1MA 2YRFA 1P45A 2CC2A 3E81A 4Q1EA 2QTVA 4MKRA 3TAXA 3OE7A 2RHTA 5GONA 1SUAA 2H65A 5IXYA 2PQ0A 2HK7A 1SCDA 2QRVA 3PFBA 2X0DA 4D1YA 3USZA 3VC1A 5BQOA 2PGIA 3PQ5A 4QPDA 3N2LA 4RABA 5EEHA 3UEOA 4AI6A 3V8BA 4U6NA 5LMNB 4ZZ1A 2BMFA 4LVOA 2V97A 2FQWA 2PZJA 3GCGA 4HZUA 4Z2AA 2QM3A 1LGYA 4MQEB 1FTGA 2HRBA 3F2VA 2OAEA 3LPMA 2B94A 2KI5A 4BLTA 2C7RA 2GZSA 3T1HB 1Z6TA 3T7AA 1FSZA 3QE3A 3NBKA 5IJZA 4QEDA 3PD0A 3WWOA 2I2WA 2EXXA 3AXSA 5IKPA 4B7UA 3URMA 4DB4A 4GR5A 3HQ4O 4DB2A 4IHJF 4B17A 1SXPA 2I99A 4HGZA 4D9IA 1KBOA 1QK5A 1ZIXA 3W3AD 3ZBPA 1ORIA 2V7BA