2NGRA

Transition state complex for gtp hydrolysis by cdc42: comparisons of the high resolution structures for cdc42 bound to the active and catalytically compromised forms of the cdc42-gap.
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
191
structure length
191
Chain Sequence
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Cdc42 bound to the active and catalytically compromised forms of Cdc42GAP.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords PROTEIN (GTP BINDING PROTEIN (G25K))
total genus 65
structure length 191
sequence length 191
ec nomenclature
pdb deposition date 1998-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ngrA00
2WJYA 4C0SA 3OESA 3GPLA 2ZPTX 4YXWD 3C41J 4HSEA 2V9PA 1DAIA 2C95A 3B2EA 521PA 3R7WA 3IBGA 5B30A 5CB8A 2R2AA 3PG5A 2YV5A 2QT1A 3PXGA 4A9AA 5L3RA 4URYR 3OAAD 1RRGA 2VF7A 2ZU0C 1ZP6A 2ZAOA 1R8SA 2PZGA 3UPUA 2Z83A 4JL5A 4R71A 4D4MA 1E2DA 4C30A 3QKUA 4QXAA 4A2WA 4IDQA 3G5UA 2Q3MA 4IOJA 4UXHA 5C46F 4IHQA 1P75A 1Z06A 5FR1A 4TSFA 4B3BA 4RFSB 2IS4A 2D7CA 2FF7A 2HF8A 4AKEA 4B75A 3K70C 3CB4A 2QTVB 5JWOA 2IUTA 3NEJA 5IHPA 4OHVA 4NH0A 2OUKA 4GZMA 2D7DA 4MGKR 4DEYA 5JJLA 2IYTA 1Q57A 2A78A 3QJYA 4ACBA 4TZ6A 1W7AA 4FI3C 5JHGB 2NZJA 2NO6A 1E1RD 1TAGA 4BZQA 1KY2A 1A5TA 3MAAC 5IRCD 1OSNA 4MYUA 3UXMA 4Z1MA 3DZDA 4O2LA 1KI6A 4OI2A 2W2VA 4DSNA 3AVUA 1JXMA 2RGNC 2AX4A 2W6ID 4XVUA 3QSYA 1IAQA 3H2YA 3SNHA 2YINC 1H8ED 1ZUNB 2GVDC 2JDID 3LH5A 1IXZA 1FFHA 1XNJA 3LQQA 1M1YE 4K81B 2IS1A 1SXJC 1Q20A 2CCGA 4BLQA 2GEDA 3GJ0A 2G0TA 3QXXA 1S1MA 3TH5A 4XTCS 2CE7A 3RHFA 1NMZA 4XIGS 4GOXA 2BM0A 3IIMA 1P6XA 3ICQB 3GLGA 5HE9A 1E2FA 4GP7A 1KI4A 1U8AA 2MMGA 3I4LA 2IYWA 3SYKA 2XNDD 2BMFA 3CLVA 3K9GA 5AUQA 2ZUBA 3TGPA 1OXUA 1GKUB 1M7BA 3O8DA 2PMKA 4LHWA 1D2MA 3K09A 2Q9CA 1CP2A 2IBMA 4BPBA 3CRQA 2C9OA 2XB2A 1I4DD 3OIVA 3NEYA 4KYUA 3K09C 1Z0JA 1XDBA 1SGWA 3C14C 1AM4D 4XVQA 3BXZA 3TUIC 4PQRA 4OK5A 3SR0A 1N6OA 2A2ZA 1YZLA 3QKTA 1XB2A 2W6JD 1W1WA 4JLMA 2J41A 3OEED 3LY5A 5CIWA 3L2OB 2K5UA 1ZVQA 1DPFA 1KK3A 1WP9A 4GI7A 1KDOA 2QAJA 5GJVC 4HLDA 3KZ1E 1W5TA 1XEWX 3HWSA 1TADA 1XZQA 4NPHA 2ZANA 1NNEA 5JWHA 1WB9A 1N6LA 1ZCAA 2IHBA 3A4MA 1E2QA 2F9LA 3RRZA 4Q4JB 2W00A 2QE7A 3REGA 4TN1A 3NBZC 4CEHB 1GTVA 2VO1A 3GJ7A 3RWOA 2IX3A 4H1UA 4RFSA 3SQXA 5J47A 3I5YA 4TLDA 4G3XA 5SZHB 3SYLA 3W8RA 1U8ZA 3CUEF 1QHNA 3OFND 3GJ8A 2BV3A 3DOFA 5JEDA 4MDFA 1UFQA 1Z0AA 2JASA 2JJ8A 2CL6X 4M21A 4EPYA 2DFTA 1M2OB 5JZVA 2DY1A 2I3BA 2VLIA 1Z0KA 2GNOA 4Q47A 4TMWA 4B3FX 1G6OA 3WHKA 4WZBE 1G291 3FWYA 1YZTA 4B73A 5JEEA 3BFXA 4V0OA 1HY3A 1Z6GA 2GXAA 2EFGA 1T91A 3FMIA 1W36B 2O0HA 1IN7A 4HAYA 1ZAKA 2ZRGA 4HB3A 4Q9IA 2UKDA 4DEXA 1K5GA 1SHKA 2GJ8A 2Q9AA 4DC9A 1XTQA 1A7JA 1G8PA 5DNYB 2OM2A 2ZREA 4CYMA 3BC1A 2FFHA 4L8GA 3L0PA 1AJEA 2IYYA 4IW3B 3MLEA 4FXPA 4IVPA 3ZQJA 1KY3A 2HJGA 1N5IA 2UVQA 3AKDA 3QKSB 5JCZA 4W5WA 4UKDA 1GG2A 1L2TA 1MO4A 5GJCA 4OQXA 1J70A 1RFLA 2ZRDA 1MABA 4Q48A 2QEQA 1X3SA 3QF4B 2ZETA 4JVLA 1P4SA 2QU8A 1X8KA 3HJNA 3M1IA 4KSBA 4C4PA 4KFSA 4M0LA 4A15A 1FNNA 2W58A 3OIWA 1M74A 4JMPA 5DLQC 3TK1A 3ZH9B 2ECKA 2QT0A 2EFEB 3H0KA 4U00A 1HA3A 4YONB 2HXYA 3CPEA 5AUPB 1US8A 3VU9A 3NXSA 5FOSA 2VHUA 2EW1A 4PPGA 5TB5A 1E9DA 2H92A 3BFVA 1ZIOA 1NVUQ 3RS4A 2NGRA 1NG1A 1OFTA 2IT1A 3LA6A 2DCUA 2ORVA 4QHSA 4G5OA 1KTVA 4G5SA 1II9A 4NYIR 1WBDA 3DOEA 2OEPA 4ZIRA 2W6JA 4KFRA 1PLKA 5FOUA 1CJMA 1TF5A 4MH0R 2QP3A 1XTKA 1ZRHA 3K1JA 1G17A 5LBIA 5FUXA 4QBGB 2A5YB 4TLCA 4LYJA 1P7CA 4A1FA 5KNDA 1XCGB 5KDDA 2ZRBA 3IUYA 4Q1CA 1KK2A 1UADA 3IKJA 4UNSA 2WIAA 3P27A 1XPUA 2FSGA 5CYOA 4NKRA 3V4FA 2FGJA 2J7PA 2YC4C 3TRFA 4F38A 4XSHA 4EFNA 4LK2A 1XPOA 1VCMA 3IPYA 3B13B 3TIFA 3RRMA 4JZKA 4LDJA 4Q1AA 1AN0A 1OH6A 4U7DA 3F5FA 2CL0X 4HAWA 3P20A 1II0A 3TW4A 1JB1A 2YVUA 3OE7A 2DWQA 1NSFA 4L9SA 1WDTA 1KI1A 3P4XA 3HU3A 2Q6TA 4UNPA 1D9ZA 5J4YA 3BORA 3U3JA 1HQCA 4DSOA 3GJXC 2YWHA 3E70C 2CNWD 2MMCA 3Q5EA 3FVQA 1ZU4A 3QUSA 3L0SA 5EE1A 2QRZA 1NF3A 1E9CA 3OAAA 2OZEA 2ZRAA 2C5LA 4N3NA 1E96A 4TYPA 2FX3A 1GL9B 2LKCA 2ZRNA 3OEHD 3W5IA 2I4IA 4KAXA 2GJ9A 3QE0A 2AWNA 2Z43A 1OKKD 5FL3A 5SZJA 2ZRMA 3VHLB 1W0KD 4BRUA 1N0UA 3AVQA 1ETUA 3PV0A 2FWRA 2WZQA 2BM1A 3GQBA 5F98A 4PANA 3ZLJA 1U0LA 4Q21A 4BLPA 2YYZA 5HR5A 1XXHA 4Q7KA 4B3CA 2FOLA 5DI3A 2JA1A 4ZI3A 4QJ4A 3EZFA 2WHXA 2O8EB 2GXUA 1KNXA 3IHWA 4CEJB 1BH2A 1XD8A 1QHHB 4HZIA 2VA8A 4XJXA 5IT5A 1E9FA 4DIDA 2WMNB 2EWWA 1QHIA 3RS5A 1UJ2A 1XMVA 2W0SA 4ZKEA 1CXZA 2GCOB 2V4ZA 4DDUA 1SZPA 1QHXA 5TY0A 3UMSA 4TT3D 3BH7A 3HR7A 2GDJA 3O8BA 4HDQB 5F2EA 1D9XA 4P31A 1KJWA 2R44A 4BLOA 3O47A 5TARA 2VHCA 1E79A 3OIUA 1CBUA 4V03A 2F6RA 1BO6A 1DBSA 1PZNA 2ERYA 2PCLA 1T3HA 4I99A 3KFVA 3IIJA 3QQ5A 4PC6A 3L0OA 5DGXA 2O8FA 3PEVA 1SXJA 1KMHB 3OZXA 4M1TA 4X8LA 4C0BA 4QHTA 4NYJQ 3KB2A 2ZRLA 2F3RA 4Q66C 4DSTA 1XFAA 1UAAA 2GZDA 3A1UA 2GXQA 5E7IA 5EE3A 1GZSA 3RS7A 1AKEA 3AKEA 121PA 2Q0HA 4GOKA 3EIQA 3NVAA 4LJ6A 5BW8A 4KU4A 3U6BA 4C0HA 2IYLD 2UZIR 4LJ5A 1XWIA 2CHVA 2V8OA 2IA5A 1HTWA 1RE0A 2ZJYA 3BERA 5AUOB 4A8JA 1RPZA 1GUAA 4PSVA 1OF1A 2VYFA 1NBMD 2FMXA 5DSZA 5GVSA 1KDPA 3V9PA 4UNRA 4Q1BA 5E7JA 1QRAA 1DELA 5JS8A 1RRPA 1FX0A 3H1TA 1N6PA 1PUIA 4QJ5A 4KXFB 1Q44A 4NYMQ 1S2MA 2NO7A 3ZZUA 1UKVY 2OCAA 2P3SA 3EZ9A 3NH6A 4Z51A 1YU9A 5C1BA 4ZDJA 1WBBA 3VHXA 5KNBA 1PVOA 4URUR 2RH5A 4A82A 2XSZD 2JJ2D 2V6JA 1SVMA 1MR3F 2I1VB 5TMPA 2Z6VA 1AIPA 2RHMA 3U3MA 2BJWA 4YMVA 1J8YF 1TL7C 2VP5A 1N6IA 3SEAA 4M53A 2P5SA 2A30A 1KSJA 4AY2A 1N5JA 4Q7LA 2RGDA 1G3RA 3FHOA 5CK4A 3U4QB 3KJGA 4IOLA 3OFNA 2B8TA 1N3BA 1YR6A 4F4JA 5B64A 2QORA 1R0ZA 1P73A 3QOFA 2J7KA 4NL4H 3CNLA 4LJ9A 4XTRA 5FUYA 1XEFA 3EW9A 1ANKA 4AI6A 4HZUA 5AUNB 2AK2A 2QM8A 2XAUA 4JLDA 1KIMA 4ESHA 5EXPA 4A4DA 4TLAA 2W83A 1GRQA 1FUKA 4JBWA 4DLSA 4EAQA 3VAAA 3ADCA 5KO2A 4Q4LA 5DYIA 2FEOA 3A1SA 5LD2B 1CR4A 3L8YA 4E03A 3OHMA 4GPTA 1Q3HA 3RS3A 2WV9A 1OJLA 1Z0IA 3K0SA 4BE7B 4P32A 2BKEA 5JHHB 3UWOA 3SJZA 2WICA 4AC9A 1IN5A 2FJUA 2WTUA 3BJIC 2NO9A 3R7WB 1G5TA 4PO9A 2IS2A 3LV8A 5J4HA 5JSZB 1K5DA 2QAGC 1U9IC 3QIAA 1XXHE 1QDEA 2IYUA 1DOAA 1MO5A 4DLRA 4LSGA 1R6BX 3BGWA 1KI9A 3TJZA 4PZYA 5KDOA 3VX4A 1G6HA 1T6NA 1EWQA 4RZXA 4HAZA 1GIAA 3IIKA 1NLYA 1E0KA 2BMJA 2PL3A 5P21A 3I92A 4URXR 4B33A 1WRBA 1JEDA 4GOJA 2VF8A 4IRUB 1KZ7B 1KMQA 2ZE6A 3K8YA 2FN4A 3FMFA 4OQMA 3DEFA 3ZQ6A 4ERNA 1XPRA 4CGZA 1U2RA 2ZE5A 2ZSFA 2J7PD 1DAEA 1FQKA 4LV5B 3Q7PA 1KI6B 1FL9A 3KUCA 3D31A 1LTQA 2H18A 1FX0B 1FTNA 3GD7A 3KQLA 5K8IA 4MYCA 2WWIA 2QSZA 4PZZA 1CR0A 5JWRA 1ZMXA 3QI2A 4JLNA 4Q18A 2GTPA 1I4TD 1JR3E 3VR6A 4Q02A 3IHLA 1ZD8A 3CNOA 4V0MA 3I5XA 4NYJR 1Q1EA 4EFMA 5JMTA 3DZ8A 3DKPA 5KTYA 5FI1B 2CBZA 4BFVA 4M9SA 4NBSA 3AVYA 3TVDA 8OHMA 4EJSC 1E0AA 1F48A 3QEJA 4JLAA 1W4BA 3OEEA 2VBCA 1EFHA 3T1QA 4QNRA 2DYKA 1L7VC 4R9UC 1JEEA 3CX8A 2AR7A 5TDHA 3HYRA 4EJSA 3AGQA 2PH1A 2NPFA 3MG9A 4U02A 3G82C 5D3QA 2ZRHA 2F1RA 4NYMR 1G8GA 5KUTA 1VIYA 3RLFA 1FP7A 4M1MA 2PMDA 4JL6A 2FSFA 2O8BB 1GDDA 2B7CA 1NVVR 1XZPA 1OV4A 3VTKA 4PSAA 5EE5B 1SXJD 5FBLB 3KQKA 2NO0A 1GFIA 2AL7A 2OAP1 4WVFA 5DISB 1TUEA 4DKXA 5EXXA 4A6PA 3EG5A 4F93B 4GDFA 1R7RA 5EZ5A 1N2CE 1W2GA 4OQLA 1JQLB 2QA5A 3A1WA 4AG5A 2GJAA 3C16C 4QNMA 4TLEA 4UQOA 2A9KA 1KDTA 3ZJYA 2ANBA 3JVUA 1GSIA 4YXWA 1WA5A 1U90A 1RC8A 4A8JC 4LWZA 2P6NA 3KKNA 3B6EA 5AJWA 1YRAA 1MABB 2B6HA 2WJVA 3H86A 5JSZA 2QTHA 3Q9LA 4RD1A 4DWJA 2QE7D 1ESNA 3GJ3A 1IY0A 4AKGA 2B7BA 1COWA 1OYYA 3CW2A 3D7MA 3QXHA 3ZDQA 1SKYB 3FYHA 2I1QA 4I1OA 2VSOA 3LLUA 3K9HA 2JLVA 2EWVA 1OXTA 3KXIA 3X1DA 3AVTA 2PBRA 2ZVQX 3I3SR 4K46A 2ZJ5A 3TUJC 3C8UA 3UANA 421PA 4DSUA 5EZ6B 3AP3A 2ZRCA 4DDTA 2AD1A 2FZ4A 3AF2A 4V02A 1AQUA 2J46A 2ZYTX 1F5NA 2BHRA 2VPPA 1NP6A 3DMDA 1XEXB 1W44A 2W2TA 1R8QA 1R0WA 5AJXA 2WWYA 1X1SA 2P6RA 2QQEA 4MRVA 2ORWA 3TE6A 5ELXA 2G6BA 5HTKA 2ZXUA 5K8UA 1JNYA 4BEBA 1YRBA 1FPMA 4LC1A 2BBWA 2ZJAA 3AF1A 1AS2A 2QGZA 5BQ5A 2ANCA 4U5XA 4Q01A 2DPXA 2YHSA 4IDNA 2A5GA 1S1CA 5EE9A 4HB2A 4IEIA 2QNRA 5FUWA 5A5GA 3TUZC 2ZEJA 5DE3A 1C9KA 1P2VA 1T5LA 1XU4A 1XF9A 5CIQA 5KNCA 3GLFA 1R5BA 4BFSA 1R5OA 3HU2A 3VX3A 1Z3IX 3WMEA 2O8DB 5BYJA 5FFMA 4LJ4A 1X6VA 1W47A 4FMCF 2JJ2A 4LCBA 2NZ8A 4EQ6B 3QF4A 4EPTA 2XOKD 2ZRJA 4C7OA 1VG0B 4NE2A 2QGNA 5H68A 4BFZA 4ZCIA 1ESMA 4PQYA 2R6GA 4TQ9A 4MYHA 3ZIAA 4ABYA 2WOJA 2FGKA 1UKZA 2D62A 1OH8A 1N25A 3MWLA 4JLBA 1KK0A 5KYKA 2CHGA 3KXLA 2C04A 1US8B 3VU9B 1FP6A 3NBXX 4V0ME 4M2LA 3AQ4A 3JZMA 4HAXA 3RWMB 1P72A 5EP4A 5FI0B 2VSXA 2ZIAA 3WRYC 3PENA 4B6FA 1S9HA 2BBOA 3THXA 4JSYA 1YZUA 2J45A 1ZINA 2ZRPA 3TAUA 3R9WA 4HYYA 2NTYC 3FGNA 2KJQA 3FFAA 3TAHA 1IXRC 1KJZA 1SKQA 3B1ZA 4G0NA 4QJ3A 3KQHA 2DWOA 4TQAA 1J7KA 4CEJA 2F3TA 4ARZB 1QHHA 5G3ZA 1SVIA 2EVWX 3FE2A 3A4NA 4P33A 2EQBA 1G3IA 4BFWA 3K70B 3MJHA 3W3AA 4AKIA 4C2UA 2X2FA 1BKDR 4LPSA 4Q00A 2RAPA 3IO3A 2QTFA 4WXRA 5HCNA 1CR2A 3MJRA 3N2EA 3VKWA 3AF4A 3LO5A 1Q3TA 2DB3A 2WIBA 1GRNA 3SJAA 2IK8A 1C1YA 2WVJA 4ZCLA 4P4UA 4IDOA 2WAYA 3B9QA 3C4JA 2PJZA 3WYAA 4QM6A 4GSYA 1KJYA 1DE0A 1LFDB 3N2IA 1BYIA 1XTJA 3RS2A 2YC2C 2VRWA 5HZHA 1KMHA 1T0JB 1TU4A 2G3YA 2XJ9A 5C4GB 2JIZA 1VHTA 3D3QA 3D8BA 4KVAA 1SVSA 4DCNA 4XD7A 2IHYA 3ZZTA 1YR9A 2F43B 4JBXA 1GVNB 5JFGA 2QM7A 1E2GA 3QXSA 2CLDX 4HUQA 4O2RA 5EE0A 1KO5A 4OHZA 3CPJB 4JYCA 4MRPA 2PZFA 4A6XA 5EXSA 1F2TB 1CJKC 2IYXA 1E2MA 2FFBA 4MQBA 2OBNA 1IN4A 2GK7A 4EDHA 2Z4RA 2QBYA 4LGMA 2J1LA 3PJRA 1Z6XA 2E87A 1T8TA 3GLFB 2FA9A 1Z8FA 2HF9A 4A8JB 4CF7A 1T3LA 2WBLC 4N0DA 2ATVA 1C4OA 2H5EA 4IOMA 2YWFA 3LQRA 2HLDD 2NPIA 5CJ2A 5BYKA 5DI9A 3GJ6A 821PA 3WBKA 1TTTA 2O8EA 2FSHA 2Z0MA 4Q1EA 2OAQ1 4PX9A 3U5ZB 2REBA 4BRWA 2QUZA 2LWIA 3HR8A 4OQFA 1ONBA 4Q03A 5KPJA 1BMFA 3PUZA 3SE0A 3TMKA 4B35A 1G8HA 4DXAA 4OHYA 1AQYA 4A0GA 4CVNA 2XTNA 2XXAA 2ZI3A 3E2IA 1V43A 4KLNA 2ZJOA 1NLFA 4I81A 2CE2X 4W5HA 1DS6A 5KOYA 1E2KA 5KDLA 3EC2A 2C77A 2ZJ8A 3EPJA 5CYPA 1G1MA 1N6RA 5SZIA 4BLTA 3FPAA 1RKBA 2IF0A 4GBMA 1T0HB 4B48A 3WY9A 4C0QC 4X8MA 2Q3HA 6Q21A 3GMTA 3REFA 4TMXA 1R0YA 5FUVA 2NG1A 5C18A 3U4QA 1G3UA 3GJ5A 1AA9A 2ZSAA 1MRNA 2GVZC 5J4KA 4FCTA 4TYYA 4ZKDA 1NJFA 2QPOA 3RS0A 3W6OA 3QG1A 4GMDA 1KI2A 1KO4A 4Z8YA 1FUUA 4ZDIA 4O3MA 4TLBA 1G41A 1Z6TA 2W6IA 3AP2A 4HB4A 2WWWA 2RCNA 3S1AA 1MO3A 4RD0A 1RYHA 2IL1A 5FBWB 4YMWA 4Q1FA 3TNFA 4YMSA 4ZDKA 2JJ1A 1R2QA 2JLQA 3LAWA 3SFZA 4C3ZA 4B43A 1F6BA 4BGDA 2GBLC 1VYTA 2VQSA 2GAOA 1KO7A 5FBRB 5J5CA 1GM5A 3SN6A 1E2PA 4M1YA 2RGAA 1WE2A 1XD9A 5BXQC 4DLZA 3Q5DA 3ICEA 2GBLA 1Z0FA 2ZROA 3AV0B 3QPVA 1U0HC 2JGNA 4H9GA 4LHVA 4M1WA 4DT1B 1A1VA 3VQTA 1N5LA 2FU5C 4IKEA 1H8HD 1SQ5A 1CIPA 1F2TA 2G88A 4RD3A 2ODEA 3FB4A 3I8XA 3FHTA 5HE8A 2V54A 3GLHE 1G64A 3NDPA 4XSGA 3DL0A 1BIFA 1ZW6A 2WMOB 2V3CC 3WP1B 4I1SA 2IXEA 2GILA 3FKSA 4D4JA 2R62A 2R6CA 1DAFA 2DFNA 4QBHA 4D4LA 3UKDA 1EFRA 3AF3A 4HZUB 1E0JA 1CEEA 4QG7A 5ANRB 5TVKA 5CB6A 2F1JA 1P9RA 3K70D 3OIYA 2YWGA 4NMMA 3VR5A 1F2UB 4KCGA 3QG5A 4A2QA 1E1RA 1ZCBA 3A1TA 3WMFA 2QY9A 3A36A 4PFSA 3UWKA 3LRPA 4I4LA 1KI7A 1EXMA 4LJYA 4O0MA 3F8TA 2JATA 5L8VA 4LOAA 5JCPA 2G1KA 1GRRA 2JCSA 1IJEA 1ZBDA 1ZNZA 5LB4A 1XTRA 4HATA 3ZVRA 3FOZA 3MSXA 1QVRA 3NTUA 5G40A 3TSWA 4B44A 5FTKA 4WIAA 1XX6A 2ODNA 2IS6A 4KHZA 1KZGB 2QENA 2P6UA 2BVNA 5JECA 4C0KA 1SULA 3GFTA 4QGFA 2CL7X 1Z63A 2ATXA 3NWJA 1YR8A 2H8KA 1OFHA 4NTZA 1NL3A 4Q9JA 5FTLA 2JAQA 1TU3A 3W34A 4FCVA 2GF0A 3LLMA 4BUJA 5L3SA 5BWMA 2MSCB 4WA7A 3WHLA 1NY6A 1UBCA 3EZ6A 3NBYC 3BE4A 2IYZA 4JL8A 2ONJA 4PTLA 4B74A 4E22A 4UNQA 1AK2A 2AWOA 3EA0A 4F7WA 3MRSA 3E5HA 3DM9B 1IN8A 3EAQA 3GJ4A 1QZXA 2HJVA 5LDDC 2IC5A 2WWFA 4MGZR 1RJ9B 2AFHE 2OBLA 4KVGA 1DADA 1VHLA 3BIFA 5K8LA 3IILA 2A7QA 3BD9A 1J90A 3RSOA 1KNQA 4II7A 1RIFA 1LS1A 4NYIQ 1RZ3A 2YOFA 2F55A 1W4RA 3L43A 4RVCA 2GESA 1KSHA 1WMSA 3N5CA 1JBKA 1AGRA 1T9HA 2AKYA 4UXIA 1YKSA 2ZS9A 4CT5A 2L0XA 3I32A 5CLQA 2GJSA 4TL6A 4F4IA 2CHQA 3LBIA 4QL3A 4QOSA 2WM9B 1Z83A 4XH9B 2AXPA 5GJBA 4ON9A 3QENA 3RNLA 4IOKA 4TMZA 2MSDB 2ZYWX 1E32A 4GT1A 1UEJA 2LKDA 4LBVA 2CJWA 4BECA 3U7GA 3PR1A 1IJFA 1F3OA 1CRPA 3O8CA 3HYTA 2QMHA 4FINA 3BAFA 1XMSA 2AD5A 5FTJA 3ZIAD 3KKMA 3KXKA 1LS6A 2HYDA 4KJZA 4PC1A 5A4JA 3W8NA 1E9SA 5DIFA 1E99A 1JI0A 1Q0UA 3LXXA 4LBZA 4AYWA 4KFUA 1F2UA 2VEDA 2ZRKA 3ASYA 3TSZA 3VR2A 4BFXA 1HQYE 3IBYA 3B1YA 4TZ0A 3PFIA 3GP8A 1N6KA 2ZSDA 2V1UA 1LY1A 1E2LA 1QHGA 3C15C 4JVSB 4RKFA 3R9XA 2EU8A 3GFPA 1Z5ZA 1JJVA 3AVXA 5AJYA 4RZ3A 1G21E 1Z29A 1IY2A 1IONA 1KOFA 5DN6D 2E1RA 4KLZA 1N6HA 3T1VA 2EYUA 4FMBB 5LB2A 1ZD9A 3ETLA 2QRNA 1P2TA 3ADKA 2J0VA 3FDIA 1UEIA 2CVFA 4RSGA 1KO1A 4AK9A 4XWKA 2JLZA 3QEOA 3L0IB 3KUDA 1NN1A 1E98A 2B92A 4FMDB 4Q9KA 1TUIA 2JLXA 1U99A 2OCBA 2ONKA 3PUWA 5AK0A 5JJIA 1HT1E 4DLTA 1W48A 3THXB 3KKQA 1NSTA 2C2HA 4ZI2A 4IXNA 1XJQA 3GFOA 1AZSC 3NH9A 4NCJA 4IDPA 3I62A 5KHOC 4LV8B 2FFAA 3RC8A 3TQCA 1VDZA 4FCWA 3IO5A 2JDIA 2GCNA 2H7VA 1IQPA 2QMUA 3T06B 5J4VA 4PHFA 4HI0E 3NC1C 4AURA 4Q4JA 2PEZA 1KKMA 1EFRD 2VIIA 3H84A 1E1QA 3UMFA 3DVLA 3RANA 4MKFA 2X8AA 3FMPB 3TW8B 2HLDA 1XTIA 2ZU6A 1O3YA 1ZU5A 2BC9A 3RRNA 4MKIA 2DR3A 3QPUA 3ZVNA 1BYUA 1GAJA 3MWJA 2IUSA 1OXVA 3CRVA 3WBJA 4PO1A 4Q4AA 1YQTA 4QBFA 5CM8B 1Y3AA 4KODA 4WZ6A 3ZD6A 1W2HA 3I73A 4DB2A 1EESA 3P1JA 4TYNA 2GEVA 1HE1C 1D5CA 2ZYVX 1XRJA 3EPLA 3GEEA 4C7OB 1IBRA 2FPKA 2P2LA 4WZAE 4RZ2A 3CRW1 1H8EA 1Z22A 4HUQB 4P3YA 3SBEA 1W36D 2AN9A 2Q9BA 4I1VA 2R9VA 2J0SA 3GCGA 3IQWA 2J5XA 4E07A 1L4YA 5IK2D 4RCZA 1LB1B 2EFHB 2OFWA 3TLXA 3ASZA 2IEZA 2CK3A 1D2NA 4ZCMA 3NC0C 4B47A 3CR7A 3EXAA 3QF7A 5UKDA 2GA8A 1RRFA 2HT6A 4NZYA 3W6PA 1M34E 2IYVA 4A0HA 2HUPA 4MGIR 4JBYA 3QKSA 2GXSA 2Z4SA 2XSZA 1TQ6A 5CK5A 2NO1A 2WWGA 1M7GA 4EFLA 3FFBA 2C9YA 2YKGA 2WJHA 2RGXA 3CR8A 1HEIA 2FG5A 3Q7QA 4JJZA 2J0UB 4IJMA 3SI7A 2V1XA 3WYFA 4RFVA 2IYQA 1CRQA 1NVVQ 2OFOA 2N42A 1CJUC 1TEVA 3CF0A 5AR1A 2RGGA 3OE7D 2XTZA 2XXAB 1G8FA 1TEXA 4ITRC 4LC0A 1MO6A 1OYWA 2D2FA 3P4YA 4XOIA 4TWZA 1CLUA 2X1VA 3QPWA 4ESVA 1FMLA 3C5CA 4PR0A 2C96A 4ZIRB 4WW0A 1T3SA 3N70A 1A4RA 1JR3D 2R6FA 3K0EA 3MWKA 3T15A 4B3GA 4KFTA 4TYWA 2D2EA 1IY1A 1E2HA 3KQUA 1P5ZB 3T61A 2F43A 2P67A 3LNCA 3CF6R 1VG9B 4AD8A 2W0MA 4A2PA 1E0SA 2CCJA 2WWHA 3LFUA 1KSFX 2H16A 2KB0A 3I8SA 1ZUHA 4X8OA 3DM5A 3P26A 3PUXA 1A2BA 4Z1MD 5FR2A 4AYXA 4DCUA 1SVOA 5CDFA 4P4TA 2ZYUX 2OXCA 4M8NE 3S1AB 4B3XA 3CRRA 1G5PA 1DAGA 4HAVA 2WSSD 1E4YA 4PAMA 3TR5A 4Q4AB 2E9SA 4I1UA 1QG2A 2BEKA 1NN0A 1CR1A 1X86B 2C98A 1RVDA 3IGFA 3B7GA 4CDGA 4JVMA 2XITA 4DDWA 4D25A 4KYIB 3C7KA 2H17A 2WWXA 4AYTA 1ZNWA 1YE8A 2OSBA 2P65A 1NVWQ 1RW4A 4DT1A 4EPWA 5B58C 2HT1A 4JLKA 3UATA 2RGNA 3DO6A 4TL7A 3MD0A 3KKOA 2DFKB 5EUQB 3R8CA 1CKEA 4Q7MB 1ZYUA 1DO2A 1HH4A 4UNNA 1W36C 4TMKA 3ZS9A 4KITB 3PUYA 4C0JA 2QI9C 1NI3A 1U0JA 2HYIC 3CM0A 4POAA 3SQWA 2F7SA 2KSQA 2OFXA 5H1YA 2QAGA 5GADl 1OXXK 3A4LA 3VNUA 2VP6A 1S4QA 2P0EA 2B8WA 1G7RA 2QROA 4WBSA 1XMJA 3KTAB 2GKSA 1ZM3A 5CJPA 2JLSA 4IEEA 4Y0AA 1U94A 2ZUCA 4ZO4A 3W9YA 4V0LA 4MUAA 4P4SA 4BZXA 3VKHA 2J0UA 1DG1G 2CNWA 2G77B 4D0NA 3GLHB 3EX7C 1WQ1R 3LW7A 4RZUA 1XTSA 4KSCA 2A5JA 3ZD7A 1OXSC 2GCOA 5KU1A 3U7FB 1UDWA 3VFDA 2QPTA 4AWXA 2OILA 1DVRA 5IF9A 3R8FA 3EWAA 721PA 1E2JA 1VYUA 1M6NA 2HCBA 3ZZ0A 4B34A 3A8TA 2D06A 4BWYA 1EWRA 2O0KA 4MGYR 2FSIA 1YZNA 4CEIB 4LJ8A 5JJKA 3UK6A 1QBKC 2VH5R 3IDQA 3PVSA 1YR7A 4IFEA 4DIEA 2KWIA 2XTMA 4JYBA 2KBFA 3B1WA 2IYRA 1E94E 5EP2A 3THWA 3K0AB 4JLJA 2IYSA 1JECA 2QMOA 3V00A 4DHEA 5G3YA 1RRCA 2C03A 1YZKA 5DH9A 3LWNA 3ZGXA 5E3HA 1NKTA 1D6JA 3K9NA 1Q1QA 2ZRFA 1EFUA 1P3JA 4NCKA 4URZR 3KKPA 2VSFA 4QC2A 1KI3A 4YDHB 1VPLA 3X1YA 3AKYA 5JRJA 1FMJA 3U60B 4LUCA 3GLGE 5AJZA 3BK7A 3FKSD 3T34A 4AG6A 1S0UA 2IXGA 3QXJA 2ZITA 1CU1A 1A2KC 2ZUDA 1OHHD 3U6KA 2J9RA 2HEIA 1S3GA 2ZVPX 4OBEA 4G5RA 4KI0A 3B5JA 3GLIA 4FWIB 3MWYW 3K0FB 3CRMA 3QBTA 2OV2A 1XXHB 1ZIPA 1XEWY 1ZJ6A 3BFKA 2AXNA 5DI3B 1AZTA 1X8JA 3THOA 2FE4A 4M9QA 1P2UA 4Q7JB 4TTRA 3NG1A 4C0LA 1VIAA 3BS4A 1RJ9A 4LPKA 1G3MA 2B21A 3I1FA 2XZPA 4JSTA 3SS8A 1S8FA 2NMVA 3KJHA 4JT2A 2WPDD 4YMTA 2ZQ5A 4XD7D 2FH5B 1NLZA 2ZI6A 3QY0A 4OKSA 2X19A 2AK3A 3B1XA 3LBNA 2X77A 3EC1A 3QNUA 2WJGA 5E4FA 1OH5A 5J40A 1UF9A 1G7CA 2BMEA 3A58B 1OE0A 3CF2A 2YWEA 1R10A 1TQ2A 2ZJZA 1JAHA 5E7MA 3NHBA 4DUGA 2PT5A 1Q12A 3GLFE 1MT0A 1G7SA 2FZLA 1Z2AA 2VL7A 4LRWA 4O25A 4OI0A 1AS0A 3BBPA 1Z08A 5L3QA 3CIOA 3O8RA 3L82B 3QXCA 4OYHA 1SXJB 1YHNA 1SVLA 4L9WA 2ODWA 4OJQA 2CJWB 1ZC4A 2RHDA 3PEUA 4MITA 1A82A 4P4SB 2IWRA 1Z6YA 3CX6A 2BBSA 3ZYCA 4NU0A 2KE5A 5FPSA 3SFVA 3U3KA 1S9DA 5EJEA 2FFQA 4B2IA 2WKRA 4E09A 3TVTA 5AJVB 2RGBA 1KSGA 4BEJA 4ZV4A 4D81A 1XJ0A 2XZLA 1D8TA 4X8HA 1N5KA 1XP8A 4PHHA 4BZPA 3WYGA 2OG2A 2G1JA 2VHQA 4C0AC 3HU1A 2C99A 1MRSA 2ODBA 2QG6A 4NHOA 3W6NA 3ADBA 3EPKA 1JR6A 3EZ2A 5L3SB 1NMYA 1FTSA 1G3QA 1OHHA 1TF2A 1XCMA 3BWDD 1OB2A 2MSEB 4OK3A 2PJRA 1DAHA 1GP2A 3AKCA 4D4KA 4LZZA 3SBDA 2WSSA 2R65A 3B85A 3G0HA 3ND8A 4L4UA 3X1XA 4DLWA 4F4CA 1SXJE 3AVOA 1K6MA 1OIVA 4NP6A 5K8TA 1NIPA 1T5IA 2FV8A 3U2QA 4BLSA 3THWB 1NRJB 2CLCX 4DZZA 3BOSA 2JLYA 1Q1ZA 1VG8A 2FNAA 3EIEA 3UIEA 1TMKA 2ZJBA 4KBFA 2CXXA 1T8UA 4RCYA 5DHFA 2BWJA 5IDVA 4G1UC 3RDPA 4D6PA 1JR3A 2VP4A 2RB4A 2A5DA 4MUBA 4PPFA 2QL6A 1I2MA 1YJ5A 4PQFA 1KI8A 3CH5A 4JVNA 2WSMA 1XMIA 3MFYA 1F60A 1G4AE 1GWNA 3SOPA 3JVVA 4YQFA 5E95A 3K0FA 3WMGA 5IK2A 4BASA 1JALA 1G7TA 1S96A 3KFXA 5EUMA 4CW7A 4FWTA 1Y63A 4G5GA 4L16A 5BN5A 4PC3A 3FHCB 1MV5A 1PLLA 4LHYA 2QPAA 1IN6A 2D3WA 2XB4A 2ZS8A 1KAOA 2J0QA 3IQXA 2NOAA 4P0TA 4JLOA 4EPRA 4N1AA 3B1VA 3AVWA 4OK6A 3VMFA 1W4CA 5J4LA 3U44B 2N46A 5FPKA 1U9IA 3SJBA 1CULC 5H8WA 5EXTA 3UG7A 2OXRA 5HKKA 3RC3A 1VG1A 1W5SA 4TQUS 3CO5A 4NCHA 4B6EA 1NJGA 2BCJQ 1TNDA 2RKOA 1YVDA 3PQCA 4LV6A 2XX3A 3BH6A 4URVR 2XJ4A 4XWOA 2EFDB 4R2HA 1QG4A 4HLCA 5JI3E 4DLYA 1FOEB 1ZNYA 1N6NA 4G5QA 1I2DA 4QGAA 2JLWA 3CONA 4JLVA 2WOOA 4GMXA 2AKAB 5BN3A 1KDRA 4EJSB 5M04A 1CJTC 1YZQA 2GJKA 2PLRA 4XVRA 1AKYA 4OI1A 3SDZA 3V4RA 4XWAA 1R5NA 2CVHA 5LPNA 4US1R 3AF0A 4Q5IA 4D0LB 1COWD 4Z54A 3EWSA 4JLPA 4D26A 2O8BA 1XCPA 1QVAA 2RGCA 4GP6A 5FPYA 4ILEA 1KYIA 2QSYA 3K9LA 4IFBA 5KSYA 1OIWA 1Z28A 3AH8A 2DFLA 3EASA 1B0UA 1EG7A 4PAQA 3CX7A 4TL8A 1EFCA 1ZM4A 1Z2CA 3OF5A 1QHYA 2ZSBA 3KJEA 1LF5A 1W46A 1OT3A 3CZPA 4FD2A 4F92B 1P62B 2D74A 4HEJA 3AP1A 4GRAA 5FL7D 3HPQA 3LDAA 1NN5A 2V55B 1G20E 3WRXC 5JS7A 4PZLA 4Z8XA 2CEAA 5JLJA 2FPLA 4QGGA 5FBQB 1DEKA 3U3RA 4PPQA 4BQSA 3LVRE 1JPNA 2BIFA 4EPVA 2PLFA 1UKYA 1E1QD 4BFUA 1N0WA 4Q9HA 2GF9A 4A92A 3THYA 1NIJA 1NG9A 2H1LA 2N1BA 1OPXA 3GEIA 3NIBA 1KGDA 3MCAA 4C2TA 2QQ0A 3IEUA 4D80A 2GAAA 1W0JA 2F1HA 4KO8A 5CDFE 1CJVC 1NBME 3DDCA 3RRYA 5FPTA 2ZS7A 3PEWA 2ERXA 4MRRA 2EYQA 4V0NA 2Q21A 2XNSA 4D82A 3U61B 5F9HA 3NDBB 5KSZA 1JAIA 3ECCA 1GL7A 1P9NA 4LX0A 4R98A 2OE2A 4ASUA 2YJTD 3W90A 2TMKA 1HT2E 4HUTA 1XEXA 4B3DA 5FBVB 1IOZA 3VKGA 4FN5A 4B76A 4NDZA 3A6PC 4OI4A 1E9AA 1FQJA 3FTQA 4R7ZA 2CDNA 5EP3A 5EQTA 1WCV1 3X1ZA 4L5BA 2HV8A 3UG6A 2P5TB 4WOPA 1HURA 2PEYA 1G4UR 2X2EA 4EUNA 5KPDA 4LYFA 3U44A 3P32A 1UBFA 1FZQA 4MRSA 4Q9LA 3R9IA 3TR0A 4HDOB 4LHXA 3KQNA 2J59A 2YOHA 3PCRB 1Z07A 1NBMA 2CLSA 3BB4A 4JS0A 4DDVA 2EFCB 2QN6A 4MA4A 1NY5A 2A5FA 3GLGB 1UKEA 2ZR7A 3CWZA 3EARA 5LD2C 3FMOB 4K8OA 5FTMA 1PV4A 1G16A 2A3RA 5B2ZA 4DJTA 4FIDA 5JBQA 4MYTA 3T5GA 2HXSA 3U7HB 1VYVA 1XD2A 2NIPA 2NQ2C 2IF2A 1FNMA 1UBEA 1TQ4A 1GOTA 1ZM7A 2IUUA 1MOZA 5FOTA 3W3ZB 4J0QA 5KSOA 1GNQA 4JT4A 3ZVLA 4OHXA 3PEYA 2ZAMA 1DAMA 2PT7A 3HPRA 3SHFA 1JPJA 2OLJA 2V7QD 2XGJA 5DO9A 4FW9A 3RABA 3MMPA 4DCVA 3LW8A 3K0CA 3KB1A 2YZ2A 1ZUIA 2HDNB 1KKLA 4PC7A 3HDTA 3PIRA 1VCOA 4QBIA 4RD2A 3F0TA 5HKKD 2R8RA 1U8YA 4LBWA 1GNRA 2ZE8A 1ELOA 3KTAA 1E3MA 3DHWC 1UPTA 2C78A 4Q4HB 1E69A 1ZC3A 4QFMA 2R6DA 1H8HA 2OO7A 1E2IA 3BB1A 4ARZA 4QGHA 1HUQA 3GLHA 2FEMA 3PUVA 3SZRA 1DAKA 4CEHA 3B8HA 1P9WA 1PJRA 1ZD1A 3RVBA 4ACAA 1ZM9A 1S3SA 5F3WB 3ZVMA 2KI5A 4S2EA 4BLRA 5BN4A 3HP1A 1NVXQ 1QF9A 1GKIA 2R6AA 4G01B 4JKYA 1VCIA 4CIDA 4QM7A 1GKYA 5FOXA 2O8DA 5FOVA 4M1KA 2PZEA 1DO0A 2YOGA 3Q85A 3QVVA 2SHKA 4RD4A 1DARA 4LYAA 1FW6A 1WXQA 1E2EA 4LY6A 2BJVA 4EQ6A 4V0KA 3LVQE 5HPYB 4W9MC 2JLRA 2QP9X 2VHTA 4W7SA 3TQFA 1M7HA 2GRJA 4YLGA 3AGPA 3AUYA 3QBVA 3SYNA 5EP1A 5TV2A 2GETA 1HV8A 1G5RA 1XBTA 2ASEA 3AUXA 1QHSA 2QP4A 4RY2A 3U3OA 4QKQA 3AM1A 3X1WA 2IWHA 4LJAA 1M8PA 2BEJA 2CMKA 4TTQA 3SJCA 3EIHA 4OJKA 3WP0A 1DTSA 4DLUA 1E79D 3U7EB 2QBYB 3VR3A 3VR4A 3QKRA 4Q19A 1K8RA 1CF4A 5SZKB 3AB3A 3B78A 3NKVA 1GILA 2RMKA 4UJ5A 3DPUA 2WAXA 3FKQA 2OCYC 2QAGB 4CT4B 5AWFC 3GLIB 5H70A 4NCNA 3KL4A 4LI0A 3ND9A 4HLUA 2GHIA 1UBGA 1XD2B 1VTKA 5HCIA 3H4MA 4EIWA 4DCTA 4YMUA 2BKUA 3LXRA 4F91B 1KK1A 4WAUA 5A0FA 3R20A 3CBQA 2BOVA 4GZLA 3MGCA 3W5JA 621PA 2OBMA 4M22A 4DB4A 3T1TA 1Q22A 1L4UA 2BDTA 1R4AA 2VHJA 3BB3A 3QVUA 1OFUX 3BRWD 4PSKA 4ZPXA 3NHAA 3PITA 4C9BA 1OH7A 3B82A 3K0CC 4QHYA 1H65A 2QMEA 4FMDF 1TX4B 4JJKA 1W0KA 4OQNA 5FOWA 1O87A 2G0NA 3EPHA 2JJ1D 1TPZA 2ZR9A 4M9XA 1KHTA 3OEHA 2CK3D 4M1SA 3VR1A 1P2SA 4CEIA 4FMCB 1LF0A 4DCSA 4AIIA 4DRZA 1HYQA 1E6CA 3VNVA 3ADDA 1PLJA 4Q4HA 1LNZA 1P60A 3T1OA 2IXFA 3WNBA 2BBTA 5JI2E 4US0R 3B60A 4B2PA 5FH9A 4B32A 1OFIA 5B57C 2F1IA 3K0AA 4RJLA 5GVRA 1W49A 1EX6A 2JLUA 2BCGY 1OB5A 3B9PA 4EKDA 1UM8A 3BH0A 1BMFD 2JEOA 3GEHA 3D6TB 1OW3B 1EFTA 1G18A 4LJ7A 5TXGA 3JZAA 3WXMA 4QRHA 4UJ3A 3L8ZA 1V5WA 4IVQA 5HZKA 1NKSA 2VP0A 4DLXA 3CKLA 1EGAA 2J3EA 3SHWA 2WJIA 4RKEA 5F9FA 2GZAA 1JJ7A 1NN3A 1OKKA 2W2XA 4DUGD 3RYTC 3CWQA 4MKGA 1Z0DA 4PPNA 1E9EA 3DMNA 4ZDWA 3TSOA 4YC7A 2GWHA 1W0JD 2DBYA 4Q1DA 2DHRA 4MRNA 3LX8A 5L3VA 2G9NA 1E9RA 3ZS8A 1E4VA 2VP9A 1R0XA 1DG3A 4BFTA 4NCIA 2PX0A 4UXJA 4A0FA 1JQJC 4HAUA 3LBHA 3LX5A 2GK6A 4OHWA 3KJIA 2WKPA 4Y0VA 3I61A 2XNDA 3LD9A 4W5JA 4PXAA 1E9BA 1VECA 2JIZD 4IXMA 4HLQB 2O8CA 2QZ4A 2ZI9A 3QKRB 3T12A 2GCPA 2FPMA 1VKJA 4OL0A 5DN6A 1D2EA 3GLIE 4MKHA 2F9MA 2FDCA 3Q3JB 1GNPA 4HLUC 3RAPR 5CM9C 1U98A 3SC3A 2Q3FA 3M4YA 1W4AA 1AGPA 1II8A 1RYFA 2ORIA 2AFIE 5L3QB 4JIMA 1ZNXA 2ZRIA 4DBLC 2LCFA 3SU8A 1KO8A 4DLVA 4S35A 2AHOA 1OIXA 2V7QA 1LVGA 4CZ2A 1IXSB 5CLLA 4PC2A 3M0EA 5GJWC 4US2R 4GFDA 5CITA 4WXPA 3AVVA 4H1VA 2XOKA 4AKHA 5D3MA 2H57A 5DHAA 3NBFA 2O52A 1OLOA 5DYGA 4ASUD 1LW7A 4CRWB 2OHFA 4TMVA 1E2NA 2OT3B 4GL2A 5G53C 1AS3A 2ZM5A 4PHGA 3IPXA 3TKLA 1IM2A 3UMRA 2WKQA 1XJCA 1T4GA 4TL9A 3CPHA 4M1OA 3A1VA 3CH4B 4BFYA 4LYHA 2J87A 1YZGA 1X1RA 1G9XA 1TF7A 2DWPA 3M6AA 3TBKA 2O8FB 1GITA 4MDEA 4HDCA 4TMTA 3C5HA 2V6IA 2RGEA 1JXOA 1Q1BA 2HCJB 3Q72A 4TSFD 2VTKA 2WPDA 1MKYA 4PO8A 1MH1A 3CNNA 4IVRA 1GL6A 4KV9A 3EA5A 2REXB 1P61B 4KBGA 2YNMA 4GNKA 3EZ7A 3KDSE 3X2SA 3I72A 4EPXA 3AEZA 1BS1A 4YDSA 1U81A 2UZ3A 2ZI4A 3ONWA 5FL7A 5JRZA 2XEXA 5G41A 4IDHA 3KX2A 4E5UA 1J99A 1N0VC 1WF3A 1NMXA 1SVKA 1ODFA 1BOFA 4DVGA 2O0JA 2ZE7A 3WNCA 1G8YA 1ZM2A 2GZHA 2REOA 3K53A 2G83A 4LHZA 4B2LA 3A37A 1VCNA 1CS4C 2PX3A 4R2IA 4N0EA 5C2JB 1Z6AA 2ZI5A 221PA 1SHZA 4TTPA 4TYQA 3THYB 2ZJ2A 2IEYA 1CTQA 2ZTSA 5C4MA 4HB0A 2OCPA 2Y8EA 3E1SA 3F3YA 3MUFA 4PAOA 4A36A 4RD6A 2IW3A 2CCKA 2O8CB 3RSLA 2C9CA 1Q21A 4L15A 2GEUA 4URWR 3T5DA 1I4LD 2ZR0A 4M4SA 1B23P 3T35A 2WJJA 1J8MF 1IHUA 4TT3A 3WNDA 2PCJA 1II8B 1KAGA 2C8VA 1G19A 3AVPA 2BMDA 2XZOA 1HE8B 1UDXA 1PUJA 2D4HA 4PHTA 1TQDA 2O5VA 3J81k 1EX7A 1VMAA 4D0GA 4A0RA 5KSPA 4B71A 2OLKA 1EK0A 1SKYE 1Z47A 2ZI7A 2KBEA 2ZSEA 3IEVA 4D2IA 4NONA 5FPHA 3Q8XB 2Z5FA 1LV7A 5D3MB 4LBYA 3CZQA 4JKIA 1X8LA 1L8QA 2OESA 4M9ZA 1J2JA 5FTNA 2VP2A 3DKVA 1SVWA
chains in the Genus database with same CATH superfamily
3QLUA 4C0SA 4ZQBA 4UZSA 3H5RA 3UGJA 3OESA 3KQQA 2BFFA 4TXLA 4W1QA 3T7SA 1CUFA 1FTQA 3C41J 4YXWD 5CD1A 3DTVB 2A5LA 2GPJA 4OUDB 5B30A 3K6SB 4UEOA 3RSQA 2CC2A 1DI0A 2R2AA 2YV5A 3FGZA 1V5GA 3OSZA 4A9AA 4URYR 1YJBA 1ZXBA 1XXLA 2VF7A 2ZU0C 1ZP6A 3ECSA 1R8SA 2PZGA 4N3CA 4ZJZA 2Z83A 2UUAB 3TG2A 1E2DA 3NOOA 4C30A 3MQFA 3OM9A 3FF4A 5LLDA 4BO9A 3OX3A 2HJ9A 4UXHA 4IHQA 1P75A 1VHDA 1JVBA 5FR1A 1LZKA 4TSFA 4RULA 4D97A 4BWVA 2AYXA 2O14A 1PU2A 4RFSB 2IS4A 4CG3A 3BRQA 5LP6F 4PRYA 4FCCA 3K70C 5KTSA 2PQ2A 1XYYA 2QLNA 3RU2A 1R0RE 2IUTA 3NEJA 5IHPA 4NH0A 5JWOA 2DUWA 4QU0A 5KTKA 3E48A 2B37A 4GZMA 1O96B 4MDYA 1YSCA 2Q8PA 4FFWA 5JXWA 1N8TA 4YCNA 2D7DA 1UDCA 2IYTA 5DOZA 4YMLA 2FRXA 5JJLA 1VSQA 4XX0B 3PHBE 4UUOA 4ACBA 1M5UA 2ZB2A 4CIWA 4FI3C 1EDOA 2NZJA 3CC8A 3TPZA 3PICA 4FR2A 2PL5A 4W8GA 4BZQA 1C8LA 2YW9A 3EFHA 1KY2A 1A5TA 5B55A 4FEGA 4KAFA 1N3LA 4MYUA 4X1KA 4B4DA 3LPMA 1K2VN 3AB8A 4OI2A 4DSNA 4FS3A 4YV0A 2OG1A 2N75A 3ANXA 1JR2A 4C3OB 1A4UA 2AX4A 2G17A 5AM0A 2E4YA 3QSYA 1IAQA 3H2YA 3V4VB 1POXA 2SNIE 3LA8A 5LOVF 4ZDWA 1IXZA 1GCOA 4MHOA 5KAMA 5HWSA 2H1WA 1RWOA 3AI7A 2Z2JA 3CEAA 4Z9XA 1T5TA 3EGDB 1ECFA 4WD3A 3GJ0A 5JRDS 2G0TA 4U2FA 3ZY2A 3BE5A 3IH5A 5ALJA 1LPMA 2WU1A 4UBOA 5HGXA 1WXXA 1GAWA 2IXBA 1K68A 3FUCA 3K3PA 3MA0A 1Q2XA 1S89A 3ILXA 4Q3EA 5E6UB 3IIMA 1Z13A 4UDXX 2QR2A 3V80A 1PW7A 3PJGA 3C85A 2A9JA 2C92A 3M6UA 3TTYA 4HV4A 3F1LA 1YS1X 1JEQB 1RAEA 3BMNA 4GP7A 3UAYA 4TS1A 2DR0A 1NM5A 3AHGA 3ESQA 3OA0A 1FDIA 4JNCA 2ZUBA 2XA1A 1GKUB 1GCIA 2PS3A 2ISQA 3K09A 3P94A 1CP2A 3Q3GE 4NAHA 4ZO9A 3A25A 4Z4GA 1EE9A 3GNQA 3MVEA 1PVVA 1SOWA 1GZVA 3OA2A 3KRTA 1A9SA 2G9VA 1RPAA 1L1QA 4IPTA 2EKQA 1P9OA 2VSNA 2R00C 4NMWA 1RRKA 4WFQA 3M9LA 3QVJA 2X42A 2MWMA 3CN9A 2WV7A 1B93A 3K09C 1Z0JA 5HUHA 1ND5A 2VKTA 4OQ4A 1AM4D 3LBFA 5K09A 4BQNA 2HV9A 1IZ0A 4XCXA 3A28A 1INLA 3K5IA 3KKEA 3LTEA 3RTAA 2NP7A 3QWBA 1PT6A 1LC0A 1T1EA 1PEKE 4I08A 4Y6OA 2BGGA 4L08A 4E46A 3DDUA 3MF4A 1E2BA 4HNSA 1JKMA 4EY6A 2AYZA 4JC0A 3L2OB 1DPFA 1KK3A 1WP9A 2AQIA 2FPRA 3VBCA 2AJCA 4JDPA 1Z0SA 2W8ZA 1IJBA 5ERGB 1KDOA 1T8PA 1M66A 4HLDA 1XHLA 16PKA 1W5TA 3HWSA 5LIPA 2AJLI 3OFJA 2GHQA 4NPHA 4RZSA 1GRCA 1GV0A 2VPIA 2AOWA 5F33A 3TNYA 5JWHA 5FWYA 4Q3DA 1WB9A 1ZCAA 2I8AA 4EVQA 4XCVA 2FSUA 4Z4FA 4LW8A 4Q4JB 1DEOA 1E8DA 1V6SA 2HBYA 2G82A 2HCFA 2QE7A 2ZYDA 2PKQO 3JWIA 3IUJA 3MTJA 4OIFA 4CEHB 3OOJA 3SQXA 3MAGA 4NE7A 4PAWA 4OGWA 4TLDA 1NQUA 5EHNA 2YXNA 5JDCC 2XTJA 1JKJB 1U8ZA 2V7TA 3KZNA 4XR4A 3O4HA 3OFND 4NCBA 2BV3A 3DOFA 1OZFA 4GGOA 2JASA 2JJ8A 3MTIA 4LXXA 4QXPA 3D2AA 1BX0A 4OJMX 2I8LA 2XOEA 2DFTA 4DL9A 2NUBA 5JCOC 1QCZA 1NJ8A 1X13A 3EG9A 3U4CA 3U48A 3ZBTA 2XNKA 3IKVA 2DH6A 3O9ZA 1QIKA 3FWYA 3P2YA 1WZCA 2CDBA 4QXQA 5JEEA 1FMFA 1Z6GA 3DHYA 2E7ZA 3FA2A 1T91A 1UJNA 1UFOA 1MJ5A 3U37A 3DOOA 4CLHA 2Z5GA 4YUZA 2R84A 4QYMA 1G9SA 2FPGA 2ZRGA 3LUDA 1AHHA 1PJCA 1RXCA 2R6ZA 3RJ5A 1V11A 1IUNA 4Q9IA 2VNKA 3R75A 2AN4A 1N2EA 4WLVA 4GS5A 1E6UA 2B1GA 1A7JA 3DQPA 1BDJA 1G8PA 2UYGA 3IESA 1E7QA 4CYMA 2J07A 3ZWVA 4BEVA 3L0PA 4I2VA 5AIBA 2IYYA 4XFJA 2CFCA 5CDGA 1WDWB 4FXPA 3ZQJA 1AY0A 3BTOA 2RK6A 2ZJ1A 1W19A 1Z62A 3QKSB 2P91A 1VP9A 2UUPA 3JYOA 4K6CA 3CTMA 5JCZA 1XGKA 2AZDA 3OPYI 2AFIA 4UKDA 1GG2A 1ZVKA 3UUGA 5GJCA 4KJXA 5IHXA 4OQXA 4PVDA 4JFRA 3G6KA 1RFLA 4N9QA 4EW1A 1MABA 2JANA 2QEQA 3RHZA 5IXYA 2Q99A 3QF4B 4JVLA 2YNMD 2QU8A 4OH1A 4OH7A 1PKXA 3BSWA 4C4PA 5JW6A 1LA2A 1YD7A 4MP3A 4B85A 3OIWA 4JMPA 2NSJA 5D8DA 5DLQC 3UCFA 1TCUA 3Q40A 3KJFA 5FLKA 5T4FA 1HA3A 3NXKA 5IM5A 4DIFA 4CV2A 5KOJB 1US8A 3VU9A 1LTKA 2GZRA 5TB5A 4MIOA 1UAYA 2EW1A 1FFGA 2P1ZA 4FQ5A 5B12A 3JS5A 1EFAA 4KRFA 3RS4A 4JT8A 3FDFA 4C08A 1DC3A 1CLEA 2FMUA 2DCUA 4YACA 2V03A 3H5TA 2NU8B 2V7PA 4EW6A 1LLQA 4JBIA 2SBTA 1WBDA 2OECA 3GJSA 4NYIR 1P1RA 4P4LA 3BDVA 3C5WP 4R40A 3MRTA 1KAMA 4KFRA 1G60A 3PD7A 3DAOA 1CY2A 2E2WA 4XB2A 4I2NA 1TF5A 2CNLA 1AZWA 2QP3A 4MH0R 4CR8A 5CVTA 4MB2A 1PJBA 3ZIDA 1G42A 5JY6A 2W43A 2QJRA 3K31A 2PWPA 5IX8A 2A5YB 5TS3A 3KQMA 5EZYF 2PUCA 1F4VA 1XCGB 4RTQA 1V3QE 5HK9A 4L27A 2PJUA 3Q88A 4YAUA 3IUYA 4NK4A 4UNSA 5KBYA 2FQ1A 2WIAA 3JX9A 2QXUA 1A97A 3LKBA 2J7PA 4JHLA 5JNWA 4KXLA 3T95A 5JZOA 2XUZA 2MINA 3L92A 3L8DA 1Z8NA 5DCYA 2LP4Y 4JB8A 4YRFA 1N1GA 4YAGA 5A0TA 3TOSA 4LDJA 1BHJA 3F5FA 4P81A 4HAWA 3ZYZA 3RFXA 2VI5A 3H2JA 1JB1A 2A6PA 2PFGA 3ZGVA 1JEJA 4LRSB 3OE7A 1CUUA 2BMWA 2DWQA 4PYRA 2W2LD 4Y2YA 5EIBD 2VUTA 3O4VA 1V5IA 3VU8A 1WDTA 4GI3A 4QRIA 5CNJA 2EJUA 1QVVA 3HU3A 1UT5A 3EEIA 4EHBA 3A27A 1Z82A 1W4ZA 1CJSA 4UNPA 3P9QA 4L5CA 4IJ5A 3U3JA 1HQCA 2R85A 3I83A 4W1RA 2OXIA 5JAMA 5FX2A 3IPLA 3P9ZA 2MMCA 3Q5EA 4HJXA 4JLWA 2PGAA 2V0GA 4WY8A 1NVKA 1WY7A 3NHFA 5BWNA 3WK8A 3AETB 1M8JA 3W05A 2C5LA 3Q2KA 5ADHA 4TYPA 1ITZA 1GL9B 4G9BA 5THQA 3PLNA 1PYOA 3MJCA 1CUEA 3H5NA 5IBRA 5D86A 2BT4A 1ODTC 2EQ5A 2Q2QA 1VRWA 2AWNA 4QDOA 1OKKD 4BRUA 1MOPA 1W0KD 4PO3X 4WOBA 2I78A 1ETUA 2AXEA 2FWRA 2F3PA 2WZQA 3GQBA 5AKLA 4PANA 3ZLJA 3M6MD 4JXJA 1U0LA 5CX1B 4FGJA 1MQ8B 2YYZA 1I3LA 1A3CA 3KTFA 2D4AA 1XXHA 4FFLA 4GPIB 4Q7KA 4Y2UA 1H2EA 3PD1A 4FFRA 4ZVRA 4B3CA 4ZI3A 3L4JA 1QP7A 2M6RA 2YN0A 3QVXA 4IIJF 2IS1A 1D0SA 1EKXA 3RUEA 1BH2A 1XD8A 1BCSA 4IUDS 4XJXA 1AKTA 1QS0A 4G8BA 5TQ2B 3T9DA 3V3TA 4ZAWA 3TPCA 2WTMA 1X7DA 4BMNA 2XCTB 1QHIA 5LQKA 3QX3A 4BMOB 4PZPA 1M2WA 1TM2A 4BNVA 4ZKEA 1CXZA 4PSUA 3QZUA 4DDUA 3UICA 4E2FA 1SZPA 3PHJA 4M7WA 2JZOA 3MB5A 5TY0A 2V59A 2CJXA 1BJRE 5JVDA 1OLSB 1D9XA 2OVFA 3B89A 3UGQA 1KJWA 5CW2A 1B6SA 1DKPA 4CMJA 3MXOA 3HB0A 3OIUA 1CBUA 3VVLA 2F6RA 2XRYA 3GDOA 4GKAA 4KR7A 2X0IA 5A0VA 4DKJA 4RIFA 1GU7A 4QFBA 4PG6A 5DGXA 2O8FA 1UFKA 3DKKA 3OZXA 4X8LA 2JIPA 3FNHA 3N0WA 2YW2A 5A5DA 4UCQA 1ZSYA 3L0ZA 5ENDA 2VC2B 4BGEA 4P3PA 1E61A 1NDHA 2PRYA 3QTLA 3WLHA 1UAAA 4YVFA 5E7IA 5EE3A 1GZSA 1AKEA 2PN1A 4LDQA 1RWKA 1UZLA 3NVAA 3D5TA 4ICIA 1M2HA 1DC5A 2H1HA 1QH8A 2JI7A 4N7BA 5AKXA 2HU5A 2ZB8A 3V2IA 5C51B 3M5DA 1WD7A 1C7QA 3W4KA 2O7QA 2YQ4A 5EQJB 2GS9A 2IPMA 3MCUA 4MS3A 4URFA 3QWIA 5I6DA 1L5RA 4E21A 1D6NA 2HDHA 3C6KA 2D5BA 4LRUA 3OT1B 5AUOB 1YI0A 4A8JA 2P2NA 1OF1A 5BWCA 1NBMD 4FYKA 3SXPA 4ESOA 4W1SA 3Q7EA 3COPA 5FV4A 5GVSA 1QR6A 1FYDA 3TQIA 5BUSA 2BP7B 5TT1A 1BXGA 3U3DA 4UNRA 1M6WA 2P3QA 2D59A 1DELA 1WSWA 3MCVA 3P2IA 5JSHA 1FX0A 1M5RA 1N6PA 4GXTA 1R16A 1X9IA 1J2EA 3GXOA 4D9GA 2H9AA 2NO7A 3JQ9C 3FR7A 3HGMA 1XMXA 4X6YA 5CJJA 3ZZUA 4BNTA 2P3SA 4V1CA 1RJDA 2ADFA 2M32A 4EK9A 4EYKA 3HZHA 3VHXA 3VUFA 1K9VF 3W9BA 4DRXB 2WNIA 4KBYA 1Q1GA 3I04A 2QTVA 2I1VB 5TMPA 1AIPA 3U3MA 2BJWA 1EDEA 1VFNA 3D7NA 2YICA 4TPKA 2VP5A 2RI1A 3RBAA 4M53A 4BNUA 3FPGA 2A30A 3N87A 4EHHA 4PXSA 1G3RA 4INAA 2VUHB 4Y9SA 5CK4A 4EGCB 3KJGA 3U4QB 3IMEA 4IOLA 2PGIA 3BGSA 1YR6A 3BCSA 1Y1SA 3MIIA 3BMCB 3QOFA 2Q5FA 4IJKA 4NL4H 1N3IA 4XTRA 1WZ2A 1XEFA 2NU9B 1TZ2A 3C6BA 1FSSA 2P9CA 4HZUA 4MEBA 4R84A 4BKQA 1T2DA 5AUNB 1IFXA 3HK2A 4PW0A 4X63A 2WJZB 4TZKA 4ZICA 4A5OA 4K2AA 1S2OA 3O2NA 5EXPA 3ETCA 1P29A 1XG5A 4TLAA 3P9NA 4WTOA 3UB3A 4RV5A 4EAQA 4JJ4A 3ZHSA 4OU5A 3L7CA 5DCLA 4IMIB 4M6WA 4M0EA 5DYIA 2FEOA 3S81A 3I01A 5KO2A 3SR3A 2Z2YA 3M5PA 5JJBA 3IT3A 5T57A 4WLOA 1XDSA 2PTHA 2WV9A 4QLOA 3VO2A 5AVUA 3AR5A 3K0SA 4P32A 3LUCA 1CEQA 4JELA 4YO8A 1FLDA 1TCCA 1CNFA 5FUMA 1IN5A 3K30A 2H4FA 2XMCA 4RKQA 2WTUA 3L7OA 2H1OA 1B6RA 1Z5OA 3BTUA 3RU9A 3PXCX 2IU4A 1K5DA 1B3BA 1LXCA 2LPMA 3LT2A 2QAGC 4RYDA 3RG8A 3ZLTA 3QIAA 1Z3CA 3ZDFA 2V5UA 3HM9A 1MO5A 3HJHA 4RGQA 1SQGA 4LSGA 1R6BX 1KI9A 1ZITA 3UMMA 4EHKA 4YXFA 1YB6A 1EWQA 4RZXA 4N8EA 4TUYF 1NRWA 4CODB 1A5AB 4NNPA 3IIKA 1NLYA 4O2BF 3R7FA 5LIRA 4PEVA 1WM1A 4UAJA 2VZ0A 3PD0A 4XCQA 1WRBA 1U5CA 4JGBA 1I5OA 4IIDA 4RETA 4KQ1A 1KC1A 2VF8A 4GOLD 5E1MA 5LMZA 3RVMA 2CJYA 1KZ7B 1AURA 1KMQA 3G2KA 2FN4A 3N0RA 4GGPA 4C07A 3DVQX 1XPJA 4CM1A 5AK6A 3ZQ6A 1NUQA 1XPRA 3DWIA 2F17A 5IJ9B 1IBLB 4B4KA 4D0RA 1QRUA 1FUYB 1VZ2A 1MQ9A 3S99A 2VNAA 5GPBA 1E1CA 4C88A 1ODIA 1FL9A 2FP4B 4KQKA 4TVOA 4UCFA 3W2TA 4ZTUB 5C1DA 3KQLA 2QR5A 3ZNPA 2CUKA 2GF2A 5FA6A 3OZSA 1EX1A 1CR0A 2IEGA 4Q18A 3IP3A 2GTPA 1M73E 2AG0A 3IHLA 5DGHA 1Z4LA 4NYJR 2FR8C 1WCWA 4NECA 1YE5A 2XR1A 4WJLA 1L7DA 4EFMA 3KDPA 3ZHCA 1J2TA 3GRZA 1RLJA 3AVYA 3FR8A 2ZYSA 1MU0A 4JLUA 3A0UA 4MV6A 1FDOA 2EHDA 1ZESA 1F48A 1YB1A 3H1BA 3TTVA 1E3IA 3ZDAA 3FJ1A 1QKKA 3ICPA 4NZOA 4FNAA 1L7VC 2GO7A 3P2EA 2AI3A 5TQ0A 4G63A 1J7JA 3CX8A 2ZUVA 4QYXA 2EBFX 3B2QA 3LVFO 2OR3A 4D9CA 5LNK1 3TEJA 2V5VA 1EFPB 1O0SA 3G5MA 3JQFC 3LP6A 3TQOA 2NUAA 2NPFA 1JHVA 4YHBA 1J00A 1JHOA 3L5OA 4CQLA 1GGFA 1MN6A 1G8GA 2Y76A 1VIYA 3E3AA 4P8RA 5ED0A 5K0BA 5KUTA 2ZJ3A 5EYPA 1U2ZA 1H1DA 1NVVR 3RTGA 3ZE9A 4DC1A 5FQNA 5G4KB 4JP8A 1SXJD 3HGTA 4HTAA 2PBZA 3HJRA 4OL9A 2AL7A 4HHEA 4A6PA 1AB6A 1YBVA 3IP6A 4OLFA 2XA2A 1R7RA 1KTIA 4GDFA 3AL0C 4GOMD 4OQLA 4LXTA 4QWWA 3NGMA 2WM3A 3KU4A 5CFOA 2LV8A 3RG2A 2Z9CA 3NCHA 2FSSA 3IQGX 4LMRA 1JI3A 1MC5A 4UPDA 5I9IA 5ILOA 1KBOA 2OCDA 1C9YA 3JVUA 1GSIA 4FDLA 3PWSA 4YXWA 4CF5A 2IU3A 5LKRA 5IXJA 1RLUA 3PE6A 1QIDA 1U90A 3K05A 4ZPJA 4F96A 1PJAA 2HHLA 4LWZA 4AJIA 4HRAA 3B6EA 1N36B 2B6HA 4UARA 3H86A 3VR4H 1TEZA 2AGVA 3HY6A 3OJOA 4ONEA 3UK1A 1SBCA 4RD1A 1R4MB 4Q9KA 3I6ZA 1P6UA 1TMYA 4ALNA 5HZMA 1B1AA 1RMTA 3ETNA 3CLSC 4RNDB 3ITKA 2B7BA 4JP3A 4DJDC 3JW8A 2H51A 2ZYGA 10MHA 1SKYB 2ONZA 1MJHA 2I1QA 3FYHA 1SRRA 1Y7PA 4UREA 3H9JA 3O0TA 3KXIA 4YV7A 5M34A 2Y0EA 4CM9D 3REQB 2NYUA 3ZGLA 1USVA 1YS4A 4LCEA 5EIXA 5JCJD 3QVGB 3R5SA 1A9ZA 4MZDA 1MG0A 2C5SA 2XEDA 3IUQA 3RSGA 2Y1DA 3OF2A 2IP2A 3AUSA 4JEHA 4V02A 3PSAA 2YFYA 3PQ7A 2PMWB 4KDCA 2H52A 3OCUA 1W44A 2QTMA 3RT9A 4NZ9A 2W2TA 2HA0A 1BN6A 1R8QA 1AQIA 1R0WA 1YDEA 2AX3A 2PSDA 3G1UA 5E1BA 3PNKA 2O23A 4U6QA 3UJNA 3ZHTA 2ZJ6A 3VI3B 3WIEA 1GG5A 2ORWA 2G6BA 5HTKA 5K3FA 4KW7A 5K8UA 2FWJA 2HN9A 4ZU6X 1X2EA 4A7PA 1JNYA 2L42A 4OM8A 4BEBA 1XRNA 4FEEA 5GOTA 4KN9S 4DADA 1W4LA 4DQUA 3ORSA 4DW8A 4FUQA 4IQ0A 5BQ5A 4UTNA 1EE1A 3H1PA 4G0PA 5K0FA 3GEMA 4ZQIA 1LVUA 2W2NA 3U9SA 2PKYX 5EE9A 3VYTB 1RYZA 3ACBA 5DW3A 5E9WA 1Q83A 4O2BB 2ZEJA 1FSGA 1WG8A 5A7GA 1XU4A 3H2KA 1XF9A 3II6X 4NNOA 5HF9A 1CIJA 3MWEB 1R9NA 3AOEA 2V7VA 4BFSA 3T41A 3RASA 2FEPA 4JCCA 1VBFA 4C4XA 4LJ4A 3P96A 2XUOA 1P1BA 1WXWA 2XUJA 4RBNA 2BW0A 4HWOA 2OUIA 5ALGA 1L1EA 2GT1A 2XOKD 3GGSA 2GCIA 4OQDA 5HZGA 4G2NA 1T36A 3V2GA 5I7WA 3ISTA 4X1YA 1MVOA 3PTAA 1MT3A 4TQ9A 1H3FA 5JASA 1W88A 4ZV7A 1CRLA 3RTCA 5TMDA 2FGKA 1MJGA 4JLBA 4RPKA 1KK0A 3Q3HA 3UAWA 4REQA 2J09A 4PHCA 3G8AA 2C3YA 5LZ2A 2GHRA 3NBXX 5IJXA 2VDWA 4L0MA 4V0ME 1PN3A 3FNGA 4LXHA 1PNVA 4HAXA 3LHFA 1TMGE 2RG7A 3N2ZB 3QW2A 1S9HA 3I64A 5JIBA 3THXA 2F4NA 1YZUA 2J45A 5L7YA 2H08A 4Q82A 5EJFA 4F85A 5KQLA 2ZRPA 3R9WA 4GLFA 4RSRA 5DJ5A 1BEZA 5KQSA 2B83A 2Y77A 1JTEA 3D6UA 3DT8A 2KJQA 1V2GA 1MF7A 3PLAE 2GCEA 1IXRC 2GPAA 3LUKA 1E3EA 3GCDA 2I62A 1J7KA 4CEJA 2F3TA 1MXFA 2H4YA 4O1IA 4ZRDA 1QWOA 1WUHS 1JG4A 1SVIA 2EVWX 2GN6A 2YCLA 3FE2A 3N7TA 3PHGA 4KXUA 1PQ4A 3MYRA 4IHJF 3ZHXA 1SXQA 1AUXA 1S8AA 2JGMA 4R68A 2B99A 4A73A 4C4SA 5LQDA 3EYWA 4AG3A 3WKAA 4BMDA 4DG9A 1P1JA 1KH3A 1X70A 4CUJA 4LPSA 1BKDR 3DSRA 4Q00A 3BTVA 5E6SA 4I3HA 1QPZA 4GPD1 2ZSIA 1Q3TA 1VI6A 1GRNA 2IK8A 2HF2A 2WVJA 2YMLA 4ZCLA 5I7HA 3FJOA 2FEWB 3WYAA 4QM6A 3VDRA 3ZWAA 1DE0A 3WLJA 5DHSA 1GYPA 2J32A 1PCXA 1NBOA 1SN7A 3UJ3X 4L74A 5C37A 5DGIA 1JFTA 2VRWA 3BPSA 2CFRA 2QN9A 4DHWA 1FTWA 2AR9A 2XJ9A 4KHPB 1UXHA 2P1RA 1P7WA 1RHRA 3GJQA 4XD7A 1PX0A 1SQFA 1OZAA 1TW2A 1YR9A 2RBKA 2J5KA 3LBYA 3R6GA 4FFMA 4J16C 5BOSB 5JFGA 1ZMRA 1E2GA 1SC1A 3L8FA 3VPCA 5EE0A 5EC8A 7YASA 3WSWA 2BM8A 3DW1X 2QW0X 4Y3UA 3GEGA 4G5XA 1U31A 5K20A 5EXSA 4WJZA 4OAOA 2GN4A 3C8MA 2Q4BA 3ELWA 1MW9X 4J16A 1R15A 5CUQA 2GK7A 1ENPA 2Z4RA 4W9NC 4DR2B 2WF8A 2QBYA 2J08A 3IXQA 4RESA 2N47A 1Z6XA 4F3NA 1F14A 1FJHA 1XDZA 2CLMB 1MHPA 2FA9A 3KR2A 3GLFB 5TPZD 1DXOA 1NGSA 4U2GA 1JILA 4CF7A 4NXMB 3F2VA 4UPEA 1NYQA 5L7WA 3FVWA 2HOQA 2QZZA 2YWFA 1SUSA 3LQRA 1B42A 4JBLA 1N7JA 4IOMA 4KO3S 2V96A 5BYKA 2P9HA 2P8SA 1RU3A 3DCJA 4QBKA 4ZJYA 821PA 2DC1A 4HN9A 1TTTA 4ETWA 2WYIA 2FX5A 2Z0MA 3U5ZB 4FFNA 1FJGB 3DO5A 1DINA 1OFGA 5KNBD 1KMMA 4OQFA 1E5TA 5AK5A 4RE6A 5HS6A 3WIBA 4R83A 4B35A 3TMKA 4OHYA 4XJSA 2FUG1 4GLLA 4A16A 5I7UA 2XTNA 1SBNE 4ZVKA 3ASUA 1T0BA 2XXAA 3E2IA 2RJNA 2QN8A 4IF4A 2ZJOA 4I81A 2ECOA 3EF0A 4KYVA 4MVJM 1GRVA 1ZRNA 3CJQA 3H05A 3GFFA 3UOWA 4OQZA 1KQFA 3HBJA 1ZD5A 5KDLA 5KQGA 1P5FA 1H9BA 3WS7A 4YRZA 3QSGA 4QBTA 2A9FA 3UFBA 3WGYA 3GAFA 4RPGA 3K9CA 4L7QA 4ZVUA 3OY2A 2E4UA 5HJ2A 1SY7A 2D1QA 4DXDA 4EDFA 3C3WA 4L7VA 2CWWA 3W77A 4U2KA 2P4HX 1N78A 2EBWA 3BKWA 1MRNA 1VZ3A 3KKLA 4FCTA 4GXRA 1F12A 2BGTA 4Z99A 4HVTA 5J4KA 4TYYA 3PC8A 2F8TA 2BFNA 2HSZA 1LGYA 3FZGA 1SXIA 2VDNB 1KI2A 4FDTA 2E6KA 5KAPA 2F8MA 4IIHA 5BVHB 1L7RA 4D9KA 1ACMA 3ZDBA 1Z6TA 3I8OA 1NJ1A 4JJFA 4QQRA 4OFWA 3DYBA 4BEWA 3PDIA 1Q50A 1I51A 2Z1MA 5FBWB 4YMWA 4Q1FA 3EE6A 1QJ4A 4AZTA 4X44A 3TNFA 1HXHA 2WIDA 3OTIA 1I8TA 1E7MA 3C3KA 3LAWA 5AD1A 3H9CA 3FW1A 4MA5A 1DJNA 1UBRS 2GBLC 3FYCA 4GKBA 3VYRB 5FBRB 2GAOA 1KO7A 1KYYA 2FVXA 3KDAA 3NPAA 4PSCA 4XWGA 3BMXA 1TM7E 3U19A 1E2PA 4MWEA 3H1GA 5AVZA 2FW9A 7MDHA 1GTMA 4BVJA 2OO3A 5T3YA 4FILA 5IU6A 1S4MA 1RYYA 4UC0A 2ZROA 3WLTA 1NPYA 3VPXA 1U0HC 4BVGA 3L01A 4DT1B 3IHTA 4PIVA 4RIHA 4D8UA 2BELA 2HSGA 3BMQA 4KXQA 3QP9A 1A9PA 1H4VB 3VH1A 1QR2A 4IHJB 2CB0A 3DEJA 1F2TA 2VZ8A 3VJKA 1J5PA 4YRNA 3FHTA 3M1AA 2ODEA 4XDZA 5CCXA 4ABTA 4P2BA 1XU9A 1OBCA 3GLHE 4HNTA 4ZYWA 4NDAA 3QVTA 1G64A 2I2FA 4PM4A 3PNLA 1PAUA 3CLKA 1I1NA 4RABA 4XSGA 1LX6A 4OFXA 4ZXPA 2WMOB 1ZW6A 5FIUA 2R68A 2ZTLA 2X76A 4ZOCA 5A6SB 3RC2A 1NLMA 5C8XA 1H2HA 2P6MA 2O54A 2EL7A 3DUFA 3C1AA 4I9GA 3EXIA 2G72A 3NV9A 3PWTA 5FPPA 3IQEA 3ZY5A 1JHXA 1GXSB 3SX0A 4BCDA 1EP9A 4RDIA 1I3NA 3D7KA 5A5EA 3UKDA 2YNMC 1NWCA 1RQRA 3MGAA 3MOSA 3PYLA 3GN2A 3AF3A 4FOLA 3ZHYA 2I29A 5FFFA 4CF4A 1IZZA 2GBFA 1E0JA 3UHFA 2OHGA 1IMOA 1P74A 1ISSA 2CXQA 1SCUA 1V7PC 2J6BA 4KQ2A 4BB0A 2DPLA 3AW8A 3GLTA 2EX1A 3EVNA 4EGSA 1QGUA 5JNRA 1MORA 1JVSA 1SXGA 1XZMA 2A57A 4X7PA 2O1EA 5H3LA 3U1VA 2JCVA 3ZWCA 3HJBA 1VLLA 5JO0A 2VNJA 3EUAA 4E2YA 4GRIA 4KCGA 4RW0A 1F8GA 3VMMA 5GINE 1KRHA 4Z0HO 2A67A 3NOQA 2L19A 5K2MA 1V0JA 3F73A 3WMFA 1ISPA 4PAGA 2C2WA 4R01A 2VDQB 4JH0A 4Y2GA 5KHAA 4EYEA 4O0MA 3F8TA 2I7TA 4GMHA 3UAZA 4UDNA 2UUBB 1QIIA 3JQGB 4F3CA 1GRRA 2JGDB 4K1LA 4ED9A 1Z35A 4KMSA 2X1MA 1ZBDA 5LB4A 1XTRA 4H0FA 3ZVRA 3MSXA 2IV7A 1QVRA 3CZAA 2OD9A 2F3QA 3NTUA 5G40A 5IZCA 3TSWA 1RCFA 1Y98A 1XX6A 2QN1A 1N2HA 4QOGA 1FRVA 5DNEA 2QENA 3A3NA 2YHIB 3TFQA 1H4TA 2BVNA 3FTCA 4C0KA 4F4UA 2CL7X 2DE0X 5D3KA 1Z63A 4F86A 6ABPA 3NWJA 1YR8A 2I4NA 2O7NA 2VJYA 4XM1A 4M7RA 3QKWA 2EGGA 2ERCA 5FTLA 2EZUA 4UE6A 5FV7A 1HDIA 2HZBA 3LLMA 3TOCA 3EXG1 3ETJA 3OM1A 1YMVA 1KJQA 1XTBA 1H23A 1JNXX 1NF8A 3O94A 5EMMA 4CQMA 3ER6A 3JALA 3ZY6A 1YQXA 4NRDA 4P80A 1GPKA 2IYZA 2XE7A 3B3FA 4D4HA 4PTLA 4F56A 4E22A 1M75A 3GPCA 4UNQA 2R7MA 1G66A 2XYPA 4WOCA 4D3YA 5JISA 3EA0A 3HCFA 4F7WA 2X5JO 3DJYA 2FLWA 1KMCA 2C9DA 1V1MA 1Q7GA 3G5AA 5D01A 5TPWA 4Q34A 5ER6A 4BVAA 4EG6A 3AJEA 5LDDC 1RJ9B 4YRIA 1QMGA 1VMDA 5FD8A 2D5IA 1YDFA 2XVXA 4MLPA 1VHLA 2PT9A 3AJDA 3BIFA 3GUYA 3ZKAA 1P0FA 3BD9A 2F48A 1KNQA 3HCEA 3QFFA 2H5LA 5HDBB 4UDOA 3PQ8A 5BSWA 1CUSA 3IX7A 1RACA 5E8JA 2QSUA 4NYIQ 2GM4A 2DBQA 2H07A 2J5BA 1W4RA 3O0DA 4GPEA 3QVOA 1Z7YA 1H0SA 5FUBA 2F55A 4XX1A 3CZMA 3N5CA 4QVIA 1JBKA 1U3VA 2INGX 2IOFK 4H3SA 3RYHA 2ZS9A 5CFNA 1BRMA 5IG2A 3I32A 5CLQA 1F1BA 3AB7A 3DR3A 3WAKA 2WM9B 4C0BA 1XIVA 2CFOA 3IBTA 1E7RA 1V8DA 2K7ZA 5DK6A 3T7TA 2BUBA 3HA5A 1QBGA 2I54A 3PQ2A 2E18A 4GT1A 4MKZA 2HHAA 2AI2A 4TLMB 4YJHB 2FJ0A 4RS4A 1DZIA 1E2UA 1JDVA 1F3OA 2XI4A 1N0IA 3DHVA 3KT3A 3DJFA 2LXNA 3G7SA 4FYXA 4K05A 5G0TA 2QMHA 5BSGA 1HLFA 3F9CA 4ZD6A 3DLTA 3KXKA 4H77A 3CH7A 3HN6A 4KJZA 1NPTO 3EXEB 1NR1A 1E99A 4D9IA 4HGOA 4EY3A 3UN1A 1JI0A 4MLDA 4H16A 4LG1A 1L8AA 3F78A 5ITVA 4KFUA 4B4OA 4DLAA 2HU2A 3ASYA 2P68A 3J7AC 1HQYE 1SK9A 4BB5A 4CV0A 4MVJE 5FORA 1QYDA 5EVJA 5AVXA 2ZSDA 1NJ5A 1LY1A 3D0QA 3TZLA 3C15C 4EFDA 2R7NA 2H3EA 2VDVE 2W42A 1FBNA 3B53X 2EU8A 3GFPA 4K5QA 2GO1A 4RZ3A 1Z29A 1IY2A 3UZUA 2E1RA 4KMRA 3TZHA 2V58A 3WI7A 3A3YA 4TUYB 4KLZA 1B41A 1GNVA 1EZ1A 1U2EA 1DC7A 3P7MA 4RL6A 4OIMA 3U9LA 2CVZA 3ETLA 4NMHA 3O9VA 3IMCA 1ORIA 4L72A 5HKAA 3TX2A 1RAIA 4MDHA 3NRBA 2OHOA 4MVJF 4RJKA 4XWKA 5I45A 5EQFA 4LA4A 1ORVA 1MAVA 4B7XA 1ESCA 1V3VA 2D1FA 4MR7B 3WGUA 4KIWA 4JOBA 4Q3LA 5DW0A 1BH6A 2GYWA 1TGYA 4GLBA 4CMBA 5K6RA 4INPA 1H9CA 3PUWA 3COVA 3I30X 4B0OA 2Z3VA 1EDBA 1W48A 3K5WA 4DLTA 1SELA 1NW4A 2UZAA 4XQGA 2ZUUA 1JIIA 4IGAA 4YJ2F 1WMBA 3U3XA 5HBRA 1H3EA 3O38A 3RYFA 3HJFA 1N1MA 2UAGA 1CJBA 5KYYA 3EGXB 4K3UA 3RR2A 4FCWA 3L93A 4BHTA 4CMHA 4QLBA 1WSAA 2JDIA 2GCNA 4MSUA 1TRHA 1PR2A 3F3SA 1YL6A 2Z9BA 2QMUA 4JYMA 5ESWA 2ZBPA 3IDFA 3T06B 3TCKA 5HVNA 5J4VA 2R1VB 3TW6A 4HI0E 3NC1C 1IUOA 1ONOA 3DP7A 3H2BA 1D6MA 3HBMA 4ILKA 4TS9A 2X4IA 3VC2A 2AOTA 4AJ1A 5LWQA 4C7MA 3H84A 2O19A 1E1QA 1QFJA 2CXHA 3PFBA 3UMFA 4RM3A 3JWJA 5KWVA 3TW8B 4YMGA 2ZU6A 1FYFA 2P6PA 3EZNA 1H4SA 3E7WA 3QKIA 4MKIA 2QRPA 2CKMA 5HFNA 1D2RA 2IUSA 1OXVA 2PTGA 5LR6A 5IJWA 1I4WA 4PO1A 1WX1A 1SUPA 1YQTA 2ZWMA 4OQPA 1UDAA 3CE9A 4KODA 1ZAYA 4X6LA 4HAIA 4MCJA 4RGYA 1IVYA 1QO7A 3I73A 3ZD6A 5LXTF 3H5LA 3TKAA 2IW1A 2V98A 5JDIC 2GHTA 4LF5B 1FFEA 5KOIA 1JKFA 3DLPX 4KOEC 4BJ5A 1T0IA 2Q4OA 1OYVA 1RAGA 1C41A 4TMFA 2OZKA 4NZPA 2GVNA 4R8SA 3UA3A 4F0JA 3TBFA 1SU6A 1L5OA 1MUUA 1Y4DE 5EKSA 3H11A 3L8CA 4CLRB 3SR4A 1H8EA 4XIFA 4BIMA 2Q9BA 4C21A 5IC5A 1AKRA 4GUDA 5IK2D 4RCZA 4G0OA 4OMUA 2D2VA 4X7RA 4C7BA 1FP1D 3Q0TA 1PZEA 3R3ZA 5ITSA 1D2NA 4ZCMA 3X0DA 4IDCA 3EXAA 4WLFA 1KH2A 2F9FA 4HQFA 4KH0A 3W6PA 5BYAA 3FNEA 4D56A 4FYHA 5C1OA 3PI6A 2HUPA 4MGIR 4WNYA 3E8MA 4JBYA 1S02A 4FHFA 2QX7A 4H7DA 5KKCA 2Z4SA 4DR4B 2XHZA 4ECEA 3LRXA 4CMAA 4BGUA 9ABPA 1P0CA 1WKCA 1M7GA 1T1RA 3I9LA 4ZO7A 1VJCA 1SBYA 3FFBA 2YKGA 2WJHA 3GJYA 2RGXA 3CR8A 5F73A 3Q7QA 5L3ZA 4CLOB 4IJMA 4DUZB 4B84A 4Z5XA 1E5QA 3IP7A 1L6IA 2YY6A 2ZDGA 4H2DA 1O77A 4A03A 3AQIA 4GMGA 1DB3A 1TEVA 1LSJA 2PS0A 3H65A 3T7AA 2X0NA