3Q85A

Crystal structure of rem2 g-domain -gtp analog complex
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
169
structure length
149
Chain Sequence
GVFKVMLVGESGVGKSTLAGTFGGLDTYERRIMVDKEEVTLIVYDIWEQDHCLQTGDAFLIVFSVTDRRSFSKVPETLLRLRAGRPHHDLPVILVGNKSDLARSREVSLEEGRHLAGTLSCKHIETSAALHHNTRELFEGAVRQIRLRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords GTP-binding protein REM 2
publication title RGK Family G-Domain:GTP Analog Complex Structures and Nucleotide-Binding Properties.
pubmed doi rcsb
source organism Mus musculus
total genus 53
structure length 149
sequence length 169
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3q85A00
4NMMA 3B2EA 1U2RA 4IFBA 3KZ1E 2EFCB 3RDPA 3BIFA 4JJZA 5JBQA 4AKIA 5AWFC 3K9GA 3LX8A 1PLKA 721PA 1TADA 3LO5A 3A36A 1J8YF 4B34A 4J0QA 4CT4B 3KXKA 1CJMA 3H4MA 1VMAA 4LI0A 1KDTA 3R9IA 1E2FA 5EP2A 3TMKA 1M74A 5KYKA 2VTKA 3THYB 1LTQA 1BOFA 3OAAD 4GI7A 2QE7D 3VKHA 1WXQA 2JLZA 2F9MA 2YWHA 3AVOA 3EZ9A 4ZDWA 2GCOB 2MSEB 2ZI7A 1VHLA 1N5KA 2OCPA 1VECA 1KMHB 1OF1A 4B33A 3X1YA 4EPTA 4MKHA 3W5IA 5KSZA 2IL1A 1RYFA 3BB4A 1WQ1R 3FKQA 3GJ4A 1R0ZA 1HQCA 5E7IA 4B32A 1XTIA 1AS2A 4LBWA 1ZU5A 2Z0MA 3QENA 4QM6A 3D8BA 4EFLA 1HA3A 4BRWA 1FMJA 4QBFA 5FOUA 4TLAA 4CEHB 3SOPA 2FFBA 1HQYE 1ZM7A 2YV5A 4LJYA 5JJKA 2X8AA 4FD2A 1Z0AA 2HDNB 1J99A 4RZXA 2R6DA 2ZETA 5FTNA 2C78A 2C9OA 4MGIR 4H1UA 4XWKA 4ZPXA 1YZNA 5JMTA 1VCOA 1W4BA 4G0NA 2WWFA 4QGAA 2NGRA 3KKOA 1II0A 3L43A 3AP2A 2F1HA 3GLFE 2WKRA 3IGFA 1MV5A 4PSAA 4IOKA 4MDFA 3VNVA 2X77A 3RANA 1JB1A 2B7BA 1II8B 1KO5A 1CTQA 1QVAA 2CE2X 3VR6A 3GLGA 1W0JA 3QSYA 4A82A 2Q9AA 3ZH9B 1XMSA 2GILA 2QMUA 1R6BX 3A4LA 5L3QA 1E6CA 2NG1A 3PEYA 4TL8A 2ZS7A 1S1CA 3PITA 4ZIRB 3T61A 3B6EA 5EE5B 1P2VA 2RGDA 2GXSA 3L0OA 4P4UA 4HZUB 2BC9A 3QJYA 1GSIA 3ZGXA 4TLDA 3DMDA 1G4AE 2J41A 1NVWQ 3WMFA 4OKSA 1P2TA 5JRJA 1M34E 2OILA 3A1VA 3DL0A 1Z0FA 3A8TA 3O8CA 2IW3A 5TV2A 1XEXA 5EP4A 1ZMXA 1E2GA 2LKCA 3T1TA 2IEZA 2ZSFA 3LWNA 1R8QA 4FCWA 3FYHA 3SJBA 3A6PC 3GJ7A 4A8JB 4YC7A 2A5DA 2WTUA 4K46A 2KSQA 4MKGA 4R9UC 4QC2A 1SVLA 4B76A 3UWOA 3G82C 2JLSA 3ZLJA 2C9YA 1KO4A 1T3SA 2PMKA 1LW7A 4NKRA 2R6CA 3IKJA 3SYKA 3TSOA 5CDFA 2N42A 1OHHA 1G6HA 4RKEA 5KPDA 3S1AB 1EWQA 2H8KA 1AGRA 2IUUA 1IJFA 5B57C 2ZRMA 3NIBA 4Y0VA 3ZZ0A 1KHTA 1G6OA 3PCRB 4Q1EA 4DIDA 4IDNA 4DCTA 1M8PA 2GK6A 1VG8A 2HCJB 2OXRA 4PAMA 3U5ZB 2ZU0C 4PQYA 2OM2A 3K9LA 4PHGA 4UKDA 2HT6A 4PPFA 2Q6TA 2RB4A 3MMPA 4JLBA 4PXAA 2AX4A 5KDDA 1OB5A 5DHAA 5DI9A 3VU9A 4DWJA 3OE7A 5HKKA 4ESHA 5SZIA 4DIEA 3QF4A 2V6IA 2CHGA 3QI2A 3W8NA 2QI9C 1EG7A 2JLQA 4BECA 4D0GA 4CVNA 4LX0A 2FG5A 1RYHA 2A5JA 4GPTA 3AVUA 3D7MA 4P4SA 2CE7A 1KOFA 5H8WA 3AM1A 2O0JA 3PJRA 2VA8A 4GRAA 2PMDA 1WDTA 4V0KA 1E79A 2GJKA 3BH6A 4V0OA 1D6JA 3L2OB 1ZNZA 4B35A 3V00A 521PA 3QY0A 4KODA 5E95A 1T3LA 1R10A 2UZIR 3AVQA 4DLSA 2ERXA 1SXJC 3PUXA 3O47A 4DJTA 2CLDX 2VL7A 2V54A 5C4GB 2HV8A 3SDZA 1BYIA 3HU3A 2QGNA 2YOFA 6Q21A 2J59A 1WBDA 3QKRB 2QPOA 3MWLA 3OAAA 1NKTA 2QE7A 3DKPA 1EFRD 3ZVNA 2PL3A 3DVLA 3TIFA 4DBLC 1BKDR 3D6TB 2AWNA 1N6IA 3HP1A 1C1YA 1GP2A 1MRSA 5GVSA 5F9FA 5DGXA 4DSUA 1EFTA 2ZM5A 3OF5A 5L3SA 3KJHA 4ZI2A 1Z3IX 2FSIA 4M0LA 5C46F 3HJNA 2EQBA 1N6KA 4PQRA 5JSZB 4L8GA 2QMOA 2ATXA 3MRSA 2BCGY 1E9RA 4ERNA 1SHKA 3CH5A 1KGDA 1PUIA 5JS7A 1G19A 1F60A 3KKNA 2YVUA 4FI3C 1FQKA 4W5JA 1AK2A 3O8DA 2E87A 2DWOA 4JT2A 3CM0A 5DHFA 2IS2A 2OBNA 4DVGA 1CJKC 1G7TA 1T3HA 2JGNA 2QRZA 3NC0C 4DLWA 1IY2A 3CX8A 5G41A 1OIXA 4KYIB 1KO1A 4LHZA 4MRRA 4F91B 4IDHA 1E32A 1W7AA 3A1SA 3THWB 2RCNA 2YC4C 2FOLA 3UMFA 2BBWA 5TY0A 4TWZA 4C4PA 4OQFA 2WWIA 3U61B 4G5GA 1Z6TA 3RS7A 1YZTA 2WMNB 2HF9A 5BWMA 1GL9B 4ZDJA 1C4OA 4Q4HA 1XEFA 4B75A 4Q9HA 1D2MA 5SZKB 4JKYA 5GADl 1TUEA 1RPZA 2WJVA 1YHNA 3CNNA 3K0AA 2EWVA 1ONBA 1DE0A 1VYUA 1X8LA 4OHWA 2D74A 4QHYA 2ZYUX 1TMKA 3KJIA 1Z22A 1J7KA 1NLYA 2Z6VA 1JR6A 4GP7A 4AI6A 3RNLA 4D4LA 1XTJA 4B2LA 3VR4A 1IXZA 2LKDA 3MCAA 2QL6A 1JBKA 1KSJA 2F6RA 3PUVA 2HJGA 4HB0A 2VP6A 4URUR 3HYTA 2O8FA 1TQ6A 4JMPA 4A15A 1G9XA 4EPYA 5CB8A 3NBZC 3DZ8A 1IN4A 3OFNA 2H5EA 3LX5A 2IYYA 1G3IA 1U94A 4LBVA 2JJ1D 3GP8A 1CR1A 4A0GA 4EPXA 1Z6YA 4TMZA 2HXSA 1JQJC 5DYIA 5C2JB 3BJIC 2ZITA 3BXZA 5KNDA 4Q4LA 1AIPA 4HSEA 1E9CA 4TLCA 3QXJA 2CHVA 2DWQA 4RD1A 5FBWB 3LLMA 2FF7A 4B6EA 2WPDD 1GG2A 1XXHA 4KVAA 2VP0A 4LJ6A 3GJ6A 4D2IA 1Z6XA 2REOA 3THYA 2BOVA 3I5YA 1XTKA 1E2QA 3QKTA 4Q1DA 2OE2A 2ZJYA 3K0CC 4FINA 3ADBA 2C98A 5EE9A 3Q5DA 4I99A 2AL7A 4HB3A 1E9AA 5KO2A 2MSDB 2GCOA 3I1FA 3AVTA 4GOXA 1FQJA 3IIKA 5HCIA 1RC8A 2F43B 1NIPA 1JJ7A 3MWYW 4KYUA 2QAGA 3R8CA 5ELXA 2JJ2D 1KNQA 3WRYC 1E2HA 2ZUBA 1AJEA 1KAOA 4EPVA 3U60B 3BRWD 4FMCF 1OLOA 1R5BA 1HV8A 4U02A 4NHOA 4C30A 2PX3A 4ABYA 3K70B 4M8NE 3B78A 4KI0A 1OE0A 5AUNB 2ERYA 3WYFA 2OAQ1 1AN0A 3RS3A 5F2EA 4E22A 4B3GA 4L5BA 4NZYA 3X1ZA 4XIGS 2B7CA 3C5CA 4LZZA 3IBYA 2H7VA 4LJAA 3FPAA 4TMTA 3UATA 4IOJA 1US8B 3RS5A 4MKFA 3SYLA 1OW3B 4LJ5A 4DSOA 5EJEA 3C16C 4CEJB 1XBTA 4XSGA 4DRZA 1M7HA 2RGGA 5HPYB 4F92B 2QBYA 3FMPB 4N0DA 3FFBA 5D3QA 4EKDA 2Z4RA 4BFVA 1S4QA 4GDFA 2KJQA 1JEDA 2CL7X 3KTAB 4IJMA 3TQCA 3ZS9A 1VCIA 1OT3A 1KNXA 2WJHA 2V1UA 4LYFA 4NYMR 4QHTA 1NVVR 1TQ2A 2F3TA 3QKSB 4XWAA 1S0UA 2W00A 3X1WA 3I8XA 5JS8A 3LW8A 1EWRA 2OLKA 3MG9A 4EJSB 2VHJA 2O8CB 2ORIA 3IBGA 3FMIA 1RJ9B 3FVQA 1KO7A 2ZRKA 2BJVA 2OBMA 3IILA 4AG6A 1VCNA 4CF7A 2XNDA 1P72A 1CLUA 2WWWA 2ODNA 1EFUA 3B1YA 3EIHA 2PZFA 4LUCA 4FMBB 3T12A 3I5XA 5LD2C 5FUXA 2G88A 3F8TA 4A4DA 4C0AC 1FNMA 1UEJA 5E4FA 1G7SA 3EPKA 1F2TA 4BEJA 1SXJE 1ZAKA 4LC0A 3VAAA 1LS6A 3BFVA 2BMJA 2IT1A 1NVUQ 1KSFX 3IPYA 2FFHA 2AK2A 2J3EA 3KJGA 2NPFA 1RRCA 1EESA 2J9RA 2ZE7A 2CNWD 4GZLA 3Q72A 3BGWA 4QBHA 4A6PA 1W2HA 1UKVY 4XJXA 4C0QC 2VP4A 3ASZA 4AIIA 2QG6A 1KZGB 3I72A 4Q66C 4OHXA 2ZAMA 3KL4A 1E2NA 1E0AA 1RIFA 4QOSA 1ZM3A 3KQUA 3VNUA 1Z8FA 4Z8XA 3ZD7A 1FZQA 4KFTA 1E2JA 1NSTA 1P9RA 5KSPA 3WXMA 1FTSA 1YRBA 4Q4JA 4PC2A 3NTUA 4GZMA 4DLXA 1RKBA 2OCAA 1KZ7B 3NWJA 3C5HA 1GL7A 5FPKA 2AD1A 2CVFA 3JZMA 2ZI3A 5JJIA 3KXLA 3FOZA 3PENA 3ZJYA 1NBME 4PZYA 1AKYA 1K6MA 4UNRA 5BW8A 3JVUA 3VMFA 4DUGD 1CF4A 4D0NA 2O8EA 2YWEA 3NC1C 1JQLB 1SKQA 5FR2A 3RC8A 1GKUB 4JVSB 1N5JA 2PT7A 4UJ3A 3UMRA 2J5XA 5D3MA 3R7WB 3PEWA 3B85A 4A36A 2ZSAA 2QORA 4P31A 3K09A 3CONA 1SVKA 1QHSA 3E5HA 1WRBA 2E9SA 2CCKA 5CK5A 4BWYA 4DDWA 1OB2A 3C41J 5BYJA 3QF7A 3TW4A 2VP9A 4OJQA 1TQ4A 2GXUA 5FBLB 3PV0A 4LV6A 2G83A 2WSMA 2WV9A 4Q47A 4HB4A 2OFWA 4AWXA 2WPDA 1ELOA 3WNCA 3Q9LA 1QVRA 3U2QA 1M1YE 1ZNWA 1Z0IA 1L7VC 1TX4B 1G291 4JT4A 1VG9B 5JWOA 2ZRDA 2P0EA 2ZSDA 4JLPA 1HY3A 3FKSA 1RRPA 5HZHA 3TVTA 4EDHA 2ONJA 3U7FB 2P6NA 4QKQA 1ZM4A 2ZJZA 4OI4A 3GLIE 4CEIA 5J47A 1KIMA 3PIRA 4GBMA 4I81A 5CM8B 1W46A 5JLJA 1YR8A 2R6GA 2QM8A 4KO8A 1GITA 1TU3A 2R6FA 2I3BA 4E5UA 2X1VA 4BFZA 4TZ6A 3RRZA 1IBRA 1IJEA 2F1RA 3UIEA 3LA6A 3UG6A 5DLQC 4FW9A 3HR7A 2XGJA 5DI3B 3QG5A 3T35A 2ZRPA 5KSOA 3CNOA 3AGQA 2QY9A 1EXMA 2J7PA 2ZU6A 3P4YA 3TSZA 2RGEA 3UXMA 3OEEA 3MJHA 1XWIA 3EARA 2ASEA 1TTTA 1GOTA 1QHXA 3BFKA 1RFLA 2AD5A 1OYWA 1LF0A 1S2MA 4C7OB 3TAHA 1FL9A 3HU2A 2O8BB 1JXMA 1N6HA 4HUQB 3AVXA 1FPMA 2ZAOA 2WKPA 4GP6A 3TQFA 4W7SA 2IS6A 2A9KA 3LQQA 1XF9A 2C2HA 3OHMA 1OJLA 4US2R 4HDCA 3CRRA 3DDCA 1ZC3A 4JS0A 3LNCA 4FWTA 1M7BA 4URZR 4UXJA 3AVYA 5DISB 2FJUA 2HF8A 5BN3A 4E07A 2JA1A 3K0EA 1AA9A 3AF1A 2P67A 4YMUA 5IK2D 5F98A 2YZ2A 3FMOB 4LYJA 2CK3A 2GJSA 1UBCA 1R5NA 5JFGA 3LLUA 2QUZA 3GJ0A 2ZRAA 4Q1BA 2WWGA 3KFXA 3FGNA 1ESMA 2OCYC 4KSBA 1KI1A 1WMSA 2FSGA 5JJLA 1MO5A 1CULC 4W9MC 4EAQA 3Q3JB 1N3BA 8OHMA 1YZQA 5LB4A 3RS4A 2ZRBA 5JZVA 4AYWA 4Z1MD 5ANRB 5G53C 3SQWA 2R44A 4PPGA 1LS1A 3LQRA 1NLZA 2BBTA 4ZDIA 4O2RA 4DCUA 4V02A 1ZIOA 3B9PA 2FH5B 1GRNA 4JZKA 2Q9BA 2WHXA 5JI2E 1G5PA 1U9IA 2G0TA 1AS0A 2OAP1 4RZ3A 1E1RD 2KWIA 5B64A 5DN6D 1U90A 1OXSC 3BWDD 5IHPA 1AM4D 4M2LA 3MGCA 1DAFA 4KU4A 3TJZA 4CGZA 2GF9A 1EX6A 3GEEA 4GSYA 5FPYA 1IN5A 2H57A 2EYQA 3U3MA 3W34A 4DUGA 1ZD1A 1IY1A 4QGGA 1YVDA 5E3HA 2A3RA 4IKEA 2IYLD 1G8FA 3TW8B 3N5CA 3VX3A 5FTMA 2QP4A 3HWSA 4UXHA 1FUKA 4YMVA 4HDOB 2Z4SA 2QRNA 4B2IA 1DAEA 3CRQA 3LFUA 4QBIA 3T1OA 5TARA 1M7GA 4H9GA 1JPNA 4RKFA 1W4RA 1UJ2A 1G20E 1DADA 1US8A 2GKSA 4DEXA 3GLGE 1JNYA 4DZZA 2X19A 4TSFD 2NO6A 2GCNA 3GJ8A 3GLHE 2BV3A 2V6JA 2NQ2C 3L0IB 1G7CA 3SNHA 5J40A 4HAXA 1A82A 2ZYTX 3ZIAD 1DTSA 1K5GA 2AXPA 4G5SA 3V9PA 2KE5A 3LBIA 1UFQA 2ANBA 3BE4A 1YU9A 3CR8A 621PA 3THOA 1G4UR 4ZCMA 4IXNA 3GCGA 1N0UA 3IUYA 2YOHA 1G18A 1IY0A 3SU8A 4TYWA 4QNMA 1KI6A 4M1MA 4LRWA 1C9KA 3W9YA 3EPJA 3RVBA 3ND8A 1G64A 2QAGC 4JL6A 1J2JA 4AKHA 4MRNA 1MABA 2C9CA 1NN0A 1QBKC 5AJWA 4LBYA 3U3KA 5TB5A 4ILEA 5K8LA 2AK3A 3G0HA 3EZ7A 2ATVA 1MO6A 4OK6A 4ZDKA 2JIZD 2GEVA 1D9XA 3A1TA 3B1VA 1CJVC 2IXGA 1XEWX 4C9BA 5CDFE 4YMWA 1Q3HA 2FU5C 3L0PA 4B47A 1N2CE 4IEIA 4Q1FA 4F4CA 3GFOA 3QEOA 1LFDB 1YZGA 1OXTA 821PA 1AQYA 4DT1A 4QJ3A 4AY2A 1RVDA 1E9BA 4LJ8A 3W8RA 1NG1A 2FX3A 2V7QD 1MKYA 2W6JD 2WJJA 4Q1CA 5GJCA 4OI1A 3T1QA 2BHRA 3I92A 2FZLA 3IQXA 2CL0X 1D2EA 2ODBA 3KB1A 3QPWA 4Q7MB 5FUYA 3ICQB 2H1LA 3U44A 4ACAA 1VHTA 1S96A 4BFTA 3ASYA 1GDDA 2JJ8A 3AKYA 3QE0A 4JLKA 1G1MA 2WZQA 1X8JA 2LWIA 4QGFA 2GZDA 3PG5A 2Q3FA 1QHHA 2DPXA 2QSYA 2XSZA 4A0HA 5JI3E 2V8OA 2I1QA 1P4SA 3W6OA 4EUNA 4Z8YA 4CRWB 3HR8A 2NOAA 4Q9IA 4NCJA 1W36C 3AVVA 4XH9B 4OJKA 2JLXA 2GNOA 3LXXA 4H1VA 1PUJA 2IUSA 1E2EA 1TU4A 1Z28A 2W83A 4MYHA 1RE0A 1IXSB 4LYHA 1DO2A 5FOVA 3EA5A 2R8RA 3CRMA 2PJRA 3BK7A 4D0LB 4IDOA 1ZRHA 4P0TA 4C2TA 4MRVA 3K0FA 3KKPA 4D26A 3B1ZA 4NYMQ 1NVVQ 1MRNA 221PA 2AKYA 2Y8EA 2G0NA 4FMDB 2H18A 1OPXA 4WZAE 5DO9A 4PC6A 3T34A 3TGPA 4DLUA 1A1VA 2ZQ5A 2OLJA 3TK1A 1EFCA 2O8DA 4JVLA 4M1SA 1GRQA 4Q00A 1E1QA 3ZQJA 3SQXA 2XX3A 1P73A 2VP5A 2BWJA 4YXWA 4JYBA 1OH6A 1Q57A 2DFLA 1QHGA 1U98A 5CJPA 4PO9A 2BMEA 3P27A 1GM5A 2R6AA 4LV8B 1Y3AA 2J0VA 1OYYA 1LNZA 1KI3A 4UQOA 1NMZA 2QEQA 3IHWA 2CJWB 1T9HA 2AWOA 4Q7KA 1SKYE 3FWYA 5HE9A 1TQDA 3V4RA 5DNYB 2GK7A 2VF7A 3HPRA 2XNSA 1XPUA 2GEUA 2WIAA 5EXPA 3GEHA 2CL6X 2FFAA 2VEDA 3AF0A 3CPJB 3K09C 1O87A 3I8SA 3TH5A 2IYVA 1OKKA 3SEAA 1P62B 5C18A 3NBFA 2PLRA 3C4JA 5JHGB 1D5CA 4L16A 4AYTA 2Z43A 2P2LA 1B0UA 1X3SA 4GT1A 1DPFA 2NZ8A 2XB4A 3RAPR 5B58C 3ZIAA 4WIAA 3GEIA 1JR3D 2AHOA 2VHTA 2CDNA 1G3RA 3C7KA 5G3YA 2J0UB 2IWRA 4FN5A 2RMKA 1XZPA 2Q3MA 5CIQA 4A0RA 2GZAA 5K8TA 3GLFA 2ZRFA 3QXHA 4LOAA 4AYXA 2PEZA 1KKMA 2WWHA 2B8WA 3U4QA 2XZLA 2OG2A 1XNJA 3QQ5A 1N6LA 4C3ZA 4D82A 4MYCA 3X1DA 2C77A 1G3UA 4LBZA 3O8RA 4BFUA 1NN1A 2EWWA 3TBKA 4MKIA 5KNBA 2P6RA 4RD0A 3M1IA 4L15A 1BO6A 1OXVA 1VG1A 1OXXK 2O52A 4HAWA 4HLQB 1CEEA 3ND9A 4OHYA 4C0BA 2JIZA 2WAXA 1F3OA 3LXRA 1HT1E 1NP6A 5EZ6B 1NY5A 2YWGA 1XD2B 1QDEA 4QG7A 2O0KA 1NIJA 3MAAC 1SXJB 4NL4H 2BBSA 5LBIA 1Z2CA 1NRJB 2V7QA 2W6JA 4TT3D 5CYPA 2ZIAA 3NKVA 4B43A 1AS3A 4OK3A 1YZKA 4NH0A 4XTRA 4O25A 2EW1A 3LVRE 1P7CA 5JEEA 2PT5A 2HEIA 1TPZA 4CT5A 3ICEA 2RGNA 2GXAA 3ZVLA 2ZJOA 4RFVA 3P4XA 1KJYA 2VSOA 4BUJA 1XCPA 2GEDA 1I4TD 2GHIA 5HCNA 2D4HA 1D2NA 2IX3A 4PFSA 2VHCA 2DFKB 1M2OB 3KUDA 2ZRLA 3AB3A 4TQUS 3KUCA 1CU1A 2WBLC 4LPKA 4YMTA 3EG5A 4IVPA 3QPVA 4RFSB 4AKEA 4PSKA 2LCFA 3SHWA 2DFTA 1FX0B 1NN5A 3THXA 4LV5B 1F48A 1G3QA 3LAWA 4UNPA 3Q8XB 3WNBA 4W5HA 5EXTA 5EE0A 1SVMA 4Q4AB 4G3XA 4QBGB 1ZCBA 2IHBA 3BB3A 4QL3A 4OI2A 4I1VA 4C2UA 2N1BA 1OIWA 3PQCA 1FUUA 3IQWA 3BB1A 1CRPA 2XTNA 3MUFA 1CR4A 1HT2E 3T5GA 4JSTA 4EFMA 4DEYA 2ZJ8A 3ADDA 4M1KA 1Q12A 1S3GA 1SVOA 1R0YA 2WSSD 5A0FA 1F2UB 4LJ4A 5EE3A 3U7EB 2GF0A 4U5XA 4NYJQ 2RH5A 2QTHA 3CPHA 1U9IC 4ESVA 3BBPA 4L4UA 2G1KA 3AVWA 2YJTD 2ZS8A 4URWR 5E7MA 4JVNA 4LJ7A 2PBRA 4DLRA 4BZQA 2XXAB 421PA 1Z29A 1DAKA 1U81A 1U8ZA 3GFTA 2FN4A 4KCGA 2GBLC 4W5WA 4PTLA 3VR2A 3K70C 1Q0UA 3CF0A 3GLIB 1X86B 4I1SA 2C03A 1KMHA 3KQHA 4L9SA 4F38A 1KYIA 5KU1A 3DPUA 1ZCAA 3Q7PA 2WKQA 2QNRA 2ZSBA 2EFHB 3ONWA 4DCVA 4ARZB 3FTQA 1SULA 1A4RA 4ZKDA 2V9PA 2PLFA 1R5OA 4R7ZA 3RRYA 1P9WA 5DSZA 1ZD9A 2QTVB 2PZEA 3DKVA 4PX9A 3IEVA 4CEHA 5E7JA 2ZR7A 1SXJD 4LDJA 121PA 1GNQA 2Q21A 1CJUC 1JR3A 4TTRA 1ZM9A 3BC1A 4DHEA 2WM9B 1UADA 5A4JA 2E1RA 4S2EA 1XX6A 4RY2A 4NE2A 4RZ2A 5H1YA 4DB2A 2ZYVX 3UKDA 5KNCA 4EQ6B 1Z47A 1VDZA 4QJ4A 4DLYA 4LYAA 5AJYA 2A5GA 3IO5A 2CMKA 1QHYA 4DKXA 3H0KA 4A92A 1N6NA 1Z5ZA 1FW6A 3Q5EA 1II8A 2YOGA 1EFRA 4HI0E 2VH5R 2VYFA 2FZ4A 5HE8A 3ETLA 4LHXA 1KI2A 5FBVB 5CLLA 4LY6A 4OL0A 3N70A 4ZIRA 2ZRJA 3AP1A 3KDSE 3PVSA 2HYIC 2GCPA 1CR0A 4HZUA 4TTPA 3LY5A 2ECKA 3HYRA 4MITA 3E2IA 1U0LA 3KX2A 1GNPA 5L8VA 1HE1C 1NBMD 2D7CA 5BN4A 1P6XA 4NYIQ 4KAXA 5AUOB 4I1OA 1FP7A 2REBA 4N3NA 5B2ZA 1MO3A 4ASUD 2HLDD 4TT3A 5FUVA 3P20A 4TLBA 5BYKA 4A8JA 1DAGA 4UXIA 5KDLA 2NMVA 2X2FA 4QM7A 4M9SA 1CBUA 2WJIA 4XOIA 2GWHA 4E09A 4HEJA 3U3OA 3V4FA 1Z6AA 1UBGA 2ZI5A 2GZHA 1P5ZB 3RLFA 4TL7A 4TQ9A 2IF0A 4A6XA 2UVQA 3MFYA 4PO1A 1WCV1 4NONA 3RSOA 4S35A 1VCMA 3EIEA 1P9NA 1ZIPA 3S1AA 2IBMA 3W6PA 2VPPA 3U6BA 1DOAA 3VR5A 4URXR 4PZZA 3D3QA 1ZBDA 2EFGA 2DY1A 4IFEA 3QUSA 2WIBA 2H17A 4Z54A 1Q1EA 1RRGA 2C95A 2NO7A 1DELA 3ZQ6A 1UKEA 3O8BA 2PJZA 5LD2B 3HPQA 2A7QA 4WZ6A 2GVDC 1A2BA 2GXQA 1IHUA 3B7GA 4LK2A 3ZZTA 4MUAA 3ADCA 1N5IA 4NTZA 5TMPA 1NN3A 5EUMA 2YWFA 4U00A 1PJRA 4JLJA 2NO0A 4P4TA 2W58A 1XDBA 2ZS9A 3CUEF 4PR0A 3K70D 4UNQA 1L8QA 1E0JA 1H8ED 3VKWA 1WA5A 5JECA 1FTNA 4RCYA 2P5SA 3E70C 4CZ2A 2OHFA 2G9NA 5J4KA 4TTQA 2JJ1A 1TAGA 3IO3A 3GLGB 2GTPA 2J0UA 4KBGA 4KLNA 3K8YA 3WNDA 3VR3A 1KY2A 3R8FA 3GLHB 3SJCA 3TR5A 5L3QB 4DSTA 2D7DA 4D4KA 5J5CA 4BLQA 2A78A 1SGWA 1Q22A 2RAPA 2VIIA 1X6VA 3FHTA 3VHXA 3U7HB 5EUQB 4Q9KA 5SZJA 4WXPA 2IHYA 3EZ2A 3QKRA 4KV9A 3RS0A 3NVAA 5EP1A 1DAIA 1NKSA 1WF3A 4HAZA 2ZJBA 2WICA 3FMFA 2BIFA 3MWKA 1TEVA 4TL6A 1FNNA 2GAOA 1E96A 1XEXB 1KK0A 4MGKR 3UG7A 3MD0A 5KSYA 2JJ2A 1KK3A 2D3WA 1W44A 1WBBA 4GL2A 2R62A 1YJ5A 5CITA 3NEJA 1KK2A 3JZAA 1VIYA 1A7JA 2KBEA 4O0MA 1DARA 2IYRA 4V03A 4NBSA 1SVWA 2WOOA 3QBTA 4YDHB 5JSZA 1KMQA 1W4CA 1MOZA 4MUBA 5AUQA 1SXJA 1WP9A 3IPXA 2ORVA 3KKMA 3NHAA 4KSCA 3PEUA 4B71A 1XTQA 5TXGA 4IEEA 3NEYA 4A0FA 4XVRA 2ZR0A 2XB2A 2AXNA 1W47A 3EZFA 1Z06A 1E0KA 2IEYA 4AC9A 1NNEA 3MLEA 3TLXA 1W1WA 3SBEA 4K81B 2NZJA 4IRUB 4JBXA 4XVQA 2Q0HA 1KAGA 2W2TA 3RRNA 4WW0A 3THWA 3VU9B 2WWXA 1D9ZA 4GNKA 4EFNA 2IYXA 3QF4B 3A4MA 1ZD8A 3VTKA 5DYGA 3F5FA 3QVUA 2DWPA 5JRZA 2PCJA 4RFSA 3SFZA 2ZE6A 1OFHA 4BRUA 1OXUA 2FV8A 4AURA 4P4SB 4IVQA 4AK9A 3KQLA 4HAUA 1T6NA 1HYQA 2QQEA 3VKGA 3NDPA 1UM8A 1OV4A 5FBRB 2DFNA 3M6AA 4D81A 2F1IA 3VX4A 3CO5A 3G5UA 4NYJR 2RKOA 4Q9JA 4LGMA 4QNRA 2IF2A 1G8YA 2EFDB 4NU0A 4QFMA 3WYAA 4JLNA 1G17A 1I2MA 3BD9A 4ASUA 1DO0A 4GMXA 3FHCB 4YDSA 1QHIA 4BLSA 1Y63A 3OIYA 5FPTA 2QMEA 3EW9A 5JEDA 2VO1A 5K8IA 3B5JA 1O3YA 3UK6A 3WMEA 2YC2C 1T0HB 4KFRA 2CNWA 5AR1A 5J4VA 3LBHA 4RD4A 4BASA 2RGNC 4C0KA 5GVRA 4Q03A 4N1AA 3WBJA 2IS4A 1G5TA 3EAQA 1XD8A 1T8TA 4IDPA 4V0LA 2FPLA 2DBYA 2QENA 4G5OA 4DDTA 5EXXA 1HTWA 3ADKA 3I62A 4PHFA 3B9QA 3CIOA 2NPIA 3CF6R 5L3SB 3A37A 4B3FX 1HUQA 1E9SA 1X1SA 2HUPA 2H16A 1XJ0A 3FFAA 1K5DA 2L0XA 2P3SA 4M1OA 2JEOA 3L82B 3L8ZA 4N0EA 1UAAA 1HH4A 1WE2A 1M6NA 4F7WA 1PZNA 1AKEA 2F43A 3BFXA 3H84A 4IDQA 1UBFA 1ZNYA 2IA5A 3AV0B 3BOSA 1I2DA 3QXCA 1WB9A 1SKYB 2ZANA 4DB4A 2DB3A 1E2KA 5C4MA 5KUTA 2IC5A 2J1LA 4PC3A 5DH9A 4MH0R 3CH4B 1TUIA 1XFAA 4BFXA 1NJGA 1UDXA 4G5QA 3U7GA 1YRAA 4M1TA 1K8RA 2PH1A 1Q1ZA 3UPUA 1PVOA 1N6RA 2DHRA 3FHOA 4B3CA 4QHSA 3ZVMA 1ZC4A 1XU4A 2BM1A 1ZM2A 4PHTA 1XMIA 1YE8A 3K0CA 2XJ4A 4QJ5A 5FOSA 4CEJA 1BIFA 3IEUA 4TYQA 1JPJA 4BLRA 5H70A 2BM0A 2ZUCA 4JLMA 1A2KC 1IM2A 1NL3A 4Q4HB 4WBSA 5DE3A 5EZ5A 2QQ0A 4NYIR 2MMGA 3LW7A 3K0AB 2W2VA 1CXZA 3C8UA 2ZI6A 3GFPA 4M22A 5FL7D 3KTAA 3W90A 3EIQA 5HKKD 3OIVA 3FDIA 3QXSA 3QKSA 4LSGA 4BFSA 3CWZA 4FCVA 2KBFA 4YLGA 2EYUA 1CS4C 1XD9A 3HU1A 4OQMA 4X8OA 4EJSA 2O8CA 1N0WA 1RJ9A 2ZJ2A 4M9XA 4WXRA 2IYQA 3WMGA 2F55A 5JCPA 2O8FB 4XSHA 2W0SA 1KK1A 4I4LA 4NDZA 5EP3A 2J7KA 2BMDA 3GJ5A 3TRFA 2X2EA 2BKEA 3TAUA 1E0SA 3UMSA 2XOKD 3WYGA 4C0LA 4DLZA 2IWHA 1CP2A 3ECCA 1L4YA 1SHZA 2PCLA 4XTCS 1XXHB 2YYZA 3MWJA 3QXXA 4JL8A 2BMFA 4ZI3A 3TUZC 2AN9A 1V43A 1FFHA 2DYKA 3DMNA 2WVJA 3LBNA 4QXAA 5TVKA 3SFVA 3CZQA 1G21E 3IDQA 1EX7A 2J46A 4LJ9A 4JVMA 4DC9A 1ODFA 2DCUA 2CCGA 1CKEA 2QT1A 4TL9A 1EGAA 4MDEA 2RGAA 3GMTA 3T1VA 2ZTSA 3SJZA 3VQTA 3C15C 4JBWA 1T5IA 1TF7A 3B60A 5FR1A 1Q20A 1RW4A 2B8TA 2QAGB 3R9WA 1NY6A 1EK0A 1W4AA 4XVUA 2ZROA 4BEBA 5P21A 4TYNA 3GJ3A 3TE6A 3J81k 1JALA 1PLJA 3RWOA 4BFYA 1LF5A 4TQAA 2ZR9A 3WRXC 1ZINA 1E4VA 2D2FA 4IOMA 1TNDA 4D6PA 5L3RA 5IK2A 4C0SA 3TR0A 3WHLA 1VKJA 4JYCA 3I73A 1KI4A 2QM7A 1JECA 4MRPA 4F4IA 4O2LA 5TDHA 4D80A 4G1UC 4WZBE 3R7WA 1W0KD 2JAQA 5AJVB 4A8JC 1KJWA 4G5RA 4BZXA 2QBYB 2VSFA 2C99A 2ORWA 4HUTA 5GJWC 4ZKEA 3NBYC 4Z1MA 3QBVA 3QOFA 1YZLA 5HTKA 1PV4A 3GLHA 2PX0A 3N2EA 1Z0KA 4OQNA 2VSXA 2OEPA 2A2ZA 4V0MA 3FB4A 4OK5A 4Q7JB 1F5NA 1P2UA 1Q44A 5DIFA 1YZUA 3OESA 4KLZA 4Q18A 4B3DA 4WVFA 1U8AA 3EX7C 4HAYA 4II7A 4A2PA 2A30A 1W49A 4KBFA 3SYNA 1Z08A 2IK8A 4LHVA 1MT0A 2ZYWX 3RS2A 2QP9X 4FMCB 4Z51A 1R4AA 1VG0B 3PFIA 5FI0B 1E9DA 3KFVA 4ZO4A 1PLLA 5FTJA 1E1RA 1FOEB 2ONKA 1YR7A 3CB4A 5DN6A 1II9A 1W36B 1XTRA 4TZ0A 2IYWA 2CLSA 2IYSA 1W5SA 1Q1QA 5IT5A 1F2TB 4HLUA 4PAQA 1W5TA 2J0QA 2OT3B 1GNRA 3LVQE 2JLYA 2ZRGA 3IIJA 3LD9A 2O0HA 5FTKA 3OIWA 5CK4A 1NJFA 1XTSA 2B6HA 3L8YA 1TL7C 2F1JA 4JLVA 2QMHA 3SI7A 3OFND 1NVXQ 4PPQA 3K9NA 1MO4A 1W48A 1XRJA 3AP3A 4ITRC 4BFWA 1YQTA 1U8YA 2JLWA 3Q85A 1R0XA 3AKEA 1G7RA 5DI3A 2J87A 3EPHA 1V5WA 4A9AA 1JAIA 3B13B 1B23P 4Q7LA 1COWD 2OSBA 1IQPA 1E2LA 2MSCB 4Q1AA 4R98A 2QPTA 1E9EA 4TSFA 1I4DD 5CB6A 2ZRNA 4C7OA 1U0JA 1T91A 4Y0AA 1KJZA 2O8BA 4HUQA 4M4SA 4Q4JB 2IXEA 4YQFA 3NHBA 2TMKA 1JAHA 1U99A 3SE0A 1E4YA 4AD8A 4HZIA 2G77B 1N25A 5FL7A 1QF9A 4WAUA 4JSYA 3ZDQA 4PC1A 4AG5A 1DVRA 3AGPA 1XZQA 1E9FA 3REGA 3W3AA 5IRCD 1GAJA 4F93B 3W6NA 3QPUA 2V4ZA 1OH7A 2IS1A 2ZRHA 5AJXA 2O8EB 5JHHB 1GIAA 2NTYC 3AF4A 2VLIA 4B73A 1LVGA 5D3MB 2F3RA 2F7SA 1ESNA 3H86A 3K53A 3DOEA 4PZLA 5LB2A 3CR7A 2OO7A 2VBCA 2GAAA 1T0JB 2CLCX 3KB2A 1P60A 2R65A 3AQ4A 2CHQA 2PZGA 5G3ZA 2XOKA 2PEYA 1E94E 4RCZA 2WWYA 3Q7QA 2FGJA 1CJTC 4RVCA 4A1FA 1ZP6A 4MQBA 4Q21A 1QG4A 2G1JA 4P33A 2FFQA 4HB2A 4B44A 5EXSA 1BYUA 4HLCA 1IOZA 4URYR 5FOXA 1CR2A 1D8TA 2AFHE 3EA0A 4JL5A 4B48A 2Q9CA 1XXHE 1N6OA 3WP0A 2D62A 2FEOA 2XITA 1ZJ6A 1IN6A 2Z5FA 3GPLA 4ZV4A 4PO8A 2XZOA 1GUAA 2ZE5A 1NMYA 5FL3A 4OYHA 4DLTA 2YKGA 3BORA 5IF9A 4UNNA 1Q21A 4IW3B 4CEIB 1KTVA 3AEZA 5FOTA 4OI0A 4YMSA 4TYPA 5FUWA 3A4NA 1TF2A 5JWHA 1F6BA 2H92A 4DDUA 3AKCA 2EVWX 2XNDD 2A5FA 4RJLA 1X1RA 4Q48A 4TMXA 4X8LA 4QGHA 3W3ZB 3F0TA 1KDPA 3A58B 1VYTA 4B74A 1W36D 3P1JA 1BMFD 2FWRA 3LH5A 3F3YA 4US1R 3QG1A 2FPMA 1XEWY 3PEVA 4BLTA 2WAYA 4P3YA 1JR3E 5FH9A 5JCZA 1BH2A 5G40A 3U3RA 4D25A 2XEXA 4DXAA 2FNAA 1Z2AA 1AZTA 3RSLA 4A2WA 1W0KA 5F3WB 5IDVA 3TKLA 1IAQA 2V55B 3SC3A 4BZPA 3NDBB 4CYMA 3R9XA 1ANKA 2GDJA 1OSNA 3RHFA 2DR3A 1OH5A 4JJKA 2HCBA 1OIVA 3I4LA 4TN1A 2ZI9A 3P32A 4NCIA 4ZCLA 2NIPA 3BAFA 4BLPA 5HR5A 2BJWA 3WHKA 2RGBA 3IHLA 3U6KA 4OQXA 2QAJA 5GJBA 3JVVA 1W2GA 1GKYA 2C8VA 2ZE8A 4BPBA 1OFIA 1DAMA 4X8HA 1BS1A 2QA5A 2YINC 4B2PA 4E03A 2VHQA 3CX7A 1G41A 3KXIA 5FPHA 1DG3A 4JLAA 2GJ8A 3OIUA 4D4JA 4LC1A 1GKIA 1VTKA 1ZUNB 2UZ3A 4YONB 4EPWA 1NF3A 2IUTA 1JJVA 1H65A 2JLUA 1G8GA 3QVVA 2V3CC 4BE7B 2WMOB 3H2YA 1Z63A 2XJ9A 3BERA 5GJVC 3A1UA 3AKDA 2W6ID 2R9VA 4HYYA 3CZPA 1GL6A 2G6BA 4KVGA 2OCBA 4BLOA 1P75A 3I32A 2JASA 4LHYA 4CW7A 1L4UA 4LHWA 2ZREA 5FPSA 5AK0A 3CF2A 4JKIA 3H1TA 3IIMA 5CLQA 1ZYUA 2QSZA 2QTFA 1OFUX 3ZZUA 1UEIA 4M53A 4A2QA 4F4JA 3KQKA 1COWA 5FOWA 3C14C 3NH6A 3PUWA 2ZUDA 1NMXA 4FXPA 2ZRIA 2Z83A 2AFIE 2ZSEA 1N5LA 4UNSA 3PXGA 4US0R 4AKGA 4MA4A 3OEHD 2VHUA 3X1XA 1MH1A 2VP2A 3FKSD 2JCSA 1G8HA 1XPOA 1XB2A 5J4YA 3A1WA 2MMCA 2C04A 5FFMA 4FMDF 2WJYA 4B3XA 1T4GA 3P26A 3T15A 2QPAA 1E69A 1E3MA 2XZPA 3DHWC 3PR1A 4R71A 4NCHA 5UKDA 1J8MF 2BKUA 4TMWA 1ZUIA 1OFTA 1S3SA 4DCNA 3K1JA 4EJSC 4B6FA 1JXOA 5KTYA 1XMJA 3VFDA 4HATA 1SVIA 2J7PD 4K8OA 3L0SA 4MGZR 3RWMB 3E1SA 3UANA 3TVDA 4RD2A 3RC3A 3OEED 4JBYA 4KJZA 4TYYA 1DG1G 1U0HC 2VF8A 2RGCA 5B30A 1G16A 3GJXC 3VR1A 3BS4A 2JDID 4M9QA 4IHQA 1ZW6A 3REFA 2C5LA 2ZI4A 1Z83A 3MJRA 1VIAA 3U3JA 1NSFA 3AF2A 3VHLB 4FCTA 5BN5A 4HAVA 2D2EA 4XD7D 2JLVA 1XJCA 2FMXA 1A5TA 2XTMA 3CWQA 1SQ5A 5KOYA 1P3JA 3K9HA 5EQTA 2FEMA 1P61B 2HYDA 3KJEA 4KHZA 3EWSA 1DAHA 1KI6B 4PHHA 2CVHA 3CLVA 2J0SA 2UKDA 3EASA 1KI7A 1QG2A 3AUXA 1MABB 3ZVRA 1GWNA 3BH7A 1NLFA 1YR6A 4OQLA 4D4MA 2I4IA 1N6PA 2CK3D 3NXSA 5LDDC 4ACBA 2GA8A 1BMFA 1E2IA 3CRW1 3NG1A 2ZJAA 3WP1B 2RHDA 5FTLA 2IYZA 3QKUA 2IYUA 1VYVA 1MR3F 2QT0A 5KPJA 1T5LA 1UDWA 3AF3A 4DSNA 3CPEA 2P6UA 2CBZA 2CJWA 1Z0DA 2W0MA 2KI5A 4ON9A 1TF5A 4I1UA 1LB1B 1UF9A 1UPTA 3BH0A 1YR9A 1Q1BA 1R8SA 4DT1B 1ZU4A 4V0NA 4GOJA 2ODWA 3DOFA 4HLDA 3EC1A 3TUIC 2BVNA 2QN6A 4DCSA 3K0SA 5KHOC 4LPSA 1R2QA 1AZSC 1AGPA 2BEKA 2XAUA 1GILA 1TEXA 3DEFA 3LDAA 2D06A 4M1YA 1IN8A 4HDQB 3SJAA 3U44B 1KDRA 3QEJA 4RZUA 5EE1A 1OH8A 1G8PA 3W5JA 1QZXA 2ZEJA 2NO1A 2AKAB 1S9DA 1E2PA 3PUYA 4OHVA 5L3VA 1R7RA 2WSSA 5BQ5A 1G3MA 2FPKA 4U7DA 3EPLA 1QHHB 1HURA 3CW2A 3DO6A 4TMKA 3UWKA 3CNLA 4PC7A 1S8FA 4TMVA 4PANA 2W6IA 1GFIA 3ZD6A 2FA9A 4R2HA 2FSFA 2ZRCA 4ZCIA 3EC2A 3CKLA 4HLUC 1KI9A 4Q19A 2HT1A 3SBDA 2QU8A 1H8HD 4RD6A 4Q01A 1ETUA 3GQBA 5BXQC 3EXAA 4WA7A 5H68A 2C96A 4M21A 5AUPB 3K0FB 1HE8B 1E99A 5AJZA 4GMDA 2YHSA 2V1XA 2AR7A 4KFUA 4NP6A 3NH9A 4FWIB 2YNMA 4UJ5A 4OBEA 3HDTA 4NCNA 4C0HA 1XD2A 1XMVA 2CXXA 5J4HA 2O8DB 1YKSA 1KKLA 3OEHA 4WOPA 2VRWA 1RRFA 4RD3A 1IN7A 3WBKA 3PUZA 2BCJQ 1J70A 1XJQA 4KXFB 2KB0A 1GZSA 3GD7A 1AQUA 4EPRA 2W2XA 3MSXA 4PSVA 4BGDA 2P65A 3SN6A 1ZUHA 2IXFA 3WY9A 4O3MA 2O5VA 2FE4A 4MRSA 5K8UA 3EWAA 1UKYA 5KDOA 2K5UA 1Z0JA 2XTZA 2G3YA 4KFSA 3I3SR 1GVNB 4CIDA 5J4LA 4GOKA 5CIWA 2GRJA 3NBXX 3AUYA 1FP6A 4BQSA 1XPRA 3AVPA 1KDOA 2R2AA 2CEAA 2Q3HA 2EU8A 4MYTA 1J90A 2RHMA 3B82A 5CYOA 3DM5A 4OHZA 2BDTA 1L2TA 3SR0A 1EFHA 4XWOA 1FX0A 2B21A 3LRPA 3SHFA 4LWZA 1T8UA 2JDIA 3CX6A 1KSHA 5CJ2A 1RZ3A 2GETA 3LV8A 1N0VC 1NBMA 1Q3TA 4IOLA 2HJVA 1E2DA 1Z6GA 1SZPA 4Q4AA 1GTVA 1CIPA 2GVZC 3OZXA 1ZVQA 4XD7A 1KSGA 3RABA 3SS8A 3X2SA 2HLDA 3CBQA 4CDGA 3GLFB 5FI1B 1NI3A 2ZVPX 2JLRA 3U4QB 1DS6A 2ZVQX 3TUJC 3RYTC 1XCGB 3KQNA 4DDVA 4R2IA 4M1WA 1GRRA 2HXYA 3D31A 1W0JD 4Q02A 5C1BA 4X8MA 4URVR 1F2UA 3B1WA 3FE2A 2XSZD 3TSWA 3M4YA 4P32A 4M9ZA 2GESA 2OFXA 1G5RA 3N2IA 1E2MA 3R20A 4MGYR 2EFEB 2ODEA 1SVSA 2CCJA 2XXAA 1UKZA 4Q5IA 3AH8A 4RSGA 2FGKA 3T06B 2ANCA 1QHNA 4Q9LA 3GLIA 5SZHB 2WOJA 4IXMA 2ZJ5A 4PAOA 2QGZA 3ZYCA 1KO8A 4NCKA 1IXRC 2B92A 3CRVA 1UBEA 2SHKA 4QRHA 3T5DA 3EZ6A 2ZPTX 2NO9A 2REXB 2N46A 4ARZA 3DZDA 3QNUA 4EIWA 3B1XA 1CRQA 4IVRA 4NPHA 2FSHA 2FDCA 3SZRA 2RGXA 1H8EA 5F9HA 2VQSA 4C0JA 2BBOA 4B3BA 1X8KA 1I4LD 1XCMA 4G01B 4PPNA 3RRMA 5CM9C 2OBLA 4JLDA 1E1QD 1JEEA 1JI0A 3B8HA 4PQFA 1OHHD 2J45A 3QIAA 1IONA 4YXWD 2I1VB 2WJGA 1FMLA 4KITB 4JLOA 3TNFA 4EQ6A 3M0EA 1DEKA 2OXCA 1KY3A 1Z07A 2JATA 2OV2A 5JWRA 1KI8A 2OZEA 2GBLA 1E98A 4GFDA 1HEIA 4JIMA 1XP8A 3I61A 4LCBA 1NG9A 1DBSA 2ZXUA 1LY1A 4MYUA 3THXB 4L9WA 3ZS8A 3OE7D 2GJ9A 1LV7A 1P2SA 1H8HA 1R0WA 1S1MA 2OFOA 2IYTA 3DM9B 4FIDA 5HZKA 2QZ4A 1OKKD 1ZNXA 1S9HA 2F9LA 4DLVA 2OESA 3KKQA 2QROA 5LPNA 1QRAA 5A5GA 2P5TB 4POAA 2QP3A 1VPLA 2GJAA 4TLEA 5M04A 1E79D 4V0ME 2OUKA 2A5YB 5FBQB 2BEJA
chains in the Genus database with same CATH superfamily
2UUOA 1T5SA 3H1GA 4HXGA 1E6UA 1A5BB 1L5QA 2EFCB 2FY8A 3BIFA 3GA7A 4XXHA 5DM2A 1GCGA 3HCFA 2W2LA 1PLKA 3LX8A 4FHEA 1BX3A 4MWTA 3LO5A 4QQFA 3IUMA 1F12A 2BY4A 1GR1A 2PA0A 1J6UA 4GQBA 4IIDA 3KXKA 4WCDA 4N47A 4CT4B 1EHIA 3E2MA 3GRAA 1JZQA 6ADHA 4PYJA 3P9XA 4MV4A 1KDTA 3FLEA 2C84A 4R8SA 3A9CA 1JBEA 3TMKA 2XZTA 1S8AA 2VTKA 5BV1A 3NWPA 4Z4GA 1BOFA 1QTNA 5ADHA 3FMVA 4QYIB 4Y30A 4GI7A 8MHTA 1NXWA 3WGTA 1SC4A 3JR7A 2JLZA 2OV4A 1KJQA 3AVOA 3EZ9A 3FNQA 4P3XA 4CMIA 3VJRA 7MHTA 3I58A 4FPXA 3O8LA 1VECA 4OP2A 1ZISA 3V9AA 4TGLA 5J2TB 4YH1A 1RLUA 1A50B 3SDBA 2V7PA 2OUIA 2J6BA 1F38A 1GZUA 1RYFA 2LV8A 2Q6LA 4ZPJA 4JGGA 2P9YA 2B7LA 3GJ4A 4YACA 1S2LA 1PS9A 4IY1A 5E7IA 1ZU5A 4GSKA 1ZI9A 1UQUA 2Z0MA 1NW6A 4JC5A 5AVJA 4EFLA 2ORED 1C9DB 1HA3A 1PV1A 4NQZA 4PLCA 1FMJA 4BRWA 3GGDA 3ABRB 3MT8A 4F1JA 1MG5A 1OFUA 1Q19A 2I6FA 1W8DA 4X61A 2JIPA 4MW2A 4NMXB 3WWEA 2DLCX 5JJKA 3VOAA 3L7OA 1IBKB 5AW9A 1J99A 3A9SA 4PR3A 4PRLA 4FX5A 1ZVJA 2EJCA 5D00A 5FTNA 2C9OA 2P4HX 3GNSA 5LXTF 3ZQ4A 2DPMA 4E21A 5JMTA 2WIKA 1W4BA 4II2A 3S2IA 3ZY5A 3GCXA 4RK5A 1KTIA 4BP9A 2BM9A 4EY8A 2WKRA 3WJ2A 1Y1TA 4DMRA 4G8CA 4PSAA 4MDFA 3LC0A 2X77A 4E5SA 2B7BA 1JFRA 1QVAA 2X0RA 3HLKA 1AMOA 3K35A 3HRKA 4I66A 1EBUA 5BY2A 3ZH9B 4F46A 3DBLB 3A4LA 2Z1DA 1GQFA 3DUFA 4TL8A 3GUUA 4AUEA 1T4CB 1Y1PA 1UM9B 2WUEA 2IZ1A 1IZYA 3G0GA 4HEHA 5EWLB 2B3DA 2EWMA 3UVEA 1U3TA 4S12A 2J9YB 3D2AA 1G9SA 3SZOA 1GXSB 3S5JA 3QJYA 4TLDA 1V41E 3UMYA 1PR5A 1P2TA 4OKSA 1M34E 3ESAA 2HHJA 2BFAA 3KEMA 4CMEC 4ZTUB 2YFHA 3A1VA 1QF6A 3E3OA 4RELA 3ZJ5A 3JQFC 3AINA 4KQWA 5TV2A 5JNSA 3O8CA 3ZH2A 1PT7A 5ITVA 2IEZA 2ZSFA 3LWNA 4X95A 5NULA 1YS4A 5CG1A 1KU6A 1NXOA 3SJBA 5JNRA 3S2FA 1EB8A 1AKMA 4YC7A 1MX9A 2WTUA 3O2NA 3JYNA 4K46A 2XXBA 4MW1A 2XY4A 3CW8X 3KR0A 4JP3A 5LXTA 4B76A 3NKFA 3KAQA 3E1GA 3UWOA 4PBRA 4UTVA 4RTMA 3ZLJA 5CCBA 5HYVA 4WTOA 4R40A 2PMKA 1YJ8A 3HFJA 5EVJA 5A3VA 1P1FA 2R6CA 4N6OA 3PD1A 3SYKA 2GBCA 3GGCA 4Z49A 5HS4A 1L4NA 1OHHA 2AFIB 1NF9A 2JAXA 4RKEA 1WWKA 1MAWA 2BZSA 2O7VA 1ZX1A 2H8KA 2RHWA 2ZBFA 3FYTA 3L0YA 3LU1A 2ZCVA 2IUUA 4AY3A 5IU6A 2B5OA 1C7ZA 3ZZ0A 1H0SA 1KHTA 2FWPA 1WKBA 1L5HA 3EHDA 5EJ9A 3O8NA 2GK6A 1GPAA 1VG8A 1O94C 3U5ZB 4PAWA 5B4TA 4G86A 2X0KA 4LISA 4PHGA 4RIIA 1Y37A 4PPFA 4B1FA 2RB4A 4JLBA 3MMPA 5GWXA 1Y7IA 1Y1RA 3VU9A 4BNKA 1MXFA 4DWJA 4EELA 1WVGA 4KR0A 5SZIA 3QF4A 5JO0A 4G6ZA 1IQ0A 2F59A 2CGEA 2MYNA 2YXEA 1EG7A 1SCNE 3MCTA 4L4RA 4L9RA 4WASA 4FSXA 3W2EA 1EWTA 1RYHA 1QMPA 1WIWA 2A5JA 1YD7A 1BKSB 3KL2A 4RTRA 3B1KA 4P4SA 2CE7A 1KOFA 3IAAA 3OOEA 4X1IB 1ZMRA 5EIXA 5I9BA 4EA6A 3PJRA 3JZFA 5KS2A 4OFZA 2PMDA 1HETA 1WDTA 3PX2A 1XVVA 4LCJA 4PCAA 2GJKA 3BH6A 3W79A 2CNDA 1MB0A 2VK8A 4P6VF 4C7KA 3TNJA 2BRUC 4CMKA 1D6JA 2YNMC 1DIRA 5B7QA 1IZZA 3L2OB 1CUHA 3L7DA 1W88B 3V00A 4UTPA 4ND7A 4KODA 5E95A 1U0SY 3HUTA 2GLUA 3X43A 4KQIA 4F6RA 2I4NA 3OT4A 1DDGA 3VYUB 1VB5A 4KREA 4O4JF 1NPDA 4BV3A 3SHTA 4AWBA 2JH3A 2JFBA 1OA0A 1JHYA 1LDYA 2HU2A 2WYUA 1C81A 4DJTA 1U5BA 2BFPA 5K0JA 2V4MA 3WQRA 1PFWA 1JIVA 2YOFA 3CX4A 2XBMA 2J59A 3QKRB 3N2KB 3D4IA 4E4TA 2OVBA 3RUHA 2FI1A 3DC7A 3HXQA 4XPIA 2APJA 1GN8A 2H8GA 2HK6A 3O4RA 4D9HA 2PL3A 4DBLC 1JDSA 1BKDR 1KMNA 3LQ4A 2AWNA 4BMZA 1H2FA 1YXMA 3HP1A 2Q99A 1TO1E 1GP2A 1O58A 2I7CA 1U5CA 3MMSA 4YNBA 3UWPA 2PUAA 3DR3A 1RCUA 1BDJA 4L8VA 4DWVA 1QU3A 3CY6A 1UR5A 4NQRA 4U4AA 4FE3A 4NAVA 3KJHA 4ZI2A 2ZT5A 4IIVA 3X1JA 5IANA 1UQTA 5KYXA 2DHEA 3C3DA 1V25A 4JEUA 3HJNA 4MXDA 4N40A 4OBBA 1N6KA 2DFDA 4A27A 1Y6RA 4B6JA 5KNLA 4DZRA 5FLKA 4AL4A 1W19A 3NZEA 1V11B 4Q93A 1A4UA 1HZZC 4ERNA 4R1OA 1KGDA 3OUTA 4AO8A 3URKA 1IDN1 1JSRA 3OURA 1HQDA 5JS7A 3U5TA 3OEWA 3U4IA 4G0PA 5A4DA 4QOEA 3KKNA 3K32A 2YVUA 5DM1A 2B34A 1SN7A 4MJLA 3HWRA 4XYMA 4C4AA 3I2GA 3DPIA 1XU9A 2DWOA 2QR5A 4X5OA 5DHTA 3SC6A 1JGTA 5DHFA 3G5TA 5F5LA 5JCJD 3Q9SA 2BI4A 2O1EA 2IS2A 2ZUSA 1PR4A 1Y7TA 2QRZA 4O4JA 4DLWA 2AG1A 1YIOA 1IY2A 3EXFA 1T5TA 1YFZA 2HK8A 3N59A 5G41A 1EDBA 3DHNA 5BRAA 1XZJA 3BWYA 1J21A 3C3WA 5GTDA 1JDPA 3V97A 5C8VA 3D1JA 4EHLA 4PICA 4D9CA 1EIZA 3CFYA 1JXAA 5G4LA 3UMFA 3HH8A 5IVPA 5TY0A 4TWZA 2NXWA 2VQEB 3KVOA 2WWIA 3L7IA 4B7AA 4KXYA 2XUOA 3QFFA 2NZYA 1J25A 3AQIA 1N33B 1GUFA 4K9RA 4PYQA 1YZTA 1ZEJA 2HF9A 3MILA 4H4CA 5BWMA 1G2QA 4F4HA 1D2MA 2BGJA 2ZQZA 2ZWVA 3M4ZA 4REQA 1RPZA 3Q10A 1I7PA 4OHWA 1MAAA 2C7BA 1K3TA 4JU8A 4QHYA 4XGIA 1TMKA 5DXFA 2I7XA 3JQ8A 1Z22A 1J7KA 3FIUA 1JR6A 1USGA 3RVOA 3T1NA 1UBTS 3LHSA 1EUCA 1T8SA 2UZ1B 4LXTA 3RU7A 4BX0A 4EF5A 3BWXA 2QL6A 4I1YA 4OXIA 1DXQA 3SK0A 5ICCA 2B83A 3ZGVA 2F6RA 1RXEA 2Z8YA 3IOMA 5JSQA 3BHIA 3SZUA 3D4OA 3HDQA 2JFYA 2VP6A 3I6QA 1SC6A 1PJZA 3PNVA 3RC1A 2PE5A 3Q0IA 3C4VA 3L77A 3CINA 2JJ1D 5EINA 4XFKA 3W8DA 4ITUA 5IFKA 4TMZA 5IUKC 1SJ9A 1XRLA 3I2JA 1O95A 2PUWA 4DMFA 1G9TA 2ZITA 5BSHA 5MFPA 1AIPA 4D4GA 1E9CA 1DWPA 1CDDA 4XCVA 1XZIA 4FGWA 5ED0A 1PNRA 1TCBA 4DDHA 4G9BA 1XXHA 4KVAA 4NENB 1TYZA 2NXNA 3EXHC 4LJ6A 3VC2A 3ZWDA 3THYA 3MMNA 1FLDA 1XTKA 1DX4A 2E3JA 1A0OA 1E2QA 2JFFA 3QKTA 2J3IA 4L78A 2PKQO 2ZJYA 4L8LA 4N48A 3ADBA 2J30A 2OC9A 1E9AA 1UT5A 2KMLA 2GCOA 3AVTA 4GOXA 1TYCA 3R76A 3IIKA 4DA9A 1K27A 4RS4A 5MGBA 1JEQA 1I5EA 3BQMB 4LXIA 2A7XA 4W7HA 3GELA 4CKYA 1RC8A 2QVYX 4KYUA 5K1ZA 3EZNA 2E4YA 2JJ2D 1KNQA 3DFKA 4N3BA 2FB9A 3E7FA 3LP5A 5DSTA 5EJAA 4FMCF 4YJ3F 4MROA 2FFJA 3R74A 1E6LA 4GMFA 1R5BA 4M1ZA 2I6TA 4C30A 1PNTA 1MFZA 1XZAA 4PX3A 4ENWA 4KI0A 1XYVA 3L1UA 4UU7A 2JAUA 5FD8A 1MBZA 3T7SA 3ICVA 3IEXA 5IVKA 1O0CA 1A8UA 2Y1LA 3RS3A 4E22A 4CTOA 3HJRA 3M9LA 4HWTA 1CFJA 4IUCS 3R3HA 2NO4A 4TKZA 4XIGS 3PGVA 4JLUA 3WHPA 1V8ZA 3QELA 3QNMA 3EXHB 1G63A 2EQ5A 2H7VA 2BPOA 3FPAA 3IBYA 1PJQA 4IOJA 4JJAA 4MJ7A 3UATA 4EYSA 2XUDA 4IWXA 1IC6A 1NUUA 2I03A 2COKA 4C3UA 1NAHA 1XBTA 3CEHA 1XZ8A 4R1MA 3IJ5A 3RUEA 1PFUA 5HPYB 4O2AB 5EQDA 1W0CA 4KR3A 2OB2A 1SEVA 4ZCTA 5D3QA 4EKDA 4JT8A 1NBIA 2WSIA 4YRQA 4BFVA 1R6AA 1S4QA 3HMKA 4EFDA 2KJQA 1P5JA 1GTMA 3FWHA 5AKZA 1VKRA 4NFYA 1KNXA 2YWDA 3HCEA 5KI6A 1DQRA 3NYWA 4IJWA 4LYFA 3I2HA 4NBKA 4NYMR 5CAEA 3WAGA 2V1UA 1TQ2A 3DE3X 2RHHA 2PNJA 5I45A 3DJFA 3I8XA 3RVKA 2VP3A 1EWRA 2OLKA 4K03A 4BX8A 4EJSB 2GYVA 1OBHA 4Z4CA 1YCHA 1RJ9B 3FVQA 5HFJA 1H0KA 1MUUA 2LTAA 3IILA 1YVRA 1NW8A 2BJVA 3H2HA 1VCNA 4QICA 4YJ3A 5B6JA 5IKXA 2XNDA 3MTEA 2PSHA 1Q74A 2Q5EA 5HQ3A 2ODNA 1EFUA 3HHPA 2FPIB 3B3FA 1DCTA 3DVSX 4F9EA 4QXPA 4JYPA 1PJSA 5FV7A 2WUFA 1G7SA 3OP4A 5D3ZA 3USES 2QG4A 2FPPB 2H11A 5DHRA 5G4KA 1XDZA 1LS6A 2QK4A 2XECA 3UF0A 7REQA 2IT1A 4MKRA 1HDYA 1KSFX 4UOZA 2WZBA 3GEBA 2VJDA 3KJGA 1U1GA 4FVTA 5JCJA 1RRCA 2A9PA 3LRXA 4P3NA 3FUWA 4GZLA 4MKXA 2GRUA 2HY7A 3BGWA 4QU0A 2R2GA 1UKVY 3O3MB 4E1VA 5A9RA 4OHMA 1PR9A 4AIIA 5EOVA 3KEOA 2QG6A 4CODB 4O2BF 4GD3Q 1R0SA 3H7IA 3R3WA 4OHXA 4TRMA 4X7MA 3TRKA 1U1IA 4XB2A 2BEUB 4AVYA 4CMHA 1D3AA 1RLMA 3NM4A 1LUAA 2OV8A 2WKSA 5T64A 4Z8XA 3FSGD 5DU2A 4UVEA 2P35A 3ZQKA 1FZQA 5K0ZA 1OASA 4LJRA 4YRTA 4Z0TA 4D9FA 3J81A 4PN3A 1FTSA 4JC0A 4IQFA 5EWMA 2ZQYA 3C6XA 3ZNQA 4D8UA 4Q4JA 1H6BA 3NTUA 2CMGA 4DLXA 2OCAA 2Z8YM 1YJAA 3NWJA 5KYYB 2CVFA 3GG2A 2VNAA 4MI6A 4GX2A 4IF4A 5HGXA 2FPOA 2NUTA 4NJMB 4R83A 3FOZA 3ZNOA 4D9NA 5FX2A 3B2NA 2JI9A 3ZJYA 5GIOE 2DHQA 1M0TA 4B8ZA 4H4DA 4UNRA 5BW8A 3G68A 3WVNA 4RK1A 4DM3A 3RRXA 4BNZA 1SKQA 2ZWMA 2VJBA 1IDOA 3DVAA 2FMIA 3OP1A 4G5HA 4TLMB 3RC8A 2J5XA 2TMGA 3B85A 3Q3VA 3CG0A 1J0CA 4RSMA 1EU1A 3M33A 1UDRA 5EGNA 4UM5A 5JAIA 3CONA 1ISFA 3MJDA 5CK5A 1OB2A 2X8BA 2RONA 1HL3A 3DMYA 3UA4A 3IH5A 3C41J 4DDWA 3QF7A 4GWKA 3PNLA 1OZHA 2GXUA 1VSTA 3IPCA 4OJQA 1E60A 4CM8B 3ACDA 4UE2A 2XB6A 2QJWA 4O2BA 1QP4A 1M66A 4B6PA 1M3SA 4J03A 5DBEX 3WK8A 1ID8A 1QVRA 2QN3A 3GT4A 5CD1A 1Q95A 4XIIA 5JVDF 2CNNA 2EBWA 1GQ2A 4G36A 1INLA 1JILA 2YMQA 1VG9B 4CMAA 1QH9A 4U9UA 2NSHA 4Y2GA 5CFNA 3K0HA 4B83A 5BOSA 3PNOA 2WF7A 4KSYA 5GINE 3QA3E 3U7FB 1Q7RA 4FM9A 3AHEA 1T1RA 4FWBA 1O97D 1H1LB 1TPYA 1ZM4A 3GLIE 4CEIA 2GK4A 4L6IA 4ZDJA 3LIPA 3AR9A 1RPAA 4GBMA 4I81A 4YYZA 3T3EA 5JLJA 1EEXB 5GONB 3GLSA 4AY6A 1LVHA 1UK9A 2XUQA 1BCSB 3V34A 1JE0A 2O2SA 3WLOA 2JD2A 2F1RA 3UIEA 2B98A 2TRSB 4TXJA 3RTAA 3UG6A 4PFJA 5A71A 4ZAVA 2QX7A 1QAOA 4I6GA 5DM4A 2XVXA 2HQSA 4OJTA 5EZSA 3E03A 5KSOA 3CNOA 1DNPA 2J7PA 2VNSA 3P4YA 2PPVA 3TAXA 5I47A 1XRRA 1M0EA 3F3MA 2PSSA 9MHTA 1QGED 2AJTA 2FG7C 5AOCA 1C4WA 1XWIA 2V5UA 1KR2A 2ASEA 4BFCA 1UIRA 3OZFA 3WWZA 2JD1A 3ZXYA 3ELDA 1KEKA 1DXOA 4M87A 1FL9A 2X1HA 4N9WA 4OL9A 1N78A 1JXMA 3DV0B 1GA1A 1JEAA 1MH9A 2DQSA 3O91A 3QU7A 5C81A 2GERA 5JVDA 3QOWA 2A58A 4Q4CA 2XQKA 1GFWA 1K1EA 5F7OA 4LF8B 1A9ZA 2WKPA 4RKQA 1VKNA 1FSFA 3CLHA 1DEAA 1C7RA 3D0QA 3GT3A 5A04A 1EVEA 2HO4A 2C8JA 3LQQA 4DJEC 1NXQA 2E85A 3ZJ4A 1EA5A 3V3TA 5IUNC 3Q2IA 2AA3A 5M7EA 3HEBA 1KWGA 2OYSA 1C7JA 2JZCA 3RTEA 3BE6A 4EVQA 3AVYA 5DISB 2NUAB 2IIVA 4U2GA 4C4YA 2AE2A 3RODA 3SYRA 2IHJA 4F3YA 2CKMA 3KLNA 5PNTA 4E07A 5ALGA 1ZUNA 2BDEA 5JE8A 3K4PA 2QB5A 3HUFA 3T7KA 3T3GA 3VVLA 4XYLA 5A3JA 2YZ2A 4EVIA 4LYJA 4JC4A 5F98A 1M0WA 3CLRD 5BQ3A 2CK3A 4LSZA 1R12A 1FMCA 3NI2A 3QLTA 1Z5PA 2A35A 2GJSA 1U1EA 1X7WA 1H94A 2QUZA 2ZRAA 2ZLBA 4O4LB 1YACA 4W7IA 5IWAB 2WWGA 3WIOA 5F2OA 1B3RA 2FZKA 3HQ4O 4CIXA 1M34B 2HWYA 3I42A 3NX4A 3S44A 1N4AA 4W9MC 4X54A 1K66A 4EAQA 3SJ7A 1YZQA 2RCYA 1VMDA 4AYWA 3AI1A 4Z1MD 1RXSA 1LLCA 1RAAA 4KXWA 3IODA 5AW3A 5I7UA 2Q29A 5EXEA 2AR9A 5G53C 4IKOA 4F6CA 2Q1UA 2R44A 1UJ6A 2YZ7A 1IHYA 1DBIA 2RE8A 1LWOA 1YT5A 4WZAB 4KQEA 2JAOA 3FSGA 4CTKA 4MUNA 4NCXA 1NDQA 1NLZA 2R79A 4MWZA 2FRDA 4G8BA 3UBMA 1ZI8A 3RYIB 4DCUA 4OCZA 2DSNA 4EGFA 4ZU1X 1HNZB 4D02A 4JZKA 3MNFA 1A72A 2Q9BA 2DFVA 4NATA 1G5PA 3ZWVA 1L7XA 3GMSA 3PTAA 1T0PA 5B64A 4IIBA 1P5FA 3PLRA 1OXSC 3BWDD 4RY0A 4DRYA 3Q8MA 3UJAA 2VDVE 3MGCA 3TJZA 1A2QA 3NBUA 1QV7A 3OM9A 4N5NA 1RWVA 4ZAGA 3ZJVA 4CGZA 4RVNA 3LCJA 2O7RA 4GSYA 4MPTA 1IN5A 5FPYA 3EQ2A 4U6SA 4WPGA 3CLTC 5DWVA 2Z3ZA 3U3MA 5LN1A 1YVDA 2OORC 2ZB2A 5E3HA 3JXEA 1G8FA 1PJ3A 4CMGA 4UXHA 3LQFA 1HEUA 4HDOB 4YP5A 1QYXA 3UT0A 3R9XB 4UCWA 3FPHA 1VJTA 3PA6A 4M37A 5FEMA 4ND4A 3VAZA 3T1OA 5AKIA 3R3YA 1AKRA 1U7XA 3HADA 5TARA 5HZGA 2Q4BA 3OG9A 4IH1A 1BX1A 4H9GA 4BVGA 3HZRA 3L84A 4QDKA 1W4RA 4RKFA 4O1MA 5CDGA 4DLLA 1VKOA 3NHLA 4HQLA 4DZZA 1O95C 1VLJA 5B7NA 1GGJA 2NO6A 4RA6A 2RC5A 1VMKA 4HHEA 5FULA 2IEBA 2QL5A 1G7CA 1P6QA 3SNHA 3TEMA 5D6NA 1C4KA 4QYTA 4L3VA 1JLLA 3VSCA 2PX5A 4QAQA 2WDPA 2AXPA 2ZSJA 3ELWA 4L5JA 3BE4A 3N2YA 1YU9A 1KYYA 1I4WA 2GHQA 2WJAA 5TQVA 1O5TA 3GCGA 2JZNA 4XM2A 1N0UA 3T41A 2L2QA 5C80A 3S0JA 2D2XA 2FP3A 3LQ1A 5D1HA 2WDZA 1IY0A 3HBMA 3I28A 3DLTA 4UVIA 5K0CA 4DPMA 1PT8A 2HRZA 4M1MA 4QSMA 4P92A 5TRTA 3PNSA 1G64A 3FOWA 3BICA 2JIDA 3WK7A 1TM7E 1BGXT 1J2JA 1G66A 1QIDA 4AKHA 2ID9A 2Q4EA 4MRNA 3HB0A 1NN0A 4MR7B 1R4NB 3IQHX 4LBYA 3B3AA 3JASB 5AJWA 4X6YA 1X9HA 1ADJA 5JSHA 4OGKA 1QZTA 3W7AA 1T1GA 1CDEA 1K9SA 2W2QA 3U4HA 2JFNA 4QPPA 1T2EA 1AE1A 1FTYA 3A1TA 4QO7A 4EKNB 4C5CA 1NLUA 5DHPA 1QKKA 1V16A 1XEWX 1QPZA 4MHTA 3JARA 1PSZA 4HMOA 1GAEO 3Q2KA 4C9BA 5CDFE 4CNBA 1B6TA 2FU5C 3I64A 4AMYA 2WVGA 2ZT8A 3G7UA 5FBKA 3TLEA 5AI0A 2FW8A 4Q1FA 4JBIA 4YRGA 1LFDB 3IL2A 1T35A 4MP3A 1AQYA 3OZCA 2C58A 3TDNA 1RVDA 1E9BA 4OHRA 1IK6A 2WEKA 4GVPA 1H5QA 4IXWA 2DKOA 2Q1TA 2WHPB 4R3NA 1CF2O 2QLTA 1LNSA 2V7QD 2W2KB 1MQ9A 2W6JD 2WJJA 3T1QA 4B17A 4BRSA 2UU9B 2BHRA 2FZLA 2BFMA 2LGJA 4MI9A 4OMFG 5LZ9A 2CL0X 1JFSA 3WIBA 4HQRA 5FUYA 4PZUA 3H5RA 3KHTA 4DREA 3ICQB 1W76A 2A0WA 4H17A 3FZYA 4ONEA 3U44A 2AN4A 3K7EA 1W29A 2GZMA 2XKAA 5A6SB 5LU8A 1NE7A 3G0IA 3P9YA 3ASYA 2DP4E 4JGBA 5ERXA 1GDDA 3WGHA 5KTMA 3D3KA 1KEWA 2LWIA 3AMVA 3ZIDA 4CKCA 3EYAA 1UMBB 4L0CA 1QHHA 5LYJB 1YK0A 3KKZA 3TZCA 3W6OA 3EH2A 4EUNA 4ZMRA 4AUNA 1USIA 2Y9MB 3B48A 1VRWA 4IRXA 3T3PB 3ZZ1A 4XH9B 3AESA 2ZWIA 3NNNA 2XKKA 4IGIA 1Q14A 1EM6A 2GNOA 1OFVA 2WFMA 3LXXA 4S0ZA 5DYTA 3UPDA 2IUSA 3ZHRA 4YT4A 3PPIA 2EDAA 1IXSB 1CE8B 4NU6A 3SR4A 4RLSA 1GL3A 5FOVA 2C2WA 2VF2A 2R7NA 2CB0A 3G2QA 3L8DA 4QFCA 5HILA 4X64B 2HWWA 4OJMX 1PI3A 4RGQA 2OV3A 4MRVA 5DK6A 3B1ZA 1RLJA 4NYMQ 5FCDA 3WYNA 3L6EA 1MRNA 2AKYA 2Y8EA 1ZUD1 1RR6A 1O9HA 3K8OE 4FMDB 2O3RA 4YRRA 4N76A 3QBJA 4FKMA 3REQA 3ROGA 5IZ4A 4BVFA 2R85A 1XZNA 2DKFA 2XD9A 3EDOA 3ZU5A 4TWAA 2WHQA 1UKAA 4PQEA 2JGIA 2ZQ5A 1KY5A 4XGQA 1EFCA 1FMFA 1AGXA 1WAMA 3OTOB 2BJHA 3QTBA 5JH7F 2HBYA 4Q00A 4DJDC 1FJGB 4KVFA 3PWKA 2DBRA 2XX3A 1KEPA 1R0KA 1TO6A 3CW9A 2FQ1A 3LSYA 4FBLA 4JX9A 3UFXA 2B1JA 3PNBA 2BMEA 2R1TA 1UIMA 3ETGA 4YRSA 4FZVA 4BP3A 1OYYA 1LNZA 2VRCD 4UQOA 2G5PA 2QEQA 2EIXA 1ZCFA 3UB4A 4C3OB 5HIAA 5KIAA 2AWOA 2KLBA 5HE9A 4F97A 5IDXA 3EG9B 5ES4B 5DNYB 1ZN7A 3CBGA 2GLXA 1BAPA 5MDHA 3ZEIA 2GK7A 1F8YA 3JTMA 5DTRA 3HPRA 2IIPA 4IL5A 1XPUA 3D6HA 2I29A 1OFGA 1LDNA 4L22A 1GRCA 1ZRMA 3K1ZA 3ETEA 4PVDA 4UUMA 4E94A 3AF0A 1NQXA 1NI4B 1O87A 3TH5A 3QVWA 3SEAA 2PMFA 1UJ4A 3WIUA 5JHGB 4GC9A 1QNFA 1F4VA 4Q39A 1A8SA 1D5CA 2ZIXB 3ED1A 3VKFA 3GAAA 2P2LA 2O48X 2HNBA 1B0UA 1IHOA 1X3SA 1DPFA 1CLEA 5L7YA 2DUNA 5HQTA 1JRLA 2G36A 3V8RA 3GARA 4N7RA 3RAPR 1S7CA 5C0OE 5B58C 5CB4B 2IGBA 5SYAA 3S28A 3GJTA 3ENWA 1LGYA 4EARA 3ZJTA 1E8DA 2PU7A 3F3SA 3BDVA 3C7KA 4N9QA 3DUWA 4KYVA 5G3YA 1KMCA 4KGVA 4FN5A 3RVSA 4QARA 1U6KA 3BQNB 4A0RA 5FA6A 2B78A 3GLFA 1A5ZA 2DFPA 3IXMA 3O82A 3QWIA 5JH7A 3QXHA 1NULA 3U49A 2Y93A 4YROA 4M8KA 5KQPA 1XRNA 5LMCA 1XNJA 2P7HA 2ILVA 2Q4TA 4TKVB 3IAS6 1KQFA 2J67A 1EBFA 4A8JC 4IJKA 1K75A 2W6OA 1N9ZA 2F48A 4I4TF 4MKIA 4MWEA 4RD0A 4EKGA 4L15A 3ZU6A 2Y92A 4IIJA 1ODTC 2FRVA 2JBAA 4FDMA 2X5XA 3DMFA 2O52A 4KQMA 2PSDA 3AL3A 3ND9A 4CI0B 2W6NA 1OXKB 4R7GA 1NT4A 2JVJA 2M2IA 2NSYA 4U39A 5KOHB 3RFTA 1F3OA 2O4CA 1SAYA 1NQ5A 3E48A 1FE8A 2H4YA 3JAWA 2C20A 3CUTA 1QGUB 4IQ0A 4JU9A 5EZ6B 1X92A 4D1YA 2FMKA 3HVUA 4D4IA 1QG6A 1OCEA 3Q2OA 3H1PA 1FSGA 5C51B 1QDEA 4X45A 3OFVA 4ARUA 4QG7A 1JHDA 3HNRA 2DLDA 1Z7EA 2OWDA 3K2QA 3U37A 4YJFB 3DA8A 2BBSA 2I2AA 5LSAA 2V7QA 2QHXA 2W6JA 2A84A 1KVUA 1O6GA 1CHDA 4NJOA 1PKEA 1UT8A 1S8OA 1K2VN 1XF1A 1YZKA 1UBOS 1YL5A 2VLBA 1L7BA 3J7TA 3ZGNA 4CWAA 1HGXA 1F4LA 3JWIA 4B7CA 2RGNA 5T8KC 1QTIA 3UB3A 1SC9A 2WWVD 4ID3A 1I4TD 2GHIA 4KQFA 2XAAA 4IDEA 5HCNA 3YASA 2QJRA 4QOGA 5ITSA 5JNTA 3NTXA 2BGMA 2QUIA 2NVUB 1QIEA 4R1SA 4CF4A 1L9XA 4TQUS 3W05A 3CCBA 5HW0A 1VJ0A 4F84A 1DC7A 4I4TA 1JG3A 2OV1A 2C2ZA 3RRFA 4LPKA 3KSZO 2DVMA 3B70A 3E53A 2V7TA 3EGVA 3HVHA 3O8QA 2Z9BA 4QUKA 4RVUA 2C3OA 3M1LA 2P2NA 1JG7A 3MMZA 3PKIA 1PEAA 4XQ9A 2ECQA 4G65A 5LL6P 1KZ9A 1SU8A 4LG1A 4RKYA 5HZMA 1G3QA 2W8BB 4MUYA 1P7WA 1YDWA 4D3YA 4E5PA 1E1CB 2I4TA 3UW3A 4H16A 1ZCBA 2IHBA 3WL8A 2CKDA 3BSWA 2ZBEA 1QLHA 2WF8A 3FBWA 4OI2A 4DIBA 2N1BA 2OK7A 1NUHA 4BXOB 4C2UA 2VWPA 5PGMA 3T9EA 3PQCA 4XEHA 2CFTA 1I10A 1H85A 3QFTA 1DSSG 2X0NA 1CR4A 3GVPA 5TPWB 1FDOA 1V95A 3T5GA 4DEYA 4JQYA 4OP3A 1Q12A 4U2FA 3ZOKA 1R0YA 5A0FA 4JK3A 4PN7A 1HLDA 4K87A 2SICE 2F2TA 1JU9A 1ZRSA 4LJ4A 4PBTA 4GI3A 3U7EB 3MF4A 2XE4A 4AIRA 5LWQA 3QXGA 3KKEA 3CPHA 2JFOA 3BBPA 4HP8A 4L4UA 1GKLA 4UEKA 1DEHA 1V8BA 4LZPA 2ZS8A 1HC7A 4Y2JA 5E7MA 4JVNA 5E6UA 1KJNA 4LJLA 5AXAA 4EY6A 5JASA 5KYWB 2D6FA 1OZFA 2PBRA 3DDUA 1H4VB 4DLRA 1VE1A 5IAAA 3RKSA 421PA 4YV2A 1DAKA 1AB5A 2WZCA 1K5HA 3GFTA 5KINB 1TAUA 2O2DA 2GBLC 1H5NA 1L7DA 1LPBB 4M46A 4CUJA 1Q0UA 3SAJA 3UT5A 1RQNA 3GLIB 4HOYA 1GZ6A 1KMHA 1OAOC 4G25A 1KYIA 3ZHOA 1CS0B 2PKXA 5KU1A 2DPYA 4AT1A 5KTKA 3RK0A 2ZSBA 5D51S 5KKNB 3DAOA 2X7JA 4L8YA 5HOQA 2V9PA 1NOJA 4PLFA 1RCFA 1R5OA 1ZL2A 2BD0A 2Q3DA 4K0RA 5EC8A 5DSZA 4DQUA 3FDFA 4ISCA 2PZEA 1O8BA 3DKVA 3MQFA 3CSDA 1SOUA 5CH5A 3V2UA 5ALUA 3RJ5A 2MSLA 5FNVF 3F6YA 4TXNA 3WV4A 3FDXA 3STHA 121PA 1GNQA 5D2CA 5B37A 4C08A 1D6SA 1FNBA 4X3OA 1XX6A 1YTLA 2GZ2A 2IDKA 3DAFA 3HBFA 4AQDA 4AX4A 4D8XA 4BQIA 4DJFC 5IFLA 1DX6A 1FDIA 4KRGA 5G2OA 4EQ6B 4XGNA 5EMJA 2VAPA 1N2XA 4QJ4A 1U8EA 4DLYA 1MW8X 3DE2X 2OHXA 10MHA 2C2BA 5JD3A 4G1VA 5JSYA 1MJGA 2Y77A 4AJPA 3ZCTA 3PDUA 4RC9A 3CNQS 1JW9B 4FW8A 1C7EA 1N6NA 3A1DA 3OHPA 4Q6BA 1II8A 2YUTA 1L8XA 4K9PA 1EFRA 3ZPXA 4HBGA 3TGWA 3NRJA 2HAEA 4FUTA 3ZC3A 4S04A 2Q5HA 5BMVA 2ZP1A 4ND8A 5F33A 3GUCA 4AP6A 4LY6A 3FIJA 2ZRJA 3AP1A 3KDSE 1QFZA 3A06A 3BEOA 3EFBA 4JBGA 4Z9YA 5BSMA 3PEEA 2ZYIA 3LT1A 1CR0A 3GHYA 4ER5A 1JQAA 4L5AA 3HYRA 1XZLA 3IV9A 1U0LA 4U7WA 4E32A 2D7CA 3OT1B 2OB1A 1P6XA 3RHSA 5BN4A 3SE7A 3M5DA 3C3PA 3STYA 2WE7A 1FLAA 3DC2A 4W1QA 1MO3A 1K7CA 2OZKA 2H6EA 5FNVA 4HQ0A 2ACEA 3BD6A 5JJCA 4B5KA 4C89A 5BYKA 4A8JA 1IWPB 4TMFA 2R7MA 2X2FA 4X84A 2WJIA 1MMFB 1NVEA 2ZPUA 3IMKA 4XOIA 2GWHA 4BTVA 5IJ9B 4YQEA 1XTZA 1LW6E 4KC0A 4PM4A 1H5UA 1IQUA 4TPKA 4HQFA 1UBGA 3HDYA 2CFIA 2PFGA 3ASVA 1P5ZB 2Q5JA 3I9V1 4FYHA 2O8NA 3AK4A 3L0DA 3GCZA 2C5BA 5FV4A 2QVGA 3D5TA 4PO1A 3WSVA 3OJCA 5I8ZA 3BUSA 1T1SA 3EIEA 1D1PA 2B30A 1FFXB 3CMCO 4H0NA 4ZYWA 3I30X 3PX7A 3GXBA 4E2YA 4RGVA 2XKBA 3M6UA 3L4KA 5GGYA 4IFEA 3QUSA 2W70A 1YH3A 4Y6GB 2QI9F 2GD1O 4CIVA 1UK7A 4DIKA 1DELA 4IWNA 4RPJA 1Q0SA 4C2BA 2V6GA 2BM8A 3LK7A 4HNSA 3JD3A 1S01A 2DQZA 4Z2AA 5B5SA 2HW8A 4NZZA 2A7QA 3EEOA 1KAHA 1WMBA 2OENG 1MOPA 3FTEA 2NUPB 1G6KA 1AUOA 3NT5A 1N5IA 3OBBA 4NTZA 4OY3A 1NN3A 1BVHA 5HK8A 1QC5A 5DM60 2QN2A 3RQSA 1PJRA 3NTRA 5JSFA 1Z74A 2NO0A 2CDCA 4NNJA 3W5CA 3I6ZA 3JWJA 3I9FA 4PR0A 2BI7A 3FG9A 4OM7A 2PSEA 3K70D 2AEEA 4CN9A 4NLLA 2XB9A 3EEBA 1Q2XA 4I3GA 2VA9A 1H8ED 4RGYA 4HSGA 3ETJA 3PRHA 3VKWA 3DE0X 1MX5A 1OZAA 4B3JA 4X60A 2P5SA 4CZ2A 3RAEC 2OHFA 4N5HX 4ZT2A 1P2GA 1TT5A 3N0TA 3VZRA 2QRUA 4MQLA 3ZXXA 2QD5A 2C97A 3ESDA 2KLHA 3V46A 2J0UA 3IXLA 4KZKA 4KAJA 4CF3A 1KY2A 2FMFA 5KOIA 2WD7A 3R8FA 2ZZNA 3D8RA 3SJCA 3TR5A 4J3FA 3LDFA 2Z8XA 4ZVPA 4LMRA 3NATA 3PHIA 4BLQA 3RAFC 5LQJA 4GSLA 3I52A 3WICA 3VHXA 4A5OA 3HE3A 4K2AA 4ZODA 4TVSA 2J48A 4YMHA 4WXPA 2BFDB 2IHYA 4KRFA 1UPBA 4KV9A 2EEZA 3R6LA 4CQMB 3ERCA 1NKSA 3PWTA 3DLCA 3LPNA 4BVLA 2ZJBA 3MWFA 4AMUA 4MLDA 5IYZB 2SCUA 3JZIA 1TEVA 2FVYA 4G9EA 1FNNA 2GAOA 1XEXB 4HDSB 3W4KA 1AKTA 1DOHA 4D45A 4M76B 1NAIA 3Q8KA 5GV8A 5U1PA 3MD0A 5KSYA 5LQRA 1KK3A 4J0DA 2IHVA 4PLTA 2P4QA 2R62A 1OVMA 1THMA 3JU3A 1VIYA 3JZAA 4ISBA 1WHTA 3CA8A 1RWWA 3ZGOA 5DM70 2HOQA 3CH7A 4V03A 1T2CA