4U2EA

Crystal structure of dienelactone hydrolase s-3 variant (q35h, f38l, q110l, c123s, y137c, y145c, n154d, e199g, s208g, g211d and k234n) at 1.70 a resolution
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
233
structure length
233
Chain Sequence
MLTEGISIQSYDGHTFGALVGSPAKAPAPVIVIAHEILGVNAFMRETVSWLVDQGYAAVCPDLYARQAPGTALDPQDEAQREQAYKLWQAFDMEAGVGDLEAAIRYARHLPYSNGKVGLVGYSLGGALAFLVAAKGCVDRAVGYCGVGLEKQLDKVPEVKHPALFHMGGQDHFVPAPSRQLITEGFGANPLLQVHWYEGAGHSFARTGSSDYVASAAALANERTLDFLAPLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Carboxymethylenebutenolidase
publication title Directed evolution of new and improved enzyme functions using an evolutionary intermediate and multidirectional search.
pubmed doi rcsb
source organism Pseudomonas sp.
total genus 83
structure length 233
sequence length 233
ec nomenclature ec 3.1.1.45: Carboxymethylenebutenolidase.
pdb deposition date 2014-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01738 DLH Dienelactone hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4u2eA00
1XQWA 1UK9A 3T52A 3FSGA 2HHAA 3V9AA 3H0CA 5AO9A 3N0TA 3M81A 1UOPA 5K3BA 1BS9A 4AXBA 5AIBA 5KREA 3DYVA 1WCYA 1XZFA 4H7IA 3CCCA 3OPMA 4K6KA 1MX5A 4UBOA 1A8SA 4N8DA 4B0PA 2QOEA 3B12A 4X93A 1CUZA 3QPAA 4LYDA 1WPRA 2PU5A 1KU0A 3PDCA 3BWXA 3HACA 1W4LA 2OG1A 2QTBA 4LXHA 2Y2UA 1LPMA 3OURA 5CURA 1B6GA 1LPAB 4CI9A 1DX4A 5EHQA 3D7RA 4X92A 3GUUA 4E14A 5FUMA 4KAAA 3B5EA 2WU3A 3H2KA 5C8XA 1CUIA 3ZWQA 2WHPA 2RHTA 2DQYA 2WIFA 1VOTA 3C45A 1LBTA 1O6FA 2OPHA 5AI4A 1K63A 5A7HA 1THGA 2GZSA 4EY5A 4KE8A 4A23A 3VXKA 2OAGA 4FBLA 4EY6A 4AO7A 2DCMA 1AQLA 3VJKA 2X76A 4CCWA 3WZLA 3A2LA 3OG9A 5F4ZA 3PICA 5C8VA 4QDOA 4P92A 1I6WA 1Q84A 2DHCA 3O0DA 4WY8A 5AOBA 5LLSA 2I3ZA 4UUQA 3X3HA 3HRHA 3G0IA 5I7UA 2FJPA 1TQHA 4GXNA 5HFAA 1BEEA 3P2MA 4BVJA 5I8PA 2QM0A 2WM2A 5EHNA 3ZLUA 4WDQA 4J3JA 3G9UA 5KWIA 1BE0A 3EIOA 4HTAA 1QIMA 1UKCA 2ZJ6A 2J4CA 3I1IA 4MQLA 4PW0A 5ALSA 1XZEA 3RKSA 2O2IA 1G42A 2Z3ZA 3MGAA 3DOIA 5E4TA 3KXPA 2XUFA 3GELA 3WA6A 2RONA 5HKAA 1MN6A 2AXEA 5DNWA 1CV2A 5C7YA 1QFMA 1U4NA 4YASA 1JU3A 4WFJA 2QKYA 2WFLB 4LKOA 4BB0A 5A71A 3STYA 4XX1A 1VXOA 3IURA 1AC5A 4YPVA 1XZKA 3R3YA 3ICVA 1FFCA 1UZAA 5C81A 1SFRA 5CT5A 3F98A 4UFPA 1GGVA 3DLTA 1QGED 2OGZA 2WU4A 2J3DA 4G4GA 1SCIA 4I19A 4W1QA 3I2IA 2H7XA 4FHZA 1F8UA 2H7YA 1VKHA 3NWOA 3R40A 1QIGA 3FLBA 4G9GA 5T4BA 5CT9A 3I1YA 1XZGA 4LXGA 2VT7A 3G9ZA 4Q1VA 5AM2A 1S8OA 4IQ4A 3Q0TA 5JATA 5ALXA 3C87A 2Z8XA 3L1IA 4HXFB 3AZOA 4GWLA 2B4KA 1ZJ5A 2J3QA 3DYIA 2AJDA 4CG1A 1C4XA 2X5XA 4BAUA 1ZGCA 1IZ7A 5I9IA 4ARAA 5CH5A 4G5XA 4BTVA 1ZD3A 4UBLA 1QE3A 2XMSA 1G66A 3KOOA 2QVBA 4P9NA 3FWHA 4KYVA 2WSLA 3A70A 3IA2A 1LPOA 5AHXA 5EI5A 2O2HA 2YYSA 3ZLTA 2PSDA 1EHYA 5DTIA 1W76A 1MO2A 3O4HA 3DEAA 3DQZA 5A7GA 4DSZA 2VJDA 1JJBA 2BFNA 2BGRA 4IHAA 3BF8A 3WA7A 3WK9A 1TCCA 4X91A 4ZXFA 4UBMA 3STTA 4G8DA 3NUZA 5ALHA 5K3AA 2XDWA 1F0NA 4BRSA 1PFQA 2PKYX 2VTVA 3MUOA 3AINA 4MEBA 3BDVA 1WOMA 3WWPA 1R1DA 3HLKA 4QDZA 3V1MA 2PL5A 4QDTA 4FFWA 1YB6A 4HRXA 1PV1A 4K5QA 4KJXA 5IKXA 3FYUB 5CBKA 3A2MA 3C43A 2QUAA 2XQKA 1EXWA 1CIJA 1EVQA 5AI8A 1UT6A 1E8DA 5A6VA 1L7RA 3D59A 4KAJA 4BVLA 3FYUC 4KACA 3TJMA 3QM1A 5K5EA 3QBJA 1XQXA 2O7VA 3D3NA 3DD5A 4L72A 2WTMA 2BJHA 1CUUA 1JT2A 1QO9A 2XUHA 1LZKA 3GA7A 4MWSA 4ETWA 4CFSA 4Z49A 1XRMA 4UFNA 1FFDA 5D3KA 1H2YA 4AN1A 1XKTA 1GQRA 3W05A 1IUPA 1BN6A 3SWWA 2Y6VA 2BKLA 4BDTA 4EBBA 2ZYIA 3DCNA 2VJAA 1W6RA 3IUQA 4GHWA 2HRRA 4E46A 4OU5A 1EVEA 3HJUA 4C6HA 4HS9A 5HCUA 1JMKC 2XUOA 3DDUA 2VAXA 5JIBA 6YASA 1UK7A 5CT8A 3VKFA 3AFIA 4OB8A 4N5HX 1GZ7A 4H35A 3AILA 3EBLA 3HXKA 4HAIA 2EEPA 5SYMA 5AK6A 1A8UA 4G9EA 3ANSA 1XZMA 1X70A 5ALTA 3IUMA 1JI3A 5FOQA 1XZHA 1QZ3A 2QJWA 4UBNA 4DMFA 4DNPA 1T4MA 4G1FA 1N1MA 3PI6A 1BROA 3DS8A 4PSUA 4OPMA 3G02A 1QIFA 5JARA 2G5TA 4B82A 1LZLA 3E3AA 3AJAA 4X97A 1VJ5A 2HA2A 3WJ2A 2CB9A 5IH7A 5FKJA 2CEKA 4Q3KA 2QR5A 2QRUA 4DNQA 2WIJA 4AZ0A 2ZJ7A 2XMRA 3EQ9A 4B85A 2FX5A 2WIDA 1DINA 4MEAA 3AIOA 5JYCA 1WM1A 2HM7A 5DYWA 2XUPA 2XUQA 1IZ8A 3I6ZA 3R3UA 2ONCA 4UBJA 1JFRA 4N8SA 3F67A 1ZOIA 2ZVDA 2HA4A 4OD0A 3W9UA 1Z68A 1MX1A 1ZD4A 4ZRDA 1IUNA 1A8QA 2XQFA 4BCCA 1VZ3A 1XLVA 4DMCA 4CG2A 4MYDA 1QLWA 3N2ZB 2JGEA 1ACJA 3WWEA 4W63A 4X94A 5JAHA 1CUVA 2Q0XA 4N8EA 4EY4A 1VA5A 3EQ7A 5SYNA 1ACLA 4OCZA 2OGTA 1AGYA 1E8NA 4G8CA 3WYDA 1CQWA 4PV7A 1J06A 3G0BA 5T4HA 2H7CA 5AKZA 4KE6A 4BDSA 3KWJA 3S2ZA 1UWCA 5DNVA 1SOMA 4LHEA 3QH4A 4FMPA 1GKLA 5ALFA 1YSCA 4E15A 2PUHA 3IIIA 2PPLA 3WKCA 2PM8A 1GXSA 4B81A 1HDEA 4EA6A 3ANTA 4G4IA 1Q0ZA 1W1IA 1DX6A 4AX4A 2J4FA 5ALWA 5EIAA 5AM3A 1T2NA 2P8SA 1CUHA 2RIPA 4DNFA 2YXPX 2HU5A 4BRZA 5DYYA 3JYHA 1UXOA 5JZSA 5JAOA 3FNBA 1AMNA 1DQZA 2CUTA 2WILA 3A2NA 4LXIA 2HL6A 2XLCA 4F0JA 3HI4A 3SK0A 2VA9A 2RHWA 1CQZA 3I6YA 4MYSA 5JD6A 1ZD2P 2ROQA 3QPDA 5E4YA 2HFJA 3V1LA 3FVTA 2DQZA 3O4JA 3MVEA 4BCDA 1BCSA 4QWWA 2QUBA 2ZYSA 4UHHA 1XZLA 1U2EA 3FSGD 2WLSA 4D9JA 4K2AA 3B3QA 1IMJA 2PVSA 2GYUA 3LP5A 3L1JA 2AJBA 2HA7A 1MNQA 5ALJA 3F9CA 3FBWA 1NX9A 5JZBA 4J0CA 4DYHA 5AK5A 3R3VA 2QXUA 5ALLA 4G8BA 4UBKA 4B9EA 4H18A 3FOBA 3QMWA 4Q05A 4S0XA 1W75A 1WB5A 4DGQA 1EINA 5D6OA 2XUDA 2R11A 2JF0A 3I6MA 1YAJA 4KRXA 1QIIA 4BZZA 1XZCA 1LLFA 1MU0A 2XQIA 3F97A 2WG1A 4UPDA 5JAPA 1TK3A 4Y2RA 1JMYA 4XIIA 1R9NA 4TGLA 3LCRA 1B41A 1QO7A 2QXTA 4FNGA 1DU4A 4I4CA 5LKRA 3IULA 4BZWA 4QDXA 5KWJA 4YX9A 1CUJA 2CMFA 4NMWA 4Y2YA 1R88A 3WMRA 1EK2A 3BJRA 1G4HA 2E3JA 4WDRA 1SCQA 2ES4A 3TRDA 2CJPA 5AI5A 1C7JA 2Z5GA 2ZJFA 3C6ZA 3QMVA 1U65A 2PSEA 5D3ZA 5ALUA 4M0MA 4L9AA 3VVLA 2WUGA 1SC9A 5JD4A 1BEZA 1FFAA 1TAHA 5BWCA 2UZ0A 2VT6A 2WTNA 4NS4A 4U2BA 1FFBA 3H2GA 2G4LA 4RPCA 2OCGA 3WI7A 5CT6A 1MT3A 3LS2A 5AOCA 4UHFA 4JYPA 2ZYHA 4RGYA 4RE6A 1IVYA 2VF2A 4H7KA 5HF9A 4H7FA 5AM4A 4ZWNA 3OOSA 5CMLA 4BAZA 2X8BA 3VJMA 2IIVA 5AK3A 3I2HA 2V96A 5CH3A 1K8QA 3BIXA 2CKMA 3ILSA 1CUGA 3G9TA 3H2JA 4CCYA 3STXA 4PSDA 4X71A 2ACEA 2BUAA 4L3WA 4OB7A 1THTA 1ZICA 4TPKA 5ALIA 1TIBA 1YS1X 4BC0A 4AN0A 1KEZA 5FLKA 2WHPB 3BIWA 3CN9A 4FKBA 5AM1A 4KE9A 1XZDA 3BJMA 4K6GA 4DIUA 2WQZA 1X2BA 5AI9A 4MJ3A 3I28A 3OC0A 2RGUA 3ZPXA 2R8BA 1VLQA 5AKIA 2JGLA 4KAFA 1LPNA 3ICWA 1DWOA 2XUJA 4B80A 4IH9A 5IVDA 2AJLI 3DJYA 3LLCA 4B83A 4Y2UA 2WHRA 1QIJA 1U8EA 2HADA 3DOHA 5AH0A 2IITA 1EB9A 2XMZA 5T4EA 1LNSA 2DR0A 1XLWA 3K9BA 3WK7A 4U2FA 4HXGA 2XMGA 2YASA 3PE6A 3PF8A 1HL7A 4YK7A 4NVRA 1VZ2A 3VJLA 5CW2A 2B9VA 1ZI9A 1HBJA 3FCYA 1VE7A 1H2ZA 3EF3A 1GQSA 3FCXA 2EDAA 2Z8ZA 1GPKA 1C7IA 1VXRA 2XLBA 4ZI5A 5DJ5A 5HQ3A 2W6CX 5ISMA 1RP1A 2XB6A 2C5FA 1JJIA 4BYMA 4FFVA 5HKBA 1CLEA 4X6XA 4J0GA 1LPSA 1UK8A 2XE4A 1IUOA 4FDMA 4X3CA 4EY7A 3RARA 2HA3A 2VATA 4Q82A 1YASA 2ORYA 2WUDA 3HC7A 1XRPA 5AKKA 2ECFA 1X2EA 2XT0A 4QLOA 3VISA 2GBIA 4UHEA 1UOQA 1J1IA 4AO6A 3E4DA 5AI0A 4PNZA 1R4ZA 3RM3A 4W1RA 2Y1KA 4CCYB 4W1SA 3A6ZA 3BF7A 1QJ4A 1GPNA 1LPBB 3O9VA 1AKNA 2JGJA 5AKHA 5A62A 2DHDA 1YS2X 3KSRA 1L7QA 5AKEA 5CH8A 4DMHA 2K2QB 5LZ4A 3IBTA 4BTLA 4PQEA 3WL7A 1O6GA 3WLAA 3H17A 3M82A 2QS9A 3G9XA 3ZLVA 5HK9A 2O7RA 4OSEA 4M0FA 4C4ZA 1K5PA 4UHCA 4X85A 5AKGA 7YASA 5CXUA 2JGFA 1ODSA 3OTQA 5EIEA 1ZGBA 2XUKA 4B6GA 4TVKA 2VJBA 1XRLA 1VE6A 2BUBA 2G63A 5LZ2A 1BN7A 2GBCA 2DFPA 4J0KA 3D5EA 1MNAA 3L1HA 3W9BA 2XMBA 3R41A 2QT9A 1N8SA 1UKAA 4FNMA 3IVMA 5J3JA 1M33A 3PUIA 1DWQA 1SCKA 3GFFA 4LIPD 4FBMA 5LIPA 1UOOA 5EFZA 2DSNA 5ALPA 1YA8A 4AO8A 1CUDA 1CUXA 2I03A 3UMJA 3R0VA 3U1TA 2PSFA 1QONA 2HA0A 1TKRA 5HQ3B 2WFMA 3F96A 4ROTA 1OILA 3HZOA 4X6UA 5DNUA 3BL8A 3I2KA 2JIDA 4X95A 2HIHA 3G0CA 3AUKA 5EIHA 4JH0A 5JALA 3STUA 3Q8WA 4P08A 1EX9A 4Y2JA 2WG2A 4Q34A 4E11A 4ZGBA 2CBGA 3AIMA 4FLFA 3HABA 1XLUA 1YR2A 1J07A 4EY8A 1R50A 1YB7A 4FLMA 4AZ3A 3QPCA 1YAHA 1CUSA 2JGMA 2OCLA 4GECA 2Y6UA 1EDDA 3BDIA 3WZMA 5ALOA 5LYYA 1K4YA 3QITA 2HFKA 1XRQA 5FPPA 4BVKA 2WUEA 4EZIA 1GKKA 4MWTA 4FLEA 5JD5A 2VEOA 3AIKA 1HQDA 5CTAA 2LIPA 1GPLA 1EB8A 4WY5A 1TCBA 2CZQA 2H9YA 1P0MA 5AP9A 4ZV7A 5AM5A 1H22A 3D2BA 4F21A 1XZBA 5ALMA 3WL6A 4EHBA 3DL7A 4CIAA 4L0CA 4OUKX 5JAUA 3F8SA 4OYYA 1CUFA 4QZVA 5K3FA 5AKLA 2B61A 4FWBA 3I2FA 4GW3A 3DL4A 1WHSA 4ZV9A 2XI4A 2C7BA 3QZUA 3U0VA 4Y9SA 4XWGA 5ALDA 4DLNA 5YASA 5E4JA 1MAAA 5HZGA 2YH2A 4ITVA 3CN7A 1CPYA 3IUNA 3C70A 3GZJA 2I78A 2C0QA 3RLIA 3BE8A 1MJ5A 1ZI6A 4G4JA 1AUOA 4AB1A 3OM8A 4C01A 3PFCA 2PU7A 1ZI8A 3C5VA 2PSJA 2WFLA 1Q83A 2QMQA 3JWEA 1BCRA 5ESRA 1EDBA 5ALRA 1LPPA 4F60A 3D4LA 4Q3LA 1YCDA 3ESDA 3H2HA 3HEAA 5JANA 3FAKA 1XFDA 5EGNA 4BC1A 2XUAA 5JASA 1E3QA 2XMQA 5ALKA 4KE7A 4C87A 4GEGA 1LBSA 1L7AA 3ZV7A 1J2EA 1ORWA 3H19A 4ARBA 4DTCA 5AICA 3H18A 2WIKA 4OB6A 4DNOA 5HFNA 3WL8A 5FDFA 2XQGA 3V1KA 2VJCA 2PBLA 1XKLA 5BV7A 5IVKA 1QFSA 5IVHA 3O95A 1XZIA 2WUFA 1WHTA 4U2EA 2QZPA 3UUEA 1CUAA 2C5GA 2WG0A 3W06A 5DLPA 3NGMA 5BWBA 4RNCA 2ZSIA 2VSQA 1E89A 3PF9A 2QJRA 4WFKA 4X90A 2RI6A 4LYEA 2B20A 4Y2XA 3MUNA 3DNMA 2HU8A 5EHXA 4BBZA 4JUIA 4C4YA 4UBIA 4HVTA 5FV4A 4C88A 1RYYA 3WK4A 3WKBA 4BE9A 4J0DA 4V2IA 5ALEA 5K3FB 4KEAA 1UK6A 1JJFA 4PO3X 4GLBA 1F0PA 2C4HA 1EH5A 1N5MA 2OXEA 1Q0RA 5LZ8A 2Z3WA 1F6WA 2ACKA 1HKHA 1H2WA 5FXMA 3WWCA 1CR6A 4FOLA 3WK8A 4BAGA 2FUKA 2I3DA 4H0CA 3KD2A 3WWDA 4ZREA 4X6YA 3PFBA 1Y7IA 5IVIA 1A7UA 3FYUA 4BP9A 2HA5A 3G8YA 1OCEA 2GBGA 4QA9A 2D0DA 4KR0A 4HRYA 4O08A 4BATA 3W04A 2C0PA 4X7BA 3CXUA 4JEIA 4IH4A 4Y2VA 2AJCA 5ALZA 4W9RA 1BU8A 2JEYA 4B0OA 5LZ5A 3O4IA 3RK4A 1TRHA 3S8YA 2XMDA 2BGNA 2H1IA 3EQ8A 4B7ZA 4MQMA 3VVMA 1W52X 1ORVA 1E5TA 4UHDA 3ESAA 2V97A 3C8HA 5HF8A 4U2CA 3IB3A 2OAEA 5AIAA 3TGLA 1NU6A 3WJ1A 5K3CA 5KBYA 1KU6A 3NOXA 5FPQA 3E0XA 4HXEB 1FSSA 1N5RA 4C89A 4OYLA 3ESBA 3VDXA 3BXPA 5JADA 2WJ3A 3STVA 4FTWA 3HYSA 4QE3A 5AKJA 5T4FA 4GBGA 4M0EA 1EDEA 2OQIA 4WCVA 3WIOA 3ESCA 4NZZA 3IUJA 3C6XA 5CT4A 5E2IA 4DMKA 2IX9A 3DKRA 5DTJA 4I3FA 3H1AA 2ZSHA 4QLAA 5LZ9A 2NW6A 3C6YA 2FJ0A 1RWQA 1QTIA 4W1PA 4J0JA 3QVMA 3D2AA 3H2IA 4K6HA 3WKAA 1VA4A 1H23A 1HPLA 1BRTA 2HU7A 1ODTC 5ALNA 3WIBA 3DKKA 5DYTA 4QDUA 1DTEA 4CG3A 1CUEA 2V98A 4WFIA 1A88A 3D0KA 4H77A 2HDWA 1ZIYA 3W2TA 4DM7A 2BCEA 5FRDA 1FFEA 2EDCA 2V9ZA 2PSHA 1QIEA 3CCBA 2WFZA 4N5IX 5A7FA 4J0IA 4P93A 1OXMA 5JZ9A 1DQYA 5LKAA 3K6KA 4BE4A 4Q3OA 1ZJ4A 3AZPA 4BP8A 4GI1A 3ZI7A 1EA5A 3TEJA 1XQYA 4J7AA 5LZ7A 1WPXA 5HF5A 3WK6A 4AMZA 2JBWA 4U2GA 4WJLA 3C5WP 1MTZA 4QWMA 1D07A 1QIKA 2JEZA 1FJ2A 1LGYA 4H7JA 1XRRA 5DWDA 3FVRA 1AURA 1ETHA 4B9AA 3QYJA 5HK8A 2AJ8A 3T4UA 3C6BA 1ISPA 5AKYA 2G5PA 5A2GA 4HZGA 1NU8A 2OQVA 2ZYRA 3E1GA 4JYMA 3WYNA 1R3DA 1YA4A 2Y2VA 4UFOA 1EI9A 3IDAA 1CEXA 4GDMA 2OGSA 3FLEA 1AZWA 3PUHA 2O2GA 5ALQA 1AX9A 4QEKA 4Y7DA 1ZD5A 2JGIA 3QMMA 1QIHA 3R3XA 4B84A 4MXDA 5CXXA 4OU4A 1R9MA 4UHBA 5K3DA 4H7HA 5AJHA 3I2GA 1Y7HA 4Y2QA 1CRLA 3R3WA 5HF6A 2WKWA 5LP1A 4C4XA 1G5FA 5AKXA 3M3DA 3K2IA 2W22A 1XRNA 4A16A 3GBSA 3O9MA 4JNCA 1XZJA 2HRQA 1H2XA 2DHEA 1UKBA 3G0GA 4PF1A 4U2DA 2GYWA 1P0IA 1GT6A 5AM0A 5EHZA 3R3ZA 3SC2A 1QIDA 1MAHA 1XROA 5FP0A 2D5LA 2PX6A 1MPXA 1MX9A 3FYTA 5H3HA 1HLGA 2OLEA 3WQHA 4AMYA 3G0DA 5AK4A 1TCAA 4H7DA 3UUFA 2XQJA 1P0PA 5K3EA 4Y2PA 1DWPA 5ALYA 4XJVA 3FLAA 4IO0A 4EUSA 3LIPA 3H1BA 1E8MA 1CUCA 3I2JA 5D7BA 4AQDA 2WJ6A 4PSCA 4DSAA 2VQ6A 2GYVA 1WB6A 3KDAA 3V48A 2BUCA 4CIBA 2OCKA 3ED1A 4IH1A 3LIIA 4J03A 4INZA 1DT3A 2GBFA 5C8ZA 3JW8A 4KRYA 2PUJA 5AOAA 2WJ4A 1ODCA 1CUYA 1WB4A 2XMCA 3WWOA 3H04A 2JGKA 3M83A 1E66A 1QTRA 3C8DA 1CVLA 1USWA 2WHQA 3KWFA 5BOVA 4RE5A 4X00A 1CUBA 4J0HA 4XVCA 2VAVA 4F5ZA 1XZAA 1CUWA 3O4GA 5CRIA 3WKDA 2XUGA 2C58A 2OCIA 3D2CA 4Y2SA 3AZQA 2HA6A 3HSSA 1Y37A 1XQVA 1P0QA 4Y2TA 4QNNA 3WK5A 1PJAA 4H7EA 3SX4A 3GROA 2RAUA 1JU4A 5AI6A 4BCBA 1UFOA 3WL5A 3G7NA 1QOZA 2GZRA 2BAGA 1EK1A 3V1NA 3STWA 3YASA 1JKMA 4A5SA 5ALVA 1K6EA 1CFJA 2XUIA 3WKEA 4EB0A 1DT5A 2WIGA 5ALGA 1ZIXA
chains in the Genus database with same CATH superfamily
3EEFA 4G07A 3F6PA 5T6BA 1H1TA 1XQWA 2NZ2A 3LP6A 1K27A 4KUEA 4LBZA 3WJ7A 3FSGA 3M9LA 4P84A 2I6SA 1TEHA 4ZVPA 3TZHA 1J0XO 2O06A 1C30A 5DGIA 3IDFA 5AO9A 2GD2A 2IT1A 3MD9A 2VHYA 2IPNA 1CQXA 4B2YA 1JQLB 4R9SA 5JS7A 1SQ6A 1DG9A 1KSFX 4EJMA 4WK4B 5K3BA 2GOYA 3IAHA 3JYPA 5AIBA 3B1VA 2CLSA 4PHGA 3O2JA 4OLHA 3UGKA 2BFEA 1M67A 2ZWPA 1FRFS 2W0MA 3CCCA 1KYQA 1WX1A 3OTHA 3OPMA 4U6NA 1G0NA 4U7HA 2ZI3A 5K6RA 4HCJA 1FNCA 4RJ2A 3PDIA 2QLFA 4B0PA 2QOEA 2W9XA 3B12A 1DXQA 4NNOA 4ZJPA 2Z6QA 2L2QA 1G3RA 4LWZA 2XNSA 3E6AA 3IO3A 3MGGA 1JHYA 5KWEA 3PDCA 3MK31 2YNMC 4ICIA 5LQCA 1W4LA 1MC8A 3FHLA 5KU1A 4GPZA 3U56A 3C85A 2QTBA 1Z0UA 2QY9A 1PE0A 2HTFA 2Y2UA 4ENTA 1LPMA 5I48A 5JYBA 1QZXA 3RNOA 3OURA 3GDWA 1DC8A 1GU1A 2RHRA 1B8UA 4KSBA 1LRJA 2YHUA 1DRJA 1ZMTA 1W4CA 3H42B 3KJIA 2MIIA 1YFJA 2TMGA 1LH0A 5IEBA 1HDRA 2ZWIA 3D7RA 3RYIB 1NPYA 2VWGA 3V4FA 4D8YA 2HT6A 2BTQA 4JOBA 4L02A 4RL6A 3PGA1 3FCOA 3BXEA 1ZA2A 4F86A 4CDNA 3H0EA 5FTLA 3IBFA 4KAAA 4M1ZA 1LXCA 3AHFA 3B5EA 4WLVA 1QBGA 5EKUA 3HHEA 4DIKA 2XCOA 4DUGD 3IPCA 4FP9A 5C8XA 2OECA 4RBNA 1DCKA 1VDMA 4XAQA 2E5LB 3COPA 1QYWA 3LCUA 2ODTX 1W44A 5CP8A 3NHAA 3QE0A 1O6FA 3KUKA 3IKTA 1L5YA 5EEHA 1UBMS 4J76A 1ORRA 4BGDA 2IYAA 4R8MA 3RG8A 4D7AA 2QA5A 2GZSA 3GEGA 3NBFA 5ULLA 4ECEA 1KMNA 3SY8A 2C4KA 2HV9A 5ERGB 3WGGA 1SC4A 1OU4A 1GYRA 1I4LD 1D8TA 2UAGA 3IMCA 5C7OO 1NN1A 1O5IA 3RAGA 1XEXA 3QJ5A 5K51A 4C0WA 3LUCA 3P71T 4UM5A 3K1YA 4LZLA 4EY6A 5B36A 1RQLA 1T0BA 2DCMA 5LQAA 1AQLA 5IJXA 3U7RA 2XOKA 1Z08A 3HRKA 3ZYZA 2X76A 4FB4A 1ZMOA 1BKSB 3OE5A 4JHLA 3A4NA 3F71A 2D4HA 4BQQA 3OG9A 3ONEA 2QU8A 1N6OA 4X6LA 5F4ZA 4JU8A 1DLJA 1I0IA 1MABA 4XE5A 5EUMA 3ZDXB 4D57A 2G07A 2I6XA 2ZS8A 2ASEA 2WEKA 3MTDA 1U28A 1ZU4A 3L8DA 2IFTA 1JFFA 4EG7A 1C1DA 3UXHA 2X0KA 5AOBA 2AQ8A 1B73A 1N6HA 1UBTS 1X7XA 2I4OA 1KSGA 4ARVA 2PX0A 2O9JA 5DO9A 1PGNA 3AFGA 3RBZA 3ZJUA 2YWFA 3FMPB 2CLDX 3JV7A 1G18A 4QHTA 4GXNA 4B6SA 1Z4PX 2QXYA 4ZQCB 2PO5A 3C1OA 3CF4G 1WSAA 3FOEC 4BVJA 3RKUA 1RXEA 2XVXA 3PQ8A 2K2WA 3QPWA 3W8DA 4N5DA 1ZBDA 2PANA 3EFHA 1XMPA 4MZXA 3CX6A 4BP1A 5F78A 1AB5A 3OQBA 2NTVA 3LQYA 3QUBA 2WPDD 4KFRA 1WHSB 1Y3BE 1A5ZA 2R8XA 2I66A 3LJKA 4XKJA 3L7OA 3K20A 3C8UA 4MQLA 3DT6A 4P4LA 4PW0A 1W0CA 4KOAA 4LHZA 3TSWA 3U3DA 2XB4A 3OLWA 3OT1B 1D4ZA 2IF0A 3V9PA 1ESZA 2Y1XA 5KNDH 2YWGA 3FJOA 2QY6A 4TS3A 4JVSB 5KYKA 1DE0A 3KYDB 1NIPA 3ONVA 3HDQA 4UM8B 4RZHA 4PPGA 5CB4A 2FPIB 2XZLA 4PINA 1SXQA 2C4VA 1XVLA 3WA6A 4KYTA 1LF0A 3AUYA 1YL6A 3RVSA 4LA4A 1YACA 2XGMA 2X40A 4MTCA 3TAUA 1EFTA 3A1FA 3K6SA 3E5NA 1C4KA 1NVVR 1O9BA 4MAFA 2CXHA 3NHSA 4J0FA 5JHGB 1QFMA 2VRCD 3OCUA 4O4HA 3PCTA 4IJQA 1DDIA 4ZMBA 4ZVQA 3WGZA 1DQSA 2O0KA 1HH4A 3HI6A 1A7JA 1VL5A 3VDQA 4HDAA 4WFJA 1PWXA 4HR7A 3SC4A 3C3DA 3E22B 1E1QD 4CMCA 3PXCX 2OYSA 4TYPA 4K9MA 1VMIA 1B00A 2Z2YA 4EHDA 1OT3A 4B3DA 1RWOA 3E03A 3D8UA 3Q2KA 4I9FA 4X24A 1ZL2A 2VHJA 4GPTA 5JNLA 4NAUA 3LF2A 1NN0A 2PWZA 1VXOA 2C54A 1J49A 2REQB 4HAZA 1Q0QA 4WQMA 1AC5A 3AEYA 4B5LA 1ZM7A 3ICVA 1FFCA 1UZAA 4EYQA 5GIPE 1SFRA 4EVIA 2JAPA 3MLAA 4KFTA 1K66A 4UFPA 2MTBA 1GGVA 2ZGVA 3M4ZA 3DLTA 1PV4A 1ORDA 4OLFA 2WU4A 1P9NA 4HB4A 4P32A 2E0IA 3RC8A 4BBAA 1Y0BA 4IMPA 1QG0A 2A9PA 1OFGA 4HRAA 4I19A 3EHEA 2QX6A 1NC1A 2QTVA 4DQ0A 1RXYA 4I50B 5KNDA 1V4VA 3FRJA 2DPXA 2WHEA 1NY6A 1PWYE 1QK4A 1F8UA 1KFCB 2H7YA 3IOMA 3G1WA 1F9AA 3O26A 4FHZA 3R40A 4IEIA 1H5NA 1GTL1 2VNJA 2WICA 1FRVA 3FLBA 3GAAA 4PG4A 1BD4A 1GTSA 3H2BA 4D3FA 3QEOA 1L4EA 1XZGA 3TZEA 3E58A 1PVDA 2AI1A 4EGFA 1Y6FA 2VPZA 5KOIA 3R8XA 1OF1A 4U5XA 2QHXA 4JITA 1F2TA 2ZIZA 4IQ4A 2Q4TA 5A2QA 5B6JA 3Q0TA 3TKAA 3HVJA 3A3KA 1G8MA 3NM5A 4RVCA 1YHNA 2Z8XA 2P4EA 4I9HA 2I4NA 4ZANA 5MN4A 3UKDA 2PBRA 3COJA 4UNRA 2PKQP 5EC8A 1Y1SA 3PR2B 2V9PA 3R7FA 4RTLA 3U4CA 3CUUA 3PVSA 4US1R 3HXLA 2Z6AA 2JBAB 2CL5A 1ZJ5A 3BFXA 4DXAA 4OHVA 3IEIA 3T1YB 3A3PA 1WHTB 2FGKA 5IC6A 1DEKA 1C1XA 2C7VA 1R6XA 3LFHA 2GN2A 1ONNA 2X5XA 2WP8J 4MO9A 1QS0A 4POOA 5KHLB 4BO7A 3D6AA 1JEAA 5EXSA 4NLLA 1ZGJA 2VDOB 5EERA 5BYBA 1TECE 1Q74A 4TXJA 3E5HA 2J5BA 1B93A 4K7JA 4LBYA 1T2DA 4DG8A 3HN7A 4BTVA 4NYJR 1PJQA 2C8JA 1ZD3A 3CINA 3OX2A 4UBLA 4UTZA 2ZYWX 1QE3A 2GJKA 3VPAA 4QFDA 2P2ZA 3KOOA 3RVBA 4GAEA 1GP2A 4GM0A 4H3HB 4ASUD 3GRPA 4LNUB 1KI2A 3G88A 4B3JA 1SM4A 3BG5A 2OZLA 4G37A 3TBHA 1AXRA 2H8GA 3I8XA 3V7UA 4PS0A 1LPOA 3BE5A 3HDYA 1DAMA 2RSLA 4HEJA 4URZR 4WXMA 4Z9FA 1W35A 2PSDA 1JBKA 3ZCXA 2UUPA 4G3XA 4PYOA 5DTIA 1W76A 3FOCA 4FHEA 1NOKA 3IAM1 1MO2A 3CG0A 1Y6QA 4GP6A 3CE9A 4MWOA 3DUWA 5AW5A 1M1YB 3T5MA 4PGHA 3TD2A 5TMPA 1JRLA 2BE7A 1TA4A 1L5KA 4YIHA 5EJGA 4L28A 3TNDA 2Q9AA 2BGRA 4C0KA 1SRQA 4MCJA 4S2EA 1S3IA 4EEKA 1V95A 1ZMRA 4LCJA 5F35A 4B43A 5K45A 4G0OA 4X91A 1JFTA 4IP0A 4J7XA 1WDMA 2AR0A 3R5TA 4FU0A 2XNDA 4KQFA 3NDBB 1TPZA 3DHEA 3IXQA 4LEIA 4UBMA 5KX5A 5FBLB 2PL9A 3ORQA 5J2UA 4OI2A 3STTA 2JH3A 3UJ8A 1O0SA 2IHKA 1YOVB 2JIPA 3KR1A 2BY4A 3LXUX 4WZAE 5L3ZA 4PYNA 3IL2A 1V1RB 2Q1XA 1KFKB 3A0UA 3AERB 1EUQA 4OM8A 2GN6A 3KR9A 1PK9A 4Q6WA 1F0NA 2XHZA 3EGEA 3KC2A 4OHFA 2PBFA 2PKYX 4GF5A 2EXXA 5K6AA 3BRQA 4NCAA 1U81A 1V41E 5AUQA 2DEUA 1FU7A 1CLUA 4GKBA 4MEBA 3PFFA 4BE7B 1G5TA 4O2AA 1VE9A 5D6NA 2VJLA 3WWPA 3EQ6A 2VUHB 1C8KA 1Y1RA 2XA2A 2QL6A 5SY6A 1PQPA 1V4BA 2E48A 4I4LA 3K0SA 3EIQA 3EIWA 3ZXUB 4INAA 2IXFA 2DTXA 3BFPA 1XTUA 3IERA 3LCCA 2PMBA 2G76A 4RGQA 5KYTA 1E4OA 4LSZA 4HRXA 2I62A 4R2MA 2R7NA 4FGWA 4XASA 2NPFA 3W6NA 2V5VA 1K8XB 3DC7A 2G3YA 1WXHA 3A2MA 1CS0A 4JBWA 1RYDA 5J2TB 4N41A 4XRRA 2V0GA 1KPIA 3D9QX 3IUYA 1D2GA 1BKYA 4Y0VA 4ZARA 2H1FA 2NTJA 2A0XA 3ZZMA 4L8FA 2RD2A 1EIWA 4TN1A 4DB2A 4JJZA 2IYUA 1L7RA 3O8QB 1V48A 3P9QA 5E3HA 1G59A 1XJWA 4DOMA 4KITB 4MLZA 1VCMA 1OI2A 3P96A 3QM1A 4YMWA 1NW6A 1Y33E 2KS6A 3OQNA 3QBJA 1LEHA 2HQRA 3D3NA 4MUFA 2CL0X 2X6RA 3PDJA 1FDRA 1V43A 4KQJA 1TAUA 2H0RA 3TF5A 3EEQA 2HPVA 1UPAA 4L4RA 2BJHA 3VR2A 2QVCA 1JT2A 3ZQJA 1LRLA 2ZTHA 3FA2A 3T7DA 4JB3A 1LZKA 3KEOA 1QQAA 2EQAA 1ES9A 2ZITA 2VZ8A 4DN6A 3BSWA 3DD1A 4MWSA 1YB2A 3INGA 3WRXA 2B69A 1DOAA 1WKCA 1IH8A 1W4BA 3D8HA 2NU8B 3QW2A 2J0VA 2X3YA 3IIKA 1XC7A 4GX5A 1FDVA 1H2YA 4PGGA 4F4JA 5FTNA 1XZNA 4Z0NA 2BBTA 5GONA 2PYDA 2AOVA 2D2FA 2ZRNA 1X1DA 4IIUA 4I50F 3K53A 5G53C 5E95A 2HGZA 3O0TA 3VHLB 3ON5A 5ES3A 1H5QA 1U0BB 5JWHA 3PCRB 2WLTA 4F1JA 3PNQA 2XXAA 3KJGA 1U7ZA 1GPDG 1VKOA 4EOGA 4LRSB 1NBME 5DCWA 2Q8QA 3DCNA 5HE9A 3MG9A 4N7JA 1UM9A 5EFOA 5DHFA 1XZPA 4WN9A 4MUAA 1USUA 2AOXA 3AJRA 3FKQA 2MT9A 3IODA 4IDQA 3RC3A 4XPIB 5HJ2A 4X66B 1Y8RA 4B7XA 2FFRA 1EVEA 2NAFA 3HJUA 5J5VA 1T9BA 5HCUA 4LE1A 1JMKC 3CLRD 2XUOA 3ZE9A 4Z4EA 3KHKA 4MW7A 1TT7A 1PR6A 5F77A 4BVAA 5IK2A 4DV0B 1FIUA 5F1KA 3EXFA 2XQVA 3FMIA 4DCTA 3THRA 1UDAA 1L4HA 4WOBA 5EP3A 2EAUA 2W2VA 4PX5A 3VKFA 2WB4A 3IPXA 5IH3A 1DIAA 2H2HA 2WZQA 3K5WA 4IDPA 1ATIA 2A6PA 2EU8A 2CFTA 5KCZA 3O4FA 1Q3TA 2ZZMA 4H35A 1S7GA 1E96A 3QKTA 4TRMA 1E1DA 3LQ2A 1ADYA 2X9QA 4M38A 2ZT7A 1Z06A 4ZXPA 5B3JA 4AZSA 2EEPA 1C9JA 3HY3A 3BUSA 3JPWA 2IJGX 1E0DA 2V1XA 4V03A 1AN9A 2PGJA 5IRCD 1P2TA 4U7TB 4Y0NA 4MUIA 3TTVA 4Q4LA 2J41A 3L7AA 4ZPJA 1LQ2A 2ZZNA 1P18A 4S0ZA 1XD9A 2A9KA 4MQ4A 5GPBA 4PZDA 3NHBA 4XVQA 2ZJBA 2V45A 1WXEA 4E7OA 5CNKA 1K3TA 4YJGB 3M4YA 3EEBA 3L0DA 1H42A 3MJEA 3U2QA 3GYBA 3WGTA 4MKHA 1OXXK 4QBFA 2W8ZA 4R8LA 5SZIA 5K0FA 1ATZA 3FVWA 2HJSA 1XZHA 2PMCA 1XF9A 3D1LA 4XM0A 4EM6A 4JCOA 3H16A 1TX4B 2FPXA 5J4YA 1XTPA 4WIAA 1HM5A 2G80A 3NXKA 3IYLW 2QJWA 4G1VA 4MVWA 1NNSA 3VZDA 1P7YA 4KWIA 1NGSA 5C1DA 1N2JA 1NSFA 2C5AA 1YL7A 1R16A 3GEHA 4C20A 4TT3D 4UBNA 4DNPA 5CEFA 5K0ZA 1W7AA 4HEQA 4YCJA 3T12A 4HUQA 3PI6A 3S40A 3TKLA 1BROA 1C41A 1QK3A 2YMPA 2ZVPX 1BE6A 4L16A 4NE2A 4IDFA 5SZJA 1IQ0A 1JTFA 1DJMA 3AIIA 2XDQA 3DLBA 3B5JA 3A1NA 3FUCA 1UWLA 6REQA 1GTRA 4D9KA 2B0JA 2F00A 3RRJA 1JKXA 2OY0A 3DO6A 1LZLA 4FKZA 2QM3A 3MWDA 4X97A 1WLSA 2ID9A 2OC9A 5DTEA 4CV3A 1VJ5A 1KZYC 1L5HB 4BNDB 4ERNA 2EJBA 4D9CA 2GPBA 1D1QA 4DGSA 3RU2A 1X86B 3JQ9C 1EVLA 3T4PA 4BEBA 5KJEA 3RG2A 2GEUA 4I4IA 4PZEA 3ITKA 3SEFA 1ZLXA 2P5YA 4QTYA 5DB4A 5EP4A 4XB6B 2WR8A 2HQSA 4LDZA 3LHSA 5D3MA 3WGLA 2CEKA 3FKJA 2W4QA 2O4CA 4ZU3A 2XCTB 4DNQA 3DTVB 3WC4A 1EM8B 1YE5A 2V3WA 3K8YA 3DZ8A 4RJJA 3E9NA 4B7UA 1X87A 3QHPA 1W0KA 4KX5A 4Q93A 5L7YA 4C21A 4WUVA 1R4NB 2ZJ7A 5IKOA 4MGKR 5K4HA 1FLVA 1VIDA 2ZYTX 2O8CA 2RCYA 2CT8A 3OFNA 3AIOA 1PDVA 3AUSA 1N2CE 2ZI9A 3UXMA 1E6EA 2LP4Y 4R6XA 2M1XA 2B8EA 4YALA 4ARZB 1IZ8A 3I6ZA 2YDYA 4QKQA 2Z2XA 2ONCA 2OCDA 3I4LA 3O31A 1CSEE 4UBJA 3CRNA 3VU9B 4IX9A 5HOEA 5J2TF 3C7KA 4JLVA 1EX1A 4IJUA 4WKCA 3HKCA 2ZVDA 1Q7BA 2ZRLA 4QYIB 3V1YA 3VR3D 6LDHA 1DTWA 2LV8A 1HLFA 4N0PA 3ZCPA 4LZJA 3W9UA 5AVTA 4HWTA 2AXNA 1MX1A 3GJSA 3K2BA 2C29D 4MR9B 2FSVA 1DCFA 3NTVA 3RFUA 2SKEA 4QYMA 3DV0A 4KRFA 3FWKA 2Q6KA 3FIJA 3PEVA 4U3JB 1Z7YA 2A5DA 2PIDA 2Q3CA 3VH1A 1IUNA 3SS8A 3W34A 3W0LB 1YDGA 2XQFA 4BCCA 5KYNA 1Z2PX 2LDXA 3H6KA 4WTOA 4LF6B 1SK8A 5J43A 4W5RA 4QTZA 2J8ZA 2QQ5A 4DCGA 1TUIA 1R6UA 3U9SA 4CG2A 4KVFA 1XTRA 2F8MA 4WXRA 2EKPA 1LA2A 1WVGA 2JGEA 3PFWO 3PI7A 1NSYA 3AI1A 2ZBUA 3KT8A 3EPLA 4MHTA 3OTIA 2GNOA 3K0AA 3QY0A 3WWEA 1S01A 4GQBA 2E85A 1W5SA 2C00A 2H1RA 3BTUA 4X94A 1CD5A 1SMKA 2G5GX 2XA1A 1ISGA 1OQAA 4BMXA 2IEZA 4HDKA 3CFYA 3QNWA 3UG6A 1TJNA 2ZM5A 4P22A 1T3SA 1ACLA 5H4HA 3UPTA 4HGQA 3RABA 3VUEA 2VH2A 4D3SA 1CZRA 1ZN9A 3S2FA 4TLMB 1AGYA 4F6CA 5JHHB 1Y7PA 1E3DA 4G8CA 3GPIA 1P77A 2B4YA 3WYDA 2LBPA 1EESA 1JE1A 5B7QA 1BDMA 1YDWA 4PV7A 3TQTA 1JHZA 4LJ6A 3ZE2B 1G4UR 2E49A 3C74A 1SKYE 4IZ6A 1YZUA 1YCGA 3DWFA 3MAAC 2PNJA 4NZOA 3ZDZB 4MW1A 4KE6A 3NBUA 4Q47A 1JDVA 1E77A 1K7CA 2J4DA 4WJKB 3KWJA 2XTNA 4K9NA 5DNVA 2P7HA 1SOMA 3LX8A 5HKKA 1L3CA 4FMPA 4H3KB 1AKUA 1GZ6A 3FNQA 3ILHA 4IUDS 4N1AA 3ANLA 4UMEA 4LRQA 1QRAA 2H2IA 5ALFA 3CUVA 3CX4A 1M8GA 3WKCA 1WQ3A 4RPIA 4P36A 2FN9A 1BZYA 3GGCA 4ZPXA 4KXFB 4D0NA 4WECA 3T5DA 1XNQB 4B3TB 2PMDA 3IQGX 4EA6A 1X38A 1E6MA 3K1AB 1SBQA 4KAXA 4YQEA 4ZOEA 3KUXA 4LYGA 1Q0ZA 4E31A 1W1IA 4XCXA 1RAAA 3EF1A 3G2LA 3OZ7A 4G0YA 1P2UA 1ZSNA 2IE0A 2R6FA 5ALWA 5THXA 5C4GB 4IDDA 2IXDA 3RFFA 2AHRA 4E2WA 5FEUA 2EGUA 3DVAA 3L8YA 2RIPA 2VKQA 4TQ9A 3EXEA 2PDAA 2B35A 2VR1A 1VSBA 2YXPX 3DV2A 4HGNA 1VJ1A 3T3EA 1YULA 1F2DA 1PW7A 4C3UA 4P4SB 2BLLA 3TX6A 4FFNA 4C2AA 4C22A 2BFDA 1CY8A 2PKQO 4B1FA 5JAOA 5JZSA 1AMNA 4CEHA 4JV5B 1TVCA 2YY6A 3LHKA 1NASA 1ND6A 1ISRA 1XDUA 1SC1A 4Y98A 5KUTA 4CLRB 4D92A 1OV6A 4LJ9A 5I7HA 2V8OA 1W581 2QAGC 4LXIA 4GXQA 5I8WA 1JYFA 4BV8A 1OWNA 3HMQA 1Z6ZA 4CN9A 1P0CA 2VCYA 2A7XA 2W93A 4HDRB 4JR0A 2Q1YA 5F5XA 3TBFA 5I7AA 4ABYA 3OPYA 3AFNA 1T6BY 2A1UA 2CHEA 2NYRA 5KSZA 1T3ZA 4IGAA 2WK1A 1ABBA 2PRJA 4LHWA 2DQZA 1OWOA 3GRUA 2PZ8A 2AX4A 5H7XA 4WBSA 3VOTA 2DKOA 4BCDA 2HY7A 2QUBA 1YU9A 3IVRA 4PONA 4D8XA 4UOZA 3CH4B 1U2EA 4PR3A 3VTZA 4K9OA 2IK8A 4O5AA 5KJ1A 2IGTA 1KI4A 2E4XA 3U13A 4D02A 4FHDA 3Q4GA 2EYQA 1KAHA 2BT4A 2CVQA 3FTDA 1Z83A 2DHRA 4FE3A 4KR7A 3FFXA 3QYAA 3RFXA 2GYUA 3U44B 3F6YA 3G8DA 4R1MA 3GJQA 1XRJA 4DUGA 1A82A 1Q1AA 3U9LA 4ZZ0A 2GNPA 3BK7A 3F9CA 4R7TA 1OH7A 4CKEA 3GD7A 5JR3A 3O8BA 1J20A 4DLXA 4J0CA 2GWHA 3GLGE 5E9JA 4DYHA 4NP6A 1FP4B 1R6TA 5GOTA 4CODB 1ZMXA 3UWKA 3L93A 2WVJA 2AGVA 3R3VA 1YZHA 4RMJA 2PGLA 5ALLA 1ETUA 3W4JA 2X9VA 4KZKA 4B9EA 4O0LA 5GTDA 1HE3A 2OENG 3GFRA 4HSGA 1BD3A 4KPUB 4YFVA 5TARA 3L84A 4AJOA 4XTRA 4JHXA 5TT1A 1FMJA 3H9BA 4BNKA 1OXKB 2E9SA 2GR9A 1NW7A 2WD9A 4D43A 5LYJF 3CRZA 1QDEA 1YJCA 2FFHA 4AULA 1V6AA 4A15A 1FSGA 3QOYA 4Q4AA 4MKZA 5CNMA 5KVQA 1AO3A 1WB5A 5ESDA 4CEJB 4K6CA 4R40A 1FVXA 3ASZA 3AHCA 3LUFA 1NHGA 2QP4A 3M5WA 1O95C 2JFGA 2JF0A 3JQQA 2WJYA 1JNYA 4M7RA 3VV2A 5LP6A 4MI9A 1ZRNA 2W6ID 2A5GA 4D98A 1EHCA 1WZUA 1FUKA 4ZAGA 4BZZA 1KO5A 2QLTA 4MQ6A 4WK6A 1U2DC 5FNVB 4JJAA 1NJ1A 4B09A 3LWDA 1T3TA 1CYEA 4B71A 1FYFA 1TVMA 4MGZR 4RYLA 1TK3A 1CR2A 1I2BA 1BXKA 2IV3A 1R9NA 2QRHA 3JWGA 1Z0JA 3ZKWB 1NM5A 4N5NA 4BNXA 4PXYA 4UEJA 1ZA1A 4KQKA 4RHFA 4B73A 1BFKA 4AQYB 3B1JA 3TK1A 2QPAA 4FNGA 4FYIA 3AUTA 4D4KA 2ZB3A 2H5EA 1E0SA 1JKIA 3IULA 2CXSA 4ITRC 3JQBC 1DDGA 3O2SB 2X8LA 1YDFA 4GG1A 1Z3IX 1OI3A 5EKSA 5AW8A 4LKRA 2OLKA 5KOHA 4EA9A 2B9EA 2JHFA 3I12A 3IUSA 4US2R 4KO4S 4MR7A 2WPDA 5K0JA 4KWCA 2I5PO 1JP7A 5K0NA 4DABA 2UV8A 2QN2A 2CHFA 2EZ9A 3Q9UA 5LQNA 3BK1A 1R8XA 1GXSB 3BXFA 5T5QA 3MTAA 5HXAA 4OLBA 3ZXYA 5B2ZA 5IHXA 2PV0A 3SC3A 3MWEA 5FH9A 1TYEB 1WXGA 2CVFA 1ESEA 1QCDA 2BDTA 4PY2A 1YL5A 3W8RA 3ZU6A 3VHRA 1VYVA 2E3JA 3EJWA 2ANCA 3WHPA 3OPYI 2WNSA 3ODPA 3ZHTA 4PLHA 2CJPA 1TU0A 3PV0A 5C9ZA 3N8HA 4XJSA 1C7JA 4EP1A 2Z1NA 3MUEA 2GT1A 3VVLA 4EMTA 2ZSDA 4GLJA 3HJAA 1SC9A 1R4MB 1MVLA 2VRCA 4D44A 2XIQA 3SJUA 1QP7A 1CJSA 4TTQA 5JECA 2W2XA 2X0EA 1GLNA 3HJGA 1BEZA 3IKMB 4DPLA 1ZSVA 3DAPA 1RKXA 2PL1A 1E1QA 3M5DA 2MINA 4MVJP 5ESWA 2Q7OE 2HB6A 2Q4EA 1IEWA 1QHSA 5C8YF 3PC7A 1T10A 1QQ6A 4M22A 5ADHA 2JLVA 2QTNA 3AV3A 2G4LA 2FP4B 3TTSA 4LNHA 4RGVA 4HNTA 5ANRB 3O93A 2UZAA 4NESA 5CT6A 1AHIA 2FSGA 2J3EA 1C0IA 1CS4C 4DS3A 4R7GA 2F3SA 5AOCA 4EPWA 1VL2A 4Q7LA 2FRXA 3U17A 4UHFA 5A02A 3B9RA 1FQKA 5CIYA 2O8DB 3UJ3X 1YDEA 1U3WA 3KQSA 4YMHA 4HH3C 2EFDB 2G04A 1EMDA 2A33A 2VF2A 1AKMA 3QF4A 2O19A 1Z88A 1T2VA 4XFJA 4F9GA 3L7LA 4OOFA 1UFKA 3SFVA 3OZGA 2FZCA 5DP2A 4DC1A 4BUZA 3WY9A 4NBNA 1LI5A 1R12A 2X8BA 4XTCS 1MW8X 5LWQA 1A98A 2P6UA 4IPTA 3F4LA 1MAWA 1C7FA 1ZW6A 5AK3A 4BHTA 2C1ZA 2C96A 2V96A 1YI0A 3N2GA 3QKIA 4GSYA 1E2LA 4KH0A 2W43A 4D4HA 1W0JD 4IJ5A 1YE8A 1E9FA 2UZ3A 4GOMD 1QK5A 3W2GA 1P1JA 3HR7A 4F5EA 1K8QA 3BIXA 4H0NA 3OJOA 2J6BA 4ZCSA 2CCGA 1ABFA 3G9TA 3HMKA 3PWZA 4BYGA 3A4MA 3H2JA 3T4EA 3AO0B 1AKTA 3CGWA 4QULA 1M34A 3V2GA 4DUPA 1T4BA 1VPTA 2JFXA 3STXA 2HLNA 3T38A 4EI7A 4YV1A 1FY2A 2WV7A 4ENRA 3EZ2A 3OESA 2ACEA 4YRAA 3KYCB 4MPRA 2JFWA 5BMVA 3U3XA 3ADDA 1K2VN 1V2GA 3PXEA 4OI4A 4MUJA 1PJ8A 1ZICA 2MJLA 3H5TA 1SG6A 2GMWA 3FDJA 1M83A 5AD1A 2Z2KA 3RRMA 1KZ9A 4BC0A 4JB8A 2BZSA 1DXYA 3BIWA 4PLVA 3SX2A 1R00A 3H3FA 3Q3HA 4LE2A 1CDEA 5FR2A 1YVPA 3GLFE 1YGYA 3SZRA 1S2IA 2O2CA 4OQFA 2HHHB 2F3PA 2ZBDA 2NU9B 3ELYA 4PYMA 4A2QA 3VUFA 4CUZA 1KEEA 1B3BA 4AJLA 1P1RA 2I6QA 3CH5A 1OFHA 4PZ9A 3UOWA 1ISIA 1XZDA 2BGTA 3BJMA 3BWVA 1AQYA 2EERA 3HDVA 1NVMB 1QGYA 4P53A 1L5RA 1QZZA 3TMYA 3V7WA 4PTZA 1I2AA 2Q9BA 1XEFA 2BFFA 4K6GA 2AFVA 2XV1A 4DIUA 1X2BA 3Q8KA 1AUQA 1S4QA 1U0JA 1M8PA 3HWWA 4MJ3A 4POAA 1XEXB 3OC0A 3DDNA 3EOAI 5K8LA 4ASUA 3V8VA 1UC8A 4NWIA 4Q0MA 3MSXA 4JP1A 2GLUA 4WESA 3R75A 1T1GA 1KOGA 3DSRA 4OQXA 1DWOA 1RJGA 2VIIA 4MVJD 4MB0A 3OEHD 4IWYA 5E8JA 3D4OA 2Y1CA 3C7CB 3NIFB 1GUAA 2AJLI 4IH9A 5EZ6B 5IVDA 2PEYA 3UGQA 1CZOA 1OGIA 2W6JD 4HNGA 1JFFB 1GPBA 1C1DB 1E2FA 4E12A 5SZKB 1LJLA 4B3SB 4Y2UA 2H0QA 4JCCA 2WKQA 1X7XB 5D5PA 1J99A 1SD5A 2WHRA 3RU9A 3ZIDA 2J5XA 1UBNA 5BSFA 1U8EA 5I45A 4P35A 2VP5A 2HADA 3DOHA 2FFQA 5AH0A 1EXMA 5FNVF 3Q7PA 3BWEA 3O1JC 3H9JA 1TT5A 2XMZA 1SN7A 4D41A 1A8IA 4JUDX 1ZJJA 4GGOA 4O2LA 4PZPA 4I6JA 1IAVA 1P4AA 1UFVA 3PQ6A 1G38A 1UCFA 1IQPA 3DOCA 3K9BA 4UU1A 2C3OA 4XVHA 3AGPA 1RYNA 4HB0A 4MRVA 3UAYA 2ZIUB 2WKSA 2H5IA 2XMGA 3P0FA 3PF8A 1ORHA 1HL7A 2GJSA 2JRCA 4EDHA 3KQKA 3L8HA 5JMTA 2OORA 3R4VA 1HT2E 2XUZA 3VJLA 3F6CA 2YWXA 3AVTA 2XBLA 4U5QA 2HW8A 5FOXA 3FPFA 1N2HA 3BRSA 1ZUHA 3NX4A 4FR2A 1VG0B 2O0LA 3QWFA 4KWTA 2NZVG 3FCYA 1DJPA 1JEDA 2RHDA 1VE7A 3N8IA 1R66A 4G9BA 3ZNPA 2XNJA 3IP9A 3F7TA 4AYXA 4BBJA 3OZVA 4IO1A 1RI5A 1EVJA 1KJ9A 1PYOA 2HCJB 3EF3A 1Y6RA 1OHHD 2VYFA 4JLWA 1ZLYA 3DVRX 3HUTA 2P35A 3FCXA 3H9CA 1HSOA 3UPUA 4QU8A 2Z8ZA 2WSIA 4HQ6A 4Q9IA 3BSYA 3UK6A 3UHOA 4FFBB 5K0TA 4RA9A 1BSVA 2YRXA 1C7IA 4RW0A 3K6SB 2VDUE 1XVAA 2FWJA 3LPNA 2XLBA 2O6LA 3SF8B 2YL2A 4C1BA 4BQOA 2YHAA 4OJTA 4PNEA 3UAVA 5FJIA 1CY4A 5HQ3A 3NJRA 4D9GA 1V8BA 1PR9A 1WL8A 3A4LA 2XT6A 4X60A 1DGQA 4IV0A 3DE1X 2QTAA 2QYOA 3PG5A 1PFKA 4KQMA 4M0CA 3PC8C 2IV7A 5GIOE 2EZ4A 1ZG3A 2N46A 4KX3A 3NRCA 4D4IA 2F43B 2VZ0A 1JJIA 3BPSA 3I05A 3PT5A 2QEQA 2XYRA 1YZYA 4P31A 2JI6A 2KBFA 3RWOA 3M3HA 3DPIA 4CIYA 3AF3A 2XE4A 1IUOA 1T2EA 4H3SA 1EBBA 2JJMA 3TOSA 2ZRFA 2AE2A 3PXBA 2LD4A 3SKXA 4HQKA 3STHA 9ABPA 3D6VA 3IBGA 5D1HA 3SIWA 5KMGA 2FN7A 1BDIA 3A4IA 3WAGA 1N6KA 3GLQA 2F1IA 2IYWA 2RCNA 4KQCA 2VATA 1RPZA 4EF6A 1M0EA 1YASA 2ORYA 4QXPA 2WUDA 3U3JA 1O54A 2O1SA 3JASA 3QE4A 2ECFA 2IPOA 2EX0A 1AGRA 4IQGA 1GR1A 4LTMA 1KDPA 2JAHA 3PX3A 4NDAA 4UUPA 4YT5A 3S0JA 4C76A 4CQMD 3A1TA 1TL7C 1JSLA 1P2DA 3N5KA 2XVZA 1O6BA 1MMFB 3GBPA 3PNMA 4XGRA 5AI0A 4ZYTA 1PJSA 4PNZA 5D5QA 4M6WA 3RM3A 1SU4A 4C04A 5C80A 3CMCO 4OAQA 3K30A 3R7BA 4MLPA 4P98A 3CVWA 3NQ41 3AOEC 4KIWA 2I8LA 2WUVA 2PGAA 1E3SA 2FU5C 1XHLA 3OLYA 4LVCA 5TGZA 1FOEB 3DFKA 4JI0B 2V6FA 3ZZNA 5TQVA 4CM3A 1I6KA 3QYPA 5LQJA 4HWPA 1GPNA 4KWEA 3X2SA 3O75A 1GVHA 4EJSA 1JB1A 3EC7A 3R74A 4BNHA 5C52B 1UWKA 1NW5A 5HSGA 1G6OA 2PQMA 1J8MF 1UH5A 3CNLA 5EUBA 4JXKA 5A62A 2P9YA 1RTTA 3H6GA 1ZUD1 3IAS1 5DYIA 4DMHA 1RI2A 2K2QB 3T5PA 1ADBA 1Z12A 2D4AA 4RZQA 3IXMA 4TL8A 5DCYA 1FE8A 5P8WA 1OW3B 4QFBA 3JVIA 2X9GA 1YTLA 4BTLA 4DRZA 3AUAA 2UZ1A 5FIUA 4PQEA 1C14A 1SBHA 4ZGWA 2GKSA 1CY2A 1QS0B 2NQ2C 1FFWA 4YRNA 2XEXA 1JDTA 2IOFA 2UDPA 3NW9A 3G2IA 3WLAA 1Y1PA 1UMBA 4AP9A 2QS9A 4N0QA 1D2HA 5JJ5A 2SBTA 3AF4A 4H1VA 2GDZA 1US8A 1AM4D 4IFTA 2FZ4A 2PAFA 1NWCA 2C2BA 5LQMA 1BGXT 2FW8A 5G3YA 5FUWA 4MUEA 3MWGA 1NIJA 2JIRA 4Q7QA 1ZR4A 1J70A 1DMRA 1KYYA 2NLOA 3WNBA 1Q0TA 4KPGA 2P6RA 2BELA 2C2GA 4M0FA 4BN4A 5J4LA 4U8GA 1K5PA 3HXPA 1KI1A 2B3DA 1YJ5A 2CJFA 2ZUDA 4FD3A 3RGGA 1SHZA 3N8DA 2YTZA 2C9ZA 3R5KA 2XH8A 4LOLA 2BGJA 2AVDA 4XVUA 2BMDA 5IDWA 1KO8A 1ZNXA 3K35A 4MW5A 2Q1UA 1NV9A 1WUKS 4MKXA 2GD0A 3BOSA 1IULA 2I71A 3D43A 5EIEA 2YS7A 1FXSA 3JZDA 2CHUA 2XYHA 3KT0A 4GM1A 4KQHA 4PLYA 2OBLA 1A9SA 2OA0A 2FFJA 2VJBA 3CT4A 4BEVA 2EW8A 3ELDA 2H06A 3EOZA 4DQUA 3OICA 4UD6A 3E9CA 4TT3A 4UJ3A 4X20A 3LDFA 1X39A 3S27A 1QOQB 2YQ4A 1UJ5A 3ZHVA 1QCCA 4J0KA 3ZUPA 1A2KC 2JFYA 3D5EA 1SQ5A 3PQ2A 1C8VB 3WGMA 4PN3A 4BY9E 5J2UB 3L01A 1F8GA 2J48A 1MC4A 1FP6A 3M70A 3R41A 2F1KA 4LK3A 1Z6TA 4XLTA 5FEMA 5FWYB 4BQEA 2I9KA 3Q3EA 3OZDA 5HM8A 3WV4A 1FRQA 1TO2E 4HZUA 4LZWA 1FEZA 2YW2A 4YMGA 1DEXA 3PUIA 1DWQA 4Q6BA 1G9XA 1NUPA 1F3LA 2G1UA 2X1LA 2NU7A 4KIUA 4UUAA 1O4VA 4I3GA 2JLQA 3TX2A 1L5NA 5AVUA 4A8JB 3P0RA 4TX1A 3UKJA 2PGIA 1V7PC 1WCV1 1ZITA 2HK6A 2QVYX 4ZC8A 2WU0A 5LIPA 2QTWB 5M34A 5ALPA 5IANA 1C0LA 4XYGA 2HU2A 2Z8YM 1CUXA 1HDOA 3AH8A 1VL8A 3N8GA 2I03A 4QJIA 5B1HA 2GXUA 4Y6LA 5IN5A 2C8LA 3R0VA 2OE2A 4L3VA 5LQUA 3EODA 3PR3A 5JO0A 2V3CC 3AHDA 3I9V6 4MGYR 1NMYA 2HA0A 2IYVA 4JK3A 4B8WA 1TKRA 4L8GA 4BO8A 4FHCA 3TR5A 4XH9B 2FE1A 4LY3A 4PQFA 3ZW8A 5CB4F 1A72A 3F96A 4QO8A 5F3DA 3VZRA 3K70D 4ROTA 1NLFA 3A28A 3TLCA 3GUYA 4NDNE 3HV2A 4X6UA 1GPJA 3HZOA 5DNUA 2DWPA 1KK1A 1UFQA 2CFOA 3BJZA 1UZMA 3UWMA 1GDTA 2GCPA 5A9TA 3X2FA 3T5TA 5JQWA 3LCJA 1A5BB 4R5HA 4ZI7B 2JFHA 1PTJC 1E9CA 1XMXA 3MBOA 3MWKA 2IC5A 4O4HF 4Z9AA 2I8AA 3VR3A 3K8ZA 3GH1A 4XLLA 3T1HB 3DOEA 4Y2JA 2BDUA 1GIAA 1T3HA 1KI6A 4AJIA 4FGJA 4H31A 3NJ8A 3L40A 4HLQB 4CMKA 2AOTA 2VDWA 2FGJA 2VXOA 4ZGBA 1O77A 4H6XA 1QRUA 4D9BA 2XCIA 2P3LA 1K88A 1SG9A 1GDHA 1GG5A 1XLUA 1ULHA 3AVPA 4FMDB 5CA0B 3WFJA 1IL0A 1P2SA 1OLSB 3W79A 4E3WA 5JRZA 3EPHA 4HGRA 3G8BA 1DIGA 4EY8A 5DSZA 2DWQA 1YB7A 1OTYA 1XDDA 2MHCA 2KM1A 3DPUA 4JB0A 1BVRA 1YQXA 2QAIA 3FCAA 2I1WA 2JHAA 4DR3B 4IIXA 2BSAA 3V8NA 1TUBB 4GUAA 1K9SA 4N9WA 3BTOA 3P2YA 4AZ3A 3ZY5A 3AJ8A 1V8OA 1W4AA 4LV5B 1X7ZA 2H48A 4G97A 5GONB 1WRBA 3NBZC 2LGJA 1FUYB 3BICA 3D8BA 4GPBA 3NDRA 1EDDA 2PT5A 3GUZA 2DBQA 4UTPA 5JH7A 1XXHE 1BTOA 3BDIA 2FNAA 2B8WA 2XRMA 2PRSA 3LRPA 3HKEB 4P86A 1O2DA 3N05A 2IOHA 2DFTA 2Y77A 3C1TA 2J0EA 2VDJA 4KDEA 2EJUA 4NEGA 4QOGA 3I9MA 1OXBB 1ORTA 3FUWA 5CVUA 3NZEA 4IAOA 3KYJB 2G9RA 4H1TA 2FEWB 1MQSA 3IMKA 3PITA 2YCBA 1P4HA 4WN9B 1RRKA 1Z2AA 1QB7A 5IF9A 5FPPA 5LDGA 4ZZ2A 2RK6A 1O6ZA 1N0VC 1UJNA 5F21A 1A5SB 3OZWA 4N82A 3M33A 4BVKA 4MWTA 1H1LB 3L4BA 4HJXA 3JD3A 5DSXA 1E7SA 4H1HA 3D8SA 1C7EA 5EPUA 5LWHA 3GP5A 3WB9A 4O4LA 2YHIA 4IIFA 5CTAA 3ER9A 2ZIFA 4ZVNA 4JQOA 4COKA 3TLGA 2B30A 3VZBA 3AEQA 3LW8A 1T43A 1EIZA 5DRYA 1EB8A 1MD9A 4IILA 1U7WA 2HRZA 5B3KA 3K9FC 1Z47A 3A37A 3KKPA 3FOAA 2P6OA 5I9MA 3UK0A 4DCPA 1JW9B 4OYRA 1H22A 1XQ9A 2OOSA 4B17A 4XD7D 1VGRA 3WLLA 4FDTA 2FN4A 1I2ZA 5EOVA 4G0NA 3D2BA 4RTOA 2ZPAA 4GBMA 2ZVJA 3NHRA 3NH9A 4MUHA 3T54A 1KYTA 1V37A 5BSTA 2J7KA 3SZLA 2Y0EA 1A2BA 3B1WA 1SCDA 4CMJA 3E70C 5JS8A 2E89A 1IBRA 3JQCA 3DBRA 3TDMA 1IG0A 1V9LA 1KH3A 3KZVA 3Q7EA 3ZWMA 4OUKX 3UWSA 1TFUA 5JAUA 1T15A 2C04A 4I2NA 4IKEA 3HXTA 4OYYA 3KXIA 3A27A 3HA5A 4QZVA 4GDFA 4A36A 1O4WA 2B61A 2PX4A 3V42A 1T5OA 3M4JA 5GINE 4Y9RA 4OTZA 3OLZA 5JROA 1IQRA 1FTNA 2YN0A 4EI8A 3KQUA 4WLFA 3ISVA 1MOSA 3IVGA 3UAXA 4GWGA 3DE4X 1D04A 2HPHA 1FFYA 16PKA 2VNIA 2Y1FA 4F04A 1Z45A 1T34A 1BJTA 1AUVA 5LLDA 1Z0ZA 4LF9B 1U90A 1ZISA 4Y9DA 4H1UA 2O1WA 5YASA 3CNHA 1OAKA 3C5EA 4YT4A 5JBIA 5KX5F 1SCBA 1NJ6A 1TZKA 5J2UF 3OD5A 2LW7A 4Y1RB 1L4GA 5HZGA 2YH2A 1AK1A 3D7NA 3ORFA 3Q2IA 2B4AA 1SEVA 1LDBA 3C70A 1PT5A 3GZJA 3ETLA 1O9HA 1ZWLA 3G0HA 1VKZA 2IY9A 4BGIA 4HB2A 1C0EA 3AM1A 5HIAA 3KLOA 1MHTA 3P9ZA 1MJ5A 1ZI6A 4B35A 3RUFA 4GO1A 1AUOA 4AB1A 4JX8A 2Q3MA 2WDPA 2HF2A 1UFRA 3PPIA 4O2AF 3RVQA 2GPTA 3ZY6A 5J4HA 1ECJA 3PFCA 4HPWA 2BMJA 4Z4HA 2XT9A 1IMOA 2O8CB 1ZI8A 2J08A 1CDOA 4LXQA 2IZZA 3VM6A 2PSJA 1Q83A 3KAPA 1YVRA 4LJRA 3LW7A 4AROA 4K0KB 3QUAA 4N40A 5ALRA 2I1LA 2TS1A 4EENA 4F60A 2JCXA 3D4LA 4Z5XA 2BFPA 3LSTA 1YCDA 1RWKA 4KXUA 5CLGA 2WM3A 1OWLA 1HRKA 2VJMB 3HEAA 1N0WA 1R3UA 5EIOA 4LV6A 5JANA 4BX8A 4D9HA 4P58A 1ZL0A 4YGXB 5T67A 4US0R 2AK3A 2NVOA 5BWOA 3AUUA 4CF5A 2IOQA 2XUAA 3HKCB 1DKNA 2AZXA 2WT9A 3GW8A 4KR6A 4E09A 1DTWB 1H9CA 1A8HA 1P7PA 4EY3A 1E3QA 1N75A 1W5BA 3T3DA 5HYVA 3E4CA 2GZAA 4ITUA 4KE7A 2VS1A 4RK1A 4QG3A 5DHRA 3VSCA 3DV0B 3MTGA 4GEGA 2JIZA 5IXSA 4MITA 4FR5A 5IAAA 3HCOA 3PGLA 3ENVA 2R1TA 3WGJA 4J91A 4OBEA 4ENQA 5IT9A 1EFHA 1NF2A 3LDGA 5M7EA 3OCYA 1J2EA 2IEIA 1ORWA 1KIMA 1LWOA 1DBPA 4FDVA 2WWVD 3Q9LA 2W6IA 4O6VA 2WP0A 1I1HA 1TLTA 3FBGA 3B52X 2WIKA 3MT0A 2AN5A 4IKPA 1J1UA 4OA5A 2C7RA 3G2MA 3K0AB 5IKMA 4W7SA 1A3CA 3CHYA 3DEIA 3R0QA 3WL8A 4ZCLA 2VJCA 1Z16A 4PCLA 3EA0A 4HDKB 5FUBA 3ZTYA 3GZ4A 1JTEA 2PBLA 2ZYGA 1NXXA 3TH5A 3MN1A 3GLIB 4M7WA 2X23A 3CYFA 4KQEA 2C99A 5GONF 4HNSA 3P2IA 4AUMA 5JWOA 5IEJA 4ZVLA 5EJ6A 4UDYX 3ICEA 2H59A 4ZT4A 4NG5A 1JEEA 3GVPA 3PXGA 3SDSA 4QDJA 3VYSB 2XJ9A 4U2EA 1B0PA 3DXYA 4QUGA 1N36B 3T9CA 1M6WA 2C5GA 3UUEA 4BRUA 3PA6A 1OZGA 3BFVA 3DM5A 2FPGB 5FI1B 5G0SA 3DOOA 5BWBA 1G3IA 2HLPA 4RNCA 1MJFA 4OQMA 4CMAA 1VP3A 8GPBA 2VSQA 3PF9A 4BO6A 3BZUA 2PWBA 1KJZA 4XQEA 2P3QA 3OIUA 4IJVA 1Z13A 5FOVA 5HDQA 4UDNA 3C8MA 3EYAA 4UNQA 4Y2XA 3F2IA 5CXQA 1J09A 4L9RA 1T6XA 2ODBA 2YZMA 4C0QC 4NV3A 1TJ4A 3U0BA 1ZK1A 5K0GA 2Q3LA 1T2UA 4TL6A 2ZRQA 1Z25A 3N7AA 4JUIA 1DIRA 3GVHA 4OHZA 4KL8S 2V74B 5CD9A 3ZY3A 2CNNA 1NFQA 4N6NA 5FV4A 2GWRA 2RGXA 1W48A 4Q7JB 3NUGA 4IQ0A 2JLBA 2WJHA 5G3ZA 3RWBA 3T5CA 1XOIA 3V4VB 4C88A 3WK4A 5KEIA 2XECA 1AT1A 3DVAB 3OX3A 2OYRA 1CY1A 1KFBB 1XCGB 4RHCA 1W36C 3GJ6A 2I7VA 2JRLA 4JBIA 3OVMA 1PEKE 3CTPA 1KAMA 1N5MA 4D4GA 4DWWA 1Q0RA 4AIRA 2BFDB 3CF6R 4TUYA 4GH5A 2A4MA 4B4OA 3TQHA 1U3UA 1Z6AA 4KGXA 3EC1A 3SVTA 4DQKA 4KXWA 4CNBA 2HF8A 4EBFA 3WLJA 4HGYA 4K87A 3WWCA 2RH5A 1Z0SA 4FOLA 2EFJA 3OQMA 1JYSA 1VGQA 3BD9A 1UMDA 3ZE1B 1GFSA 3CLUC 3LPMA 1ZD9A 5THKA 3KDPA 4QPPA 3SM9A 2WAAA 4NXMB 5FTMA 1E2NA 2AF3C 3WP1B 1IE3A 3P2EA 2DTEA 2A1UB 3FPHA 2BHTA 4F4DA 1BVHA 1XPRA 1PJTA 1A69A 3GLKA 3KD2A 2RGNC 3WWDA 1CNMA 1Q0HA 3IUEA 1NF8A 1R18A 1HNXB 1S8NA 2JC3A 1PT8A 1W0JA 1C0KA 3EIUA 5FA8A 4NOKA 2D3TA 3IV9A 1C2YA 4MVJH 1QTQA 1VSVA 1RDFA 1AHNA 1T1JA 3MXOA 4Q1BA 5KTTA 4H6WA 4W7IA 3TQRA 2VH1A 3B6JA 4NH0A 4NBSA 3GAZA 4O08A 4WX2B 1UMCA 5IUJC 5DISB 3UFXA 4S1WA 2OBNA 1ZBQA 4CV1A 5B5SA 3E82A 4LDPA 5DHAA 1GZDA 1XLTC 1NBMD 3UJ7A 3F9IA 4GZ6A 4Q48A 5ALZA 1M2NA 1YS9A 1UBGA 3MAGA 4IR7A 1U4OA 1CY7A 1V39A 2DUUA 1QF9A 2Y1EA 2RHLA 3FMGA 1YQQA 1K75A 1IZYA 3L8CA 4GZ5A 4IFIA 1J25A 5LZ5A 3VR6D 3RE1A 3X1ZA 5A03A 2ONYA 4L8WB 5K1ZA 5F51A 1U7DA 2BGNA 1BEUB 2Y71A 4QXQA 3AJDA 3EQ8A 4RFSA 4MQMA 5DGXA 1TTTA 2ID4A 4Q4CA 1VIMA 3OCCA 1MCZA 4PWYA 3JD0A 7MHTA 5IBRA 3HVIA 1A4XA 3O6VA 2GPSA 3RVKA 2P4SA 4D4MA 4YRIA 3DM9B 2ZRAA 2DQ4A 3AVQA 3PVZA 2CYCA 4A1FA 2JVKA 2MYUA 3IOCA 3EOBI 4O29A 5HS4A 5JMWA 3UJ9A 4XB2A 3BSSA 3WJ1A 1KU6A 2HK8A 4M3NA 3GA5A 4I14A 4C7MA 1SBYA 3E0XA 1WR8A 4X3PA 1OIVA 2WRZA 4IF6A 2CBXA 3SNHA 2CLFB 3N2KB 3OIWA 5JXWA 3Q3JB 1BXZA 4YDSA 4MVJA 4CIWA 4LOAA 1OLOA 3IE1A 3MQ2A 3WAKA 1Q0UA 3OEHA 1WTCA 2IHZA 3BXPA 3SVZA 2QZSA 4ZQFA 1QV7A 2WJ3A 4QXAA 1FNSA 1I33A 1VRVA 2W6JA 4FDUA 1JJ7A 4AZWA 3AHEA 3DAFA 4RHTA 2DFNA 3L2OB 2F3QA 2XWPA 3IT0A 3GFPA 2UVDA 1REQA 2Z5LA 4QE3A 2E87A 4D74A 3NBQA 1KWGA 2F8SA 3LX5A 3NGLA 1UKYA 1Y6GA 1E2HA 1VLVA 5CVJA 4M0EA 1HO3A 1EDEA 3WIOA 4YUYA 1EFRD 4AG6A 3ESCA 2FLKA 3ROXA 4IHJA 1AA6A 4XFKA 2FWBA 3EPRA 1CYDA 4GR9A 3NRBA 4AFNA 2P5SA 1A7KA 3P5SA 1RS0A 2OD7A 1VIVA 1ZJZA 4QBIA 2G1KA 2GERA 2WUWE 3MJCA 2IU0A 1JHOA 1X94A 1XA4A 3MB5A 4QJ3A 5JWRA 2VDKB 1H2FA 5C18A 1KE2A 3RYHA 1BMFD 1ZZGA 3VGJA 4A91A 2FJ0A 2KMLA 5EMNA 2BFMA 4HAXA 4C3VA 4ZFNA 3L82B 3THYA 1TW2A 2QRKA 2OV6A 4ZJZA 5DHUA 5TPWA 4J0JA 3ECAA 3QVSA 2WAYA 3LHDA 2KSQA 3D2AA 2VI5A 3LHFA 3QG1A 3R5HA 4QOFA 5ICMA 4R7ZA 3CZQA 4M8SA 2DOKA 2H8KA 2CXTA 1HPLA 3TYXA 1BRTA 1RFGE 2YV3A 4Q03A 2OQ2A 1OREA 1KARA 5CCDA 1Z6YA 3VH3A 4H17A 3Q12A 1OHHA 3K8QA 2D6FA 1I8TA 2CMKA 2GFQA 4P34A 1DC3A 1M9NA 2HSZA 2I3GA 3UT0A 3W5IA 3NNSA 5AXDA 5AFSA 4CHGA 3Q1LA 2UYQA 1SU8A 3VSBA 1DHRA 2NXCA 1WZEA 2J9GA 5ENVA 3OY2A 3G5MA 4QDUA 5JRDS 3D6NB 3VU8A 4EPVA 2BN4A 1CUEA 5JNUA 2V98A 5KC9A 3L8GA 3W3AD 3I4FA 4ZMSA 4ND3A 3OE7D 3N70A 2GO1A 4WFIA 3RJ9A 3P9XA 3DCIA 2HYIC 4QFCA 2HDWA 1PQUA 4TKUA 4AY6A 1MFZA 3BWMA 3ORSA 5MFPA 5ICCA 5FRDA 3C16C 1DX9A 1S8FA 2WSBA 3EFBA 3HR8A 1M1XB 1WCXA 4EO9A 3WQBA 1FFEA 2C7OA 2RHMA 4KBFA 4LTDA 4JYCA 2V9ZA 4I1YA 2PSHA 3RYTC 3OC6A 4YQZA 2PTHA 3DO5A 3ILXA 1D9ZA 2GARA 2WFZA 2DULA 1JG2A 4J7CA 4N5IX 5HWSA 2D7CA 4EKGA 1G6KA 3PGXA 4RFVA 5H16A 3DVLA 4WOCA 4G86A 2CYAA 3H1PA 4FQ7A 4CU5A 3WWZA 2I0FA 4I6GA 3TOVA 5JUWA 3GOHA 3PQFA 4PPFA 3M49A 3QF7A 4INPA 3EGIA 1PS8A 2UZIR 3T4XA 2ERYA 4CQMA 4M21A 2Q2OA 1I30A 3LC1O 3P9SA 4IDBA 2NVUB 2G1JA 4DV4B 2R00A 3RVJA 2DAPA 1E5VA 2CWWA 4LOHA 3MFYA 3RF7A 4OXQA 1TD9A 1XQYA 4FI3C 3VAYA 4F3NA 4J7AA 1KJNA 3GDHA 1LK5A 5LZ7A 4IVQA 2BMWA 1P2VA 4P5EA 5F9HA 1G21A 3VNVA 1GLVA 1BX3A 5AOVA 2R6HA 2EFEB 3WK6A 4AMZA 5TMBA 2OL4A 2AD5A 2HWYA 3WWYA 4RS4A 3ZHBA 4LF4B 3EDRA 1M34B 4QSMA 4A2PA 4NF2A 3QENA 1AB6A 1SXJC 1RU3A 2WZBA 3NP7A 4DE5A 4E51A 3TMKA 1Q2UA 4L6CA 1ZD1A 1X0XA 1HFKA 1OA0A 2HJWA 2W8BA 2JEZA 4QWMA 5BMVB 1F8FA 2DKFA 5KYUB 5HP4A 1R0XA 4LXYA 3KOXA 2AI3A 3U3KA 4FEAA 1EVZA 3EEYA 3HNPA 3FVRA 4QUDA 5JISA 4ML3A 1ETHA 4TLBA 4AQDA 2UXBB 3GXBA 5HUHA 4N18A 3FN4A 3FTPA 5DM70 2HH9A 5JJKA 2WIBA 3WOVA 4Y9TA 4X8LA 3L43A 2X42A 3I3SR 2P41A 1KQFA 5HGXA 2EP5A 5DX8A 5L95A 4FHFA 1YZQA 4CV0A 4HPXB 5A2GA 3EVAA 5L40A 1H05A 2BZGA 4CL0A 3EZ7A 4XEUA 5H5JA 1Y81A 4HZGA 3SZOA 5BR8B 2RJNA 3UJHA 1C4OA 1G7RA 4LAFA 3DMRA 1ZYUA 2BFFB 1K7FB 1H69A 2FW6A 4RQUA 5DULA 5L7WA 1G20A 3EISA 2OXTA 3PNVA 4CUJA 4M99A 3KKOA 4DRXB 2P1RA 5K3SA 1EBFA 3K09A 5K99A 2O0HA 3GCGA 2CDAA 4PYLA 2GNAA 4JP5A 3RTEA 4PX3A 4BB9A 2ACWA 4MW0A 1EI9A 4WESB 3GVXA 4OP1A 4CF6A 1JR3E 1QHYA 2PWAA 2ZAOA 2DBRA 4MUYA 1GCOA 5EE1A 2A9RA 1RI3A 3F8WA 3IKVA 3K4PA 3PUHA 4D0LB 3TUJC 4PGMA 5LP6F 2Z5VA 5L6LB 1BWSA 4IHKA 4QPDA 2ZFUA 4D3ZA 4ALMA 2CVOA 3Q6MA 3IBCA 2H1LA 3BVPA 4LWOA 3J80A 1NUUA 4K3VA 5CYOA 1ZD5A 2ZTVA 3B3JA 1MGPA 1OGYA 2RH8A 3IR5A 3R3JA 4MV0A 1RWXA 1WBJB 4WADA 3O2QB 3L49A 1Z6PA 2NO7A 3RUDA 3THOA 1FDSA 1I13A 1NQ5A 3ROMA 4FFRA 4W9NC 5CXXA 3F0TA 4RMIA 2HKIA 3DEKA 4EA7A 4YRZA 1AU9A 1B6RA 4RTNA 1RHKA 1HOTA 1QVVA 4UHBA 2ZLBA 2P4QA 2QMOA 3V1TC 2IUEA 4RLQA 2IYZA 4ZCMA 2V03A 2QENA 2IXTA 4LWQA 4QJ5A 1E7YA 1CZLA 4RD6A 3FM9A 4Y2QA 1CRLA 4RKFA 4ON9A 5ENDA 5CHYA 2HSDA 5KNBH 4WBNB 3K0FA 4DCCA 5HF6A 1TYBE 3IEXA 2GO7A 3H13A 4U1RA 4WD3A 3THWA 3PXUA 1G5FA 3TM5A 2FFAA 1V1JA 3D0OA 4A73A 1KMMA 1VBKA 3ELBA 3JAWA 4MUNA 3GQBA 3DHYA 4A16A 2V6IA 3D02A 4K28A 3O9MA 4N0MA 5G40A 2IEBA 4PQRA 1XZJA 4Q16A 1GG2A 3ZE7A 1KVTA 1NTRA 1UXKA 1Q16A 2AMFA 3OHSX 4ZC1A 4ZHQA 2QV7A 2C4WA 4RMNA 3FTFA 3K5IA 2IVZA 2X1VA 3ZQUA 2DHEA 1U63A 5BT8A 1YFZA 1UKBA 2RAVA 1VQ1A 3G0GA 1NY5A 2DU8A 3JU3A 1PJRA 4X8MA 1JTVA 1TK9A 4LJ5A 3SMQA 1MB0A 4PF1A 4U2DA 3TB4A 3TFWA 2FMXA 4EHIA 1AKQA 4A8JC 5JD3A 4DJAA 1GT6A 2SCUA 1W30A 2BFBA 3A9UA 2VJKA 3V8MA 1E1KA 3R3ZA 3SC2A 3G59A 3AVYA 2PFSA 4I81A 3B9PA 3ZBQA 1FNNA 3ZWCA 1X9HA 3NHKA 1MAHA 1R8SA 2COEA 4Z8XA 4WK0B 1IUKA 2ZUUA 4OQPA 1SOAA 1UT5A 3ND7A 4G1EB 3FYTA 4DQXA 5FL7D 1E58A 2ZZKA 4EHLA 3UH0A 1QQBA 2KPOA 1U0HC 3C6QA 4C5BA 3VC2A 3Q2OA 2CVPA 4UTVA 5E7MA 2F3RA 1XD2A 4QQNA 1N0UA 1ILWA 4UZEA 5HVNA 5AK4A 3TAXA 3P26A 2DJ5A 1L5VA 1W34A 4H7DA 3UUFA 2F1JA 4MW2A 4NATA 3WMFA 2R6CA 5KMGB 2UVQA 3B82A 4RPJA 3QFTA 4WJZA 4AWXA 1MZVA 2NV2B 3EZLA 4GR4A 4XWKA 3RLFA 3U31A 4BJHB 4G0QA 1BXGA 4N5LA 3O8DA 5HW0A 1MQ9A 2VYQA 3FLAA 1G7TA 2B1JA 2HJGA 3JASB 4XJVA 4EUSA 1TZ2A 4KDCA 2XW6A 1MH9A 2YJ4A 1UZUA 1CUCA 1O03A 3PE3A 4QYTA 5E2AA 4KXLA 3MJSA 5ELMA 4BN5A 1ZNZA 3KG2A 3MTQA 2PL3A 2HNBA 3NYWA 3QE3A 4RHYA 2PMWB 4M6WB 3KELA 3KHUA 3TQOA 3OQIB 4MW9A 3CNBA 3L04A 1XNRB 3FHTA 4Q4JB 2VYVD 4ZTZB 1T9CA 4PCUA 4O4IA 3HE3A 5BWLA 1KVRA 2OCKA 4MIYA 5F4BA 1DBVO 4F2GA 1TEZA 4IH1A 3FNRA 3TEFA 1U9ZA 1M2VB 1AE1A 3N7TA 2KYRA 1FRNA 4J03A 3LKDA 2BEVA 2PZLA 3JW8A 3NYQA 1ZAKA 2HEIA 2BW0A 4KRYA 3CLSC 1AKYA 1XUOA 1D5CA 4MV7A 4HVLA 1ODCA 2GEBA 4PHHA 1LX7A 1Z56C 1X15A 2VK2A 4FJ0A 2B4TO 3NKLA 5EE9A 1R0SA 5BMVF 1YJ8A 5BRNA 2PEZA 3H04A 4CL8A 2GX6A 1EM6A 5G02A 1QTRA 2ZG6A 1SU7A 2H65A 3DG9A 4MRSA 4PYKA 1VBFA 4GP7A 3C8DA 4QUIA 2OV4A 3O94A 2HCRA 4XIJA 5KSPA 2PD4A 3DULA 1AV7A 5CDTA 3D8RA 3CLHA 2NYUA 1U6IA 2FCAA 4BMDA 4RE5A 4X00A 5JFTA 1L6IA 1SUBA 4AXXA 5TDHA 1UMBB 7GPBA 4ZVSA 4J0HA 2ZRDA 2VH5R 4PRLA 1W5EA 4P1ZA 1SPBS 1NFRA