4U2EA

Crystal structure of dienelactone hydrolase s-3 variant (q35h, f38l, q110l, c123s, y137c, y145c, n154d, e199g, s208g, g211d and k234n) at 1.70 a resolution
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
233
structure length
233
Chain Sequence
b'MLTEGISIQSYDGHTFGALVGSPAKAPAPVIVIAHEILGVNAFMRETVSWLVDQGYAAVCPDLYARQAPGTALDPQDEAQREQAYKLWQAFDMEAGVGDLEAAIRYARHLPYSNGKVGLVGYSLGGALAFLVAAKGCVDRAVGYCGVGLEKQLDKVPEVKHPALFHMGGQDHFVPAPSRQLITEGFGANPLLQVHWYEGAGHSFARTGSSDYVASAAALANERTLDFLAPLQS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carboxymethylenebutenolidase
molecule tags Hydrolase
source organism Pseudomonas sp.
publication title Directed evolution of new and improved enzyme functions using an evolutionary intermediate and multidirectional search.
pubmed doi rcsb
total genus 83
structure length 233
sequence length 233
ec nomenclature ec 3.1.1.45: Carboxymethylenebutenolidase.
pdb deposition date 2014-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01738 DLH Dienelactone hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4u2eA00
3BF7A 1P0PA 3JWEA 3L1JA 2YH2A 4IHAA 2G5PA 4V2IA 1LNSA 1EB8A 1YB6A 3HC7A 3HRHA 3S2ZA 1CUGA 1XZEA 3G02A 2AJDA 3STVA 1XZHA 3I2HA 3ZLUA 3TGLA 3D4LA 5FLKA 2ZYHA 4HXGA 4ITVA 3A2LA 2HA7A 1XZBA 1K5PA 3WK6A 2XUOA 5IVIA 3HABA 5E4TA 3N2ZB 5A6VA 1TCAA 2AXEA 3U0VA 2H7YA 1AURA 1FFBA 2B9VA 2VQ6A 2OG1A 5ALMA 1GPNA 2ACKA 5LZ5A 2VJDA 3BIXA 1ZGBA 4W63A 4DIUA 3WL6A 2Q0XA 3I6MA 3DCNA 4P9NA 4AO7A 1YSCA 4FKBA 5A7GA 1MU0A 3DL7A 5K5EA 1Y7IA 4EBBA 4JNCA 1ZD4A 1Q84A 2QJRA 5AKLA 3ESCA 4EA6A 4NMWA 1TIBA 1VE7A 2PU7A 1W75A 3H1AA 4YX9A 5ALLA 4Y2VA 1UK8A 4DNQA 3C43A 3R3VA 4QE3A 5ALKA 2IIVA 1W52X 3GFFA 2EEPA 1PJAA 5JAOA 2Z8ZA 4BP9A 4QA9A 4I19A 3ANSA 2WUDA 1N5MA 5HZGA 1G4HA 2DSNA 3FCYA 5C8VA 2V96A 4UHFA 1AZWA 5AKXA 1IVYA 4BATA 3G9ZA 1R1DA 4O08A 3STUA 3WKDA 1UOPA 1Z68A 3X3HA 4AN0A 3H2IA 2PUJA 5E4YA 3IURA 3EQ9A 1RP1A 2W6CX 4QNNA 4B85A 1KEZA 5D3KA 2XUDA 3H2GA 4KR0A 5AI9A 2WHQA 3ZI7A 4H7FA 4AMZA 5AM4A 1GQSA 5EHZA 1HL7A 4KYVA 3E1GA 3M83A 4Q1VA 4GHWA 3WWDA 2H7XA 3PF8A 5AIAA 2CB9A 2FJPA 3ZWQA 4G8BA 3DD5A 4XX1A 5JAHA 3FYUA 4H7HA 4UBJA 1G5FA 5DNWA 1CUHA 1I6WA 5BWBA 1J1IA 4J0HA 3G0IA 1F0PA 4QWMA 4H77A 4BRSA 1GT6A 3F98A 1QIHA 5LYYA 2OXEA 1BS9A 4J03A 4D9JA 4PSCA 4DSZA 1XKTA 4LXHA 3O4HA 3C6XA 3D3NA 1H2WA 5HFAA 5EGNA 3KXPA 3D59A 4G5XA 3VKFA 3DOIA 1SCIA 1B41A 2WFMA 1QFSA 1DQYA 1XZDA 3H2KA 4WDQA 4IO0A 3WK7A 2XE4A 2OQIA 4BZZA 2ZYSA 2I3DA 1MN6A 5F4ZA 3G0GA 4K6GA 4EY6A 5K3FA 1QIDA 4ZV9A 1BROA 1WHSA 3SWWA 5ALRA 4Y2XA 4UHBA 1AQLA 3M82A 4DMHA 2G5TA 3WKBA 2WUFA 5DYWA 5ALNA 4BAGA 4AO8A 3I2IA 2XQGA 5AKEA 5FRDA 5C8XA 3EQ7A 3YASA 2C58A 3AIKA 3R41A 1A8UA 1XRMA 3BWXA 3FYTA 3PI6A 5AKHA 2Z3WA 2J3QA 2PVSA 4G1FA 3I2FA 3W05A 3AIMA 3AJAA 5EFZA 5ALDA 4BTVA 4PSUA 4NZZA 2Z3ZA 4KE7A 1BRTA 3KWJA 1GPLA 1QIKA 1QTIA 3C8HA 3DKRA 4BRZA 4W1PA 3O9VA 3OM8A 1QONA 3WL5A 4NVRA 1UK9A 2XQIA 5CW2A 1B6GA 2QTBA 2ORYA 5LZ8A 2OAGA 1IZ7A 1F6WA 5FP0A 1WB4A 1WPRA 2O7RA 3G9UA 5JATA 2WQZA 3AILA 4QDTA 4UBMA 2WIFA 3OURA 3VXKA 1LBTA 3K9BA 1TCBA 4EZIA 1IMJA 2PSDA 5JD4A 1AKNA 3C5WP 1UZAA 2JGKA 4Q05A 3I2KA 1GPKA 2O2GA 5ALIA 2V97A 3ZPXA 1EINA 4QLAA 3QVMA 4HXEB 1DWPA 1LPNA 1VKHA 4X00A 2HADA 3UMJA 2K2QB 3GUUA 1W76A 1KU0A 1QFMA 4J7AA 2XQJA 5H3HA 3PDCA 4HRXA 2D0DA 2RIPA 4OUKX 4CI9A 2XMQA 3DOHA 5LZ2A 5CTAA 5AK4A 2JBWA 4K6KA 5AOCA 2X5XA 2HA2A 4UHDA 3FSGD 1UOQA 5HK8A 4GW3A 4BAUA 2WU3A 1LGYA 1UOOA 4FBLA 2HU8A 3I2GA 3U1TA 2JEYA 5AK6A 4G9GA 2HA0A 3R3XA 4ARBA 4Z49A 3WWPA 1NX9A 5HCUA 3I1IA 1MNAA 1EK1A 4I3FA 4B83A 4GWLA 4RGYA 5ALZA 5CT5A 1LPMA 4INZA 4BZWA 1JFRA 5AM5A 1VA4A 5IVDA 4DM7A 3WA6A 5SYMA 4BVJA 3LLCA 4M0FA 2HL6A 3CN7A 4EB0A 3TRDA 4DNFA 4FOLA 5AKGA 1DU4A 4H7EA 1ZI9A 4G8DA 2WKWA 3LP5A 1QLWA 4WJLA 4H7DA 1X70A 5JARA 4CCYB 4C4XA 5D6OA 2YYSA 5T4BA 4QDUA 5JASA 4QEKA 4DLNA 5C81A 4BVLA 2Z5GA 1ACLA 1Y37A 4B82A 1JKMA 2RHWA 3F8SA 3G9TA 4X6XA 3R3UA 3V1LA 2ZSHA 2QS9A 5DLPA 5IH7A 4AO6A 5JD6A 4B0OA 1XRQA 2CKMA 2YASA 3A70A 3DDUA 3FBWA 5EI5A 4LYEA 5AM3A 5K3BA 3L1IA 1CUYA 4YASA 5A71A 3HJUA 1U4NA 5HKBA 1XLUA 4BVKA 1CUZA 1UXOA 2RONA 1XRLA 1E8MA 3CCBA 1F0NA 2DHCA 1J07A 5I8PA 1PV1A 3H04A 5ALQA 1XZMA 3QMMA 2O2HA 2ZJ6A 3BXPA 3AINA 4Y2YA 2GBFA 3V1MA 3VISA 4F5ZA 2B20A 3O0DA 3ZLVA 4DNOA 3O4GA 1U8EA 2XQKA 5AKZA 1LBSA 5FOQA 5KWIA 4LXIA 5DTJA 4OU5A 4U2FA 4X3CA 1QJ4A 5ALVA 3BE8A 3C6YA 5BOVA 1CUXA 5LLSA 1HQDA 2OCLA 4UBKA 2DHEA 2FJ0A 1SCKA 2X8BA 1LZLA 4HZGA 2VT6A 4OB8A 1YS1X 1A8QA 4KAFA 4KAAA 1K4YA 4J0CA 1RYYA 4Q3OA 2WHPA 2I78A 4UBNA 4BBZA 2OLEA 5FXMA 1CUSA 3FSGA 1C4XA 5FV4A 3QMVA 4MEBA 2O2IA 1CPYA 3WK5A 4FDMA 1JU3A 3FYUB 2BKLA 2WIGA 3DJYA 1M33A 4UHCA 1CUAA 4DTCA 2R8BA 3E4DA 1OXMA 3WK4A 2XI4A 2WIKA 1JMKC 4H0CA 3G0CA 1NU6A 4BC0A 1E8NA 2WUGA 3WWCA 3VJMA 4S0XA 2VATA 3Q0TA 1ODSA 1YA4A 4EY7A 4PQEA 1MTZA 2I3ZA 3D7RA 4DMKA 4X6YA 3WQHA 5ALHA 4OPMA 1ODTC 4MWSA 3DYIA 1WB6A 4DYHA 1E8DA 3EQ8A 4X71A 1EHYA 3JW8A 1FFAA 4RE5A 4HTAA 3VJLA 2B61A 1VXRA 4WY5A 3D5EA 3PE6A 2J4FA 4H35A 4U2DA 5DNUA 4UFOA 5ALTA 4AX4A 3ICVA 1A8SA 1BEEA 4BCBA 4WDRA 4KE6A 1R4ZA 2XUGA 3V9AA 1CUFA 6YASA 3WK9A 4WFJA 5LP1A 1LPPA 3QMWA 2Y6VA 1THGA 2XMRA 4M0MA 5AJHA 2PSFA 3TJMA 3C8DA 2OCGA 3H1BA 3VDXA 3FAKA 5ALGA 1YS2X 5HK9A 2AJBA 1ZIXA 5CURA 2OGZA 4F60A 3MVEA 3BJMA 1JMYA 2QT9A 1VA5A 3QPCA 1L7AA 3STTA 4RPCA 5AKIA 5AOAA 4FLEA 2CZQA 1QIEA 2JGLA 4PW0A 4BDTA 4U2EA 4H18A 2O7VA 4FHZA 3DYVA 4C4ZA 3DS8A 4RE6A 1L7QA 3UUFA 5CXUA 5LZ9A 2CBGA 3WYNA 2DCMA 1UT6A 2HHAA 3KDAA 2H7CA 1CV2A 3IUJA 1H23A 1EVEA 1E5TA 4JEIA 4KE8A 2XUIA 1CUWA 2WFLB 5AM0A 4B84A 4C01A 1SFRA 1MT3A 4Y2PA 4Y7DA 5HKAA 1J06A 3I28A 2WG0A 1QIGA 1XKLA 2HFKA 3R3ZA 4X90A 3MUOA 1GQRA 1XRRA 4PNZA 3STYA 5K3FB 3AZQA 4PV7A 2WSLA 3NWOA 1HDEA 2GBCA 4EY8A 4GEGA 1QZ3A 2QM0A 2PSJA 4WCVA 2ZSIA 2ROQA 4J0IA 1IUPA 2VT7A 5FPPA 2OGTA 3IB3A 1C7IA 5IVKA 5CH5A 3ILSA 2C7BA 1OILA 5ALUA 4L3WA 5K3EA 2OCKA 1YASA 5AOBA 4X7BA 5JAUA 2XLCA 1E3QA 2Z8XA 3GELA 2OCIA 2WIJA 2ACEA 5AIBA 4XVCA 1ZIYA 1AUOA 2WHPB 4E15A 2PBLA 5DTIA 3WWOA 2XUKA 3OTQA 3WWEA 4G4JA 5JD5A 2BCEA 1VOTA 4EY5A 3EIOA 5CH8A 4TVKA 1XZIA 3CXUA 3DL4A 3OOSA 1QGED 1W6RA 1USWA 2VAXA 1H22A 1H2YA 2C0PA 4AB1A 5K3DA 3F9CA 3NOXA 3HACA 2XUQA 1N8SA 2PSEA 1F8UA 3NGMA 2CEKA 4CG1A 2VEOA 2WHRA 2B4KA 4E14A 1DINA 1UK7A 1R9MA 3HZOA 1CRLA 2ZJ7A 1HBJA 1XRPA 1UWCA 4OYYA 5CMLA 1XROA 1GXSA 3BL8A 2NW6A 1BN7A 5EHXA 1YR2A 1KU6A 3HYSA 2AJ8A 5DNVA 3A6ZA 1CQWA 1P0QA 3BF8A 3FCXA 3H2JA 3L1HA 4FLFA 2RI6A 2JGMA 3W9BA 5EIAA 1R50A 4FFVA 1ZJ5A 2HA6A 5FDFA 4W1QA 1X2BA 1XQYA 4GXNA 4B6GA 4HVTA 1R88A 4W1RA 4WY8A 5DJ5A 1DTEA 3QPAA 4LYDA 4BE9A 4JUIA 2ONCA 2XMGA 3WIBA 4X95A 2HRRA 1Q83A 4P92A 4BCDA 3FNBA 1EI9A 1CUIA 5T4EA 1QO9A 2LIPA 3WJ2A 2WJ4A 4BP8A 3IUNA 1UKAA 3LIPA 5K3CA 3OPMA 2WJ3A 1R3DA 5A7HA 1RWQA 3OG9A 4H7IA 4AMYA 2WUEA 3PICA 1BEZA 4Y2SA 1YAJA 4HRYA 3O4JA 5JALA 3WI7A 1QIFA 3EBLA 5E2IA 4ZWNA 4ZGBA 3ED1A 3WZLA 4GLBA 1FFCA 4CCYA 2QJWA 5HQ3B 2GZRA 4KAJA 1ACJA 5JZ9A 4OB7A 1ZD3A 5YASA 1O6FA 2HA3A 3DNMA 3I2JA 5HQ3A 2DFPA 4W9RA 1FSSA 4P93A 5AI8A 1CUCA 1UKCA 2HFJA 3G8YA 3KD2A 3D2AA 3IVMA 3W2TA 1OCEA 2PX6A 3BIWA 3IUMA 3GBSA 5JYCA 4FMPA 2RAUA 4N8SA 2BJHA 4N5IX 5JADA 3E0XA 2HRQA 1QO7A 4K5QA 4ZREA 1XZLA 2ECFA 4QWWA 4KRXA 3LIIA 3IULA 2DR0A 2QKYA 1DWQA 5DYYA 3PFBA 1WM1A 3C6BA 1ZI8A 3S8YA 1CUDA 3O9MA 2C5GA 2PM8A 4NS4A 7YASA 3GZJA 5A7FA 2XUHA 1H2ZA 5AI5A 4U2GA 2QXUA 5AK5A 2E3JA 4EUSA 2WIDA 3SC2A 4UBOA 3NUZA 5EIEA 4UBIA 5C8ZA 1MAHA 1TKRA 5HF6A 4X93A 2V9ZA 2XT0A 3TEJA 3T4UA 1PFQA 1CUBA 1DWOA 4RNCA 2QXTA 1VZ3A 1QOZA 2QVBA 1ZGCA 1T2NA 1TAHA 2DHDA 4B81A 4Y9SA 1S8OA 3C70A 4BTLA 4C6HA 4BYMA 4AZ0A 4WFKA 3IBTA 2XDWA 2I03A 3FWHA 3RKSA 5JIBA 1BE0A 1CEXA 4H7KA 4TPKA 4IH4A 3RLIA 4G4GA 1JJIA 3C45A 5ALWA 2XMBA 1D07A 4LXGA 5IVHA 5ISMA 5AM1A 2BGNA 4L0CA 5E4JA 2GBGA 1CUVA 5ALFA 4BC1A 3Q8WA 4OD0A 5T4FA 2X76A 2ES4A 5ALPA 4A16A 5C7YA 1MPXA 4QDOA 2XUPA 3JYHA 4UBLA 3AUKA 3IUQA 5JAPA 5CT9A 2QUBA 3FVTA 3G0BA 1EDBA 2WLSA 2BAGA 3ESDA 4EY4A 1K6EA 1VJ5A 5K3AA 3STXA 4OYLA 3FVRA 3K2IA 3O95A 3IDAA 5ALJA 4AXBA 2G4LA 1EK2A 1EDEA 3QBJA 4OB6A 2HA4A 1MAAA 1BCSA 5AO9A 4BE4A 2BUAA 2XMCA 3LCRA 4DSAA 2VA9A 4G8CA 1Q0ZA 5EIHA 4IH9A 5ALOA 4Q34A 4Y2RA 2GYVA 2VJAA 2XQFA 4BB0A 1XQWA 3D0KA 4LIPD 1CQZA 3W06A 1JT2A 4HXFB 4KE9A 4E11A 2QR5A 5CT8A 1XZFA 4OSEA 1EA5A 1ZD5A 3W9UA 5AH0A 3MUNA 3FLEA 4JYMA 4CIBA 1Q0RA 4J3JA 4M0EA 1LPAB 3G9XA 2VF2A 1H2XA 5LZ4A 1MX9A 3A2NA 4X91A 5AI6A 2XUJA 2C5FA 3D2BA 2ZYRA 3WKEA 2W22A 4YK7A 1A7UA 2JIDA 2AJCA 4BAZA 4I4CA 1XZKA 3QYJA 3CCCA 3R40A 4PSDA 3WZMA 4X92A 3D2CA 4FNGA 4ARAA 5AK3A 1W4LA 1ETHA 1BN6A 1UFOA 1HKHA 1XRNA 2J4CA 3VVLA 5HFNA 4CG3A 2Y1KA 2PKYX 1LPSA 4ETWA 1CVLA 4N5HX 2FX5A 2BUCA 1CUUA 4DGQA 2HU5A 1CR6A 2RGUA 3T52A 1QIJA 5BV7A 1CUJA 3KWFA 5ALEA 4GDMA 4Y2TA 5LIPA 4K2AA 5ALXA 1HLGA 1BCRA 3AZPA 4BDSA 2XMSA 2WTNA 2QMQA 2EDCA 3B3QA 3V1KA 2JF0A 1ZD2P 4J0KA 3H2HA 3VJKA 3BJRA 2QOEA 3ZV7A 1CIJA 2OQVA 2WG1A 3BDIA 4KRYA 5ALSA 1ZOIA 2JGEA 3R3YA 5CH3A 3FYUC 4EHBA 1GKKA 4J0JA 1ORWA 5CBKA 3RM3A 1XLWA 2JGFA 5KWJA 4N8EA 3DEAA 1EX9A 1YAHA 3UUEA 1N1MA 4GI1A 5LKAA 1TK3A 3M3DA 2GZSA 2WM2A 1EXWA 1TCCA 1JU4A 2PU5A 5DWDA 3C87A 2ZJFA 3WYDA 1DX6A 1WHTA 3FOBA 4MQMA 2WU4A 1T4MA 2VSQA 1A88A 3GA7A 1AX9A 2WG2A 3HLKA 1VE6A 3SX4A 4N8DA 1ZICA 4MXDA 4U2CA 2WILA 4B9EA 2VAVA 4H7JA 3QZUA 2RHTA 1CLEA 1EVQA 2JEZA 4JH0A 2FUKA 4X85A 2XMDA 4UUQA 3B5EA 2BFNA 3BDVA 4DMFA 2GBIA 1TQHA 2DQYA 4KACA 1DX4A 1EH5A 1FFDA 5IKXA 3N0TA 1QIIA 3GROA 3STWA 4X6UA 3QH4A 4WFIA 3PUIA 4UHEA 1YB7A 2WFZA 5AKYA 2CMFA 3I6ZA 3ESBA 5AM2A 4GECA 3F67A 1IUOA 1WB5A 4X94A 3WIOA 4Y2UA 4PF1A 3ZLTA 1K63A 4AN1A 2AJLI 1XLVA 3W04A 3ESAA 3WKAA 3KOOA 5LZ7A 4DNPA 2PUHA 5T4HA 2XUFA 3KSRA 5CT6A 3G7NA 4Y2JA 3EF3A 1W1IA 1P0IA 4K6HA 5A2GA 2XLBA 2CUTA 2HU7A 2QUAA 5D7BA 1GZ7A 3PFCA 1NU8A 1K8QA 2OAEA 3FLAA 3I6YA 3ICWA 2OPHA 1GGVA 1WCYA 2VTVA 4F21A 1SCQA 3IA2A 1XQVA 2VJCA 1C7JA 2BGRA 2P8SA 4MWTA 5JANA 1JJFA 4FNMA 5CT4A 2PPLA 1X2EA 4QDXA 1QIMA 2ZYIA 4FLMA 5JZSA 3HEAA 4LHEA 2WJ6A 1UK6A 5ESRA 4CG2A 5HF9A 5FKJA 3I1YA 2Y2UA 2VJBA 4FFWA 1VLQA 4JYPA 4CCWA 1U2EA 5HF8A 5ALYA 1YA8A 3HI4A 4UPDA 2H9YA 2QZPA 4ZRDA 1SC9A 3DKKA 1R9NA 2HM7A 3RARA 1G42A 4FTWA 5AI0A 1ORVA 1Y7HA 4MJ3A 1QE3A 2OGSA 3WJ1A 4CIAA 4KEAA 5JZBA 1LZKA 5KREA 2XUAA 4B9AA 5DYTA 1ODCA 2Y2VA 3IIIA 3DQZA 3C6ZA 4Q82A 1N5RA 2H1IA 1E89A 1MX5A 4P08A 4G4IA 4FWBA 4U2BA 1ISPA 2G63A 5FPQA 1J2EA 1EB9A 4DMCA 1XZAA 2PSHA 3R0VA 1THTA 4MEAA 4KJXA 1XFDA 3PUHA 3H19A 5I9IA 2HA5A 4UFPA 4L9AA 1L7RA 4Q3LA 3SK0A 2C0QA 2WTMA 3MGAA 1MNQA 1P0MA 2DQZA 1VXOA 1O6GA 4QLOA 2XMZA 3QPDA 4J0DA 2R11A 3HXKA 1XZJA 4AQDA 3H0CA 4PO3X 1MJ5A 2J3DA 2CJPA 5EHQA 4J0GA 4FBMA 1DT3A 4A5SA 1IUNA 4GBGA 1IZ8A 3RK4A 3WA7A 3F96A 2JGIA 3ANTA 3CN9A 1LPOA 1XZCA 2Y6UA 1G66A 4C4YA 1AC5A 4YPVA 5CRIA 3C5VA 1BU8A 3OC0A 4C89A 1AMNA 4LKOA 4XWGA 4IH1A 5AP9A 1UKBA 1WOMA 4E46A 2D5LA 5A62A 2XB6A 3G0DA 4AZ3A 5J3JA 3QM1A 3K6KA 1YCDA 3HSSA 1TRHA 4OCZA 4QDZA 4C88A 4XJVA 2C4HA 3QITA 4ZXFA 3FLBA 2UZ0A 2PL5A 3DLTA 4QZVA 1LLFA 5AI4A 3V48A 4B80A 2GYWA 4XIIA 5CXXA 1XZGA 1DT5A 1CUEA 2IITA 3VVMA 1JJBA 3AIOA 4ROTA 1FJ2A 2ZVDA 5AKKA 2HDWA 4Q3KA 3WMRA 3O4IA 1DQZA 5AHXA 5HF5A 3AZOA 4UFNA 3E3AA 4X97A 3R3WA 4IQ4A 1JI3A 5SYNA 2WFLA 4G9EA 4B0PA 1ZJ4A 1GKLA 4ZV7A 5AKJA 5D3ZA 4ZI5A 4MQLA 4L72A 5LKRA 2EDAA 4CFSA 3H18A 2JGJA 1HPLA 4A23A 1QTRA 5I7UA 3LS2A 1FFEA 5BWCA 2BUBA 2GYUA 4TGLA 1MO2A 3WLAA 4F0JA 1E66A 4BCCA 4HAIA 2QRUA 4W1SA 5KBYA 2V98A 4MYDA 1AGYA 1CFJA 1ZI6A 1VZ2A 1U65A 1LPBB 3WKCA 3V1NA 3WK8A 3A2MA 3WL8A 3M81A 5EHNA 4OU4A 1SOMA 4MYSA 4UHHA 3H17A 1MX1A 1EDDA 2IX9A 4Y2QA 3PF9A 3AFIA 5AICA 1XQXA 4B7ZA 2HIHA 4C87A 2YXPX 3WL7A 1WPXA 5FUMA 3P2MA 4HS9A 3F97A 3B12A
chains in the Genus database with same CATH superfamily
3GRUA 1P1CA 1P0PA 1LUAA 4DRZA 2BCJQ 1ZVVA 4JI1B 4AJEA 3OQIB 1WUKS 5E2AA 3WIDA 4F92B 3D6JA 4B45A 1CXZA 3KV1A 3GC6A 4PPNA 4V2IA 4CM8B 2V74B 3VU3A 1Z2EA 2IE0A 5B1SA 3QVGA 2I80A 3W6NA 4E5YA 1XZEA 4DG8A 5DXJA 2AOTB 5BUCA 3USCS 1YB1A 4MUKA 4KC0A 4O5AA 1ZXLA 4XWTA 1J2JA 5T8KC 1T0IA 1IY2A 1NN0A 2FUG6 3D4LA 2PX0A 3HLTA 1TA9A 5G53C 1O9GA 2HA7A 3N74A 1SC6A 2GCPA 1TU0A 4JROA 4KHPB 4CL3A 5E8RA 3IP6A 5FV7A 1N9GB 1YU9A 2PAFA 3D81A 4UTRA 4JVSB 2COEA 4H59A 4JAVC 1CQJA 1T0HB 1JG3A 1TCAA 3U0VA 2H7YA 3ZVRA 4IIVA 4OV6B 4OTZA 3WHIA 1FFBA 2H8KA 3O1HB 4EGAA 4KW7A 2OXCA 4O2BB 2X0NA 1S9HA 1CIPA 4D6PA 5K8CA 1U0FA 3HA2A 2VK8A 1WXWA 3BRWD 3KLOA 3UGQA 1DTWB 2BI4A 3DMDA 3RVJA 1ZGBA 1DL5A 2Q0XA 2W2NA 3WHLA 4YJFB 2B8JA 3DFIA 1A1SA 1ZCZA 3PRKE 4O4HA 2HXGA 5A7GA 3UEOA 2CFOA 3UHOA 4LYAA 3DL7A 3MSXA 1Y7IA 1EK5A 4GOOD 4HMOA 3T7EA 5K5EA 3PENA 2HZ7A 4JNCA 3BPSA 2P3LA 2QX8A 2WINI 5TMBA 4HT3B 3JWHA 1DRJA 3FHTA 2WF9A 4AP6A 1KVSA 2QJRA 2X1MA 1H5QA 3VI3B 5AKLA 4RA6B 3HDHA 3H9JA 3ZJVA 2MDTA 3G8AA 4KLRA 4Q16A 2JFXA 2MR5A 4OQXA 2X15A 1OI3A 3EQZA 4EA6A 3NNSA 3KPUA 2HRZA 3DWEX 5C8YB 5KHLB 2CLOB 3MRVA 4FK8A 2PU7A 2OZLB 3VZQA 3ZXXA 4IEFB 3H1AA 3M2PA 3NP9A 4IZIA 3R8FA 1UK8A 2GEDA 4JT9A 2X2FA 3C43A 4P53A 5HBRA 2YCBA 2DAPA 3R3VA 3UN1A 2VPQA 1RLJA 2BN4A 3WLHA 3AR4A 3B89A 1WCXA 1BMTA 4W5QA 4LV6A 2R00C 3BGDA 3E3LA 5EP4A 2Z8ZA 4G0NA 1N32B 4N6GA 2ZRKA 4HJXA 1RRFA 4FMDF 1NRWA 2Z1NA 1AIPA 3S4YA 1M7HA 3CF2A 2P8JA 2R68A 1G4HA 1O95C 3AGQA 3L04A 3LC0A 4LJAA 4OHKA 1BVUA 4YECA 4W9NA 2ZAOA 4CTKA 2R6ZA 2REBA 4YUYA 5CFLA 2PNJA 2HV8A 1KDPA 3KKMA 1MENA 2ZTLA 5HOEA 1L5VA 1VL5A 3AHDA 3G82C 1DAEA 3G9ZA 4MRMA 3WL6A 2FFBA 3JY6A 3STUA 4XSGA 4QT4A 5IRCD 4O1HA 1QQ7A 2P3QA 2GASA 1G8KA 2R1VB 3U4GA 4MGHA 1KQOA 3G2KA 1W88B 3PPXA 1VJ0A 1XCLA 1QCZA 4AN0A 2DWCA 2X5KO 3H2IA 3HGMA 1E5XA 2H9IA 2PUJA 3ZCTA 3W5DA 1NYTA 4R1TA 2QZZA 1SA0A 3CEMA 3Q3GE 1Y8QB 1RP1A 5GPBA 2QPOA 3RRXA 3ZNNA 1A9OA 1S7GA 4G84A 5JMTA 4CETA 3O3NB 3N76A 4B85A 1UAGA 4YCJA 5HUHA 2E4XA 1OFIA 4LBYA 2IXFA 4R40A 4ZGWA 3QKIA 3OT5A 2ZBVA 1B6SA 5D3KA 4EENA 1CETA 3UMGA 3NKVA 2FXIA 3H2GA 2XYHA 2COKA 3UAWA 1CJBA 4DREA 3ZI7A 2J48A 3DO8A 4RESA 3KQHA 2AD5A 1SIWA 4H7FA 4AMZA 5AM4A 1C0IA 2DC1A 2ISQA 4KI7A 3VO9A 5I7EA 4FYMA 2H1FA 2PN1A 1TZBA 2EX1A 2GCOB 2X14A 2JBHA 3IEXA 4U8HA 5BSRA 1SRQA 3MILA 1SELA 1U02A 2ZRNA 3PXUA 4AMVA 3T12A 1V43A 2ZOSA 5F2KA 1NBIA 2IOHA 5EKSA 4MUGA 4EQ6B 5LLTA 2CNOA 1M10A 1BCRB 2PA0A 16PKA 1Y3FE 2F3QA 4DA6A 1OROA 1EDOA 2P4UA 3OD1A 2X0IA 2I4NA 4F8JA 4ZJZA 2DERA 5AIAA 1G0NA 4ZQFA 1A8IA 4R8VA 4O4LA 2FJPA 1DOAA 1T43A 1ZNYA 4OOEA 4R84A 4YCNA 1GTSA 1HDYA 1KJQA 3CLSC 4HDOB 2CXSA 4OFZA 3KB1A 4LF5B 3NHBA 1TEHA 3GNSA 5JTTA 3W4JA 2WBLC 4M1OA 3F8TA 1K4KA 5DT9A 1J1IA 2WQ6A 3AM1A 1VL1A 2F1HA 4KFUA 4X7PA 4DEVA 3CLRC 3H5WA 2IUTA 1GUAA 3EJ6A 2PWBA 4MARA 4L08A 4YJGA 3ZCRA 2BIFA 2PL9A 1LB1B 2ONJA 2WIAA 3F98A 5KYKA 3B48A 4M36A 1QIHA 4YVFA 1NY5A 3EZ6A 3MRSA 4B2LA 2IEIA 1X1DA 4JVLA 4LXUA 5EINA 2OXEA 2ZWOA 3B5IA 4LY3A 4D9JA 4G4SP 5DX0A 3L7DA 1JQLB 2CXRA 3C6XA 3EWSA 3ZVNA 3NVAA 3MQFA 5K09A 2EKZA 3D3NA 1T91A 1H2WA 1TJ4A 3GLHB 2P65A 1X14A 2L42A 1G19A 1J39A 3BTUA 1AGXA 2A33A 4F8YA 5JFOA 3KXPA 4LQLA 1YMVA 3D59A 3KB8A 1P1IA 3VKFA 4D9HA 3NAQA 3U4IA 3EFHA 2IU4A 1FVHA 1CDZA 3REGA 3EGXA 2WFMA 4EI9A 3KNZA 1Z5VA 4WCFA 4JI0B 4YT2A 3LCJA 3ENZA 1RVDA 2PXHA 4UMDA 1MUUA 1PE0A 5JXJA 3H2KA 4WDQA 1VG8A 3SS7X 2XE4A 2QI9C 3GN1A 4EL0A 4LDQA 2VHXA 1TQDA 2ZYSA 4QEDA 5K0EA 4C0QC 2PEZA 4HDKB 1E2MA 1VG0B 2G5CA 4CN8A 3H9EO 4YDHB 1FNMA 4IDGA 1O96B 2JGRA 3I0MA 1QMGA 3JYOA 3G0GA 4BXOA 3SLGA 2Q1WA 4UXIA 3EFEA 5B7PA 1RMQA 4D3XA 1IWPB 2QNRA 3UPTA 3HJFA 2G8LA 4IF6A 3V8MA 4CV3A 1BROA 1NDUA 3U62A 5ITZA 2QRNA 2A5GA 4J1NA 3BL6A 1GADO 1D7AA 2H2IA 3N7AA 4XWOA 2BTOA 1Q0LA 5H83A 4EYGA 2HPHA 1TQ6A 3NTVA 2B37A 4Y2XA 3HHEA 1P5JA 1HFWA 2XRYA 3WQSB 3PRJA 1EM8B 1HYBA 1UADA 2C99A 5B1YA 3ZIDA 1IHXA 3U7IA 4HVAA 4PYNA 1BW9A 3K1TA 3QJYA 2G5TA 4X63A 1I6MA 1MB0A 5SYAA 4DMHA 4KR6A 2AVDA 4P31A 5DTEA 2WZCA 3PR3A 3QKTA 1NF2A 5DYWA 1YULA 4HLDA 3SX2A 5JXIA 3EW7A 4BAGA 1V9SA 3SNHA 2ZTSA 2SBTA 3IESA 1NM5A 5C8XA 2UZ1A 4TQAA 2C58A 4L4ZA 5JOQA 2WMNB 1XELA 1H69A 4BLOA 1LDEA 2FSPA 4DEXA 4P3OA 3UAYA 1R6DA 3W8DA 1RRMA 1UPAA 1Y3HA 3PI6A 4G3XA 1IFXA 1B15A 1BD3A 2Z3WA 4GLLA 3PNPA 4B3JA 4G1FA 1R0SA 2D6FA 4RNDB 1GUBA 3OZGA 2AQ8A 1OX4A 5CXSA 3S8MA 4BY9E 1BS1A 1UP7A 2ZRQA 2APJA 2GX6A 1WO8A 2ZI9A 3IHLA 1FYFA 2JHFA 1NATA 5A9SA 5JNWA 4KFCA 2JHCA 3IKVA 1K8YB 3R6GA 3VSAA 4BTVA 4CL8A 2C59A 3TIFA 4KXWA 4WZAB 3E5MA 1KJ8A 4NZZA 4TS9A 1KZ9A 4QRDA 4J4HA 1V1MA 3SDZA 4WV3A 1V6AA 3CZMA 1KI9A 3L49A 2IHUA 1UPFA 1ZGGA 2XOKA 3DEZA 2GPTA 4RFSA 4GMKA 3BHMA 4L78A 4V24A 4QPDA 5E9JA 1JIUA 4NCKA 1WV1A 4TWIA 2E21A 4PPYA 4ARIA 5L3SB 4UUPA 4H7PA 3DKRA 3CHYA 4HDCA 3DZKA 3RYFB 2H8GA 4BRZA 3HL4A 1II8A 3O9VA 3CEHA 1OQAA 1P77A 1V6SA 4MIEA 1HYGA 1Z62A 3H11B 4AZ0B 1WF6A 3F5DA 4IVNA 5FNVB 1PP4A 4H1WA 4KNVA 2XTMA 1C4WA 4NVRA 1XTJA 2JLWA 4RIGA 5KNDA 1EFTA 4UXHA 1MF7A 1ODIA 4YMTA 2DPLA 1PU2A 2OAGA 3QLUA 4FJ0A 5GZ3A 2VQDA 2OCDA 1JFFB 2WQZA 4AN4A 3NPAA 2PX5A 4YCAA 1EFPB 1II0A 1E59A 5HTOA 4QDTA 4AKIA 1UDBA 3R5TA 7ABPA 4R2LA 1AZSC 1KTVA 1QFJA 4R2WA 3K6RA 3AF2A 4DZZA 2O5RA 3EZGA 5KIAA 4E5VA 2OENG 5L53A 3CNHA 2A5LA 2UUAB 4NFLA 1UXKA 4HAXA 2OO5C 1Z2CA 2QHXA 2HJRA 1DUVG 3QA9A 3UA3A 3DA8A 5C46F 1U4OA 5ILGA 3RAEC 2QRZA 1Q92A 1AKNA 3OP4A 2GZAA 2OHIA 3EIXA 4MVJM 1WMSA 1AN9A 2GD0A 3M5WA 3ZR4B 4CMIA 2P3OA 2Z1MA 1FP4A 4WIAA 5DOZA 3RW9A 3TD9A 3HYLA 3VR1A 2QVZX 3EG5A 2OG2A 1RYNA 2IKSA 2X1HA 3ICCA 3RHSA 4D9BA 4CTNA 1K92A 1AB6A 4EFLA 3JQ8A 2JFGA 2GLXA 4HNVA 4HEHA 1Z17A 5HMLA 1JDNA 5COQA 2V7BA 4DMRA 2A35A 3FNIA 2WPDA 2P2NA 5B58C 4FT2A 2VOEA 4S12A 3EA4A 5JNLA 4E08A 1FY2A 2HJ9A 1ADCA 4MHOA 3E5NA 2ZW9A 3QVMA 2IEAA 4HXEB 4EUNA 3AK4A 2NU7A 2XDQB 3LRPA 1XUOA 4K6FA 3IERA 3EN0A 3VX3A 2A94A 4AG5A 4DCTA 1C9NA 2G04A 1VPEA 3FZEA 4KQWA 4MS4B 3Q5GA 5EE3A 2FB9A 3UMJA 3WFIA 5HGXA 1I2BA 2YWBA 3FMOB 5IYZA 1XD2A 2RGXA 4CKEB 3ILHA 1NWHA 3ME5A 2BKVA 1B16A 2XB4A 3ORFA 5BRAA 1C9MA 2TYSB 2W2LD 3MZ0A 2XQJA 3U4DA 1JFTA 1RJGA 4OHUA 3NDPA 5LP6F 1O6CA 1HFEL 2EJBA 3AJEA 3VUEA 1XKQA 2RIPA 4O4IA 4Y9RA 5JSFA 3ONEA 3KSZO 3WDKA 5CTAA 2ZAGA 5AK4A 3T9AA 2GARA 2NUPA 5HDQA 5J2TF 3ZOZA 2JBWA 4K6KA 2OM2A 3T54A 3HBJA 1NMEA 1QHFA 1MAWA 2REQA 4MV6A 5AOCA 4XWWA 3KYJB 2ORVA 1OBCA 4IFTA 1TZ2A 3HJAA 3MYRA 2DRIA 4MQUA 3DB2A 3OCJA 2A78A 1I7LA 2BZGA 1E5DA 2VWQA 3V4FA 5HK8A 2XB2A 2XZTA 3EMVA 1R8JA 1GGKA 4GS5A 1GFSA 2WU3A 1UOOA 1RJDA 1V45E 4JSYA 2PBFA 2V8BA 3HJRA 5EQJB 4ZVPA 4MP6A 4FYKA 4ZIRA 1SXQA 3LT2A 4N5DA 4GWGA 5JH7A 2JEYA 2VDKB 2VUSA 4OXNA 3RE1A 1R4AA 3AH8A 4D7AA 3QF7A 4TSRA 1D2MA 5AK6A 1N2CB 3HCOA 2V6JA 4R0NA 2NO4A 4BQOA 1RP7A 4XGKA 1XVUA 2XHZA 4JP1A 1GNRA 4ARBA 1F9AA 4KQHA 4DQDA 1HRKA 4ED9A 5DE3A 3ZGZA 1NX9A 1OAOC 3B9QA 5EJGA 1XC7A 1MABB 4TZKA 1TVKA 3NBMA 5IT4A 1EK1A 2WU0A 3THOA 1COWD 4JI4B 1PKEA 1JEOA 1YR6A 4GR9A 4XGIA 2XH8A 1P9NA 1ND6A 1U8AA 1JRLA 1R27A 2Q4EA 2VXCA 3WGGA 1IZ9A 1KI8A 1P3DA 4G01B 4F9FA 5JVDA 2XPCA 1P39A 3ROTA 2J9RA 4GWLA 1J8FA 5LJIA 2UU9B 3VYUB 1NVGA 1QGDA 1XALA 2ZJBA 1ULHA 2Q46A 1O0SA 2ZJZA 3E7WA 4HGYA 5CT5A 5TXGA 4POOA 4ZI7F 4RHUA 1KHHA 4INZA 3IEIA 3LOUA 1LQTA 1PVVA 2GWHA 1JFRA 1WS6A 2KHZA 1T2UA 3VR0A 1VA4A 4F2WA 4YY3B 1NI3A 3M5DA 1RWWA 3H7IA 1XZNA 4IG4A 2D59A 3LLCA 3MIIA 2A7QA 1MTOA 4JLJA 1ZSNA 2QF7A 1DV1A 2Q6KA 1LRKA 4U7FA 5ICMA 3Q87B 2QSJA 4HEQA 1U3CA 2C2KA 2OFPA 1MOZA 3MB5A 2ZP1A 3C1OA 1U04A 4PYQA 4AJKA 3DMNA 3NTXA 4BFVA 5AW2A 5A4KA 2FPPB 4P4SA 1QLWA 2IYPA 4ZT6A 2JLZA 1CY6A 4WJLA 4H7DA 1P6XA 2X1VA 1AHHA 5JARA 1KEWA 4ZU3A 4ETIA 3FFBA 3MCUA 2YYSA 1I0ZA 3OICA 1EBFA 2QENA 4URXR 5I3CA 1KEEA 4DLNA 1DMRA 1KFBB 4D4GA 4NBUA 1H5UA 3NHLA 4HY3A 4IXDA 2GNOA 2XKJE 2IS6A 2O59A 2N3ZA 2ZJAA 1A50B 3E5HA 2Z5GA 3PNMA 4XQEA 5H70A 3N2NA 2IEYA 4UULA 2HYIC 3GGJA 3C8ZA 4R0VA 3D0OA 4UM5A 3DBRB 3QW4B 2ZSHA 2FG7C 2QS9A 5L3RA 5IH7A 1JKJB 4BNDB 1X3LA 5JQGF 2YBEA 3DW3X 5JD6A 1XRQA 2YASA 2IV7A 3DDUA 3FBWA 4UUAA 5IJ0B 5K3BA 1UAYA 1UDWA 4OLAA 1JZQA 3DAGA 3L1IA 4WPGA 3VH1A 2QBYB 2NMVA 1N2CE 1UBLS 3R4CA 4YASA 4HOYA 5A71A 3ROGA 5JZMA 3HJUA 1H2FA 3LLVA 3R0ZA 4NMHA 4EYQA 3JQDA 1K8XB 4MKGA 4XUGB 3C3CA 3NG1A 1FUUA 4RK5A 5JO0A 3A1SA 1FNCA 2VRCD 1HO3A 4BVKA 4B3FX 1CUZA 1POWA 1V37A 2FLKA 2E5WA 1P8AA 2FPRA 5KAPA 1YD7A 1YHNA 1XRLA 2RONA 3E9RA 3WTBA 1K0FA 1E8MA 3HLYA 1Z18A 1PLLA 4ZARA 1F0NA 2DHCA 3AT1A 1RPNA 4WNCA 4I81A 5JC1A 2NQ2C 2AOXA 3H04A 1G5HA 3AJDA 3TQTA 4DR3B 5FUWA 6Q21A 1TK2A 2OPBA 3QMMA 3H9UA 2O2HA 2ZVJA 3A6DA 3ACBA 1KMHB 3BXPA 3BMXA 2BE9A 2VNSA 3GMIA 3CC8A 3HGQA 1UINA 3DT8A 3RSLA 1IM8A 3O4FA 3V1MA 4CM4A 3NFYA 1DAHA 4NHOA 5GJCA 1G59A 1NL3A 5JQGA 2P1ZA 5AT1A 4C6TB 2BFBA 4IM7A 4OQFA 3ZLVA 2I7CA 1NLYA 4QASA 4HN2A 1RIFA 3KELA 2NO9A 3K15A 1PEDA 3GWZA 3NKLA 4OBEA 4XQ0A 4DNOA 2J0UB 1U8EA 2G77B 3MJHA 2O8DB 1SOUA 1E2QA 3MJVA 5EE0A 1QG6A 3MBIA 1FTYA 3S55A 3KQWA 4NOKA 1UMDB 1HOXA 3EZNA 4JUAA 4LXIA 3VU1A 2E4WA 2HJVA 3QVSA 5JROA 2M1ZA 2C2YA 5KVAA 4U2FA 4RKWA 2D8AA 1ZXXA 1QJ4A 4UNSA 2HYDA 3UMFA 2G0NA 4FQ7A 2V6MA 3C6YA 4IVQA 5IABA 1K3FA 2PRSA 1CUXA 2Q6VA 2DU8A 1Q1AA 3ECSA 5AW5A 1KOJA 4FFDA 1HQDA 4EJSC 1NMQA 2OCLA 4UEQA 1S8FA 4PLCA 2C83A 2FJ0A 2O52A 3PUVA 4LJ8A 1SCKA 3DD1A 1EBUA 5K8TA 3PNSA 2GAJA 4HZGA 4EW3A 1UBOS 4KO1S 2ISCA 3LKDA 4RHFA 2OA0A 1QWOA 3FB1A 2GKGA 3FKSD 2AR7A 5CR9A 1OZAA 1RYDA 3B3GA 1Q1EA 4EX7A 2QJFA 4AS3A 4U7GA 2CLIB 3AP3A 1P75A 4DLZA 4P38A 3TIVA 2QTWB 4YCSA 4J0CA 1GTVA 1MVNA 2NUTB 1QHHB 3FX2A 1H6DA 2IXDA 4OK5A 2E18A 4YPFA 5K20A 1YFJA 1RKVA 1PJSA 3MWKA 3CLRD 3FOWA 1P31A 2ZDHA 1ITZA 4MVYA 1OWMA 2I78A 5KOIA 2IS4A 2O8CA 1YMQA 5CBPA 4AZ3B 1I4DD 3WLOA 1Z37A 4U1RA 2OLEA 2RBKA 1BJKA 3R77A 4IVRA 1BWPA 4B7CA 2XYQA 2IBSA 1CUSA 3KALA 3VNSA 3SKYA 3M9LA 4BEWA 3DVRX 3PDUA 4TMFA 1YZYA 1CPYA 2XWJI 2CLFB 5CM2Z 2H6EA 1IQPA 5HP4A 3K96A 2OP0A 1P4GA 1UEJA 4LJSA 1UBKS 1XNJA 4IGAA 5IKOA 1JU3A 2WT9A 1NVFA 2CHGA 1V7QA 3M33A 4HBZA 2YW9A 1W0JD 1SZJG 1X19A 4ACAA 5JBIA 1SVIA 4YRGA 3GGCA 4MVJG 3DHYA 1GCAA 2IUUA 2GM9A 1LNQA 4DTCA 3MLAA 1ULBA 2I1LA 3N2GA 4JA2A 3E4DA 4OMCA 2WABA 3WK4A 3BXEA 2NUPB 1JXOA 5FI3A 2I71A 3ABSB 4JLUA 2MINB 3FRHA 5DU2A 3RNOA 1JMKC 4E7OA 1DTSA 4DLTA 3K6JA 4ZD6A 2B7CA 2REXB 5EMLA 2CVFA 2PUDA 1A4IA 3CVVA 1T2DA 1NRJB 2OXFA 4ER3A 5BPFA 3L79A 4MVJI 4L73A 2A0WA 2WUGA 3Q1LA 4R6WA 1EXDA 3ZDBA 5IXSA 5ADVA 3AFHA 3D02A 1S0UA 2SICE 2IZOA 4S0XA 4LMPA 2OD9A 5TF4A 4AJNA 5F2NA 1Z4LA 1ZM9A 1O95D 1TVKB 3P4YA 4Q9NA 3OPNA 2QA5A 1KOGA 1NQVA 1ODSA 3TLGB 3ZS9A 4D97A 3DO5A 3CH6A 4XVHA 2W0MA 2QTAA 2QLJA 2VPTA 3U61B 4TYWA 1W5EA 3P97A 5KX5F 2IDJA 2OORC 5CJ2A 1U0GA 2DLCX 1CJTC 2DFVA 5DCLA 2YN4A 5FULA 2WTAA 3D7RA 4DBLE 4DMKA 1LFDB 3BC1A 3VQTA 3A04A 3EIQA 2FPGA 3MTQA 1W94A 3FPEA 3L6BA 2P9TA 2QTRA 4JP3A 5JUWA 2IPNA 4A0QA 4YP0A 2AEFA 2F3SA 1WB6A 3FPAA 1NUAA 3IUBA 5TB5A 3TDMA 4Z7NB 4AYXA 1NVVR 2YMQA 3N6XA 4GG1A 2QV7A 2VDOB 4PG6A 1U9CA 4N0DA 1VLVA 1E6WA 4QXQA 4WXPA 5SZHB 3QFRA 2RK6A 3V32A 1ML4A 1KSGA 4RE5A 2D2IA 2P2LA 4JHLA 2HRBA 3DLAA 4JFAA 2B61A 2CL5A 1TO1E 2P90A 3HR8A 1CS4C 4M54A 2GXSA 1XF1A 4JBWA 3VPBA 2ZXEA 2GEUA 4K9DA 4YWJA 4OKSA 4JBGA 2FX2A 3G0OA 5LA6B 3U09A 1XHEA 2BGMA 5CPBA 5LD2C 5DNUA 2J5QA 1ISGA 4KPGA 4EWLA 4I08A 5EIXA 4QXOA 4Q3BA 3PVCA 1NJ8A 1XMQB 1KZGB 2F3TA 2PS1A 2XGGA 2FEXA 5IAKA 5KX5A 5IWAB 1C3XA 1FDVA 1GA6A 1EGHA 3P4XA 4JYAB 4AG6A 1HFJA 5C53B 2GFIA 1RZRA 1Q3KA 4NARA 2HT1A 1JVSA 3VI4B 1E94E 3EODA 3H16A 3DB1A 4ENPA 2O8BA 1I4EB 4KE6A 2A9KA 3FM9A 4M7RA 4YP1A 4RSHA 2XUGA 1PYOA 1W2WB 2FK8A 2R8PA 2RG1A 4D2IA 1L5WA 3D1JA 3KJEA 3V1YA 4B74A 4DG5A 2FZKA 2B25A 4WFJA 3TECE 5LP1A 2GPYA 3SBEA 3CEAA 4M60A 4YCMA 3GLQA 5LQDA 2X4IA 3NYWA 2RHOA 1THGA 1TGVA 4FWIB 3PP8A 4MW1A 4FMCB 1KKUA 4XXHA 2J0QA 2CFTA 1JAYA 2PSFA 4CG0A 3K8QA 1P74A 1DJMA 3IRVA 4KPUB 4MEJA 4DSOA 3KEQA 1Z8FA 4C0LA 2OCGA 3F3YA 3H1BA 3LVQE 3VDXA 2FCAA 4TTQA 4Y1FA 1UZNA 4HC4A 1TGYA 3GFSA 2FYTA 3ZHRA 2AJBA 1JFVA 2B3DA 1K7SN 2JA2A 1G6KA 4WBXC 5CURA 2PD4A 5E6RA 4DBLC 4HVLA 1W93A 4EPRA 1OGIA 2JARA 2C2OA 4PQYA 1AXGA 1A0OA 2R2AA 1FTGA 2H4WA 1Y1QA 4F60A 1F5NA 2I4RA 1DBWA 5BMVB 2FWNA 4IDPA 3OPXA 1KETA 2CXPA 4Z99A 1VA5A 4HAUA 3QPCA 4LYFA 4W7HA 3T5CA 5BY2A 1CQJB 5FPSA 5JXWA 4RPCA 4D5EA 3ML1A 4FLEA 2X9GA 1RXYA 1QIEA 2OGWA 4FHCA 3IHKA 4JASB 2Q5QA 3EC2A 4PR0A 1C14A 3EY9A 4U2EA 5DK4A 1O54A 1AKEA 2PNFA 4PLFA 2XA2A 4R2JA 1QG4A 1Z6PA 3UCXA 3ZBUA 4ESEA 4KMMA 2C7PA 4C4ZA 4KFTA 3R09A 4D41A 4LI0A 3UUFA 2NIPA 4ZTZB 5BQPA 4GLJA 4XTCS 3T0FA 3B3AA 4PYKA 5IZCA 2ZRGA 5EPEA 1GL9B 2HHAA 1OYWA 2RK3A 1OFUA 4HDAA 4JR1A 4ZMRA 4X1KA 1MC1A 3VNRA 4BO6A 5JRDS 4MPTA 4U3JB 3EPRA 4JLDA 1CQIA 1O58A 5B4UA 1V35A 1YBVA 2JCXA 4H60A 3WWZA 2XMPA 4FIZA 4KE8A 1KPHA 2XUIA 1I2DA 1M8JA 3LP8A 3P52A 2UXBB 2LRHA 4IVPA 2OV8A 4JKYA 1J7JA 2WFLB 2X3UA 3ISJA 3C39A 5JZVA 1ZH8A 2H16A 3LC7O 2XNJA 3OF2A 3O8NA 5EQTA 1Z45A 1QZTA 2AMYA 3D3KA 5F5LA 4C01A 3F74A 4B6SA 5JXGA 4LQ4A 1SFRA 3LTEA 4Y7DA 5BWNA 1E3DA 2J08A 5U4XA 3TO5A 4A91A 3I28A 2OXRA 3CU5A 4KN5A 3UJPA 1D03A 1H2EA 2ZCVA 3I8SA 3ITDA 4S1PA 4E1VA 1M5RA 1Q0SA 1HZJA 3UMSA 2ERXA 2XBLA 1FZQA 3Q9SA 4I9NA 2XE7A 1J09A 5AHWA 3L7MA 5BN4B 3U48A 2Q4BA 3INNA 3MUOA 3V9PA 3AVVA 3INGA 1ZJJA 1SHUX 3KE8A 5DCUA 4UU7A 1QBGA 3DFUA 5E1MA 5F64A 1LLUA 1TQ2A 2YN2A 2ETXA 4D96A 4JC0A 1ZA2A 1L7XA 4PV7A 3UT5B 2WSLA 3A9CA 1IN6A 2X6TA 4G0WA 2GBCA 2XRMA 3MBKA 1T36B 3MOGA 4ZK6A 1PR6A 1XN1A 4BGVA 4BLRA 1HDRA 4EY8A 2J31A 1GQQA 4DB2A 3ND5A 5L6MB 2AR9A 2QM0A 3LH5A 2PSJA 3AI7A 3VR2A 4XYLA 2ZSIA 1C81A 3QE4A 1HK7A 3IP8A 1PFYA 1WDTA 2DUUA 4OQDA 4QD3A 3AFNA 1XP8A 5ECWA 2R5NA 1O5OA 2AXNA 1C7IA 3ZU3A 1OXKB 1DRUA 1YOVA 1RYHA 1VSTA 2R4TA 5EPOA 2WWXA 1A9TA 3DE1X 1G3RA 1QVWA 2Z0MA 4KDEA 5JWHA 4D0SA 1LVUA 5EKXA 3D8SA 4LZAA 2JFHA 3R3JA 1GOTA 1KJNA 2RKBA 3QI2A 3E9YA 1I6KA 4OGKA 4DXHA 1YASA 5CVUA 4I4TF 4DJEC 3W77A 2BHLA 4X7BA 1WCWA 1V9LA 1YUBA 2Q7XA 3KQVA 1PCXA 3LHSA 4H1HA 3HFJA 4M9ZA 1TJ3A 1YFKA 3HXLA 4Z1MD 5I6DA 1AH2A 1QR2A 3TQIA 3ROKA 4ASUD 4BKOA 1IJBA 3IL2A 5IEJA 1JFSA 1IK4A 3BUSA 4QOJA 4PGHA 5BUSA 1IL0A 2CSXA 3G1UA 5DBIA 2QORA 2WIJA 3WYFA 2BI8A 4MB6A 1SKAA 4RSMA 1Y34E 4XVCA 3OESA 2R97A 1AUOA 3VYTB 3GAAA 4LF7B 1YUMA 2WHPB 1XDGA 2H5JA 4E15A 1JLRA 3PXGA 1OH7A 1KK1A 2EJWA 3R4VA 3TVDA 1M54A 4DQKA 3R0XA 4INJA 1QHXA 3E7PA 2A0UA 1K2WA 3WWOA 5HJ7A 1WD7A 1Q7EA 3FJ1A 3FDJA 3HNRA 1IATA 4G4JA 4EMBA 2MSEB 2GFHA 2BELA 1PDOA 5CH8A 1A77A 3BFPA 3F0TA 5EP1A 2OORA 4KOAA 4BIMA 1TA0A 3OOSA 4WXHA 2AOUB 1OA1A 2VAXA 2XYRA 1YR3A 3AF4A 3PGKA 2WOJA 2PV0A 4I2NA 1ATZA 1QYDA 3BXXA 1XEAA 3QPBA 4GKBA 4IJ6A 2VK2A 5K3DA 3KKKA 2NO6A 2X7HA 3VPXA 3WBBA 4CMBA 2XUQA 3LSTA 3BBLA 1N8SA 1QVZA 5AW9A 1SXJE 1AN0A 5H1YA 3HJTA 5LA6A 4EZBA 1A72A 1FL9A 4FOSA 2GK4A 2J6HA 4MWEA 2WHRA 3IODA 5B4VA 5FLYA 4PY2A 3JD0A 4PX3A 3T3GA 3U39A 4MAAA 4E14A 4JR2A 3VNUA 1ZZGA 3OECA 3ZE8A 2W6PA 1UCFA 1KJYA 2VF4X 4MP8A 1CRLA 1Q0HA 2DTEA 2ZJ7A 1HBJA 1X1BA 4R2XA 4DDTA 2PRYA 1UWCA 5KOHB 1BS2A 3DLPX 4WUVA 2ZXFA 2J6CA 4ZZ0A 1ESDA 1XGKA 2CYBA 2FSFA 4JIMA 4YLEA 5MHTA 1SCUB 3DAPA 1CERA 3SE0A 3P20A 1BN7A 2BZSA 5JSUA 3GIDA 3H13A 4GM4A 5IARA 5BUQA 2CJWB 3FWZA 4QSMA 3DLHA 4B76A 3MMXA 2PH1A 2E9SA 1TAUA 2FZWA 5D7NA 2DY1A 4LRQA 3EFOB 3U3MA 2C4KA 3D6TB 3JWIA 5DOVA 4CIXA 4C4PA 1FRVA 4L74A 4S1VA 1ODJA 5DNVA 1EFHA 5L3SA 2QUHA 2HIAA 1J22A 2CNDA 4G1UC 4Z4GA 1M2NA 1B6RA 4MVJE 8LDHA 3T1YB 3ESYA 2R8YA 2OZLA 4HUQB 3BF8A 2FGJA 3EH2A 4KVGA 1E2HA 3WRXC 1V8BA 1QRUA 4FLFA 1KRHA 1XEWX 3VO2A 2JGMA 4AF6A 2BWJA 5EIAA 1Y82A 2NNLD 2H1RA 4RH3A 3NYQA 2HTFA 5SZIA 5INTA 3O2QB 1RWVA 2OD2A 4MUYA 1VE9A 4ENSA 1BQEA 1VKRA 1YDHA 3K4HA 5KYXA 1R4MB 3Q41A 2MSLA 1GA1A 4NU0A 1SB8A 1E63A 1RAIA 1I24A 3G5AA 4H15A 4G81A 3BVPA 4OFWA 3RJTA 1X2BA 1XQYA 3LRTA 3OOJA 4H3VA 2CJFA 3SSOA 1FMJA 4PRZA 4ITUA 1N6HA 1ONNA 1D2GA 5FPPA 4CM6A 4DSNA 4ZCQA 4DLPA 1G3IA 1R88A 1U2PA 1TNDA 3LUAA 4XCQA 4HFMA 1X7XA 3QIAA 1DTEA 1NW7A 1U3UA 2EFJA 2LIVA 3P9ZA 2L19A 4FGZA 5DDIP 5DZSA 4BE9A 4L2IB 1BXGB 3L0OA 3EGDA 2R9VA 2GJSA 4ABTA 4I1VA 3GJYA 1R5BA 5FUQA 1P73A 2LZ0A 3WIBA 4HYYA 4YV2A 4J4BA 1XN4A 1GPH1 1CB0A 3THXB 1VDZA 2RGCA 4PHTA 2JLSA 4HNQA 2UUCB 3FNBA 1VB5A 2GZ3A 4C7OA 1TEVA 4EJ6A 4F1KA 3QVLA 1CUIA 1SVUA 1VG1A 4EUHA 2J30A 2AUMA 3ETJA 4JL8A 3BXOA 3GJTA 3I3OA 4BMDA 3E6AA 4S35A 2ZAYA 3OPMA 1R3DA 4ZU6X 1PJ4A 1QWSA 2NXJA 2RHRA 1AO0A 4Z7OB 4YRNA 3Q6NA 2WUEA 3PICA 1BEZA 5DRTA 4TWBA 3E05A 2BLLA 3E82A 4R1PA 4RFSB 1SKMA 3RUEA 1E1YA 1HL3A 4L4YA 2PIDA 1OLOA 2ZUSA 3S2UA 1QIFA 4X3OA 4NENA 1QHYA 4RKEA 3B9PA 4DDKA 4KKVA 2RGAA 2WTUA 2ZFUA 5JS7A 2BBOA 1LWOA 1NUUA 1OV6A 3DH0A 3GRPA 8OHMA 1N25A 4KUHA 2XRZA 3HB5X 1Y6QA 1P5RA 2XB9A 1FLDA 2XW6A 5E2IA 1V41E 1Y7PA 3PGXA 4FQ8A 3TQHA 3ZGYA 2D1TA 4ZVRA 2ZSFA 5TC4A 4BJ6A 4P7BA 3DDWA 4PRLA 3BSFA 4B3XA 2Y1GA 3WZLA 1SXIA 2EYUA 3EQ2A 5GIPE 1GCOA 2JFFA 3VHLB 4UAJA 1JAIA 1U81A 3UQZA 2QJWA 3V7YA 1TW3A 2WDPA 4M0UA 5TQ0A 1Z74A 3V2GA 2EKLA 1P7PA 2GZRA 4JK3A 1WAMA 2NZYA 3VNQA 1MO3A 1GG2A 4KAJA 2ILTA 3QPWA 4REQB 3WG9A 1QK4A 3PBKA 2GR9A 3F1LA 2FEAA 3JQRA 2HA3A 1ZM2A 4DLUA 3M6UA 5FUXA 3ANMA 1QU3A 2IEZA 2QROA 1K6JA 3I2JA 3RQIA 4KIFA 1ZG3A 5D6NA 2IU3A 1FSSA 2R66A 1YZGA 2YFHA 3QUAA 4FDAA 4KJZA 3X44A 1E60A 1M1YB 1XD9A 5DF1A 3VJRA 3UQYS 2F8SA 1H8HA 3QIVA 4I1IA 3DF7A 5E9WA 4WXMA 1SQGA 1J90A 2QI9F 4WERA 4RSRA 1ZWLA 2CLMB 1NZJA 3IVMA 1VL8A 3R0IA 4PCVA 1QORA 4OATA 4PVDA 2HPAA 4TZTA 1J8VA 3FPLA 1NLZA 4MLPA 2PX6A 2BEUB 1AHPA 1YWGO 1JE0A 5EZYA 3SQMA 4OI0A 4B87A 1V5GA 1F1JA 2JLYA 1QGZA 1T36A 3P4UA 4M1KA 1XAHA 4X1IA 1TIPA 5BSFA 9ABPA 2A14A 4XSHA 2P9JA 3QE2A 3UT6A 3G6KA 5HM8A 1JI0A 1N5KA 4MB0A 1Y6JA 3EOZA 1NFFA 5JE8A 5J4LA 3T3OA 4NF2A 4PX9A 1NN1A 1QO7A 3U6BA 1M8GA 1YVEI 4HHEA 5ED4A 4X41A 5ICFA 3SIWA 2CDAA 3WNBA 2VYVD 2SNIE 4H6PA 4Z54A 3ILXA 1XD2B 3N2IA 4CKEA 4IKPA 3HYRA 1XJCA 5DCYA 1XZLA 3P0EA 4QWWA 4IZ6A 3ZWXA 1X0VA 2P62A 3LM8A 3W5AA 1P91A 4N49A 3PX2A 4B3MB 1AY0A 3GMTA 1RAAA 4YR7A 2PCLA 1E61A 1DWQA 1WJGA 2QR3A 4G9BA 3HGTA 2C95A 3HVJA 3I04M 3PCRB 4OHFA 4YHBA 5CDFA 1WM1A 3RC9A 3C6BA 2AYZA 5E1OA 2AR0A 1US8A 2IHVA 1WOYA 3L4EA 4H4DA 4KQ1A 1DEHA 3S8YA 1E1RD 2ICAA 4J16C 1PVDA 4R3UC 1OJ7A 3PNBA 4IRUB 4PCLA 1PGJA 2CD9A 3VH3A 5B64A 2WRZA 1UZMA 2ZRPA 5J5CA 5EWMB 1Z2NX 5C1PA 4HH0A 3PGVA 1ZOPA 4HBGA 1EZ4A 1H2ZA 1HTBA 5AI5A 2HXSA 2QXUA 5AK5A 3S5UA 1SXJD 1W9HA 3R9XB 1H66A 2IY8A 3RREA 4EUSA 3SC2A 2XVZA 3NUZA 3SZMA 2DUJA 5LVAA 3CVJA 5C8ZA 2W90A 2BEJA 2I7XA 3UHJA 1OPXA 3OBIA 2B36A 1MAHA 2NG1A 4OLJA 4IGKA 3C97A 3WR5A 4CDMA 6ABPA 1KARA 2JASA 3MCTA 4A6PA 1OXSC 1TKRA 4HYQA 4US0R 5HF6A 4BO9A 1ZONA 2XT0A 5HS6A 3DEHA 1WULS 2IXAA 3HKEA 2G0TA 3LECA 5AW7A 3DMTA 3HEBA 1GEEA 1GITA 2QY9A 2GCGA 5G0UA 5H16A 1XK7A 1SPXA 2VHWA 3MAJA 1MIHA 1E2KA 3MJ4A 3AB3A 4BFUA 4HH3C 4D9GA 2J5KA 2YXEA 2D2EA 3EVDA 4RKQA 1XLTA 5J40A 3QNMA 4WNAB 2CUNA 3ENNA 3WTCA 2F64A 5DSZA 2P4SA 2RHCA 5C5DA 4ND8A 4R7TA 1WG8A 3ITNA 3PTZA 5IK2D 2V4MA 4ANFA 2AMLA 2XBMA 1QOZA 2W6ID 1P5FA 5IM4F 2KX7A 3OFKA 1OBFO 1F0YA 2UV8A 1NLFA 4RMGA 4BECA 5FFMA 2DJ5A 3T95A 2FQXA 1S8OA 3WLMA 3H11A 2ZREA 4AZ0A 4FM9A 2Q1SA 4O0MA 3NQ41 1OIWA 4L50A 2Z6QA 2AMJA 1Z6GA 2BF7A 4GVLA 1L1RA 4FFPA 2MTBA 1GAQA 3BA1A 2UUPA 4IDHA 4N6OA 3ZKWA 3NCHA 1XA3A 2HSZA 3DAOA 4H7KA 3OWXA 4Q00A 4RUKA 3RLIA 4URVR 4LA4A 4QOSA 1DIBA 3B3FA 3E18A 4Y2HA 3VR4D 1D07A 1PQ4A 4YBRA 1HDOA 3HKCB 3RTGA 3IT0A 3SOPA 4ARUA 4R71A 1ZYUA 2I4MA 2ZM6B 1IY0A 2BJWA 2H08A 3H65A 1NT4A 3KXKA 2ZUBA 1JKXA 3LY9A 3O73A 1L5ZA 4L0CA 4PTZA 2VYNA 4WZZA 3E22B 5BV2P 4D9MA 5ICSA 4F72A 1GZUA 3Q8WA 1DAGA 1OXTA 2XTZA 5EUBA 2IL1A 4YJHA 1GQ2A 3D6FA 1SHTX 1WETA 1KYWA 2ZSBA 1DGQA 1V11B 3IS3A 2X76A 3IP3A 3HA5A 1Z0KA 2PKQO 3KJGA 5EERA 1P7CA 1KERA 4I8IA 2RD2A 2I99A 5TR9A 3V2IA 1PS8A 3H4MA 4QDOA 1JHPA 1TMYA 4JLNA 3P96A 2K5UA 3L8ZA 4RFVA 3HJCA 1JS1X 1M1ZA 3SJBA 5C3MA 3FXAA 2F1JA 4OL9A 1H3NA 1WR8A 4UBLA 3ZZUA 3RWMB 3CPSA 3ZQKA 3GMSA 5P8WA 1E1RA 1F38A 2LP4Y 4X1KB 4CT4B 4P7JA 1NE7A 4OJNA 4F3TA 3ECAA 3NAMA 3K70C 3FJYA 4R1LA 3HWRA 3IKTA 2DEUA 3AMVA 4ZJPA 1ES9A 4L16A 3B60A 3G0BA 4GQAA 3QLEA 3K8ZA 1LDMA 2ZRDA 3TZEA 1M0EA 2VNJA 4RA9A 3O2SB 3N75A 1PAUA 1RWMA 1SEVA 1W5TA 2L17A 1JPJA 3EVGA 3VOTA 5AESA 3T1QA 3STXA 2O3QA 4OYLA 5U4QA 2QPTA 3K2IA 1M2KA 4UCXA 1BTOA 3T3PB 1D4ZA 2RHJA 2IH2A 4BNYA 4A5OA 2RH8A 4AXBA 2G4LA 2H4FA 2TMKA 3LPNA 2AFHE 2QMEA 4QRIA 1EDEA 1RRGA 5F4BA 2GM3A 4QBIA 3SSMA 3ZE2B 1FMLA 1BFUA 2PQ0A 2Z1DA 3KT8A 4WESB 1DKMA 3AL2A 4YP7A 3BGIA 3QBJA 4JU9A 4OB6A 3V2UA 2HA4A 1MEJA 4C7MA 4ZDKA 3ELDA 1MAAA 3L0BA 4BQPA 4M7WA 3I04A 1RI4A 4ZOLA 4DIFA 4YMUA 1JN0A 3MNFA 2XMCA 5DP1A 3CKMA 3LCRA 1BIFA 1JWAB 1UT5A 1Z07A 2H92A 2XIQA 3E7DA 3LQ1A 3RS0A 3COPA 1M1NA 5EXXA 3BB3A 1JPNA 1C1XB 2IXGA 2PGJA 3ZK7A 4G8CA 4AT1A 4O0LA 4DQ0A 4JHXA 1M2EA 5EIHA 5LPNA 1T2EA 2JIBA 4K28A 4B8YA 3AYZB 4HO1X 3NTLA 4BGDA 1E9EA 1U1EA 2GYVA 3LSYA 4W6QA 1F2TA 4BNMA 1G8PA 1MB4A 1CTQA 1DBPA 4YDRA 4FSXA 1H42A 3D5QA 3GN2A 2H29A 4GZ6A 4PZEA 2YVKA 1GU7A 1OAKA 3IT1A 5F77A 3KE9A 4P83A 3VR5D 1SO8A 4M9UA 2AHOA 1NQWA 2QPLA 5MFZA 4Q4AB 1XTBA 2YC2C 1NBMA 1I2AA 1NKTA 4C2UA 1X92A 3IBSA 4ZT2A 4MR8B 5KU7A 4CM1A 3GYGA 4DWWA 1M34B 4QOEA 2MSDB 1GZDA 2B34A 4FE3A 1R5OA 2ZBEA 2ZKIA 1A9XA 1N33B 3UK6A 1H2AS 4Z3DA 1JHQA 3WL3A 2A84A 4K9RA 4YMHA 2YOHA 2J6IA 3I8XA 3RD5A 3BJIC 2ODTX 2V1UA 2AFIA 1BOFA 2WJJA 4F2PA 4G1MB 1G5TA 2CL7X 1EA5A 1ZD5A 3KOZA 4RPJA 2GN4A 3RODA 2P30A 3ZDRA 1AKWA 1ISSA 1W46A 3NX4A 4KQKA 5H8WA 5ITWA 3W2GA 1B3RA 1ZR4A 4JYMA 3T15A 1NDHA 3KUUA 4CIBA 4DXDA 2ZETA 4HYTA 1B26A 2F1OA 3DVLA 5AHKA 3B6ZA 3BRWA 3NANA 2CNNA 4OA5A 3LE8A 5P21A 4E3WA 2PX2A 2P5SA 3EDCA 3W4KA 3OIDA 4P36A 3A0UA 1C4KA 3GYBA 1WA5A 1O5TA 3O26A 4WVFA 3WOHA 3WK8A 5GY7A 5BUZA 1LV7A 2HF8A 4EQ6A 1KWKA 1EUDB 2OV1A 2PQMA 4JITA 3CVUA 1I8TA 4MQ4A 4FUTA 1PWHA 4IOMA 1TUGA 2IDMA 3WKEA 1P9RA 4KIUA 3BZWA 4DUGD 4FC7A 3F49S 1P2UA 4O4LB 4EHIA 2AJCA 1NBME 1OF1A 5KNLA 2R4QA 4BAZA 3AR6A 3REOA 3G5TA 1XZKA 3QYJA 3CCCA 1WMBA 3NB0A 2EL7A 4PSDA 2ZRAA 1NUHA 2NZ8A 3FWKA 3QSGA 3R9KA 2XGOA 4CT0A 2BI7A 3OQPA 2VBIA 3PWZA 4Z8XA 2IWRA 3UGTA 2BFFA 2W11A 1RWPA 2P6OA 1HKHA 2ZR8A 5AVQA 2JAPA 1Z6XA 1FDUA 1J7KA 2HEGA 4Y1RB 2GK6A 4BX3A 5C1IA 4EHLA 3E81A 3MWEA 1EVIA 4TX1A 5T41A 4ZVNA 3HUTA 4ETWA 3QVVA 4B3CA 1CVLA 2ZJ5A 1EP3B 4JWTA 1IJEA 3FIUA 4NQZA 2QXYA 1XHLA 2YYAA 5IK2A 3EDMA 1CS0B 3BAZA 1S9DA 1E3TA 2PFKA 2V6GA 1KVUA 3O83A 3BEOA 4ZEWA 5D1NA 2GTIA 3I6BA 2Q45A 3L93A 3U3DA 3NVKI 3C7AA 3UV7A 1CUJA 3IJEB 3KZVA 5ALEA 1PUIA 2Q8NA 2R1TA 4M6WA 4AAYA 3RYIB 5AFSA 5J1SB 3C7KA 1PR2A 1KK3A 3ZTTA 4IKOA 2DMRA 2P75A 1M34E 2CYCA 1EX7A 4MMZB 3ROXA 3AZPA 3ZH9B 4HJRA 4DSAA 2WTNA 4YV1A 3FMGA 1P1HA 3BS4A 3L07A 4Y0AA 1MW8X 2ATVA 3GW8A 1U7WA 4C0AC 2B4TO 2OAP1 4RA6A 1N77A 4AJJA 3GFOA 1M73E 2Z5VA 4RELA 3WDSA 1M2OB 2PUTA 1DHRA 1UMBA 1WABA 5THQA 3N0WA 2CMKA 2O6LA 3PHCA 3VJKA 1RACA 2NO5A 1UDXA 4QGGA 1B3BA 1Q3HA 1Y63A 2QMYA 3EA0A 1XVIA 3KBBA 2OQVA 2F55A 3HG7A 3JATA 1WDMA 4IJMA 1Q19A 4ND5A 3AM4A 3GCDA 1MRSA 1R10A 3NO4A 5DIFA 1KPGA 3SP1A 5ALSA 3NORA 2GEVA 1NIPA 5E6UB 4LJ7A 1FJGB 1G7RA 3R3YA 4DJFC 1ARZA 3GGOA 1L4GA 5K8IA 4DILA 2IIQA 4CEIB 1APBA 2OBNA 1DLJA 3IQZA 3L8HA 4XVQA 4I1RA 4Q9HA 1G21A 3PKJA 1PFUA 5CBKA 3AVYA 2MJLA 4YUWA 1SIOA 4RDHA 4HZUA 3HH8A 4BMZA 4ZMBA 2ZSAA 2LCFA 3TAXA 3WGJA 4CLOB 1BVHA 3BXGA 4FGLA 4O2RA 2X2OA 1RM3A 4O4IF 2GF9A 4TL6A 3PDIA 4EDFA 3U5ZB 1J9EA 2M6SA 1D1PA 2GF0A 2WTXA 4N8EA 1KI4A 1I3LA 1OMOA 5BVGB 1B0AA 3EMDA 3TDKA 4OBWA 2NACA 3DBHA 1LLQA 1SU7A 3EZLA 5EJAA 1RAGA 3DQPA 4AY6A 3NDRA 2BSXA 1EVLA 5TS2A 4GPBA 4JJ6A 1PIWA 5B1HA 1ISHA 1G2QA 4PCAA 4BNIA 1K6MA 2AMFA 2HC9A 2CFSA 5TVKA 4BNUA 2ST1A 1A8PA 3VOSA 3PX3A 1CC1S 3RIEA 3I9OA 4WZBE 1Y4ZA 4HPXB 3M3DA 5JS8A 5DI3B 4PXSA 3RFUA 5BN3B 5KSYA 2OY0A 1JU4A 3DV2A 3JQGB 4J94A 3Q8XB 4ND6A 2C9OA 4MVJH 4AF8A 5CA1B 2PU5A 5DWDA 3C87A 3HWX1 1XI2A 1DX6A 3PC2A 1WHTA 4LG1A 4NCHA 4LZPA 5B5SA 4DN6A 1A5SB 3FOBA 1IOZA 2DYKA 3C6KA 4PN3A 1FTQA 1A88A 2VSQA 4DA0A 4OG2A 5KNBD 5IT0A 1PT7A 4P7KA 3R6TA 2C77A 4DG9A 3K5WA 1RWXA 1C0LA 1F2UB 1VE6A 4N8DA 1N2BA 3RVSA 3WRXA 4RV5A 1CYDA 3A1EA 2ZR0A 5KTTA 1MDBA 4MXDA 5AHRA 3T7IA 5L3QA 3Q7TA 1I36A 4GXQA 5LDHA 1LTQA 621PA 2AD1A 1U2DC 2X0JA 1CZUA 1LRLA 1RKQA 5AJVB 5DHTA 3QUBA 4H7JA 2GT1A 1Q0PA 3CUSA 4B46A 4V0QA 4FFSA 1WY7A 3GP3A 1ZIPA 2QL6A 4N76A 2I2DA 1LF0A 1RQXA 5HQTA 3QY9A 4IJWA 1ISRA 4L8LA 1C7QA 2ZJ1A 1EIZA 4LHXA 4C29A 4BKPA 1T3LA 3JQ7A 3SQDA 2J45A 3I58A 3U3ZA 1RZUA 1U9JA 3DFKA 4YJ3A 4D9FA 3WB0A 3KYIB 3DR5A 4V03A 1OYVA 2I8LA 2YFKA 2DQYA 2W00A 3QUCA 1DIGA 2G67A 1GFIA 1GFZA 1STOA 3GK3A 3LBHA 3WGKA 2BHNA 2FWMX 2C9ZA 2QYTA 3N0TA 4GP7A 2DWOA 3KEOA 4ARCA 1AKVA 4KQ9A 1QLJA 3STWA 1OE0A 1CVIA 3F2IA 3ERCA 3SICE 5BSWA 4O8CA 4FGSA 1DV2A 3NNNA 3F3MA 3QH4A 2C4TA 4DR7B 1L0BA 1I1OA 1LJ8A 4MAMA 4UHEA 5SY4A 5K6RA 4N7MA 1W4BA 2VHYA 2CXOA 3ASVA 1O94A 4FJ1A 3KU1A 3ESBA 4H0FA 4N18A 1ID8A 2E85A 4ZAWA 1IUOA 4M22A 3I72A 4WK6A 4YJ2F 2VNIA 1REQA 2BEWA 3V4RA 3V55A 1VCIA 3WIOA 2IY9A 2GVDC 2H18A 1HH4A 1MQ9A 4LJKA 1SXJC 4M21A 4Y2UA 2W4QA 3PDWA 3ZLTA 3GPLA 3KZKA 1PYDA 1T3HA 2I22A 4AN1A 2BDTA 4EZEA 1MIOB 3ZD6A 1H8HD 3P1JA 3U16A 3PFNA 1MAUA 4PFKA 4X5OA 4CQMA 1GY8A 1JLLA 1UMCA 5EVCA 2EZTA 3HBAA 1OC2A 2IC5A 1KGDA 1YQUA 3ZDAA 3BGVA 3NJRA 4RM2A 1S01A 2P6PA 3KOOA 4W8GA 4L15A 5KQMA 1NI5A 2TMYA 2VDWA 2NUAB 1EXVA 1FFHA 4OQPA 4DM4A 1H4TA 1NNUA 2V7TA 4RZ2A 5D1HA 1UBJS 1M5TA 4Q47A 3HU5A 2VJMB 5T4HA 3KRTA 3RTCA 3UAXA 4B7UA 3NBKA 3DV0B 3G7NA 2C5AA 1WL8A 5JFTA 3VFDA 3FPJA 4RX1A 5TRTA 3CT4A 3EF3A 4GUAA 1P0IA 2EBHX 3AY3A 3KYDB 4K6HA 4LMBA 1ZK2A 5FB3A 3V8RA 3FOZA 4EMTA 4RZUA 3A36A 3X1XA 3CF4A 3PFCA 2CVZA 4NYMQ 4DWOA 2OAEA 1ZA1A 3K0EA 4ZFNA 1ECBA 3E5RA 2VNKA 3HV0A 4WXEA 3IUYA 4EO9A 1ADJA 2I76A 3X1YA 1SQSA 5IHXA 3DDZX 5IC4A 2QGZA 1GGVA 2VTVA 1V8FA 2Z57A 5LA6F 4OP3A 1Y8RA 2OV4A 1H0RA 4NSNA 4DLBA 1MJFA 4E2ZA 5J4YA 1Q0QA 2PR2A 3MCAA 2EJUA 3MYYA 3O03A 3OE7A 1E3WA 5GIOE 3LWZA 1KDOA 5HXAA 3H5OA 2P9ZA 1X2EA 2Z04A 5CFNA 3BRCA 3FUTA 5BYAA 3PCXA 3HB9A 1QVRA 4DT1A 1W35A 1F2VA 3DE6X 3CMCO 5L7WA 5AVRA 2AEMA 1N6OA 3BCUA 4IHQA 4QODA 1OH8A 4M9SA 2RAPA 5JZSA 1NYRA 4II2A 4QXMA 4BMOB 2XWPA 4FD3A 4EP1A 2FPOA 2G08A 2YDYA 5LUBA 2G1UA 4LNAA 4WGGA 3RAJA 2IDZA 4B40A 5BV8A 4XWAA 4EFDA 5ESRA 3WZ2A 2ZWMA 1ISFA 3BMQA 1GLNA 4YJKA 1S2DA 1JEYB 4P35A 4REQA 2PWYA 5FKJA 3H87A 4PZYA 2NU8B 3SF8A 3ZXIA 2GILA 1VCNA 3AEZA 1QHIA 2OWEA 1BE1A 4YT8A 1IC6A 2NZWA 3CB4A 3JAKA 1L6RA 4W5OA 4Y8VA 1YA8A 4N5LA 4UPDA 2QN2A 2XOKD 3VTFA 4ZRDA 4Z0HO 3H3XA 3V6MA 3W5UA 3IR5A 4COKA 2YZKA 4Z9XA 5IAOA 1VCHA 2RAVA 5C5CA 2BR5A 2X8WA 2X2PA 5FOXA 1X1RA 1RU3A 1JECA 5IUNC 2X8JB 3HCPA 3D4OA 1J0DA 4OGFA 3DO6A 3QELB 3D9QX 4A0RA 4FEGA 3RARA 2ZJ2A 2I66A 5DVZA 1P9WA 2JLQA 4NU6A 1SRRA 2FPUA 3OF3A 4IP0A 4BX9A 3S2GA 1DP4A 1PJRA 2OGSA 2W2QA 3T9FA 3MRTA 3OZXA 5IAJA 3P26A 2NTYC 4LISA 3BN3A 1LZKA 4JVOA 1JFFA 1NN5A 2I5PO 2IW1A 1PEKE 3VMMA 4B9AA 3OZTA 4TT3A 1A82A 2OFXA 2BFMA 5DYTA 2ZRFA 2C61A 4OX9B 3ASZA 1DAKA 2Y2VA 1DAPA 3DQZA 2C4MA 3C6ZA 1GSOA 2VTDA 4L4XA 3T4EA 1NV8A 3EZ9A 1O7JA 2VUUA 2JAHA 1X94A 4O63O 1UFQA 3C5EA 4DIBA 2H1CA 1W25A 5HCNA 3QE3A 4JL6A 5KYUA 1II9A 3TR6A 4G4IA 3CRVA 3FDIA 3CNQS 4ZPJA 5FL3A 2P2DA 5FPQA 4MLDA 4C4AA 3U80A 4KH1A 1Z7EA 4DMCA 2PMDA 2YY6A 4RORA 3WLSA 4TZ0A 3ZCQA 1YRLA 4G09A 3QOWA 2LWIA 2RGBA 3LW7A 1JHRA 2A57A 4W5TA 3LUCA 4MKIA 5TS3A 1E2NA 2F3PA 4C5BA 5ELMA 4KJXA 1A4UA 1CZKA 2HQ1A 1ZCAA 4RLFA 1ZESA 5IJXA 4BNFA 4BBJA 4AY2A 3NUGA 4WOCA 4KXUA 4HGZA 2FLWA 1JG2A 3E8XA 3OIGA 3PRHA 2HA5A 2R96A 5GONA 5B53A 3SKXA 3ZCUA 4GR5A 3I37X 4DNXA 1N4AA 4ALLA 4OUDB 1NXSA 1KNXA 1WUHS 3UB2A 3AESB 1Z7WA 4Q3LA 4QAQA 4XIFA 3SHVA 2YOGA 3ZY2A 4LW8A 5A5VA 5K0LA 2FQ1A 4Z53A 5KYGA 5I5EA 2EOAA 3A6GA 5JPCA 3SHFA 1CK4A 4N3GA 5IYZB 2XDYA 4D9KA 5KCMA 4QYTA 3MGAA 3OSUA 1NVEA 2DQZA 1O6GA 1VXOA 1KMHA 3KT3A 3AJ9A 4RDXA 4K81B 4DHEA 2XMZA 2YJNA 2GESA 3NFRA 4ZAVA 2IV2X 3FFWA 2VDRB 1N9GA 3GT0A 5D8DA 5T7BA 1VMKA 2RGNA 2PSSA 4ZDJA 3F9RA 1M66A 3HXKA 1L7BA 3N3AC 4LZZA 3EXFA 4TKUA 4A0SA 3TD2A 4WBNA 4GKJB 3TE6A 4AKTA 2R62A 4QIHA 4HH1A 1CE8B 4UVIA 4O2BA 4CZ2A 4E94A 4EG6A 5B1EA 5K0TA 2BFFB 1N1GA 3NHWA 3IPXA 2XYPA 2YYZA 3CLTD 3DOEA 3OOYA 4M1QA 3CUTA 4J6EA 4ZXPA 3P5SA 4K9LA 1K9VF 1PR4A 1TZJA 3TZHA 1OBVA 3B7GA 1ONSA 2OCBA 5I9LA 5AJXA 4UE6A 3VDRA 3UWMA 1Y42X 3A6FA 1K89A 2XWBF 4UW9A 4ZKDA 3P2OA 1JALA 2JLBA 3P9KA 4IFBA 1RCTE 3RK4A 4D3YA 2EYQA 1BMFD 1E7MA 1KEVA 3F96A 3WA7A 1VKJA 2PZLA 1DKRA 3AR5A 3CX7A 3M4JA 1YNSA 3DOCA 3IQFA 3ANTA 4Z9AA 1KI3A 4I5IA 3ZIAD 1LPOA 3QVXA 2I54A 3VZSA 5G3ZA 4Y67A 1GQFA 4NI5A 4UDXX 1KO8A 3CZ4A 4F93B 2WPNA 3H1EA 3DHVA 2D74A 4NEGA 3M6XA 4GOXA 4HTFA 4DA9A 2XGJA 1PX0A 2GAFA 5EIOA 3NGXA 3ZW9A 4BMYA 2YJ3A 4EIWA 1CJVC 2RARA 4XWGA 3PPVA 1I7SB 1IBMB 2G5GX 2CXQA 1IY1A 4XCXA 1WOMA 4JIGA 3MTJA 4CKCB 2AI1A 2D5LA 5HBGA 3SHWA 3UK0A 1SVOA 2VDJA 3I5MA 3M9XA 2CVHA 3OZVA 3JAWA 2XY4A 5ESDA 4EPVA 2ACWA 2XB6A 3G0DA 3FKSA 3H9QA 4ZAYA 2KLHA 4J0QA 5WRFA 5CGZA 4AZ3A 1VKOA 4EGQA 4M76B 3NDIA 2BGTA 2DHRA 4UNIA 3B6MA 1YCDA 1GGHA 3FW1A 5CA0A 1NIJA 2ZBDA 3EVZA 3DC7A 2IYUA 1TRHA 2P1RA 2Q99A 3SOZA 5KTRA 2P6RA 2DWPA 4QDZA 4IX1A 1VYTA 4ZXFA 1RRKA 3FLBA 1U2RA 4KN9S 1SUFA 1PTKA 4XGNA 2QD1A 2UZ0A 1A9PA 3EEFA 3MEQA 2HW8A 1ZEJA 2P40A 5EKDA 3BOSA 3PLRA 4OHCA 3LVBA 3RJ5A 1AB5A 3H7AA 1C3EA 3FUCA 2A1UA 1YJQA 3IE2A 4B80A 3PE3A 4LYJA 3W8EA 3DTVA 3TNYA 5CCDA 3OTHA 1LBQA 1KI2A 4BNWA 1DT5A 1M9NA 2GD2A 2ASVA 1VRVA 1DG3A 1JJBA 4V2UA 4WKBA 3Q85A 1N6LA 3OIWA 4KTVE 4ER7A 5BWMA 5GADl 1G20A 3Q72A 2W8BB 4AKEA 5AKKA 2F8TA 4IYRA 2W58A 3KP1A 4LWZA 4JOSA 1JJAA 2X19A 1OLXB 4REMA 3HJBA 3ZYCA 4UFNA 4QREA 4BB6A 1NXPA 1SURA 3SZUA 2RJ3A 2W2OA 2FN4A 421PA 3FHCB 3T1OA 5CDYA 1Y5IA 3KR9A 4X97A 1R0ZA 4I6GA 1ZY2A 2V54A 4DLRA 5K0FA 5EG5A 2PG3A 1IVSA 1J8YF 1J2RA 1JI3A 2W9XA 3C48A 1HEIA 3HNPA 2J0VA 2EVWX 2JHAA 4NFSA 1BDIA 2OGUA 4BKRA 4INAA 3DWFA 2XNCA 2FSHA 2I6XA 4ZV7A 5KTKA 4D25A 4NPAA 4ZI5A 4OXRA 1KI6B 5DMXA 4DJTA 3PEYA 4HUQA 4YO8A