2NGRA

Transition state complex for gtp hydrolysis by cdc42: comparisons of the high resolution structures for cdc42 bound to the active and catalytically compromised forms of the cdc42-gap.
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
191
structure length
191
Chain Sequence
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PROTEIN (GTP BINDING PROTEIN (G25K))
publication title Structures of Cdc42 bound to the active and catalytically compromised forms of Cdc42GAP.
pubmed doi rcsb
source organism Homo sapiens
total genus 65
structure length 191
sequence length 191
ec nomenclature
pdb deposition date 1998-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ngrA00
1OFHA 1N2CE 2GEDA 5KOYA 3S1AA 4CT4B 1CR1A 2PZEA 2BBTA 2XNDA 3OIYA 1OH5A 3SHFA 4YMVA 5G40A 4TLEA 4JVMA 3I72A 1E9BA 1YKSA 1Q3TA 2LWIA 2W2TA 3Q5EA 1NLFA 5J47A 3FPAA 2ZAMA 5HCIA 1YR7A 4JVNA 4US1R 2ZRCA 3W5JA 1GFIA 2FWRA 2GJKA 2DR3A 2FJUA 5BW8A 5KSZA 1MR3F 4Q48A 1Q12A 4L9WA 1RRGA 1K6MA 3W9YA 1G5TA 4M9QA 4PPFA 5L3SB 4MGKR 3AKCA 1MABB 1Q0UA 4EAQA 3NC1C 4HUQA 4A4DA 1NSFA 4C3ZA 1NI3A 3I73A 4X8HA 1FTNA 2CMKA 5FBLB 4IFBA 1JEEA 3EZFA 1OIWA 2OE2A 3ADKA 4GOXA 4TWZA 2RGBA 4PAQA 1T91A 2EFGA 3THYB 3WBJA 3IQXA 4X8MA 4DLTA 2V3CC 2FH5B 3IPXA 1NBMD 2OAQ1 3VTKA 1CJTC 2CNWD 2ZS9A 3CNNA 2ZJAA 3EC1A 1II8B 3KKQA 4FW9A 4OQFA 4MYHA 2CJWA 4TQ9A 1DS6A 3ZS8A 3ZS9A 5AJVB 2YHSA 5H70A 1GOTA 1F6BA 1FFHA 1YZGA 3LBIA 4LPSA 4M9SA 3F5FA 4JLPA 3I92A 4M22A 2FGJA 3LBNA 2HUPA 2SHKA 2PH1A 3PCRB 4OJKA 1EX7A 1GNRA 3CW2A 4R98A 2O8EB 4X8OA 3OZXA 3QPVA 1E2HA 2IA5A 4OKSA 4LSGA 4P4TA 2C78A 2NO0A 1UDWA 4PX9A 4A36A 1OFTA 2QPTA 5HPYB 3OEED 3ONWA 3TE6A 1XCMA 5KNCA 3BK7A 4WZAE 4UNQA 5EP2A 4BLQA 1KI6B 4RJLA 5HKKA 2PJRA 3AUYA 1E9EA 1A4RA 2OLJA 3T06B 2N1BA 3UMSA 2CL0X 1MO3A 4ZO4A 3QI2A 1E2QA 2QI9C 4Q1DA 1SXJE 2WWIA 2AHOA 3EWSA 4A0FA 5FBVB 3MJRA 1T0JB 3CRVA 4HLCA 3AVUA 4AG6A 1G3UA 2ZJZA 1Z6TA 1KK1A 2J0UA 2VP5A 3A4NA 5CB8A 3WXMA 5DE3A 4NBSA 1SVKA 2GETA 2BMDA 5DYIA 1Z2CA 1JR3D 4B3DA 1SVMA 1G3IA 2VP2A 2Z83A 2A5YB 2ZVPX 4EQ6B 2R6GA 2P65A 1IJFA 1ZUHA 5L8VA 3BJIC 2PT7A 2PZGA 1S4QA 3OEHD 4PZZA 1MO4A 3KL4A 4TLBA 3EASA 1HT2E 5EE9A 3TH5A 4AYWA 3RC8A 2BMFA 1FTSA 2FX3A 4M1SA 5L3VA 1A82A 3TW4A 5BQ5A 1Z0AA 1KK2A 3AVXA 4IJMA 4LJ6A 2XOKD 4NYMR 3BXZA 3QF4B 2MSEB 2IS6A 2DFTA 2XZOA 2BCGY 1II0A 2YZ2A 4Q9JA 3ZVRA 3U3OA 1BMFA 4TT3A 2G9NA 2H17A 1R0ZA 1EXMA 3Q9LA 4BASA 3TR0A 3R9WA 1SQ5A 4FCWA 3C4JA 4WZBE 4FI3C 3UATA 3VKWA 1WQ1R 2WMOB 2REBA 3A1SA 4Q1CA 3OFNA 1IONA 2WPDA 2GA8A 1Q1QA 4AWXA 2NO6A 4Q19A 1U9IC 4DZZA 3NHAA 2YC2C 3CRQA 1M34E 2B92A 4YXWA 1RRPA 5KO2A 4YMSA 5IF9A 2A5GA 4NYIR 4FMBB 4L16A 2YOGA 3W3AA 4C0QC 3U3KA 4D4MA 1OV4A 3GEHA 1KK3A 5DI3A 3W8NA 2AK3A 2Q9CA 1DOAA 2GCNA 4MUBA 3WRXC 1W2GA 5H8WA 1DAFA 4HEJA 1KAGA 3CONA 5KUTA 2QAGC 4ON9A 1JXMA 4MDEA 3KUCA 3TK1A 4II7A 1G1MA 2CE2X 3FVQA 1OLOA 3CX8A 3ZGXA 1QG2A 1C1YA 3KB1A 3D6TB 3O8DA 4JLBA 4P32A 3DVLA 1W4BA 1TUEA 2HJGA 2VP4A 3ZLJA 3VU9A 3RSOA 3HYTA 2F6RA 1G3MA 3BBPA 2F1JA 2XITA 3IUYA 1IAQA 2XSZA 4QJ4A 1YR8A 4I1OA 5GADl 4DB2A 3QKUA 3R7WA 4F91B 1IQPA 1SZPA 2OZEA 4JYCA 3QOFA 2FF7A 4JLVA 3TRFA 1SVIA 2GCPA 3B6EA 1E2MA 3EPJA 2IEZA 4ZKDA 3IEVA 4HUTA 2V4ZA 3D8BA 4BE7B 1T3LA 1YRAA 4IOMA 4Y0AA 2HYDA 2EWWA 1N6PA 2VH5R 4RD2A 2JLZA 1S0UA 2IWHA 4RZUA 2W6ID 2VBCA 4UXHA 1W5SA 2ZRLA 1E2KA 2G83A 2OO7A 3ZYCA 5KNDA 1ZCAA 2UZIR 2C2HA 5F98A 3H2YA 4A82A 1XEWY 4TSFA 5H1YA 4MRPA 4M1YA 3C16C 3HPQA 3SE0A 1E9SA 2IYRA 4B44A 2W6JA 3DOFA 4KHZA 3T35A 3W5IA 4B3FX 3GFTA 1MT0A 4B74A 2IBMA 1AJEA 5CYOA 1Z6XA 1KO8A 3KX2A 2P6NA 3WBKA 3SHWA 1JB1A 1UFQA 2GJ8A 121PA 3W6PA 2PX0A 4UQOA 4ZDWA 2EVWX 3AH8A 1AKYA 2ZJ8A 2BVNA 1MO6A 4KFRA 2ZRMA 3HJNA 4LUCA 1S2MA 5HR5A 3VNUA 3QKRB 4NCKA 4UNNA 4JVSB 2IXFA 1E69A 4HAVA 1TQ6A 1E1RA 4GSYA 1G4AE 3K0CC 2G1JA 2A2ZA 1G19A 1HQCA 4Z1MD 4TMVA 6Q21A 3F0TA 1Q20A 4O3MA 4XTRA 2F43B 4XWKA 1S1MA 1LS1A 2AFIE 3TJZA 4EFNA 4QFMA 1HEIA 2VA8A 4XH9B 3AVVA 4CEIA 2QROA 1Z0IA 3B85A 3CPJB 4LJYA 3DM9B 3RVBA 4TMTA 3K09C 2ZJOA 4HB0A 3ZZUA 1OSNA 3ZJYA 2C98A 4KLNA 1HH4A 1JAHA 2FA9A 3I8SA 1X1RA 5AK0A 3SNHA 1MRNA 2WSMA 1HQYE 4Q01A 3TGPA 3QG5A 1UF9A 3BC1A 5IK2D 2WIAA 4POAA 1UBGA 2QBYA 1N6IA 3SYLA 5D3QA 3ZVNA 2AXPA 1W2HA 4D0NA 1P2UA 3BGWA 1NIPA 4C0AC 2BBWA 3TAHA 3U6BA 3TVTA 3B9QA 2QRZA 3MLEA 5TARA 5JSZA 1KO4A 2YWEA 4PHGA 1VG8A 4GMDA 1UPTA 2FFBA 4KJZA 4AG5A 3F3YA 4OI1A 3PQCA 3ZZTA 4ERNA 4P4SB 4FN5A 1E2PA 2CVHA 1OJLA 4JL8A 3RS2A 2AL7A 1AS3A 3TSZA 4ASUD 3VX4A 4MYTA 3NH9A 4GOKA 4OK3A 1P2VA 2ZU6A 4C0KA 3T12A 4A8JB 2O8DA 5DISB 1ZYUA 2FG5A 4M9ZA 3VX3A 1FX0B 1M74A 4DDTA 1N0WA 2PCJA 1FNMA 3V4RA 3U44B 1XJQA 4JVLA 2UVQA 3BORA 1XPUA 1F2TA 1ZM9A 2ZREA 1U0LA 3SFVA 221PA 1ZU5A 4NYJQ 2NPFA 4G1UC 1X3SA 4IDNA 3AVTA 2WKRA 3UPUA 1DEKA 1U81A 1W48A 2IK8A 5G53C 4WOPA 3THWA 3FYHA 1R5NA 4FMCF 4G5RA 4RZ2A 2JIZD 2YWGA 2QENA 2EFHB 5FTMA 2V54A 1GKUB 1OE0A 1G8HA 1YR6A 1OB2A 1GVNB 4OQXA 1NLZA 2D2FA 1W36C 4TL9A 4PHTA 3BB1A 3NC0C 3HYRA 3O8BA 5F2EA 3PR1A 1RC8A 3P4XA 3U7HB 2P6UA 2PEZA 1M7HA 1NG9A 5DSZA 1SKYE 1RJ9B 3IBYA 2ZRJA 4BFXA 2IS1A 1P5ZB 2BV3A 2G0TA 2OV2A 4BWYA 5L3QB 1EESA 2OHFA 2V6JA 1G7RA 3VR2A 1UEJA 2CXXA 5EXSA 2BWJA 4EKDA 5AWFC 5LD2C 2FNAA 4RSGA 3OAAD 2FN4A 4DCSA 1Z8FA 1H8ED 1YZKA 3CIOA 3BFKA 3BH6A 4HAZA 5FUXA 4CF7A 2WHXA 5CITA 1G7SA 4MDFA 2Q9AA 2BEJA 4HI0E 4QHTA 3RC3A 1NSTA 3GJ6A 2DHRA 5C46F 1CEEA 2J5XA 1TU4A 4B71A 4WA7A 4DDVA 4TYWA 3NTUA 1O87A 4FMDB 3AB3A 1LB1B 4B48A 4V0KA 3KDSE 3T5GA 3A1WA 4K8OA 2ONKA 2O8CA 5KSOA 3LFUA 1ZAKA 2IYWA 5E4FA 1EFRA 3SQXA 3CR7A 1XEFA 4A2WA 3I5YA 1DVRA 4TL8A 1RVDA 1ELOA 4BFTA 4DLVA 2RCNA 4QL3A 5E7MA 3EA5A 4XVUA 4XVRA 1LS6A 3GLIB 1SXJC 3L0SA 3EIQA 3SDZA 4OBEA 1CRQA 3KQNA 1BIFA 4IW3B 2K5UA 3WYAA 2JJ8A 3WYGA 5FH9A 5C4MA 3WP1B 4UXIA 2ZPTX 3B1YA 5EXPA 1I4DD 1VG9B 1XTIA 3H1TA 1P2SA 4PC1A 2A30A 1T3SA 4W5HA 2PL3A 3PUWA 4QGAA 4DDUA 2EYQA 1A5TA 1QHHA 1RW4A 1IXZA 4NCJA 5EP3A 2CCJA 2YINC 4BFUA 1CRPA 1NVXQ 1W44A 4HAUA 4OHZA 1VMAA 3RWMB 2IW3A 2WJGA 1Q3HA 4BLTA 3N2IA 4I99A 1IXSB 2J0QA 2Z43A 5E7JA 2N46A 2WJVA 1C4OA 3AVQA 2B21A 3KQHA 4YONB 4BFYA 3U4QA 2ZI4A 1XD9A 2OAP1 2VSOA 2VIIA 3L0IB 5HZKA 5DHFA 2ZI5A 3LW7A 5L3SA 3AVOA 1MABA 4DCTA 1HE8B 2JJ2A 4LYHA 2AN9A 2FEMA 2HJVA 2DPXA 2OFXA 4HLQB 4LDJA 3T15A 2FFQA 2PMDA 4OI2A 3ZVMA 4NU0A 2Z5FA 1U8ZA 1XNJA 3SBEA 4HB3A 3WY9A 3THYA 2F3RA 2WAYA 3CPEA 3DPUA 3K70D 3FE2A 5FTKA 5DGXA 2F9LA 3X1ZA 4IXNA 2W2XA 421PA 3AVPA 4QG7A 2ZYWX 4MKIA 4IOLA 1YRBA 3DO6A 3E1SA 2GNOA 4JLAA 1ODFA 3MD0A 4U02A 1QHGA 2ZRPA 3K70B 4HLUC 1GNQA 3GLFB 3KQUA 1N6HA 1EK0A 1W4AA 4JLJA 3FMOB 4F4IA 4DLWA 2JLQA 2X2FA 2CNWA 2ZYVX 5FFMA 3KXKA 4DCUA 1GWNA 3NHBA 2B8WA 2O8EA 1RIFA 2GKSA 3I1FA 4PPNA 3EZ2A 1W47A 5GJCA 2AD5A 2OEPA 3SR0A 3H86A 4RFSA 4AIIA 1VG0B 1RYFA 1O3YA 1KI6A 3NBFA 4LHVA 5EUMA 4M1KA 1P60A 3GJ3A 4E07A 3SJBA 3OEEA 4A1FA 4LJ4A 2BKEA 1L4YA 1J90A 5B58C 3U3RA 4GP6A 1TEVA 4CRWB 1ZC4A 2AWNA 2WOOA 1BYUA 1N0UA 2IYVA 1Q44A 1BOFA 2ZSBA 4UXJA 4YMUA 3BS4A 3K9GA 5FOSA 4GMXA 3KZ1E 1E3MA 5EXXA 5M04A 3SC3A 2ANCA 1KJZA 3EX7C 2JLXA 3Q85A 1QF9A 3CBQA 1CR4A 5AJXA 3KJIA 4NL4H 5GJWC 4EQ6A 2QTVB 4ZIRB 1CJVC 2CE7A 2D4HA 4Q03A 1S8FA 3UKDA 1JR3A 4D6PA 1M2OB 2ZJ2A 1I2DA 1UKZA 4YC7A 821PA 5E95A 2ZE8A 5KSPA 4KYUA 1UBEA 2J41A 5P21A 4W7SA 3I8XA 4DJTA 1AM4D 3CF2A 3OEHA 3FGNA 3LLUA 3WMGA 2C04A 3UG6A 1FUUA 2PBRA 1OYWA 4CEHB 2HYIC 4C30A 1W4RA 4OL0A 4OHYA 3EIEA 2CBZA 2N42A 2O5VA 4BLRA 4TLCA 2F1RA 2XOKA 4RCYA 3OE7D 1NY5A 3E2IA 5KYKA 2FPLA 4OI0A 3MJHA 2KI5A 4E09A 2VRWA 1ONBA 1Z6GA 1G3RA 3IIMA 3GEEA 3ASYA 1GNPA 5FL7D 1ZIPA 3GJXC 2I3BA 2X2EA 3VR5A 4DLYA 4HAWA 3B82A 5JWOA 2WWYA 3C15C 1EGAA 1UKVY 1OH8A 4B3GA 2Z0MA 1TF2A 1TNDA 4Q66C 4AKHA 4WBSA 2WJYA 2XTNA 3LQQA 4RD3A 3LWNA 3FKSA 3ZIAA 2HV8A 2A9KA 1Z07A 5LDDC 2KBFA 2IC5A 5BN5A 3BH0A 2FFHA 3PEYA 2FE4A 3SU8A 2XNSA 4N0EA 1M7BA 2JLUA 1UM8A 4OHXA 1Q1ZA 3WMFA 3CH5A 1XXHA 4Q4JA 4M0LA 1ETUA 4IFEA 3BB4A 2QQEA 1F2UA 5CLLA 1GAJA 4NCNA 4H9GA 2LKCA 2V7QD 5CIQA 2ZI6A 1OPXA 3KQKA 3C8UA 4PANA 4PPGA 4LBZA 1QVAA 4PHHA 2R65A 5DHAA 2AKYA 4NTZA 1SULA 1VYTA 2QP9X 3AF4A 4NYIQ 1CS4C 2VSXA 2Q6TA 1ZNYA 2IYYA 3FTQA 4ITRC 2NTYC 3VHXA 1VYUA 5A5GA 4QM7A 2J0VA 3BH7A 4B3XA 1G8FA 3X2SA 1E2GA 2QGNA 2V1UA 1E94E 1EG7A 2IUTA 1T5LA 4NZYA 2RMKA 4RY2A 3I61A 3AP3A 3OIVA 2AK2A 1TAGA 3QE0A 2W6IA 2CHVA 1X1SA 3I32A 4NPHA 1G20E 2WKQA 3CRMA 3MWJA 4KCGA 1T6NA 3ADCA 2BCJQ 1G5PA 4DIEA 2CLDX 1WP9A 2YJTD 4LJ8A 4EPYA 3KFXA 2GVZC 4QGHA 2ZR0A 3K9HA 2R44A 1NIJA 4AI6A 4V02A 4V0ME 3LVQE 2ZI3A 3LLMA 1VPLA 2X1VA 1W1WA 1R10A 2GWHA 4KFTA 3VHLB 4AY2A 2FV8A 3TVDA 1XEXA 1E0SA 1FQJA 4DLZA 1N25A 4IDQA 2WIBA 4DCNA 1ZRHA 2BBSA 2BM0A 3IDQA 5AUNB 2JASA 2J7KA 2OT3B 3W6OA 5FR2A 1ZUIA 4PSAA 4IKEA 1Q57A 2NMVA 2F43A 3SEAA 2AWOA 2ORVA 3EW9A 1JQLB 2O8BB 2XTMA 4Z1MA 1NN3A 2NOAA 2WWXA 4A2QA 3CO5A 3QKSB 1R7RA 2G88A 1D9XA 3MG9A 5EE5B 4IHQA 1AK2A 1DE0A 1NVUQ 3SFZA 2P6RA 4Q1EA 4L5BA 3A1TA 2PZFA 4QKQA 3IO3A 4M1TA 5FBQB 4EPXA 4V03A 1XP8A 2Q9BA 5UKDA 3VMFA 2JDIA 4GP7A 3AVYA 2ODWA 3GCGA 4ZCIA 4NDZA 1JR3E 3AV0B 4D4JA 3NH6A 3UANA 4TYNA 1G4UR 1N6KA 1P4SA 1US8B 1W4CA 3GJ5A 5IK2A 4JBYA 2GF9A 3QEJA 3T1QA 5SZHB 2QY9A 1D8TA 4KSBA 4N3NA 1OHHD 1VCOA 2GXQA 2FZLA 1HA3A 1YVDA 4LV5B 1WMSA 1OF1A 2PLRA 4CIDA 1HTWA 1XF9A 4AKEA 2ECKA 1NRJB 2ERXA 2GCOB 1KMHB 2J7PD 4TMZA 2IXGA 1W0KA 1NL3A 3HR7A 4PC3A 2QUZA 2WWHA 5IHPA 3D3QA 3P4YA 4U5XA 1KI7A 1RRCA 1ZBDA 2QAJA 3W8RA 2JLSA 2BM1A 5KPJA 3AGPA 3EARA 1FX0A 2JLRA 1QZXA 2CL6X 4JJZA 5FL3A 3U44A 2ZYUX 3FMPB 1KTVA 4LV6A 4Q1BA 1CTQA 1R2QA 4DLXA 1W46A 1IXRC 4MYUA 1ZNZA 4DRZA 4X8LA 4DWJA 3RS5A 3HDTA 3KXLA 4UJ5A 3VR3A 2DBYA 4PO8A 4KXFB 2ATVA 1ZM2A 1GIAA 1SHKA 3A6PC 1IN8A 1XXHE 4TL6A 2WSSD 1IN5A 3BRWD 3RDPA 1TQDA 2WJHA 3X1XA 4FCTA 3CRRA 3SBDA 1E1QD 1G17A 2JIZA 2O0KA 1E9CA 3SOPA 2C95A 2XZPA 5FOVA 3QXCA 4WZ6A 2HF9A 4D25A 1KK0A 3A4MA 1Q1BA 3IKJA 3CF6R 3CX6A 4PAOA 3AF3A 5L3QA 2LCFA 1HE1C 4ZDJA 1EFTA 4D81A 3RYTC 3BERA 3OF5A 1K5GA 5KDDA 5LB4A 4FXPA 1TPZA 3QG1A 5ANRB 4C7OB 3B5JA 2QMUA 3H4MA 5JHGB 4B34A 3PIRA 1N5KA 1CF4A 1IJEA 4LCBA 1YZLA 5FOUA 4G5OA 1KJWA 2YOHA 4GPTA 4JSTA 3OAAA 4PQYA 4Q21A 4TTPA 2CHQA 1FNNA 5EE3A 1PV4A 2HT1A 3H84A 4WW0A 3BB3A 3QXHA 1TL7C 3GLHB 3SYKA 2VF8A 4PQRA 1LW7A 5AR1A 2P3SA 3AUXA 2ZI9A 3MFYA 3O47A 4EJSB 4XJXA 2QN6A 1M7GA 2D06A 3RWOA 2OBNA 4TYPA 3PG5A 4XWAA 4RZ3A 1FUKA 1YE8A 5JJKA 1LY1A 4AK9A 2ZI7A 4JKIA 8OHMA 2ZRBA 5AJWA 2WWWA 3OESA 4N1AA 4OQLA 2ZRHA 4LJAA 4DSOA 2QE7A 4LOAA 1J2JA 4FWIB 3CZQA 3EXAA 4Q1AA 4Q02A 4YDSA 3UXMA 3ZD7A 2GILA 3L8YA 2IWRA 1QVRA 5LPNA 3GLIA 4EPVA 4KITB 2A7QA 1E2EA 2P2LA 4YDHB 1XPRA 1Z29A 1X6VA 1N5IA 4A0GA 5JJIA 4Q9LA 2RH5A 3LQRA 5EJEA 3T1TA 5AUOB 1VKJA 2NIPA 5FR1A 2OCAA 1KO1A 4C2TA 4F4JA 4C2UA 4LJ9A 4UNSA 1CR2A 2RKOA 4EPTA 2G77B 3S1AB 2CK3A 4JSYA 4XTCS 2HLDA 2D7CA 3AF0A 1NN5A 2VHJA 4GT1A 4QM6A 2RGDA 1OYYA 1OKKD 2ASEA 4QJ3A 1GRRA 2W58A 5FOXA 1OT3A 3R20A 4PC6A 4TTRA 1PLLA 2J3EA 4D82A 3EAQA 4ZDIA 1C9KA 1BS1A 4B73A 2J9RA 2YC4C 4O2RA 1SHZA 1IY2A 1F5NA 5KTYA 2CLCX 4PR0A 4PHFA 4GDFA 3P32A 1CLUA 4IVQA 1E98A 4PXAA 1XX6A 5CIWA 4TQUS 5EP1A 1KNQA 1VCNA 1PUIA 4BLOA 1A2KC 1XD2B 1GITA 1ZM4A 2QNRA 2F7SA 3U60B 2QZ4A 1AKEA 2ZRGA 5J4LA 1ZMXA 2OFWA 3V4FA 4FMDF 1KSHA 2MMGA 3PEUA 4Q9HA 1NF3A 5DH9A 4FD2A 3GLFA 4QBHA 5EXTA 4BFWA 2C8VA 5JWRA 4KVGA 3Q72A 3G0HA 2FSIA 4NKRA 2H5EA 4HZUB 4G5SA 4C0HA 4A15A 1TQ4A 3RS3A 4AYTA 2IYUA 4MA4A 3IHLA 1ZIOA 3NDPA 5EQTA 4DLSA 3IEUA 5KPDA 5CJPA 4Q4HA 4DEXA 5FBRB 2IXEA 3SQWA 3BWDD 3CLVA 3SJAA 1XMSA 5CYPA 1KJYA 3LW8A 1AA9A 3FHCB 1NVWQ 3E70C 4KI0A 2A3RA 3L43A 2ZUBA 4JJKA 5GJVC 5AJZA 1E96A 2EQBA 3KJHA 1E2JA 3PFIA 4HDQB 4YMTA 2H8KA 2A5FA 1AN0A 4DLRA 5FOTA 2IYLD 2QORA 2AX4A 1SVLA 1TTTA 2O0JA 2REXB 4ZI3A 4KLZA 4I4LA 2ZJYA 4D4KA 1DAEA 3JVUA 4A9AA 1JQJC 4FCVA 2KE5A 3O8RA 3EC2A 3CM0A 1D6JA 1KI8A 2J0UB 1U0JA 3RRNA 1CR0A 2HCBA 3DM5A 3ICEA 2DFNA 2ZEJA 4LYAA 3TQCA 2PX3A 2YYZA 2XXAA 4LJ7A 2Q3MA 3A8TA 4GZLA 4JL5A 1M6NA 4LWZA 1AGPA 3MWLA 3NWJA 2ZRAA 4E03A 3R9IA 3GJ7A 1XDBA 2O52A 3GMTA 5FUYA 3THOA 4LC1A 1XPOA 5A0FA 3GFPA 4KO8A 2IEYA 3FWYA 3EWAA 4URYR 4LC0A 1E2NA 1BMFD 1OXXK 2BMJA 2WM9B 4CEHA 1X86B 3U7GA 1NJGA 2C5LA 1KI1A 2UKDA 4MKGA 4TYYA 4Q1FA 1WBBA 2PCLA 4H1VA 3TNFA 1LVGA 2P5SA 3AKYA 5GVSA 1P2TA 2QA5A 4JMPA 4D80A 1GP2A 2H16A 1W0JD 4W5JA 5JS7A 1PJRA 2A5JA 4DXAA 3HU3A 1QDEA 3TQFA 2PMKA 3X1DA 2ZM5A 4PO1A 2MSDB 5AUPB 1S3GA 4YXWD 1KNXA 2VTKA 2J87A 4Z51A 2ZVQX 5FL7A 1COWD 1DARA 4QGFA 2ZUCA 3AGQA 2WBLC 4BRUA 2ZETA 1M1YE 3MGCA 2BIFA 1G8PA 1IBRA 3CUEF 4XSHA 1P72A 3GLIE 1OB5A 3KQLA 1FMJA 1KSFX 2GF0A 3PITA 3QXSA 5F9HA 5DI3B 3NDBB 4URVR 1X8LA 2ZSAA 1GL6A 3HP1A 3LX8A 2IF2A 1TUIA 2I4IA 3PUXA 4LBYA 1RRFA 3LY5A 1G7TA 4EFMA 3U7FB 4OJQA 3ADDA 1Z2AA 2ZSEA 3A37A 2BEKA 2ZYTX 3GJ4A 2EWVA 2GAAA 2G6BA 1Z83A 1S3SA 1GG2A 4O0MA 4D4LA 2VLIA 4M21A 4QHSA 1P7CA 3RRZA 1S96A 1WBDA 2XSZD 4DKXA 5JECA 3M1IA 2HDNB 3PEWA 2ZAOA 4HAXA 2KWIA 2QEQA 3MUFA 3WHKA 1GM5A 1J99A 1JBKA 1A1VA 4DDWA 3R7WB 2D2EA 4ESHA 4ACAA 4BQSA 1AS2A 3LXRA 4CEJB 1XCPA 3B13B 1KDPA 1S1CA 3K1JA 5KNBA 3BIFA 4TQAA 4IRUB 4DLUA 1XRJA 4LZZA 4D26A 4KYIB 2J46A 5IDVA 1DG1G 1G64A 2D3WA 4G5GA 4B6FA 1G9XA 1OW3B 4GRAA 4R2IA 2QPOA 1KZGB 4GFDA 1TF7A 4JLDA 2W6JD 1KI4A 4FWTA 2RGNA 2VYFA 2VEDA 3WNDA 1KDOA 1NVVQ 3JVVA 4LPKA 3GLFE 2NQ2C 3KJGA 2ONJA 2H1LA 5J40A 1KKMA 3HU2A 3P20A 5G3YA 2JLVA 4OYHA 1P9NA 1E0AA 1AZSC 3FMIA 3DZDA 3GLGB 1XMVA 1P73A 3UMFA 4JBWA 1H8HD 3BFVA 1D5CA 2C96A 4NMMA 5TVKA 2ODEA 1T4GA 4RZXA 4D0LB 3DMNA 3RHFA 5B30A 1ZD8A 2EFCB 2I1VB 4L4UA 1II8A 4NCIA 5TB5A 1GKYA 3R8CA 1GRNA 3CX7A 4Q18A 1KY2A 3B9PA 1HT1E 3NXSA 3T5DA 3AP1A 3EZ9A 1UEIA 2IYXA 3CRW1 1J7KA 1NBMA 3M0EA 3K53A 1QHXA 2H57A 4MGZR 2W0MA 1EWRA 2O8BA 3QF7A 4K81B 2CLSA 3QKSA 4V0MA 1XTSA 3VKHA 1LNZA 1R8SA 3DHWC 3I4LA 1A7JA 3QPUA 4B35A 4DT1B 3FMFA 4QOSA 4QGGA 2P67A 3BOSA 2ZSDA 4JLOA 2QMEA 1QBKC 3B1VA 1VHLA 1E2LA 2OCYC 4ZDKA 4Q4LA 3MCAA 3B2EA 1W5TA 3NIBA 4B43A 1DAHA 3T61A 4O25A 4P31A 1WA5A 3EG5A 1XMJA 4QNMA 2XEXA 2G3YA 4IEIA 3V9PA 1US8A 3AF2A 3WNCA 4LV8B 5J4VA 2WWGA 4HB4A 2F1HA 5CJ2A 3AP2A 5LBIA 1LF5A 4TMKA 3QIAA 3L2OB 4L15A 4WAUA 4E22A 1E0KA 3RANA 1Z08A 2ORIA 4PPQA 3TR5A 3MWKA 1BO6A 2GJ9A 2QAGB 3PXGA 2IS4A 4LRWA 1XD8A 2QSYA 1R0XA 4PC2A 4CW7A 3OHMA 4Y0VA 3CR8A 1LTQA 3B60A 1OHHA 2GCOA 4HAYA 4Q47A 5J4YA 2GBLA 1TF5A 4GZMA 1DADA 2VPPA 4MKFA 2WZQA 2REOA 2VHQA 4GBMA 2ORWA 1Z6AA 4ZCMA 2GZAA 4UJ3A 1XTKA 3R8FA 2J0SA 3IPYA 2AXNA 4LHXA 2J7PA 3ND9A 4QBGB 2FPKA 2NG1A 1P62B 5K8TA 2O8DB 4LYFA 5EZ5A 3ADBA 3THXB 2V1XA 1XZQA 3QF4A 3TBKA 5DI9A 1T8UA 3P1JA 1V43A 1KI9A 2XGJA 1DELA 3TW8B 4DSUA 1DAIA 4XVQA 1AQUA 3MWYW 3TUIC 1CJUC 3DKVA 4JS0A 4XSGA 1QHIA 2O8FB 2BOVA 5HCNA 3THWB 1G8GA 1KDTA 1YZTA 2OBLA 4CT5A 2FDCA 3A4LA 2WICA 1T5IA 5FUWA 1MKYA 3QBVA 4BRWA 5KSYA 5JI2E 3OIWA 2ZANA 1AS0A 4KAXA 3K0FB 2WSSA 3O8CA 1KSGA 5JZVA 2EFEB 2EW1A 2ZR7A 1KI2A 4C0BA 4KBFA 4C4PA 4B3CA 4BECA 2GRJA 4JLMA 4NYMQ 2WTUA 4IVPA 1Y63A 3J81k 1WB9A 3Q5DA 3TUJC 2GAOA 5FPYA 2IT1A 1IHUA 1Z06A 1G291 3SZRA 4KU4A 3EZ7A 4B2IA 1AZTA 1E9AA 3RSLA 3ND8A 1KO7A 4B76A 1IY1A 4XIGS 3EPKA 1G7CA 1RZ3A 1T9HA 1F48A 2BC9A 2JA1A 2O0HA 4J0QA 5D3MB 5JCZA 1ZM7A 1MRSA 3GLHA 1ZVQA 1R5BA 3G5UA 3LV8A 2YNMA 1ZNXA 5FOWA 3CNLA 4CDGA 1G3QA 4US2R 4DUGD 4A8JC 2GJSA 3IGFA 4URWR 5JCPA 2DWQA 2XB4A 4YLGA 5JWHA 1E4VA 5CK4A 2FSHA 3REFA 5DLQC 4ZPXA 1L7VC 1KY3A 2TMKA 1R6BX 2XTZA 3BFXA 4HLDA 4WVFA 521PA 3HPRA 3IO5A 1L8QA 1JJ7A 3W3ZB 1YZNA 2C03A 1GTVA 3Q7PA 4V0OA 3RRYA 1G18A 4GL2A 2AKAB 4L9SA 5C2JB 1GKIA 4DB4A 1R0WA 3MAAC 4M9XA 4URXR 2ZRFA 1RE0A 5DN6D 4BPBA 5IRCD 4TZ6A 4H1UA 3K9NA 1YZUA 2KB0A 3REGA 3CB4A 1TADA 2W83A 4DVGA 2CDNA 4AKGA 1OFUX 2Q3HA 4RD0A 1VTKA 3KFVA 3CKLA 1CULC 4DBLC 4YMWA 1NBME 5F3WB 1E9FA 2ODBA 1N6NA 1NP6A 4LBVA 4URZR 2E9SA 2RHDA 1QHHB 1DTSA 5FTNA 4PO9A 3RAPR 5GJBA 3LD9A 4S35A 2GVDC 4JZKA 1E79D 2QM7A 3QVUA 3QKRA 1WDTA 2OFOA 1FOEB 4HYYA 1OKKA 1G16A 2XZLA 2JJ2D 1XMIA 3L0PA 621PA 1U90A 3U4QB 3KJEA 1CXZA 3GPLA 4XD7D 2ERYA 3JZAA 2IYTA 1SVSA 2VQSA 1Z5ZA 4PC7A 4MYCA 3U3JA 1N6OA 1GSIA 4A2PA 1XD2A 3WMEA 2HF8A 1NKSA 3TSOA 1IY0A 3B1ZA 1LFDB 4IEEA 4LBWA 4Q4AB 2V9PA 4ARZB 1E2DA 3TIFA 1II9A 4G5QA 1I2MA 4Q7LA 4NH0A 1W36D 3FB4A 4EFLA 3K0AB 1NG1A 2R8RA 2WKPA 4N0DA 3VR1A 2NPIA 1ESNA 1OIVA 5CK5A 1KDRA 1NN1A 1W36B 4HZUA 3QXJA 4AC9A 1ZW6A 1HY3A 3ZQJA 1PLKA 5CDFA 5EE1A 3G82C 1E9RA 2JEOA 5SZIA 3U2QA 1Z0JA 2ZRIA 3ZH9B 4CYMA 1S9DA 1PZNA 3EPLA 1TX4B 1T8TA 2QRNA 4M1MA 4DIDA 3KTAB 1P9WA 4B75A 3ECCA 3AQ4A 4MITA 5B57C 3FFAA 4RFSB 5LD2B 4R9UC 2J1LA 3SS8A 2DY1A 4M4SA 1XFAA 3GD7A 3NEYA 2R9VA 2VO1A 4Q7JB 4C0JA 2ZIAA 5BXQC 2ZITA 2R6CA 1U0HC 3IILA 4P4SA 1NNEA 1T0HB 2ZR9A 3IIJA 1ZD9A 1KMQA 1JAIA 2HXYA 2X77A 5DO9A 1IM2A 1VHTA 3X1YA 3CZPA 4A8JA 1P61B 5JBQA 2ODNA 1GUAA 5F9FA 2OSBA 3EPHA 4F4CA 2VP0A 5CLQA 4ASUA 1N5LA 4QHYA 2KJQA 1D2NA 1BKDR 1DAMA 3Q7QA 1ZINA 2RGGA 3H0KA 1QHSA 5TXGA 2DWPA 2VSFA 2FFAA 4KV9A 3QPWA 3EIHA 3LH5A 1D2MA 1OXVA 1UBCA 3QY0A 5E7IA 4JYBA 1AQYA 1SXJD 2C77A 1FZQA 4TTQA 5EP4A 5FI0B 5C4GB 1H65A 4DCVA 4YQFA 1GRQA 2ZE5A 2GTPA 2JJ1D 5AUQA 2J45A 1SXJB 3A58B 5CM9C 2X8AA 3K70C 5JRZA 2G0NA 1UKEA 1QG4A 2XB2A 3T34A 3MSXA 2WWFA 1DBSA 2B8TA 4MRRA 1E2IA 2HT6A 3Q8XB 4NCHA 2JLYA 2Z6VA 4KODA 2F3TA 2WJJA 2MMCA 4F7WA 1ZNWA 3D7MA 1TMKA 3GLHE 5BYJA 721PA 5DNYB 1UDXA 1HURA 4KFSA 2IL1A 2QP4A 2QTFA 1RJ9A 2QPAA 4BEBA 3ICQB 4PAMA 2OG2A 3SYNA 2BHRA 3C41J 1Z28A 1BH2A 4AD8A 5H68A 3VR6A 3IIKA 2W00A 2BBOA 1G8YA 2P5TB 4RCZA 1W0JA 4NP6A 1GDDA 3C14C 4HDOB 1VCIA 4V0LA 5FPKA 3UG7A 1NN0A 1N5JA 4Q00A 2NZ8A 3FKSD 1KIMA 3ZIAD 2EU8A 1IN6A 5BN4A 4RD1A 4D0GA 1TQ2A 1COWA 2H7VA 1H8EA 1D2EA 4O2LA 3WHLA 3NBZC 5HE9A 3QKTA 4ZKEA 2RGEA 4I1UA 2OXCA 4IDHA 2ZU0C 4E5UA 5KU1A 2ZJBA 5KDLA 1MO5A 2ATXA 1OFIA 1XXHB 4Q4JB 1OH7A 2WAXA 4A0HA 1FP7A 3B1XA 2CVFA 3LAWA 2GZDA 2BMEA 1F2UB 1XU4A 2MSCB 3AEZA 2XAUA 2YWFA 1WCV1 2LKDA 3AM1A 3PUYA 4A6PA 2PJZA 2WVJA 5A4JA 2QM8A 1VDZA 2VL7A 4KBGA 1DO0A 1KOFA 4F93B 1NKTA 4CEJA 2XNDD 3VAAA 1WXQA 4DHEA 2KBEA 4R7ZA 1SKQA 2R6DA 2DYKA 1U8AA 1VIYA 4EDHA 4DSTA 4MRNA 4AURA 2B7BA 4FIDA 3FHTA 3RS4A 3ZZ0A 4B6EA 2QQ0A 4GNKA 2IF0A 1SVOA 1Z6YA 2QP3A 4JL6A 4M1OA 3PVSA 1J70A 1MOZA 4I81A 3TKLA 2FSGA 4BZPA 4HATA 1Z47A 5FPSA 3KKMA 2ZE6A 1U2RA 3RNLA 1N3BA 1FW6A 4IDOA 1Q1EA 4OHVA 2A5DA 4TZ0A 1OXUA 3F8TA 4IDPA 2F9MA 1YJ5A 2ZTSA 3P27A 1ZCBA 4URUR 3HU1A 1UKYA 3WYFA 1P75A 5HTKA 2PLFA 2RAPA 3GLGA 3I3SR 4RD4A 2XJ9A 4RVCA 2IYZA 2JGNA 4M8NE 1EWQA 3QNUA 5CDFE 4HUQB 3VQTA 2VP6A 2X19A 3HR8A 1ANKA 3NVAA 3ETLA 2B7CA 3GQBA 1RKBA 4B32A 4BZQA 5K8UA 5JJLA 3M4YA 4OHWA 4US0R 1CIPA 1FPMA 4M1WA 2OXRA 2QG6A 1H8HA 1XEXB 4MRVA 5SZJA 1Z3IX 4QXAA 2Q21A 1G6OA 2FEOA 3I5XA 1F3OA 4R2HA 4AKIA 1PLJA 3L82B 3W6NA 2ZSFA 2W0SA 1VECA 2VHCA 3DMDA 4NONA 5EUQB 2VHUA 2CJWB 4Z54A 2IHBA 2YOFA 4A92A 4OQMA 3ZQ6A 4DT1A 4B47A 3LNCA 4JLNA 4TMWA 1FMLA 5SZKB 3K0SA 2OUKA 3BE4A 3SN6A 2H92A 1FL9A 2XX3A 3UIEA 4PSKA 3LXXA 4AYXA 4C0SA 3L8ZA 3KB2A 4QRHA 3B7GA 3LRPA 4S2EA 1E32A 2KSQA 2C99A 2RHMA 2JDID 2RGXA 5HKKD 4LHZA 3SI7A 3PUVA 1DO2A 4WIAA 1J8MF 2FU5C 4BEJA 1U9IA 3LDAA 2R6AA 1R8QA 3QVVA 4ILEA 4EPWA 4PFSA 2GESA 2OLKA 2HEIA 3QQ5A 4B3BA 3LX5A 1UBFA 4P33A 4LYJA 4Z8XA 2RGNC 4TMXA 4TL7A 4JBXA 3KUDA 1RYHA 4BFSA 1XTQA 5J5CA 5FUVA 3UWOA 2D62A 2QAGA 2FPMA 1M8PA 3AF1A 4QBIA 2ZJ5A 4Q9KA 3X1WA 1W0KD 2IYSA 3IHWA 2YV5A 1I4LD 1VCMA 2DCUA 3VNVA 1LF0A 3FHOA 2GHIA 4HZIA 4BLPA 4CZ2A 4ZIRA 3U6KA 4W9MC 1K5DA 4LK2A 4PQFA 2ZRDA 5JI3E 5HZHA 3AVWA 3RABA 3QBTA 2QSZA 5CM8B 3QUSA 1X8JA 2PT5A 3W34A 4RKFA 3TSWA 5JRJA 4C0LA 3NBXX 4RKEA 1XWIA 1WF3A 2ZXUA 3THXA 2V8OA 1E9DA 2E87A 3MRSA 5DYGA 5C1BA 2GK7A 4Q9IA 4TT3D 1MH1A 2OILA 4P0TA 1VG1A 1XJ0A 4ZCLA 1P6XA 1N0VC 2JLWA 1AIPA 3LA6A 3U5ZB 2F55A 2AD1A 4XWOA 2NGRA 4TLAA 1YQTA 4Q5IA 2RGCA 2ZS8A 2BJWA 2OM2A 4F38A 3GJ8A 2O8FA 3OFND 2WPDD 3OE7A 1XEWX 3BAFA 2J59A 1B23P 4M53A 4BGDA 4BZXA 3KXIA 1EX6A 1SVWA 2G1KA 4JT2A 5J4KA 1CP2A 3R9XA 1ZM3A 3K0FA 3QENA 3U61B 1N6LA 4G3XA 4GI7A 4ABYA 3MMPA 2Z4RA 2DFLA 3Q3JB 4L8GA 5K8LA 4I1SA 1XBTA 3DZ8A 2BKUA 4MKHA 1PVOA 2DB3A 3U3MA 1KKLA 3V00A 4KFUA 5CB6A 2GXUA 2JAQA 2BDTA 1CJKC 1Y3AA 3GJ0A 2OCBA 1ZP6A 4V0NA 2YKGA 2GEUA 1NMXA 2DWOA 5G41A 1HYQA 1DPFA 3CH4B 1I4TD 1G6HA 4LI0A 5FI1B 3WP0A 3NG1A 1TEXA 5TV2A 5TY0A 1JALA 3K0CA 2GBLC 2HCJB 5D3MA 1E6CA 1CBUA 1NLYA 1SGWA 1OXSC 4IXMA 1Z0KA 2OESA 3FOZA 2VF7A 4JIMA 4B33A 5L3RA 3VU9B 3RRMA 2V7QA 4MQBA 2IYQA 1EFCA 3PENA 3KKOA 3SJZA 1CKEA 4Q7KA 1SKYB 2E1RA 4XOIA 2QL6A 1QRAA 3A1UA 1Z22A 2GZHA 3N2EA 1T3HA 3SJCA 4QNRA 2QE7D 1E4YA 4DUGA 1EFUA 2C9YA 1XCGB 3HWSA 3ZD6A 5AJYA 3K0EA 5JS8A 3K09A 5JEEA 1JECA 5JHHB 4PZYA 3PUZA 1ESMA 2RGAA 3W90A 3GLGE 2R2AA 3T1OA 4LHWA 3TUZC 1NY6A 5E3HA 5K8IA 2CEAA 4ZV4A 5JFGA 1JJVA 1IOZA 1FP6A 3PV0A 2Z4SA 1G21E 2WMNB 4TSFD 4OK5A 2NO1A 4Q7MB 3CPHA 3D31A 2VP9A 2QT1A 4LGMA 5KDOA 5DN6A 5TMPA 4K46A 1GL7A 2JATA 2CK3D 4PTLA 3VKGA 1CJMA 2QU8A 2HLDD 4G01B 3EA0A 4WXRA 4JKYA 3FDIA 2GK6A 2R62A 2ZUDA 3DDCA 4P4UA 4ACBA 1LV7A 1U94A 1JR6A 1Q22A 2ZE7A 1E99A 3DL0A 3FKQA 3RLFA 3TLXA 3JZMA 1Z63A 3FFBA 5GVRA 5BN3A 5TDHA 3GP8A 1CU1A 1FQKA 1WRBA 3DOEA 4C9BA 4D2IA 2ZRKA 2ZS7A 5KHOC 2Q0HA 2GXAA 2R6FA 1E1RD 1ZD1A 3RS0A 1GILA 2AR7A 1XZPA 1U8YA 1UADA 4RFVA 1E79A 1S9HA 1YZQA 2QMHA 1XJCA 5BYKA 5FPHA 2XJ4A 1BYIA 1L4UA 1G5RA 2L0XA 4HSEA 5DIFA 4BLSA 1U99A 4LJ5A 5JEDA 1OIXA 2UZ3A 2ZROA 1KZ7B 3VR4A 3BD9A 3NEJA 1UJ2A 4FMCB 4XD7A 4EJSC 2C9CA 1OXTA 1JEDA 2GJAA 2P0EA 4Q4AA 4TLDA 4IOKA 1IN4A 4ARZA 2NO7A 2FMXA 4CEIB 4A6XA 3EZ6A 3E5HA 1ZJ6A 2I1QA 3K0AA 1K8RA 4QJ5A 2IX3A 4KVAA 1W49A 1PUJA 4A0RA 2NZJA 1VIAA 1XB2A 4NE2A 3M6AA 1JPJA 1KGDA 1YU9A 3KKNA 1RPZA 2CCGA 4OI4A 3PJRA 3ZDQA 1L2TA 4P3YA 5B64A 5C18A 4ESVA 2QTHA 2FSFA 2QBYB 5IT5A 4F92B 2AFHE 3K8YA 1XTJA 1G41A 3C7KA 1JPNA 3LO5A 3N70A 2VHTA 3LBHA 1A2BA 3LVRE 4JLKA 2EYUA 3UWKA 3KTAA 4NHOA 1KAOA 4CGZA 4GOJA 4Q4HB 1DAKA 4NYJR 5JSZB 3KKPA 4G0NA 2PEYA 1E2FA 4MGYR 2IUSA 1E0JA 2YWHA 1P3JA 4RD6A 5FBWB 5BWMA 3GEIA 1W7AA 1ZC3A 1KMHA 1NMYA 1GZSA 2CL7X 1KI3A 4TN1A 4OQNA 4MGIR 5ELXA 4CVNA 2QT0A 1F60A 1Q21A 1JI0A 2W2VA 3CF0A 2H18A 3ASZA 3CNOA 1N6RA 2B6HA 3I62A 4ZI2A 3N5CA 2HXSA 4JT4A 3OIUA 4DEYA 1B0UA 4KSCA 1XTRA 1KSJA 3T1VA 4I1VA 4Z8YA 1QHNA 1R0YA 4R71A 3IQWA 1HUQA 1YHNA 1QHYA 1F2TB 4U00A 3WRYC 2XXAB 2JCSA 1JNYA 1HV8A 4FINA 3B8HA 1MV5A 5FTLA 3UMRA 2GDJA 1SXJA 4DSNA 2GEVA 4LHYA 2DFKB 3QEOA 3A36A 2F1IA 4HDCA 2WV9A 4M2LA 2EFDB 5FTJA 3U7EB 3A1VA 1X8KA 2JJ1A 2A78A 2ANBA 4EPRA 1D9ZA 3QSYA 3DEFA 4LY6A 2WOJA 3P26A 4UNPA 2D7DA 3PEVA 5EZ6B 2QMOA 1TU3A 1DG3A 4B2PA 1E1QA 5JMTA 3C5HA 1IN7A 3IBGA 2OCPA 1V5WA 1OH6A 2IS2A 1YR9A 3B1WA 1R5OA 1ZU4A 3AKDA 3CWQA 3VFDA 2Y8EA 1GL9B 2FZ4A 2WJIA 2CCKA 4UNRA 2ZRNA 2C9OA 2FGKA 4C7OA 3WNBA 3RS7A 4HB2A 4PZLA 4MRSA 2OBMA 3K9LA 4DC9A 4PSVA 4W5WA 1U98A 2RB4A 2V55B 4U7DA 5B2ZA 3GFOA 1ZUNB 4MUAA 4EIWA 1KO5A 3AKEA 1JXOA 3TMKA 3UK6A 4EJSA 4EUNA 4LX0A 4MH0R 1KHTA 5JLJA 2IUUA 3ZVLA 1EFRD 1EFHA 2ZQ5A 3B78A 5HE8A 3QJYA 1R4AA 4BFVA 2O8CB 4BUJA 1VYVA 1Z0DA 1WE2A 2Q3FA 2YVUA 4WXPA 2GXSA 2V6IA 3L0OA 3NBYC 4QBFA 3NKVA 5LB2A 2NO9A 4TYQA 4B2LA 1Z0FA 4HLUA 4BFZA 1NVVR 1NMZA 1P9RA 3TAUA 3DKPA 3QXXA 1J8YF 4QC2A 2FOLA 5EE0A 5J4HA 5FPTA 2QGZA 2D74A 3CWZA 4IOJA 5G3ZA 1DAGA 2CHGA 1AGRA 3C5CA 1RFLA 4UKDA 1NJFA 4IVRA 4OK6A 2BJVA 1UAAA 1KYIA 2IHYA
chains in the Genus database with same CATH superfamily
1OFHA 2H5JA 4S1NA 5ITSA 3DDNA 1GPNA 3CURA 3RIHA 2J08A 4QUAA 2WVHA 2JGDA 4P08A 3OO0A 2JFZA 4KQ1A 4AUKA 2PO5A 5AOVA 2Q4EA 4ECAA 3UAVA 3ROXA 3AZQA 4MWTA 4ZAVA 1OH5A 3SHFA 1JJBA 4ZANA 2C2WA 1B26A 4ZYTA 4XWGA 3GLSA 3M5CA 4TLEA 3PZRA 4WY5A 4BNYA 4XAQA 5CDSA 4RU1A 3C97A 2ET6A 2H1FA 2OGUA 1E9BA 2Z2KA 3FMGA 3IUQA 3O4RA 3Q5EA 3SZGA 3PDWA 1NLFA 3FBTA 1HYGA 4J6FA 1TKBA 3FPAA 1VRCA 3S3TA 3JTMA 1SIOA 1YR7A 4MO9A 5FAXA 5LM3A 4US1R 3AQIA 2ZRCA 5ALXA 4KIJA 4U7HA 2WZCA 5IN5A 4MAAA 1CB7A 3EOAI 4NK4A 2DR3A 1PNVA 4E5KA 5BW8A 3ME5A 1JXAA 4P3NA 1FVHA 4L9WA 1Z34A 2VJPA 2YVAA 4Q6BA 1QIDA 1SUIA 3W9YA 5PNTA 5L3SB 2A1TS 1PEKE 1QTNA 1QB7A 3AKCA 1M54A 4V1CI 3QU7A 3VYVA 1UWCA 1SXGA 2OHGA 4A4DA 3GT3A 1SBNE 4YAUA 5B6JA 3HE3A 4X8HA 1GDTA 3Q10A 2OGTA 1P44A 3CW8X 4IIBA 5A3JA 3RO7A 4PAQA 2XUKA 2VDRB 4K9LA 8ABPA 1FJHA 1Z37A 4AZTA 4X8MA 2XR1A 4IJ6A 4DLTA 4Q93A 1X42A 3H04A 3DVRX 1MFZA 2HZ7A 1IUNA 1CJTC 4OQFA 3U13A 2ZJAA 3L77A 2J6IA 4YCJA 2JARA 1EP9A 4N01A 3ZS8A 1P2BA 2IH2A 5CR9A 3ET4A 3ZS9A 4UBOA 2YHSA 3LK7A 3ROPA 4WHMA 1GOTA 4KPYA 1H9CA 1F6BA 1FVFA 4PYJA 3A9WA 3I2FA 4PGGA 4UW9A 1UIRA 4GICA 4Y2PA 4B3RB 4M22A 3LBNA 1KP2A 2HUPA 1V39A 1JYSA 2PH1A 3PCRB 2XODA 3PFFA 3GZ4A 4M49A 3DD1A 2TECE 4OJKA 1EUQA 1A69A 1VE7A 1WSDA 2COKA 2O7QA 1PIWA 2BFWA 3CW2A 3G8YA 4OGLA 4X8OA 4XASA 4MV3A 4BO7A 3CUYA 4OKSA 1P19A 4INOA 5K3FA 3FUVA 2NO0A 1UDWA 2BFCA 1JG4A 2AI1A 2NO5A 3EULA 4W99A 4X45A 4X3CA 3P2MA 5ERGB 1CUVA 3TLMA 5KNCA 3WHIA 2DJ5A 3A4IA 2CLOB 3HBAA 4RJLA 5D51S 2O3QA 1DCKA 1E9EA 3AUYA 5B3AA 3T3PB 2ZWVA 1DQZA 2N1BA 3IXQA 1MO3A 1E6WA 2LIPA 4XWTA 1NJ5A 3FUXA 3W2FA 5FT9A 1C4XA 2AFIA 1F8GA 3H1GA 1TO2E 2B0JA 4I19A 3EWSA 2VWGA 5FBVB 4HLCA 2XVXA 4PLGA 5F64A 3RTGA 5I7WA 1BDMA 2VDWA 1Z6TA 3GRVA 4W1SA 2OCIA 1RZUA 4XYEA 1LVUA 2BTQA 2V45A 4CN8A 5CB8A 2VR1A 2WSBA 4ROTA 2P8SA 3L7DA 2J07A 1SVKA 4A3SA 1E7YA 2BMDA 2HY7A 3NIDB 2CBXA 4CDRA 4IV8A 1G8SA 1M8KA 5IAAA 3DDUA 2D5AA 2VWPA 5JO0A 5CX4A 1YNOA 3LYLA 4MAFA 3AX6A 2G4LA 4C7KA 1ZOOA 2PZGA 2R8ZA 1S4QA 1VDMA 2XUGA 2YL2A 2P9TA 4HNQA 1HT2E 2NVWA 3FD8A 2BMFA 2FX3A 1NW4A 5ECDA 4R16A 5G1PA 5K0EA 1BXGB 2PXXA 5BQ5A 4BB5A 1KK2A 2EV9A 2Y05A 1MOQA 4IJMA 4RLHA 4LJ6A 4RJKA 4U2DA 1QZ3A 2HA5A 3U4AA 2PGIA 3QF4B 2J8ZA 5IBCA 2IS6A 4WGGA 4HYTA 4Y2UA 2ZJ0A 2X0KA 4Q9JA 3RKRA 3BWCA 3C8DA 3ZVRA 2H5IA 3W4IA 5BR1A 1RYZA 5KEIA 5GM2A 2HFJA 2J3HA 1KQNA 3LG2A 3R0QA 1Z2DA 1R0ZA 3ON5A 4P7GA 5KMGB 4JIGA 3JD3A 4UOQA 1KDYA 3BILA 5FX2A 3C4JA 4WZBE 4AJLA 4UTPA 3VKWA 1WQ1R 2WMOB 1G98A 1H4QA 4KB5A 4MKXA 3KIPA 4AWXA 1LLDA 3HEBA 4Q19A 5BYBA 2CXPA 1QQBA 3FTNA 3TIVA 3VZDA 4B1FA 2ZGVA 3AESA 1KYTA 4G1VA 4HFNA 4YXWA 1U2ZA 2Q4BA 4Q3NA 4CJXA 4NZOA 1MPTA 3I1YA 4JP3A 1Q50A 1VL8A 3H4TA 4UPDA 2YOGA 3W3AA 3GMDA 3ZK9A 1KK3A 3ZH2A 4CCAA 4NZNA 4O33A 5ALIA 1YJXA 3HUDA 4MUBA 4NWIA 3J80A 1KH2A 1CQPA 2BHLA 1JF8A 3CONA 1K7CA 5JBNA 5KUTA 4INAA 3KUCA 4II7A 4D02A 2XA9A 1LJUA 2RJ3A 3VDQA 3FVQA 1QOZA 1Z5UA 3A2MA 5KHLB 2WB2A 3ZGXA 3ZE7A 2HU7A 1C1YA 2DUUA 1FS4A 1K3UB 3O8DA 4NESA 4OHPA 1T1JA 1CIVA 4JT8A 1BE6A 4YRNA 1K0FA 3RSOA 1H2BA 2PFGA 2VS1A 1H2EA 5BV0A 1KJNA 3WYBA 2XSZA 3HNOA 1LBHA 4I1OA 4ID3A 3QKUA 3R7WA 4H6WA 2DC1A 1CUHA 1SZPA 1U8CB 2VZ0A 3B36A 2QRLA 4MRMA 1WB5A 2I2FA 3QOFA 5CMLA 5THQA 4O4LB 5BSMA 2ONYA 5EXEA 2YFKA 3B6EA 3HB4X 2XEDA 1E2MA 3ICVA 1NT4A 1ZJ5A 3M1YA 4FP9A 4O3FA 4QOGA 4S3MA 4RYLA 4RESA 3TPZA 2IEBA 5ARCA 1FDVA 4D4IA 1KORA 1ZEJA 1T3LA 3HDQA 4IOMA 2PIAA 3EOBI 1DBWA 1EH5A 2ZFUA 3KZVA 4RD2A 5K4GA 2IWHA 2Z2XA 4UU8A 4RORA 2W6ID 3Q9UA 2R11A 1W5SA 3PC2A 4HS9A 3ZYCA 4UZEA 5KNDA 2Q0SA 3H0CA 1KEEB 3E22A 3VC1A 4KN9S 3H2YA 4IZ6A 3LGXA 3QOWA 4DV7B 1XEWY 4N5LA 5LZ7A 3C16C 2I6TA 5A5EA 4FYYA 2VTEA 2AN4A 3G7UA 3T35A 4B3FX 2NVUB 4QPNA 1DV1A 4HF7A 5CYOA 2FW8A 3OWXA 4LQLA 4MI6A 4JI7B 2GQ0A 3ESCA 4J0KA 3RTBA 3SHWA 4H4EA 2XUPA 1UFQA 1X94A 4PSUA 3C7CB 1YF3A 3HA3A 3W6PA 2EEZA 4ZDWA 2W48A 4FXOA 5TQ2B 3T4EA 5EIXA 4NBRA 5AKHA 1AKYA 1LDYA 1Y9JA 2ZYGA 2WQZA 5IW8A 2W70A 1OT5A 2DR2A 1RI4A 3W5VA 2R1VA 5C8VA 3QKRB 3IQIX 4NCKA 2F3QA 4EG6A 2C8LA 3NCTA 5JPDA 4HAVA 3MCUA 2PZBA 2YYYA 3OPXA 1E1RA 4I55A 1ZH2A 4TWRA 2G1JA 1KJJA 2A2ZA 3DEYX 1G19A 4F9EA 5AVYA 5JNVA 4Z1MD 4TMVA 3A2KA 1J1IA 6Q21A 4UBKA 3DH0A 1MXHA 3QE4A 3NKLA 5EXDA 4QECA 1CUZA 4NV3A 2Q3DA 2F43B 4XWKA 1S1MA 1KYXA 1LS1A 2AFIE 3B9RA 3KHKA 1HZJA 3D6NB 2Z1NA 1HEIA 3UXEA 4HEA1 3W9UA 1YS4A 1EVKA 1B8UA 4Y9TA 4CIWA 4YDQA 4O2BB 5AW9A 3RVBA 4LJYA 1N5RA 3UOAB 5IFLA 2NTNA 2NAPA 3L1JA 1LWOA 3R4CA 5FA5A 3WNQA 2J9FB 4DR1B 4TMTA 3WGNA 3K09C 1S5PA 4CLRA 5FEMA 3EVEA 2V5VA 2WFZA 4KXMA 3ZJYA 1L5NA 3B9BA 3NUQA 1HH4A 1PSWA 4X94A 3SNHA 4N65A 4XX1A 5BOSA 5P8WA 3DOCA 2PYIA 2YFHA 1B8NA 1RCFA 3ZZMA 2PSEA 4YR9A 4KE8A 5CTAA 2AEJA 4LTNA 2I6QA 1EK2A 2AXPA 2OKGA 3JQ7B 4K2AA 4MS1A 5LMNB 1X15A 3SBXA 3UOGA 2UZ1A 4AMYA 4EG8A 1RLTA 4TKZA 1ADYA 3TVTA 3WB0A 5KQMA 1T34A 3AHEA 4OJTA 4R1OA 1W4ZA 5JSZA 3UJAA 3ZWXA 4FYKA 1VG8A 3DF9A 4M88A 2X7HA 1JU3A 4GMDA 1UPTA 5LFAA 2H9YA 1OA0A 2I2DA 2YVLA 4TROA 2ZTUA 2IP4A 4PGAA 2IHNA 1PYOA 1K9SA 2X8WA 2COEA 4X62B 3ZXSA 5DTJA 1P5FA 2EHDA 3KEOA 3QFHA 1E2PA 2R6JA 2OL4A 5GWXA 5JD4A 4N3CA 3TSZA 4MYTA 1LBIA 4AKSA 1BDIA 2BI7A 4QVGA 2FX5A 1P2VA 1PWXA 2D0OB 2YIMA 3T12A 4A8JB 4BQRA 4C0KA 4PICA 4TRRA 4U2FA 3UV7A 4N82A 4AJEA 4Z6KA 3IERA 2Q2OA 2Z58A 1C3OA 3VX3A 3PFNA 1D3AA 4R9SA 4RGQA 4WCFA 4ZK6A 1U0NA 3CINA 1UC8A 2PCJA 4DDTA 5CB4B 2IZZA 2OYSA 2PSSA 2UVQA 3QEKA 3LLCA 4I9UA 4QICA 1YIAA 4ZVRA 1BTOA 4OXYA 1NYLA 2E5WA 4KXVA 1ZM9A 4U2KA 3F2VA 1CP3A 1U0LA 3K3PA 3G0GA 1QONA 3SFVA 4G0QA 2ZUUA 1KJ9A 3PQ7A 2NPFA 5JAIA 3OF3A 4IDNA 3AVTA 3AWDA 2IK8A 3THWA 3BJEA 5HQJA 1VHDA 4R1QA 3UAGA 1R5NA 4FMCF 3HLKA 1QLJA 2JIZD 1LNQA 3GUZA 1S2GA 1AE1A 1ZNQO 3BEDA 4BVKA 4HDRB 1G8HA 2IZ5A 3KSAC 1J8QA 2JCBA 3C7TA 1NLZA 3ZHBA 4YAOA 1BA3A 2XUFA 4PHTA 3ZHCA 3PR1A 4WNAA 3H75A 5E2BA 1C3EA 1YDEA 1RC8A 3GCDA 1IAVA 1L7NA 1JZTA 5DP2A 2O3UA 3QUBA 3F5SA 1JBEA 3S7TA 3TL3A 3UY4A 3IBYA 1TE2A 5FQNA 2ZRJA 3SFZA 3LUHA 2BV3A 2G0TA 2OG1A 3HO6A 1OAOC 4ZICA 2XCRB 3BD8A 3ROMA 1G7RA 5EKTA 7GPBA 3GFBA 5EXSA 2CXXA 4YMLA 4BXOB 1H2HA 4RAOA 4KR9A 3E8MA 5LD2C 4G37A 2FNAA 1WOMA 2FN4A 4BNJA 1I3LA 2HNKA 4FYWA 2FR8A 1R6DA 2OBBA 4RKWA 5BN4B 3PC8C 1YZKA 3CIOA 4LECA 1PK9A 3BFKA 4OQDA 4QYMA 1WUYA 4CF7A 1IZZA 2WHXA 1XXLA 2CMGA 4Y2JA 1UFRA 2OBYA 2BEJA 2Q9AA 4HI0E 4QHTA 4G36A 1A5BB 4AL4A 3KLPX 4ARBA 2DHRA 2ACWA 2J5XA 2BE9A 1TU4A 4OLFA 3ABOB 4XJTA 1XELA 3C5VA 1PYGA 3DLPX 4JJ7A 1N9GA 2FW6A 1LB1B 2Q50A 3G2KA 4B48A 3CUKA 4V0KA 4EECA 4KP7A 2HBZA 1ID8A 4K8OA 1FEZA 2X0IA 4UHFA 5J2TF 4L07A 1KU6A 3NT5A 3PXCX 1M2VB 4H2DA 5KSOA 5ALWA 3T0IA 3RVQA 1UJMA 2CV1A 1ECFA 1RZRD 5IWCA 1CEYA 2CLIB 3OTWA 3CR7A 4ITVA 1CY2A 1FFEA 2JFGA 3WIDA 3A4TA 4RK6A 2GUWA 4FFPA 3CCCA 4XJVA 3NALA 3BMCA 1SXPA 1M1YB 4XDZA 3RYIB 2FPOA 2JLCA 3OZAA 3L0SA 4K1XA 4ZAGA 3H0EA 3RBZA 3M6XA 4OBEA 3R5JA 3KQNA 1YVRA 4KR6A 2VPTA 2XYQA 1UJCA 3OCZA 3NAMA 1JKXA 2P2NA 1U0BB 2JJ8A 2VJBA 1WNFA 3GLVA 3KLOA 3VZQA 2I03A 2ZPTX 2CKMA 1M5UA 5EXPA 1I4DD 3HSSA 3WG9A 1U1CA 2VDNB 3D3WA 1XTIA 1DIRA 2X5OA 3H1TA 1GQRA 1PWHA 4PC1A 1T3SA 1YSCA 2G06A 3PUWA 4QGAA 2PT9A 2VBGA 4KH0A 1L5VA 4FBGA 5G1NA 3TI9A 5BP7A 4L7QA 5DDIP 2ZWMA 4D9EA 4EHKA 3WLSA 1URPA 3DUFB 3L6UA 1DKUA 2WJGA 1W76A 5DBIA 5DGIA 3GRPA 1EFVB 3PT9A 3HDHA 4N8SA 1I4OA 2WJVA 3KT8A 2IZ6A 4B5LA 1DQSA 5I3ZA 1BWQA 2ZI4A 1XD9A 3L0IB 4V0SA 3LBAA 5BV1A 4A26A 1VP9A 4PRLA 3HXPA 4K28A 1PDOA 3QVGB 1FXWA 5L3SA 3G68A 2XNCA 3OOJA 1HE8B 3QVLA 5E4YA 1AKQA 2AN9A 3KOOA 2HD4A 4TMYA 5K0ZA 2RI0A 1QS0B 4J91A 3SF8B 4JNCA 4NU0A 4HVAA 3DVAB 3KHSA 4QYTA 5B7NA 1U8ZA 1XNJA 2N47A 3ZG6A 5BSWA 4ZOLF 1WULS 1P7PA 3U49A 1Q0QA 2NT4A 1EVZA 1R6AA 1T3TA 3FE2A 4A16A 2F9LA 3K70D 2W2XA 1O08A 2FWPA 2ZYWX 1R9JA 1QRSA 1E6MA 1YRBA 2JW5A 1I3OA 2GNOA 3ANNA 3DMPA 3WV5A 3MD0A 3V1KA 2AQ8A 1NR5A 2ZRPA 4JI2B 3BGSA 2RGRA 5H0IA 5TPZA 3EGWA 3DJFA 2IOFA 1E60A 5I7VA 1RPTA 3B6IA 1KBQA 1AOXA 3PFKA 5TRTA 1WDKA 2JLQA 3DV9A 4L51A 5DNEA 3SSAA 3THSA 4DLWA 3HRHA 1N2HA 2FSUA 5FFMA 5IJXA 2QXUA 5HA5A 2O0MA 3KXKA 2ZTHA 4DCUA 2EIHA 3HN2A 3HJRA 4QTTB 3GZNB 4U6SA 4AO6A 3EXHC 3M4NA 4HAOA 4MQ5A 3VNBA 4AKTA 4YR7A 5AM0A 4CIAA 1V9SA 3KO8A 3N53A 2AD5A 2CVPA 2C4MA 3TDMA 2HWXA 4RPHA 3B7WA 3H2GA 3CEPB 1RQRA 4DW8A 5CT4A 3KAPA 4LHVA 5EUMA 3L5KA 4Q3AA 1DNPA 5ERXA 3OEEA 5F12A 2C3PA 3RS8A 4EGAA 3SWWA 3K30A 2K2WA 4ALJA 2B4KA 3W5HA 5ALRA 1BKYA 4GP6A 3LC2O 1V25A 4CRWB 1RJGA 1ZC4A 2AWNA 3ZU6A 1N0UA 3IB6A 3UA3A 2UYCA 3OX2A 3BS4A 3K9GA 4KWIA 3E03A 5FOSA 4ZREA 1K3TA 1U8XX 3Q7TA 4GG1A 4PSDA 4FKZA 2ZPAA 1H2XA 3KZ1E 3OU6A 1Y5MA 4EGFA 2X23A 4KPEC 1TYDE 4FYXA 4MNTA 1HDCA 2BZ0A 1L3CA 4DREA 3GX1A 2IH5A 1IJBA 2RH9B 2X2PA 3KJIA 2PX5A 1BROA 2PQ6A 1CJVC 5GMOA 1L7BA 1WV0A 2D4HA 2PKQP 3W6ZA 2ZYIA 3HZZA 1RXWA 3PICA 1CQZA 1UKZA 5CURA 1YC5A 2ZXFA 3GARA 3N6VA 821PA 4I8IA 4HX5A 5BUSA 2O7VA 4W7SA 1R15A 3AM3A 1H1DA 2OORA 3I8XA 3UQYS 1YI8A 5CDHA 3FGNA 1QFXA 3LQYA 2IXTA 1QXSA 4OD0A 2YUIA 1FUUA 2PBRA 1KBZA 1OYWA 3IUBA 1XI2A 4NG4A 1T2VA 4J29A 4K2HA 2PLWA 4JASB 2WU1A 3N3AC 1QOQB 4LXHA 2F1RA 1YB2A 4QU9A 4DLBA 3QUTA 4EJMA 5TQVA 2H08A 4EEZA 1WLSA 1YASA 4EO7A 2FPLA 4OI0A 3MJHA 4MJLA 2KI5A 3PXUA 1Y6QA 4MLPA 5E1MA 4M86A 1H0HA 3TAXA 4YRSA 3L8HA 1Z6GA 3CJQA 3RFXA 1G3RA 4N5HX 1ZVMA 2BFAA 5EPEA 3JQDA 4MP3A 5DLPA 1ZJ4A 2WJ3A 4GX1A 4ND7A 1HI9A 1QKIA 5FQOA 1BU5A 3QI7A 3ZGLA 3H9EO 2X2EA 4GUDA 5JFOA 4D26A 1KGSA 1HG1A 3DZIA 3KB6A 4HAWA 4WKPA 3B82A 5CNMA 4DCCA 4DQDA 4CXMA 1FMTA 3KPUA 3C15C 3UMGA 2QJTA 2R66A 1BN6A 1TF2A 2WDZA 4B3GA 4AKHA 2FW1A 3G1UA 2OV6A 3K71B 3N07A 4WBSA 5F78A 1P1HA 2XTNA 3LQQA 3LWNA 2FETA 3EZLA 3ZIAA 3NV7A 2HV8A 2A9KA 2N0SA 3HCNA 4RVHA 1PW7A 4U7FA 1WXGA 1X87A 3AR9A 2FFHA 3BD6A 5C9ZA 4EBFA 5DFAA 4E14A 1MNQA 4IJQA 2ADFA 2WD8A 1UWVA 2XNSA 5HHTA 1VKNA 3AIIA 4NS1A 4WKGA 1OBFO 2E37A 2JLUA 4NARA 1MT3A 1QLHA 3H3XA 3PJEA 1PG5A 5THXA 3MN1A 3A10A 3G5TA 3WKEA 3TSYA 5D1NA 3VR4H 1GNTA 3TOZA 4YRCA 2E5FA 4KZKA 1O9HA 4H9GA 3N1UA 4OTZA 1J0AA 5CIQA 3RR2A 3BTSA 4QPPA 2VXCA 3NDIA 3S55A 1MOSA 4PPGA 1MHPA 3JQAB 4YRIA 1XOIA 2AGVA 2OM6A 2XT0A 1I3CA 4PHHA 1JLLB 5JNTA 1MEJA 2W90A 3VU1A 1TZMA 4ZMRA 5EQFA 2CN1A 4NTZA 3LY9A 4O4LA 1FVOA 3AF4A 3DEIA 3OQNA 2JIOA 4J90A 4LF5B 3WQBA 4JFRA 4JR1A 1JDJA 1CUWA 2EGUA 1J8VA 1O0SA 1NRXA 2IYAA 5K0NA 2DJIA 4QPCA 4KQIA 2FZ5A 3STXA 5A5GA 1WW2A 2I67A 2J0VA 4BNTA 3RHSA 2IZ0A 5BSGA 4B3XA 2FEWB 2HPZA 3LYAA 3WWZA 3IAM6 1KZ9A 3KU4A 1E94E 2QTNA 4NZYA 3KR0A 5EIHA 1BX0A 5JSHA 1U0SY 1XA0A 2MWMA 2XD9A 3QE0A 3E05A 1MX3A 2ODTX 3ED5A 3JD4A 1X1SA 3WIUA 3OPYB 1DDOA 2WKQA 5K99A 2JAUA 4K40A 3MWJA 3NTQA 1T6NA 1I7NA 3ADCA 1G5PA 4WESA 3VI4B 4EVSA 2CLDX 2NVUA 1Q95A 1L5ZA 2RGWA 4K9DA 4OXRA 3RSSA 2D0PB 3QUCA 3C1UA 1JLSA 2VUHB 3WMRA 1DKOA 1E20A 3T3GA 1DO8A 5A02A 4QGHA 1QRTA 5DLEA 2JFPA 2ZR0A 4YJ3F 4B9AA 3SGLA 2IYNA 4V02A 4UM9B 3HCOA 1L5SA 2ZI3A 1OMOA 1VMEA 2ZIXB 1PSZA 3L07A 4HWTA 2CV2A 1E3DA 1W1WA 1R10A 2AT1A 2GWHA 2OV4A 3Q3HA 4GPIB 4ND3A 1XRQA 1WQ3A 3REOA 3RASA 4AY2A 2FV8A 4HPJB 2IPLA 4J1TA 2X8JA 3VV3A 4BJ1A 4EY3A 5KOJB 2PWPA 2A9VA 2JHFA 1PWZA 2WIBA 4PN7A 2V7TA 4XEUA 3VR4D 5HRAA 2E4ZA 4I3GA 2OT3B 4BY9E 2Q41A 3OCCA 3T7KA 4HFRA 4E30A 1YFJA 3FUTA 4IKEA 1Q57A 3GWZA 2F43A 1T6ZA 1BWRA 3ZOKA 2IUEA 2R3SA 5HJ5A 5ITWA 2WJWA 1JQLB 1RAHA 4RGBA 4GUAA 5ADUS 5BNTA 2O8BB 3STVA 4F9TA 4A2QA 3CO5A 4O2BA 1R7RA 2G88A 4G4IA 1D9XA 4ZQBA 3MG9A 1A3CA 1Z74A 5AH0A 1EUDA 1PL7A 1XCOA 1YB5A 4BC0A 4EHIA 3HYLA 2E4UA 4S1VA 1I33A 2Q5OA 5FP0A 1AK2A 1XZJA 3DT9A 1CS0B 1QFZA 4II2A 4L5BA 3A1TA 3UV6A 3RK4A 4US0R 1RRKA 3OT1B 3JVEA 3WWEA 4V03A 1YCDA 4DMKA 5FNVB 4HWRA 3MPOA 4UTZA 4LVNA 2ODWA 5JMOA 5T5QA 2P2YA 4LFAB 1M10A 5IEJA 4ZCIA 1A97A 3JQ7A 1WX1A 1XCBA 3AZPA 3PGMA 3UANA 2R4QA 4M98A 3RFFA 5IK2A 1EUZA 3EQ2A 2D0DA 3JQFA 4NLLA 3TQIA 1FTYA 1Y3CE 1U3UA 4AX4A 3HBMA 4E08A 2XYVA 1D8TA 2AJLI 3DC7A 3GA7A 3KPVA 1OHHD 4WBNF 5ADVA 1TYEB 2BGNA 4CIDA 2MCFA 1WMSA 5ER9A 3TPFA 4AKEA 1CY4A 2O3SA 2D1SA 3QVOA 4TT8A 5IZCA 2ERXA 2NQ8A 4WPGA 3NYRA 4E31A 1NL3A 4PC3A 1AQ6A 2R48A 4O0LA 1U7XA 4RY9A 1PQPA 4LF4B 2O5RA 2B0CA 5A0TA 1I5OA 1KI7A 1ZBDA 5JECA 1RRCA 2O05A 4BJHB 1GZVA 2GCGA 2ARKA 2Y0BA 1ZH4A 1SBQA 3X3HA 4MUHA 1T36B 3PTAA 2P9YA 3LUDA 5G0WA 1GPBA 5FL3A 3RARA 3A6GA 2XCUA 3P9XA 3PHCA 4HH0A 4LV6A 4LWOA 2IY9A 3WIEA 5ALVA 1Y1LA 1W46A 1IXRC 2X4DA 4O4IF 2HW8A 4X8LA 4DWJA 4NQZA 1OWNA 2VHEA 3KXLA 4I0WB 2QN2A 3GFQA 2OCDA 3V2HA 1XMOB 2CFOA 2QW8A 3QITA 4KN6A 4L4ZA 3GGCA 4MWEA 3GMSA 4PO8A 4JFAA 1XT6A 2QLFA 1EBBA 4QLBA 1PQWA 2ATVA 4O1HA 4XIYA 4AY3A 5A5VA 3STUA 2PA3A 4O2AF 2R1ZA 4QQFA 1D2CA 1IN8A 3PDIB 5T7BA 4HDRA 5KOIA 3EDYA 4FCTA 3CRRA 2VVTA 2Q3LA 2Y92A 3ANYB 5IPFA 1U04A 1Z75A 4YRPA 1RQGA 1S89A 4U9IS 2O0KA 4W1PA 1PGPA 3P9RA 5FOVA 2E48A 3V8VA 3KZKA 5DM2A 2VZEA 2W2PA 4KL8S 1CUSA 1DUSA 1Y37A 2XECA 4RWEA 4LZWA 3IXLA 4PAOA 4B4OA 5TS3A 4ZDJA 3HJHA 4M54A 3H1BA 2H4FA 4BXOA 4P8RA 3QX7A 1WMDA 4D81A 4K26A 4DLLA 4YCCA 1G5QA 5A2QA 1GG9A 1TPZA 4GWLA 1ZL0A 2F3PA 3B5JA 2QMUA 3D8NA 3K9QO 5HZMA 5JHGB 5BSEA 4HYQA 3ZIUA 2PNFA 2YICA 5B6PA 3GDOA 1L5HB 1DOHA 5HBGA 4GPTA 4JSTA 3ES9A 5EE3A 2C3YA 2CHQA 4DCMA 1LDNA 2A14A 3F9CA 3G8DA 3H84A 2I9PA 4MVXA 2AJTA 3QXHA 1HKHA 1TL7C 1YCHA 3B1KA 3GLHB 4HTFB 3JU3A 2VWHA 4ENUA 4E5PA 4XYLA 3AR6A 3MFYA 1Z4LA 4RGVA 1AD2A 2HRBA 4XJXA 1OZHA 1EEHA 5EPOA 2H7YA 1OWMA 1W96A 3I9JA 4XWAA 4GMGA 4AN4A 4W5TA 5JJKA 3L7JA 2QYTA 2XDYA 4L74A 2X9VA 1HZZA 4I36A 1KVTA 5BNIA 3OESA 3VPXA 2WTNA 3AUAA 5IKEA 1C7FA 4Q02A 2CNBA 3IVCA 2OCKA 5K3AA 2PG3A 1RE1A 1M1YA 5LPNA 4WXMA 3ENVA 3HVHA 2O59A 4DDMA 1MA3A 1SCDA 2Q3BA 3WGQA 1DWPA 2ADOA 1FRVA 3G2OA 7MHTA 1KVRA 1TDJA 1O96B 1Y9EA 1SC3A 3H6HA 4RVGA 1OLSB 4TTVA 3MWFA 5B1HA 4A0GA 3HM2A 3JRNA 4JYMA 1B42A 5EJEA 5BXYA 1NM5A 4N3GA 5AUOB 5FR1A 4XEHA 2OCAA 1KO1A 3EXHB 5I4KA 4C2UA 2DG2A 1CR2A 1Y8AA 3N2YA 3DTNA 3RG2A 2G77B 3UH0A 4EPTA 1OUMA 2QR3A 3S1AB 2PX6A 1XYGA 4RLFA 3PR3A 1ODJA 4PXSA 1G59A 4LAFA 3AF0A 2VHJA 3FI9A 2VJYA 2OD9A 2NO4A 2I62A 2RGDA 3O21A 4V24A 1M1UA 1H5QA 4UAVA 2WIKA 1YJQA 1EFVA 3FVWA 2WNIA 4H0CA 1I24A 3NZEA 4RSRA 4NZ9A 3M34A 3TTWA 3VSCA 1ADFA 3DV2A 3GLQA 3R20A 4PC6A 5NLLA 3FPFA 4TTRA 3R7DA 3SSMA 3VHQA 4B81A 1K2WA 4D9JA 4TVBA 4H77A 4LCEA 2H4JA 4TV9B 4J1NA 1C9KA 4IIEA 4ZOEA 3HA5A 1SUAA 1UJ6A 3JVIA 2J9RA 3CC8A 3KQYA 1SHZA 3AR7A 3DXXA 4GLFA 4WTOA 4B0PA 2CLCX 3L92A 4PHFA 4GDFA 4IGFA 1QS0A 4N9QA 1O97C 4B17A 1E98A 3KT3A 2A59A 3IAUA 1XX6A 3LC1O 5ALOA 3RYHB 3SF8A 3R41A 1NXOA 4KI7A 4TQUS 2O5EA 1ZUWA 1VCNA 4BLOA 1XD2B 1ZM4A 1GITA 2QDXA 4OM8A 3NU1A 3RJTA 5MN5A 3U60B 1X19A 2QZ4A 2XQVA 4MW1A 1AKEA 3LE8A 3PX3A 1S3IA 3ZXUB 4XRGA 3DCNA 2VSYA 4CMEC 4F3NA 2OFWA 3V4FA 3F7TA 4BMYA 4PS0A 4FMDF 1FC0A 4L76A 1V8PA 3INTA 1NF3A 4N8EA 4QBHA 2NSLA 2G40A 2C8VA 3ZD8A 3GQVA 3Q72A 1NXSA 4U2CA 2JCGA 2FSIA 3AOGA 4NKRA 3RM3A 3VVCA 1VIVA 1W6RA 1TKAA 1YNSA 3K1TA 3KWJA 4C0HA 1MAAA 3K5IA 3R7NA 3BTUA 2IYUA 3I05A 2R7KA 5BQFA 3IHLA 4MPJA 1MGOA 1KEKA 4PNPA 1N36B 2PR7A 2NZXA 1H2RS 1KMMA 3CLVA 3UCEA 1E6KA 1XMSA 5CYPA 3SJAA 3UHOA 3GBSA 5DTMA 5LQMA 1V7PC 1V7ZA 4OF4A 1O95D 1AA9A 1PGQA 1IG3A 1NZFA 3FHCB 1C9MA 1A95A 3GXOA 4EM6A 2OC9A 3MRXA 3PFIA 2EQBA 3KJHA 4QX6A 4HDQB 5AJZA 4LRQA 3VSAA 4B4WA 4EG3A 3T1NA 4YMTA 5BSFA 2FSVC 1I1QB 1AN0A 2A5FA 1YAJA 4ONEA 3HCDA 2QORA 3OTIA 3G2PA 2JB9A 3PC3A 1YKGA 1SVLA 1XLTC 2BONA 2O0JA 2REXB 4HCJA 4M7PA 4DQXA 2J48A 2WM2A 2VRCD 2ZJYA 3NHZA 1NFFA 3JVUA 2BFOA 4D4KA 1JQJC 1FSZA 3JQGB 4FCVA 4U8GA 1YRHA 5I3CA 3OJLA 4L5YA 4EHFA 1EBFA 1M73E 3WIOA 1NQ5A 4FCCA 1CR0A 4PONA 2MYTA 3F6PA 2DFNA 2VTDA 1GUYA 4UBJA 2FWIA 2VDKB 3OZWA 3F5QA 3FFTA 4DIUA 2G0AA 1QTIA 1FCJA 2XXAA 1D6SA 2GZ1A 2P79A 5TEVA 3EXFB 1QNFA 2PUJA 2EDAA 3FCAA 4IPTA 2R87A 1JVSA 3NWJA 2PK3A 3KR2A 5ECWA 4B46A 5A0FA 1TJ4A 1H1TA 2JJYA 1EJ2A 3I12A 4EJ6A 8MHTA 2IXBA 2IEYA 4RIIA 1QP7A 3OHPA 2IOFK 3M70A 3EWAA 3R4VA 2WDPA 4LC0A 1K9VF 1KMCA 1Q7EA 1THMA 3U7JA 4LRSB 2I2AA 1QK4A 3DOIA 2C5LA 3RC1A 5IXSA 2H7CA 3HKBB 5K6RA 4TYYA 5DLYA 4WLEA 4FHZA 2PCLA 1GN8A 2P5SA 5CP8A 3AKYA 3DTVD 1T2EA 2QA5A 1P81A 4MOWA 2AV6A 3HCAA 1W0JD 2FQYA 1PJRA 2A5JA 2QY6A 3PNPA 4YB8A 1E8MA 1U9YA 4KVZA 3TQFA 4MW9A 5IAGA 5IKOA 4DXAA 1NR1A 3P9YA 2ZM5A 1AUVA 3ZHTA 4NAVA 3MTDA 5ER6A 1KNXA 1U02A 4LJRA 2DT8A 3ROEA 2FUG1 5M5BA 3W77A 2JAHA 2PL9A 2VRBA 5FL7A 1BEUB 2ZTLA 5HIAA 3AHCA 3DAGA 2RARA 5A5FA 3EGOA 2NYAA 3B3QA 2XIJA 1C29B 1M1YE 1O6FA 1PJLA 3MGCA 4PLPA 2BIFA 3UMYA 4YP5A 3EVBA 4IHJF 3SC2B 4ZQFA 1FMJA 4C07A 4HNUA 3NT2A 4OMCA 4CKEB 1WG8A 5C3UA 1X8LA 1XQWA 4KIWA 2D3TA 3OD5A 4IIXA 3LZDA 4UVGA 2EJTA 1FYXA 3DW1X 3PUXA 3EGCA 4OB8A 3ECSA 3LY5A 3IP1A 1R18A 3LVFO 4EFMA 1D09A 4RL6A 1Z2AA 5DSTA 1P1JA 3RT1A 1T43A 2AMVA 2HMSA 4U2BA 2ZYTX 3VZCA 4O0MA 1GG2A 1PS0A 4D4LA 1XHFA 5JJBA 3QEBZ 4EQZA 4QHSA 1ZUD1 3SXJA 4RTOA 3RRZA 4RF5A 4INZA 1AH2A 3PFCA 4U6NA 4I5FA 3AONB 2B1RA 1ECBA 1A8QA 5DIZA 2ZAOA 5JSFA 4HAXA 4IZIA 3K8QA 1BCSB 5AHWA 3HP4A 3NANA 2C4HA 4FLFA 1GM5A 1QQ5A 2I7DA 4JBLA 5E1OA 4Y2YA 2ZIVB 3ZW7A 5F7ZA 5IM4A 4QDXA 2KS6A 2I6XA 1X39A 4GVPA 3W05A 3WXBA 2QUJA 1CF9A 1AS2A 4BQSA 2AOUB 5SYAA 4M36A 1GU7A 4KO1S 3UICA 3DMTA 2YWBA 4CMCA 4FJ1A 5KNBA 1KAMA 3BIFA 1YWGO 3TLGB 4TQAA 5FD8A 3S0JA 2W93A 3DKIA 5DYTA 3TX6A 5HGXA 5LJIA 2OZKA 3RIXA 1XRJA 3F6BX 1A9SA 2EATA 5EFZA 1E92A 1KEWA 5G0UA 5CXUA 1VE9A 1DG1G 2G6TA 2ZULA 3OZVA 1MB0A 1XMXA 3CVWA 1BVRA 3GOHA 4RPIA 1CUBA 1G9XA 1OW3B 1FDSA 3HN7A 1ETHA 3IV7A 1JIIA 3KCQA 1GPLA 3QWAA 2H7XA 2QPOA 4GFDA 4GI2A 2F9FA 1TF7A 2GPJA 1BVUA 3GLUA 4JLDA 5BWCA 2W6JD 4FK8A 2FG6C 4ZC1A 3UT0A 4FWTA 2HSWA 2I7CA 3WNDA 1W581 5HWSA 1KDOA 4GKJB 2HX1A 1NVVQ 1DKMA 5GINE 5COAA 1PX0A 1ZMRA 4LPKA 1OYVA 4V2IA 5J40A 5B3KA 2DE0X 1M67A 5G3YA 4EX6A 1Y48E 4RXMA 4I4IA 2XDQB 1DFGA 1ISHA 1SCUA 3DONA 5H7XA 3M3DA 3ITDA 3DZDA 1HDEA 4KN5A 3BK2A 1L8XA 3EF0A 4UM5A 1JDNA 2JJQA 5D3ZA 4R3WA 4ED9A 4P5DA 1H66A 2HJHA 1FJ2A 1KYWA 2ESRA 2NV2B 4UUBA 5FFFA 3FOWA 1U3GA 4DJFC 3RYCB 1Q1GA 3I52A 3PPXA 4BPRA 5KOJA 1J0XO 1I51A 2G7ZA 2Y99A 3V2UA 5TVKA 4I46A 4PWYA 2NYUA 1T4GA 2ODEA 4RZXA 4PCUA 4CTOA 1ULZA 2IOQA 4D0LB 3DMNA