4CMCA

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
267
structure length
251
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords PTERIDINE REDUCTASE 1
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
total genus 93
structure length 251
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cmcA00
1FJHA 1JU9A 1PJCA 4PIVA 3UCFA 4W82A 3DMYA 4Y6SA 3U4HA 4ALIA 3EK2A 3ZW8A 1JA9A 1P3DA 5BQFA 1UJMA 2VYND 2X0RA 5K6AA 2DBZA 3DOCA 4AJPA 3WBFA 1KEVA 4EGFA 1DJQA 4RZHA 3EHEA 2ZJ0A 3G1TA 3INGA 4W6ZA 3I9JA 4CUJA 4LVCA 1WZIA 4KQXA 4WLNA 3WIEA 1ZK1A 4BB6A 3FR7A 3QHAA 2BGKA 4BKUA 5GY7A 1T1SA 3DAFA 4FD3A 3RC9A 2LDXA 4DREA 2Q49A 3RVDA 3ZWWA 4PRKA 3DL2A 1WDKA 1YL5A 3C8MA 5AXAA 5A02A 1RM0A 2WJPA 5IG2A 2OHXA 2TMDA 4R41A 2ZCVA 3C1OA 4XZ3A 3OJFA 4JJIA 2O3UA 3UAGA 4D41A 4CMIA 5K0ZA 3B1KA 5ICSA 4DIFA 2YFQA 4OOFA 3W8EA 4QX6A 3FTNA 5KVCA 1NX6A 3PJGA 2QQ5A 2QW8A 1NR7A 5DBFA 4U8GA 2V6FA 4ALLA 1NASA 1PS9A 3GAFA 1UXJA 3MOGA 3U9LA 1SBYA 1F8GA 3ABIA 1I3NA 1ISIA 2ZB3A 4K6FA 4RORA 5ES3A 4F6LA 3GVHA 3KB6A 1PZHA 2AXQA 1C1XB 3S8MA 4ZD6A 1UXKA 1K6JA 2EHDA 1VL8A 1L1FA 3RIHA 4BNMA 2YJZA 4IXTA 4EDFA 1M67A 1O8CA 1GZ3A 4OH1A 2PZMA 1EVIA 3PIIA 3PK0A 4RDIA 2HMSA 3HG7A 1DC6A 4XGNA 2I6TA 3GG2A 3F4LA 4E5PA 2EKLA 4P8RA 3K2BA 1P45A 1A72A 5LDHA 2G5CA 3DBHA 4Y6RA 3JQGB 1UAYA 2CZCA 1UDBA 3IKTA 2YHUA 4PLTA 3DC2A 1NFFA 1A9YA 4HX5A 3RUIA 2BRUA 3JQDA 4TQGA 4E5KA 2IEBA 4AFNA 2HQ1A 2EXXA 3RSHA 4WEQA 1JKJA 4M8SA 4WLOA 1M2WA 2Y1GA 3CINA 3VDQA 3WSVA 4FBGA 3MWDB 2B83A 2E49A 4ZQFA 1DEHA 5B1YA 3QRWA 3GRKA 4IY1A 5A04A 1C0LA 1J5PA 2BGLA 4DPMA 1HSOA 1YE3A 2QRLA 4FC6A 1UR5A 2VQ3A 1RM3A 2OORA 2R00A 2RCYA 4GLOA 1W4ZA 4PZCA 1NHGA 4WNIA 1X15A 3C7CB 1LRLA 3PEFA 3VTZA 2ZYGA 3H5RA 5LDGA 4DUPA 1K2WA 2HK8A 2CNBA 4UUMA 3VKVA 5BR7A 3LSYA 2XPCA 4WJZA 3GDFA 5IN5A 3WMWA 4BGUA 4BOYA 5C3MA 3JYOA 4XB1A 3PDUA 1A4IA 3LDHA 1XCBA 3F46A 1U2DA 3U4DA 3U3XA 3WGYA 3HFSA 1H0KA 1HRDA 5KWEA 3BYZA 1PS0A 4II3A 3TZ6A 3AFNA 3H3FA 3PWSA 1NM5A 4HXYA 3CPSA 3NEPX 3PLRA 1I36A 1U3UA 1VC2A 3K30A 3BTVA 5JC8A 5I7VA 1JTVA 2EIHA 1I0ZA 4MVJF 2UAGA 5L7YA 1JW9B 2B0JA 3QVSA 4BO0A 1R4NA 4CQLA 3BA1A 1CETA 4BO9A 4XDYA 3NT2A 1C0KA 3GPDG 4L0QA 2FOIA 3EW7A 2J3JA 3WWYA 4L9RA 3C24A 2V6MA 1JLLA 4RCVA 4CMHA 5FF9A 3K2EA 1GD1O 4R1UA 5G0TA 4BO3A 4GX2A 5THKA 4R3WA 2VT3A 3WQRA 4DPKA 1KOLA 2GASA 2NACA 3E6AA 1NP3A 4BS9A 3JD4A 1HKUA 4MVJM 3V1TC 2FPGA 4PZDA 4E13A 3LYLA 4BMNA 3QQPA 4KDFA 3JTMA 4Z3DA 1JWBB 1MV8A 2IODA 3IC5A 3GFBA 2OBYA 4CPDA 4RV9A 2PY6A 2YV3A 3NTQA 1HDGO 1W0CA 2UDPA 5IXYA 4I5EA 3PHHA 3DFUA 3WS7A 1CWUA 5A05A 2YV2A 1U2GA 4YRAA 4XQEA 2C20A 2FPPA 3PJEA 3CMCO 4I5DA 1LBEA 5THQA 4BNJA 3TFOA 1GCOA 3AOEA 1SB8A 7MDHA 1I3KA 1MUUA 1UZLA 3SC4A 1GTMA 3O8QA 3VZSA 3RAJA 1DIRA 1U7HA 2RH4A 4KUHA 1ML3A 2QHXA 2QIOA 3SC6A 1KS9A 5BT9A 1LDMA 1XA0A 3GLQA 3JQBC 5FYDA 5JMPA 1Y81A 3AM3A 3RBVA 1U5AA 2R6JA 3PYLA 3PPIA 2PH5A 4TRMA 1LJ8A 2OO5A 5JC1A 2JFFA 5L7TA 2YHIB 5JCJA 1BDBA 2ZB7A 4A7PA 1D8AA 2AEMA 3ZU5A 4U7WA 3EAGA 2WTBA 4U5QA 2NU8A 4UEOA 1NPDA 1RM5A 5IDWA 4IDFA 3O26A 2YUTA 3UFXA 1X0XA 1B15A 4XR9A 2TMGA 2NNLD 4JX8A 3FWZA 4JBGA 4JJGA 3E18A 5A5FA 1EFLA 4IDEA 5KJEA 5CAEA 1PS8A 2X6TA 4PG6A 1BMDA 4OGWA 4JGBA 1U3TA 1PR3A 4CUZA 3HB5X 4XWYA 1Q7BA 1PX0A 3GZNA 1NFRA 1H5QA 2Y67A 3TWOA 1LSOA 1EFKA 1GCUA 3FSRA 5TQVA 1BDMA 3CMMA 4UEJA 5EINA 1E1MA 2DQ4A 2ZTLA 4KDEA 3WQQA 4EEXA 1GADO 4IQ8A 5ITWA 3DFZA 3VPXA 2G82A 3DZHA 1DFIA 1XIVA 2UUPA 4HY3A 4NFHA 5G4KB 4EYEA 5TLSA 1GPJA 1PL8A 1OAAA 1BWSA 3HB4X 4EUFA 1LLCA 3ROPA 5IFLA 4JJFA 4JNKA 4JQCA 1EVJA 4PZEA 1YBMA 5EMHA 2GSDA 3EDMA 4IQGA 4KTVE 3I4CA 4XGIA 3PTZA 1YOVB 3FN4A 2Q1TA 1X13A 2NU9A 1ZFNA 4J1NA 4PLWA 1ZMOA 2A94A 3V2GA 3G0OA 2JFHA 4INAA 2DFDA 2WD7A 4QSMA 4YTEA 3D4NA 5AXDA 2H5LA 1BVRA 1FDWA 2NQ8A 4EEZA 4GSLA 4CMEC 4HV4A 3OICA 3CTMA 1E6EA 2PNFA 4UUNA 4IMPA 3T4XA 4CMGA 4PG4A 3OA2A 3R1IA 4YAJA 1Y9AA 2HRBA 4FGWA 5CFZA 4E31A 3D5TA 4O0LA 5CPFA 4HFNA 1PJ4A 1IULA 3I9NA 4GGOA 3R0IA 3ZWAA 4Q3DA 3Q3CA 4W7HA 3U09A 2CVZA 1K5HA 3IAHA 4MKRA 1Y1PA 3KETA 4FCCA 3E9NA 1M76A 1MC5A 4B7UA 5L53A 1JVSA 2EW8A 3H7AA 4YCAA 4B3JA 4MIYA 2NVUB 4WEOA 3WTCA 1W6UA 3H9JA 3QW2A 1DAOA 5DCWA 3GEMA 4MVJH 4MVJA 4OL9A 4WPGA 5F1PA 5HM8A 4XYMA 4F3YA 4DLLA 2WWRA 1ULUA 4NH4A 3QSGA 1DC4A 1EBUA 1Z7EA 2I3GA 3F6YA 4FFOA 3D3EA 1RYEA 4JP2A 4E32A 5MDHA 1B8PA 3Q2IA 1B8UA 2HMVA 3TRIA 4YQZA 3ZI0A 1EQ2A 5GZ1A 4OSOA 4YJHB 4IJUA 5ENVA 3DZFA 2X5KO 4EI2A 2EEZA 3DBRA 4N7RA 4A26A 2DPHA 4X54A 4BO1A 4DC0A 4YB8A 1ZXBA 4IMRA 3AOGA 2Z1MA 3VZRA 4YA6A 4OKNA 3W4IA 5CEFA 5A1TA 1CYDA 1PEDA 4WKGA 1SO8A 2WEKA 2B35A 3TOZA 3I6IA 1KVRA 5KJFA 1PU2A 4I5GA 3MJTA 4PLGA 4P4GA 2VYVD 3G17A 1TVEA 3WQSB 1E1LA 1QYCA 4WLFA 1E77A 4RVUA 2ZTMA 2X1HA 2G76A 3NUGA 1ZSNA 4CM8A 2VWQA 4ONEA 3K92A 3SJ7A 3ZZNA 1IHXA 1MLDA 3OJLA 4LVUA 3RFTA 4J4TA 1YDEA 3I52A 5TGDA 1HE3A 4IUYA 1T25A 1WLYA 4CV2A 5H81A 4DWVA 5BSFA 4M87A 1DC5A 1E7MA 1Z75A 4D3FA 3GVPA 2C54A 3M2TA 3PFWO 5FFFA 3WGOA 1AGNA 1SEVA 1WXDA 3EVTA 3HJAA 4NK5A 4DBVO 2HAEA 2C7GA 2X23A 2JCYA 3RWBA 2YQ5A 4ROSA 4YACA 4UVHA 1VL6A 3S55A 3ZDFA 1PSDA 4BNFA 3V1UA 1IHYA 2HUNA 3ZHYA 2J8ZA 2X7HA 1NBOA 3GQVA 4R4JA 1PWZA 3QY9A 4WUVA 1U7TA 3GT0A 3ROMA 1I5RA 2PD3A 3AFMA 3VTFA 4A73A 3LT4A 4R51A 1P44A 2JL1A 3H9GA 4GSKA 1IYZA 4Z9YA 4IGEA 2WYWA 2IXAA 4BNIA 1O0SA 1A4UA 3TOXA 1KVSA 1DRWA 2O3QA 3BXXA 1HZJA 3JYPA 2GR9A 1TA4A 3ZWPA 4YXFA 3PYMA 2AQHA 2B37A 3EVNA 3M2PA 5DP1A 1LSUA 3DBLA 4DQXA 3U62A 4MKXA 3WGGA 1M6WA 4E6PA 1BTOA 3X2FA 2NSDA 4CLOB 1DAPA 2I67A 2DTXA 4BNWA 3V8BA 4BHTA 1GL3A 4XRRA 1MC4A 5AVOA 1GEEA 3JQ7B 2CSUA 3DHEA 4J1SA 3WJ7A 1O95A 1GPDG 4KWHA 1I2ZA 3ANNA 3I9OA 3B70A 1X1TA 1BSVA 1UAGA 1NQOA 4RF4A 3TL2A 3L0DA 3S2IA 4UULA 2GZ2A 4PFJA 5I7SA 4NU5A 1PZEA 1E0DA 1O89A 4BNTA 3PHLA 4P22A 4EJMA 1KC3A 4ALMA 5IZCA 2FR1A 1A7KA 3ORFA 3MWEB 3ZV6A 1Q0HA 1R6DA 2D2IA 1I32A 3CZRA 4RDHA 4BNLA 3Q1LA 4J1TA 3ULKA 1N1GA 1OBFO 3AU8A 1I10A 2NUAA 2ZJ1A 4GVLA 1J49A 2Q2QA 4XQCA 5L4LA 4BGEA 2UV8A 5BSEA 3NAQA 3ETEA 1LU9A 2VHZA 3BTUA 4UEKA 4PLCA 2CDBA 4PRLA 2OGUA 2X8LA 3A28A 1F14A 1HE2A 1SAYA 2Z1NA 1EUCA 1SNYA 2YHIA 4RVSA 2E4AA 3C7DB 3KBOA 1SOVA 1E6UA 2CMDA 2Q99A 4DQUA 4FQ8A 2HK7A 4GX1A 3QA9A 2Q3EA 3BHMA 4KWIA 4OOEA 1LNQA 4DMMA 3SVTA 3RUDA 1ADBA 2J3HA 1WPQA 1E1NA 2OUIA 1JWAB 3GFGA 1PJ2A 1EEHA 3ENNA 4NBRA 1E5QA 4N5MA 5F5NA 3JQEA 4CMKA 1IB6A 3RD5A 2X9NA 4H7PA 3P7MA 1N2SA 4RQTA 5JO9A 1HL3A 2VYNA 1MG5A 1P1KA 3KYDB 5JS6A 3T7CA 4TKMA 3RC1A 3IUSA 3BMOB 4M1QA 3D4OA 3LC7O 1YGYA 3K6JA 3L4SO 3NDIA 3C3XA 3ZNNA 3BHIA 1YL7A 4B7XA 4DPLA 4RF3A 3ZU4A 3HE3A 2X22A 2J6IA 4URFA 1NVGA 2D4AA 3LT0A 5A9SB 3R3JA 3K5PA 4TZTA 1V3UA 3JQAD 1PR9A 3PHJA 3FF4A 1UDAA 2X86A 2FY8A 3VPSA 3DWFA 2C82A 3D5QA 3UGKA 2Y0CA 1YOVA 1OFGA 3GVCA 2PWZA 4GPD1 3C85A 2BH9A 2VUSA 4XRGA 3GH3A 4MVJI 2OL4A 3L9WA 3TF5A 1ZK2A 3A14A 1XG5A 4CM3A 5KTKA 1Y7TA 2HJSA 4CMEA 4ZHSA 4FFNA 4FJ0A 2QZ9A 3VH2A 4C4OA 3GDGA 2RAFA 4BV9A 3KUXA 2FSSA 5B37A 4EUEA 1E7RA 3OP4A 1LC0A 2O3TA 4DXHA 4FPXA 1F0YA 1GAEO 2YQ4A 1DIBA 1P1RA 1LRKA 2Q45A 4D45A 1E3WB 2NTVA 1J6UA 1TT5A 1I24A 2DFVA 3KYBA 2EKQA 4GWGA 4QFDA 4A0SA 4DLAA 4DIBA 2WYUA 3RFVA 1HDXA 3L6DA 3RC7A 4E2XA 3TQHA 1G1AA 7ADHA 2JFGA 2EGHA 1A27A 3PQEA 3RFXA 5IXSA 4J2OA 2NVUA 5KNLA 3LLSA 1FF9A 2G0TA 2H9IA 1P1HA 1R12A 5A9RA 1P33A 1I2BA 4L73A 5HS4A 1K89A 3FNEA 1AUPA 1T2CA 4CLRB 4AL4A 1FK8A 3I9MA 4BNNA 3EY4A 5JDIA 2ZYDA 2Q1WA 2VCYA 4LMPA 4YEDA 4BIIA 4B3IA 3AUUA 1GZ6A 2VNSA 5L7WA 2QRJA 3FR8A 3K31A 3RUFA 1DPGA 3QWBA 4UVIA 3W8FA 2GERA 4BL5A 2FR0A 4YAEA 1OC2A 5A3JA 2AHRA 3DONA 1P74A 4IGFA 4N18A 3QP9A 4NFYA 2GN6A 2IXBA 2NU6A 1OMOA 3TPCA 9LDTA 6ADHA 3CKYA 2GD1O 4BO4A 3GNQA 3NX4A 1N9GB 1ZBQA 4CMCA 3LC2O 3OSUA 2CF5A 2DLDA 3BMNB 1D7OA 1E3EA 4O5OA 1I2CA 5EL0A 4GVXA 4MIOA 2WD8A 4HFRA 4CQMD 2VWPA 1ZEJA 4UVGA 4AJKA 5JY6A 2PZJA 3OQBA 1UUFA 1YKFA 2H1SA 3GHHA 1EQUA 2E48A 2QG4A 4XGKA 3Q9UA 3L4BC 1ARZA 4N5LA 4GL4A 3RC2A 2EGGA 1EVZA 2J5KA 1HE5A 3FPLA 1Q7GA 3AW9A 1GYQA 4BV8A 4CR7A 4ZGWA 5KCZA 4IIUA 1PJLA 4Q3BA 4K6CA 3HDQA 4F6CA 5JAZA 2O4UX 1X1EA 4FJ1A 3ZV3A 2EJWA 5A3VA 2VWHA 4XIYA 3Q0EA 5KIAA 4CM1A 4DRYA 1R0SA 1DIGA 1O5IA 1P0CA 4QXMA 5U1PA 4BNXA 1M66A 3GRPA 1H2BA 2XOXA 1Y6JA 2QZZA 4YJGB 3ZU2A 1LUAA 1JKFA 1NTOA 1IUKA 2PD4A 4ESOA 4XYGA 3W4KA 4S3MA 4GMFA 3B1FA 1E3LA 3NGLA 4B8WA 1H2HA 2C2YA 2VTEA 3RUHA 1U8XX 2V7PA 3GN1A 3MJ4A 4DMLA 4GQAA 1R0LA 3WICA 4BNHA 2IYPA 3QVWA 4J7XA 4CM4A 4YBZA 4PVCA 2NQTA 1CRWG 1DIAA 4MO2A 3ZWYA 2BHLA 3LT1A 1KEPA 1X0VA 2I65A 4JROA 2C07A 5JNLA 4WCFB 1U8FO 5L51A 2NVBA 3RUEA 1DLJA 1WDLA 4MP6A 4WCFC 2ZK7A 3IL2A 3I83A 3EC7A 1E7QA 4ZA2A 3OM9A 2Y1OA 1N7GA 3HDHA 1XQ6A 1UP7A 2I5PO 5B4TA 1HEUA 3PYXA 3JD0A 1DJNA 1ONOA 1ID1A 2OBNA 4GX5A 4U0JA 5K9ZA 1QYDA 2AA3A 1CQIA 2EP7A 3Q2KA 3WR5A 3U4CA 5FEUA 3JQ7A 5I9LA 1P31A 4NFSA 1PL6A 4M89A 3VVBA 1PJ3A 3PI7A 3D4PA 5DP2A 4D0RA 2J3IA 1DXYA 2QYTA 2YW9A 5F21A 1ZH8A 3DMTC 3TZHA 1ZSYA 5GMOA 1LDBA 1VJ1A 3WLFA 5JYEA 2VUTA 4OO3A 4RF5A 4R68A 1XKQA 1YB1A 1ADCA 2FHSA 1DIHA 2PA3A 4QO7A 4W7IA 5L3ZA 1ORRA 4E5MA 3L9XA 2V6BA 1M75A 1R16A 1T26A 1S7CA 1RJWA 5C5IA 1NAHA 3T4EA 5B12A 3GOHA 1XWFA 3AUAA 1DFHA 3RUAA 3C7AA 3ROKA 3ZN2A 3I4FA 2P91A 2A35A 3ICCA 2J5RA 4NJOA 4QT0A 4TWRA 4PN3A 5ER6A 5TJHA 1R15A 2Y68A 1EBFA 4ND4A 3EMKA 2RHRA 4Z6KA 3G1UA 2NV6A 1Z74A 4EZBA 2X9VA 2C5EA 2POQX 2YY7A 4HADA 1H6DA 1CF2O 2YDXA 3OJOA 4QEDA 3ADOA 1YQDA 3WWZA 4PG7A 3BMCB 1HDCA 4FS3A 4TRRA 1PJTA 3H9UA 4GMGA 1U28A 1XU9A 3U4IA 1BHSA 3LT2A 3Q6IA 3TDKA 2VHYA 3W6UA 4ITUA 4MVJE 4NU6A 4DL9A 5TNXA 4DYDA 2VHXA 2DTDA 2W98A 3HN7A 4B8ZA 5A06A 2VZ0A 3INRA 1CEQA 3GMSA 1WW8A 3QV1A 1Y8QA 4PVDA 4U6QA 3PDJA 3S1LA 4J6FA 1BG6A 2P9CA 2ZTUA 3JQAB 3WDSA 3RUCA 5AXBA 5T8KC 5JDCC 2JKVA 4W9NC 1QP8A 4MOWA 4WNCA 5A9SA 1KERA 4Y67A 2P2SA 4K1LA 1ENOA 4WOKA 1A71A 2RHCA 3LLVA 1BXZA 4YYZA 3VDRA 4CMBA 2WMDA 4B3HA 4RLSA 1E3IA 4RJTA 4UUOA 5KJ1A 2CF6A 4DYVA 2Q4EA 2V65A 4H15A 1ZXLA 2VRCD 3K96A 1Y5MA 5EJ2A 2QX7A 1HYGA 5A03A 1EVYA 5KOIA 2GRAA 3AUSA 1Z82A 4CM9D 1ZK3A 4GWKA 2DT5A 3QWFA 1KBZA 5COAA 3S2EA 1XLTA 1DOHA 1SZJG 3DAPA 3SLGA 4OYRA 4HNHA 3ZNPA 4TROA 2WE8A 4RVHA 2EG9A 3DR3A 4MP8A 3MEQA 4CR8A 1CDOA 1E3WA 5TF4A 2NU7A 4ZQGA 1KVTA 1D3AA 3ASUA 1H6AA 1V8BA 2HRZA 4HFJA 4I08A 4BUCA 4W99A 4YJFB 1GUFA 4ZRMA 5TIIA 1NVMB 2NTJA 1GUYA 1P1IA 1B0AA 3WTBA 2W90A 2IZZA 2JCXA 4DLBA 3WNQA 3I3OA 2Y93A 3UICA 4C7JA 1JQBA 1LX6A 5I8WA 3HADA 4G5HA 4E21A 1VI2A 2YZ7A 2C5AA 3KM0A 4CLHA 2Q50A 4P4NA 4XKJA 1K0UA 1UZNA 2BI7A 4EUHA 4XQ9A 1GU7A 4K26A 4WASA 5DDIP 3KYCB 2VTDA 3LU1A 4J2HA 4BNGA 2B5WA 4ZJUA 3E9QA 3X2EA 2A92A 2W2KB 4CLRA 3G49A 1KVQA 3TZKA 1VKNA 1MX3A 1ONPA 2NWQA 2JJYA 1Q0QA 3PHGA 1IE3A 3IIEA 2O50A 5I8ZA 4D79A 5G4LA 5I7FA 3O9ZA 4R69A 5I7EA 2O48X 4W4TA 5KKAA 1NWHA 3DZIA 3AY3A 1R4MB 2VHVA 4TVOA 4XQGA 3NJ8A 3UF0A 2VYVA 3DEYX 3GA0A 4H3VA 1C1DB 1ZZEA 4R01A 4AICA 3RCBA 4EITA 4PG8A 3WLEA 3KZVA 4XCVA 1ADFA 3W4JA 4XJSA 1YJQA 3MOIA 4RO0A 3H2ZA 1FMCA 4E5NA 5C7IO 3F5SA 4CQMB 1N9GA 1E7WA 1PZFA 4Y8VA 2J3KA 1E92A 3BMNA 2I9PA 1Y8RB 2HJRA 2WE7A 1XYGA 1C0PA 4HKTA 3JCZA 4E30A 2CVQA 4JIGA 5T6BA 3OMLA 4ND1A 3JV7A 1C3VA 3QVTA 4KP7A 1O9BA 3MJVA 5CPBA 2JHGA 3PWZA 2HCTA 1C1XA 2Q2WA 2VWGA 4CL3A 1LDEA 4QTZA 5F1KA 5JYDA 2IRWA 3JQCA 3OEYA 4NI5A 3H3JA 3H4VA 4OAQA 4LSWA 3NT5A 4MINA 1IY8A 4NBTA 2RH8A 3PQDA 2HMTA 2O2YA 3HDYA 5G2OA 1HXHA 4FGSA 4J91A 1LLDA 4DBZA 4YJGA 1YDWA 3CE6A 1BW9B 1Z45A 2QRKA 3OIDA 2C59A 5G0UA 3GNTA 3JSAA 4IDAA 4CMJA 2ZKLA 3KSUA 3JQGA 1F17A 3F3SA 4MDHA 2E82A 4L8VA 4DGSA 5DCUA 3O4RA 1AN9A 1WMAA 2W2LA 4G2NA 4F45A 1LLQA 4E33A 1ZJZA 4NR0A 2C0CA 1OZAA 3W6ZA 1LI4A 1TXGA 2VNAA 3NTOA 3SLKA 8ADHA 8LDHA 4WECA 1LDYA 2WM3A 1KY4A 4WLVA 4CJXA 3FWNA 4J3FA 3OQ6A 4R1SA 1QRRA 4LCJA 3NRCA 1MXFA 2CY0A 1LSSA 3BTSA 3H5NA 1HYHA 2D0IA 4M54A 3ZWCA 5KVQA 4J90A 1DRVA 1LRJA 2EW2A 1K6IA 4DIOA 2PK3A 4KOAA 2X5JO 3HWRA 1D1TA 3NJ4A 1WZEA 4PLHA 5KVVA 2E37A 4IZHA 3U49A 5I9NA 5CP8A 4XYEA 1Q7CA 4KZPA 3QJ5A 1SPXA 1KVUA 2PKRA 1QMGA 1GQQA 1V9LA 3DOJA 5DZSA 3ZNQA 3GZ4A 5JAMA 3K8ZA 2EJVA 2WDZA 3CUKA 4YAGA 3FCOA 1GEGA 5ADHA 4XYLA 1NYTA 3AU9A 3ONDA 3PIDA 4AVYA 4CMIB 1B26A 2FZEA 5ITVA 1SCUA 1J0XO 4RL6A 1C0IA 2ZATA 2D8AA 3PJDA 3DO5A 3UW3A 4YT8A 3KVOA 3Q9NA 2VUUA 5CDGA 4J0EA 4CV1A 3WYCA 3DTTA 2DPGA 2DTEA 3MJSA 4IXWA 4PLPA 1X7GA 2PKQP 3RBXA 4FFPA 3GMDA 1NFQA 1HE4A 4J7CA 3E82A 2IDZA 3NTRA 1UXIA 3EGOA 3INTA 4KUEA 5ICMA 1ZNQO 5T5QA 4XEHA 3VH3A 1PZGA 1E5LA 2BFAA 4MPDA 4WLEA 5LC1A 4NBWA 2AG8A 5JE8A 2QYSA 3KLPX 2BFOA 5C7LO 1NQTA 1NHWA 4E12A 1ONNA 2AE1A 4WE3A 5C37A 1EDZA 3P5SA 4Q3EA 4HBGA 3QWAA 1K6XA 1EUDA 3KOUA 4OQYA 4IM7A 3TSCA 1DLIA 2PZKA 2BGMA 1GYPA 2DM6A 5GZ6A 3BMCA 1B7GO 3PJFA 4AJEA 4BO5A 3AM5A 3TJRA 3CH6A 2Q4BA 1GZ4A 4KUGA 4R16A 3VVCA 4AJ2A 5COBA 4JLWA 1O94A 1F8FA 1XSEA 4WK6A 1UDCA 2DVMA 3C1AA 1ZUD1 4IIVA 4FR5A 4S1VA 1ENYA 5KKCA 3PRJA 1HDYA 2EF1A 4MVJG 3H9QA 3ZWXA 1DC3A 1LTHR 2P5YA 1B2LA 3SJUA 5T8KA 1XDWA 5JDCA 3F1KA 2GGSA 2R00C 5H83A 3BMQB 4CM7A 3JQBA 3KXDA 4Z0TA 4P4LA 1ZJYA 3DAGA 4YQYA 3H5AA 4UREA 2IEDA 3JYLA 1EE2A 4A2CA 5BSHA 5JAIA 1PGOA 4E2WA 2YFHA 3FNFA 1CERA 3F47A 1UXGA 4DQVA 4PLYA 4RPHA 4CLDA 4ZRNA 4NBUA 3B6ZA 4U0KA 4D3SA 2GO1A 4I9HA 4FFMA 4JP3A 4BNVA 5AXCA 3DB2A 3ENKA 1W73A 3RKUA 4E2ZA 4QECA 1SMKA 1ISGA 4CMAA 2B36A 4FW8A 4B79A 3O03A 2D1YA 3DTYA 1R4NB 4IDBA 3UUWA 4Z3KA 5CEJA 4NNJA 4D46A 1SOWA 3A1NA 3VZPA 4CQLB 3M1LA 5EIOA 4OM8A 4LMRA 1AXEA 3GAZA 3OH8A 2IE0A 1P0FA 2YYYA 4NHEA 1N92A 4HNGA 3IQDB 2O3SA 5JCXA 1XR3A 1NQAO 1GV0A 4TKLA 5CHEA 3U0BA 3IJPA 1BVUA 1YBAA 1Z73A 1QSGA 3WOHA 4CM5A 5T64A 4DTIA 4YRBA 5ILGA 1MGOA 1YQXA 1YL6A 5G4KA 3EZLA 2W2KA 4L4XA 4CM6A 2B4QA 2X4GA 1V3VA 2FPIA 4Z0PA 4CV3A 3D7LA 3FTPA 1HWYA 3SX2A 2PGLA 1RWBA 2E6UX 3PWKA 1DO8A 1XELA 1YBVA 5TT0A 1NPYA 4BO8A 5BSGA 1VRWA 3DZGA 1ZCJA 4OMUA 3OEWA 4NJMB 1R4MA 3GY0A 1XGKA 4O6VA 4RF2A 1QYXA 1WWKA 2P5UA 1C1DA 2BELA 3AI3A 3H8VA 2D5CA 4YRDA 3JQ8B 1D1SA 2O7SA 3KO8A 3O8QB 1XU7A 3CZMA 3ZNOA 2Y1FA 4YWJA 4I1IA 1I3MA 1W8DA 1P1JA 2JHFA 3I5MA 1NNUA 3ITDA 4R5MA 4CLXA 9LDBA 1PJQA 3WGHA 1KETA 4CQMA 4HP8A 1TT7A 1LDGA 1PGQA 4A5OA 1UZMA 1G0OA 4Q39A 4II2A 4K9DA 3G79A 3S2FA 3VH4A 1DSSG 1PIWA 1ZO8A 4RPKA 4L4RA 4RPGA 2NM0A 1ENPA 5JSFA 4AJJA 4UUPA 1WDMA 2FRDA 4ZU3A 2HKIA 4J4BA 4XYBA 1EK5A 4DC1A 3EZYA 3LF1A 2X0JA 4Y98A 3KSDO 2W4QA 2HSDA 1TB4A 4XD2A 1XHLA 4AJLA 2ZTVA 3ZWMA 2I3AA 1H94A 3N58A 5DULA 2G17A 1I01A 4L76A 3ONEA 5T57A 5H82A 2FP4A 4R1NA 4IPTA 1OOEA 1E3JA 1BW9A 1WP4A 5JBIA 3GZNB 3MJCA 4NMHA 1YXMA 3GNSA 1PL7A 2PKQO 5G0WA 1VJ0A 4AJHA 3AUTA 1HSZA 1IZ9A 1YONA 5ENDA 4YJHA 3P2YA 4BMSA 2CUKA 2Y1EA 2FZWA 1H9BA 3IP1A 2B4TO 1JN0A 2C29D 4IQ0A 4RGBA 3AI1A 4PGFA 3WNVA 4MVJP 3R3SA 3DHYA 4NPCA 2GN4A 4PCVA 4XDZA 1RM4A 1ZKMA 3RROA 1QG6A 2EKPA 3DDNA 3N74A 2DBQA 4YDRA 1FDUA 1GUZA 4GH5A 5DOZA 2VT2A 1IPFA 1U4SA 3V2HA 2PGDA 3PGXA 4K28A 3WJAA 1T1RA 2PD6A 1LSJA 3VC7A 1R0KA 2Y0DA 2WD7B 5F3RA 4GI2A 4XIJA 1ZEMA 1S6YA 1OC4A 4YAKA 3HNPA 3L07A 3H6KA 4ZVVA 4PG5A 1FDTA 2GDZA 5TSDA 3VPFA 1VSUA 2VOJA 3V2UA 1H9AA 3DBVO 4ZICA 2O3RA 3A06A 2AQKA 2PFGA 5TRTA 1TI7A 3TN7A 3ZGYA 2B5VA 3FHLA 3JYNA 5L9AA 1EK6A 4HUJA 4EJ0A 1FDVA 3ETGA 2GLXA 1ZK4A 1N8KA 1MB4A 1E3SA 1JAYA 2FR8A 1PWXA 4ALNA 5JY1A 4IS2A 1OI7A 2UVDA 4O63O 2WSBA 2BF7A 3F5QA 4L4SA 3VH1A 4TSKA 3UKOA 3GK3A 4UVDA 3RBZA 3VAZA 1GV1A 3LK7A 1PJSA 4KTTE 4ZQBA 1HETA 1ZSVA 2EWMA 5DBIA 2OMEA 1YVEI 1ISFA 2BFPA 1HT0A 4J16A 4JXKA 5HA5A 4Q3CA 3CXRA 4BO2A 3QIVA 4UAGA 1RPNA 3DHNA 5AOVA 1EDOA 1MA0A 3BTOA 5FWNA 3NT4A 4D7AA 3DZBA 4UVEA 4WCDA 3ZU3A 4MP3A 2GN9A 3DBRB 2H63A 5CDSA 3ZWVA 2HLPA 2VZ9A 5B4VA 4JBHA 4I5FA 4CLOA 3NDRA 3WX0A 2X5OA 1Q2XA 4B7CA 2CDCA 2ZIZA 4IBOA 1R66A 2SCUA 2P9EA 4N5NA 4AJOA 2GN8A 1AHHA 2RBEA 4I8XA 2JAPA 3ZHZA 2AEJA 4JBIA 2IZ0A 1NVTA 3KHUA 1Q0LA 3OJ0A 1YB5A 3WFJA 1V0JA 2XAAA 4WGGA 1JKIA 3GN2A 3GGGA 3STHA 4CM8B 4OIMA 3TNLA 4OJNA 1Y9EA 2LDBA 5L40A 4GX0A 5JMWA 3OA0A 2X0IA 3NGXA 2FMUA 5KJ6A 2P9GA 3BMQA 1RYDA 4U6SA 1VPDA 1L7DA 4AJ1A 4RPLA 5A4DA 2PTGA 2JCVA 4NK4A 1B3RA 1VKOA 3ROQA 1QV6A 4HFMA 3IKVA 4OXNA 2VRCA 3PZBA 5COQA 4TRJA 2Y0EA 2W8ZA 3P19A 3HN2A 4ALKA 1QLJA 1ZIDA 4OSPA 4CM9A 1PQUA 3R6DA 4LRTB 2C7VA 1U9JA 2OP0A 3KLMX 4R1TA 2O3JA 3GGPA 5IDXA 1M6HA 1BXGB 4B4UA 1LDNA 2ZB8A 3GHYA 1WAMA 3KTDA 3FBGA 3ADPA 3GR6A 3QWIA 3ST7A 1A5ZA 3ZWNA 6LDHA 3DZKA 3CEAA 4BNZA 3A9WA 2EERA 1SEPA 3ANLA 3EYWA 5EPOA 4RVDA 4GLLA 2CDAA 3AWDA 2GCGA 4IZIA 3UCEA 2BI8A 5EERA 3NKLA 3SBOA 3FNHA 3VZQA 3WGZA 5IJZA 2HO5A 4PLFA 3RQSA 3FPCA 2CD9A 1BRMA 3DQPA 2HMUA 2X0NA 4LCEA 3B1JA 1QKIA 3DBLB 3WXBA 3ZHBA 1LEHA 3KYDA 3TZCA 1HYEA 4KMSA 4WLUA 1U5CA 4FSHA 3A4VA 3BMOA 3WYBA 1T2DA 1J4AA 1WMBA 5ILOA 2AQ8A 4O1MA 5IDYA 4R3NA 1GFSA 3Q11A 5HBRA 3PQFA 4AJIA 5IN4A 1H6CA 1KEUA 4YT2A 1I3LA 4XB2A 3GC6A 2IZ1A 1IZ0A 3VKUA 1ZVMA 4FIZA 5EQDA 4J9VA 4NJMA 2OXIA 2Y1CA 4NZ9A 1IPEA 3D3WB 1HZZA 4D42A 1RKXA 2BFMA 2O23A 5L4NA 5IZCC 1X14A 1GYRA 2Y05A 3JQ8A 5U4QA 2AQIA 4JN6B 4ILKA 1G0NA 4A03A 3OJEA 3H9EO 3OIGA 1QXSA 3ZWBA 3UVEA 1DDOA 3H2SA 3WGIA 3E5RA 2GNAA 2VN8A 1B16A 1LC3A 3WG9A 2HU2A 4O59O 3C1TA 4NIMA 5CDYA 1I8TA 3FNGA 1TEHA 1EMDA 2YV1A 3HFGA 1LQUA 4FOOA 2D59A 4PLZA 1VE9A 3IOYA 4LK3A 3AM4A 1U1IA 1QLHA 3K9QO 3PLNA 5IAAA 3GF4A 5AQ1A 4CODB 3IUPA 4ND5A 1ENZA 1T24A 5JW6A 1GR0A 3OECA 4NBVA 1ADGA 1CQJA 4BKOA 5JAQA 5T67A 1JDJA 2NTNA 1EE9A 3N7UA 1T2AA 1KC1A 3IDSA 2ZCUA 5DT9A 2Q46A 2BLLA 1C14A 4NG5A 4BVAA 2PR2A 3GPIA 3UN1A 2O7QA 4R9RA 4R5HA 5EQFA 1MFPA 1VJTA 2O4CA 3QVXA 3AY6A 3HDJA 1I33A 1UH5A 2X9GA 1E7SA 3GDOA 1YQGA 3LQFA 4J49A 4QFCA 3WYEA 3MCVA 2A9FA 2I66A 5LCXA 3WBBA 4AG3A 4QO8A 3FD8A 4FFLA 3QE3A 3AK4A 3ITKA 1HLPA 3EUWA 5U9CA 4FOSA 3NDJA 3QLJA 5A9TA 4BQRA 2H6EA 1Z7BA 5C7OO 3GGOA 1V35A 2FN7A 3JQFC 2RIRA 4QUKA 4BNUA 5CG2A 1PGNA 3GUYA 3HQ4O 3JQ9C 3ZCXA 3UXYA 2OP1A 1O6ZA 1Q1NA 1F12A 3W1VA 2D5AA 3M1AA 2ILTA 2WYVA 2DUWA 3PHIA 1VLLA 3PZRA 2PGJA 3VPHA 2PV7A 1DRUA 3ZV4A 1QYVA 1PQWA 3G3EA 3GG9A 3KV3O 1NR1A 3M6IA 3L4BA 4AJNA 3OQ1A 2DC1A 1VSVA 5DN9A 5TJ9A 4BGVA 2Q2VA 4FJ2A 4J4HA 4OXKA 1LA2A 5JCJD 4E5YA 2ET6A 2EV9A 1T2FA 5TX7A 3GUCA 3LF2A 1X7DA 2I76A 4BNYA 3IMFA 3QWHA 4Q3AA 2AG5A 2P4QA 5TT1A 2I99A 4Y9DA 3GVXA 1TT5B 1QV7A 2ZYAA 4NDNE 3GEGA 3WGTA 3D64A 1DBVO 2NLOA 3ZWOA 1ULSA 1PGPA 4J1QA 4Z9XA 1AE1A 4OXYA 3TL3A 3VOSA 1BXKA 1VL0A 1YH3A 2BMAA 3HSKA 5AYVA 5B4UA 1QORA 2GZ3A 5EN4A 5CEEA 4TRNA 1A9ZA 3MTGA 1JVBA 4FC7A 4A10A 2ZB4A 3JD3A 2XF8A 1V6AA 3VHRA 4D43A 2A4KA 3CIFA 2AEFA 1BGVA 2VHWA 4YJDA 5CG1A 3UHAA 3RJ9A 4OHUA 3LC1O 2NVWA 2AMFA 4BB5A 4RZIA 4WCFA 4E2YA 3V5NA 4Z0HO 4YR9A 2CVOA 3JD1A 5K6AC 4IDGA 5EESA 5JDIC 1AHIA 5L45A 4D44A 1WVGA 2Y66A 1U3WA 3AI2A 1ISJA 3KSZO 4BKQA 3KEOA 4XR4A 3BHJA 1MG0A 4IJVA 4J43A 1X7HA 3FI9A 1N7HA 3I6QA 4GKVA 3KRTA 1GQ2A 3I23A 3PXXA 1A7AA 3UCXA 3BIOA 3B20A 3IS3A 4GBJA 1NWCA 3E8XA 4IINA 4J7UA 5DNAA 4MJLA 3L6EA 2GUGA 4YT5A 4OQZA 4JK3A 1FDSA 3DMTA 2HMWA 4D3DA 1KEWA 3F9IA 4BKPA 4CUKA 5BNTA 1YB4A 2HK9A 1PQPA 4GAEA 4ALJA 2B4RO 1DB3A 2CFCA 2NADA 5ER9A 4EW6A 5JO0A 3I1JA 2D3TA 3ICPA 4L74A 4OKIA 4ND3A 4EBFA 2FWMX 1U3VA 3ZHXA 2VRBA 1FXSA 1P1FA 1LLUA 4M86A 1UP6A 4DA9A 2XXJA 1P9LA 4R9SA 3PP8A 3AY7A 4YVFA 3PVZA 4BMVA 5JXWA 2J5QA 1UXHA 3ETDA 3MJEA 3DZJA 1DFGA 1QYWA 1P77A 4XJTA 2ZQYA 3MTJA 4ZN6A 1YO6A 4RVGA 3I9KA 4CR6A 3SXPA 4XX0A 3FBTA 2PH3A 2F00A 4BQPA 4YAIA 3L77A 4XA8A 1XEAA 4A27A 4B4WA 2FSVA 1EUZA 5CDUA 1L7EA 1T2EA 2OFPA 1BXGA 4E3ZA 1UP4A 2DBRA 4MVJD 2JAHA 1ISMA 1Z6ZA 2IYOA 5IF3A 2AW5A 2DU8A 3DBHB 1NQ5A 1E6WA 3F4BA 3WMXA 5DBGA 5GZ3A 3DOOA 3GEDA 2Q1UA 1MFZA 4MKZA 4CM4B 5DCYA 3OBBA 3U5TA 2DBVO 3E03A 1NAIA 2W2LD 4RQUA 3E1KA 3O38A 2JD1A 4AJ4A 5L95A 2XXBA 3QVOA 5FI5A 3T7EA 1HDRA 2Y1DA 3IJRA 3UOGA 4RPJA 1KY5A 5A5EA 2Z95A 1SC6A 4CL8A 2VZ8A 3ZW9A 2Y99A 3DXFA 3RU7A 4N54A 1WNTA 1DHRA 4LW8A 4R54A 4ND2A 1JAXA 3NYWA 4I9NA 5HRUA 3JQAA 4LGVA 3BAZA 2PZLA 4PLVA 2OZPA 3KEQA 4W9NA 3WGQA 1K3TA 1GQYA 1I30A 3VPGA 2OOSA 3FRJA 4CV0A 4FFRA 1HDZA 3ZV5A 4FDAA 2G1UA 4D0SA 3RI3A 4BKRA 5CDTA 3E9MA 3GVIA 1B14A 1H93A 3AJRA 4TVBA 3IP3A 1ZW1A 3D3WA 4QQRA 2DKNA 3BZUA 3NV9A 1YWGO 2BD0A 3RKRA 5BNIA 1PTJA 3TFQA 1CJCA 4ZQEA 4GGPA 4HWKA 1HF3A 2Q1SA 4RLHA 4BGIA 1KYQA 3CSDA 4FB5A 1XQ1A 5IZ4A 5MGBA 4G65A 2PLAA 1MXHA 4B4VA 2P4HX 4P38A 1LQTA 5TS3A 4B4OA 1LXCA 2V6GA 2O2SA 1MP0A 4J0FA 2GYYA 1HDOA 1H6BA 1PGJA 2B69A 1HLDA 4YJFA 3WIDA 4BO6A 3MZ0A 1V3TA 1U4OA 4H16A 4I9UA 1T4BA 2JD2A 2F1KA 1B3BA 3I9LA 1DHTA 3D1LA 3OHSX 3WB9A 3P2OA 3E5MA 2AE2A 3LVFO 2GPTA 3RJ5A 1F06A 4Y6PA 1KIFA 1E7YA 5HTOA 4LRSB 4LN1A 3OFSA 3TZQA 3HZZA 4F46A 1E1KA 1Y5RA 3JYQA 1D4FA 1GDHA 3ASVA 2Z5LA 4JCOA 2DAPA 1IOLA 4LISA 3KYCA 3S2GA 3HUDA 4C7KA 4YPOA 4J9UE 5J23A 5IDQA 5L4SA 4DVJA 3D0OA 3PGJA 5G0SA 1T4DA 5BNFA 2VOEA 4ID9A 5KVSA 3E48A 2GZ1A 4CLEA 2YDYA 3JD2A 3JQ6A 4LSMA 5KJCA 1ZK0A 1IL0A 4E0BA 1CIVA 3HHPA 4GKBA 3ON5A 2UYYA 2C2XA 2EP5A 3H65A 1HTBA 1YJ8A 3RU9A 3WFIA 1Y8QB 1G6KA 1GY8A 2DUUA 5TC4A 1VM6A 3AOEC 3JQFA 2ZQZA 5F1OA 3JQ9A 4RVFA 3W8DA 2GF2A 5DOVA 2P68A 5FI3A 3UH1A 1B8VA 4IS3A 1R37A 1NXQA 1N1EA 4IJKA 2X58A 1Y8RA 1QR6A 4NQZA 4Q9NA 4EJ6A 4KQWA 1ISHA 5JFOA 3RASA 4FN4A 4L75A 3ZH2A 1YRLA 3L6OO 1NPTO 4IDDA 4G81A 2BKAA 1N5DA 1PJBA 4Z9FA 4IDCA 3OIFA 4TZKA 2JD0A 4IJWA 5F5LA 4M49A 4BO7A 5JPIA 4TMFA 2R2GA 4ZQHA 2UUOA 4BNKA 5G0VA 1AXGA 3SEFA 5HWSA 3PFFA 3LZ6A 1ZMTA 3ONFA 4MIEA 4YT4A 5JLAA 3COSA 1EZ4A 1YS4A 4M55A 4Q3NA 3F1LA 3V1YA 3WSWA 3OETA 5I9MA 3ANMA 3K73O 5HS6A 5DF1A 3OF2A 2HDHA 1SB9A 4E4YA 1TLTA 4WOJA
chains in the Genus database with same CATH superfamily
2YXLA 4PIVA 1CBUA 4W82A 2WV7A 4WMLA 1MN6A 3DMYA 4Y6SA 3B85A 5JQGB 3GV0A 2JK1A 4DA8A 4NBSA 1C1HA 1G7SA 4TL9A 2PZGA 2GEVA 1K75A 1MAAA 2D13A 3DB1A 3ZW8A 1JA9A 2OHIA 3KK0A 3Q6MA 5BQFA 4P0QB 2VYND 2QDKA 3THXA 2WUEA 2R1UA 1MHPA 3URMA 3SJZA 3ZE0B 2W71A 4FLMA 1M8PA 5C8YA 1OTHA 3SR3A 3SXJA 3QPUA 3DOCA 4ASUA 3PKZA 2ZROA 4EKDA 4L07A 3V6MA 3AP2A 3G1TA 2ZCJA 1ILWA 5FBKA 2GM5A 3S3TA 3V6LA 3T3OA 3BORA 1WZIA 4WLNA 5DRTA 4KKVA 4TPKA 3TMYA 5K09A 3WIEA 1PR1A 3RTGA 4TL6A 3DPUA 4FM9A 4NCJA 3SJBA 4EG8A 5JCZA 3FR7A 3QHAA 2BGKA 2Y2VA 4DQKA 2H0RA 4Z4IA 3H0CA 4X97A 1LBIA 3HLTA 1W87A 3I92A 3DV2A 4K9RA 4LXHA 3A11A 3VO1A 2WK1A 1O96B 3NLLA 3UJHA 3DL2A 3QEJA 1WDKA 2C3MA 3OQOA 4C1NA 1ZRMA 2VJPA 4FQ5A 1RM0A 5HKKA 2HIAA 2OHXA 4R41A 4L7QA 4XB6B 2EOAA 2YN4A 3GH1A 4Z99A 1RPZA 3C1OA 4XZ3A 3HHEA 3W8NA 3OJFA 4MV0A 4HAWA 3EXHA 3U3DA 3VGJA 4CMIA 4MVCA 4L7VA 1XA4A 2P2NA 3FW1A 3G1WA 4QX6A 2Z6AA 4FDMA 4BP3A 2J41A 5DBFA 2ZG6A 4D6PA 1ZOPA 3WB0A 5B58C 3KS9A 3KD2A 3S2ZA 4ALLA 1I7QB 3EY9A 2GT1A 4PS1A 4R3UC 1DEXA 3B9RA 5E6SB 4RORA 2RCNA 1HQCA 1G21A 4J03A 1E2EA 2I2XB 2EKBA 1Y48E 2FMIA 2BH2A 1L1FA 1K6JA 1R88A 2VPTA 3OSZA 1OVGA 2TRSB 4EY6A 4K9QA 1BMTA 1X1BA 2PZMA 1GKIA 4OH1A 3ZY4A 5JFTA 3D6MA 3P1JA 1IXZA 2RBGA 4GI1A 4IXMA 1XC7A 2QXUA 2BFDB 3TRDA 3UENA 3WIBA 4RCZA 3AHDA 2I6TA 2R84A 1JHAA 2C4WA 3W6OA 3UTCA 3C8ZA 2EKLA 3JWIA 1LK7A 5AM2A 1P45A 1P0PA 1XAGA 4QBFA 2ZKIA 3UJ8A 2BZSA 4MRRA 2GXUA 4TQAA 4Y6RA 2PJRA 2CZCA 3OJXA 1HMYA 3IKLA 1GCAA 1G8MA 2YHUA 3NIGB 2HYDA 3DDHA 3DC2A 1NFFA 1A9YA 3P4YA 4FFDA 1NVXQ 1K86A 2BRUA 3N75A 4EGQA 2IEBA 3HRIA 4XJXA 5LNK6 2GCNA 4WEQA 3VO2A 5LQMA 3VPAA 3Q3EA 1BXRB 1EHYA 4NC9A 3FPFA 5DM4A 4DADA 3K8OE 3UBTA 5CA0F 3GRZA 1M8JA 1BVYF 3ILSA 3QVVA 4PGMA 3R23A 3QRWA 3GRKA 4YMGA 2IXEA 1LPPA 4ER7A 3REOA 2BFFA 2CMFA 3UY4A 2ADOA 4J0HA 1J5PA 4NV3A 3NASA 5EUMA 4DPMA 3ADCA 3M9WA 1G60A 1E32A 2JJQA 3QNMA 5K2MA 4FC6A 4EFLA 5GJVC 3ORHA 1FX0A 3N2KA 3QFRA 5DNEA 2RCYA 3OZRA 4N0QA 1NHGA 1G20B 4WNIA 3BB3A 4F1WA 3L79A 3PEFA 2H17A 1B42A 2ZYGA 3AYXB 2VAPA 1DWQA 4OHYA 4LHEA 4BNDB 3R3XA 5KTRA 5DI3B 4OSEA 3JY6A 4WJZA 4BFZA 5IN5A 1L7VC 3WMWA 1AG9A 4XB1A 5DASA 4ERNA 4QVGA 5EP2A 1XCBA 1U4NA 2Q9BA 5DEOA 1KSFX 1K7YA 1XK6A 4ARZA 4YX9A 3GA5A 3N53A 1TF7A 2G4LA 3S40A 3AHHA 3K9HA 1XTQA 3LGAA 2XDYA 1MOSA 3PWSA 4G01B 4PC2A 1DAFA 3H19A 3IAUA 1W35A 1VC2A 5JC8A 4H7HA 621PA 1L7QA 1XAHA 5CXSA 1RKBA 3E7DA 5D85A 3VZBA 2Z30A 3R77A 4MVJF 3WBJA 4CEIB 4QWMA 1ZA1A 2JIRA 4RADA 3BH7A 4AMBA 3ZGVA 2FE1A 4I36A 3AV0B 1ZD4A 2XNDD 1K8ZB 4XDYA 5TE9A 3LG2A 1ULZA 2H3EA 2HC9A 5FUWA 1M6EX 4L0QA 3GPDG 1WXIA 3E35A 3VNUA 3D0QA 4DLUA 3JAKB 3VU3A 2J3JA 3U6BA 4MCHA 3VPDA 1PJ8A 3S1SA 1Y33E 4KXWA 3FUXA 1JLLA 1OXMA 5BSTA 4CKBA 1Y0BA 3D3NA 2UUCB 4NULA 1PYGA 1PKXA 2HSGA 4GX2A 2VIIA 5F5XA 3ZK7A 4R3WA 5K0EA 1ZH4A 1OIWA 2ZSIA 1KOLA 4DPKA 2ID7A 1E6MA 1HKUA 3V1TC 4BS9A 1PZXA 4C87A 2FPGA 3H5VA 4PZDA 4DNQA 3LYLA 3I2KA 4E13A 5BSVA 3DLTA 3QQPA 4KDFA 2ZR9A 2ZI3A 1KO5A 1JWBB 1MV8A 2JBAA 2WR8A 3M49A 3ZX4A 3RTEA 3K70C 2ZUCA 4P86A 2OBYA 2VA8A 4PVDA 2ID9A 1RADA 3GJXC 4CPDA 2PY6A 1EDDA 2YV3A 2Q6OA 1HDGO 4RS4A 5FPTA 1GAWA 3ZQJA 4G1FA 4MW6A 3I6BA 2HWUA 5C34B 2UDPA 3L8CA 2EWVA 1FTNA 1NURA 4I5EA 4LIPD 3CJTA 5JFGA 2REQA 1ZM2A 4LKRA 4EY5A 4YRAA 3JVUA 4NE2A 1R10A 1RNLA 2K7ZA 3CMCO 3FWHA 1LVUA 3PJEA 4MQUA 3EGXB 2F1JA 3Q0IA 4NZOA 4RAQA 7MDHA 1I3KA 2VHJA 5F7OA 4L5YA 3JTEA 4C89A 1NJ6A 4O25A 3JVDA 5AVJA 5IAOA 1U7HA 3M89A 5G53C 3RO7A 3W9SA 4BX0A 5C2JB 1ML3A 2QIOA 3QZUA 4KR0A 1KS9A 1QIIA 3KFXA 5BT9A 2JFZA 2ZM5A 2MOKA 1LDMA 3TI7A 4ESVA 3LUCA 4LXUA 1YA6A 3VSCA 4D6XA 1A9TA 2IXFA 4UC0A 1TL7C 1JSRA 3RK4A 2GEFA 3HH8A 3IQGX 3UW1A 1QG0A 5BWBA 1F7UA 3EODA 1BX0A 4N9WA 3HM9A 3VR2D 2GHTA 3FOZA 4TT8A 5HIIA 1D07A 2BGJA 1LJ8A 3JRXA 4XVHA 4F96A 2JFFA 1UWKA 2H92A 1IEWA 1SKUA 2YHIB 2BCJQ 5JCJA 1BDBA 1J9ZA 4F4HA 3NIBA 3O8RA 2D06A 1JQKA 1E2BA 3G0BA 1DCFA 2OHFA 2BLNA 3EAGA 3WK8A 4LZAA 4TYMA 2ODBA 3EBLA 1Y7HA 3RC3A 3TNFA 4EGSA 5BVHB 5H59A 5IDWA 3OU2A 4NYJR 3WL4A 5JD4A 1F38A 2YUTA 3GJ4A 4QDTA 1JG1A 1X0XA 4S0XA 3IKJA 2TMGA 2NNLD 3CTPA 4KHZA 4E4RA 1E9AA 1ODSA 2Q28A 3W2EA 5CAEA 3D4BA 1RQLA 3HO6A 3QG5A 3ZHVA 4JGBA 4MQ6A 3Q8WA 2PIDA 2N75A 4F8EA 3KDSE 1PR3A 4XWYA 4WXEA 2XB8A 1E2QA 1NFRA 1TU4A 1H5QA 5AM0A 5IUKC 5KX5A 4XDGA 3HKCA 4O4IA 4Q9HA 4A6DA 2SKDA 4MGKR 1E62A 3SBEA 5BWLA 1C7ZA 4F06A 2ZJOA 2Q3JA 2J1LA 4FKMA 5KQRA 1VBKA 3DL0A 5KYYB 1GARA 1LS6A 1W4AA 5FNZA 2XWJI 3PT9A 1GLNA 4HB4A 1BDMA 1Z3IX 5TQVA 4X6YA 2VH1A 2EEPA 1E1MA 5AR1A 2QAJA 2B82A 2XRYA 1GADO 1H1LA 1NMEA 1XMSA 3BRCA 3LXUX 4IP0A 1L5KA 5B30A 3DZHA 4EA9A 3COJA 1XIVA 3EOBI 2Z8YA 4TKZA 3QPCA 3DS8A 5HK8A 4EYEA 1H23A 2J0VA 1UPUA 4U2GA 1F0KA 2FLVA 2WG2A 2ONYA 2X3YA 1TAUA 4AZTA 4JBXA 4ENVA 1G8HA 3DMRA 5IYZB 1FRZA 4NABA 5CA1F 4JNKA 1FVHA 4JQCA 4PZ0A 2NYVA 2QORA 4BQFA 3EDMA 1CE8B 2JH8A 3ZGNA 3CLRC 2AXEA 3BX1A 2QPLA 2YZNA 3ENWA 3IVAA 1SBZA 3FN4A 3REFA 2Q1TA 2QR3A 5LN1A 1DARA 2NU9A 2Z98A 2PXXA 2WKQA 2XF2A 2CLDX 4O4JF 1GTVA 1NVWQ 1JA1A 3GCXA 4PLWA 4QUGA 3G0OA 3SEZA 2JFHA 2C99A 5EJAA 3KQWA 1JFFA 3R24A 4QSMA 4CG1A 4NYMR 1VG1A 3LFUA 1BVRA 2R8YA 3SYLA 4EEZA 4AUKA 1TA9A 2EAUA 3AEUA 4Q19A 1R7RA 3FIUA 5FPPA 1Y98A 3RABA 1TKCA 1F6BA 1Z4OA 1YR6A 1TTQB 3X2SA 1ZLYA 1JHMA 2J5BA 3DEFA 1BGWA 2KM1A 2XUPA 4RIFA 4D4MA 1XEXB 1X7XA 1ESDA 2ZSFA 1U0NA 4C78A 3PS9A 2EG5A 1PR2A 3D5TA 4O0LA 1BEEA 3T3HA 2GHQA 3H1BA 1A9PA 2VNHA 1HURA 3BGIA 3RTCA 3BDAA 1QH1A 3I5UA 4JS0A 3AVOA 3U09A 2C4TA 4MKRA 1B6SA 1CNMA 2F8MA 2QW1A 3EA4A 4L50A 2WV9A 3E9NA 1M0TA 5L53A 1JVSA 3W2HA 3SHWA 5JPDA 3OTOB 2C5FA 4BX3A 1ODIA 4B3JA 2Z9DA 3ECAA 2NVUB 5CX4A 1A88A 4WZAA 1C9DB 5I4IA 2G5TA 3CQ9A 3N6RA 1NI3A 1YA8A 1KZ1A 2OM6A 2JAXA 3QW2A 1PNQA 5B7GA 5DCWA 1RP7A 1PR6A 5TMDA 1E3MA 4HRVA 5I6DA 4DLYA 3X1WA 2ESRA 1O77A 2WWRA 4WCVA 2A0UA 5E0OA 3SU8A 4NH4A 4DLLA 4X7RA 3L0YA 4FFOA 2I3GA 2GVDC 2HA2A 2WB4A 1RKUA 5H16A 1G5FA 1VGQA 4WTOA 3G6WA 2OCAA 5LD2C 4X45A 4Q4JA 2ZETA 1K8YB 3ZI0A 1J21A 3D6HA 2HWXA 4YJHB 3VJKA 3DZFA 3ZY2A 4EI2A 3SQOA 1SQSA 4DC0A 3K9LA 3W3AA 4NPHA 3TB6A 3AOGA 2Z1MA 3ZCSA 1EINA 4AQYB 5DW3A 4K6GA 3SMVA 3HA7A 4WKGA 1SO8A 1R27A 2BTQB 1FSGA 1AKQA 3G89A 4BECA 2MSKA 3JVVA 2B35A 2XKBA 1J8YF 1KVRA 1UEXC 1PU2A 3A37A 4LX0A 3BJEA 5CB4A 3ZLVA 3TTUA 4P4GA 1KDYA 1BWQA 1PFUA 1W88A 3JWJA 1TVEA 2ZQ5A 3D6NB 3FAKA 3PQ2A 2O8NA 1Y8CA 4GDMA 4NCHA 4TMVA 2N46A 3W78A 1VGVA 1K7FB 1S5PA 2BPOA 2PYDA 4NOLA 4XUDA 3WYNA 4BFTA 4DM3A 4YMVA 4NECA 1MVLA 4BQEA 4JUIA 1IQRA 3AHIA 2LCIA 1QVZA 2PRKA 3AG5A 4ONEA 2O52A 2OXEA 4BLVA 4ZCLA 2H9AA 1IHXA 5ELLA 3V2IA 4F84A 5KREA 1KK3A 1ZOIA 2QJRA 4GNKA 3QKWA 2DT8A 1FFAA 1HE3A 1VA4A 4IUYA 4QYIA 3ZVNA 4CV2A 5HIAA 4PO3X 2Z83A 3LCRA 1KJNA 3NC4A 3OX1A 4DWVA 1Y4UA 2BCEA 1DC5A 3P32A 2AJBA 4D3FA 5HXAA 2WAOA 2C54A 2ZVDA 3NBFA 3PFWO 4XOUA 3ZKWA 1SEVA 2V0NA 4XPIA 1W30A 3CCFA 4NK5A 1WCV1 1YGPA 4ZMBA 1OW3B 2HAEA 4F3RA 5KBYA 1UWVA 3L41A 4XUEA 3RWBA 2YQ5A 3GRYA 2EJTA 3MWFA 5KOHA 2QMYA 1T9GR 4L5CA 3T9BA 1IHYA 1SKYB 2J8ZA 2XWBF 1IN5A 2AFRA 3GQVA 3KOMA 4WUVA 1UMKA 4P7GA 2XADA 1U7TA 3EIWA 3GT0A 1VKRA 2DYKA 2HT6A 1I5RA 2HWYA 2PD3A 3DM9B 4HEHA 4GPZA 1JIKA 4BEJA 2JGMA 3C48A 2GEKA 1FXUA 1USIA 1Z4JA 2OR3A 4IFTA 2MTBA 1JVNA 1W2WB 1P44A 3BWCA 4Z4FA 3KYIB 3O21A 1UANA 4BBAA 4GSKA 4R6XA 1IYZA 3CVXA 2IWHA 3CSSA 4HAXA 2WYWA 4M8KA 1DKPA 3T4UA 5JXHA 4H1VA 4G07A 4IH1A 3TOXA 1MKYA 3GROA 4LAFA 2Z3WA 5LMZA 1HZJA 2OO3A 1GUAA 4MAFA 2KBFA 3FOWA 4X8MA 4BCCA 4YXFA 3PYMA 4G86A 1B8NA 5CB6A 1XVIA 3R7NA 3M2PA 5E7QA 2F1IA 3K9FC 4L28A 3IE0A 4WW0A 1IVNA 1LSUA 1YS1X 2EZ8A 3Q7SA 4Q03A 1CLUA 4NJEB 4QDJA 4MKXA 3IOEA 3M6FA 3WGGA 4E6PA 4RFSA 3X2FA 2NSDA 4RAOA 2QX9A 1AT1A 1DAPA 5EZ5A 3V4ZA 4IEEA 4ZODA 4AZ3B 4CLOB 4BHTA 4KYTA 5L8VA 4C4SA 1X7ZB 3U3RA 4HQNA 2DY1A 3DHEA 3MQ4A 4G4IA 3ZY6A 4ZT6A 3FFBA 2DZDA 4MS1A 2VTBB 1VIAA 1L4UA 1I2ZA 4B3FX 2WC1A 3HB1A 1Z6AA 3B70A 4AF6A 2OXFA 2E1RA 3CJQA 5LOVA 1XZLA 2OUKA 3B13B 3TL2A 1D4AA 2VDKB 5D00A 1O3YA 1O89A 2FWBA 2YCLA 4P22A 5I48A 2FR1A 2IXDA 2ZSHA 2BVNA 3MWEB 3GMIA 4JL6A 3ZV6A 3LOUA 4K8RB 1R6DA 4RDHA 3CZRA 3NXKA 3PX3A 2DP4E 4J1TA 1N1GA 1OBFO 3AU8A 3QJYA 3ULKA 5JJ5A 4GVLA 5KCMA 3KE9A 3PTLA 3LQYA 1LGYA 3FGOA 4E51A 1U04A 2AOWA 3UQYS 3ETEA 5CDFE 2OSVA 1PWEA 3OG9A 2NTYC 3A2KA 5EUBA 1V9CA 3JYHA 4LXYA 1RRCA 2C2GA 5I3ZA 1WSAA 4DCCA 2IV2X 1HE2A 1OZFA 3CG4A 3HYRA 4Y0NA 5H68A 1EUCA 1OV6A 5AW9A 4RVSA 3N05A 3UHOA 2E4AA 1KOGA 4DYHA 3HCFA 5IM4F 1ZN8A 2QSYA 3KBOA 3ICQB 1SOVA 2NW6A 3HPQA 2C5GA 1ACJA 4RLQA 4AN0A 3EXEA 4IW3B 5IC5A 3OIWA 3RHZA 3STYA 3ZJ4A 5JRDS 5IKMA 1V8DA 2E2WA 1CUAA 2XTMA 3BE5A 2OYRA 5HJ5A 1C7RA 4WBXC 5SZKB 3T12A 3SVTA 1BFUA 1UZAA 4JLVA 3TIFA 3VC2A 2IHNA 3SR4A 3N70A 3ODGA 3RYCB 2OUIA 1CHDA 1JWAB 5KQMA 4N12A 1PJ2A 4LHWA 4RE6A 4EJSC 3EG9A 4BAGA 4NBRA 4N39A 4N3BA 3L5OA 1WHSB 4EG3A 1EAMA 1MENA 3IT2A 5FX2A 3VMMA 4JUDX 2CNNA 1CVRA 1HTTA 1FTQA 1A97A 1ORHA 3DVQX 4QEZA 3OURA 4H7PA 3QV2A 4HAYA 1N1MA 3RF6A 1TVCA 2QRGA 3GFVA 4IIJA 4Q9AA 5HP4A 3QOFA 1HL3A 3KWFA 1P1KA 5BSUA 3KBBA 2OAP1 1HI9A 1U0SY 2I2FA 4G5SA 4ZVUA 3C3DA 3RC1A 1EEXB 4M1QA 2FGJA 3L4SO 1DQNA 2IHUA 3FKSD 5KNBD 1YL7A 3DL7A 3ZU4A 3TDMA 4CVNA 5JZSA 3DLIA 2BEVA 1AQIA 1DWUA 1K88A 1CUUA 1JIUA 3K5PA 1XDZA 3JQAD 1UDWA 5H5JA 1PR9A 4L78A 1BWRA 5K0LA 2P8JA 2X86A 1NRJB 2FY8A 3GLHE 4XFKA 5IVHA 1SUDA 4RXMA 2OT3B 1C5KA 4ZIRA 3D5QA 3A7EA 1EFAA 3HSSA 1YOVA 3GVCA 4ENRA 4YUZA 3H4IA 1BJTA 2BH9A 2OCBA 3CLUD 2QSJA 4I4TA 4MVJI 4B31A 3TS1A 1E1RD 2ZWAA 3L9WA 3HI6A 4WXRA 4Y6GB 1XG5A 5ALXA 5KTKA 2V55B 1Y5LA 2QE7A 3F7MA 3WGKA 2MSEB 3V4RA 3MTEA 3DE0X 1LNSA 4EUEA 3MBKA 1MO3A 1GDDA 4HVLA 1E7RA 4ZO9A 1LC0A 4NMXB 2Z43A 1KIMA 1UM9A 2AR9A 2Z4SA 1Y3AA 1LRKA 3COWA 4D45A 2LVBA 2I2AA 1KJ9A 1PR0A 2H65A 2VKQA 5JANA 2C9ZA 1TT5A 2Q7XA 1OIXA 2EQAA 1VDZA 2A1UA 4G4GA 4OHMA 1I24A 4GWGA 4NMMA 4A0SA 1ZJ4A 5MN6A 2NZXA 3QENA 3LPDA 5EKDA 3RFVA 1RE0A 5CVTA 3HSYA 3R6GA 3LIPA 3LHSA 2KJQA 4EFMA 3I2GA 3UG7A 2GXSA 2W6CX 1CUWA 5JYCA 2C2KA 4OQEA 1UPXA 2EGHA 3RFXA 3PQEA 2CXPA 3KCNA 4LJSA 5IXSA 4H0CA 1S3SA 2G0TA 1WUHS 2XB6A 4MWEA 4QUEA 1GFZA 4ZVRA 4AB1A 1WDTA 5CMLA 4KZKA 4V39A 1P33A 2ZUWA 5KAPA 3FNEA 3S1AB 1T2CA 3DE7X 5JVDB 4EMBA 2YQZA 2AUTA 3VR3A 1C0EA 3LL4A 2ZRNA 3DV0A 1JKMA 1IN4A 1UJ5A 2VCYA 1KSGA 5B1SA 4D5GA 1FY2A 1CKEA 4S04A 1EFPA 1U1CA 3WLMA 4ARAA 3IA2A 1E2UA 2XV1A 3RUFA 1Z6GA 3QWBA 3W8FA 3BT7A 2BR3A 1KDVA 3QE9Y 3LMKA 3IB6A 3PITA 1YV9A 2DQSA 4ZVSA 3P9IA 2RDMA 5K4AA 1J0DA 1BDIA 2PRIA 3HBMA 4MJ7A 3OJWA 1OC2A 5CNKA 5IDXA 2AHRA 3R0QA 5LMNB 5T4HA 4OU4A 3UOAB 2IP4A 4NFYA 1Z07A 3OZ7A 3HCEA 5KB3A 1OMOA 1L5ZA 4M98A 5DRYA 1A96A 1IDOA 3B1YA 3BB1A 3T9AA 1GQRA 1G8SA 3NX4A 4QPJC 4HSEA 4P0TA 4QJ4A 2OD2A 4AN1A 3OQMA 1JPVA 1ZBQA 2VP0A 3DEZA 1YMUA 4TTSA 4CMCA 2BY4A 5LYJF 3OSUA 2DLDA 5BSWA 4UXJA 1L7MA 1CQWA 1ZGAA 1R1DA 1VE5A 1Z12A 2Y76A 4RA9A 3BFVA 2B1RA 3FCCA 4HUQA 3E2IA 4JJ6A 2WVHA 4MIOA 4QBKA 4ZZIA 1CULC 2HV8A 2WTAA 5BSMA 2X0KA 1PV1A 3V97A 5JY6A 3A1TA 1J42A 1YKFA 3GHHA 3TUIC 4NE7A 2V7XA 1WBBA 2PT5A 3ANSA 3T5GA 3Q9UA 5K45A 3MINA 4IWNA 4N5LA 2L42A 5L3SA 1CY1A 5HQ3A 1YUMA 3RC2A 3RYTC 3IAFA 2YJNA 4JKIA 5EIWA 3RVKA 1IPHA 1P7VA 1S3IA 3DNFA 3FPLA 1AF7A 2PSDA 2QRHA 4BVGA 4ZGWA 3GLIE 4IIUA 1PJLA 5F73A 3RYHB 1U7OA 3SX4A 3AVQA 1C7QA 2OO7A 5JAZA 2O4UX 3JAWA 5AJTA 2XMGA 3KEFA 4L5BA 3ROZA 4FMCF 4DRYA 1R0SA 1QM5A 1WHTB 1DIGA 1O5IA 1P0CA 3E7XA 5HZHA 3ELWA 1UMDA 3GRPA 1ZXXA 3ZU2A 1Y6JA 2JFPA 4BE9A 4C7OB 3TUZC 4RD4A 3A3YA 3LY5A 4G85A 4KAAA 5JQGF 1KE2A 1P9WA 4XFJA 4WKPA 1GPYA 4ESOA 4EHBA 1UJBA 4TTQA 3J7TA 3LTNC 2GI4A 4G0YA 4PQYA 3KKMA 3P97A 1U8XX 3LM8A 4PPQA 1IXKA 3WICA 5GQSA 4CFYA 3W2IA 3H99A 4RXUA 2QYOA 1MOQA 2O57A 3EXG1 3JQRA 3K94A 4YBZA 3TAXA 4O2BB 3MNFA 5J2TA 5KINB 3VOBA 3LT1A 1KEPA 2C83A 1JKXA 1L7BA 4JROA 2C07A 1AVTA 2ZRCA 1TC2A 4NNOA 4RENA 4WCFB 5LBIA 5FLKA 4D4JA 2ZK7A 2CL6X 3VVLA 4TV8F 3EC7A 1X7YA 2XGSA 3UB3A 1N7GA 1GPLA 1Y1LA 4M21A 4EQZA 2PUEA 1XQ6A 3BL6A 2VDRB 2VDMB 5HSGA 5M29A 1ONOA 4U0JA 2QK4A 5KDLA 1IY2A 4TT3A 2Q8NA 3HP4A 5BWOA 1U63A 4BRUA 1WR8A 4X1KB 1II9A 1IOVA 3UK7A 2R6HA 2HNBA 4EJFA 1EHIA 2VK4A 1QDEA 3KD3A 4M89A 2IL1A 2ZSDA 3D9QX 1EP9A 3ACCA 3KAKA 3UMJA 5EA2A 1SOUA 2QYTA 4XLTA 1H8EA 1AS0A 2Z56A 3C45A 1UEIA 2V6JA 4ZZ3A 4EPTA 1B43A 3DMTC 1TRKA 2QQFA 4UTOA 5GMOA 4R8VA 4Q34A 3RHSA 2QLLA 2XECA 4ZHQA 3L0SA 4IDHA 4E5VA 2BM8A 2A9KA 3PL5A 4QO7A 1J2TA 3K4QA 5ITZB 4M22A 1ORRA 5AKKA 1E9VA 2F1OA 3QM1A 4YAUA 1RJ9B 4YGYA 3ZXXA 5I4BA 4MV1A 3RADC 1PNRA 1FTGA 2H1RA 3D3JA 1JEQB 1W52X 3Q7TA 3WLTA 5LA6A 4QYTA 1Y9ZA 4E4TA 1SBIA 3PFIA 5C5IA 3VHXA 2RGUA 1JQ5A 3N3BC 2OZLA 2IY7A 1VCOA 4C20A 1E9DA 4ZI7B 4DLKA 5HK9A 1IUNA 2QZSA 1EFCA 2LXNA 3C7AA 4RH0A 3EXAA 2VS1A 3Q12A 3ROKA 4KXVA 4LZNA 3KEGA 4EHDA 1NI5A 4RGYA 5BXYA 4A9AA 2CL0X 4MYUA 4YRMA 3AJDA 2J5RA 4LDQA 3FLAA 1E98A 4EDFA 4Q7QA 4YCJA 1E96A 1BEZA 2IXTA 2XZTA 3L43A 2GARA 3GPCA 1HT1E 1EBFA 3NWOA 1D2AA 4WESB 2YZKA 2H1WA 2RHRA 3SOZA 1YBFA 3VPCA 2AJTA 4A8TA 3G2LA 5EE9A 3F96A 4O5AA 2BJHA 2IEYA 1PUJA 5REQA 3O2SB 3PC8A 3OFNA 2PSFA 3WNZA 4BB0A 4DV1B 3NBYC 1QKJA 2HXGA 2A0YA 1K6EA 3DO8A 3OX2A 4HADA 4KBYA 3FYHA 3WGJA 2G36A 4QEDA 3ADOA 5H1YA 3ICEA 3WLRA 3SQDA 2PGXA 1KKUA 2X77A 4TN5A 4MUAA 4KMOA 4LF4B 1LI7A 4K2AA 1KGSA 3WYAA 4GMGA 3NETA 1U28A 4C6TA 4WINA 3H11A 2I6GA 2BGUA 2B98A 3LT2A 1AF4A 1G6OA 2YIVX 3TDKA 2IYXA 3V9AA 5IH3A 1MJ5A 3O1LA 5TNXA 4CKCA 1O94C 3CJRA 4C4PA 2WZCA 5JCOA 4CL0A 2HH9A 2VZ0A 3INRA 3M6XA 4YI3A 3GFTA 1Z29A 3S1LA 4H7DA 1RWXA 3KUDA 3PDJA 1JR2A 2H1LA 2CLOB 4J6FA 1E1QD 3AF2A 4MR9A 5HKLA 3WWCA 2P9CA 3JQAB 3L1UA 3WDSA 4QKQA 3HRHA 4AMYA 3AERA 4RPCA 5AXBA 5T8KC 1IEQA 1KO8A 2YR0A 1C3EA 1KU6A 1OXSC 2D8MA 2WU4A 3H86A 5F3WB 4K5QA 1ZD5A 2QL9A 4QUDA 4ZT4A 1NE2A 2YWDA 3A3OA 3EUEA 1JQAA 3I4LA 3O47A 4L85A 4MS4B 1KMHB 1A71A 2RHCA 3NFYA 1BXZA 1OH7A 5ALOA 2R6R1 3QXGA 4KPUA 1Y1SA 3T35A 2FZLA 2CF6A 2FZVA 1JU4A 2HRCA 3WIVA 1E2MA 1SZDA 2NP6A 3QGMA 4DR2B 5I7OA 2YRXA 4OX9B 1NMSA 5KYGA 1EVYA 4WADA 4A0RA 1AA6A 4N0DA 4CM9D 1ZK3A 1JT2A 1NF8A 4GWKA 3QWFA 3CRZA 1ND6A 1GFIA 3DAPA 5FUVA 1MJGM 2QU7A 2ZLBA 3ZTTA 2JJ2D 3QA3E 3PUYA 3VR4H 3VNRA 1C3LA 3EPKA 4K88A 2X40A 1E3WA 3BIXA 1AZSC 4RKWA 4U2DA 1V8PA 2C4UA 4ZQGA 1D3AA 2VF4X 2HRZA 3FNBA 4J29A 1DX9A 4W99A 3EQ2A 3NQ41 1ZJ5A 1OXVA 3AF1A 4GKAA 1DT5A 1SKMA 4ZRMA 1NVMB 1QS0A 2C8JA 2XJ9A 5AK4A 4B6GA 5E3JA 4DSNA 1C29B 2ZSUA 3GW8A 4IVRA 1A9XA 5WRFA 1WKCA 2CMGA 4C7JA 4KNYA 2JFBA 1EXNA 5DLQC 1LX6A 4TS4A 4Y9DA 4G5HA 1XBTA 4E21A 3QH4A 2YZ7A 4WBSA 1HLGA 4IJ5A 3B8HA 4CLHA 5BOVA 3EIUA 2H48A 5T7BA 1K0UA 5FH9A 4YV2A 1UZNA 3JPWA 4K26A 4HXGA 3CUVA 4I99A 4MQFA 3KYCB 2JG3A 3LU1A 4ZJUA 4MWSA 4BNGA 2W2KB 2PLWA 4KH1A 3B3AA 4ZU6X 4A6EA 3ROTA 4CLRA 3G49A 4LZPA 1KVQA 5ETJA 2Q3CA 2ZE8A 3V7NA 2JJYA 1XHFA 1OBVA 2VTVA 4LGYA 3IIEA 2XSZA 1XJ5A 5I8ZA 1ZI9A 1HV8A 3FXAA 1X1CA 3O9ZA 4HYYA 1P9OA 4P98A 4YJ2F 5DFAA 2X0FA 3X2EA 1VHJA 1C9MA 1DC7A 3LI2A 1JEDA 3B9PA 5CVJA 3IESA 2FJUA 4YREA 2AYXA 1TOAA 1XMXA 2VYVA 3G2HA 5A3QA 5PNTA 2JIZA 4EITA 1GPH1 4P9NA 3OPVA 3AB3A 3BILA 3OZBA 1UOPA 2X8AA 1N6PA 1S9HA 3WZ2A 3J81A 1YJQA 1VL5A 1A3CA 1VHTA 1NXVA 5F4ZA 2CFRA 3CZ9A 4E5NA 2BBWA 3F5SA 3LW7A 1NN1A 3G8BA 1N9GA 2JCSA 4I4NA 1E7WA 1V1RB 1PZFA 2PLRA 3CE9A 5ALDA 3DMPA 1XEFA 2ZIEA 4OEHA 1E6LA 4MR8B 1ZD3A 4D4LA 2WE7A 2YW2A 1C0PA 2WUFA 3JCZA 1HDEA 2IZ7A 3EUAA 3SQMA 1MH1A 5EJ8A 3SQWA 2X14A 3P94A 3EXG2 3C74A 2KBEA 5CITA 3FYTA 2XYRA 3FY4A 1E4EB 2ZXUA 3OMLA 4ND1A 3SSOA 3TLGB 3JV7A 1C3VA 2GD6A 1NSTA 3HUUA 4X1YB 5EHIA 4DJDC 1O9BA 4U63A 4KE6A 1XZHA 3A6HA 5E9QA 2GB4A 2HIHA 2QM7A 2JHGA 3AG6A 1SUCA 5CPBA 5FL7D 2J5XA 5TMPA 1OI4A 3WL3A 1NDUA 2GBPA 2RONA 1NR5A 2IUFA 3N1UA 3T7RA 5KNDA 5IW8A 3RRBA 3MLAA 3VSAA 4B9EA 1VSBA 3QEOA 1CF9A 3D8NA 4QTZA 4FT4A 2IRWA 5DM1A 3RG2A 1OJLA 3O9MA 1CS4C 3H4VA 1P73A 2OGZA 1IMOA 3C3MA 3RYIB 1P5RA 3DF7A 2WIFA 5EHGA 2VQSA 2EJUA 1IXYA 5G2OA 1NVUQ 1HXHA 3E5NA 3EISA 5E38A 3C6ZA 1WUIS 3KQLA 1ORWA 2ZJ8A 1CR6A 5FUQA 5G0UA 1H2XA 3DDOA 3LTEA 2HSZA 1DV2A 2YWXA 1ECFA 2FWPA 1F17A 1E60A 2V54A 4QQ8A 3LWZA 4HH4A 4DGSA 4L8VA 4BRWA 4FZRA 1KP9A 1LLQA 3F49S 3D7SA 2Q6LA 3EG5A 4JJEA 3JW8A 2ZRPA 4GOND 2YVUA 3SP1A 3W6ZA 3ZC3A 1J9EA 3NTOA 2VNAA 1M0EA 8ADHA 3TD2A 1B4DA 1H42A 2P3OA 3IUJA 4MEJA 4WECA 3ZXIA 4CFZA 4ZYVA 3THXB 5C8YB 1KY4A 1A0OA 3KJFA 3MWDA 1NJSA 3FWNA 4WZ6A 2C4KA 1NBIA 1U0RA 2BCGY 3L8YA 1K68A 1QCYA 3QU9A 2CLLB 5EIBD 1BCRA 4HJRA 2R5FA 3H5NA 4V3BA 3OX3A 4CKEB 3OCVA 3MD0A 5D6NA 1GNSA 3AT1A 2DMRA 3MJHA 2IHBA 2WLSA 1K6IA 1H05A 2X5JO 4ITRC 1DAGA 3RS4A 1WBJB 4PLHA 4TTPA 1ICIA 2GZMA 2HMYB 5CP8A 1KJJA 2CWDA 1KFCB 1NN3A 1Q3TA 1QMGA 1GQQA 3FH0A 5I7AA 3ZNQA 5FWXA 3CBGA 2I4OA 3GOQA 4WK2B 2NUPA 5AI5A 2NV0A 1W46A 1ZD2P 3PIDA 4CMIB 4AVYA 1NV8A 4I1UA 1VHQA 3MPOA 2YVKA 1B23P 3ZHRA 2WOJA 2GF9A 2ZATA 4MTLA 1QRAA 3UW3A 3CKKA 4F71A 4ZKEA 1YIAA 4J0EA 3AO0B 2PMWB 2CSXA 2DUNA 1YJ5A 4MJ3A 2DTEA 2PMDA 3AINA 5IJXA 3F6PA 3EB9A 3MJSA 4OGFA 3TXYA 5ALSA 1G21B 3UGTA 4MQEB 1RACA 1GQOA 5KNCD 3GMDA 1W7AA 1QCDA 4MVWA 2PQ2A 2IDZA 5C7YA 1WX1A 1UBHS 3OAAD 4FZJA 3NTRA 1LVHA 1Z5UA 5IRCD 1HX7A 4WWHA 4KUEA 1F2UB 1GPWB 3PNMA 2GYUA 5T5QA 1BFKA 3VH3A 1QOZA 1F9AA 4CEJA 1E5LA 2RGBA 4MPDA 4WLEA 4B44A 3QKRA 3UHFA 5JE8A 2OD9A 3OO1A 2BFOA 4R83A 4P3NA 1TVMA 1EWQA 4X6XA 1D6MA 1DIOB 1JR4A 3V8NA 4EL5A 5C37A 3CNHA 1EDZA 4YP6A 4NARA 5EJ6A 4U4AA 4KR9A 2D2FA 3QWAA 1K6XA 1EUDA 3FYUB 1WQ3A 1DLIA 1GUDA 1KO4A 2F6RA 3ZVKA 1E1DA 1JLKA 3FHOA 4LVOA 1VBMA 1CV2A 3KKKA 1GYPA 2JAOA 4K05A 4ZQIA 5GZ6A 1TUIA 1PG2A 3BMCA 1H5UA 1W9MA 1B7GO 1YAHA 2LKCA 2FF5A 2OEPA 3LHIA 3OZXA 3AM5A 4M1KA 3CH6A 5LZ5A 4EO9A 3W3AD 4B45A 4Z4GA 2GJAA 2XW6A 4OQFA 3HCDA 1TO2E 4Z9AA 1LBQA 1X42A 5COBA 2ZRLA 3A9TA 2VVTA 4WK6A 2QUIA 1IZ7A 1XKLA 4DLVA 1UBSB 2X2OA 2BFFB 2D5LA 3N9IA 4GUDA 4KQEA 4UU8A 2OXCA 1ENYA 1KFJB 1JG7A 1HDYA 1WY5A 1CUCA 1RQXA 2BKLA 3WB1A 3O1HB 1LTHR 2P5YA 1XDWA 1EIZA 2HXSA 3F5FA 3DZCA 4K8OA 4B46A 3N2KB 1YI0A 2O2CA 5JDCA 2R00C 1Z0IA 4RTMA 2UXBB 2YNMC 5K51A 1F4VA 3AF5A 4LV8B 4OK3A 3LRXA 4MI1A 1SG6A 4H08A 4QARA 3WKEA 1O87A 3DAGA 4KSBA 3IODA 4MRAA 5EAIA 4HRXA 3EVEA 2IEDA 1HFEL 2IPAB 4GI5A 5IEBA 1NMZA 3JYLA 1YZUA 4MV6A 5BSHA 1PGOA 1J8MF 4E2WA 2I9KA 1X8LA 2GYWA 3EF3A 4IIHA 1M1UA 1LV7A 2C5SA 5A1JA 3TD6A 4H35A 1UXGA 2P0YA 1BMFD 1U8CB 2JGKA 2XODA 4ZRNA 5HX7A 4ARZB 2IUEA 5AQEA 4U0KA 5K7SA 1OQAA 3ZLJA 2NXJA 1U2DC 4H6VA 4FLFA 4O8CA 4BP8A 4KLCA 1Y4DE 2QGNA 3KKOA 4G0XA 1KH2A 3CNNA 1OXKB 2VKTA 4DDUA 5AXCA 5BQ3A 1EGVB 3DEHA 4KIFA 2EBUA 3B2NA 3EDQA 2QTAA 3REQA 3D6VA 3RKUA 3CCBA 4R98A 2DJIA 4QECA 4JVMA 1N75A 3H2KA 4CMAA 2FUG1 3T3DA 3LL7A 2PX8A 2NT3A 3F98A 2D1YA 4Q0MA 2A14A 2Z3VA 1GTL1 3AIIA 4GLFA 4QYXA 4UPDA 3M1LA 5FT9A 1T5HX 1EFUA 2H16A 1WOMA 3COYA 2O7VA 4LMRA 4JJ7A 2VJMA 4QTUB 5GM1A 3H5IA 3R6TA 4NHEA 5KTOA 1SKYE 1JLLB 3PNSA 4QULA 1I1NA 4H1TA 3BWXA 2Z5GA 4QPCA 3FTDA 4IV5A 4TKLA 4CKBB 3KV1A 2IOHA 1ZAKA 1BVUA 1K7XB 1Z73A 3NIWA 4PXSA 4F5WA 2IEAA 4QHTA 2FPUA 2RHLA 1V5GA 4YAWA 4DLXA 2FPGB 1GNPA 1KY3A 1MGOA 4IL5A 2H1CA 4KE9A 2V45A 5ILGA 4DLNA 5G4KA 2V9ZA 4R8KA 1WG8A 2JBAB 1RBQA 2VSXA 2X4GA 1V3VA 4NLLA 5AI6A 2FPIA 5C5EA 4B87A 4NVRA 4ZOEA 4AP6A 3PWKA 5BSGA 1XELA 1L8LA 1NPYA 1UL1X 5TT0A 2NUTB 3DZGA 2QYHA 3G7UA 3SPXA 1WXGA 3NHLA 3NG1A 4UMDA 5DNDA 2ZJAA 1RWKA 3Q5DA 5D7NA 4RHCA 4XPZA 2WQZA 4JVLA 3GY0A 1XGKA 4O6VA 4M83A 3NWBA 1QYXA 1PDWA 3MQFA 2P5UA 4B3TB 1C1DA 5HKOA 3H8VA 3MWYW 4D02A 4YS6A 2CZGA 4HGRA 1D1SA 2BHTA 2OCDA 5FOQA 1E6CA 3CZMA 1BYIA 2Y1FA 3ZNOA 4E5DA 4F4UA 3GQBB 1I3MA 1W8DA 4DDMA 3UUGA 4EHKA 1PRYA 4IJ6A