2NGRA

Transition state complex for gtp hydrolysis by cdc42: comparisons of the high resolution structures for cdc42 bound to the active and catalytically compromised forms of the cdc42-gap.
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
191
structure length
191
Chain Sequence
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Cdc42 bound to the active and catalytically compromised forms of Cdc42GAP.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords PROTEIN (GTP BINDING PROTEIN (G25K))
total genus 65
structure length 191
sequence length 191
ec nomenclature
pdb deposition date 1998-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ngrA00
4IXMA 2WKRA 4M9ZA 1GWNA 4RY2A 2QM8A 1WCV1 4IKEA 1XX6A 3ZZ0A 4W5HA 1KMHB 2ZE6A 4G1UC 3OZXA 2JIZD 1E99A 4H9GA 4BLOA 2BDTA 3K0CA 4LJ8A 1WQ1R 1XMJA 5GJWC 3AM1A 1NL3A 2OFOA 4NONA 4Z1MD 5CYPA 2ZRIA 1M34E 2ZUDA 2ORWA 3IKJA 2JATA 3KKNA 1ELOA 2SHKA 3TH5A 4JVSB 5KDDA 1NG1A 5CLQA 4IDOA 1XCGB 4OHXA 4TQ9A 2FFAA 2D74A 3SHFA 3TKLA 3ADDA 1OXTA 5CIWA 5EXPA 421PA 1O87A 3GLGB 3MSXA 1NVWQ 1TF7A 2AD1A 3QJYA 1Z47A 5G40A 3QUSA 1N6HA 4DC9A 2OAQ1 2ZRBA 2WBLC 1AGRA 2Z0MA 4AC9A 2MSEB 1TAGA 2WSMA 4KYUA 3FKQA 3U61B 2V1UA 3MCAA 2G77B 4XSGA 1IXSB 1E1QA 1II0A 1OKKA 1VCIA 3GEEA 4JLOA 5G41A 2O5VA 4YLGA 1TUIA 1T8UA 2NZ8A 4UJ3A 3T1VA 2A5YB 1P9WA 3TW4A 2FDCA 4C9BA 1P9NA 3IIMA 2CLSA 4LJ5A 3OE7A 1FP6A 2ZROA 2XNDD 3PCRB 2DB3A 4LYHA 3E1SA 4LJAA 1DOAA 1P9RA 4PC2A 5KHOC 2AR7A 2VSOA 2HDNB 4DCUA 3ADCA 2ZANA 3V4RA 2OXRA 2XTZA 1FOEB 1NIPA 2J7KA 2KSQA 4QFMA 4V0NA 1EX7A 1TQ6A 4R98A 2IXEA 1A2KC 2ZS7A 3M1IA 2OO7A 4IW3B 1IN5A 1Q21A 1D8TA 2ZYVX 3EWAA 4WIAA 2WTUA 1VDZA 2GBLA 1QHSA 2H18A 4DT1B 2RGAA 2GWHA 3PJRA 2V7QA 4BRWA 2RGNC 1J8YF 2KE5A 2BBOA 4D0NA 1HQCA 4WZBE 3HDTA 4DXAA 3G5UA 2IC5A 1NSFA 3CF6R 4Q21A 4IOMA 2ODWA 1SKYE 2XITA 5B64A 5CB6A 1XBTA 3BORA 1QHGA 2BBWA 1IY1A 3U4QA 4B34A 3EWSA 3ZYCA 2OUKA 4TMTA 1SXJB 2CJWA 4EQ6A 2ZS9A 2W6JA 3EPJA 3AKCA 1DO2A 1SVIA 1OPXA 3EIEA 1C9KA 1Z0KA 4URVR 2PL3A 1U94A 2ZRFA 2XNSA 4ZI2A 4BZPA 1FMJA 1KDRA 3RDPA 1N6RA 1DAIA 1II9A 2RMKA 4KODA 1NBMD 3KXKA 2EYQA 3QXXA 1LS6A 3TAHA 1W4AA 2YC2C 1UEJA 2W83A 3IQWA 2JLXA 2X1VA 2A3RA 5UKDA 4QM7A 2GAAA 1II8A 2QENA 1FW6A 2WOJA 4RZUA 1KNXA 2ZRJA 3NEYA 3CLVA 3EIHA 4TL7A 4HB3A 5F2EA 4M1SA 4DSTA 2WSSA 3K09A 1KYIA 1OH6A 1KOFA 2OLKA 1AZSC 2ZJ8A 4UNQA 2NO6A 4QJ4A 2WWHA 4A2PA 3QXJA 3T5GA 2HCJB 4MA4A 2G88A 2V4ZA 1OH7A 3DKVA 1SHKA 2VBCA 3BE4A 1FPMA 2QMOA 5IK2D 4QXAA 4NYMQ 3ADBA 4YDSA 2QE7D 3MJRA 2WJIA 1ZINA 1OT3A 1ZNYA 4TL6A 5L3SB 1JXMA 2ONJA 1SGWA 2OESA 5FOUA 3SN6A 1IN8A 3FHCB 3MMPA 1CR2A 3MRSA 3HPRA 4R71A 1E4YA 3BFVA 2AXPA 3PEVA 4HZUA 1SXJD 3EZ9A 4TMWA 3QKSA 3WHKA 3VNVA 2JGNA 3BAFA 3NBXX 5CK5A 1GRNA 3AUXA 5LDDC 1R8SA 1GAJA 1GSIA 3WNCA 1G20E 3QVUA 1Q44A 1UADA 4MH0R 5KNBA 1GNQA 5FUWA 2IF0A 3DMDA 1K5GA 2BMJA 3D31A 2IYRA 4RKFA 4P4TA 1KK3A 4B3XA 2GCPA 3NKVA 4XD7A 3L0SA 4XVUA 2PLRA 1H8EA 4DIEA 4PQRA 4EFLA 2GRJA 1G41A 3CBQA 2ZAOA 3OAAD 1F2TA 1R5BA 1IM2A 1IXZA 1N6LA 4HLCA 3CUEF 1W36C 1SXJA 3NBYC 1E9DA 2G3YA 5IDVA 4O2RA 2QPAA 3A1WA 5JFGA 3KFXA 4B32A 2WPDA 3KZ1E 3HR8A 4HI0E 5FTNA 2NO9A 2Q9CA 1XTSA 3QPUA 1RFLA 2IWRA 3BH0A 1G9XA 1FTNA 2DWOA 1NN3A 4QOSA 4TQUS 2H8KA 1TTTA 4DRZA 4FMCF 3Q7PA 1QVAA 3CO5A 2OFXA 4LBWA 2QROA 3T5DA 3RYTC 4C0SA 1JALA 3QPVA 1QHHB 5TY0A 2A78A 1XEXB 2EWWA 2P5SA 5L3VA 1BKDR 2C2HA 4J0QA 2YOFA 4Q48A 2V54A 4C0QC 4Q9KA 4Q47A 4E03A 1GL9B 2ZRDA 3OAAA 2OLJA 1WBBA 1E69A 1ZC4A 2OBLA 3DL0A 1M2OB 2D2EA 4RD2A 1CRPA 5BYKA 1KAGA 1TF5A 3SBDA 4BZQA 1EG7A 2N1BA 4M8NE 1G3IA 1T0JB 4ZDKA 3AUYA 3AH8A 1VTKA 5J5CA 2R65A 3I92A 3B9PA 1KO5A 1KK0A 1NMXA 2AHOA 4XIGS 4E09A 1MR3F 2ZEJA 5KSZA 1DAHA 5D3MB 1CJKC 1CR4A 3QKUA 1NJGA 3FE2A 1UDWA 1F2UA 2VA8A 2ZYWX 2WJGA 4KBGA 2CHQA 1WDTA 3FVQA 1Z63A 1EXMA 3X1WA 1X86B 1WA5A 4JBYA 1ZVQA 5JS7A 2ODNA 1JR3D 4IDQA 3EG5A 1UBFA 2R9VA 3L0IB 4D82A 3U3KA 3I3SR 3K70D 2C9OA 3WXMA 4US2R 521PA 1CP2A 4LV5B 4PC3A 3KQLA 3OFNA 4NU0A 1IJFA 1J90A 2ZVPX 4OI1A 2GDJA 3TQCA 1N5KA 2FEOA 4CEIB 1NVUQ 2O8DB 4LJ9A 3F3YA 4ZDIA 4GL2A 3QF7A 4JYBA 3THYA 3H0KA 4KFUA 1NLFA 4BZXA 1KAOA 3AGPA 3DM5A 3BFKA 2FU5C 2IYZA 4PC6A 1OW3B 2XB2A 3ICQB 1RJ9B 1TX4B 3C14C 2P2LA 1NKSA 3IIJA 5JMTA 1EK0A 3DMNA 2GJKA 1W46A 4DDTA 1J70A 4KAXA 2IYTA 4Z51A 4OQXA 4ESHA 1GP2A 2FSHA 3OEHA 1VG8A 3FGNA 2I4IA 1MH1A 4TMZA 1IONA 4B33A 5JI3E 4F4JA 3GLHB 3Q85A 2YWGA 4UXIA 4EAQA 2C95A 2ZVQX 1OXUA 1Z0JA 4URZR 1AM4D 2YKGA 3CRVA 3EAQA 5LD2C 5CDFA 2FN4A 1X1SA 2QORA 3V00A 5FBLB 4OHYA 1UJ2A 2NPIA 5E7IA 5JWOA 4B71A 3RNLA 2F9LA 3R9IA 3WMGA 2J0UB 2GZDA 4PZLA 3QF4B 3K70B 1KNQA 2HCBA 1U9IC 1VHLA 1D2EA 4PPQA 1XJ0A 1ZBDA 4O3MA 4Z8YA 1G16A 3GJ3A 4IFBA 1GKUB 2A5FA 1KO4A 3I1FA 1NMZA 5FBRB 3RANA 4LV8B 3TIFA 1L7VC 1RZ3A 4MKFA 1N5LA 2GHIA 1KO8A 4URYR 3GJXC 5J4LA 1YZTA 2EWVA 4BFTA 1KI7A 3DEFA 4HB4A 1YZUA 2GK6A 1G21E 1S9DA 2H57A 3NDBB 5F98A 1ZW6A 2VHQA 1W36D 1NVXQ 3IILA 5DNYB 3VTKA 2HLDD 4A0GA 4DJTA 1TMKA 2FSGA 2HYDA 1N3BA 4LUCA 4JLBA 3RS3A 3U4QB 1JXOA 3QF4A 5JLJA 4K46A 4QGAA 4HEJA 4ERNA 5J4HA 2KBEA 5C46F 3DDCA 2C9CA 2FF7A 3GQBA 2DY1A 2E9SA 3V9PA 1SVLA 2KJQA 1E2GA 4BFVA 1WXQA 1NMYA 4AG5A 4Q7MB 1ZIPA 2RGNA 4YDHB 3N5CA 3NBFA 3SR0A 2R6AA 2V8OA 2NIPA 2XJ9A 4U02A 1U81A 2ZRPA 1TF2A 1KGDA 1ZAKA 2GILA 4QG7A 3PENA 4URXR 5EXTA 1Z6AA 1S96A 5FOXA 1D5CA 1UKEA 3TBKA 3FYHA 4NYIR 2OCAA 1S4QA 1S9HA 1Z5ZA 2Q9AA 2WHXA 4RFSA 4II7A 5G3ZA 2VHJA 5BN5A 3TSZA 2ZR0A 3L82B 4D4MA 1HTWA 2NPFA 2O8EB 4CEHB 3CWZA 1YRBA 1VG1A 4DLRA 4ZIRA 4JL8A 2WIBA 3NG1A 4A36A 1N6OA 1NRJB 4FW9A 5HR5A 3I61A 5F3WB 2ZI3A 4QBHA 1BS1A 4PAOA 2BBSA 4AKIA 2HT6A 3ETLA 2CL0X 1W47A 1FNMA 4PFSA 4CZ2A 1PLJA 3EC2A 1AJEA 1Z29A 3ZVMA 3DPUA 1TL7C 4HLUC 2KI5A 2NMVA 1ZM3A 4OK6A 5EJEA 1E9RA 4B3BA 3B2EA 5FOWA 4AKGA 4JLVA 4G01B 2WSSD 3OIVA 4HAXA 4LHVA 5CLLA 2XB4A 1DAGA 3CX6A 2HYIC 2JIZA 1RPZA 2IYQA 4L8GA 3VR6A 221PA 4AG6A 1N6PA 3RRYA 3K9GA 3HYTA 4C0LA 1E79A 1N5JA 4N1AA 3GD7A 4PPFA 4TQAA 1OFIA 1QVRA 1XEXA 1XU4A 1LS1A 5EZ6B 5JBQA 5L3QA 4M0LA 1ZC3A 4NZYA 1XD2B 2HUPA 4GMDA 3KQHA 4LJ6A 5AK0A 4OBEA 5FR2A 4M9SA 2AFHE 2V55B 3QY0A 2WWWA 1UBGA 3BD9A 3DZ8A 2JLVA 1QHXA 1R8QA 1X8JA 2QI9C 3DKPA 3B8HA 3LRPA 2N46A 5EE5B 1XD2A 1J2JA 1KK2A 1NP6A 1ONBA 1P60A 1M7BA 2AK2A 3GMTA 4EPWA 3EIQA 4AKEA 3QBTA 1A5TA 1GIAA 5CK4A 4KSBA 4DEXA 4G5OA 2N42A 3G82C 2PMKA 2IHYA 2WZQA 1AIPA 2GCOB 2WWYA 2C77A 4GPTA 1E2HA 1F5NA 3LY5A 1JB1A 1KDPA 3AKYA 3Q7QA 4POAA 2AX4A 2JLRA 2ZE7A 3HU3A 2VSXA 1DO0A 4HAYA 3KJEA 2IYLD 2QNRA 3P32A 3ZDQA 5CB8A 1KDTA 3WYFA 1Q20A 4KFRA 2R2AA 1MKYA 4A0HA 2QU8A 2BJVA 5KSYA 1ODFA 1FQJA 3NBZC 4KLZA 2DWQA 2G6BA 3IO5A 3Q5DA 3GPLA 3R8FA 2G0TA 3R9XA 5SZJA 2EVWX 5BW8A 1OYYA 2DBYA 1OB2A 4DLWA 2YINC 1BMFD 1HE1C 2X77A 1G3MA 4IDNA 2YYZA 4F93B 1SVSA 2NO7A 5EP4A 1A82A 4Q19A 3ZH9B 3GJ5A 4LRWA 3UKDA 5C1BA 2FMXA 3QNUA 2ZSEA 4P4UA 3B6EA 2ODBA 3CRMA 2ANBA 5HCIA 3SI7A 1E9EA 2QL6A 3QEOA 2JJ1A 3DOFA 3C15C 4D80A 3EX7C 2IF2A 3UXMA 5EUMA 4NCHA 4JT4A 3U3OA 4PQYA 4ILEA 2RGEA 3EZ2A 1HQYE 1XTIA 3M6AA 2LKDA 1JBKA 4TT3A 3KJIA 3CX7A 3AP2A 1KK1A 4X8HA 2EW1A 1GTVA 3E2IA 1U0LA 3FTQA 2FWRA 2DPXA 2Q21A 3A1VA 3H1TA 4Q4HB 5HE9A 4XD7D 2QT1A 2GNOA 3U7GA 3CPHA 2BMEA 2BV3A 1ZUIA 1XCPA 2O8BB 2D62A 1G4UR 2GK7A 3FHTA 1XJCA 3CH5A 4RCYA 4TYWA 2QP4A 1U2RA 4M1YA 3Q72A 5CM9C 2WMOB 4RZXA 1G18A 1UDXA 4PQFA 2J87A 2B6HA 2W2TA 1UAAA 2VRWA 2F6RA 3AVXA 2YWEA 4ITRC 2V9PA 1XJQA 1VIYA 2F1IA 1KI9A 2ZSDA 2GJ9A 1XMVA 1OIVA 2C98A 3TUJC 2O8BA 3I32A 3X1DA 2GTPA 4DLXA 1DVRA 1XDBA 1DEKA 1DTSA 1KTVA 4XOIA 2XAUA 3K8YA 1BIFA 4HAUA 3B1XA 1K5DA 4AI6A 3OIUA 2LKCA 1KO7A 2FEMA 1HYQA 1CR1A 1YR7A 3U44B 2XTNA 2VP0A 2WKPA 3UMFA 2MMCA 3AVPA 1BH2A 2Z43A 4MYUA 2QT0A 4BFXA 4OHZA 2FPMA 3C8UA 3WBJA 1OSNA 1G1MA 1M74A 3H2YA 2REBA 3AF1A 1OV4A 3QBVA 4OI0A 1NLYA 1WP9A 4A92A 5JHHB 4XTRA 2PX3A 1H8ED 3MGCA 2WMNB 2O0JA 1GRQA 4MKHA 4JJZA 3KTAA 1OH8A 1D2NA 2W0MA 3ZVRA 4IOJA 1A7JA 3R20A 2RGDA 2ZRKA 4CVNA 1RJ9A 1N6KA 2JJ1D 2OFWA 2W0SA 3S1AB 2HJGA 4GI7A 1RIFA 1D9XA 2CL6X 3FMOB 4B43A 1ZNXA 5IK2A 3SE0A 2JAQA 3U3JA 5B57C 2GJSA 4CEIA 2VF8A 3EZFA 1KI6A 1SXJE 4M1MA 4TT3D 1KI1A 2VH5R 4B2LA 1W0JA 4NCJA 3BB3A 2ERYA 1M1YE 2WAXA 4B6EA 2BEJA 3NHAA 1E2JA 2R6CA 3ZIAA 4KU4A 3GLIB 1PV4A 5DGXA 1T5LA 4O2LA 4TL8A 3KTAB 5LBIA 1AQUA 1XCMA 4BEJA 2YJTD 3UWKA 4YXWD 2O8CA 3HJNA 1RRFA 2QZ4A 4TSFD 5CM8B 3SFVA 4G5SA 1GL6A 5DO9A 2FH5B 3RC3A 2ZM5A 4CEJA 1E2NA 3CWQA 2H17A 2IYUA 4BFZA 1C1YA 4I1OA 1FX0A 4QM6A 2QTHA 2QQ0A 6Q21A 3LVQE 4M22A 2ZRLA 1DE0A 4YMWA 2PMDA 1P62B 4O25A 4WBSA 3RS7A 2QP3A 4ZCMA 5TVKA 1W36B 3VR3A 1N0WA 4Q1FA 5KPJA 3GFOA 3SYKA 4CF7A 4N3NA 3M4YA 2YOHA 4Q02A 2XSZD 2FOLA 4US0R 1IXRC 4HAWA 2PCJA 3QVVA 4ACAA 5FR1A 3TVDA 4F92B 4MYTA 1SXJC 4ZPXA 4M1KA 3QXHA 2VHTA 2QSZA 3U2QA 1GFIA 3CNOA 2AN9A 4Q66C 1KSGA 2ATVA 4M4SA 2V7QD 3DVLA 1JJVA 3D3QA 4YQFA 1NNEA 4NE2A 3BERA 2AXNA 3ZGXA 4QBGB 3T34A 4EDHA 1MO5A 1PLLA 1VCOA 1P72A 5DN6D 4M9XA 2IHBA 2FV8A 4JLMA 3ZS8A 1Z0IA 2ORIA 4GNKA 2V1XA 4PR0A 1HH4A 1W2HA 4UKDA 2F3TA 5AUOB 5TDHA 3ZLJA 3HU2A 4KCGA 1U0JA 3GLFE 2WJVA 4ASUA 3U7FB 4QGFA 2YC4C 1ZM9A 2ZJ2A 3VHLB 5K8LA 3RRZA 4JLDA 2FPLA 4JSTA 3ZVLA 1UEIA 4MUAA 2WWIA 3W3ZB 3PUVA 3W90A 3O8CA 4PZYA 1R0WA 1XEWY 3SC3A 2FJUA 2HXSA 4OJQA 1U0HC 3RWMB 3RHFA 4C0AC 2FGJA 3Q8XB 1EFRA 4GRAA 3KXIA 3W9YA 5L3RA 8OHMA 4KI0A 4IOLA 2AKAB 2NGRA 2JDIA 3IHWA 4CDGA 3PXGA 2H16A 4PXAA 4A6XA 1I4TD 2YWFA 1P2UA 4N0EA 1Q57A 2ONKA 1E1RA 1E0JA 2JLYA 2O8CB 1I4LD 5FTJA 3NVAA 5TXGA 1E1RD 3D6TB 4A0FA 4N0DA 4W9MC 1X6VA 2C5LA 1ZUNB 5D3QA 1XD8A 2IUSA 5KTYA 4HDOB 2IS2A 2IXGA 5JCPA 1G8YA 1R10A 2DCUA 4B76A 5J4YA 2CNWD 1KI4A 4I1SA 1KI6B 1LF0A 3WMFA 5FPKA 3K0FA 1EFTA 3PUWA 1KI8A 4KVAA 1W5SA 4MRRA 5K8UA 3P4XA 1G3RA 3PUXA 621PA 2XZLA 1UPTA 4QHYA 4FI3C 2UZ3A 4B47A 2BM0A 2E1RA 4ZCIA 3O8RA 1EX6A 2W2VA 4YMSA 1E0SA 5FOSA 4A9AA 3I5YA 2RGXA 3U7EB 5JEDA 3QENA 3R7WA 3TSWA 5A5GA 1OB5A 3UG6A 4RCZA 4PO9A 3LA6A 2QBYA 3NH9A 2DHRA 3T1TA 1QHIA 1Z08A 2A5JA 3WP0A 1IBRA 3QXCA 4X8LA 3LH5A 2IWHA 5P21A 3EPHA 4B3CA 1T3SA 1ZRHA 1YZLA 4CRWB 4NHOA 4DEYA 2CVHA 1L8QA 1D6JA 3KL4A 4W5WA 3X1XA 2Q9BA 1K8RA 5GVRA 1XXHA 3EXAA 5FTLA 4TMXA 4D25A 4NYIQ 5HKKD 4L4UA 1D9ZA 4CGZA 1W1WA 1VG9B 2ZAMA 1XNJA 4GOJA 4UNSA 5FPTA 1Z6YA 5HZHA 2QBYB 3UG7A 1G7RA 2F43A 4QNRA 4PSVA 2VTKA 2P65A 1PUIA 4O0MA 2A7QA 1P7CA 4BQSA 4RSGA 3KKQA 3U6KA 1XEFA 2XEXA 3W8RA 3OEEA 5DI3A 2MSCB 3B1YA 3BWDD 3SJAA 1OFUX 4QGHA 3SJBA 1IN7A 1Q3TA 1YHNA 1B0UA 2O0HA 3JVVA 4YMUA 4Q7JB 3BIFA 4LBVA 1W4CA 4FWIB 2ZSAA 3A37A 1EESA 1RC8A 3ZD6A 1QF9A 3K0FB 4NYJQ 4FCTA 4Z8XA 1P3JA 1R0YA 2DFKB 3TE6A 1QG4A 3GLIA 1G7TA 4FMDF 2Z6VA 2D7DA 3Q3JB 1R2QA 1TPZA 4KBFA 4C0KA 2JJ2A 4QBFA 4ZKEA 5EP1A 2F9MA 4HDCA 3W6NA 1KJZA 4CIDA 2J0QA 4LI0A 1F6BA 2BJWA 3N2EA 4F7WA 1H8HA 1COWD 3SEAA 4JBXA 4A82A 3A1SA 3CB4A 2IX3A 3RLFA 4JIMA 4FCWA 3C5CA 1Y3AA 1YR9A 4IXNA 1NBMA 1W4RA 3AKDA 3VKGA 4GZMA 3LV8A 3I4LA 4TWZA 4B3FX 4DLVA 5JSZA 1KY2A 1RW4A 4HSEA 2Q3MA 1S8FA 1SVWA 3THXB 3MWKA 4TYPA 2EYUA 1T8TA 2CEAA 3SOPA 4XWKA 1TQDA 3KKOA 1YR8A 1E2MA 4DCNA 1LY1A 4TLAA 1MT0A 1Z83A 3MG9A 3HP1A 3LAWA 5AJVB 1F48A 2C99A 1JAHA 4ZI3A 3U5ZB 5CIQA 2PZFA 1ESNA 3QEJA 1T4GA 3KQNA 1GUAA 2OBMA 1T0HB 2I3BA 4QBIA 1E1QD 1OKKD 3R8CA 4FN5A 1E96A 5JJLA 2ZPTX 2G0NA 2HV8A 4JL6A 821PA 4HB0A 3A36A 1OIXA 4URUR 2FFBA 3AF0A 5GVSA 5LB2A 1KDOA 1EFCA 1U8YA 2C04A 2VP9A 3UPUA 4LV6A 2IS6A 2RHDA 5DISB 2J0UA 2V6JA 3IIKA 2G9NA 5J4VA 2JLUA 4MKGA 1NY5A 3NWJA 4DLUA 4G0NA 3LBHA 2NZJA 1P73A 1OIWA 1XEWX 4JVNA 4UXHA 2C9YA 1EWRA 4LHZA 1KJYA 1UM8A 3AP3A 2ZJZA 3IEUA 4TTPA 1GM5A 1VPLA 4WA7A 1ZYUA 2ZI9A 5SZIA 3CPEA 3CRQA 3LBNA 4M1TA 1KKLA 4LZZA 1N0VC 1HT1E 3GCGA 2GKSA 3PV0A 4TYNA 2CL7X 1TU4A 1GKYA 3BC1A 2BCJQ 3GJ8A 4JLJA 5KYKA 2NQ2C 2V3CC 1UKVY 2I1QA 3K0CC 4P32A 2GCNA 4JVLA 5AUQA 3J81k 1XXHB 2ZRCA 1CF4A 2VP2A 1F60A 1OFHA 2JEOA 3GLHA 3H86A 4F4CA 4CT4B 1ZP6A 1VMAA 5JECA 1FTSA 2QAGC 4KO8A 4MYHA 1VHTA 2BMFA 5C18A 1XPOA 4PSKA 3MWJA 2OBNA 3W34A 1R0XA 1CBUA 1Z0AA 4Q03A 4OQFA 3RS0A 1YU9A 2OV2A 4WZ6A 4HATA 3EPLA 3L43A 4A2WA 1GNRA 4IEEA 1B23P 4PHGA 4LK2A 4ASUD 4DSNA 5IT5A 2QN6A 2O8DA 4NL4H 1RRPA 1KKMA 1KSJA 3KDSE 2GXSA 2QQEA 1IY2A 1QZXA 4KITB 4LYAA 2B8TA 1VCMA 3HU1A 1VECA 4PX9A 3W3AA 1AQYA 1G7SA 3DHWC 5E4FA 4ZV4A 3AQ4A 1QG2A 2WOOA 4YMVA 1JPNA 3CONA 1DADA 2PEYA 4Q18A 4LBZA 1IAQA 3TRFA 2ZJOA 5HCNA 2G1JA 1AZTA 1PLKA 4PO8A 5KO2A 1OFTA 3AVOA 3WMEA 2GETA 5BYJA 4JLAA 3OHMA 3SQWA 3CZPA 1CS4C 2ZSBA 2CHVA 5AJZA 3THWB 2CHGA 1VKJA 4FMCB 1NI3A 4DIDA 3SBEA 2FE4A 1G8PA 3FB4A 5D3MA 1EWQA 1GVNB 3SHWA 5AWFC 3HWSA 1VYVA 2B92A 4P4SB 3TQFA 5TMPA 2PJRA 4DDUA 2PEZA 5FFMA 4BPBA 4M1WA 4MGIR 1CTQA 3EW9A 1W2GA 5FUXA 2BHRA 5DN6A 3KKMA 1ANKA 1X8KA 3SZRA 4C0HA 2ZYUX 4TTQA 1E2LA 3L8YA 4AK9A 4US1R 2W6IA 4DLZA 3B82A 4BFSA 4RVCA 4WOPA 1BYUA 4Q9JA 1G8GA 2VSFA 3W5JA 4PANA 2R44A 2ZE5A 4MITA 3OESA 4GOXA 2ORVA 4PHHA 4PAQA 3WY9A 4DBLC 5JEEA 2NOAA 2EU8A 4P0TA 3FKSA 1UKZA 4C0JA 2ZR7A 2GAOA 3REFA 4B44A 1E4VA 3BB4A 3D7MA 4GP6A 2J41A 4U5XA 1ZNWA 4IVPA 3QIAA 2ZITA 1LW7A 3U44A 2WV9A 4JKYA 5FBQB 2J0SA 4D4LA 2QE7A 1F2TB 3BS4A 1KMHA 2A9KA 2WIAA 4PO1A 1MV5A 2AFIE 2ZETA 2Z5FA 4B73A 1G5TA 3X1ZA 3B85A 2FSIA 4RKEA 4V0MA 1M6NA 1T3LA 4B2IA 1A2BA 2J45A 3PFIA 1G4AE 3P27A 3ZVNA 1GDDA 3LQQA 2FPKA 2QA5A 4A1FA 1G64A 1XZQA 4GSYA 1E9CA 4UJ5A 5E3HA 5J47A 4TZ0A 4Q4HA 3PEWA 4Q1BA 3NXSA 1E2FA 4D6PA 1HV8A 2GEVA 2GJAA 2XOKA 3UMRA 4KVGA 4LDJA 1ZCBA 2PJZA 3PITA 4PC1A 2BOVA 1G7CA 3M0EA 4Q1AA 2VP4A 4Q1CA 3AF4A 5KOYA 4IVQA 3IPXA 5GADl 2ZXUA 1JR6A 2GVDC 4Q7KA 5CJPA 2OILA 4BFUA 4QHTA 2FG5A 3QG5A 4HB2A 4E07A 3AV0B 5FL3A 2CLDX 2WKQA 2XX3A 1J7KA 2BEKA 3I5XA 3QOFA 1P75A 3C16C 2KB0A 1NLZA 4RFSB 2JASA 4MKIA 4V0OA 3C41J 1BYIA 5TARA 1XB2A 1CJTC 4K81B 2XGJA 2F1HA 2ZREA 2P0EA 1Z0DA 1XMSA 3IDQA 2RKOA 2ZE8A 4PC7A 1JEDA 1RVDA 1PVOA 1AGPA 4RD1A 3PUYA 4TTRA 2E87A 3GFTA 4DB2A 4GBMA 4L9SA 4MGYR 2C96A 4GP7A 4OK5A 4XH9B 2CMKA 3CKLA 2H1LA 3BFXA 1E94E 3VAAA 3CR8A 1I4DD 1G19A 2CNWA 5GJBA 3W8NA 3MUFA 5AUNB 4Q4AB 2CXXA 4IHQA 4ESVA 5SZKB 2VP5A 4JVMA 1T6NA 1GKIA 2Z4SA 1KMQA 3QSYA 3MLEA 2P6UA 3T1QA 3KX2A 4KYIB 2G83A 1MO6A 3LX5A 4QKQA 2QPOA 2RGBA 2QAGA 3RVBA 5IHPA 4RD6A 4NCIA 4D81A 2QSYA 2AL7A 3B1VA 2DWPA 4PPGA 2XXAB 2ZI5A 2GXUA 2XNDA 4Q4JB 5LB4A 5HKKA 4WXRA 1JEEA 1A1VA 4TMVA 2BMDA 4LWZA 3I8XA 2B8WA 4CW7A 1X8LA 4DUGD 3RS2A 3FPAA 1S3SA 1DG3A 3QXSA 1AKEA 4HZIA 5HTKA 3VKHA 5KUTA 3TAUA 1CKEA 1E32A 4LC1A 2WWFA 1WBDA 3VMFA 3E70C 4JLNA 3QKRB 3KQKA 1HE8B 3AB3A 5DYIA 1R0ZA 3KJHA 4HUQB 4A0RA 2J9RA 4MRNA 2J1LA 1E9AA 1LFDB 3H84A 3O47A 3ZZTA 3TR5A 4DUGA 3AVUA 2ZU6A 1AA9A 2J7PD 3AKEA 3A4LA 3EARA 4X8MA 4BLQA 4QNMA 2H92A 3G0HA 4MYCA 4NPHA 3CZQA 3UATA 3PUZA 1JQLB 1XWIA 4FD2A 1G5PA 2FZLA 1CU1A 1CJMA 4NTZA 5GJCA 2JDID 2VHUA 3CPJB 4G5QA 5L3QB 3O8DA 1Z2CA 2IEZA 3CF2A 2KWIA 4PAMA 1TNDA 3ZQ6A 4Q9IA 4AD8A 4DWJA 2JLSA 1Z0FA 3FFAA 1DAEA 121PA 4I4LA 3THWA 3OEHD 3B5JA 1C4OA 2GF0A 3LXRA 4KSCA 1NF3A 1RYHA 3VFDA 2UZIR 2PBRA 1KO1A 2RHMA 4NCNA 5DLQC 4OQLA 5FI0B 1RKBA 2O8FB 3B1ZA 1E2PA 4ZIRB 2HLDA 5DE3A 3UWOA 5SZHB 2FA9A 2YZ2A 4NP6A 3VX4A 4A8JB 2QRZA 2IYSA 1HY3A 3KXLA 2IL1A 1M7GA 1KZGB 1S1CA 2QG6A 1N5IA 1NVVQ 1SULA 1IOZA 3FMFA 4HLDA 3RSOA 4EKDA 1YE8A 3WHLA 2C78A 3VR1A 2NTYC 1KI3A 4C7OB 1P5ZB 2DYKA 3W6OA 2LWIA 4DDVA 3RAPR 1W4BA 2OZEA 4ACBA 4A6PA 5KDOA 3ADKA 1XXHE 3NC0C 4NDZA 5E95A 3EZ6A 1VYTA 1TQ4A 2X2EA 1UBEA 1G5RA 1UFQA 3RWOA 4B2PA 1LTQA 2PLFA 4BGDA 1KSHA 1TUEA 3WYAA 4QHSA 2VYFA 3LLUA 4D0LB 2NO1A 4OJKA 1WB9A 1PZNA 3VKWA 4AKHA 3K53A 4DLSA 3LFUA 5IF9A 5JZVA 3GEHA 3L0PA 4JYCA 5H70A 4A8JC 5DI9A 3MWLA 1ESMA 1SZPA 1ZNZA 2VF7A 3PR1A 4B3DA 1FL9A 3DM9B 1DPFA 4OHVA 2IYYA 4GDFA 3IBGA 4RD0A 1V43A 4WW0A 721PA 2IK8A 3GP8A 2JCSA 1XTRA 1E9SA 1E9FA 3B9QA 1YRAA 2QGNA 4BRUA 2K5UA 2Q3HA 3QKRA 5EUQB 3RRMA 2P3SA 3K9NA 1UBCA 4MQBA 4L15A 5EXSA 4M1OA 3GLIE 1OXVA 2IBMA 3K1JA 1AKYA 2J7PA 1EFUA 3MJHA 1MABB 3D8BA 4GZLA 4PTLA 2EQBA 4GT1A 2EFEB 2RAPA 1OYWA 1M8PA 3HR7A 3T12A 3N70A 2RB4A 3QQ5A 1QHNA 3T1OA 3EPKA 1TEXA 4JT2A 4OI2A 5AJWA 3RS4A 2P5TB 2YNMA 1EFHA 4TLCA 4R9UC 1T5IA 2F3RA 3L8ZA 3C4JA 4AYTA 2CE7A 1FZQA 4DLYA 3F5FA 2DFLA 2GCOA 4DLTA 5JWRA 4V03A 2IYWA 4BLPA 4V0KA 1WMSA 3HYRA 1SVMA 4QJ3A 4FINA 4HZUB 1YZGA 4DZZA 1CEEA 5DH9A 1XTKA 1MABA 4JZKA 1E0KA 1GITA 2YVUA 4QL3A 1S2MA 4BUJA 5C4GB 2ATXA 3CRRA 5KDLA 3QKTA 2PH1A 4U7DA 5FTKA 1E79D 3JZAA 3NEJA 2CLCX 4HDQB 5KNDA 1JI0A 5FOVA 5CITA 3I8SA 4LC0A 2GBLC 2JJ8A 1XTQA 4ARZB 2UVQA 4S35A 1M7HA 4DHEA 3OF5A 1AK2A 4S2EA 5E7MA 3ZIAD 1YKSA 3V4FA 3AVYA 3TUIC 1Z22A 1P61B 2MSDB 1R5OA 5CJ2A 1GRRA 3FHOA 5EE9A 3LW7A 5LD2B 3ZD7A 3TVTA 2YV5A 4ARZA 1JECA 3B78A 4E5UA 2RH5A 2BCGY 3SYLA 1MO3A 4OKSA 4L16A 1JQJC 4IOKA 1YZKA 2HJVA 2ZJ5A 3I72A 5BXQC 5JRZA 4JJKA 2DFTA 4KFTA 4OI4A 2WICA 4TN1A 3REGA 4P31A 4AY2A 1NKTA 1Q3HA 3CRW1 4XVRA 1VYUA 1VCNA 1R6BX 2J3EA 2QAJA 3GLFB 4WAUA 3TK1A 1ZIOA 2EFHB 2VEDA 3GJ6A 1OF1A 4M9QA 3TR0A 3PVSA 4H1VA 3AGQA 1XPRA 1I2MA 2HEIA 2OCYC 4XWAA 4D2IA 1DAFA 1P2TA 2O52A 3K9LA 3ZJYA 1F2UB 4QGGA 3A4MA 3P4YA 3SJCA 2FFQA 1YZNA 3TNFA 4A8JA 4K8OA 1Y63A 5DI3B 1U98A 2PZEA 4Y0VA 1Q1BA 5M04A 2Q6TA 1Z6TA 2XJ4A 3K09C 4XJXA 5DSZA 4C3ZA 1XZPA 3W5IA 2BBTA 3LVRE 4M2LA 1E2DA 4DVGA 4D26A 3O8BA 2PZGA 2FZ4A 2ZJBA 2IS1A 3L2OB 4UNNA 1CLUA 1T3HA 3Q9LA 1MRSA 1XFAA 2D7CA 1W48A 4GMXA 4ABYA 4P33A 2H5EA 1YJ5A 5ANRB 5EZ5A 5EE0A 4QJ5A 4BFWA 5K8TA 3UK6A 2CCKA 4I99A 4KV9A 1Q0UA 3GLHE 4MDEA 1S3GA 3LX8A 3U60B 3DO6A 1BMFA 3AEZA 2WAYA 5FUVA 2ZS8A 4KFSA 1XRJA 2WM9B 1NIJA 3ZS9A 1G17A 2XOKD 2BIFA 2CK3A 4TMKA 4HLQB 5FPSA 2OCBA 4LHXA 3U6BA 2D3WA 3EZ7A 2FX3A 4I1UA 1YR6A 2VO1A 3KB1A 2XSZA 3KJGA 1FX0B 4BECA 2QGZA 1OHHA 4B75A 1KI2A 4BASA 2OT3B 3WRYC 1R5NA 4AYWA 5BN4A 4XVQA 4R2HA 5HPYB 5KNCA 1G8HA 3THYB 3W6PA 4NCKA 2B7CA 2QAGB 4KXFB 2GEDA 5KSPA 4EPRA 2V6IA 3ND8A 2ODEA 2DR3A 4I81A 3R7WB 4YC7A 2KBFA 2ZRAA 2JA1A 4UXJA 2FGKA 4R2IA 3LLMA 2A2ZA 4IFEA 3FWYA 4OHWA 5FBVB 3BRWD 3FDIA 4B48A 2BVNA 4P3YA 3ASYA 4BLRA 4G3XA 4Y0AA 4XSHA 3F8TA 3EASA 3NIBA 1XTJA 5TB5A 4WZAE 3GLFA 4F91B 5HE8A 4IDPA 4PSAA 4V0LA 4CEHA 3AVWA 5C4MA 4MGZR 4JKIA 3SDZA 2PT5A 1CR0A 3THXA 2A30A 3DZDA 5FPHA 1U9IA 1HEIA 4WVFA 1Q1ZA 4D0GA 4L9WA 4DB4A 3OIYA 1IJEA 3A6PC 5CDFE 3BBPA 3BH7A 4C0BA 1J99A 5TV2A 1JJ7A 1JR3E 1DELA 3H4MA 2AKYA 4W7SA 1JNYA 1GOTA 1RYFA 5HZKA 3FOZA 1R7RA 1BOFA 1OLOA 1R4AA 2WJYA 3RS5A 3IHLA 1JR3A 2VLIA 1TU3A 2TMKA 1HT2E 4A4DA 2FFHA 2LCFA 3KUCA 1HUQA 1EGAA 3SQXA 1E0AA 3MD0A 2XXAA 2IYXA 1E2KA 4U00A 5AR1A 1XF9A 2ZRHA 2ZU0C 3TW8B 3LNCA 5AJYA 4CT5A 1GZSA 3B60A 4FMBB 2F1JA 2PX0A 4C2UA 4HYYA 3T06B 4BFYA 2R62A 4I1VA 1AS0A 3GJ0A 3NHBA 4MUBA 4Q01A 2HT1A 5JJKA 5FL7A 1Q1QA 2P6NA 4B74A 3PQCA 4D4JA 3A58B 2NG1A 3TSOA 5FI1B 1E9BA 2R6FA 2ERXA 4Q1EA 1TEVA 4X8OA 2J46A 4TL9A 2A5DA 3MWYW 4Q4AA 4E22A 1BO6A 3KB2A 3QI2A 2WWGA 1IQPA 5B30A 3R9WA 4C4PA 1AS2A 4IDHA 3NDPA 2Q0HA 3WYGA 1NVVR 3DOEA 3K9HA 2OCPA 3CNNA 5BWMA 3IPYA 3CR7A 4ZDWA 3QKSB 2CJWB 4EQ6B 4EPTA 1DBSA 4M21A 5JS8A 5H8WA 3RRNA 3LBIA 1QBKC 1Q22A 3LQRA 4Q00A 3OIWA 1E98A 1Q12A 2D06A 1ZM7A 1Z2AA 1ZD8A 2IA5A 3CH4B 5F9HA 2W2XA 1E2EA 4CEJB 1E2IA 3CX8A 4IRUB 2B7BA 3C7KA 3P26A 5L3SA 2X2FA 1W0KD 2RGGA 2ZTSA 4URWR 5C2JB 3TMKA 1X3SA 2BWJA 3K0AA 2F55A 1W5TA 1QHYA 2ZR9A 4LJ4A 2IYVA 4KJZA 4LBYA 4M53A 2R6DA 4DT1A 2W00A 4DCTA 2GESA 1E6CA 1WF3A 1SVKA 4Q4LA 3A1UA 2ZIAA 1EFRD 4Q4JA 5CYOA 5FUYA 2ANCA 2EFDB 1L4UA 2J59A 5DIFA 4LY6A 4D4KA 2O8FA 4C7OA 2QTVB 2G1KA 5KSOA 2OXCA 4Q5IA 3WNDA 1W44A 4UNRA 2QY9A 4NBSA 5GJVC 3RSLA 4FWTA 3E5HA 2ZRGA 1Z06A 2ZI6A 1Z8FA 3ASZA 5H68A 1FP7A 1QDEA 4MGKR 4F38A 3S1AA 4XWOA 2ZJAA 1PJRA 5EP2A 2BC9A 2VL7A 1JAIA 3K0EA 2GXQA 4AWXA 1DG1G 5IRCD 1N6IA 5B58C 1T9HA 3LD9A 3WBKA 5JJIA 1XD9A 4IJMA 5E7JA 3EA5A 5KU1A 3IUYA 2BM1A 3P1JA 1KJWA 2RCNA 1YVDA 2O8EA 3KFVA 2ZRNA 1MOZA 1IN4A 2F43B 2RGCA 2QP9X 1OJLA 3IBYA 4KLNA 1XP8A 4R7ZA 4ZKDA 4RFVA 1NBME 2CCGA 2JLWA 1N25A 4EUNA 2GZAA 4B35A 1XPUA 3AF3A 1TADA 1NY6A 1Z6GA 3IO3A 4LYJA 4MDFA 3I62A 2WVJA 3I73A 2AD5A 4JS0A 1MRNA 1H65A 3SNHA 4LPKA 1E2QA 1J8MF 2I1VB 1U90A 1FQKA 5EE3A 1DARA 2GZHA 3MAAC 4RZ2A 3LWNA 3T15A 4C2TA 1ZJ6A 3PEUA 2GEUA 1VIAA 2CK3D 4HUQA 5AUPB 3TGPA 1OH5A 1S0UA 3VHXA 2AWNA 5J4KA 3WRXC 4BEBA 2IUTA 1ZCAA 2VQSA 1FUUA 3FMIA 3A8TA 4Q9LA 5BQ5A 2DFNA 5DYGA 2W6JD 3EA0A 4OQNA 3VX3A 4YONB 1NN0A 2HF8A 5FPYA 4EPXA 2CCJA 2IW3A 5A4JA 4EFMA 4LYFA 2VIIA 4PZZA 3BH6A 2D2FA 4NYJR 4HLUA 2W58A 2ZUBA 4BWYA 1UKYA 1ZM2A 2QUZA 3ECCA 2ZSFA 1DAMA 3B13B 4TLBA 3B1WA 4WXPA 4NKRA 1LNZA 3LXXA 4DCSA 2W6ID 2EFGA 4EIWA 2GVZC 4JLKA 1Z28A 2ZI4A 2IS4A 2P67A 3MFYA 4LOAA 1W49A 2FSFA 3KUDA 5B2ZA 2L0XA 2ASEA 1Z6XA 2QRNA 2R8RA 3CW2A 2ZJYA 1DAKA 2CBZA 2QTFA 4HAZA 1ZU5A 4Q7LA 3VNUA 4W5JA 1G291 4TSFA 3U7HB 2QMHA 1RRGA 3QPWA 1KSFX 2J0VA 3F0TA 5G3YA 3TLXA 2QEQA 1RE0A 1LF5A 1KZ7B 2GA8A 2Y8EA 1F3OA 3ZZUA 4CYMA 3GJ4A 4JMPA 3UANA 3FKSD 3K70C 2X19A 5H1YA 3SS8A 1W0KA 4LHYA 1US8B 3KKPA 1JPJA 4RZ3A 1L4YA 3N2IA 5JSZB 1S1MA 1Z07A 2ECKA 5FL7D 3NH6A 1FFHA 2AWOA 1ZMXA 4H1UA 5JHGB 3QG1A 1I2DA 2FNAA 2OE2A 3VU9A 4UNPA 2P6RA 4HAVA 4ZCLA 4BLSA 5L8VA 2Z83A 2ZRMA 1X1RA 5AJXA 4FIDA 4A15A 2OSBA 3A4NA 2IEYA 1W7AA 1G3UA 2WPDD 2YOGA 2QM7A 2PT7A 4JL5A 4FCVA 3SYNA 3GLGE 1SHZA 3AVQA 1P4SA 1IY0A 3WNBA 5BN3A 2BKUA 4MRPA 4YMTA 1P2SA 1VG0B 3GLGA 1G3QA 2XTMA 2XZPA 2JLZA 2CDNA 5FTMA 4EFNA 1ETUA 3CNLA 3BXZA 3K0AB 3IEVA 2HXYA 3Q5EA 1QRAA 4OQMA 1SKQA 2OEPA 4QRHA 4BLTA 3UIEA 1OE0A 2GF9A 3EC1A 1CXZA 2REXB 4LPSA 1LB1B 3VR4A 3A1TA 4NMMA 3T61A 4GOKA 4TYYA 2WJJA 3ZQJA 1CRQA 1P2VA 3CF0A 3FMPB 2OHFA 4B3GA 4L5BA 3GFPA 3THOA 1U8ZA 2IT1A 3VR2A 2F7SA 4ZDJA 4A2QA 1LV7A 2UKDA 4NYMR 1H8HD 2OG2A 2ZI7A 1CULC 3T35A 3LW8A 3TJZA 4DSUA 3NTUA 1FNNA 2QPTA 3X2SA 4PHTA 1NN5A 1HURA 5EE1A 1P6XA 1Q1EA 1N2CE 3BOSA 4Q9HA 5FBWB 4B6FA 5JI2E 4RJLA 1GG2A 4LSGA 5DHAA 1QHHA 1YQTA 3SFZA 3ONWA 5KPDA 1NSTA 1KIMA 5FOTA 5FH9A 1U99A 2WWXA 3HPQA 2VHCA 3X1YA 4PHFA 1IHUA 5G53C 1U8AA 1Z3IX 3UMSA 3PG5A 3CM0A 4LX0A 1V5WA 1OXSC 1XMIA 3GJ7A 1ZD9A 4P4SA 3RABA 3LDAA 1SVOA 3U3RA 2PCLA 3JZMA 1WRBA 1ZD1A 2O0KA 4JLPA 1MO4A 4JBWA 1ZU4A 2MMGA 4LGMA 4V0ME 4DSOA 2XZOA 1OHHD 1IN6A 2VPPA 4ON9A 4UQOA 3SJZA 3ICEA 4MRVA 1NJFA 1US8A 2VP6A 2YWHA 1L2TA 2ZYTX 1GILA 4GFDA 4IVRA 4Q1DA 3PEYA 4G5GA 4XTCS 1NN1A 2X8AA 3BGWA 2C03A 4OK3A 3U3MA 1A4RA 2IXFA 4FMDB 3AVTA 4C30A 4QC2A 2GJ8A 3VU9B 1GNPA 3WP1B 4LJ7A 2D4HA 3PIRA 2HF9A 5J40A 2JLQA 2YHSA 4RD3A 1AN0A 2H7VA 2REOA 1SKYB 1HA3A 1G8FA 1G6OA 5LPNA 3AVVA 4LHWA 2J5XA 3ND9A 2WJHA 1CJUC 4MRSA 1KY3A 1FMLA 3L0OA 1SQ5A 1WE2A 3BB1A 4F4IA 4YXWA 4IEIA 4TLDA 2CVFA 2NO0A 4KHZA 4RD4A 4DKXA 1RRCA 1K6MA 2CE2X 1GL7A 3IGFA 2OM2A 2GXAA 3B7GA 1CJVC 2OAP1 3IQXA 3JVUA 4EPVA 3BJIC 4V02A 3FFBA 5JWHA 2QMEA 3C5HA 1PUJA 3VR5A 1FUKA 1O3YA 3SU8A 5EQTA 4G5RA 1UF9A 5A0FA 1CIPA 3CIOA 2BKEA 1ZM4A 4AYXA 4EJSA 1KHTA 1D2MA 4TLEA 4EPYA 1G6HA 3OEED 5JRJA 2C8VA 4EJSC 4PPNA 2Q3FA 4Z54A 3VQTA 1E3MA 1COWA 3AF2A 3P20A 1AS3A 1OXXK 2R6GA 3NC1C 4NH0A 1DS6A 4AIIA 5EP3A 4DDWA 1ZUHA 3K0SA 1T91A 2Z4RA 3QE0A 4TYQA 4BE7B 5JCZA 4LCBA 3TUZC 1YZQA 4ZO4A 5K8IA 3RC8A 2ZQ5A 4FXPA 2JJ2D 1II8B 3KQUA 5F9FA 4TZ6A 3OFND 2B21A 1N0UA 5ELXA 4AURA 3BK7A 4JSYA 3LO5A 3OE7D 4HUTA 2ZUCA 1NG9A 5DHFA 5EXXA 1N6NA 4LJYA 4Z1MA 4OYHA 1TQ2A 1W0JD 2EFCB 3GEIA 4EJSB 1LVGA 4OL0A 2IUUA 2A5GA 4DCVA 2F1RA 2QMUA 3AP1A 2AK3A
chains in the Genus database with same CATH superfamily
1GA4A 1CNEA 2QM8A 3AEKB 5ES3A 4IKEA 1TYBE 4WJKB 1EB8A 3S8MA 3LHKA 4F3KA 4MW5A 4X54A 3X1KA 3D4IA 3UAVA 4BLOA 1E1NA 4LJ8A 4WLOA 5H0IA 1OI3A 3LCCA 4QA9A 2HQ1A 1VFPA 3GV0A 5DCUA 4C20A 3NLLA 4DM7A 5J9FA 1BE0A 5JNVA 1MX5A 1QRRA 3AM1A 4Z5XA 1FDUA 3F98A 5CYPA 2G25A 2V0NA 4MQ5A 2XCQA 1D3AA 2YHBA 2ZUDA 4KE6A 5CMLA 2WJWA 2VDWA 3KKNA 3GIDA 1ELOA 2A1UB 2SHKA 4I6EA 3UXYA 5EZQA 1FXUA 5JDCC 1IMJA 1NG1A 5I3ZA 1VLHA 2H4FA 4IDOA 1B42A 1ZOOA 2QLMA 5JJ5A 3GNLA 2D0IA 4K6OA 2D74A 2XVXA 3SHFA 5JAZA 3ADDA 4PGAA 4O1IA 1O87A 2OVFA 3OCXA 421PA 4F3RA 1GUZA 3RV3A 2R8YA 3W6UA 3ZJ5A 5LYJF 3JQ7A 3WYNA 4U8HA 1ULSA 4DHWA 1UBNA 1SBTA 1JHRA 1SVUA 1FMCA 3TFWA 3WRXA 1N6HA 2XBUA 4BKRA 4TROA 1IRIA 1I7QB 3FMGA 3X0DA 2BI7A 4LQLA 5EKXA 3UMYA 3EFBA 3FCUB 3CUSA 3MCAA 1IXSB 2QYOA 5G41A 3QU9A 3TOVA 4OB6A 2XMZA 3H13A 4M76B 1NHWA 4I4CA 2O5VA 3VTAA 5LIRA 4YLGA 2YNMC 5KJEA 1TUIA 1WZEA 1C1DB 5LDHA 4QELA 1GEGA 3OPYI 4BEWA 4RTOA 2RGWA 4Y2VA 2FDCA 3IIMA 1CDZA 1G59A 5CUQA 2HZBA 1FP6A 1JPVA 5DFAA 4XCQA 2OBFA 1DKPA 2VSOA 3P9PA 2ZANA 5AFSA 1J24A 1BVYF 4NZ9A 5KTKA 4B6OA 4FSXA 1NIPA 1C8VB 2KSQA 4G0OA 5K0GA 1VPTA 4GLFA 1NMSA 4IIVA 1HF3A 1TQ6A 1YUMA 4IILA 4X6LA 2PR2A 3EFOB 1QMPA 1G8KA 1HT3A 3KC2A 4CODB 4DE5A 2Z30A 2D1RA 1PSWA 1D8TA 1DKOA 1Q21A 2ZYVX 3COSA 1KYVA 1UOEA 1VDZA 1ML3A 2H18A 3ULKA 4FFRA 4BRWA 1YIDA 1I4EB 4H6PA 1J8YF 4PQGA 5EY5B 1UK9A 2BBOA 3TW6A 1SQGA 4HJRA 4WZBE 3X3HA 2QRLA 4U7JA 3GLRA 3GNQA 3NNSA 1U7OA 4AMZA 4DTCA 2PZBA 5AQ1A 4ZJZA 2ZBFA 3HZHA 4R1QA 5DYNA 1XMOB 1DXQA 2IZ0A 5B3JC 5CB6A 2PS9A 3N8GA 1QQBA 1TZMA 4D8VA 2J8ZA 1NMEA 3KDAA 3KLPX 4HMOA 1SUWA 4H3HB 5JATA 3ZV7A 2VDLB 3H9QA 2YZGA 2OUKA 1UPAA 2CY0A 2A94A 2ZIWB 5JG7A 1SXJB 4I36A 4LHEA 3SOZA 4Q9AA 4KFCA 1OUMA 2AW3A 1Q92A 3EIEA 3HU5A 3I53A 3A3NA 1GO2A 1U94A 1IULA 4LDRA 2XNSA 4O02B 4EB6B 1BG6A 4UHKA 1DLJA 3GGPA 4NX2A 1KZ4A 2ZB3A 5KQMA 3R24A 1UMDB 4OV6B 4D92A 1NBMD 3RHZA 1Y98A 4YH1A 1S01A 3HYCA 3NEAA 4PNHA 1TW2A 4L78A 3QXXA 1LS6A 2IOFA 4ZC1A 2TS1A 1TZJA 1K75A 2XECA 1GV1A 2D3TA 2VJKA 3PE4A 3R09A 4DCOA 2XMPA 3F2VA 1JDTA 1RU3A 2VNHA 1A9YA 2GAAA 1II8A 2QENA 3PDHA 1YWGO 1J1ZA 1N3LA 1CZLA 1U2GC 4X7PA 4KRFA 2VPTA 3RYIB 4ITUA 2ZRJA 2EW8A 2CMGA 1DGQA 2B37A 3UJ7A 3WLJA 4EG3A 4TL7A 3PJDA 3Q3IA 1AB5A 1UWKA 4M1SA 1BJRE 4DYDA 1H4SA 1KYIA 4JR2A 4JODA 3C70A 5JCOA 4BV8A 1NYLA 3C5EA 2DF8A 1NQ5A 1RAHA 3AIIA 1AZSC 1PJAA 4QJ4A 2PAFA 4ALKA 3WKAA 2WWHA 3F1KA 1GQRA 3OFKA 2G88A 2V4ZA 2FUNB 4EX7A 3DKVA 4IICA 1OH7A 2OD2A 2VBCA 3P0IA 3BE4A 1IEVA 1FPMA 3GEPA 3ESBA 4PG8A 5IK2D 4QXAA 4F71A 2GD6A 2CFSA 3MJRA 1Z3CA 2WJIA 1ZINA 1ZNYA 4TL6A 5L3SB 2XR1A 1SGWA 2OESA 5FXMA 3SN6A 3D1VA 2IV7A 2VR1A 2X4DA 5ILQA 4DIUA 5AKGA 2GI4A 4FGKA 1EX9A 3ED1A 3FXAA 2E1PA 4HZUA 1SXJD 1R12A 1X39A 3EZ9A 4JP5A 2PYDA 1GZHB 1PL7A 4TMWA 3KSDO 4P93A 2G5GX 5I51A 3WHKA 3VNVA 2JGNA 3BAFA 1O5IA 4LTDA 2GN0A 2X8JB 5K0FA 2CF6A 4HGPA 3TLZA 4G0YA 1O96A 4ENSA 3FFTA 3PI7A 4CM4B 4JYAB 1WUTA 2ZXFA 1MHPA 3CZRA 3LUBA 5E1MA 3WNCA 4ZEMA 3PDIB 3AT1A 3N74A 4MH0R 3WK8A 4GVPA 1MB4A 2IF0A 3C4QA 2C2ZA 2BMJA 3GT0A 4L9AA 4BNUA 3V2GA 2P6OA 1IB0A 1ZK1A 3I4FA 4P7KA 1BGVA 2HIAA 4MUFA 1WCYA 2HRRA 1AQNA 4E15A 3IVGA 4XVUA 4HS4A 3E0XA 2V58A 3IJPA 5JSFA 1U0TA 4PQRA 4DIEA 3SLRA 2XUHA 3I4CA 4AL4A 3U1BA 3NAZA 3OAAD 3PHIA 2H51A 5DBIA 1DC3A 1SNYA 3N6XA 3MOSA 5EHIA 1N6LA 4GXTA 1AUVA 2MHCA 3FNBA 4YAEA 4Z0HO 1KDZA 4TKVA 5PNTA 2I4RA 3AONB 3WYBA 5IDVA 1YK0A 2D13A 2QPAA 4YQEA 3V7UA 3A1WA 5JFGA 3KFXA 3PUHA 2WPDA 1DKRA 3KZ1E 3QM1A 1QG6A 1SIUA 3NKFA 1T9ZA 2YRWA 1JMYA 1THMA 3OKAA 3QPUA 4CF6A 1NW4A 3P0FA 3ZW8A 2PJDA 1CRWG 1G9XA 1G21A 1NN3A 3WDMA 1TTTA 2EKQA 3G7SA 3BE5A 5HFAA 3E9MA 4UVGA 3MCWA 3CO5A 1BKSB 1CC1S 1U3CA 1TMOA 2MINA 2O2YA 4HWPA 3FGPA 4IZ6A 1JDJA 2NZYA 3OZRA 2W2LD 4R2KA 5BSFA 4DMFA 2EWWA 3NBMA 1BKDR 4UQLA 4GWKA 4MTLA 4Q48A 2FP4B 1XTTA 3GPLA 2HEGA 4P22A 1QOQB 2ZRDA 3C98A 3OAAA 1AHIA 1LNSA 4NY1A 5I9NA 1ZC4A 4F4DA 1RWWA 3DL0A 4Z53A 1M2OB 1Q14A 3KHKA 4JBHA 3H4TA 2D0DA 3JQAB 1DL5A 1JH8A 1ZN9A 4YAGA 4WZZA 1RVV1 1GN8A 2QD2A 4MINA 5JYBA 1G3IA 4ZDKA 1N8NA 1O1YA 1WSBA 5C34B 2P7IA 1M75A 1V11A 1VTKA 1XHEA 1Z4IA 2BTQA 2MSLA 3PBKA 1ZL0A 1IFXA 4OQDA 5KSZA 3FWKA 3UT0A 4Z9FA 3OLQA 1DAHA 2FE1A 3AESA 4URFA 2PUBA 2HNAA 1NJGA 4ZAYA 4PQEA 2H2HA 2ZYWX 4EELA 4GR4A 1WLYA 2OCDA 1NF8A 1RQXA 1WDTA 3ELYA 3FVQA 2A86A 1EXMA 2NWQA 3TM5A 1RRVA 1X86B 2YJGA 4AJ4A 3WAGA 3GFGA 3R7NA 4IDQA 3R5SA 4C88A 4YMIA 2V9CA 1WPXA 4NEQA 5JXHA 3GH1A 2R9VA 4KMRA 3GWZA 1B6GA 4OGFA 4HVCA 4F2PA 4D82A 1DEOA 3I3SR 5D5QA 2E4XA 2C9OA 2X9GA 5U9CA 3UFXB 4NRDA 1E3IA 3W77A 2O57A 4LV5B 1GV0A 5JDIC 1A8QA 4M0PA 4OQQA 3KQLA 1ZA1A 4TRJA 3ZWKA 4KX5A 1Z8HA 4EDFA 2C2XA 4EHJA 1IJFA 4W1QA 2FW9A 1J90A 2DQKA 2QRVB 3OA0A 4E31A 4YT4A 2H1CA 5H4GA 5KVQA 2GDJA 4OI1A 3TQCA 4ZHQF 2FEOA 1PJBA 3Q1LA 4QT4A 5J2UF 4IIGA 4LJ9A 3F3YA 4ZDIA 3TLGB 4WNAB 3H0KA 2G6TA 4K40A 1RTKA 1K0FA 4KFUA 1YS2X 1JTFA 1KAOA 3MRXA 3VA7A 5KTSA 1OW3B 4MVJD 4MXDA 3BX1A 1TX4B 4DWOA 1NKSA 1P2DA 3IUJA 4WZAA 3C43A 2JAXA 3I2GA 3OWOA 3MFQA 1W46A 3GLTA 1QIFA 5P8WA 1SQ6A 2IYTA 2Q6OA 3KU4A 4NZZA 4Z51A 2QTCA 1YJCA 2B2NA 2FSHA 3FPSA 3FGNA 1WKCA 4JT8A 5CA1B 3Q8LA 3D7RA 3W06A 1WKVA 4CTNA 3LT4A 3DYIA 2BEUB 3ABQB 3Q85A 1Z16A 2YWGA 1G9SA 1Y1TA 3U48A 2HTEA 3WYEA 4ZI7B 2ZVQX 2AC2A 4G1CA 1Z0JA 1QH1A 4ZVQA 4KXQA 2YKGA 5DM4A 1SB9A 3GRZA 2XAAA 3EAQA 5CDFA 2FN4A 2OZVA 3W2HA 3ZQUA 1X7YA 5FBLB 4QULA 5FNVF 1T6ZA 4RENA 1X7XB 2O3TA 5TQVA 1Z15A 1MXFA 2OFPA 3D4PA 4MVJM 3F6BX 3RNLA 1E8MA 1GY8A 2XMSA 3IE2A 5FADA 2Q2QA 4MMXB 5A6SA 1N92A 4MVJA 3K70B 1KNQA 4K86A 1VHLA 2BGUA 2IHJA 3EY4A 2OV8A 4QDJA 1G16A 2XUZA 4IFBA 4EY6A 2V0CA 4LDNA 3C7TA 1YJ8A 4WNCA 3FFXA 5JARA 1KEZA 1UL1X 3TLMA 1L7VC 5LYJA 1RZ3A 3RGWS 5FEUA 4URYR 4E3ZA 1GZVA 1JV2B 1U2DA 1U1IA 1X13A 1QYVA 1YZTA 2F17A 1O95C 2EWVA 3E7WA 3FSGD 4JBLA 4M54A 4R1PA 5DNDA 2ZCVA 5BN4B 4ZT7A 2BH2A 3FH0A 4QPZA 3BDVA 2J9ZB 3GUYA 5F98A 1E64A 1W36D 1XDGA 5DNYB 1P5HA 1TMKA 2FSGA 1GAQA 4JLBA 3RS3A 3DB2A 3QF4A 5KX5F 1E3TA 4K46A 2FUG1 3LG2A 3TW0A 2C9CA 1VI6A 4D0RA 1E2GA 4MS3B 3PNVA 4KDRA 2XDYA 4MYSA 3TQIA 1ORIA 4BFVA 1NMYA 5LJLA 2F00A 4FXOA 1GPNA 4LDPA 4BNFA 3BWVA 4MK4A 1K7SN 4HDNB 4K03A 2L42A 4U02A 4YGYA 4E7OA 1KGDA 5KJFA 2MIIA 3OC0A 3LRXA 4QG7A 1RQRA 3QOXA 4RTJA 1JA0A 4BNMA 2PT9A 3TB4A 1SURA 1THGA 4HQ6A 5HF6A 3P19A 1S4QA 3A70A 3F9IA 5LLSA 3QIVA 3TLAA 4EF4A 2WHXA 2D6FA 2UUOA 1GGFA 1S6YA 1LX7A 3O2NA 4RA9B 4CCSA 1V1MB 2UXBB 1DC6A 2I22A 3ZGLA 4OREX 2CFIA 4FHCA 3ND7A 2C9ZA 1A9ZA 3CUWA 4KQJA 2DSTA 1CUUA 1BAPA 2CHFA 3IT2A 1ZLYA 3D3EA 1XF1A 1N6OA 4X97A 3I61A 4BC0A 1V95A 1Z9BA 3OFJA 4JJ8A 2AEFA 4QBHA 4UM5A 5AXAA 3RTEA 4RJIA 2BBSA 3GP3A 4AKIA 2VNJA 3ETLA 2C7QA 3ZDZB 5K0CA 5JPDA 4K05A 4MUNA 2A0XA 4FFNA 4CZ2A 4J0GA 1E5TA 1Z29A 4GWGA 5DBOA 3RVQA 4DYVA 2DU8A 1SU4A 4WH0A 3ZC3A 2NMVA 4OK6A 1P4AA 1OROA 3L1KA 3IR5A 3QFTA 3TI9A 1A72A 4BO4A 1YDWA 4KL8S 3JYQA 3N2ZB 4ND6A 1FFAA 3AC0A 4OD0A 5CLLA 1MJGA 3LYLA 3TIIA 2XB4A 3CX6A 3BZBA 4EHLA 4ZCPA 3UTDA 1VSTA 3GT3A 5F7OA 3OWHA 2I2WA 2Q5EA 2QTVA 3NX4A 221PA 8AT1A 4U7WA 3HYTA 1PFWA 4C0LA 4XWWA 1CETA 3ZKWA 3GD7A 4UU8A 1IEQA 1KU6A 3WKBA 4C07A 4OSOA 2VHXA 1LS1A 3MMNA 1OYOA 5EZ6B 2H00A 5L3QA 4HNUA 4FYPA 1ZC3A 1SUFA 4EY4A 4LJ6A 5AK0A 1ZGJA 2VXBA 4OBEA 2IFTA 4F4HA 4M1EA 3D6HA 4M9SA 2AFHE 1UBKS 2J4CA 2V55B 1Z56C 3QY0A 2WWWA 1WCWA 3DZ8A 4H6XA 2OZLA 5CA1A 1AT1A 1JT2A 2B1GA 2QI9C 3L8MA 3HEBA 3PE3A 6REQB 5EJ8A 4ZARA 3C4VA 1AF7A 1VL6A 5IBPA 4ZYYA 1WZUA 1KR5A 1BRTA 4PHCA 4A2CA 1NP6A 2BFCB 1JIXA 2G9QA 2AK2A 1P8AA 2IITA 4IHJF 3MW8A 3EIQA 3N2GA 1R3DA 1G63A 3OA2A 5E4YA 5CK4A 4OH1A 4DEXA 3AYZB 4DAOA 5A03A 4E21A 4RY8A 1MUUA 5KWEA 2WWYA 3MRTA 3VMMA 1GPKA 2YZNA 1CUFA 1E2HA 4GPTA 5L6MB 2PUGA 3ESYA 3QOWA 1JB1A 2DX7A 1J0EA 4E6EA 1S8AA 5BMOA 5BSMA 4F3CA 5KB3A 2A9PA 4ENWA 3JAMA 2OK7A 3ERCA 2GZ2A 2VSXA 3D3WB 4EYSA 1M1XB 5CX1B 5T3YA 5ITSA 1NNUA 2Q3CA 2FUKA 5ALYA 5FNZA 4CN9A 1KDTA 1Q20A 5DTJA 4X6XA 5F21A 1YGYA 3R6LA 3ZHSA 1QFJA 1FP1D 4RS4A 1U80A 1THTA 1GXSA 1PK8A 3R0ZA 3AB8A 1FQJA 4MULA 5B1SA 5FDFA 3Q5DA 2XIQA 2J07A 2QRMA 4QDTA 4RZSA 4U9HS 4QPDA 3NOQA 5EIBD 3RYFA 3KZKA 5BW8A 2R6ZA 2H4ZA 2Q2VA 2HV9A 4DLWA 1YDMA 4HADA 1X7HA 2BFOA 4IIYA 2AJDA 1NBWB 3L5KA 4H7EA 3RK4A 1XJWA 3BREA 2I6TA 4RBNA 4AS3A 3TTXA 2NO7A 4CE6A 4F93B 3EFHA 4BKMA 2AMYA 2FN9A 2HO4A 4TT8A 3MUOA 5GY7A 4FBGA 3ZH9B 3IXQA 3Q3EA 4GUAA 4OXXA 4C22A 2I54A 2ZBUA 4RZIA 2FG7C 1RLOA 1VKHA 2C4TA 1RT9A 2NVUA 4C7MA 1M2HA 3QNUA 4II3A 1TJ4A 3SM9A 1J21A 4XCVA 2ODBA 3CRMA 3JTEA 1LZKA 2QL6A 3QEOA 4GAEA 2JJ1A 1SBIA 3DOFA 3KHSA 2XMQA 3C15C 4S0ZA 1AN9A 1A3CA 4PQYA 5ALZA 1RM0A 1O0CA 2RGEA 2XEDA 4QOFA 1CX9B 1O4VA 4RLFA 5LJIA 3BMNB 4OFXA 2LKDA 4QTZA 2ZBVA 1CQIB 3OCVA 4OAOA 1E1LA 2EW1A 3EUWA 3N9IA 3DMTA 4TQGA 3K15A 1DDGA 4LQ4A 4JH0A 2WYHA 4U2DA 5HE9A 1XN4A 1HL3A 2Q21A 2H0AA 1FTQA 2CMDA 3GAFA 2QT1A 2GNOA 3H1TA 4R6XA 4XD7D 1Q74A 4JCOA 2VPIA 4ZAZA 2CXPA 5TNXA 4CG3A 3MJDA 4CIBA 4YIHA 1G4UR 1DTEA 4UDXX 3M34A 1QTNA 4RCYA 3JQFA 5EUBA 1EVKA 2QP4A 4ND5A 3PPVA 5KC9A 1J0XO 2V8BA 4ZVSA 1U2RA 3ZBTA 1DBVO 2UZAA 3JQAD 3ANTA 3Q72A 4Q4DA 5DN9A 3ROZA 1U0RA 4K8RB 1G18A 1KYXA 2FQWA 3PKIA 2JH8A 3M6WA 3LBAA 4S0XA 3H7IA 5JR3A 5JROA 1W75A 1P1CA 2NX2A 2VRWA 3AVXA 1Z82A 4C9BA 4IV8A 1XJQA 3E1GA 4MLZA 3KEFA 1KI9A 2WAAA 4LRUA 2NAPA 4YRDA 3SSAA 1MB0A 1OIVA 1TRHA 2J30A 5A9TA 1OC4A 3FVVA 3GAZA 4C4YA 2HADA 3NIDB 2I66A 3WKEA 1NQOA 3O2QB 4CF4A 4CKBA 4XOIA 2PU5A 3DOHA 2XAUA 3T7IA 2UUPA 3OJOA 3VNSA 3PQ7A 1SXQA 1BE1A 1K5DA 2FEKA 3KYCB 3D6UA 4AI6A 2GA9A 2CKMA 4MX8A 1CZRA 1WSDA 1PV1A 3C3DA 2O0LA 1LH0A 4I1RA 1J2YA 3BJRA 3GPIA 5FPPA 5HZMA 2H1VA 4DV5B 2PSJA 1UJCA 2Z43A 4O1MA 1H0HA 2I71A 3C8UA 3GY0A 1Y3CE 2JI4A 4Q7EA 2ATEA 4Y2XA 5BV8A 1M74A 3N6VA 1SWVA 1KQNA 3U7IA 2REBA 3AF1A 1OV4A 2BL4A 4JC5A 4JUDX 4KDFA 4A92A 3LVFO 2AC7A 4RGBA 5HMMA 5JHHB 4XTRA 3LQ1A 4UM8B 5DOVA 1PF7E 4XUCA 1A96A 3RS8A 3K94A 2CXOA 3L7LA 4X61A 4MKHA 2OGUA 4LF7B 1Y8AA 1OH8A 2DHCA 2W0MA 3KETA 3ZVRA 2C4UA 1TIBA 3OZFA 3PIDA 4K88A 3R20A 4AU1A 2RGDA 3UENA 4CVNA 2VJDA 1RJ9A 4RANA 4QWMA 5ARBA 1M10A 2DLNA 3QE4A 4H7PA 1QIDA 3M9XA 4H16A 4RLHA 3UXEA 1D9XA 4B43A 1RQLA 1V1RA 3HO8A 3U0VA 5IBCA 2R1TA 5ESWA 3E22A 4QX6A 2Z57A 4CEIA 4IH4A 2IZOA 1E77A 1I7DA 3TEFA 1O58A 3II6X 1KI1A 1XFDA 2VH5R 1W0JA 1JAYA 1WF6A 2VKTA 4NCJA 5HF8A 4CUJA 1M1YE 2P78A 4HFNA 1I5EA 4D8UA 4MR8A 1E2JA 4L02A 2DTDA 2R97A 3DT8A 3PHJA 4KU4A 1PV4A 3Q2IA 3Q6NA 4AMBA 1T5LA 3ELBA 1RQPA 2BTQB 4G37A 1Z8DA 1F0NA 3T9AA 3KTAB 5LBIA 4FEGA 4BEJA 1RWVA 2ZBEA 4PVDA 4QZVA 4EBFA 3HJNA 1ZIYA 1U7UA 3IUQA 5K20A 1U0BB 3DDNA 3W8DA 1ENYA 2CXRA 4L6IA 3ROXA 2G5TA 5CU7A 2FH5B 3C3BA 3QHPA 4FR2A 4ZFNA 1Z6ZA 3FDXA 2H17A 3AOEA 1C1YA 3HMQA 2HRCA 5TRTA 4YYZA 1XLUA 4MV4A 4UUAA 4A1OA 2VJQA 5IJXA 2Y1XA 5A7FA 4YMWA 4YRAA 4FYIA 3LX6A 4O25A 2QJFA 1WZ2A 2QP3A 3VR3A 5DM60 2BCEA 2OZLB 4JJEA 3MGGA 5C8XA 2OL4A 3GFOA 1DUSA 3PF8A 5ILOA 1QWSA 1T4BA 2F9FA 2ZJ0A 4Q3KA 3L6UA 2NSLA 2XSZD 4US0R 1IXRC 1KXJA 5AK6A 2WQ6A 4IDAA 2P1ZA 2PCJA 3OZWA 2OQVA 3TVDA 3K0KA 1L5OA 3CG0A 4ACAA 2WYOA 1SXJC 1YHYA 2CGEA 3MCVA 4FI3F 3CEHA 4ZPXA 5CDHA 3FKJA 4M1KA 5HKKA 5LLDA 1Y4AE 5EIEA 3U2QA 3QVLA 3SSNA 2AJLI 4H35A 1H3EA 2PKXA 5HS6A 2JI7A 1N34B 3V3TA 4M4SA 1MAHA 3U5TA 3HC7A 2HK6A 3DVLA 3ETJA 1ORTA 2FEPA 2BSAA 1L7RA 3JATA 4ZP1A 7MHTA 4QBGB 2V5VA 1MO5A 1PLLA 1VCOA 3O4VA 2F4VB 1P72A 1YUBA 2AFIB 2EW2A 4M9XA 3ZE7A 4KYVA 2IHBA 1NVEA 2PUAA 3JY6A 3ZS8A 2UYYA 1TUBB 5JSYA 2XPCA 4PR0A 4UKDA 1HH4A 1JFVA 3ZLJA 1I3MA 3HU2A 5GZ1A 3TBFA 4KCGA 4CHGA 5BMVB 1EDZA 2XKJE 5KJ6A 1O97D 3F7OA 4ASUA 3GLFE 4OSPA 3QLUA 1OGIA 1IY8A 4KN6A 4RH1A 5JJCA 4KIFA 3WGVA 2GHTA 2C2KA 3IJRA 1YBHA 5IDXA 1Y8RA 3OE5A 4H6VA 4PIPA 4UUQA 3DAHA 1PRYA 3SQMA 4BQIA 4QPJC 4AF7A 5FWYA 1YRLA 2GN6A 1VKZA 1XYYA 5AK5A 2H54A 3BK2A 4J1QA 3W4IA 1NM5C 4UHHA 3H5NA 3PFBA 4PBRA 1SD5A 2A3NA 3G2IA 4HRXA 4JOSA 2VPWA 3LIIA 4X90A 1U0HC 3FWPA 2NVUB 4G1MB 4JHLA 4EJ0A 4C0AC 3VVCA 2A9RA 2EBFX 1EFRA 2FGJA 3Q8XB 4GRAA 4OCZA 1CB0A 5JRDS 3RFUA 1Q2XA 4YEDA 1NOIA 4ZAVA 8OHMA 4KI0A 4A0SA 5BRNA 2LCQA 1UQUA 3PNBA 1WQ4A 1Y7PA 3PXGA 3E8SA 2H16A 3E4DA 4LJLA 3HI4A 2PX6A 1I4TD 2YWFA 3M2TA 1BA2A 1EP3B 3QI7A 4MWDA 1P2UA 2RIPA 2R84A 5CJJA 3V8PA 1Q57A 1VDMA 5F51A 4D3XA 4D7AA 5FTJA 3PXBA 3NVAA 4GQBA 3DC2A 3OY2A 4YAOA 2BLLA 1WB5A 2C5LA 2ZWMA 3KG2A 1A9PA 5D3QA 1H6AA 1SD2A 1HYHA 2G71A 3G2JA 1UBRS 3IURA 3L6DA 2IS2A 2JC3A 2WTXA 4PZUA 1N7HA 3L02A 2P0AA 1CUXA 1HC7A 1GZ3A 3RLIA 3I01A 3AHJA 1BWQA 4FDTA 4DKJA 3IAUA 2G5PA 5FPKA 2R11A 3K0FA 1VCHA 1HEYA 1F0YA 4H18A 4X1KA 2PNFA 4KVAA 4MLDA 4MRRA 3TL2A 3P4XA 4I5DA 3RRBA 1Z5UA 1XCOA 5CDSA 2XZLA 3HJGA 2XDWA 1A2OA 4B47A 3CJTA 5K0NA 2BM0A 1FNDA 1T9GR 3DBRA 3HBMA 4KQMA 3E8XA 3TQHA 4WGGA 5C1DA 3FX2A 3BM5A 5FOSA 3I5YA 3PWTA 3HDQA 1F0PA 2ILVA 2G72A 3BWXA 3U7EB 4EB3A 3R7WA 5CLFA 5JEDA 1CCWA 1ZPDA 1T1GA 3N2GB 4WCDA 3WMWA 3UG6A 5KYGA 4RCZA 1OB5A 5B55A 2QBYA 3NH9A 1LNQA 5HS4A 4QOHA 2WU0A 4RPLA 1VYHA 3WP0A 5HUHA 5BYBA 2DR2A 4YUWA 4PONA 1ZWLA 5DNCA 3LH5A 1RXSA 2AG0A 1QO0D 1S2DA 1EDEA 2RBEA 3E27A 4IZHA 3SC6A 1KBZA 4DV7B 1FUEA 3QMWA 2PUTA 4QJIA 4MWZA 1P4HA 2CVHA 3EC7A 1D6JA 3KL4A 4W5WA 2X8BA 3IEMA 1K8RA 4ETWA 4OYRA 1C2YA 2DUNA 3G13A 3L79A 2QTGA 5FTLA 2SBTA 1CVIA 1NR7A 3DLTA 4K9RA 4D25A 1ZUWA 1WMEA 5HIKA 1AY0A 4CGZA 4N7JA 3FOWA 1A9XA 1XNJA 4GOJA 5CT9A 1VOTA 3FTEA 1YFKA 1I1OA 2WM2A 3NHSA 4FOTA 3SIRA 2VBIA 3WISA 1TKRA 2FWNA 4GBJA 3V8MA 2QTZA 4KKVA 1G2PA 2JGJA 5HDQA 1R4NA 2VTKA 3V97A 2CDBA 5IAEA 2Z6AA 1GGEA 1RP7A 4Y8VA 3QKIA 1TIPA 2A7QA 1ML4A 3P9RA 3SCZA 1HFWA 1I7SB 1DJMA 4WPGA 1ZOPA 2QL5A 2HA0A 4EHAA 5MN5A 1FFXB 1NULA 1NT4A 2FMKA 3OEEA 4GOND 1XMXA 2C9BA 4G36A 4GQAA 4QGHA 3ZCRA 1X1EA 3KEMA 1JMVA 4D8XA 3OJWA 3MAJA 4LBVA 1OFUA 5FP0A 2HSDA 3D7NA 3VOSA 3I9MA 3NYIA 4FJ0A 5BO5A 1J5EB 4JSRA 5J2UB 4ZHQB 2DFKB 5T4BA 5L51A 1QG4A 3GLIA 3T4PA 3EGVA 2F4NA 4MYRA 5IT0A 4FMDF 4JYZA 1JDVA 4P34A 1YACA 2BF7A 3D9QX 3EA4A 3F7TA 1VGQA 1BNCA 5DSTA 1R2QA 2ACEA 3JQPA 2XNKA 5CAEA 2G1UA 1GHTA 3TCKA 3EXEA 3ZHRA 5K3EA 2O07A 3SP1A 4JROA 1Z38A 3G2QA 3Q3VA 2VNIA 1G9TA 2BJWA 1UP4A 2YHIA 1W6UA 3A9WA 3G9UA 1VSQA 2J48A 4GMKA 1PFGA 4M83A 4F7WA 2HY7A 3SEAA 4A82A 4A26A 5FX2A 3O9ZA 1DWQA 1HDIA 2O7NA 4J0EA 3NEPX 4KXLA 2IX3A 4YMGA 1SUCA 3B48A 1YR9A 3C5CA 3UFBA 5BSVA 5KWVA 1NBMA 3ZXIA 1L4KA 2FFJA 4DLVA 5JSZA 3SLGA 5AW4A 4U2KA 1XMPA 1T36A 1M0WA 2Q3MA 4R51A 3VVMA 1RJWA 2ID9A 2WUDA 2XD4A 2AOWA 4G4IA 4J29A 2XIJA 3AEKA 3LI2A 1M8FA 1YS7A 4XWKA 1CZOA 1TQDA 2XWJI 5E6RA 1YR8A 4E5MA 4BNTA 2BE7A 3DFZA 3ZJVA 2DFDA 3ILVA 2C0PA 5D8DA 2HSGA 3DDHA 4IDGA 4DBZA 3HP1A 2L17A 4G0MA 1SAYA 5G1OA 2DOKA 3V1UA 1OLSA 1X80B 2PZFA 3MPOA 4PSDA 3JSAA 1KYYA 2DLDA 3I8OA 5B58T 3ZHBA 3ZWWA 4QBIA 1XZAA 2SICE 2XYGA 2CW5A 1VJ0A 1C30B 1PG5A 2I4TA 3ACDA 1GXSB 3PEEA 4ZJUA 5IPFA 5LXTF 3B6ZA 3T5TA 1SUDA 2AW5A 3J80A 4JL6A 4HB0A 2DG2A 2IP1A 1Q1GA 2XYPA 1QRDA 1KJ8A 1XUOA 2FFBA 5LN1A 3ACBA 4M49A 5AICA 4B4OA 2C04A 2VP9A 1J2RA 3QU2A 2GFIA 4BNDB 5BMVA 3NUQA 5L7TA 2V6JA 4QAQA 2KX7A 1NY5A 1YB1A 5K4AA 5F12A 5LDGA 5JDIA 4L4SA 3OTGA 1HO3A 1P73A 4UXHA 5KWIA 1I5OA 4H7IA 1OU0A 2NXCA 2V6FA 3EUFA 1UM8A 3IP9A 2PBLA 3BD6A 4RYLA 4BHTA 5BW4A 4WA7A 1DKUA 1GADO 3NM4A 1P1HA 2C00A 1JIKA 1P18A 1ZXBA 2B1JA 4M1TA 4MQUA 4BB9A 5IT4A 5JXJA 4WN9A 1XJ5A 1J20A 3DFFA 1NZDA 2E5WA 4ND4A 3WRYA 3ZOKA 4LZZA 4JDUA 4FFVA 1SCQA 3UH0A 4EEXA 2VS1A 3AR4A 4N5MA 4N8EA 3JTMA 1TU4A 1KRXA 3DAPA 3BC1A 5I7SA 2C5HA 3EXIB 4JLJA 3W7AA 2V3CC 1UKVY 5T3UA 3DDUA 3UJPA 3WK6A 1I13A 1XTVA 1KEUA 1XTZA 3GLHA 1S2OA 3H86A 4IHJA 3MT8A 3C5WP 5ALXA 1ZK4A 3RJZA 4CT4B 4EGQA 4BU0A 2X9LA 4MYHA 4RAQA 1B93A 3IV9A 2COEA 5C18A 4G0ZA 1XPOA 2H1IA 1CUCA 3D6FA 4KRGA 2RG7A 1CBUA 3C3AA 4B6PA 3I42A 3CSDA 1T36B 4IAOA 4WZ6A 2B5WA 2WHEA 5LU8A 3EPLA 3L43A 1MZPA 2B69A 1GNRA 3WV5A 4PM4A 5F3DA 5GONB 4LK2A 4DSNA 1N7GA 1VHQA 5EMLA 1M2VA 4MS1A 1K4MA 4NL4H 4RMHA 3KLOA 3MOGA 4DCMA 3N58A 2PQ6A 2XQFA 3U9LA 4KITB 1ZI8A 1ENPA 3L04A 4GL4A 5L4SA 3TG2A 2B8TA 2I91A 1VCMA 3HU1A 1AQYA 3I37X 4UVDA 2RSLA 4RE6A 4LZWA 3TSYA 4XIYA 2BJHA 3L7KA 2WRZA 2X0DA 2BAGA 4K6KA 4EMBA 3ZBQA 4L5AA 1PLKA 1UAYA 3H5RA 1E5QA 1PR1A 4AFNA 2WB4A 4ZMRA 1AQLA 5KO2A 2ONCA 3AVOA 3WMEA 2DTXA 5IW8A 1E5LA 4JLAA 3OHMA 3PT5A 5A3RA 4GYWA 2Z1NA 2CHVA 1AHHA 3DFIA 3IDZA 4FMCB 3V5NA 5LOVF 4IUYA 4UBNA 3NRCA 5H83A 5IKXA 4BQNA 1SQFA 2VBGA 3DONA 3AESB 1DMRA 4OHCA 3H75A 4NXMB 5TMPA 3TQFA 1ZS9A 5DCLA 1LRLA 3OU7A 4BPBA 1YA8A 3P9IA 4B80A 2E7ZA 4LG1A 2R1TB 4PCLA 2CUKA 3PQ6A 1HSOA 3E61A 2PLNA 5GIOE 1FJGB 5DWQA 3TG8A 1S8OA 2JFBA 5KNBD 2PYIA 2XHEA 3GFQA 4ZMBA 3ZCUA 3SZRA 3OTWA 1C3EA 1E2LA 1ZVMA 3NM5A 1ZMBA 2IRWA 4MW9A 4OFWA 4GZ5A 2W6IA 4N47A 1QCYA 2J3QA 2WF8A 4WOPA 4Y9UA 2VSFA 1PKXA 4PANA 1QH9A 3UGQA 1HE3A 1ZHFA 2R44A 2CLLB 1FLDA 3F4KA 4GOXA 2ORVA 4PHHA 4DBLC 2CDCA 3FKSA 4ER7A 4DV6B 3TXXA 4RYDA 3NWPA 4B44A 3ZPXA 1HT0A 3H7AA 5B3JA 4NH4A 3X1JA 4E0BA 4IVPA 1JFLA 2XA2A 3KD3A 2AN1A 3QIAA 2ZITA 1WXXA 3RD5A 2ZUEA 4BPRA 2FMUA 5AXCA 5KCZA 5FFFA 4U7PB 2FF5A 4C6RA 2N75A 1QH0A 1KYTA 2G80A 1F2TB 2QE7A 3URKA 1KMHA 2A9KA 5ELLA 5BPFA 5EHNA 3PFWO 3IPAA 3QYJA 2I67A 1YL7A 4FQ5A 1QH8B 2ZETA 4FB5A 1FRZA 1E5DA 3CQ9A 4F12A 5KQRA 2EJTA 3R4VA 3I6MA 1W59A 2ZDGA 1EZ1A 3OT1A 4UQPA 3BMQB 5AHXA 1YL5A 2AFIA 2AMVA 4MEAA 4NEGA 4EHDA 3OP4A 5IS2A 2FQXA 3S8EA 1A2BA 5BN3B 2J45A 3N28A 1PN3A 1WW3A 2NTEA 1Y8CA 1VB5A 3ILYA 2GPJA 3RG2A 2W2KA 2QA5A 2Q0XA 4C4AA 4GI5A 4JEUA 3ZVKA 1U2GA 1UK6A 3PZRA 1GGJA 4V38A 3PNQA 5E6UB 4Q4HA 3ROGA 4X95A 1J1IA 1W1UA 1YDGA 4CMIA 3CURA 4Y2PA 3WSVA 4D6PA 4HL6A 2GJAA 3E23A 4QDOA 3KXPA 4ZXFA 3H17A 3RVSA 3UMRA 4BGVA 5CH8A 3E22B 1ZCBA 4HOYA 5M34A 3VPCA 1NWHA 2IVZA 5JMOA 2BHTA 4R9SA 4Q1CA 3AF4A 3TLEA 4KQFA 2BRUA 5JQGF 3DQQA 2H1WA 4FEEA 5DEOA 3H0EA 4Q7KA 2R6JA 4DGSA 3WGJA 2GEJA 1OAOA 1E7RA 4QHTA 2FG5A 3QG5A 3GHYA 4E07A 5FL3A 2CLDX 3RJMA 1J7KA 2FLKA 4BO1A 3I5XA 1Y4UA 3QOFA 2HXGA 1MO2A 4PYJA 4RFSB 2JASA 1YV9A 4NOKA 4LRXA 1OZFA 1BYIA 4RK6A 5TARA 1XB2A 4N5HX 4PE5B 4XIJA 3REQB 1L5FA 3WLPA 5B36A 4WN3A 3S0JA 5I9MA 1EVIA 1KQOA 3LX4A 3IDQA 1I2AA 1QLWA