4CMCA

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
267
structure length
251
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTERIDINE REDUCTASE 1
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
total genus 93
structure length 251
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cmcA00
3IIEA 1PSDA 4GH5A 4FBGA 1SB9A 3JQCA 1I2BA 3NV9A 2VWPA 1E0DA 5B37A 5HM8A 3NTQA 1O8CA 4CMHA 4PLGA 2P91A 3TPCA 1R0SA 1PZEA 4NPCA 4AJNA 4XCVA 2DQ4A 1MX3A 2V6BA 3OH8A 4UEJA 1ZBQA 3PWZA 4FGSA 4IZIA 5C3MA 2I66A 2PZMA 3U4CA 1MA0A 1Z6ZA 1N2SA 1SAYA 4XA8A 3V2UA 2CDBA 2VN8A 3E9NA 4YT8A 2D59A 4DMMA 1GCUA 5TC4A 1NPDA 4NBUA 1BVRA 4CMCA 5HA5A 3AUTA 5CEFA 3LF2A 2JFHA 2PY6A 2ZATA 4YVFA 2I5PO 2OP0A 3OIFA 4EDFA 5A5EA 4D0RA 1NP3A 4TRJA 2F1KA 3OEYA 4IJUA 1U4OA 4Z3KA 4Q9NA 4CMIB 2YW9A 3MOGA 1NQAO 2Q49A 3WYCA 7MDHA 2OBYA 3GNTA 1UZMA 4M87A 2JCXA 4OGWA 3IJRA 3ANLA 1KETA 3HDYA 3PJEA 5DBFA 3PZRA 2AEFA 4UVHA 1DLIA 3TNLA 4BKOA 1PS0A 3ZNOA 4W7IA 2IZZA 3SJ7A 4DMLA 4FIZA 1K89A 2ZTMA 4AJ1A 5FI3A 1E1MA 2YFHA 3DZHA 3IP3A 4FJ2A 3L6DA 1NHGA 1Z82A 1ZMTA 4B3HA 2D2IA 2FZEA 3JYLA 1LEHA 2Q1WA 1MG5A 1VL6A 3ROQA 2X5OA 1V35A 3PRJA 1WWKA 1LJ8A 4QECA 5L53A 4J4BA 4BNNA 2B5VA 4RV9A 3PYLA 1XELA 3F46A 3PEFA 1DO8A 3K73O 4YEDA 4QTZA 3PQFA 4B7UA 4D44A 4XRGA 4L74A 1YB4A 5CDGA 3L6EA 5IDYA 4A0SA 2FPGA 1TT7A 2Y66A 1UAYA 1R0KA 1ZCJA 1X13A 2IXAA 2WYVA 1KEVA 3AUAA 5ITVA 1GV0A 5KTKA 3I9MA 1OFGA 4RL6A 2BMAA 1GFSA 1NNUA 4AL4A 3L4SO 1O0SA 2HJRA 3K2EA 5JSFA 3HG7A 2F00A 4DC1A 1BSVA 5JCXA 1GUZA 1PZHA 1SC6A 1E6EA 4E2WA 3NRCA 4PZEA 4BNTA 4CM9A 3MJSA 3CINA 3GG2A 4XJSA 1ISFA 4TZTA 3MTJA 3PK0A 3MOIA 1NBOA 3NDIA 4R3NA 2BKAA 5IZ4A 2EHDA 1E7YA 3VOSA 5C7LO 4Q3AA 3HADA 2CNBA 1JVSA 1I32A 3QHAA 1MFZA 3QJ5A 1W0CA 1R15A 3DBHB 4R41A 4RLSA 1X1EA 4WLVA 3VPGA 5JBIA 3V5NA 1LLDA 4A5OA 1LC0A 1S7CA 1KEUA 1UDBA 3AFNA 4RCVA 1N7HA 5G0SA 3WWYA 1KERA 1DHRA 4B3IA 3RBXA 1NWHA 1W8DA 1RM0A 3PLNA 3WGQA 2IXBA 4YPOA 2UUPA 5H82A 1PJBA 2ZQYA 3QSGA 4PLYA 1N1EA 4IIUA 4ZVVA 3UAGA 2VWQA 1ZH8A 4BKQA 2NADA 2GO1A 2AHRA 3NTRA 3O8QB 3ULKA 1E7QA 3E9QA 3H3JA 2O7QA 4MDHA 3RUHA 5CPFA 1KEWA 3PP8A 1DC3A 4GVLA 4J2OA 2AQIA 4MVJG 1ZJYA 1N5DA 4W9NA 1C1XB 2NTVA 3P2YA 1T1SA 1XHLA 2HCTA 3PQEA 1V8BA 3AI3A 3H8VA 4GX2A 4F3YA 2Y68A 4EUFA 1QP8A 1XSEA 2GN9A 2EKQA 1C0IA 4PLPA 3RKRA 1I01A 3VKVA 1ZW1A 1YWGO 3CMMA 4YJFA 1A71A 1VJ0A 3DZIA 4LVUA 1R66A 3Q2KA 4IIVA 1WAMA 2HK8A 1E7MA 3LU1A 5I7SA 2FOIA 2IEBA 2P5YA 2DU8A 1BTOA 5DP1A 4CR8A 1DFHA 4DBVO 3PHLA 3ON5A 1D7OA 1BG6A 3OJEA 2QHXA 4YJGA 3WB9A 4F45A 3HWRA 3B1KA 3C7CB 1PU2A 4XX0A 1JKIA 3UGKA 4BGUA 3OFSA 3RC9A 5KJEA 3K6JA 3JQFC 4P4GA 2G76A 1C1XA 1DC6A 3FWZA 1XU7A 1WMBA 4F6LA 2DT5A 3U4HA 1SOWA 1NPYA 4L75A 2HUNA 4J16A 4NJMA 4CM9D 1E7RA 3T7CA 1M75A 3NGLA 3HN7A 4LMRA 4R1SA 1F06A 2B36A 3A06A 4M49A 2BFPA 3OJLA 4WJZA 4WOKA 4R1UA 2VNSA 5HBRA 5A3JA 4WKGA 1I30A 1H9AA 2J5KA 2YQ5A 3IUSA 4BNJA 1EDOA 2YY7A 1GPDG 4PG4A 2OXIA 2JAHA 5ENVA 4CLDA 3E18A 2G1UA 1RM4A 3KSZO 4HNHA 2P2SA 4KMSA 4BNKA 1CQIA 1HWYA 3DMTC 2VZ9A 3UCXA 3NTOA 1EE9A 5COAA 4CUJA 3Q6IA 4AJOA 1JA9A 2X8LA 2BLLA 3TZKA 4U6QA 3DMYA 1O5IA 3WJ7A 1H94A 1ADBA 1IPFA 4JIGA 3KO8A 3JQBC 2B4QA 5JCJA 3VDRA 3VTFA 5ICSA 1YBMA 1T2FA 3ABIA 4FD3A 1Y7TA 4R9SA 3LLSA 4O1MA 1CQJA 2AMFA 3K5PA 5LC1A 3UFXA 2TMGA 4PLFA 1X0XA 4P4LA 2JHGA 3CTMA 3GQVA 5FWNA 3KM0A 1LLCA 2HK9A 3DZJA 4YTEA 2W2LA 1LTHR 3HZZA 4NBRA 1HDOA 3JQFA 4H3VA 4IM7A 3S55A 5IF3A 3GVIA 2JL1A 1Z7EA 1R12A 2QRKA 5ITWA 1JWAB 3G49A 4YAKA 2V65A 1QXSA 3DZKA 3GNQA 3GHYA 4PLCA 4QO7A 3F3SA 5JYEA 1QMGA 3I4CA 1GU7A 3C1AA 4I1IA 5GY7A 3IJPA 4GMGA 3R3JA 4J9VA 4KWHA 1YJ8A 5TJHA 5AXBA 1CDOA 5L7WA 1H6DA 1UZNA 3PJGA 3B20A 1Y5RA 3LSYA 1BDMA 1XG5A 5JDCA 1C3VA 1L7EA 1ISJA 4Y67A 1QRRA 4ZQFA 4PLZA 5IXSA 4BNMA 3TSCA 4IJWA 4HP8A 3DMTA 3EMKA 1SO8A 4QFCA 3VZQA 2WD7A 2OFPA 4GGOA 3EY4A 4GL4A 3H2ZA 4NFHA 1PJSA 3RCBA 2JJYA 3JQBA 3ADOA 3GA0A 3PDUA 1U3WA 4B4UA 2QZ9A 1M6HA 4J1TA 1ZSYA 1HSZA 1PGQA 1E5LA 4BNUA 2C82A 3QRWA 3JCZA 3ORFA 5BSHA 2B37A 2DBRA 4PG5A 5HS4A 3P5SA 3ZWBA 2PZLA 4FFPA 2VHZA 4IDCA 3EC7A 4I5EA 1UDAA 5B4VA 3I9LA 3D4OA 2PZJA 1JAYA 3HDJA 3U4DA 2FPPA 3DXFA 5A9SA 1P1RA 5DZSA 4DPKA 3EUWA 1HE3A 2X6TA 2R00C 2H1SA 1V6AA 2Q1SA 4GVXA 1Y6JA 4YACA 2DPGA 4Q3BA 5ER6A 2CUKA 1O6ZA 3MWEB 5G4LA 3U09A 2D8AA 4E4YA 2V6FA 1WXDA 4D46A 1K6XA 1BRMA 1PR3A 3M2TA 3WXBA 3GC6A 4RDHA 3DDNA 4WLUA 2O3UA 1RWBA 1A5ZA 3GY0A 1G1AA 2EERA 3LC1O 5FEUA 2QG4A 3QWBA 4EUEA 2C29D 3NJ8A 1YE3A 5JAQA 1VLLA 2HO5A 5DBIA 2UVDA 1IUKA 1H6CA 1NM5A 4QQRA 3I9NA 2GN6A 1E7WA 4NFSA 4CLXA 2G0TA 3E03A 3WFIA 4JJGA 3ANMA 2I65A 3NDRA 5JAMA 2OMEA 1VPDA 2IYPA 1EBFA 3OA2A 1LI4A 3QWAA 4R1TA 5EERA 4RPJA 3B6ZA 3FSRA 2VZ0A 4JGBA 1V3TA 3WLEA 2IE0A 4HY3A 2Y1GA 2X0JA 1HKUA 1SBYA 2IYOA 4CM6A 2NTJA 4PG7A 3GEMA 2YDYA 3A9WA 3EGOA 1JKFA 4MP8A 4JP3A 2E6UX 3GMDA 4OAQA 1LX6A 1A7KA 5CG2A 1PZFA 1PQPA 3WWZA 2C2XA 4FSHA 4HBGA 1AXEA 4K28A 5JO0A 2VRCA 3VH3A 2X5JO 4R9RA 3IC5A 3DFZA 4IGEA 4ONEA 5B1YA 2FZWA 1KOLA 3ROMA 1DFIA 2FR1A 2P9GA 2R00A 3WNQA 4CR7A 3KVOA 3UN1A 3ZHXA 2O4CA 1Z73A 4EZBA 2IODA 1LLUA 5MDHA 1YOVA 1PJCA 5JAIA 5JY1A 1Y8RB 3I23A 4RF5A 4E0BA 1BWSA 1I2ZA 2PD6A 2GZ3A 4QSMA 4PGFA 2HMVA 3F5SA 3S2GA 2BHLA 4CQLB 4UUMA 4WECA 3PIDA 3GZNB 4I5GA 5TGDA 4AG3A 3KZVA 1ZK1A 2ZJ1A 3GPIA 4DPLA 4TKMA 1A27A 2O50A 3ZWXA 4BO8A 2DVMA 3G0OA 4DBZA 1HXHA 4E31A 1P33A 4OIMA 3QVTA 2WYUA 2YJZA 4ND4A 2ZTVA 4RF4A 3BYZA 1H0KA 3I9JA 3NAQA 1XQ1A 4RF2A 3W4JA 4B4OA 4ZD6A 3KLMX 1BXZA 4J4TA 1LDNA 4CL8A 1RM3A 1ULUA 5JW6A 3DONA 4FB5A 4M8SA 1DJNA 4IXTA 3WSVA 3NT5A 2PKRA 4R51A 5CDSA 4PFJA 1T2AA 4XQCA 4EBFA 4ZU3A 3ROPA 1HYEA 5F5NA 1EUZA 1I3NA 1PJTA 4BIIA 3ZW8A 1WDMA 3C7DB 2NVWA 4OOFA 3F6YA 4QT0A 1RPNA 1X15A 5KVQA 3W1VA 3AM3A 1UUFA 3LZ6A 1VM6A 1C1DB 1E3JA 2BI7A 3RUEA 4BNFA 5AQ1A 5T5QA 3ANNA 5KVCA 4WGGA 3LC7O 3VPXA 1KVQA 3FR8A 5EINA 4NDNE 1NAHA 2HQ1A 3PPIA 4JQCA 3V1TC 3VVBA 3BZUA 1PS9A 3PHJA 5DNAA 4UREA 5BSGA 4UEOA 1U1IA 4L8VA 4D45A 3DHNA 3Q9UA 3ASUA 1B26A 1T2CA 5JMPA 5JNLA 5I7EA 1XR3A 4KTVE 3GZ4A 4IDFA 1XYGA 3BXXA 2AG5A 2DTEA 4MKXA 1SEPA 1YRLA 3JYOA 1BDBA 5T8KC 2B0JA 3IDSA 4CM1A 4YT4A 3JQGA 4BO3A 4CLOB 3DOCA 4PN3A 3WGTA 3IUPA 3GEGA 4AJKA 1OAAA 5IZCC 2O3JA 5A02A 4Z3DA 1LDEA 4GWGA 1IY8A 3X2FA 5FYDA 1ZXBA 1VSVA 3L6OO 1CERA 1YH3A 3JSAA 2CSUA 1PWXA 4GBJA 4IBOA 1NYTA 2C59A 1H6AA 1BW9A 4WEQA 4AJLA 5T67A 3G3EA 1YL6A 4XB2A 3JQAB 2GSDA 1WZEA 3PHIA 1GCOA 1DC4A 2VNAA 1LXCA 3RFTA 4Z9FA 4C7KA 1KYQA 1DIRA 4IMPA 4BS9A 5U1PA 1J4AA 1IZ0A 3RI3A 4CM3A 5THQA 4EGFA 3I6QA 4N5NA 1NFFA 1U8XX 5TX7A 1ISIA 4N5MA 4NBVA 4IDGA 3QVOA 4ZQEA 4II2A 4UAGA 1MLDA 4CQMA 1I3LA 2OBNA 3O03A 4JBIA 4WLFA 1G0NA 4OXYA 4FC6A 1ZMOA 2AQ8A 4AJIA 4ZA2A 2D5CA 2C2YA 3U4IA 3ZHYA 5IN4A 5EQFA 3RQSA 3ITDA 1H2BA 1Y8QB 3W8DA 2NVBA 3BTUA 3JQAA 3WFJA 4I5FA 3QW2A 4I9NA 4YXFA 2DPHA 1HRDA 4R5MA 4W99A 1NAIA 1FDUA 2O3TA 3BA1A 3GVHA 5T8KA 4BKPA 4DIOA 1U7HA 3DBLB 3R0IA 4Y6SA 4RVHA 1E1LA 3KLPX 4UUOA 4W82A 5B4UA 1R4MB 5G0VA 1T4BA 1P45A 2HLPA 2RH4A 4NBTA 2C5EA 3V2GA 5IZCA 4Z9XA 5JDIC 4OJNA 4I9HA 1RM5A 4J90A 4L9RA 5L45A 1ONNA 2J3JA 1QLHA 4NZ9A 1E3WB 1R4NA 3H65A 1AHIA 1IHYA 1SZJG 3QY9A 3QWIA 2VYVD 4BQPA 1D4FA 3HB4X 1K6IA 1J6UA 1BVUA 1ZSVA 2ZCUA 3H5RA 2QRJA 2RAFA 4XJTA 1DLJA 4GPD1 1GYPA 3FNFA 5I7FA 3QVWA 4IPTA 4CLHA 3N74A 2XAAA 4HXYA 4HWKA 5AVOA 1LNQA 2NTNA 1P77A 1VI2A 3D7LA 3O38A 3DBLA 3PXXA 4GLLA 1C14A 1D1SA 5DF1A 3WYEA 1DEHA 1SEVA 3DZBA 3WBFA 5L95A 3VVCA 4IMRA 4ALKA 2GGSA 2FR8A 3SEFA 4ZRNA 3EDMA 4J43A 3PYMA 4MVJH 1PJQA 4XGKA 3X2EA 2I3GA 4PRLA 3U5TA 3TN7A 5G0TA 1E3WA 1YB1A 2QZZA 3EZLA 3MJCA 3ZWYA 3DBRA 1E1KA 2BH9A 1ZK0A 4YQYA 8ADHA 3H3FA 3PWKA 2I3AA 4QX6A 3NKLA 2E82A 3WQQA 3V2HA 4E5PA 3AFMA 1WLYA 1ENYA 3ETGA 4IS2A 1LUAA 4AJPA 5JMWA 3WYBA 4OSOA 1P1KA 4CQMD 4XWYA 3OMLA 3T4EA 4II3A 1VL8A 1B7GO 4YT2A 3R1IA 4MVJI 6LDHA 5JDIA 1UAGA 2XPCA 1QKIA 4FOOA 5A5FA 4XDZA 4JBGA 2A94A 4MVJM 4TSKA 1HTBA 3GGGA 1PGJA 2WWRA 5GZ1A 4BO1A 3F47A 4WE3A 6ADHA 3VPFA 1Y9AA 1ID1A 1XCBA 2UAGA 4OO3A 2X5KO 2QW8A 1BXGB 1GZ6A 2WYWA 3EYWA 4Q39A 4DIBA 1QYDA 3GDOA 4E12A 3MEQA 5JXWA 3NX4A 1JQBA 1KS9A 2YUTA 2YDXA 3L9XA 4OYRA 1I33A 1YO6A 3HHPA 4B8WA 4MKZA 2VUTA 4XKJA 2ZYAA 1UXHA 1UXJA 3I9OA 4MVJA 3SC4A 4PG8A 4B79A 4CMIA 1DRWA 4J6FA 4W9NC 4Q3CA 3TZHA 4KUGA 1NX6A 1OMOA 2WEKA 3HB5X 3AJRA 3PLRA 1ZK3A 2FSSA 5TQVA 4CMGA 4ESOA 1XEAA 1U8FO 3PGXA 5KJCA 1R6DA 4XZ3A 1WMAA 1TEHA 3JYQA 1LDGA 1GADO 4AJJA 5GZ3A 4CL3A 1LRKA 1ZIDA 1PWZA 1BXGA 2VOJA 1LSOA 4FN4A 1K3TA 1HYHA 2NQTA 4DRYA 2GYYA 1EE2A 4KWIA 4XYLA 4W7HA 4P38A 5AOVA 1UDCA 2GD1O 4L73A 4QFDA 4BVAA 4JROA 5KOIA 2GCGA 5EJ2A 1M76A 2X9VA 1NR7A 5IDXA 4O6VA 3FTPA 3WQSB 4DLLA 1HE4A 2Y99A 1BGVA 2DTDA 2GERA 3KYDB 1RYDA 4GAEA 3WSWA 2H6EA 2GZ1A 2Q99A 1TLTA 3RWBA 2BFMA 4ALMA 2J3KA 1PIWA 2HSDA 1DRUA 1K6JA 2CVZA 3E6AA 2VWHA 4HV4A 1O9BA 2SCUA 3T4XA 2VT2A 1EMDA 1A7AA 2JD0A 1ADGA 3PJDA 5L4LA 3TOXA 3DB2A 4HFNA 3AY6A 4R01A 4E5NA 3M2PA 1A4UA 1CF2O 3NDJA 3RIHA 4BKRA 3STHA 3UKOA 4BNXA 4IQ8A 1H6BA 4HFMA 4NU5A 3W4KA 1DSSG 4O5OA 2HMUA 3U3XA 1NHWA 3M6IA 4B8ZA 1XWFA 4BNYA 3PDJA 3PQDA 3KYDA 1C0KA 3DBHA 2X1HA 1HL3A 3D5TA 3I4FA 3PVZA 3RBZA 1GTMA 2EIHA 5A4DA 2FRDA 4GX0A 1B14A 4JXKA 1LLQA 4I9UA 1GQ2A 3GVXA 4CLRB 3KOUA 3L4BC 4K6FA 3ICCA 5T6BA 5H83A 3MWDB 3ZDFA 3ZWWA 3DZGA 2C5AA 3ETDA 1K5HA 4MP6A 1W4ZA 5JC8A 4ND5A 5J23A 4AJHA 4XRRA 5THKA 4U8GA 3ZWNA 3AW9A 3ZI0A 3O8QA 1NVTA 5HTOA 1ML3A 3H9QA 1TA4A 5TT0A 1U9JA 4J91A 4BHTA 4YAGA 4YYZA 4LCEA 5GZ6A 1M67A 4CM4B 2B4RO 3AM4A 1JLLA 3DC2A 3A28A 1CJCA 4RVUA 1HZJA 1PQWA 2ZB8A 2ZYDA 3CUKA 4O0LA 4WOJA 1I3MA 4XYMA 3DR3A 1I8TA 1GQYA 4RQTA 4OQYA 1DXYA 1Y9EA 3TL2A 1VKOA 4XR4A 3K9QO 1IHXA 2OP1A 2Y1DA 1I3KA 2PD3A 4LSMA 1DIHA 4PLTA 3ZNQA 5JDCC 1ZK2A 5MGBA 1I0ZA 2BRUA 3SJUA 4NHEA 1MUUA 2CF6A 5BNTA 4YJDA 3WS7A 4ZRMA 4M54A 3U9LA 2QRLA 3N58A 4CM4A 4EYEA 4YT5A 3ENNA 3LVFO 4GKVA 4PVDA 1WW8A 4TQGA 3UVEA 3JQ7B 4PLVA 3LQFA 4ZHSA 3OJ0A 3T7EA 1NFQA 3ONDA 4PVCA 1IL0A 3QLJA 3W6UA 3MZ0A 2VYNA 4WASA 1B8PA 3A1NA 1ZEMA 2XXBA 4A26A 2O3SA 3L4BA 2VUUA 7ADHA 2AEJA 3OF2A 4ALLA 5ILOA 2HMWA 4RPLA 5CEJA 1WDLA 4XGNA 1KY4A 1LSUA 2I67A 1F14A 5EMHA 5KKAA 4TVBA 4EUHA 4FC7A 1IZ9A 3RSHA 4D42A 3ASVA 3RROA 4ND1A 3QV1A 3H4VA 3DTTA 3VH4A 4BB5A 3GLQA 4YWJA 3GFBA 4N54A 5EQDA 2X0IA 5IXYA 2VUSA 4CMJA 4PLHA 4BB6A 1GY8A 3R3SA 1UH5A 2PZKA 2AG8A 3MTGA 3NEPX 2H9IA 2HK7A 3PGJA 3PFWO 4GSKA 4NNJA 3JQ7A 5DBGA 3RUDA 4TRRA 3INRA 3K2BA 3GUCA 4GGPA 5FI5A 4EW6A 5C37A 2E48A 2GF2A 2EJVA 5G0WA 1ISMA 2WJPA 4KUHA 4MVJE 3FNGA 1P44A 1E3EA 1NVMB 2FWMX 3G79A 3Q0EA 2A35A 2VZ8A 1ZJZA 1YQDA 5JY6A 1WPQA 3QQPA 5B12A 3HJAA 3C1TA 1YL7A 3AK4A 3TQHA 3SBOA 3AOGA 4D79A 3OM9A 1F8GA 1R0LA 4ROSA 4UVEA 4ZN6A 3MJ4A 1KY5A 1MB4A 3Q9NA 4BGEA 4EJMA 3W6ZA 2ZCVA 4XQ9A 1VRWA 1EFLA 3OBBA 2UUOA 3AY7A 3BHIA 3ADPA 3ZV4A 4TRMA 3H9JA 3OJFA 4IJKA 2JCYA 2XXJA 1OBFO 1YJQA 1P31A 2IEDA 5T64A 5A3VA 1HE2A 1NQ5A 1CYDA 1NFRA 4M86A 1YBVA 4E6PA 2ZIZA 1GZ3A 2WTBA 1QV7A 4E13A 5IDWA 4TKLA 1JWBB 1QSGA 2DBVO 2QIOA 1VC2A 2E4AA 4KQXA 2GRAA 4FS3A 3OECA 1Z75A 4OM8A 4N7RA 2NNLD 2PGJA 1ONOA 1PJ2A 4IINA 3D3WB 1JKJA 2I76A 1JU9A 1HDCA 1WNTA 1DIGA 2DKNA 2Z5LA 3GAFA 5C7OO 3CZMA 2JD1A 3JYPA 4A73A 1DRVA 2OUIA 2VYND 2YZ7A 4HADA 3E9MA 5JCJD 5CDYA 3IP1A 1ADFA 2VHXA 3JD1A 4M55A 2NSDA 1HLDA 3A14A 1WZIA 3FHLA 4DQUA 4FOSA 4J1NA 3NJ4A 2D0IA 4D3DA 3C3XA 3E82A 1I5RA 5DCYA 1TT5B 5DULA 2WE7A 5A9RA 3DFUA 2VHVA 5BSFA 3ENKA 2W2LD 1R37A 4OKNA 2EW2A 3G1UA 1HSOA 2O23A 3E5RA 4YCAA 3ZWVA 5JYDA 1BHSA 3I3OA 1LSJA 1XA0A 2CVOA 3K92A 4TVOA 2BI8A 2PTGA 5BNIA 2I9PA 3UUWA 2RHCA 3D3EA 1F17A 4L76A 3WGZA 2QYTA 5EN4A 2PH5A 4HKTA 3WOHA 1XQ6A 4L0QA 5K0ZA 1HF3A 3UICA 5A1TA 2Y0DA 5K6AC 1HDYA 3GG9A 3GUYA 2O4UX 1KEPA 1UP6A 2DTXA 3DQPA 4Y9DA 5LDHA 4E33A 2EEZA 3P2OA 3I52A 1H2HA 3LYLA 2JKVA 5LDGA 3U0BA 1JAXA 1KVTA 1N9GB 5GMOA 5I8ZA 1U3TA 4PZCA 3TF5A 1E6WA 1EEHA 3WIDA 2NWQA 2FMUA 1SOVA 1E77A 3BMOB 5A04A 5A9TA 3S8MA 4XYGA 3UCFA 4YQZA 5JS6A 5KIAA 4E2XA 1GZ4A 4RQUA 3VKUA 1NQOA 3IKTA 2EG9A 4MVJP 3QA9A 3BAZA 4RJTA 4XQEA 2PKQO 2GN8A 2W4QA 4HUJA 4U5QA 4LK3A 1B16A 4AVYA 4B7CA 9LDTA 2Y05A 1SNYA 1UXKA 2FP4A 3WGGA 4DQXA 5ILGA 3DZFA 3WMXA 3EAGA 4XYBA 4J7UA 1PGPA 4OH1A 1X0VA 1HYGA 3PFFA 1X7HA 4Z9YA 4MINA 5KJ1A 1FDTA 1N9GA 1XKQA 4MOWA 1Y5MA 3O9ZA 3OICA 4NIMA 2OZPA 1LDBA 3C85A 1GEGA 1PZGA 2NUAA 3PJFA 3ZU2A 4NK5A 1QG6A 1TXGA 2Y93A 1C0PA 4U0KA 5I9NA 4CM7A 4CM8B 3NUGA 5BSEA 1VJTA 4ALJA 3GF4A 2Y1CA 1D3AA 3AY3A 5L51A 1EDZA 4IY1A 3QVXA 3QWHA 4BO4A 5HWSA 2ZKLA 4CPDA 4E32A 5A06A 5K6AA 1TB4A 3N7UA 5CAEA 5BNFA 3KSDO 2G5CA 2QX7A 3GHHA 3VPHA 5CHEA 4E5KA 3S2IA 4DPMA 2FY8A 5TJ9A 3BTSA 3LC2O 1D8AA 1H9BA 1DB3A 1E6UA 5CP8A 4NJOA 3OP4A 3UXYA 2H63A 4OL9A 2YHIB 1Y8RA 2P9EA 2YQ4A 3DOOA 3FR7A 3ZNNA 1DPGA 5F3RA 3DAFA 5G0UA 4EEZA 5JE8A 2Y1EA 1FXSA 1PR9A 4K9DA 3KRTA 2B4TO 1T26A 2I99A 4CQLA 1W73A 3GZNA 2HKIA 2IRWA 5DOVA 5U4QA 5G4KB 3W8FA 3UF0A 4IGFA 4WCDA 1BMDA 4CMKA 4R68A 1E5QA 4R54A 3GT0A 4E21A 4BV8A 5A05A 3LT0A 2R6JA 1GYQA 3CZRA 1OZAA 3PYXA 4E2ZA 3F1KA 3VZRA 2J5RA 1V0JA 3OJOA 4IQ0A 1Q1NA 4IS3A 4DIFA 3OQ6A 3Q3CA 1T2EA 1U5CA 1YB5A 3PTZA 2O3QA 2VRCD 4FFOA 3RBVA 4QO8A 3ZN2A 1G0OA 1FDVA 2IDZA 2PGLA 4HX5A 2NU7A 2CD9A 2JD2A 4YAJA 1O94A 4BNGA 3GRKA 1QR6A 4EEXA 1KVRA 1I36A 1CWUA 1ZVMA 4FR5A 1C1DA 2FHSA 3ZGYA 3C8MA 4PZDA 1FJHA 3GR6A 2PH3A 4WK6A 1NWCA 1SB8A 4GX1A 2JFFA 4NQZA 1MGOA 2Q50A 4RF3A 2ZB3A 1PJLA 1ZK4A 4QUKA 3ZZNA 3IMFA 2EW8A 2DFDA 5TIIA 5EPOA 4ZQHA 5KVSA 3WX0A 1DIBA 2ET6A 3AU8A 3FWNA 4IXWA 4G65A 3ZH2A 1GR0A 3H2SA 4CV1A 1IB6A 3PHHA 5DP2A 5AXAA 3TOZA 1PJ3A 2OO5A 4JJIA 2DC1A 2QYSA 5U9CA 3RAJA 5HS6A 3TL3A 1OC4A 1B3BA 2ZTLA 1H93A 1O95A 3INGA 1QLJA 1LQUA 3LT1A 3SXPA 4BNLA 4FFRA 4CLOA 1EQUA 3DWFA 3MJEA 2NVUB 3UHAA 3VPSA 3WNVA 1NXQA 3UCEA 1W6UA 3EZYA 1VE9A 3ZU4A 2Y0CA 3OIGA 2WDZA 2AE1A 2OORA 2EWMA 2JHFA 3VH2A 1VKNA 2WD8A 2FPIA 3D4NA 2E49A 2AEMA 2OOSA 2PLAA 2O7SA 1UP7A 4FJ0A 4A27A 4MKRA 3GMSA 3RKUA 1T4DA 2Q2QA 3SX2A 3OQ1A 2CMDA 1ADCA 2AA3A 3Q2IA 1J49A 4CV0A 2RBEA 1Q7GA 5JO9A 5CG1A 4LN1A 4WNIA 2DAPA 4PLWA 3FNEA 1NVGA 3JQ8B 4J49A 4N5LA 4R4JA 3BMNB 4YDRA 5JLAA 3K30A 4D3SA 1S6YA 1L7DA 3D1LA 2BD0A 2P4QA 5A03A 1KBZA 1P1FA 3JQ9C 4ITUA 3JV7A 5IDQA 1GV1A 4D41A 3EVTA 1I24A 4YBZA 4K6CA 4I8XA 2C7GA 2DUUA 5AXCA 3EK2A 2W8ZA 3F5QA 3KB6A 3HDHA 2Q1UA 4JX8A 1C0LA 4JK3A 5L4NA 3O4RA 2AQKA 2LDXA 1GUFA 3BMCB 4Y6RA 3PI7A 3E1KA 2Y67A 1Y8QA 3KXDA 4KZPA 2AE2A 4KDEA 5TT1A 2OL4A 3FI9A 5TSDA 1SMKA 4A2CA 3H9UA 5CFZA 4RPKA 2DM6A 3JQ8A 1SCUA 3NYWA 3CH6A 2O2SA 1DIAA 1R4MA 3BMNA 4O59O 4LISA 4MPDA 3IS3A 1D1TA 3PZBA 3WG9A 4DUPA 3JD2A 1Y81A 1PL7A 4J9UE 4RVFA 2Z1MA 4CMEC 5I9MA 5G2OA 5DT9A 1MP0A 4LCJA 1EVZA 1U28A 2FSVA 4NR0A 3TZCA 3BMCA 1IOLA 4BO0A 3H9GA 4B4VA 3WIEA 1HDRA 2B5WA 3KTDA 1F8FA 5IAAA 1L1FA 3DOJA 3V8BA 2BELA 1AXGA 3RC1A 2Y1FA 3DL2A 1FF9A 5L7TA 1A9YA 3OETA 1FK8A 2Q2VA 3JQ9A 4BKUA 1ISHA 2GZ2A 2CZCA 4J7XA 1U5AA 2HMTA 3S1LA 3ZHZA 1Z45A 4BO6A 2BGLA 1EVJA 3JQAD 3BTOA 1DOHA 3RD5A 2AXQA 1CRWG 2DBQA 3AUSA 2EGHA 4J1SA 2YV2A 2HU2A 4CM5A 4LSWA 3R6DA 4DTIA 5LCXA 2VWGA 9LDBA 3MCVA 1E1NA 4QXMA 5TS3A 1XLTA 1XIVA 4XDYA 5CPBA 3KYCB 2YHUA 4MJLA 1PJ4A 2GR9A 3DTYA 4RVDA 1JDJA 2CF5A 3WLFA 4BNHA 2Q4EA 1DDOA 4CMEA 3RUAA 1Y1PA 1U4SA 1YXMA 1JN0A 2G82A 3EVNA 2J3IA 4XR9A 2C20A 3UOGA 4W4TA 3AM5A 4DLBA 3ZW9A 3KETA 4Q3EA 3JYNA 2X0RA 2O3RA 5DCWA 5JPIA 4TWRA 4P4NA 1PGOA 1EQ2A 4B7XA 3MJTA 4ZJUA 3MJVA 1T1RA 1Z74A 5JC1A 5TLSA 1XU9A 1U3VA 1YONA 5CDTA 2YV3A 5BQFA 2EKLA 3GRPA 3C1OA 4A10A 4UUPA 3ZU3A 2GDZA 3KYCA 1F0YA 1K2WA 2G17A 3GK3A 3I1JA 3NT2A 4K1LA 5F1OA 5BT9A 3RJ9A 1GEEA 4GKBA 4DC0A 1PS8A 3F9IA 3LT4A 1AE1A 2X22A 1TVEA 1E92A 3RU9A 5ICMA 3JQDA 4XEHA 2EP7A 5KWEA 4WCFC 1DHTA 3EW7A 1T2DA 4FW8A 5EL0A 1MC4A 4WEOA 3WMWA 2YYYA 3HNPA 4OSPA 4P8RA 4DREA 2WMDA 2P5UA 2VT3A 3GAZA 1BXKA 3WGHA 3ST7A 4BNZA 2VRBA 1YQXA 4UVDA 2R2GA 4Y98A 1HE5A 2CVQA 3QE3A 3AU9A 4BV9A 4DQVA 4OXKA 3CPSA 2ZB7A 4YJFB 4BMSA 1RYEA 1LC3A 1EBUA 4TZKA 4FGWA 3WJAA 5ENDA 1V9LA 3QVSA 4G5HA 5C5IA 4OKIA 4FFMA 2GUGA 4LRSB 2B35A 3D4PA 3E48A 4IUYA 4WCFB 3EHEA 4YJGB 3VHRA 4BOYA 1MG0A 3SVTA 4F46A 3GGPA 5IJZA 1RJWA 1JW9B 4OQZA 4R1NA 3K8ZA 4FDAA 1RKXA 3FNHA 4DXHA 4M89A 2OHXA 2A4KA 4E3ZA 4MVJD 3KBOA 3FF4A 3KHUA 1CIVA 1B8UA 4I5DA 1B8VA 2Q1TA 4H16A 2IZ0A 1LDMA 1X7GA 3AWDA 1HZZA 4BGVA 2J3HA 4M1QA 4NJMB 4NBWA 4I08A 3IAHA 3P7MA 3D64A 4YRBA 4GI2A 4WNCA 4Q3DA 1VL0A 3GDFA 5L3ZA 2FR0A 4PIVA 2DFVA 1NTOA 1IE3A 2J5QA 3SLGA 5I8WA 3A4VA 3FPCA 4XIJA 3RUFA 4E5YA 4RPHA 1QV6A 1A72A 4WLOA 5C7IO 1X14A 2D5AA 4IJVA 4BUCA 1P1HA 4C4OA 4WCFA 1ZNQO 4U0JA 1LRJA 1U3UA 1I10A 2X9NA 1XGKA 3FTNA 1WVGA 4MIOA 4U6SA 3GEDA 2V7PA 3Q1LA 2XF8A 4YJHB 4EI2A 4RVGA 4CLRA 4CODB 3NGXA 2EP5A 2J8ZA 2NU6A 1EZ4A 3ETEA 3WGIA 3WICA 1U2DA 1E3LA 4NK4A 4S3MA 3I9KA 3TFQA 1HDXA 4H7PA 1QYXA 3QWFA 3D0OA 1LBEA 2Z95A 3IQDB 4Z0HO 2X58A 4Q3NA 4GQAA 4J3FA 2Q2WA 2ZB4A 4CMBA 3L9WA 3WTBA 1DJQA 2PA3A 4BGIA 3G17A 2W90A 5KCZA 1HT0A 1PEDA 3ZV3A 3GOHA 3GDGA 5DDIP 3VAZA 2WSBA 3FRJA 1LU9A 4IZHA 4YB8A 2UV8A 4AJEA 1N7GA 3IOYA 2O48X 2PFGA 2J6IA 4YJHA 3HSKA 3VZSA 1VSUA 3HDQA 4C7JA 5COQA 4KQWA 2H5LA 4IQGA 1UR5A 1AHHA 2HJSA 4EJ0A 3BTVA 1LQTA 1PTJA 1YKFA 3BHMA 3E5MA 1GDHA 2GN4A 4OHUA 2RIRA 1Q7CA 5KVVA 3KEOA 1P0FA 3WGOA 2NQ8A 1GUYA 4W6ZA 4YRDA 1YDWA 3SLKA 5EIOA 5IG2A 2PWZA 2PK3A 1KVSA 4BNIA 3ZWOA 3ZWCA 3FPLA 5KJ6A 3GN2A 2WE8A 2V6GA 4BO9A 3FN4A 4F6CA 2HRBA 3VC7A 1VJ1A 3M1AA 3I6IA 2E37A 3K31A 1EVYA 1UJMA 2RHRA 1K0UA 3AI2A 4KDFA 4PCVA 2WD7B 5ER9A 2X23A 3OSUA 4LGVA 1NPTO 4UVIA 3RFXA 1HLPA 2DBZA 4Y6PA 5KJFA 1ZZEA 1LDYA 1Q7BA 2HRZA 2P68A 4P22A 4YAEA 1P1JA 1MXFA 4CUZA 1M6WA 1HDZA 2GLXA 1M66A 3F4LA 4OXNA 4CUKA 3LK7A 1EFKA 1HDGO 3ITKA 4J0FA 2HDHA 1ENPA 1M2WA 3WDSA 4ILKA 5AXDA 1ULSA 1B0AA 1B2LA 1Q0LA 1CEQA 1U2GA 2NLOA 1LRLA 3TDKA 4GWKA 3OEWA 5F1PA 4DLAA 1ZSNA 1EUDA 2GPTA 1EK6A 1U7TA 3BMQB 4PG6A 4A03A 1YDEA 4ALNA 1DAOA 2A9FA 3GFGA 4J4HA 5A9SB 1T25A 4BMVA 1T24A 1PX0A 4MIYA 3RJ5A 2O2YA 4LVCA 3ZV5A 3TJRA 2EF1A 3TFOA 3WR5A 2RH8A 1MXHA 4FQ8A 5L4SA 4Z0PA 2CDAA 3B1JA 4WPGA 4JLWA 4NI5A 2VHYA 2IZ1A 2PKQP 1OC2A 3S2FA 4RORA 4D3FA 4FFNA 3HQ4O 4NFYA 3IKVA 4J7CA 2CFCA 5DOZA 2QQ5A 2EV9A 1ZXLA 3VZPA 3SC6A 5HRUA 2X7HA 3FCOA 2X86A 3ONEA 4LW8A 1PGNA 4JCOA 3AI1A 4RGBA 4YR9A 3PIIA 3BMQA 4J1QA 2NU9A 1ZFNA 4BO2A 1H5QA 5F5LA 2JAPA 1XDWA 3W4IA 1MC5A 4YAIA 5TF4A 4TRNA 4XB1A 1Q2XA 3D3WA 3LT2A 3I83A 1HEUA 3FBGA 1OOEA 2EKPA 1EVIA 2Z1NA 1KVUA 1PQUA 3JTMA 4L4RA 4R16A 4J2HA 2Y1OA 4TROA 3VDQA 3AOEC 3TRIA 3GVPA 3RASA 3GNSA 4FCCA 4RZHA 4Z0TA 4FPXA 2NV6A 4LRTB 3ZNPA 3HN2A 2VCYA 3HE3A 3CMCO 3LLVA 3H7AA 4ZQGA 1TT5A 2Q4BA 3VH1A 5CEEA 3DAPA 3DBVO 4IDEA 4CR6A 1Q0QA 4PRKA 2POQX 4R3WA 3JD4A 2Q3EA 3PWSA 1X1TA 3KSUA 4E30A 3HUDA 3TWOA 4YRAA 5L7YA 4NH4A 1E3IA 1E7SA 1P74A 2TMDA 4GLOA 3W8EA 4Y8VA 1NQTA 1YOVB 2FN7A 2UYYA 3G1TA 3H5AA 3WGYA 4MIEA 4GMFA 2YV1A 1QYWA 3COSA 3FBTA 2AQHA 3JD0A 4JJFA 1HETA 2B69A 5IFLA 3F1LA 1A4IA 3CKYA 4A7PA 4ZGWA 4CV2A 3UH1A 1YGYA 4RZIA 3JQ6A 2CDCA 3KUXA 1WDKA 1N8KA 1EUCA 3HFGA 4D7AA 4HNGA 3CIFA 3BMOA 4DL9A 3PHGA 1SPXA 5JFOA 1ZO8A 1V3VA 1GAEO 1NR1A 2XOXA 4RDIA 4D0SA 2Q45A 1GQQA 3OQBA 1YQGA 5FFFA 4ALIA 2VOEA 2EGGA 2BGMA 4ND2A 2C0CA 1J0XO 2C07A 4GX5A 1FDSA 2ZTUA 4UEKA 1ZUD1 3FD8A 5BR7A 4MVJF 3V1UA 1AN9A 4MO2A 1TI7A 1ISGA 5COBA 3AOEA 1J5PA 3ICPA 4H15A 4KTTE 3ZV6A 2NU8A 1YVEI 1UP4A 2W98A 4FFLA 3ZWPA 3CE6A 3ONFA 1F12A 4JP2A 3S2EA 3ZWAA 2X9GA 3E8XA 4CLEA 1DAPA 3Q11A 1ENZA 2EJWA 4QEDA 2Q46A 3OHSX 3L07A 5AYVA 1ENOA 2LDBA 1IPEA 3BHJA 4WLNA 2BF7A 1IULA 5I7VA 1DC5A 4WLEA 1GL3A 1AGNA 2ZK7A 1GD1O 3GH3A 1X7DA 3K96A 4ID9A 4N18A 3RUIA 4CM8A 4UVGA 4DGSA 2A92A 3LF1A 4L4XA 2D4AA 4ZQBA 3V1YA 2WM3A 4IDDA 4URFA 1JTVA 3NT4A 5KKCA 1ONPA 3QIVA 4MP3A 1LSSA 4R69A 4YA6A 3D5QA 4DWVA 2VHWA 3I5MA 4RVSA 2BGKA 4R5HA 4OOEA 2PR2A 2PD4A 4XGIA 4JN6B 4E5MA 1DFGA 4JNKA 5ES3A 2EXXA 3TZQA 3B70A 1YBAA 4FJ1A 1JVBA 2P9CA 2JFGA 2YHIA 3JQGB 4RO0A 4CV3A 5F1KA 3M1LA 4U7WA 3WQRA 1WP4A 1P9LA 1E3SA 3O26A 1MFPA 5F21A 2GNAA 3VTZA 5G4KA 4KUEA 2CY0A 3RUCA 1DBVO 3ZU5A 5L9AA 1CETA 1BW9B 1LA2A 4D43A 3DHYA 4G81A 5L40A 4L4SA 4BMNA 2X0NA 3KEQA 2JCVA 5TRTA 4BNVA 3H5NA 8LDHA 4AFNA 1QYCA 2VYVA 4IDAA 4AICA 1N1GA 2DLDA 4NU6A 1OI7A 3RU7A 1P0CA 3RC7A 3U62A 1ARZA 5EESA 4DA9A 1NASA 2PNFA 4G2NA 4BL5A 3L77A 3AUUA 3KV3O 4BO7A 2DUWA 4HFJA 5B4TA 2UDPA 3CXRA 1ZKMA 4Z6KA 1G6KA 1P1IA 1QORA 1UXGA 2PV7A 2X4GA 1I2CA 3CSDA 3U49A 3GVCA 4CQMB 1GPJA 2V6MA 3KYBA 3JD3A 5ADHA 1KC1A 1UXIA 5IN5A 2HAEA 2W2KB 5TNXA 2BFAA 2YFQA 2C54A 4DVJA 3RVDA 3ZWMA 1AUPA 4O63O 1IYZA 1ZEJA 2PGDA 4EITA 2OGUA 4UULA 2B83A 4TMFA 5CDUA 5H81A 3TZ6A 1MV8A 3JQEA 3ZHBA 2NM0A 4B4WA 1Q0HA 4ND3A 3WTCA 3RC2A 4RLHA 1B15A 2RCYA 4GSLA 4X54A 3P19A 2C7VA 4IDBA 4BNWA 4JBHA 1Z7BA 5DCUA 3WBBA 3GGOA 5JAZA 5T57A 3CEAA 4DYVA 4UUNA 3RFVA 3H9EO 2ZQZA 4HFRA 1PL8A 3DO5A 4OMUA 2VQ3A 2ZYGA 2BFOA 2VTEA 4BO5A 1GYRA 1P3DA 3F4BA 2NACA 4WUVA 1V3UA 1UZLA 1R4NB 3INTA 4KP7A 4CJXA 3UW3A 2VTDA 4XQGA 4DYDA 2W2KA 3H6KA 3C7AA 4RPGA 2ILTA 2HMSA 2NVUA 1O89A 5DN9A 1PL6A 2ZJ0A 3IL2A 5KNLA 3OA0A 1FDWA 4XIYA 2P4HX 4CMAA 4EJ6A 2AW5A 4AJ2A 4BQRA 1N92A 4ZICA 4NMHA 3LDHA 2D3TA 4XYEA 1KIFA 3DAGA 1ORRA 4NG5A 3GPDG 1A9ZA 2I6TA 4B3JA 2GASA 3L0DA 3ROKA 3BIOA 5FF9A 1EK5A 5I9LA 3DHEA 3C24A 4J0EA 1R16A 1YL5A 4KOAA 1B3RA 4XD2A 4E2YA 3OIDA 3GN1A 1KC3A 2Y0EA 3ZCXA 3DBRB 4S1VA 2D1YA 5K9ZA 4LMPA 3DEYX 3QP9A 1YS4A 4AJ4A 1FMCA 4K26A 1QYVA 4INAA 3B1FA 3HFSA
chains in the Genus database with same CATH superfamily
1OI4A 4RS3A 3N6XA 3K8YA 3FCYA 3AKYA 4QPJC 1MO3A 2N3ZA 2YN2A 5CA0B 3W5AA 2VWPA 1A5BB 4W5NA 4D98A 5JBNA 5HM8A 3NTQA 3CSSA 1INLA 1O8CA 2QJOA 1FX0A 4HRYA 3OUUA 4PLGA 2P91A 5BUQA 5GINE 1KDOA 3RBAA 5CHYA 4AJNA 2H92A 2EP8A 2CL5A 1MX3A 2DQ4A 2R1ZA 3OH8A 3TIFA 3OE7A 2R7LA 2IUYA 2JIQA 1XJCA 4UEJA 4PRZA 5LB2A 4OHWA 4IZIA 4D74A 3WYAA 1T5OA 2I66A 3TGPA 2PZMA 2AMJA 3Q98A 5B2FA 4XA8A 1Z6ZA 2Q5FA 4HWSA 3O94A 4A8JC 4ZI2A 3MWJA 1TFUA 1PD0A 2F8SA 1ZHHA 1BAPA 1WRBA 2CZGA 5LA6F 3I2JA 1NPDA 5HF5A 4TYYA 4RIFA 1WL8A 3AUTA 3F97A 3NALA 2RFLA 4QTTB 4YLYA 4COOA 5A4IS 4NF2A 3AGQA 4OJMX 3OIFA 1PI3A 3CGWA 5CX1A 4D0RA 5KQPA 1JH9A 4IO0A 4G1MB 2F1KA 3DKPA 3OEYA 4TRJA 4B48A 1DWUA 4Q05A 4QDUA 3BWMA 1E8DA 2C7OA 4Q9NA 4EFNA 4KR3A 3GBPA 3I64A 1PYGA 3H1BA 4RE6A 3WYCA 4PTLA 2HYIC 2O5VA 1TVMA 1C9YA 1H65A 3BB1A 4EARA 5FA5A 4BMXA 5LP1A 3ESQA 1WUHS 2JCXA 2JI8A 2PRKA 2L69A 5E6SB 2H1HA 3FSJX 4JJAA 5CVJA 4RFSB 2OECA 3R3HA 3RSOA 4U39A 1X19A 3G2IA 3NBUA 1IMJA 5MN4A 4FIZA 1K89A 2ZTMA 4AJ1A 3VX4A 1EWYA 2QIPA 3U44B 3IP3A 4X9XA 1NHGA 3L7YA 3T7JA 3R3YA 4I4IA 3CZQA 4HQNA 1LEHA 2Q1WA 3OP1A 1J8FA 2EFYA 2UYHA 3FH0A 8GPBA 2R44A 2FMFA 1V35A 1RAHA 1ZNWA 1N8NA 3ADKA 4RK6A 5FOTA 1P60A 1WWKA 4Z4QA 2QUKA 4IWXA 1VB5A 1XMQB 1II8A 3PYLA 5AW7A 3RAPR 3GJYA 1KBQA 1N6KA 3K73O 4QTZA 3PQFA 4YEDA 4DGQA 1OI2A 3UG7A 5CDGA 6AT1A 2ESRA 5IDYA 4XPIB 2ZIFA 1NRIA 3ZZ1A 3ZQJA 4CFYA 5BQ3A 1GNLA 4MWBA 1JIJA 1WQ4A 4EG4A 3AUAA 3DD1A 3FCCA 3CJRA 1GV0A 1HFWA 3LOPA 4ZRDA 1W0KD 1USGA 5IM4A 5KTKA 3EA4A 5EKUA 2SCUB 2ZUWA 1WUKS 2H85A 4BB9A 1CK4A 1AF4A 1OFGA 1WULS 2C97A 2BMAA 2FE1A 2YWJA 4M8IA 5C0OE 4OMFG 1NNUA 1D07A 4I36A 3R76A 5H4GA 1JZSA 3ZCSA 1BMQA 1F0NA 4YDQA 2HJRA 5JSFA 1YDHA 3A11A 2CFIA 4MJXA 3CRW1 1BSVA 4DC1A 2QZ4A 5JCXA 4Q3KA 1JA1A 1PZHA 2X40A 3AF0A 1E6EA 2PUWA 4GZ3A 4CM9A 2WOOA 3NIBA 4TZTA 2QPTA 1SRQA 2QA5A 2QDKA 3QJGA 5I9BA 2Q3DA 2YWDA 1GN9A 2APJA 3HXOA 2UXDB 4YJ2B 5DIFA 2BKAA 4Y2PA 3HKCA 5F52A 1TEZA 1IXSB 5K8JB 5IZ4A 1POXA 2OFOA 2Z6VA 2XYRA 4JSTA 3VOSA 4D9IA 3HADA 1OB2A 2QM0A 1JVSA 1AGPA 4PZAA 5KBYA 1QGDA 2YV5A 3FHCB 4D80A 4F5EA 1LB1B 2NZYA 1LLDA 3K32A 2Y9PB 4D0NA 1LC0A 4R1OA 4EKNB 5G0SA 4RCVA 1BYIA 4UTRA 3W5IA 4UNIA 3RBXA 1QG4A 1NWHA 3Q12A 1NW5A 2LE0A 2QTCA 3EE6A 2IBSA 3PLNA 2IXBA 4MYCA 4YPOA 4Z7QB 4W6QA 5DLEA 1XKTA 3UAGA 5EZ6B 1KYVA 3BCSA 2P6RA 1D0VA 2NADA 2FPOA 1CHNA 3EODA 1TW2A 2FUNB 3AKDA 3HABA 2E4UA 1E7QA 3QNUA 1QWSA 4KEAA 5CCEA 3W5SA 1LS6A 1YAHA 3H3JA 4RH0A 4NVRA 3TO5A 2DSTA 4WXEA 3PP8A 1KOJA 3KXIA 1DC3A 6REQA 2GZMA 3JALB 4GVLA 5FB3A 1RD4A 1P0PA 2AQIA 4DV0B 1ZJYA 4CIBA 3H1EA 1CY1A 3DTVA 4W9NA 2VSXA 4BP1A 2J0UA 2HCTA 4OG2A 1G8MA 3DP7A 4TKZA 2YW2A 2WP8J 4AWBA 4EUFA 1QP8A 1JVNA 4N0PA 4Y30A 1SULA 4KWEA 1G8JA 3IAFA 4YQFA 5LOVA 2VQSA 5GONF 4CFSA 1QQ6A 1VJ0A 4RTNA 3EMDA 1R66A 3LU1A 2AX4A 1CS4C 1TYEB 3C3BA 3FBWA 2IYSA 1O58A 2DU8A 3JZAA 3KX2A 3SS9X 3ZGVA 2MSCB 5K7SA 3AF6A 3JZDA 1Z7YA 3N3BC 3WK8A 4CR8A 4DBVO 1JR3A 2ZIEA 3PHLA 3HNRA 1CP2A 1BG6A 1D7OA 4LZJA 4K9RA 4KLAA 3GEBA 1AZSC 3TLYA 5ALTA 1XMIA 1PP4A 2YNMC 3ESXA 5F7XA 4KIFA 4AY3A 1MW8X 3EA5A 3GP5A 1YQQA 4BGUA 1VQ1A 2BR3A 4UNNA 4LV8B 3RC9A 3C8UA 3K6JA 3FPSA 2G76A 1C1XA 2IYAA 4LAFA 2IIPA 4IEEA 2XRZA 4AP6A 3ER8A 1RWWA 4U7HA 4D9BA 4F6LA 2B34A 3GB9A 5B7NA 4J16A 2XGOA 3RS4A 3F74A 3HN7A 2PPVA 2W93A 4LMRA 1TIKA 4YHBA 1G6Q1 1SM4A 4MKHA 4V1CB 4NL4H 1ADJA 2F6RA 1G4HA 4PHTA 5FUVA 3SX0A 4BQFA 4R1UA 3WLHA 4GEGA 3BJEA 3M6UA 1P8AA 1E0JA 1I30A 2UXCB 2J5KA 3D1VA 3IUSA 4F6RB 1OLUB 2QRPA 3MCUA 1VJDA 4YRIA 1NNEA 1K3UB 2CJPA 2ZSIA 4CIVA 2I4LA 3H8JA 4LWQA 1JI3A 5E2AA 3IEXA 4YP5A 1DWQA 2G1UA 2EFHB 2EATA 1CUWA 2IPNA 3JRWA 3KSZO 3DO6A 4IDHA 1HNZB 3D6TB 1PJZA 2A1UB 4BNKA 4BASA 1CQIA 2HU5A 4TMWA 1CSEE 1J9GA 2VZ9A 3TLBA 3GEPA 5KOJA 5EHIA 2FW7A 3ESCA 1NXOA 2HHAA 2IP4A 3P2IA 3DMYA 1FB5A 2J6CA 1W9HA 3SZMA 3OU6A 1IXZA 3GT3A 3KO8A 4JIGA 4BEBA 3HM9A 3QTBA 2H65A 3GJXC 5HYVA 2JLQA 1T2FA 1HM5A 1WXEA 2MDTA 1J22A 4JNCA 4YAWA 1C4XA 1Y7TA 3E4DA 3JWJA 4FD3A 4PSVA 2OAGA 4Y2GA 4L0CA 3T5AA 3QENA 3LLSA 4Z1MD 2N0SA 4RK7A 4ZVMA 2ON6A 3A9TA 5ICSA 5C53B 1NLYA 1ESEA 3F2IA 4I46A 3UJBA 5JISA 5E6RB 3CONA 3MELA 3P0HA 1FRNA 1SKMA 1P39A 1LLCA 2HK9A 3B82A 3LS2A 1T8PA 3JQFA 2WF5A 3OY2A 4H3VA 5FL7A 1NJGA 3S55A 4F9FA 4L50A 3A8TA 2CB9A 4I55F 3GVIA 2QRKA 1WXHA 3MT8A 3QG5A 1K5PA 2V65A 4EY5A 3QE2A 1QMGA 3KKQA 1W34A 4ACAA 5L8VA 4ZZ0A 1V39A 3AESB 3LHFA 4D25A 5E7JA 5GY7A 3IJPA 4EH1A 3EG9A 2Z5GA 3LBHA 1T0UA 1AN0A 2QN1A 1CDOA 3E7XA 2ZETA 4G97A 821PA 1N9ZA 5AKXA 3B20A 4RK4A 1PK8A 1VXRA 5F4BA 1UQUA 3ESAA 4EHNA 1BDMA 1XG5A 2H4JA 2JJ1A 2ATCA 3RYTC 5JDCA 1C3VA 1ZRMA 3JX9A 1FVHA 1FRFS 2GOYA 2HWWA 1VBMA 2XX3A 3BWVA 3EW9A 1D2AA 4HP8A 2H1IA 4N8EA 5IXSA 1RLTA 1RLIA 1O87A 4HTAA 2A84A 3TAHA 4X93A 3N2GA 5BQOA 1SO8A 2XYVA 3B38A 3HBMA 3C97A 4JD5A 1SU8A 5I7AA 2OFPA 3BDIA 3FMVA 4GW3A 3BK7A 3EY4A 4GGOA 3SNHA 1UMKA 3S8YA 2OHHA 3WDLA 2E4VA 1Z6XA 1E66A 1AOXA 1JBQA 3ELDA 3SVZA 1VJ5A 3DE0X 1VBKA 2Q3MA 3G82C 3UUGA 4C2BA 2P2YA 4XAQA 3ADOA 3IE2A 1E58A 1QK5A 1LBSA 3MWKA 1TK3A 4YMLA 3EDCA 4BRZA 1U9IC 1U3WA 2JLBA 1H4TA 2QD2A 1SPBS 2OD2A 3HXTA 1V5EA 4IHJB 3WL6A 4JKIA 5KTTA 1PR2A 3NWJA 3RT9A 4B31A 4CEJA 3VA7A 4MR7B 3W6OA 2CXSA 2QM7A 4YBRA 3QRWA 2VAXA 4IV0A 2B37A 2CXHA 2W6PA 3P5SA 5K0TA 1ZYUA 4V3CA 2VHJA 2VTBB 2B1IA 3T94A 1KXJA 1AA9A 1Q0PA 4C0XA 4I5EA 1IONA 2PJUA 4FI3C 3ND7A 2RB5A 1JAYA 4M0EA 2FPPA 3CHYA 3UOAB 5IP5A 5A9SA 4DPKA 2COKA 1EFTA 2X6TA 3RS0A 1XRSB 3JVEA 3A3KA 2QBYA 1XA3A 3CEHA 3WAGA 3OCZA 4ENRA 1Y6JA 4YACA 4AZSA 2B30A 3CVWA 4Q3BA 2QL5A 3O91A 2W2VA 1O6ZA 2CBZA 5T7BA 3FUCA 5SY9A 3U3JA 3IVRA 4HDRB 1T4GA 2P2ZA 4CWAA 4ZZ3A 5I47A 2YICA 4ZOLF 2JDIA 3B9BA 1VHWA 2DH5A 3T0FA 1EB9A 1XDGA 3CT4A 5I7RA 2OGTA 4BJ1A 2PLNA 2ZIUB 2CV1A 4FYXA 4ZT7A 2DWUA 3DDNA 3ZDQA 1DKUA 2O3UA 3IPAA 4Z4IA 3R7NA 4FCTA 4PZPA 3G5MA 4JVMA 2GA9A 4MARA 3VTKA 2YV4A 3MWLA 2QG4A 1RMTA 4G1FA 3ESYA 2EGUA 1QB8A 5SY6A 3GMTA 3CKLA 4QUDA 1YE3A 5G3YA 3H0KA 5JAQA 1RFLA 1JJFA 5LWQA 3NM4A 1G20E 4HDOB 1JR3E 3P52A 1PD1A 5TMDA 1BEUB 1UJ5A 4MYHA 5FR2A 1OZHA 1YIDA 1B0ZA 3SS7X 5D87A 4P3YA 2G0TA 4XM0A 4CLXA 1UQTA 2HWXA 2W2OA 5DYNA 4GL2A 4C7OA 3HU3A 1WHTB 2OMEA 4EO7A 5EERA 1G9SA 5CDFE 1FP4A 2FSPA 1R0CA 3B6ZA 1OYVA 4PSKA 4I9FA 2IE0A 4OBEA 3TLAA 2Y1GA 4PSCA 2X0JA 1HKUA 3TSAA 4CM6A 1GPWB 1CY2A 1TPYA 2NTJA 3FB4A 3QHPA 1DDIA 2N46A 3GEMA 3EGOA 3UXHA 1EHCA 3GMDA 2XVMA 3KKPA 4OAQA 3UB2A 1SUDA 5I51A 1O1YA 3WWZA 1GM5A 2VO1A 1AXEA 1XXLA 2VAMA 2VRCA 1NVVR 4KPUA 4TZ0A 4ONEA 5JU6A 3FDJA 3GBSA 2DR2A 4JI6B 4DWOA 2IPLA 2CVHA 2TRSB 3MT7A 3DKRA 3B51X 1J9ZA 1QAOA 3FA2A 2FG7C 3UN1A 2O4CA 3DMFA 1Z73A 4P93A 1L5NA 2IODA 2Q21A 2YJ4A 2IQ5A 3W7VA 4UASA 5DHTA 4N82A 5H80A 4LYJA 5JY1A 1Y8RB 3W5BA 2ZSKA 4RF5A 3HA5A 4E0BA 4HNSA 4OHCA 1BWSA 3LUDA 3G02A 4DXDA 5JWHA 2ZWOA 4C5CA 3F5SA 1SD2A 1NI5A 4MA0A 1C1YA 3EULA 1SK8A 5TY0A 1A69A 4JLJA 1OCEA 1SIWA 3I9V1 5TGDA 1ZK1A 4DPLA 1XNQB 4OQNA 4G0PA 2ZB2A 3ZWXA 4MRRA 2HWYA 3G0OA 4DV4B 1ZRNA 3EGXB 2HF2A 4FHZA 1B6TA 3AB7A 5DXFA 4PX5A 2PUGA 3T95A 2YJZA 4JSYA 4RF4A 3BYZA 3HXKA 1XL0A 2QP3A 3NAQA 4KSCA 4RF2A 3BHNA 5CDHA 3W4JA 5F7JA 5IM4F 2H7XA 2RIPA 2IPOA 4ZTZB 1LDNA 2JIMA 3R6LA 3VYVA 1B6SA 5ESDA 3LRTA 3LYUA 1MJFA 1RM3A 3UHPA 4AYTA 5JW6A 2VJKA 5GGXA 1DJNA 1MV5A 2VDRB 3WA6A 1K9VF 2AN3A 4UEWA 1K68A 1J2YA 3VSBA 4TS1A 3MGGA 3FNRA 2JI7A 1T2AA 2CXQA 4JI8B 4FDVA 3ROPA 3DP9A 2PH7A 3NTVA 3V7YA 3ZW8A 3I2YX 3FY4A 1X7ZB 2I4MA 4EAQA 1GZDA 1L1RA 2X76A 3F6YA 3JARA 3H99A 2X77A 3CRNA 5CT5A 1Z36A 5DHQA 3L8MA 3WGNA 3V33A 4OMDA 3V7UA 3U7FB 4BNFA 1C1DB 3O0TA 4HX9A 5AQ1A 5K6RA 2A14A 5LXTB 1E6CA 2DMRA 3ANNA 4G0YA 5T5QA 4OJYA 1WCIB 2ZDGA 1QAQA 3VU1A 4D92A 5C46F 4F5YA 3FR8A 3A6HA 1G6HA 3B3QA 2C4MA 5GJVC 5D6OA 5A0VA 1A96A 1RI2A 2HQ1A 3PPIA 4G0XA 3R7SA 1PS9A 3PHJA 5CB0A 1BE1A 4UEOA 1N0IA 4PYRA 1M8FA 2MSLA 4L8VA 5A0TA 2ZUSA 3A6LA 3ELBA 3URKA 1Y9DA 5JAHA 3ASUA 4LBVA 4Q4JA 1HT2E 1T8TA 1B26A 1WVMA 2I03A 1LPNA 3JWHA 2O5RA 2BN4A 3VOBA 3P5BA 5AM5A 4IDFA 1Z37A 3LXMA 1XPJA 4MKXA 2QG9A 2AD1A 4URHA 4YHHB 1DC7A 1MJHA 3R8CA 3VYTB 3IDSA 4CM1A 3JQGA 1JJ7A 4PN3A 1XDZA 2VF7A 3WNBA 3GEGA 1TZBA 4AS1A 2CMGA 1J1UA 3DYVA 5IMSA 1BU5A 1HY3A 4NXNB 1QH0A 4KGDA 5EUQB 2GRUA 5EWJB 2O3JA 3KQMA 1QH8A 4NBSA 4X90A 2GF0A 1LDEA 5ALKA 4GWGA 3WL4A 5LOVF 5DU2A 1KEKA 1RQLA 2B2CA 3L6OO 5CU7A 1CIJA 1YH3A 3OTHA 3JSAA 4XASA 1TKRA 4B71A 3FZQA 1NQUA 3PD1A 1NYTA 4R2LA 3OTIA 1Z4JA 4ZO7A 3A3NA 3EEOA 4AJLA 2PZAA 1LX7A 1H3FA 1P75A 2Q8QA 1K8XB 3Q7RA 2WVJA 1H3EA 1VIDA 1XROA 4J0IA 3LUAA 1VB3A 1U98A 3P9PA 1QRDA 3BE4A 1SHTX 1KYQA 1RI3A 2WIKA 4IMPA 1LK5A 1CR0A 4LWPA 1J4AA 4U2DA 4ARZA 3L7IA 4GOMD 2ZFUA 1NI4A 4N5NA 4NV0A 1IOZA 1ISIA 3SEAA 2FRXA 5ADHA 3RK4A 2VDWA 3FJ1A 4L7VA 2AIRA 3K20A 4XH9B 1X7WA 3HVIA 1IM2A 5UKDA 5A1JA 4ZQEA 5DM70 1BEZA 3TKYA 1JEDA 1I3LA 2JIPA 2OBNA 4JBIA 4QQ8A 4WLFA 3EIQA 4CQMA 4EPXA 3S8EA 3QEMA 4V2UA 5BWBA 1YZFA 1QZTA 4BB0A 5LZ9A 1LBHA 3GWGA 5IN4A 5DGHA 2F43A 4HLQB 3OQOA 1ZITA 2YYSA 3TTUA 3VZRA 3BORA 4BFUA 1Y8QB 2A0XA 4ZOEA 2JGIA 4DMUB 5ICGA 4QHYA 1DJPA 4I9NA 4YXFA 1X8JA 2DPHA 3ZCRA 4ABTA 3ZHOA 3ZDBA 1FDUA 4HH4A 4AUMA 2F3PA 2ZTHA 3GVHA 4DIOA 4F2WA 1O77A 1U7HA 4O2AB 1K9SA 3R0IA 2AVNA 1PF7E 1KFCB 2IHBA 5H68A 1SCUB 3SXUA 2ZJ8A 4F21A 1S3SA 2G0NA 1WNFA 2BZ0A 3KLPX 3LPAA 4W82A 3IO3A 3H8SA 1S7GA 1P45A 4LXYA 4NBTA 2FN8A 3UQZA 1L4KA 4RTOA 5DTRA 2FMTA 4Z9XA 4F2DA 5J1SB 2GSWA 4CRWB 4OD0A 4RY8A 3CH5A 4O4IB 5FV4A 4OJNA 1TZMA 1VTKA 1X7XA 2R5NA 4EB6A 5L45A 3OKAA 3OURA 3T8YA 1LV8A 3TI7A 4NZ9A 4RZUA 3VPBA 1R4NA 1HORA 4LQCA 4DAOA 3TGLA 1X39A 1SZJG 4IGAA 5HKKD 5EXPA 2EKDA 2B9VA 1M0WA 4QU8A 1WZ2A 1FUEA 2PS0A 1ZSVA 2ZCUA 2PM8A 3CZ9A 3IP8A 5KTRA 3I5UA 4OH7A 2QRJA 4JEHA 5SZIA 2XUJA 2CUZA 3GT4A 3VM6A 4PX2A 4FBLA 3KSBC 1CDDA 2CFSA 1O4VA 1U3CA 2RGYA 3FNFA 4ISCA 2ZYUX 2CUTA 3VAAA 1Q57A 1XN4A 3KU1A 1LNQA 1VI2A 1APBA 3M3HA 4EW1A 2AYXA 1D1SA 2ZIAA 4RC9A 3I2HA 1EP2B 2VA9A 3SYMA 2Q8PA 2GGSA 5HX7A 3WB2A 4ZRNA 5CA1F 3A1FA 4J43A 5DYYA 3U7GA 3V3TA 2HPZA 3OJWA 5GV7A 4ZC8A 4B45A 1TMOA 3HCBA 2PMWB 3UAXA 2QE7D 2QZZA 1AO0A 1AG9A 1M2KA 3DBRA 3HCOA 4HMPA 1TM2A 3G85A 1ZK0A 4X44A 1N1DA 4MITA 4FEAA 1F5NA 2KJQA 4Y1GA 4YQYA 1ADYA 3UV7A 3WK9A 2WKSA 4OQEA 8ADHA 4ZVQA 3M0EA 2FWPA 1ZI9A 3NKLA 1TQ6A 1T13A 3O84A 4HK4A 4RWEA 4LFBB 4HWTA 4E5PA 3VGPA 3G2OA 3WNZA 4C89A 4IS2A 2DQZA 4OSOA 3KJGA 1Z2NX 2G07A 3T5CA 5FI1B 4YRZA 5BWCA 4UFOA 5BV2P 2MSEB 2P5SA 2FAXA 2JH8A 2VJBA 1NF2A 1YR6A 2GEUA 4JVNA 4IFTA 4X65B 4HB0A 4O4HB 1TQHA 4ZQIA 5A5FA 5JZMA 2ZZNA 3RQIA 1H1DA 3TQTA 2WI8A 4DR2B 4M36A 1R6BX 4JBGA 4MVJM 4QLAA 5ANRB 1L4LA 1V41E 3FYSA 5HE9A 3F47A 4WE3A 1EIZA 3ZGLA 4ZVOA 1AZTA 2VDQB 1Y9AA 4WA8A 1ID1A 2CLEB 3IHTA 5HILA 2GCNA 3PGMA 3EIOA 3P9QA 2X5KO 3VKHA 1DAFA 1RAFA 2QTGA 1XLUA 4DIBA 1XFDA 3QEAZ 1JU3A 1I1QB 1T9CA 1E4EB 4OYRA 2VJMB 4DM3A 4MKZA 3CB2A 1GUAA 4BVEA 1TJ5A 2DHDA 4XKJA 1ODJA 1UXJA 2QU7A 2AOTB 4IX1A 4N3NA 4PG8A 5FEMA 3RVJA 4B79A 4KQCA 1KIMA 2Y4OA 3S2SA 4W9NC 4KLZA 1KY3A 2CNNA 5EJ8A 4X00A 3VJKA 4KUGA 4G63A 4L57A 1ZK3A 1I51A 4A0GA 2WNHA 4EAAA 4CMGA 3BXOA 4F92B 5JNRA 1J2UA 1VCOA 4ATNA 1U8FO 4L8YA 4ARVA 5E6SA 2NVOA 1O03A 3O4HA 3UW1A 1PT7A 1S3GA 2P6UA 3SVLA 2BCGY 1E6MA 2JHCA 3ND8A 4RFSA 1L4BA 4PYLA 2H1RA 3F6PA 4E11A 1LDGA 2PDAA 4QE3A 1PSWA 1H1TA 2GPBA 3ZY2A 4FQ5A 4M8KA 1P7PA 1XZLA 1GPYA 4WOCA 3R9IA 2MSWA 1BXGA 2ZEJA 2ZBVA 4UU7A 1EE2A 2M98A 1OGIA 4LTNA 1IZYA 5ALNA 4W7HA 3HYCA 1G7CA 2GD1O 1UCFA 2PN1A 3K0KA 5EFZA 4C0SA 5IDXA 2NO5A 2R5WA 4LOAA 1Y8CA 3WQSB 4DLLA 1HE4A 3HA7A 1UPAA 4FNMA 4JH0A 1N0HA 2QROA 5IJWA 1N33B 2GERA 2OSVA 3KSAC 3QBVA 3WSWA 1VE7A 2GZ1A 4CGYA 4XPIA 2XLBA 3H83A 4ZTBA 1TLTA 3OMWA 1XMPA 3RWBA 1SXJE 3A2KA 1M2FA 2HSDA 1DRUA 1MDFA 4IIJB 4JOSA 3E6AA 2VWHA 4O4JF 4HV4A 2SCUA 1DAKA 2ZWVA 3WGUA 1F4VA 3MG9A 4NCKA 2JD0A 1A7AA 4J16C 2JFQA 4PTZA 3ZVLA 1IIRA 3ZX5A 2OM6A 1NVUQ 1S0UA 5HCIA 1H42A 3NP7A 1ADGA 3PJDA 5L4LA 4KN6A 3TOXA 1QOQB 1CQZA 3QXGA 2PQ2A 3AY6A 4JBLA 4U4AA 2O0JA 1A4UA 1CF2O 3PG5A 4JI7B 4JLUA 2AJLI 2XUPA 3LP5A 3ZC3A 4BKRA 1NJ6A 1T0JB 3UKOA 2G88A 3HY3A 4HFMA 4NU5A 4MKGA 4X1IB 4YJ2A 4FDTA 3TZLA 2HMUA 3DPSA 4ZMRA 4JXZA 2HZ7A 1GZSA 1WY5A 1L5FA 2R48A 3G59A 3PQDA 5IH7A 3G13A 2YWXA 2V9ZA 5G41A 2MOKA 2ODEA 1KMHB 2XBLA 3O3NB 1GTMA 3V8VA 4K88A 1JIIA 2ZYIA 3ZY5A 4GX0A 4HG2A 3U61B 4BQQA 3PSAA 1E9AA 3L4BC 1ODCA 3QMMA 1JQKA 1PZNA 4MAFA 2XKBA 5GV8A 5J9FA 3ZDFA 4DSNA 4F5ZA 5BNZA 3AKZA 4MP6A 2YJTD 4PINA 3W9BA 2IH5A 4XRRA 3UHOA 3H4MA 4Q9LA 4ARUA 2FDCA 3TRJA 2UZAA 4MI6A 1O5TA 4UE6A 3CNEA 2XTJA 3ZVNA 4F86A 4ZYYA 4PX9A 2WHEA 4LCEA 4DIEA 3JALA 1NUUA 4LUCA 5I01A 3ME5A 4NPHA 1D6NA 2JF0A 4RKEA 2BTEA 1ZW6A 2BMEA 1Q1EA 2JI9A 3A28A 4K9PA 1E2NA 1PQWA 2HIAA 2J3QA 2ZB8A 3L06A 4JLNA 4O0LA 5DMHA 9ATCA 4WOJA 2PZ8A 4TTQA 2NYRA 1U0LA 3HPQA 1I3MA 4BFXA 1WQ1R 3D59A 5IS2A 1DBPA 2HA7A 2B78A 3BQNB 3PNPA 2DWCA 3LX4A 3O2NA 4G0QA 4U7GA 5FA6A 5E1OA 2BZGA 4KB5A 3E8MA 1YR1A 2FJPA 1O2DA 2IGTA 2XKJE 4J2TA 1KOGA 4I0WB 1LJLA 3EOAI 2O52A 3C5CA 2GQ0A 4QUGA 1WCYA 1Y9EA 2DR0A 3LCUA 5KS2A 2Y3IA 2O1EA 1ZIYA 2BGJA 1RTKA 2Z2IA 1OV6A 3MWDA 1NW8A 5KI6A 5K3OA 3BGOS 4L85A 4XR4A 3THOA 5K0BA 4EGSA 1R5OA 5CM8B 3TMKA 2XUGA 1DJLA 1JT2A 1JG7A 1I3KA 3FMOB 5IU6A 2R62A 3O8NA 4RNDB 5JDCC 1P4JA 3UMYA 1J00A 4KXXA 1J0DA 2I7CA 3JZIA 3MHTA 1EXMA 5BNTA 1VMDA 3COPA 4P2BA 3V34A 5LZ7A 2MSKA 1Z39A 5D7BA 4CM4A 3RNLA 4EYEA 4UE2A 3ENNA 1UC5B 3CNOA 1H2ZA 4M7WA 4UMDA 1WW8A 1GNTA 1NLMA 5K3BA 3SDBA 3OQHA 2QJRA 4PLVA 3UVEA 4AZ3B 4BCCA 1HNXB 2JLVA 4PVCA 5H16A 4LJ4A 4LTDA 2OK8A 3ZOZA 4RDCA 3QLJA 3M6WA 3W6UA 2VYNA 4A26A 2YY5A 4WACA 1DTWB 2O3SA 5CFMA 3IODA 3WK4A 4LGYA 2AEJA 3FUVA 4XWKA 4GO1A 5ILOA 4V1CA 2QRMA 5BV7A 1LSUA 3DE3X 1RC0A 5EMHA 5AVXA 5KKAA 4OJKA 2ZZKA 1XTZA 2DFLA 3N5KA 4QREA 4AMVA 4RSMA 1OLUA 3D6UA 2X1MA 3QV1A 5K03A 5DM4A 3GLQA 3UUFA 5F3WB 5EQDA 4L8LA 1B74A 5EIAA 3UNXA 2VUSA 5IXYA 1SOMA 2XT9A 1YU6A 2BY4A 4PLHA 2VPQA 4BB6A 2C57A 1UH5A 2X8AA 3R3SA 3EWAA 4YASA 4JKOA 2A1UA 2QUBA 1AURA 3NWOA 4FOPA 3I6YA 3UJ3X 1N7IA 1OAOC 2RARA 4ODIA 5ELMA 2HWUA 1JDSA 2XMZA 4WERA 1WG8A 5EI5A 1R18A 2G1AA 3K2BA 1JR3D 4RA6B 4CIDA 3ONWA 1VXOA 3HCEA 4GXNA 4J0JA 2GF2A 1VSTA 2QQFA 3GGJA 4H9GA 2PSDA 5HTKA 4QVIA 2YHAA 5G0WA 5A71A 4W5RA 2GN1A 1IXKA 2WT9A 3RYIB 2FWMX 1XZDA 2FMIA 4PPGA 3G79A 3OIUA 2A35A 1ZJZA 4Q7QA 2WICA 3QPCA 5JY6A 5JIBA 4FEYA 2HM7A 4Y7DA 2IPXA 4RTJA 2W2NA 2XDWA 2WQ6A 2YVUA 4HC4A 5DWDA 5E6RA 2C2ZA 4D79A 5G53C 1F4LA 3LHIA 4BN0A 2NUPB 4RH1A 3HJBA 4N0MA 1CT9A 3MJ4A 4JASB 3ZWDA 2PWAA 1PW5A 4MHOA 3ROEA 3WDMA 2PSFA 1T43A 2OCIA 2ZCVA 3CUWA 4JLAA 4XQ9A 4YN3A 2WU1A 4L51A 1A82A 2UUOA 1OIVA 4FYKA 3K0AB 2ZVDA 1PT5A 2WFAA 3ZV4A 1TUBB 3EARA 4WI1A 1E9VA 1PO7A 4IJKA 3AV0B 1P31A 4UHFA 5IARA 4M0DA 5DM2A 3COYA 1NMSA 1SH7A 3K1AA 3PCTA 4TKUB 2Q27A 4WT7A 4BTEA 3UYLA 2ZIZA 2XT6A 2V4MA 3GGSA 4PS0A 3UMCA 2WTBA 1QV7A 3DLCA 4EGCB 1JSZA 5AW4A 3CTPA 3MILA 2WJWA 4MVWA 2UUCB 4Q4HA 2YZ2A 3L6UA 4ML3A 2VXYA 4WW0A 2QN3A 2RHLA 1TTTA 3MB8A 3OECA 4DKJA 1SXPA 1ZX1A 3P0FA 1ONOA 1PJ2A 5GJCA 3D3WB 1JKJA 4BZWA 1ETUA 1UBLS 3V1NA 2BGGA 1DIGA 3EOBI 3IP5A 1C2YA 4UM5A 5JVDB 2PQMA 4FU0A 1KNQA 1KR2A 1GTZA 1TCBA 3JYPA 4C03A 2OUIA 3M6MD 3FLMA 1VCMA 2C5HA 2PLFA 3JPYA 1Y9ZA 2O2ZA 2VHXA 3D3KA 3IT0A 3MN1A 3V6MA 2PEZA 4QKQA 4MR9B 5FFNA 3Q0TA 3J80A 1EDDA 1HLDA 1J5XA 2OV1A 3CB4A 1WZIA 5TV2A 4E1AA 2HQSA 3T1QA 5FWNA 3C3KA 2H8GA 3ILSA 2QNBA 2Q7DA 1YR2A 3DLPX 3JAMA 3NJ4A 2D0IA 4NAVA 2MSDB 3L5KA 3KUUA 3C3XA 5EIEA 1VBNA 4BFSA 3G5TA 1R9NA 4WIAA 3G0DA 1J23A 2JW5A 3CNNA 5DULA 3ZHQA 4FB4A 3R9XB 2BH2A 1QGZA 3L0CA 1T4CA 3C6BA 4QC2A 4B81A 1I2AA 1ODLA 2EW2A 2J9GA 2Y9MB 4S2UA 1X92A 3E5RA 5FL7D 1BHSA 3P2MA 3K92A 4TVOA 5BNIA 2I9PA 4MV5A 1BN7A 3DVAA 4WK0B 2Q5OA 2RHCA 2AWOA 2YY6A 1QRAA 1U0OC 2LTAA 3AUKA 2ZRAA 3GLKA 4IVNA 1YMUA 2YOFA 2NV0A 4HH1A 4HKTA 4L76A 2C8LA 3IXLA 5HR5A 2VTBA 1UAAA 4D8WA 1HF3A 3UICA 3FVQA 3CR8A 2XIQA 4BBPA 3UWDA 4CU2A 3GLFB 1ZGCA 1UP6A 3JWGA 2HSJA 3LUCA 4C0HA 3T7DA 2BVNA 3P2OA 3GAMA 2FE4A 2ZRLA 3NNSA 3I52A 4LOHA 4P5DA 5CYFA 3ICQB 1H4SA 1FX1A 1JAXA 1I2MA 1N9GB 2FMKA 1WSDA 4L27A 2O1WA 4JYZA 1RNLA 2YZKA 2GZSA 2FMUA 1SOVA 5FT9A 4BQEA 5FNVF 1YQTA 2YXPX 4IP0A 2RHHA 4G09A 4XYGA 2PKEA 3W5CA 2MTBA 4Q24A 2CSXA 3K16A 1EM6A 1B41A 3M1IA 2V3WA 4JYAB 4MVJP 5HFNA 4RJTA 3EPJA 3HO8A 4XQEA 5CA0F 1NP6A 1RFGE 2PKQO 2VKQA 2D2FA 2GN8A 2HT6A 2XCOA 4U5QA 1B16A 4Q9IA 1AH2A 2J9FB 3HRIA 2H4YA 2I1LA 1DAIA 3EAGA 4X8LA 5LQAA 5DNWA 1V26A 2CHEA 1PGPA 4OH1A 4Z8YA 1YQWA 1RWKA 3U4AA 4XVCA 1XEWY 2H4HA 1IK6A 1DV2A 2AF3C 1N5LA 1X7HA 1SUIA 3EZFA 1E2BA 3JQPA 2ZJOA 4B80A 4YMTA 1MOSA 1P81A 1DQSA 1QO0A 5E38A 5FUXA 4ZI5A 3OUTA 2V97A 2A67A 5K5EA 1D2NA 1X74A 1XTPA 4MUMA 1WHTA 2OOKA 2GPAA 3KJHA 4G4IA 3FROA 2FUG6 1GVNB 3EEFA 3F5MA 5IJXA 3T9EA 3THSA 3TTWA 5AIBA 5C7YA 2W2TA 3L7CA 4NK5A 2BM0A 3DAHA 4IZOA 5JJ5A 4AY5A 2A1TR 4WBNA 3AY0A 3Q7PA 2DULA 3P4YA 4LCBA 3W0LB 2RJNA 4PAQA 1K7FB 1D9XA 2FN4A 2QLFA 5HUHA 3ANXA 5I9NA 4CM8B 4M9CA 5JS8A 5CGZA 2C3UA 1XMXA 5BSEA 2DQSA 2R3SA 4G5FA 3SBEA 4ALJA 3GF4A 4KPFC 5L51A 1C29B 1N2JA 4DNXA 1RRGA 3DLIA 3QVXA 3QWHA 4P92A 1QS0B 1OFIA 2EHJA 4G3XA 4E32A 5A7FA 4M0CA 4ZQBA 3UK0A 1N6IA 2KMLA 2FSFA 5JQGB 1UBFA 4MPRA 3VPHA 2C31A 2G5CA 2R4QA 2BEWB 2P30A 3NBZC 4DPMA 1C7ZA 1W46A 5TJ9A 3QK7A 2JDID 1KPGA 3R09A 1D8AA 1GZVA 2CEKA 5EJFA 5BUZA 5KX5B 4NJOA 3UXYA 4J0DA 3G6KA 1HPLA 1SQFA 1Y8RA 2RKOA 3DOOA 3PRYA 2ATXA 3VNQA 4M1TA 3ZNNA 3ET4A 3AVUA 3SSNA 4EEZA 2WAXA 5JE8A 3CNHA 1XZMA 1TJ4A 2G8LA 4KQJA 3T3HA 5A6VA 2ZAGA 4E3ZA 5JS7A 2R9VA 1NMZA 4OA5A 2G9UA 3GNLA 1SXJC 4IGKA 4P53A 1CJBA 4PHCA 2O2DA 4MH0R 5B7PA 1Q0ZA 1IG0A 5G4KB 5U4QA 1Z0FA 3PUYA 4EENA 4QDTA 4L72A 3EH2A 1PJAA 2D74A 1QZXA 5CK4A 4CMKA 1REQB 3EGXA 3RVBA 2C03A 5FHRA 4E21A 5I7UA 4EW3A 4BV8A 4OLAA 4UTXA 4RIGA 2OC4A 2QRZA 2IXTA 5FV7A 3VR6A 1ZVQA 3BSWA 1LI7A 1BDIA 3HYRA 2R6JA 3LWNA 5K09A 1THGA 2H5JA 2ZAMA 1OZAA 5A4KA 3AR4A 3ISVA 1M10A 2YYAA 1FU8A 5KSZA 1W5EA 2HPAA 2Y27A 2J5RA 5D5PA 3TZBA 2FPUA 2ISQA 2OBFA 1GZHB 2JJQA 4IQ0A 4QOJA 4BPRA 3NASA 3OQ6A 3PICA 3H6HA 5JH7B 3D3NA 1U5CA 4BX9A 1GGFA 1JDBB 3QKWA 3H17A 2VRCD 3CV3A 4RPCA 3L2OB 4FFOA 3M9XA 3K15A 1VIAA 5MF6A 1G0OA 1TM4E 4OI4A 3KT8A 2Z09A 4H59A 1G21B 3EQ9A 3QXXA 4TXHA 5FBKA 4AK9A 3X1YA 1QBKC 2NU7A 1P72A 1FCJA 2CD9A 2JD2A 4YJ2F 3X1WA 4BEJA 2EWWA 4EEXA 3RT7A 3J7AC 5F7ZA 2JGDB 1C1DA 1G8AA 1V7CA 1E79D 1NSTA 2WSLA 3ZGYA 4Z2YA 1ACJA 1DT3A 5IANA 1WCIA 3GR6A 4N39A 2R6FA 3M4ZA 2AUMA 4DEVA 1FJXA 1JWLA 1NWCA 5CBPB 2PAAA 2WPDD 4F7DA 3TXXA 3ZZNA 4BVGA 5C5CA 3M70A 2FW9A 2AI3A 3MCZA 1RRMA 4ZQHA 1NYRA 3TBFA 1AKMA 1EG7A 3TEJA 3DUFB 1YCGA 3MINB 1GR0A 2WW8A 1CY4A 5TMEA 4CV1A 1IB6A 4ZK2A 1RS0A 5DP2A 2JC3A 5KOYA 1A5AB 1OZGA 3HXQA 2HEGA 2YXDA 5AXAA 3CJQA 2Z30A 3VOTA 2Q3CA 2OO5A 3GJ0A 5KKNB 3GJSA 3G2JA 3T4UA 2RI6A 4K6OA 4Q9HA 4J7AA 4QDKA 4P7JA 2HNKA 1ZQ9A 2Q6VA 2Z56A 2HUPA 3OOJA 2V1XA 2RI0A 1YA4A 4MQMA 5HS6A 1KSJA 1O95A 2VP4A 1QLJA 3OE5A 4UW9A 4ZAFA 1ODTC 5DWQA 2P67A 4HT3B 2VUHB 2QTTA 3LPLA 2NVUB 1IH8A 1ZXXA 3D4LA 1W6UA 3PC3A 1VE9A 3KOMA 1CY6A 1YACA 5EWJA 1FPMA 1ACLA 3OIGA 3S99A 2FSIA 1NG1A 4QLBA 2AE1A 3PVSA 1VDMA 2WD8A 1W4RA 2PLAA 2AEMA 2OOSA 3MJFA 2O7SA 2Z5VA 5GIOE 3FZYA 2G6BA 3EVDA 2OD7A 5AWFC 3RDPA 4EVRA 2X4IA 3GMSA 1H0HA 4TWAA 1P2GA 4I9GA 1W88B 4NZPA 4CKBB 4UM7A 2A59A 2JVJA 3TLXA 3IO5A 3QLUC 1Y3DE 4NCHA 2IEIA 4LN1A 1JDVA 1W4AA 3CR7A 2F2TA 4GP6A 4QU9A 3OM8A 3T52A 4RENA 1NVGA 2TS1A 4LXIA 1U80A 4N5LA 4QELA 5F5XA 1S4MA 3M8KA 5IDVA 5IMBA 2AJCA 2HC9A 3BMNB 2FFHA 3K30A 5EWMB 5JH7A 1L7DA <