4CMCA

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
267
structure length
251
Chain Sequence
b'EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTERIDINE REDUCTASE 1
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
total genus 93
structure length 251
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cmcA00
4IY1A 1TI7A 3NJ8A 3WWZA 4D46A 1E6UA 1OBFO 5DBIA 2EJWA 2X1HA 1MFZA 3KEQA 3ZHBA 5TX7A 1BRMA 3B1JA 5DZSA 2IODA 5BSGA 4M1QA 1ZSNA 3KEOA 5BR7A 1ZEJA 2WDZA 4E2ZA 5GZ6A 1GUYA 3L4SO 1XR3A 2WD8A 3H3FA 1ZK1A 3QE3A 4JQCA 3H9EO 4GQAA 4P22A 3RFTA 1Q1NA 5BQFA 5I8ZA 3MJSA 1QYDA 4PG8A 1OAAA 1I2CA 2BKAA 2X0NA 3OEYA 3OIFA 4XR9A 4XYGA 4ALLA 2PV7A 1ID1A 3H6KA 1KVSA 3LT1A 5A3JA 1MLDA 4FGSA 3ZHXA 4E2XA 1VM6A 1EQ2A 3FWZA 3I4FA 3HG7A 3JQ7B 1NYTA 3W1VA 4RVDA 1BXGA 1KBZA 2XXJA 3AM3A 2NUAA 4MKRA 5EJ2A 4B7XA 1ISJA 4CM5A 4HKTA 3ONFA 4NG5A 4NJMB 3S2FA 1KEPA 5JDIA 3RC7A 3GEMA 2Z95A 2W2LD 3ORFA 5L4SA 4LSMA 3ZDFA 4BNJA 4YT5A 1I36A 2FWMX 3PIIA 3CEAA 1EUDA 1K6JA 4DUPA 4JJFA 3ONDA 3N7UA 3C85A 3L6DA 4XDZA 2CVZA 4BNGA 1QV7A 2X8LA 4LW8A 3DAFA 3KRTA 1O8CA 1T4BA 4G65A 4ITUA 5COQA 3WX0A 4WASA 4AJEA 4BQPA 2W2KB 1LQTA 5FI3A 3H2ZA 2VHXA 4L4SA 3TRIA 3JQGA 1NQAO 5GY7A 4PCVA 4YAJA 5AYVA 3UUWA 1EVJA 4MKZA 3BMNA 3FNFA 2JKVA 3OHSX 4XYLA 1W8DA 1XA0A 2ZTMA 3OICA 2GSDA 3WSWA 5KJ1A 4BMNA 5F5NA 5BSFA 1KOLA 3WBFA 1UDCA 4UUNA 3PJGA 3D5TA 4BKRA 4GL4A 4IS2A 3JYQA 1DC4A 4YA6A 3F47A 2VHWA 1I33A 3EMKA 3SEFA 3OSUA 3PQDA 2GZ3A 4Q3BA 1YH3A 5JS6A 4YT8A 5TS3A 4WPGA 5ER6A 5A5FA 5JC1A 5JDIC 3TOZA 5A9RA 3IP3A 1G0NA 4PLTA 4Z9FA 2OXIA 3K6JA 2JCVA 1CYDA 2X5KO 3PQEA 1ZK4A 3U09A 1BTOA 4GWKA 1SPXA 3BHMA 2Q1UA 2PH5A 3A06A 4ZVVA 1E3WA 1Z82A 3ZV6A 1JLLA 2UYYA 3T7EA 3DZFA 3EY4A 4BO7A 3R3JA 4QECA 1NVTA 4IS3A 1FMCA 4GAEA 4OH1A 4U7WA 1CF2O 2AG5A 3KO8A 2O3TA 1C0IA 5CEEA 4XRGA 2QYSA 1DLJA 3VC7A 2YDXA 3VZRA 3P7MA 3AM5A 4IJKA 1P1JA 4JX8A 1WVGA 1J6UA 2ZQZA 4W82A 1XLTA 2NVUB 3ENNA 1D1SA 5JBIA 2GN8A 4B4UA 3JTMA 3ZWYA 2ZIZA 4N18A 3WOHA 5COAA 2DTDA 4DC1A 4QO8A 4UEKA 2XAAA 3NT4A 3WNQA 4R9SA 3KSZO 3I9KA 9LDTA 4IBOA 1QLJA 1O0SA 2ZATA 3KV3O 3UCXA 1PS8A 1QG6A 1UDAA 3ANNA 2GN6A 3TZQA 3LT4A 1RPNA 4EI2A 2IEDA 2OO5A 4ZQBA 3WS7A 5B1YA 1U3UA 4LSWA 4KMSA 3VVBA 3RBXA 5JCXA 4XX0A 5TLSA 4BNLA 4KWHA 1JU9A 3H9GA 4TRMA 5CDTA 1A9ZA 2FZWA 5FI5A 4PG7A 1OI7A 3RUEA 2X0JA 2GCGA 4EGFA 2O3SA 1GADO 1PGQA 1B2LA 3AUUA 2C0CA 4BVAA 4WUVA 1BHSA 2X4GA 4DL9A 3GHHA 1DIBA 4BMSA 4FC7A 4IIUA 1IULA 4J4BA 1NWHA 1ZZEA 2Q2VA 4OQZA 2IYPA 2ZB8A 3D64A 4HWKA 2VRBA 3DMYA 1JDJA 4ROSA 3IC5A 2H5LA 1T2DA 2YQ4A 4PN3A 5T8KA 2PZJA 3EC7A 1KYQA 4PG4A 4IXTA 3IKVA 1PJ3A 6LDHA 2BFPA 3ZWPA 3OFSA 4CQMA 4KUGA 3D3EA 3I9LA 4TVOA 4MVJP 3IKTA 1DIAA 3NEPX 4ND2A 3WG9A 1KVUA 3FR7A 1V3UA 1E1NA 4Z0TA 1A71A 3TZHA 2W8ZA 3UICA 2GD1O 5KJFA 1ZK3A 3S8MA 1OOEA 3DHEA 4BO5A 2SCUA 2Y1CA 4NDNE 3O03A 5IJZA 1SB8A 3GY0A 4CR7A 4B8ZA 2VUTA 3VH3A 1KEUA 1C1XA 3NT5A 4XEHA 3CTMA 1HETA 4MIYA 4XD2A 1V8BA 5COBA 5JY6A 2O3RA 3PZBA 4PZEA 1IHYA 1VC2A 1Y9AA 1UAYA 3MJEA 4N5NA 1R0LA 4D41A 4B8WA 2D4AA 2I9PA 1E1KA 1WMBA 4N7RA 4B4OA 2PH3A 5T8KC 1WP4A 4FDAA 2C5EA 3O8QB 3MJCA 4R1SA 5TSDA 3DFUA 1LDYA 4EUFA 1P44A 3I3OA 3LVFO 2IYOA 4CV2A 4AL4A 3AI2A 3EK2A 5KOIA 2BI8A 3PHIA 4OKIA 1D4FA 1DRWA 3UH1A 5AXCA 3DZJA 1NASA 4M87A 4CM9D 2C20A 3KYBA 2NVBA 3H65A 1IUKA 4AJKA 3RBZA 2H63A 1VKNA 3H7AA 1X0VA 5AVOA 4CPDA 1QXSA 3GZ4A 4EJ6A 2HJRA 4FFLA 2Q1TA 4GH5A 3I4CA 4W9NC 4OXKA 2OMEA 3WR5A 3F3SA 4JXKA 3JQ9A 3ABIA 5B12A 3PZRA 2G76A 2ZYAA 3CSDA 4WNIA 1YXMA 1P1HA 3CKYA 4ILKA 1VI2A 1RJWA 3PYMA 1ONOA 4BNMA 4EJ0A 4Y6SA 3O9ZA 3V1YA 2P68A 3QRWA 2EERA 2Y05A 5BNTA 3ROQA 4PLWA 1E1MA 3QIVA 4R5MA 1DBVO 3GNQA 3QWHA 4IPTA 2PGJA 2VHYA 4GX5A 1LSJA 1Q0LA 2UV8A 1CRWG 3OQ1A 4K9DA 3UXYA 3WB9A 2HLPA 2I3GA 3Q9NA 2Q49A 4DA9A 1MXHA 4OXNA 3KYDA 3D4NA 2QW8A 4N54A 4FJ2A 5CDUA 4JJIA 3KTDA 1D3AA 3JCZA 3PYXA 3K30A 3ONEA 3LLVA 1DEHA 4MINA 3JQ9C 4WNCA 3RI3A 2EKLA 3GNTA 5C5IA 3B1KA 3WBBA 3C24A 4UAGA 2DBQA 1G0OA 4D44A 2G1UA 5JXWA 1N9GB 2VRCA 3IUSA 4TRNA 3TL2A 2EGHA 4O59O 3VH4A 4RVFA 2CD9A 3DDNA 1U5AA 3AFNA 3K9QO 1N8KA 4XYBA 3D7LA 1LI4A 4DGSA 1IL0A 1G6KA 3M2TA 1Y1PA 1I01A 1HE2A 4RVGA 4DWVA 1HDRA 1E3LA 1HE5A 2BELA 3WGGA 2E4AA 1B3RA 3PK0A 1HYGA 4XB2A 2GERA 4BO3A 4OL9A 2V7PA 2WYVA 3VDQA 3HDHA 4K6FA 4YXFA 5T6BA 3MOIA 3Q9UA 1LC0A 3E9MA 3M1LA 3EGOA 3ZU2A 1ULSA 4FSHA 1DRVA 3W6ZA 1WW8A 3BMCA 4L75A 4LMRA 3PLNA 3E5RA 3W6UA 2Y66A 5IN5A 2V6MA 3H4VA 1D1TA 1SMKA 2B4TO 1BVRA 4XRRA 2NU8A 4B3HA 2Z1NA 1NVGA 4H15A 1SEVA 1IPFA 1Q0HA 3HDYA 4CODB 5CG2A 1DO8A 4CMCA 3DBVO 4YJDA 1YBVA 1J4AA 1U4SA 2CDAA 4JROA 1T1SA 4BB5A 1GDHA 3H5AA 3JV7A 3NRCA 1DIHA 3D4OA 3VZPA 4OGWA 2A35A 1IOLA 1HDXA 3JYLA 4MP8A 1A4UA 1U4OA 4IZHA 3OECA 2E49A 5CFZA 4PLPA 3PGXA 4J7CA 4B4WA 1FDVA 4RVSA 2PKQP 3FTNA 2X86A 3DBRA 1HXHA 1PGNA 4FS3A 5TT0A 1F0YA 1DSSG 1HDYA 4FFRA 1C1DA 4IJWA 4L4XA 3MTJA 4UUMA 1EVYA 1BXGB 2A92A 1V0JA 3TN7A 1EMDA 1RYDA 4GX0A 3ROMA 5FWNA 2HK8A 3AUSA 2NM0A 4PRLA 1LSUA 3ZW8A 2CY0A 4BNTA 5A9SA 3CXRA 3I1JA 3GAZA 3LT0A 3ZHYA 4L4RA 1KC1A 5I7EA 3ETEA 5LC1A 1XHLA 1E6WA 3RJ9A 4KDEA 4LVCA 2JFHA 3JD3A 2VN8A 1Z7EA 4FCCA 3RFVA 1SO8A 2C82A 3KM0A 1JQBA 3L0DA 1PGOA 2R2GA 4NMHA 5HWSA 1XEAA 3GFBA 3CMMA 2W2LA 3JQGB 3OMLA 1PJQA 4CJXA 2NU6A 4JNKA 1IZ9A 1WDLA 2VZ8A 4DXHA 4ZRMA 1GD1O 4AJ2A 1NQ5A 5KKAA 1PJ2A 5IXYA 1WZEA 5DCWA 3BMNB 3GVIA 4J1QA 2HMVA 4DQXA 3LYLA 1E92A 3ZU3A 1LRKA 2OBNA 1NP3A 4YDRA 4IMPA 5A5EA 1MG0A 4ZQHA 4YJHA 4RPJA 2VNSA 1X13A 2R6JA 4YTEA 5IG2A 1GQ2A 2W90A 4DPKA 4BGUA 4NBTA 3HNPA 1DJQA 3Q6IA 1QLHA 3AUTA 3WIDA 4JJGA 4J7UA 5DCUA 2RH8A 4Y8VA 4BO2A 2DKNA 4YQYA 4OOFA 2IXAA 2IZZA 2ILTA 1PJ4A 3I9MA 1LDBA 4EZBA 4BNNA 5L7TA 5EL0A 1E3WB 1U7TA 1JWAB 4Q3NA 4FW8A 3FF4A 2VUSA 2DTXA 3VPFA 4IXWA 4A0SA 1SNYA 1DAPA 4YAKA 2O50A 2O3JA 4FFMA 3UW3A 4LVUA 1WAMA 4I5EA 3ZV4A 3ZWNA 1CEQA 4PLYA 1T2CA 3RC1A 3W4JA 1V9LA 2NTVA 4ZQGA 2DBRA 3DQPA 2B5WA 1YDWA 4YT2A 2VZ9A 3PQFA 4RZHA 4CMIA 3LF1A 1CDOA 3SXPA 3TPCA 3WIEA 2EW8A 2P5YA 3VOSA 2QX7A 4UEOA 3RJ5A 1M6WA 4DIFA 3SJ7A 2HSDA 2DAPA 4GGOA 3GDGA 1XQ6A 4CLRA 4RDIA 5C3MA 1TT5A 2RCYA 2GUGA 2Y0CA 3V8BA 2CF6A 1XIVA 4QT0A 1ZJYA 3K31A 4TRJA 3Q11A 5JDCC 3AY3A 3PI7A 3UOGA 1HYHA 2GPTA 4D3SA 1YO6A 1R15A 2BLLA 2P4QA 1GQYA 1IHXA 3KHUA 1XCBA 1KS9A 4RGBA 3LZ6A 4U6SA 2UVDA 4R4JA 4HNHA 1YE3A 3SX2A 5ITVA 1OMOA 1LDGA 4CUJA 4P4GA 2B5VA 4DIOA 3WGIA 3HE3A 2FOIA 3DZKA 2ZCVA 1AUPA 1I5RA 2IDZA 4NBRA 4CM3A 2P5UA 3D0OA 2ZKLA 3LC7O 4R69A 2ET6A 3DFZA 1YOVA 4CM7A 1ZUD1 2EXXA 2RH4A 2Y1OA 4ZU3A 3DBHA 3H3JA 1E0DA 1K6XA 1XSEA 1TLTA 4WOJA 1YRLA 3VZSA 1QYXA 4FFOA 2J5KA 3WGZA 3FRJA 2O4UX 4R68A 4XIJA 4CQMB 5FEUA 5JSFA 2WE7A 1A4IA 2AE2A 1DIGA 3WLEA 3VPGA 2FPIA 4QSMA 3DTYA 5TJHA 1M67A 2ZB7A 5DN9A 4UULA 1M6HA 1T26A 2PK3A 4AJJA 3QHAA 1QSGA 1LUAA 4JBIA 4Q9NA 4Y67A 6ADHA 3MOGA 3S1LA 3WGYA 1E1LA 1I3LA 4I5GA 3PHHA 1YQGA 3S55A 3LSYA 1C1XB 1FDUA 4BO6A 5CEFA 4NK4A 3WFIA 2FR8A 3H2SA 4IQGA 3V2UA 2HJSA 1D8AA 1GUZA 1GZ4A 3RD5A 3ZH2A 3OF2A 3TWOA 3TFOA 1JKFA 4TMFA 5C7OO 3GHYA 2X0IA 3GPDG 3COSA 3WYEA 2O7QA 1DOHA 3E9NA 1LRLA 4XKJA 4EUHA 3B6ZA 4YRBA 3JYOA 3AOGA 4BB6A 2EP5A 1JAXA 3GQVA 5A4DA 4IIVA 5EMHA 3F4LA 4AJHA 4CM1A 2Q45A 4RDHA 2VTDA 4LRTB 4WCDA 3WTCA 5FYDA 1P1RA 2J3KA 3U9LA 3M6IA 1AHHA 4PLFA 1FDSA 2EJVA 2PNFA 5F21A 3TDKA 5KVSA 2HCTA 1KVQA 4YRDA 2GZ1A 2Q2QA 1EQUA 4IDAA 3I52A 1SOWA 4IQ0A 4RVUA 1PQWA 1JTVA 3MJVA 3WSVA 4UVGA 4FPXA 4ALJA 4O1MA 5L7WA 1BW9A 5DNAA 3VTZA 4BNZA 4WJZA 3GN1A 3KLMX 1B16A 1KY4A 2JHFA 4K6CA 4UVDA 4CM9A 3FCOA 3BTSA 3G1TA 2AQHA 1V3VA 4YAEA 3SLKA 2Y0DA 5HS4A 3DAGA 4CMJA 3TZCA 2BFMA 4DMLA 4LMPA 4TKLA 2HK9A 3JQEA 3HN7A 3STHA 3VAZA 3WICA 1EUCA 5I9LA 5L4LA 5HS6A 4W7IA 2OHXA 5EESA 1LLCA 2WD7A 1EFLA 1ADBA 5GZ1A 5A05A 2YFHA 5CAEA 1PU2A 4RPGA 3CIFA 1JN0A 4S3MA 3WMXA 2XXBA 1Q7GA 1Y5RA 3WGHA 4BNFA 1M2WA 4FR5A 4CV1A 4RZIA 4OSOA 5TC4A 1H2HA 1UXJA 4BNXA 3AJRA 2Q4EA 3KYDB 4CM8A 1DJNA 4YEDA 3AY7A 9LDBA 1ZW1A 4KZPA 4XR4A 1QP8A 5KVQA 1HEUA 1ULUA 4Q3EA 1DLIA 5JAIA 4E5KA 4OHUA 1YL5A 2FP4A 2HO5A 5F1OA 2OP0A 3BIOA 4ALMA 3ENKA 4I1IA 1RM5A 1ENPA 3H5NA 1IPEA 1B8UA 3PWKA 4Z0HO 4BOYA 4YYZA 1R0KA 1SC6A 1GCUA 3EVNA 2OP1A 4U8GA 5A9TA 5HBRA 2C5AA 3ZHZA 4LCEA 3NT2A 3RVDA 2DUUA 3I83A 4L76A 1DB3A 4OXYA 5CDGA 5HTOA 1YL7A 4DVJA 3HADA 2NADA 3ROKA 3QQPA 1VE9A 5G0SA 1HT0A 4OQYA 5JE8A 1U2DA 4PGFA 1ORRA 1GCOA 1P1IA 2D2IA 2BFAA 1P3DA 3EDMA 3GG9A 1VL6A 2OZPA 4M54A 4NFHA 3JQDA 3DOOA 2NU7A 2X6TA 2PKQO 3BHJA 1U28A 2VHZA 1L7EA 5ES3A 1EDZA 4WKGA 5G4KA 1GUFA 2WWRA 3I23A 4K1LA 1H0KA 3GF4A 3V2GA 1NTOA 1Q7CA 1DAOA 1G1AA 2V6BA 4WLNA 3PGJA 4E5NA 1R16A 3PP8A 3BMCB 4BMVA 1S6YA 4JP2A 1I3MA 4DQVA 3ZGYA 1R4MA 5CPFA 1ADGA 1ZNQO 4E2WA 3JQCA 2P9CA 2VWQA 4L0QA 4D7AA 4BNWA 2PY6A 3HDQA 4CM6A 2VT2A 3D4PA 4Y6PA 1U7HA 1YL6A 3OM9A 4MJLA 4R1UA 1ZXBA 2E6UX 3QW2A 4F46A 1A7AA 1XG5A 1ZK2A 3PWZA 1M75A 3EYWA 1ZMOA 4E13A 2VWHA 1PZFA 3TSCA 1HE4A 1NAHA 3ICCA 4R3WA 1A5ZA 1GPDG 2C2XA 3DBRB 2C7GA 4MVJD 3W4KA 3ZZNA 3WFJA 3E03A 1BDMA 3FNEA 1C1DB 3NX4A 2J3HA 3K96A 5A03A 2Y1GA 4R16A 4FN4A 4GLLA 3HB4X 2FPGA 3GK3A 3AFMA 3RBVA 4DYDA 5JMWA 1ARZA 2YV3A 4CLEA 3E8XA 1GU7A 4J6FA 5A9SB 4KQXA 2W4QA 5IF3A 3FR8A 2RHRA 3KSUA 1DFHA 2IZ1A 1TVEA 4YCAA 3H9UA 5CEJA 1UAGA 2Q1SA 3MEQA 3PXXA 5G0UA 4PRKA 3DZBA 4MDHA 4INAA 4RJTA 4Z0PA 4DLBA 3GGGA 1FDTA 1LLQA 3F9IA 4RQTA 3OJLA 5ICSA 3SLGA 2GDZA 3WNVA 2YQ5A 3F6YA 1TXGA 3QVTA 1MFPA 3U4IA 2OUIA 5DT9A 4HFJA 4EUEA 3VH1A 3UGKA 4JLWA 4LK3A 3T7CA 3ZWMA 3VVCA 1BWSA 2X23A 5DBGA 1DC3A 3E5MA 1YB5A 2ZB3A 2CNBA 2EF1A 4UUOA 5DF1A 2O7SA 4JBGA 4YJHB 5DCYA 3QWAA 2BMAA 3IJPA 1TT7A 5IZ4A 2PGLA 4YR9A 3CZMA 4W9NA 1X1TA 2OBYA 4C7KA 3VPXA 3ASVA 4KUHA 1UUFA 3C1OA 4MVJF 3ZN2A 4A7PA 1Y5MA 3VZQA 3Q2KA 4R1NA 1LJ8A 2Q46A 3UKOA 3GG2A 2PWZA 2DC1A 3NTOA 3QVSA 3B70A 4D43A 5JYEA 2FZEA 4FC6A 5T64A 3X2FA 2DU8A 5BSEA 4II3A 4M8SA 4CUKA 7MDHA 5KJCA 1LC3A 1NFFA 4W99A 3IS3A 1PGJA 4RORA 5CDSA 5K6AA 1PR9A 2NV6A 1GEEA 3B20A 3RC9A 1W0CA 2EWMA 2BGLA 1RWBA 1ZMTA 2I66A 1UXHA 1MV8A 1U8XX 3BTVA 1UH5A 2AA3A 1LXCA 3DONA 4OYRA 5JY1A 1EDOA 4R01A 3CUKA 4BV8A 1PJBA 2V65A 1YBAA 4J91A 1TA4A 5AXAA 4CMIB 1X7HA 4HFNA 4BQRA 2EW2A 3FWNA 1Z75A 1HLPA 3WXBA 3ZNPA 1GPJA 3JD0A 3JQAD 1F14A 4CLRB 3MCVA 1I2ZA 1N1EA 1TT5B 3IUPA 4GBJA 3RU9A 4CLOA 5ADHA 5KWEA 1X0XA 3HFSA 4BKOA 5I9MA 2BI7A 1PJSA 5L95A 4L73A 1VPDA 5U9CA 1ZK0A 1NQOA 5GZ3A 3V1TC 3U5TA 3AU9A 1I24A 3AUAA 1ISGA 2O3QA 3DHNA 2Y1EA 4J1SA 3ASUA 3PYLA 3K73O 3UVEA 1UXKA 3AOEA 2DTEA 2QHXA 5L53A 4MVJG 5I7VA 1L7DA 4Z3DA 1HE3A 4KTVE 3D1LA 4QXMA 5K6AC 5I8WA 4OIMA 4FQ8A 4BO8A 3K5PA 4RPHA 5DBFA 4AJLA 4B79A 1P45A 1QR6A 5TGDA 4CR8A 2NU9A 2VZ0A 3PJDA 4TROA 1V35A 2Q2WA 2EGGA 1FXSA 2JAHA 4LN1A 1YOVB 2WE8A 3A28A 5JMPA 1B8VA 4A03A 2NTNA 2P9GA 3DBHB 1EK6A 1V3TA 1TB4A 1HSZA 3BMQA 3ZNNA 4ND5A 1GV1A 4AICA 4PLVA 3OIDA 5JAZA 4G81A 2E48A 3AWDA 4S1VA 5B4TA 4AG3A 2QIOA 1PS9A 4CM4A 1O89A 1PZEA 3A14A 3QVOA 4CL8A 2Q4BA 4BGVA 1ONPA 4P4NA 3UAGA 2QRLA 3JQBA 2XOXA 3QP9A 1Y8QA 4J7XA 3PHLA 2QZZA 3AOEC 4YVFA 4DTIA 3P5SA 4F6LA 1AE1A 4MIEA 3L6OO 4ZRNA 4II2A 4IDGA 3GLQA 3IOYA 3JD1A 4GWGA 1QYWA 3RUCA 4B4VA 2PD3A 2D8AA 4F6CA 4PLCA 2CDBA 3C8MA 2GO1A 5LDGA 2YY7A 4QTZA 1ML3A 3F1KA 3S2EA 2GN4A 4HBGA 4UEJA 3PRJA 2FN7A 4YACA 1J49A 5IZCA 1UDBA 4XQEA 4J4HA 2RIRA 3FTPA 4I5DA 2YV2A 2A4KA 4IGFA 1LTHR 1BGVA 3IQDB 1ZXLA 4YB8A 1SZJG 3BAZA 1EFKA 2GF2A 4XYMA 1VKOA 2Z1MA 4FOSA 5DULA 1AN9A 1JKJA 1I3KA 1YJQA 2OOSA 3LF2A 3ON5A 1B14A 4WE3A 3JQBC 1NM5A 5AOVA 1E7SA 3KVOA 1U5CA 1K6IA 1JVSA 3D3WA 3FD8A 4XIYA 3W8EA 1NPDA 1T25A 2D0IA 1LX6A 1JA9A 1B3BA 4E12A 2AXQA 4RPLA 1ZSVA 1O9BA 4RO0A 1VL8A 3K8ZA 5ENDA 4PLGA 1EE2A 4HFRA 4R41A 5KIAA 1QYVA 4RLHA 1KIFA 4MKXA 3F46A 3HSKA 2X22A 5JPIA 4FGWA 2B35A 5A02A 1HZZA 1U3VA 3NDRA 5TF4A 3TL3A 4OO3A 3WGOA 1A7KA 4F3YA 2UDPA 1WDMA 4M89A 4TKMA 1I32A 3ADPA 5IZCC 2WD7B 2NQTA 4CMHA 5HRUA 1ENYA 2YZ7A 1C0LA 1DPGA 3GZNA 3GRKA 1LQUA 4CMKA 2BGMA 2YUTA 1C3VA 3A4VA 4IMRA 4AJPA 3DMTA 3HJAA 1Q2XA 2PZMA 4GMGA 1CWUA 2JFGA 1V6AA 1QRRA 3JYPA 4I9UA 2HMTA 2PKRA 4BHTA 1DIRA 1PSDA 4CM8B 4A27A 1ISHA 3A9WA 3E18A 1D7OA 4E33A 3KETA 4ZQFA 4JGBA 5TT1A 3SVTA 1LRJA 1W6UA 4BL5A 4OAQA 5B4VA 3OH8A 4WEQA 2AQ8A 1HLDA 1YWGO 1P74A 5IN4A 1MXFA 2O2YA 4K26A 1R6DA 2BF7A 1KERA 1LDMA 2OL4A 4XB1A 1Z45A 4GGPA 4TSKA 4BV9A 4FFPA 4LISA 2I6TA 4H3VA 4G5HA 1P0CA 4PIVA 4NHEA 4ND1A 4IJVA 2AW5A 1Y8RA 2IZ0A 2JJYA 5U4QA 4D42A 5JO0A 5EN4A 4AJ4A 3C3XA 2JD0A 4WECA 1C0KA 4BKPA 5ENVA 3DXFA 3E6AA 2BH9A 3VHRA 2J3IA 1I0ZA 1NBOA 5CPBA 1BXZA 1Y6JA 3E9QA 3Q0EA 5G0VA 2BD0A 5JDCA 4PG5A 3DMTC 4DBZA 4CQLA 4E5MA 1PS0A 1UXGA 5K0ZA 4L9RA 2B83A 4HXYA 4XQ9A 5G4KB 2O48X 2D1YA 3INGA 4GSKA 5C37A 4DC0A 1QKIA 4BKQA 3GVCA 4FBGA 3MWDB 2FMUA 4WEOA 1QMGA 3EAGA 1NXQA 2B0JA 3I9JA 3F4BA 2BRUA 4MVJI 4RVHA 4RPKA 4IJUA 1UZNA 3DO5A 3WJ7A 1R4MB 1ZKMA 3R3SA 2CF5A 4UVIA 3DBLA 5ILGA 5KNLA 3G0OA 1BDBA 4TRRA 3ZW9A 2YFQA 4OSPA 2EV9A 3RU7A 1NR7A 4XGIA 3ZV5A 1LEHA 4OJNA 5AXBA 2Y0EA 2X5JO 1O95A 4Z9YA 4WGGA 5H82A 1DC6A 1ZJZA 4B7UA 5MGBA 3BTOA 4DMMA 2FSSA 3L6EA 4HUJA 4WCFA 3CMCO 5BT9A 3KOUA 4BIIA 5F1PA 5CG1A 3GAFA 4M49A 3L9XA 2DBZA 4NU5A 3BA1A 1VSVA 4O0LA 1UZLA 2PD4A 3HZZA 4WK6A 4GVLA 4D3DA 3ANLA 4LGVA 4IQ8A 4G2NA 1YKFA 1LBEA 3OJEA 4HNGA 3JYNA 4NFSA 1HDZA 1YJ8A 3AM4A 3KXDA 3NDIA 5KJ6A 1UP7A 2DLDA 1N5DA 3K92A 2JHGA 4D79A 2IXBA 4XA8A 5IFLA 2J5QA 4MVJA 1CIVA 4TZKA 4FD3A 1YBMA 3BTUA 3F5QA 2TMDA 3K2BA 1FF9A 4YJGA 3T4XA 3ULKA 3V1UA 4P4LA 5IDQA 3U4DA 5H83A 1GEGA 4EBFA 3IMFA 3U0BA 1F8GA 2D59A 1HYEA 2DPHA 2RBEA 4J0FA 3JSAA 4ESOA 1B15A 4NR0A 4J9UE 3PFFA 5KTKA 3K2EA 1VJTA 3JD2A 4RCVA 4DREA 2PGDA 4J2OA 1P33A 1NPTO 4U0JA 3BMOA 3F5SA 3VKVA 3WJAA 4WCFC 4YJFA 3GPIA 1EEHA 3H5RA 3UF0A 4ND3A 5L51A 1A9YA 4NZ9A 2G0TA 5EQDA 3AU8A 3EVTA 5T57A 1PJCA 5T67A 3N74A 3GGOA 3ZV3A 4MP6A 1GZ6A 4J43A 3ZWWA 1JKIA 3G49A 4BO0A 3WLFA 3MZ0A 4B3JA 2O4CA 4IZIA 5GMOA 1E7MA 2EP7A 2YV1A 1GTMA 1UJMA 3EZYA 4WLUA 2VRCD 2DPGA 1XWFA 1H9BA 3DL2A 1XYGA 1K2WA 5LDHA 4CMBA 3TFQA 4R5HA 3ITDA 4J0EA 5J23A 4QUKA 5B37A 4RQUA 4HADA 2HDHA 3WYCA 4GSLA 3LLSA 4I8XA 3OJOA 3R1IA 3ETGA 1Z74A 1NFQA 2OORA 4WLEA 1NR1A 3GC6A 4M55A 1PZHA 2POQX 4IGEA 4DYVA 3VH2A 2I99A 3RC2A 1YS4A 3CINA 2JAPA 3CH6A 3SC6A 4MVJE 2BGKA 3NJ4A 5CDYA 1N92A 1VJ0A 3KBOA 1NAIA 1VJ1A 4ONEA 4W7HA 2VYND 1CQIA 3FPLA 5DOZA 2Q1WA 2JD1A 4H7PA 2VTEA 1H6CA 4E4YA 1IE3A 5MDHA 2P2SA 1YQDA 2E37A 1BVUA 1FDWA 3G79A 3ZCXA 4ZJUA 1DC5A 3FBGA 5JAQA 4CLOB 2QZ9A 3C7CB 4BS9A 3ST7A 1QYCA 2WJPA 4IDDA 3ZWCA 2VQ3A 2B37A 3LT2A 3WQSB 2DBVO 3INTA 4XQGA 1R66A 4GLOA 4JN6B 4NU6A 2NLOA 1M76A 3KSDO 3FSRA 5TJ9A 3S2IA 3JQAA 5BNFA 4QO7A 5IAAA 3OQ6A 4E3ZA 2X0RA 5JCJD 4BNVA 1U2GA 3GGPA 2GR9A 1YDEA 1GV0A 5JLAA 4H16A 4RL6A 2WTBA 2AG8A 3PTZA 4MPDA 2JFFA 2HRZA 2PTGA 4L8VA 2GGSA 3HHPA 1NWCA 1XDWA 4BO9A 8LDHA 1IYZA 4E6PA 3ZWVA 5JYDA 1YB1A 1B7GO 3E82A 1XKQA 3O4RA 1HTBA 1N7GA 1WXDA 1ZH8A 2C2YA 3DZHA 3ZWAA 3I5MA 2NWQA 4NI5A 3BMQB 2DFVA 1PL7A 2YJZA 3H9QA 4W6ZA 3NGLA 2HU2A 1YVEI 4YPOA 4FFNA 2TMGA 2R00A 3RASA 1CJCA 2NSDA 1HZJA 2YHUA 4EITA 2J5RA 4NH4A 4CM4B 1K5HA 4ALKA 2QRJA 1GY8A 1HDGO 1PX0A 4IM7A 3BYZA 5L3ZA 4BNIA 1MC4A 2ZYGA 3QWBA 3U49A 1RM0A 1R12A 1XU9A 2EHDA 2FR1A 3RKRA 3RUFA 1NFRA 1XU7A 1NPYA 2PD6A 4ZA2A 1Q7BA 2VT3A 2QRKA 3GR6A 1Y8QB 3KYCA 3V2HA 2VCYA 2XF8A 2ZTVA 4E5YA 1KVRA 5ILOA 2XPCA 1B0AA 1BMDA 4X54A 5JAMA 1E5LA 1FK8A 3GMSA 3DEYX 1PIWA 3BXXA 4K28A 2C7VA 1JWBB 2J6IA 4NNJA 5G2OA 4AJNA 2J8ZA 4KDFA 1C14A 3DWFA 4GKBA 1ZCJA 4AVYA 3NTQA 1LU9A 5LCXA 5L45A 5KVVA 1LDEA 5AQ1A 3W8DA 1U9JA 1DRUA 1E3EA 2O3UA 1H93A 1WLYA 3GH3A 3T4EA 3VPHA 4ALIA 1RKXA 1B26A 3OP4A 5KKCA 1JVBA 2R00C 3OIGA 1PTJA 2NNLD 2ZJ0A 1R4NA 4Q3AA 4OKNA 1DHTA 4DBVO 4GVXA 2Y1DA 2JCXA 2GZ2A 3UCFA 2ZQYA 4P8RA 4D3FA 4NFYA 3U4HA 1E7WA 1IZ0A 2H6EA 2WM3A 4BNUA 1I8TA 1GAEO 3PDUA 5FF9A 4YBZA 5K9ZA 1P1FA 3ZWXA 4XDYA 5BNIA 1A27A 1T4DA 3D3WB 4J49A 2AEMA 2LDBA 4CV3A 1J0XO 1UR5A 1ZBQA 4KTTE 1WDKA 3U3XA 5TQVA 3V5NA 3VPSA 1HKUA 4WLFA 4DPLA 4O63O 1U3TA 3JD4A 2F1KA 3SC4A 4J3FA 4CLXA 4PZDA 1X7DA 5L4NA 1ZO8A 3F1LA 4LCJA 4IDCA 2ZYDA 2P4HX 2IRWA 4QQRA 2WMDA 4R54A 4NBWA 4MIOA 3WGQA 1XELA 1OC2A 3RIHA 1EK5A 2CMDA 5HA5A 3NGXA 1AXEA 4KQWA 3GZNB 5FFFA 7ADHA 4XJTA 5A06A 4J1TA 4FOOA 4IDFA 3HDJA 3DR3A 4FJ0A 1KC3A 1ENZA 3DZIA 3E1KA 4AJ1A 5H81A 3FPCA 4DLLA 4PVCA 4FB5A 4DLAA 2LDXA 1LLUA 1LSOA 2VYVD 3N58A 3MWEB 4RF4A 2FRDA 4UUPA 5IDYA 3ZNOA 3GEDA 2UUPA 3M1AA 4PZCA 2EKPA 3WGTA 1H6DA 3B1FA 3TJRA 3MTGA 4PVDA 3TNLA 1BG6A 2IEBA 4A73A 4IDEA 5TIIA 3Q3CA 1MGOA 1Q0QA 3IDSA 4LRSB 1YGYA 4CMGA 3JQ8A 4GI2A 1VLLA 1T2AA 4C4OA 2B4RO 1MX3A 3HN2A 1OC4A 2WEKA 4F45A 5EIOA 3HFGA 4XZ3A 1P9LA 3FHLA 2ZJ1A 3QWIA 4Z6KA 1Y7TA 3GVHA 2Y67A 4RF3A 1Y8RB 4KWIA 3OJ0A 1E3SA 2NACA 4J1NA 1B8PA 2DT5A 3IP1A 1MC5A 2YHIA 3RQSA 3RWBA 5JNLA 5L40A 4NJOA 1K3TA 1NQTA 4BNKA 2Q3EA 1MB4A 2GYYA 3JQ6A 2UAGA 4Q3CA 4PFJA 4CQLB 1WMAA 1KY5A 2Y68A 5DP1A 4U0KA 4CUZA 3HB5X 1F17A 5A04A 3GDOA 4A5OA 3GRPA 1HDCA 2EEZA 1GYQA 2E82A 2P9EA 3UHAA 5G4LA 5L7YA 3LC2O 3AI1A 2O23A 1E3IA 3QVWA 1PWZA 1O94A 1GL3A 4DRYA 2X58A 2ZK7A 1A72A 2OGUA 2VWPA 3AI3A 4NQZA 1W4ZA 3U4CA 1MP0A 1I10A 4EDFA 5HM8A 3RUAA 3OEWA 3L77A 5EPOA 5C7IO 3DBLB 4XGNA 1ENOA 3RAJA 1VL0A 3RROA 4EYEA 3FNHA 3TF5A 2I76A 2VWGA 4L74A 4DPMA 1E5QA 1O5IA 3ETDA 2X7HA 2X9VA 4IINA 4C7JA 3VTFA 1KVTA 4MVJH 4Z3KA 5F3RA 1PL8A 2JL1A 5BSHA 4ND4A 3HUDA 2C59A 3MJTA 2Y93A 4TQGA 5JW6A 1NHWA 3R6DA 5CP8A 2EIHA 2VNAA 3GDFA 4WCFB 5G0WA 2PZKA 3ZWOA 3AK4A 4EEZA 1RM4A 4I08A 4U5QA 1X1EA 4EEXA 1HDOA 3RUHA 1T24A 3OJFA 5IDXA 2X9NA 4ZHSA 1NHGA 3I6QA 5A3VA 3NAQA 4KP7A 3VKUA 5B4UA 4Z9XA 4CV0A 2AEJA 1T2EA 4CMEA 3WMWA 4BGEA 2DM6A 5IDWA 2ZTLA 5CHEA 1PEDA 4D0SA 1SEPA 1WPQA 2Q99A 4GX1A 3WWYA 4P38A 5JFOA 1EUZA 4R51A 4A26A 4J2HA 1AGNA 4MOWA 1Z73A 3RFXA 3KZVA 3INRA 3EW7A 4YJGB 5KCZA 3QY9A 3C1AA 3PJFA 3RCBA 1BXKA 1NNUA 1LA2A 1Y9EA 4AFNA 2AQIA 1N7HA 5I9NA 3GMDA 4I9NA 1IY8A 4D45A 4OM8A 2CFCA 1M66A 4BNHA 1T1RA 3PLRA 4WOKA 3DB2A 3QLJA 1E7QA 4J16A 3JQ7A 3BMOB 2AQKA 3OETA 4N5MA 5U1PA 3TZKA 4YJFB 2V6FA 4CL3A 4E30A 4PLZA 1BSVA 1N2SA 3GVPA 1EZ4A 5EERA 1OZAA 3IIEA 2CVOA 1GR0A 4ALNA 3L9WA 4NJMA 2HK7A 3QA9A 1K89A 1XQ1A 3CPSA 1PQUA 2WYUA 3RSHA 4Y9DA 2GN9A 1PR3A 4BUCA 5ER9A 1C0PA 2GLXA 2I67A 3IAHA 3PHJA 3OA2A 1E7RA 2FSVA 4CMEC 5KVCA 3PIDA 3WQRA 1SCUA 1LDNA 4MVJM 4DQUA 5L9AA 4J4TA 3FNGA 1MUUA 1N1GA 1YB4A 1Z7BA 4E0BA 1WZIA 4E2YA 4JBHA 1SB9A 2AHRA 4GKVA 4QEDA 1P31A 2W2KA 2YYYA 1H5QA 3O26A 3G3EA 1U8FO 3IJRA 3QJ5A 3LQFA 3ITKA 3WYBA 2JD2A 1LNQA 2Z5LA 3NDJA 4N5LA 1X7GA 1H2BA 2DQ4A 1HSOA 1E77A 4HFMA 2IE0A 3UFXA 1U1IA 4JK3A 3VDRA 2HMUA 4R9RA 2A94A 2AE1A 1HRDA 3W8FA 4XWYA 4HV4A 3EUWA 3I6IA 1SOVA 2J3JA 1DDOA 2G5CA 1KEWA 2DVMA 4YAIA 1AHIA 2VHVA 3QSGA 1BW9B 1QV6A 2GRAA 5TRTA 4M86A 4MP3A 2I65A 1IB6A 1GQQA 2VYNA 3RKUA 1L1FA 2ZB4A 4CLHA 4RLSA 2H9IA 3P2YA 3JQAB 5THKA 2PR2A 1UXIA 3L4BA 3O38A 2AMFA 2C29D 1DXYA 3KLPX 1CERA 4WLVA 1O6ZA 1X14A 2NVUA 5A1TA 1LLDA 1H94A 4JIGA 3GFGA 5DOVA 3GEGA 2AEFA 2WYWA 1AXGA 3PHGA 1F8FA 5C7LO 4OMUA 1F12A 3WTBA 1ZSYA 1HL3A 3G1UA 3AY6A 3LDHA 3EZLA 4RV9A 2FHSA 1PGPA 1J5PA 3DOCA 3C7DB 1GFSA 1CETA 4AJIA 3HQ4O 1RYEA 1I2BA 3PJEA 5JCJA 4KUEA 3CE6A 4Q39A 4E21A 2D5CA 4NIMA 3PVZA 1ADCA 3S2GA 4Y98A 4XJSA 4U6QA 5EQFA 4B7CA 1CQJA 4AJOA 4EW6A 4I5FA 2I5PO 3ZU5A 3NKLA 1P1KA 2Y99A 4TWRA 4BO4A 1PJTA 3FN4A 3E48A 2VOJA 3P2OA 1H6AA 2PA3A 4CQMD 4UREA 4KOAA 1ADFA 1MG5A 5ICMA 2Y1FA 1Y81A 3KYCB 4NPCA 1R37A 4PLHA 2B36A 1P0FA 2HKIA 3DAPA 3L4BC 5THQA 1PWXA 2OFPA 2Q50A 2HAEA 5IXSA 1DFIA 2D5AA 3GOHA 3NTRA 4R3NA 3D5QA 3PFWO 1DHRA 1ISMA 1YONA 2PFGA 3BZUA 5F5LA 4IUYA 2CZCA 3UN1A 3OA0A 3SJUA 1H9AA 1X15A 1GYRA 2CUKA 3NUGA 3U62A 4DIBA 1SAYA 2G17A 2FY8A 2HQ1A 3UCEA 3NYWA 3MJ4A 4YRAA 1XGKA 4O6VA 3TQHA 5F1KA 5EINA 4ZGWA 4E31A 1E3JA 1RM3A 5JO9A 1R4NB 3HWRA 1P77A 2JCYA 1ONNA 2HMWA 1KEVA 2X5OA 3BHIA 1R0SA 3QWFA 1T2FA 2V6GA 4B3IA 1K0UA 4A10A 4BO1A 4EJMA 4GX2A 1U3WA 2ZCUA 3TOXA 3AW9A 3ZWBA 3KUXA 2I3AA 3Q2IA 3TZ6A 3DZGA 3JQFA 3R0IA 2HMSA 3C1TA 5AXDA 2A9FA 3I9OA 4XGKA 8ADHA 3QVXA 4UVHA 4J90A 1PL6A 3WDSA 3GVXA 1EVZA 1UP6A 4MO2A 4HX5A 1UZMA 2GNAA 4TVBA 3P19A 2D3TA 4TZTA 2VUUA 4HP8A 4YWJA 4A2CA 3ZU4A 3PWSA 1E6EA 3C7AA 1NX6A 1LSSA 3EHEA 1ZVMA 4FIZA 3H9JA 3O8QA 2CDCA 2P91A 1KETA 3GN2A 2BHLA 5TNXA 1I30A 3ZNQA 1JAYA 4ZICA 3I9NA 2B69A 3QV1A 2VOEA 3KB6A 1E7YA 3ADOA 2C07A 4IDBA 3GUYA 1GZ3A 3DOJA 1EBFA 3WQQA 1EVIA 4QX6A 4NK5A 1PZGA 5DDIP 1NVMB 4BKUA 5ITWA 1ZEMA 3OBBA 1HWYA 4FJ1A 1WNTA 4W4TA 3LK7A 4D0RA 2FR0A 3PDJA 2BFOA 4CLDA 2WSBA 4J9VA 5I7SA 4ID9A 3GUCA 2EG9A 2G82A 3PEFA 3ROPA 4HY3A 2PZLA 3SBOA 3JQFC 4CMAA 1OFGA 1VSUA 4ZD6A 2O2SA 1H6BA 4NBVA 1S7CA 4Q3DA 2W98A 1UP4A 4RF5A 1EBUA 2UUOA 2CVQA 3IL2A 3X2EA 1W73A 2DFDA 1ISIA 3JQ8B 2YW9A 2YDYA 1EE9A 2DUWA 4GMFA 1MA0A 2ZTUA 2QYTA 1GYPA 2VYVA 1ZIDA 3GNSA 4RF2A 2H1SA 3ANMA 4BNYA 3NV9A 4UVEA 2EKQA 3CZRA 1WWKA 2QQ5A 5KJEA 5I7FA 2RAFA 3FI9A 3L07A 1F06A 4I9HA 3FBTA 3ICPA 5DP2A 4JCOA 2CSUA 3H8VA 4ZN6A 3LU1A 3RUIA 2YHIB 3RUDA 4ZQEA 1DFGA 4YT4A 3A1NA 4QFCA 4R1TA 5T5QA 1ZFNA 1YQXA 2RHCA 4JP3A 4BGIA 2NQ8A 1VRWA 4XCVA 5G0TA 3M2PA 1QORA 4E32A 1I3NA 1Z6ZA 4YAGA 2X9GA 3PPIA 1SBYA 2HUNA 3DC2A 1HF3A 1N9GA 4GPD1 4XQCA 4Y6RA 4WLOA 1FJHA 3G17A 2FPPA 3DHYA 2B4QA 2C54A 3OQBA 2F00A 5JC8A 1JW9B 2GASA 3DTTA 3GT0A 4E5PA 4OOEA 4QFDA 4XYEA 2NTJA 3GA0A 2QG4A 2HRBA 3ZI0A 4PG6A 3W4IA 1PJLA 2PLAA 4URFA 4CR6A 4NBUA 4YQZA 3Q1LA 1PQPA 1TEHA 1ISFA 4O5OA 3LC1O 2NVWA
chains in the Genus database with same CATH superfamily
1RYMA 1TI7A 4KXQA 1H85A 1E6UA 3E7WA 2O19A 4N5HX 1UIRA 2EOAA 2XI4A 1LGYA 2ZYRA 1BRMA 2QMOA 3B1JA 3QBTA 4RKWA 3STTA 4WL0A 1C9YA 3EQ8A 5AJHA 1M3SA 4AG5A 5JUWA 4CDMA 3QMMA 5H9WA 1IXKA 1BCSA 4FX2A 1ZSNA 4RY9A 2R8PA 1ORVA 2GESA 3RVRA 5GZ6A 1T9CA 2EARA 5IARA 5JVDB 2PMKA 1IXYA 3QE3A 3R3YA 4MUJA 4MYRA 4MUAA 5B4TA 3WSTA 3D6VA 3UG6A 1XAIA 1ESMA 3CE9A 3E58A 4N3CA 3NUZA 5BQFA 3FMOB 3MJSA 1XCLA 2XJ4A 5FJJA 4J07A 4PG8A 3OIFA 4ALLA 3F98A 1AG9A 4GRDA 3O3OB 5ADUS 2Z6UA 3LT1A 2FR8C 1ZN8A 3EOAI 4OFZA 5A3JA 3TMAA 3U44B 4RCZA 4EQ6B 4FYIA 5IKEA 2QTAA 1EQ2A 4HAXA 3FWZA 3I4FA 2QTZA 3HG7A 2ODTX 3RAPR 5AVRA 4E5UA 4S04A 2QM8A 3F9CA 5HIMA 2OCKA 3W1VA 5ALVA 4XSVA 1WXEA 2O2DA 2V4MA 3NO4A 3ENQA 1KBZA 2UZAA 3F96A 3L8FA 5D8DA 1WUTA 2BL4A 1EK2A 4BJ1A 2IVZA 1W93A 3MBKA 1A8IA 3V4PB 4HKTA 4CM5A 4NJMB 1XRJA 2YMLA 3R3ZA 3PC8A 3QM1A 4HNSA 3F2VA 2BJWA 2Z95A 4MDFA 4F93B 4LSMA 1JB9A 4EGAA 3H2JA 5C53B 4IGKA 4YT5A 3AEUB 5HSGA 4PC6A 1SCUB 4Q3LA 3ZVKA 3PFCA 3KQWA 3OZIA 5EZYB 3CEAA 1EUDA 4R8VA 5BQPA 4JJFA 3ONDA 1Q17A 3C85A 4MUEA 3ZGVA 2CVZA 3OOWA 4BNGA 2X8LA 2XOKD 2P78A 4Q82A 2R66A 4FFVA 2GK6A 1T4BA 2OKGA 1YE8A 3QOFA 2IX9A 4G65A 4IWXA 1NNEA 4GVPA 5ALMA 4WASA 1L7AA 3EQ6A 4U2BA 2OQVA 4N3BA 2B4YA 1M6VA 3QQ5A 4L4SA 3D1JA 3GFVA 2XCLA 3IHWA 4IW3B 1UJBA 2N1BA 4O2AA 3TRIA 3ZI4A 1AUOA 4I55A 4DNQA 4PCVA 1CB0A 2DKFA 5CDFA 3KKMA 1KEEA 1DUSA 3BWEA 3BX1A 4QICA 5DRYA 4JHXA 3OHSX 1T10A 3NHAA 1S1CA 3EWNA 5KWSA 1XA0A 1NW8A 2XBLA 2ZTMA 2GSDA 1NUPA 4FD2A 5DTQA 5CFRA 3IPYA 3WSWA 3K09C 2GARA 4M0FA 5IP5A 1G7TA 1XQYA 5F5NA 3MT9A 1SHKA 4BMNA 2W71A 5BSFA 4NF2A 4UUNA 3D5TA 1OU0A 2ZZMA 1XVTA 4IS2A 3TLAA 4HK4A 3U3ZA 5DW3A 1DC4A 2ZSAA 4YA6A 2VHWA 1OQAA 2GN0A 5CFOA 1XCGB 2ZIGA 3GT3A 4MKFA 5KX5B 2ICAA 5JS6A 3PEVA 1E96A 5TS3A 1V7PC 5K05A 4QNRA 1VJGA 4XW2A 4ZOLA 5ARCA 3VVMA 1C4WA 4LE0A 4YGYA 4Z9FA 3UT0A 2OXIA 3K6JA 1J07A 1CYDA 5EP1A 3P96A 1UPAA 4J3JA 4EEKA 4GWKA 1D09A 5JEEA 2CV2A 1SPXA 4JV5B 3IJEB 1C30B 3H11A 3A06A 2IUFA 4IYRA 4CN9A 1U0NA 4RM2A 3UANA 4W5JA 4RFSB 4QU9A 1LTQA 2KBFA 4C3OB 4U7JA 5KB3A 1U8ZA 3DE2X 3B85A 1TZJA 2ATVA 4IS3A 3TEMA 3RC8A 5ESXA 4RZSA 5HUQA 5CEEA 2QXUA 3IP9A 4KYTA 1AT1A 3CYFA 1RXUA 3VC7A 3G2PA 2YDXA 4PZAA 1Y9ZA 3E3MA 3AM5A 4IJKA 1ECGA 2I2WA 4EH1A 1J42A 5ALXA 2ZQZA 3T15A 6Q21A 4QDJA 3SHWA 1IMJA 1IY0A 1D1SA 5JBIA 2YXPX 2P65A 3PNQA 3GJ8A 3JTMA 3C3YA 3QK7A 1TM4E 4HB0A 4HJXA 2JKYA 1KGSA 4Y9TA 5COAA 4KR9A 2Y76A 3FMGA 1D4ZA 4RIFA 3VSEA 2C96A 5AW3A 1QRTA 2XAAA 3UWOA 3WNQA 2XXAA 3KSZO 1PL0A 4IBOA 2G71A 1O0SA 1D4OA 4YP5A 5DO9A 1P7WA 4QBKA 4W1QA 2X0FA 1PS8A 1UDAA 2CZQA 1RPJA 2ERYA 2PIDA 4HYEA 4RZ2A 1RPNA 2HBYA 3TZQA 4CI9A 2PS9A 4Q01A 5FCDA 3H19A 1CUSA 3HUFA 4TV8B 2QSYA 4ZP1A 3CR8A 4XGRA 4ZQBA 3RS3A 4DLWA 1NX9A 4MZXA 4EY8A 3BBLA 1IB0A 1RR6A 3RBXA 1FSPA 1ECLA 4QZVA 3MHTA 5LQDA 1QMPA 1N2EA 3SMQA 4KWHA 3AB7A 4RV5A 4X1KA 2ZWPA 1NW6A 3IALA 2X0JA 2GCGA 2XE8A 3QFSA 4QQ8A 1JEYA 1D0IA 1GADO 1P2TA 1B2LA 3IELA 4U7HA 1QAQA 2C0CA 3AUUA 4IX9A 5GONF 2LKDA 4WUVA 1BHSA 1HFEL 5CXSA 3ODGA 2R86A 2GILA 2ZIXB 2P7HA 2F8SA 3HNRA 4ENPA 1E2IA 2RG7A 2I1LA 3M6UA 5FULA 4OP3A 1XTZA 2JAXA 1NL3A 4X85A 1NMSA 4HDSB 4C4ZA 2VF7A 2VRBA 5DEOA 2CMGA 1V41E 1C9NA 2Z2ZA 3FUTA 4FNAA 4E07A 1YB2A 3REQA 1MRNA 2CFTA 4PAQA 4ER7A 1QIGA 2V9CA 2LV8A 4NJEA 4OHBA 2JI6A 3HUUA 3TIIA 5LJLA 3H16A 3NQ41 4HQOA 1P0QA 3OFSA 4LZJA 5ED0A 4FNMA 1PNOA 2H52A 2HF7A 1ZOOA 5FBWB 1RWQA 2F7SA 2ZSIA 4QDTA 2OHVA 3FLEA 4XUCA 5DBHX 3IKTA 4IIXA 4XI9A 3IDOA 3KQUA 1O0CA 2YRWA 3RVBA 2P79A 5E0OA 1L5FA 1KVUA 1PWHA 2OECA 2WAYA 1N4DA 2O6HA 4Z0TA 5CB6A 1NG1A 2F17A 1FSSA 5HOEA 1AH2A 5BVGB 4C22A 2XCIA 1YKSA 2WKPA 4HYTA 4LEIA 1DMRA 2FLKA 3LLUA 2HMAA 4MW5A 3O8NA 5LYJA 3NWOA 1DKMA 4KHZA 2I3ZA 4HSGA 4BO5A 1IWPB 3ZXIA 2FP3A 1O03A 1U2ZA 2PH7A 3GPCA 3GY0A 4ETIA 1O0BA 4AECA 4LC1A 2VUTA 3SVZA 3VH3A 4BZQA 7ABPA 5CCBA 3WYFA 4XEHA 4MIYA 4JUIA 1RQ7A 4BMOB 4YCMA 5BRJA 1RRCA 4U39A 4AMZA 3M9LA 521PA 4B3TB 1JSCA 3AEQA 1I5OA 3OCZA 1IVNA 3O9MA 4HQLA 4LJYA 4PZEA 4YAFA 4DIMA 4N5NA 2YUIA 4E5VA 2NAFA 3BEOA 4PXAA 3BF8A 3R0ZA 3UTCA 5T8KC 4F7WA 1Q57A 1WL8A 2C5EA 4FDAA 5TSDA 5CMLA 3TLMA 4EFDA 4O1IA 1ZXXA 2WBLC 4C4RA 2XNDD 2BOVA 1LDYA 2HQOA 3AH8A 4NKRA 1XEWX 3CR3C 3FPSA 3WLNA 2WKQA 3GW8A 4CV2A 2A0FA 4AL4A 1QCZA 1UEXC 2IP2A 3GUUA 3M82A 2JJ1D 3KZNA 1M6YA 2BI8A 5DTMA 4OKIA 3E9ZA 1D4FA 1M1YB 1XMQB 4LTDA 4QEKA 3ZHBA 2LNDA 4ZIRA 5LP6F 3R9XA 1QGUB 1XZQA 3WHLA 2NVBA 1IUKA 4AJKA 3DAYA 1SFRA 1P7VA 4CPDA 1QXSA 3GZ4A 3G5TA 5C51B 2BDUA 4GH5A 4ZYTA 2XY4A 3F3SA 3JQ9A 2Y1WA 3ABIA 2JCSA 2GEJA 1KFEB 1II8A 1KA9H 3NBAA 5EZSA 4ES6A 1ZM4A 1OIVA 1JE0A 3K0FB 3K0EA 2KHZA 4XASA 3R5SA 3LWZA 4EYGA 1PW5A 2V7XA 1YUBA 4ILKA 1VI2A 1RJWA 4WQMA 1ONOA 4WBNF 2CYCA 4M0EA 5GAJA 4HDRA 1V1MA 1P2GA 1MX1A 2B7BA 1A98A 4PF1A 4B82A 2P68A 3QRWA 3CX7A 4C6RA 4Z4FA 3O8BA 2WSSD 1XAJA 4ZREA 4HWTA 4R5MA 4MMYB 4WZAB 1DX9A 1DBVO 3GNQA 4IX1A 4ZO6A 3PX3A 3EGDB 4GXQA 5DASA 1M10A 3CVUA 2GPSA 1LSJA 4ZYVA 1YRHA 1X8LA 1CRWG 3OQ1A 3QVJA 2HTEA 2GPBA 1FFSA 2G3YA 3C7TA 3OZXA 1A9PA 2JW5A 2Q49A 1GRQA 3Q9NA 4TGLA 2UU9B 5BMVB 4OXNA 4K87A 1JFRA 3D8TA 1Z2PX 4Q3KA 1N36B 2QW8A 5CDUA 4JJIA 1D3AA 4LUCA 4BFYA 3A4IA 5C8YB 1P2UA 5DLYA 3K30A 3D6AA 1XPJA 2P3SA 2BFDB 1T5IA 3NW9A 2ST1A 4GECA 4NP6A 3LHIA 2O2ZA 3BIFA 4OBEA 3FYDA 5AIBA 2OZVA 3H1PA 5C5IA 3DDUA 3G88A 2H4HA 3H4IA 5BR8B 2F8TA 3NU1A 1B42A 4PNHA 5G1NA 4Q03A 1OASA 4D44A 2WJGA 1H8HA 1QR2A 2UZ1A 4F60A 2VQFB 5JXWA 4QD3A 4N01A 1G2PA 2A58A 2L0XA 2VRCA 3IUSA 3PDHA 3CLSD 5EYPA 2I2FA 3A9RA 1K98A 3TL2A 1VBFA 1YS9A 2UYOA 1GSHA 2VSFA 4H4CA 1EFUA 4L8FA 5AKKA 3SHQA 2V3WA 4K6MA 4B0OA 3CX6A 4MA4A 3GLGB 3W34A 3K9QO 3EOBI 2GKOA 2YOFA 3FBWA 3N3BC 1NVUQ 3D7LA 1ZVJA 2EFJA 3OI7A 3P9IA 4MRNA 3WC4A 2QTMA 4MO9A 3B1ZA 3WDMA 4KR6A 1IL0A 1OWOA 4ML3A 5FTMA 4ZAXA 1Y1PA 4D0LB 1I01A 2LD4A 4OEHA 3WGKA 4RVGA 1M0EA 2G1KA 3U6BA 5K3EA 1C41A 3ZDAA 4P7JA 3JW8A 4REOA 1JHAA 1YUNA 3HVIA 2HWKA 4JOBA 2P2NA 5DNDA 3HDHA 4K6FA 4YXFA 3N0XA 3H7IA 2UVPA 3OWHA 4U2CA 3S7ZA 3VR1A 4ACBA 5I8PA 4KV7A 5KUTA 3HP1A 3EGOA 3FSGA 1NLFA 4B76A 4EPTA 1T35A 1CUCA 3BE5A 3DDZX 3GQBA 2Z8ZA 4XIIA 2JH9A 3BMCA 4R2KA 1NVKA 2DWOA 3AQ4A 4RK0A 4A8HA 3VA7A 3E5RA 4B83A 1CE8A 4PO8A 1U9YA 3F3YA 2V6MA 5HE8A 1HH4A 3HH8A 5JD4A 1FVOA 2H1WA 1KYTA 721PA 3UMVA 2Z1NA 1BCSB 1NVGA 1SEVA 1Z25A 3HU1A 2QP3A 4OJQA 1IPFA 1NNI1 2DRIA 4BNDA 4G37A 2XTNA 4C14A 4DFDA 4WD3A 4XIGS 5CX1A 1QIMA 4BPBA 5CK4A 4UZFA 3FOBA 4U2KA 2N3ZA 4H59A 2FEXA 5GV7A 2VZLA 3H5AA 5BP7A 4ZPJA 2VQEB 1J70A 2MYNA 2FFRA 4GPIB 4RX1A 1N0WA 4ZVKA 1IOLA 4MP8A 1SD5A 4L07A 1GLVA 1L4EA 3UPDA 3UV3A 4D8YA 2P2LA 3NWPA 1RYZA 2E49A 1A77A 2DH6A 4RK7A 2BEUA 3PA8A 1JA1A 4LDPA 3LX4A 4J7CA 1FDVA 3LXUX 3PT9A 4TVKA 3K9CA 2FPRA 3HBFA 4J94A 4AF7A 4KAXA 4KLRA 3P0FA 4DSUA 1CULC 4H0NA 4M98A 1G8HA 1F0YA 4L5BA 5HHTA 1R2QA 1SVNA 3NALA 3OTOB 5ARBA 1EESA 1F6BA 3TTYA 1DIOB 5SY6A 2Z0MA 3GL9A 1ZWLA 3CXUA 1EMDA 3VJMA 5CLIA 4GEGA 5BPHA 2RHBA 3ROMA 3OIUA 2PRJA 5FWNA 3M4XA 2HK8A 5ICGA 2CY0A 3ICWA 3VHLB 5A9SA 3KX2A 3PRHA 3SHVA 2FOLA 3L8ZA 1TW3A 2MINA 3MN1A 3V3KA 5EJ6A 4AS3A 3R9KA 2RGAA 5I7EA 3ETEA 5D6NA 1CDEA 5LC1A 4RNDB 3AF4A 2POCA 1EUDB 1G3UA 3CF4A 1K75A 3B8EA 3K35A 2PYIA 3KB2A 4R2HA 3AZOA 2EF0A 5DGDA 4KXMA 2VN8A 1W29A 1WDTA 2WMOB 1Z7EA 2ZJ7A 2ZUUA 3RFVA 3NDBB 3X0DA 1Y1RA 3V32A 1PGOA 5AM4A 1M6VB 2QQFA 2BGNA 5HWSA 4JI8B 3ESXA 5AESA 4O2AB 3NWEA 4I55B 1G16A 2G5GX 2NU6A 2IH4A 1DAFA 3FNRA 2FZ5A 4AJ2A 4XWGA 2HEGA 1NQ5A 4IJMA 5KKAA 3KPJA 4BFLA 3PUHA 1PJ2A 1KEEB 1QVZA 5J1TB 5DCWA 3DDCA 4DQXA 3LYLA 2V3CC 3Q3EA 4HR7A 4URYR 4YRLA 3THXA 2DFPA 4P35A 2OQ2A 4G8DA 3L7NA 1MG0A 2O20A 4RPJA 5F12A 5FOVA 4ZXPA 3TQIA 3P0EA 5IT0A 1WMSA 1XZNA 1GTZA 1O6FA 2R6JA 3AFHA 1KDTA 1GQ2A 1UEJA 2VDRB 2W90A 3HCNA 5BRNA 2VSXA 3ZVNA 4OB7A 4LHWA 4Y0NA 4R7ZA 2X0EA 2JIOA 1CW2B 3MJRA 1DJQA 2P5SA 3S40A 1XB2A 1OZGA 5BVHA 5JCZA 1QBKC 3WIDA 4ZOLB 3Q1KA 2ZWMA 4P9NA 3VR4A 2QX8A 1Q83A 2DKNA 1CNMA 2QW0X 4YQYA 2IXAA 2IZZA 4R7GA 1LLFA 3ZKAA 4EZBA 5B5SA 5L7TA 3H11B 4RTJA 2YJGA 3NFYA 3PNVA 4QXPA 2KLBA 4ZK6A 1VGVA 3FF4A 4OK5A 4S1TA 2LVBA 2Q5QA 3VPFA 1NLYA 1Z83A 3N8IA 4YAKA 4G09A 4CCYA 5HQTA 4N8SA 4LVUA 1SKQA 2LXNA 3S68A 3VR5A 3WNBA 3ZY3A 3FLMA 5MN6A 3ZJTA 1C4OA 4PLYA 1COZA 1BQ4A 5BQOA 5SY4A 1Q0ZA 1V9LA 4ZQGA 4BECA 5KEIA 1Z6XA 1ULZA 5BSMA 4DLNA 2MSDB 3RB8A 2O8BA 3TOVA 4RZHA 4CMIA 3LF1A 3AVQA 1CDOA 2ZRJA 3MWFA 1ZN9A 3TJZA 4I6GA 2P5YA 3KJEA 1NVVR 1P17A 2QX7A 4WI1A 1H4QA 2DFNA 5MGNA 4XFKA 4BVHA 3PL5A 3OLYA 3HCBA 1XQ6A 5G40A 4RDIA 3TBFA 1MQAA 1TT5A 1VSBA 1J2UA 2ZEJA 1HPLA 2CZGA 4KBYA 4O4LF 4RKFA 2AIRA 4HUTA 1Z0SA 3AY3A 1OYYA 1HYHA 2GPTA 3IUJA 1R15A 2R4UA 4J0DA 1ZD1A 1PLLA 1G5FA 3ROZA 1M1NA 1DG1G 1PHRA 3A3YA 2VNKA 3M1IA 4LGYA 1HTWA 5T4HA 4DDWA 1JQAA 2A14A 1XPOA 5F33A 3SMVA 5IU6A 1W1WA 3R7BA 4X1KB 3KVNA 4W1RA 4EA7A 1JEYB 3IV6A 1KI6A 3ZD8A 3DZKA 4L7VA 5D3KA 4H4DA 4NICA 3DM9B 4CM3A 3KJGA 1NUSA 2OYCA 3KZ1E 3KKNA 3BBPA 5FPHA 2B7CA 3KJHA 2CBZA 4RELA 1GKLA 3WIOA 1KK2A 4BX0A 2OHGA 3G5LA 2H0AA 1KO7A 3GJ3A 3PD0A 1D9XA 1W52X 2EXXA 2RH4A 3O92A 3DBHA 3H3JA 1E0DA 4MVYA 1MCZA 2ZU0C 5ECYA 3UT6A 2XADA 3AEYA 3VNQA 3BPSA 3REQB 4AXXA 4HS4A 1I7PA 4NJEB 4BY9E 1SIBE 1V5GA 5JIBA 2Q1XA 4R68A 4G23A 3R6LA 4XIJA 5EVCA 3T4UA 4V0LA 2PFSA 3QKRA 1ZONA 2GD2A 1Q3KA 1KNXA 4QGFA 3FHOA 3CHYA 4HUQA 4QPZA 1A4IA 3GDHA 2Q7DA 2AE2A 1DIGA 3BFXA 3ZX4A 4ASUD 2XR1A 3J81A 1BDIA 1TYEB 1VA4A 1COWA 1ABFA 1IONA 1VJ5A 1J09A 1DXOA 1PP4A 3WLJA 3SM9A 3ISJA 1K8RA 2K87A 5DN9A 2IWRA 4MCAA 2R5NA 3GD7A 4RJLA 1N25A 3B7PA 3CNNA 2PK3A 4ZAWA 2WF5A 1Y1TA 1QSGA 2PRKA 3SE7A 3BH0A 1D1PA 4JUBA 5A5GA 2I3BA 3OEEA 2IUTA 4V3CA 3S1LA 5JD3A 5LYJB 1PV4A 2PVCA 1I94B 4LOKA 5AJWA 3PF9A 4YN3A 2BFCA 3OCJA 1AKYA 2QM7A 4EF4A 2R9VA 3ASZA 4I5GA 4XPIA 4K9KA 1T8SA 1TCBA 2NT4A 1ZD8A 1P7ZA 4NK4A 2FR8A 1DT5A 4JUCA 1R0WA 4U2EA 5DNVA 2XITA 4KITB 3AEQB 3LPAA 2UUCB 4TMFA 1I3OA 1YZNA 1J0CA 2CXNA 3GPDG 3COSA 2BMJA 3T9EA 1C9EA 2P2CA 5IM4A 1L8OA 1LRLA 4N9WA 2V7WA 5BSRA 3TCXB 1GG9A 3CSUA 4KSCA 2O2GA 4BB6A 2EP5A 5LLDA 4ZVTA 1BEUB 3C6BA 3FZEA 4B09A 2Q5HA 4RLQA 4H6WA 4PC7A 5JD6A 4MRMA 5TY0A 3FLBA 5GADl 3WTCA 3DO6A 4XLZA 2J3KA 2J9XB 1N8NA 4QDXA 4KO2S 2IS1A 3B1WA 4HEJA 2QNBA 4AUMA 1DV2A 3LI2A 1Y33E 2GVDC 1MQ9A 4F9FA 1AHHA 3I9V1 4ZIRB 2PL5A 3K9HA 2AB0A 3E15A 3R9XB 4D97A 2PNFA 3TDKA 3PPWA 2C4TA 1MO4A 2AL7A 1KVQA 3NFRA 2EX0A 4XM0A 3FJ1A 4CG0A 1EX1A 1EQUA 2OXCA 3PC2A 1SG6A 5FA6A 4TWAA 4Q0MA 1TO2E 3UW1A 2VIIA 1KPIA 1G42A 3ORSA 1TZKA 4L28A 3NHMA 2WWGA 5DTRA 3G2QA 2OE2A 1II8B 2Z2XA 3IEKA 3VVLA 5DNAA 4DUGD 1YZGA 1JQ5A 2DUJA 2GNOA 3PV0A 4HWGA 3ACBA 2HF9A 4G1VA 1XBTA 2ZWVA 1KH1A 5K4AA 3RHSA 1KBOA 3FCOA 4CM9A 4G0VA 3BTSA 2FWIA 3PBKA 2Q8QA 4X84A 3UMJA 4HDRB 1GGVA 2CLCX 1V1MB 2EDAA 2EFGA 2C4VA 1Y6ZA 1PKXA 1D9ZA 4JHLA 4QBFA 4S1NA 2BFMA 3SHOA 3BXEA 3Q6MA 4DMLA 1SCAA 2W0MA 3N0WA 4BYMA 2HK9A 3JQEA 1EXWA 3BZWA 3M6WA 4KPEC 2I6FA 4CIAA 1EUCA 1B1CA 1G3IA 4RTLA 4HX9A 2WTXA 1LLCA 2VAXA 1O9HA 1E63A 2A33A 2HI0A 2OBLA 3KVVA 4K9PA 1JR4A 5CJJA 1PU2A 5A05A 3WZMA 1YJ5A 3IQHX 3OZUA 4DN6A 2EC5A 1RJEA 4PYRA 4E11A 3JZIA 4C0WA 1Q1GA 4GOXA 4EHFA 1TFUA 2DY1A 2ZJ5A 1RAAA 4CV1A 2L18A 5J63A 1TF7A 2J3LA 3VXKA 1UXJA 4MNTA 3AJRA 4F91B 4CM8A 3UWPA 2QL7A 4YO7A 1DJNA 3T3GA 9LDBA 2PUBA 4MQBA 2CLEB 1L4LA 4Q3EA 4YCSA 5JAIA 4E5KA 2JIDA 1ETUA 2HO5A 4E7PA 1IEWA 5D3MA 4GQBA 4ALMA 4IO0A 1CS4C 3BCSA 2P4SA 3ENKA 4JJ4A 2FG7C 1K6MA 3N2LA 4UTVA 3PWKA 1ULHA 3GI1A 2I2CA 5K20A 3CIOA 1HEIA 1MB2A 3ZYZA 1ZVKA 1OXBB 4NE7A 2IYRA 3N2YA 5HBRA 2C5AA 2QDXA 3ZHZA 2UZ1B 2C8VA 4HXGA 1JIQA 5EYPB 4XWKA 3DLBA 4L76A 4OXYA 2P7IA 3VZCA 3B53X 4NQRA 2J9RA 3M4ZA 1MTZA 2NADA 2FK8A 5F64A 5JEDA 4OQYA 4L8WB 5JE8A 4Z5XA 4DHEA 1EUQA 1MAAA 1GCOA 1ORRA 1P1IA 1U2GC 2C2WA 2D2IA 2FQXA 3O1HB 1NR5A 2TMKA 3EDMA 4DSZA 2XUJA 1ZC3A 4FOTA 3WB1A 5BMOA 3GFPA 4M37A 3V8RA 4BMXA 2YICA 3DG9A 4M8KA 1TEXA 5B7NA 1K8ZB 1N3IA 1RD4A 2IYYA 3GLKA 3DO8A 1U28A 3PT5A 1L7EA 2L69A 1W9HA 3BREA 3DM5A 4WKGA 3UAOA 1ILEA 3MWKA 1OH5A 1D0SA 2OGWA 1NW4A 2QENA 1WXIA 4RHCA 1L7OA 2V4ZA 5F4BA 3RKSA 4N76A 2UVPB 3GF4A 2B30A 3LVQE 1EP2B 3TUZC 2OPBA 4X92A 1KWKA 1G1AA 3GQBB 1R16A 1TMKA 2HHCA 4G8BA 3BMCB 5DNUA 1O95D 4BMVA 4CHGA 1GP2A 3KVRA 2HIGA 1CE8B 3N86A 2J48A 1I3MA 4G0QA 4DQVA 4FYWA 1N2OA 2FA9A 3ZGYA 4PY2A 3UMYA 3BFKA 4ZCTA 4PYMA 2HSGA 3DKKA 3LCJA 4BNDB 2BZGA 4TSRA 3ET4A 4L0QA 3TNYA 5EHGA 1QK3A 3AP2A 4BNWA 1I4EB 5CX1B 4KG7A 2FF5A 2VT2A 3D4PA 3RAEC 4F71A 2E3JA 3KKLA 3AR4A 4IXNA 2F59A 1VCIA 4MJLA 1QQ7A 5J43A 3AG5A 2K2QB 5BUSA 5KBYA 4F46A 3QPVA 1UBHS 1A7AA 1U9IC 4GZ6A 2QI9F 1XG5A 3SAJA 4PZZA 1YJAA 4O3FA 4CF5A 2NW6A 3O7WA 3QV2A 4DJ5X 3E81A 4RTOA 1ZMOA 2BEUB 4HNRA 4KKXB 1PZFA 1NAHA 1MX9A 1F9AA 2PXAA 3GUHA 4G8JA 5CYFA 4YRTA 4ZWNA 4D3YA 2C2XA 5B36A 5JPCA 4MVJD 1PE0A 1MH1A 2C3OA 4R40A 1U11A 2G1PA 2Q9AA 3HRIA 3JQRA 2TRSB 3K5WA 3NX4A 1K6EA 2BMDA 5ALQA 1IBLB 5DYYA 3K96A 1QZZA 1G8GA 2Y1GA 3FSEA 4ZVQA 3T3OA 2O7RA 1Q95A 1ABEA 3DE6X 3W05A 1TVCA 1Z4IA 1PUXA 2ECQA 4M22A 3O1IC 4UU8A 3TIVA 3VNUA 3KQVA 5F7JA 3GK3A 1N6NA 3MGAA 1GRNA 2ERCA 2IITA 3RBVA 3G7SA 2O8NA 4A82A 1ARZA 4F04A 1SUWA 1HT3A 2AF4C 3DCIA 4J6FA 1TLLA 5A9SB 1NJ5A 3H1FA 4HQ6A 2RHRA 3AVPA 2MINB 3QPWA 3DZDA 3DVSX 3S28A 3JRNA 5IMSA 2VSQA 1YE5A 3OOJA 4C29A 1TVEA 5JAOA 3QNMA 3H9UA 5CEJA 3BIJA 4EG8A 4E15A 3PXXA 2XRMA 2ZAGA 1KI1A 1L4KA 3WAGA 1JH9A 4RJTA 1AB5A 1RXEA 2PLWA 2VTKA 3CJTA 5CUQA 5EP2A 4DLBA 3GGGA 1Q5PA 3D8BA 1LLQA 1WVMA 2XMBA 2AN4A 3DVRX 5DE3A 1CUAA 1KAHA 2GK3A 3LXMA 1X6VA 1SVIA 3DVQX 3F6YA 3H9BA 4JUDX 4ZGGA 3LXXA 1VPVA 4HLUA 2PPLA 5KVAA 4MHOA 5EJAA 1IOVA 3SX4A 4TTRA 3SVLA 1DARA 2NU6B 1M2NA 2IYVA 1BX3A 1XALA 1H3FA 2OUIA 5JNWA 4PYNA 2ESRA 3TKLA 3H75A 3MLBA 1IN6A 3EVEA 3HABA 1BFUA 3LUHA 3ZTYA 3BXGA 4LK3A 3ZWMA 3R5HA 4EECA 1QH1A 1BWSA 3OJWA 3THXB 2RD2A 1DC3A 3CBQA 1Q1BA 3AX6A 1YB5A 2PEYA 3E5MA 2PBLA 3HJUA 5BWMA 1EXDA 3ORQA 5E95A 1QHYA 4JBGA 3VUFA 5DCYA 1DJMA 5MFZA 3DMFA 4OM7A 5IZ4A 2C1EA 4YR9A 3GROA 3RABA 3B5JA 3CUEF 1X1TA 4AKTA 2QMHA 3CISA 3WLAA 4EMUA 1Z3CA 1Y5MA 5BVHB 4Y2PA 2OV1A 4R1NA 3W7BA 2FSPA 1IUPA 4CMEC 2YV4A 3RYCA 2FN4A 2DC1A 2E0IA 1PDOA 1PNTA 3L6UA 3LW7A 4DLTA 5K99A 1GKUB 1K97A 3EF3A 4Q4HA 3QVSA 4D43A 5JYEA 3L46A 4I9FA 2CLMB 2DU8A 3LA8A 1II0A 3LUCA 4II3A 4M8SA 4PICA 3X2FA 5KYWA 3EB9A 2VPIA 2WRZA 1NFFA 2V0NA 1OPRA 2VC2B 2X0KA 3E4CA 2GBLA 5CDSA 1Z4KA 2BWJA 5B64A 3P27A 5K6AA 4M1YA 4DA6A 3AV3A 4EI7A 3EQZA 5I45A 2VUHB 4CCYB 4QJIA 2XB8A 3MQ4A 3I72A 1UH5A 1GTL1 2EFCB 3Q8MA 2FSIA 4G5YA 2LUOA 3OU2A 3CUKA 1Z36A 3NWBA 2QQGA 2JGNA 5CBKA 4FDTA 2WILA 3FXAA 2O8BB 2AH5A 5HQ3A 4CMIB 1X7HA 4DR1B 3DF9A 4HFNA 4BQRA 4DJEC 4C43A 1JDZA 2YQZA 3FWNA 1Z62A 3W0LB 3ZNPA 2PZ8A 3RIXA 2A9PA 2EFDB 1C7JA 2PX6A 1KYZA 1GUAA 1YJBA 3A10A 1EWVA 1A2OA 1N0VC 4CG1A 1UPUA 4LYAA 3O5AA 4B74A 1US8A 1DJLA 4CLOA 1JEQA 1TT5B 3KLNA 4GBJA 3K9LA 3SXJA 1A04A 1X0XA 2R7LA 1LF0A 2BI7A 1PJSA 3ABQB 2NXJA 1OSNA 3HLTA 5IJWA 3CQ9A 3V1TC 1KK3A 1QQ5A 1M1NB 1S2DA 2JLQA 2VHUA 3IV7A 3K4PA 4J1SA 4JLDA 3QZUA 4MWTA 5AKLA 1P7PA 1UXKA 7MHTA 1FDIA 1HM5A 1SXJD 1K1EA 5I7AA 4MVJG 5I7VA 1KI6B 3ZLVA 1HE3A 3GJXC 3Q98A 1PFKA 3U3RA 2NUPA 4QXMA 3V7NA 3VM6A 4CKEA 4B6EA 1GFZA 2C4UA 5CFNA 5DBFA 5MFPA 4B79A 5CLJA 5FT9A 1GKYA 1KHHA 2P27A 5HX7A 3PJDA 2ZDGA 2AZXA 2VQSA 2WF8A 5FOWA 1JBQA 3A28A 4CQJA 4A03A 2P9GA 1V48A 2HQRA 3DBHB 3GLFE 1FRFS 3NM5A 1V3TA 1RTTA 1HSZA 3HTXA 3BMQA 4ZGBA 1GV1A 4DJJA 3EXG2 5B55A 3LTEA 3E70C 4GQIA 4JQOA 3QKRB 3UMRA 4DG5A 1O6GA 1U3FA 2YS7A 4NZOA 1DBQA 3OIDA 4C7OA 5BOVA 2FW6A 4HUQB 3EWAA 4FLMA 2QTWB 4G81A 2GLTA 2B92A 3AWDA 3FPGA 3IP7A 3IT1A 4PSAA 4S1VA 1WSBA 2JBAA 4X3OA 3RYIA 3EBPA 2QIOA 2QLBA 3BOSA 4AN4A 4FSXA 5AIAA 1L7NA 4JODA 3M4YA 2IPAB 1DBPA 4O2BA 3C3JA 1X1CA 3QVOA 3Q7EA 2C3PA 4CL8A 5LOVA 4QWMA 2QSUA 1ONPA 3L02A 3GOQA 4LCBA 2Z8YM 3ITEA 4H0FA 2OVBA 3DT9A 4K9RA 4XAQA 5FHQA 2HSWA 4BJ3A 4O0MA 4ZU6X 2FFQA 2HXGA 3PPXA 2QZZA 3BXOA 3UB2A 3OUZA 2BFCB 1VKZA 1GQRA 3TIXB 2XYRA 4XPIB 5EZ5A 1DWOA 3TBKA 2RB5A 5IAGA 3P5SA 3TLJA 4TOIA 1CXZA 3BB3A 1C7ZA 2PGIA 4UJ3A 3AY0A 1CEYA 2W6OA 4GWGA 1YIAA 1SBNE 1NW3A 1P0PA 2PD3A 2GYUA 2W37A 4B35A 2D8AA 4ZZ3A 3C8MA 3EDRA 4K88A 1ZU4A 5BWCA 2V5VA 3S2EA 1AMOA 4NENA 3PRJA 4YP9A 1P1CA 3Q7SA 3D7RA 1J49A 2QYOA 2O52A 3FKJA 4XQEA 1H2XA 1FP6A 1TTQB 2YV2A 4MRMB 4H9GA 1V9SA 1LTHR 4YUVA 1B8NA 1LFAA 1VYVA 4KZKA 5IXJA 2WG0A 2C7QA 1ZXLA 3PNPA 2VJAA 3ZPXA 4TZ6A 1UJ4A 4WY2A 4ZI5A 5DHRA 1TCUA 4JBYA 1XDZA 2BY4A 1KKMA 3RSSA 2GEBA 3U7QA 1EWTA 3IAAA 5DYTA 1JKJA 2H54A 5AVYA 1OIXA 1NYLA 4CHTA 5ELXA 2GWHA 3KVOA 1U5CA 1K6IA 3D3WA 3FD8A 4G84A 4DDMA 4F84A 5AH0A 2Q6VA 4B6PA 4F6RA 2RK6A 1ZLXA 3DLIA 2D0IA 5HE9A 1OB5A 2R7KA 1BJKA 5JASA 2JH3A 1W5BA 4JWKA 5E7QA 1YDHA 3HKBA 1W2HA 4M7WA 3TLCA 4CKBA 5JZBA 3BRWD 5ENDA 3SQDA 4DLPA 5K03A 3HJGA 3C5WP 2JJ8A 3Q72A 4R41A 5AI5A 1QYVA 5K0CA 5C32A 5MHTA 1J06A 2DR0A 3K05A 3HSKA 2X22A 2VH1A 5HKAA 3FFXA 2B35A 4KE7A 5KKNB 4LC9A 1JIVA 3RR2A 4OO3A 5DIFA 1EJBA 1DS6A 3AILA 2UDPA 1WDMA 1EUCB 3CKMA 3Q10A 4GYJA 3HZOA 2QLMA 4MUGA 4W8GA 3ADPA 3R7LA 3HRKA 2V59A 5IZCC 1MO6A 2BUCA 4CMHA 4GU5A 1C0LA 4I9GA 3QELA 1FB5A 1R6XA 1LQUA 2QRVA 2XUOA 3O0DA 4BFZA 5KTMA 4XTRA 2P62A 3DMTA 3HJAA 4X7PA 2WHRA 3FPHA 3WLLA 2QPLA 1QRRA 3JYPA 1S4MA 2OZEA 4ARSA 1FFEA 1PW7A 4CM8B 1J23A 3RREA 4A8JA 1D7OA 3KETA 1J2TA 1ESDA 4IV8A 4MTCA 4D99A 1M2FA 5D3MB 5GM2A 1KEKA 4Z53A 3SS9X 5AJVB 5IN4A 3HEAA 4UHJA 2O2YA 3LWNA 3OZWA 3H17A 2QU7A 3JRXA 4LK2A 1R6DA 2E18A 5KWIA 1FE8A 2BF7A 2OL4A 3I2JA 3V8VA 2BP7A 5KPJA 2QQ0A 2CE2X 4DR7B 2QZ4A 3U7FB 2I6TA 5HTKA 1YQUA 3EZ2A 4LVOA 3U3MA 4PIVA 4AN0A 2IP1A 5AHOA 4ND1A 1V95A 2ZI5A 3DOEA 2IZ0A 1E1RA 5U4QA 2NZXA 4BTVA 4KJZA 3PC3A 3USZA 2QGNA 3LQ4A 1E5XA 4WECA 2PKEA 2VF8A 3ZHOA 3G8AA 1FP7A 2W6JA 3QLTA 3E6AA 2BH9A 2DWCA 2D3WA 2H7CA 4C30A 3WQHA 1UK6A 2F9LA 4DZTA 4TKVA 5CPBA 3A36A 4RSRA 1Y6JA 1IWOA 2BD0A 1ST2A 2AFRA 2DKOA 1W47A 4E5MA 5AW6A 1D5WA 1EPUA 1EWKA 5K0ZA 2B83A 2Y9MB 2RJ3A 4XQ9A 4XWWA 1THMA 3BFVA 2DWPA 2D1YA 3A4YA 3IAFA 4NEHB 4GSKA 3LQQA 3ZE8A 3ER8A 2P9HA 1GCIA 2H1VA 3BL6A 3BSSA 2GM3A 3OLQA 4MWEA 4P58A 5HOQA 3IHKA 1PVOA 3T9BA 4WEOA 1QMGA 2QN2A 2DLCX 3EAGA 5JR3A 5JECA 1JIKA 1AGRA 2HM7A 2ZVDA 3DE0X 4PGGA 3R0QA 4U8HA 1Q7EA 4CU5A 4DB2A 4YRRA 4OK6A 4RPKA 5JC1A 5EXSA 4IJUA 3C70A 4DCSA 1KFCB 4G97A 2L2QA 4C0HA 4K2AA 2OHOA 4TRRA 3OT1A 3PQ2A 2CFSA 3STVA 3THRA 3ZW9A 1I6WA 2NSLA 4RTMA 1WUHS 4OJNA 1ZNZA 4Q66C 1EZ1A 5AXBA 1TD1A 5AVXA 1XRMA 5GTDA 4HH3C 4DUYB 2Y0EA 3CV3A 4DRZA 5FJIA 4WGGA 1Y3CE 1SUCA 1F1JA 5MGBA 4XDHA 4XM2A 3HB0A 5AKYA 4AG6A 3T7AA 4DMMA 1RXIA 2FSSA 2VYQA 2YIDA 1UKYA 3L6EA 4DEVA 1SK8A 2ENUA 4WCFA 5J2TF 1AO0A 4DG9A 1Z29A 1QX4A 2Y1LA 4N3GA 5AKHA 2AFIE 3CMCO 5ESDA 1GSOA 1O54A 5G53C 3HCOA 5BT9A 4G89A 5F1PA 3ZJ5A 1X77A 3EZ7A 4G0NA 4M49A 4YK7A 3L9XA 4WFQA 4AXBA 2WWFA 2CXUA 3H8SA 4QQFA 2IPNA 2BW0A 1W4CA 3NHWA 4ZC8A 2VRWA 2WWXA 4Y2QA 2WHPA 3OURA 3ANLA 4KQEA 4ZO7A 3VR6A 4UBNA 1OI4A 1BFKA 3A3OA 4G2NA 5DTEA 1O7JA 4NFSA 2ZYSA 3VBEA 2JJ2D 4B3GA 4LXTA 1M2OA 2DLDA 4MWOA 4Z1OA 4OHZA 5A5DA 5EOVA 2R7NA 4UNPA 3GRCA 5K8TA 5IFLA 4PZ0A 3WMFA 4EY3A 4UM8B 1P6QA 1I4TD 3FVRA 1J8DA 1H1LA 3K2BA 1XZIA 2TMDA 4YJKA 3T4XA 4EHAA 5E7JA 3RW9A 1YKGA 3ET5A 2Q62A 4I3GA 4XVHA 3U4DA 3W2TA 3ZCSA 1J8YF 1GEGA 4KO3S 3UPUA 1WZUA 3IMFA 1HYEA 3OEHD 2DPHA 3JWPA 2G07A 4FGLA 4GYYA 4J2TA 3JSAA 4OK3A 3ZYCA 1TCVA 5A2QA 3DYIA 3R4VA 1U3CA 3ZHUA 2WT9A 1GGNA 3I73A 4H1HA 1WP9A 3U37A 4AQYB 2AYXA 4JJZA 1GPMA 1NXOA 1UC9A 1NW5A 4WRRA 3JAMA 1WVIA 1DWQA 1NJ2A 3BMOA 3WJAA 1REQA 4KAFA 1L0BA