1NATA

Crystal structure of spoof from bacillus subtilis
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
119
structure length
119
Chain Sequence
b'NEKILIVDDQYGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SPORULATION RESPONSE REGULATORY PROTEIN
publication title A response regulatory protein with the site of phosphorylation blocked by an arginine interaction: crystal structure of Spo0F from Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Regulatory protein
total genus 40
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 1997-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1natA00
1K68A 3H75A 3JTEA 2HQRA 3I45A 2QSJA 4N41A 4KQ9A 1ZGGA 6ABPA 1WETA 1RZRD 3N6VA 1K66A 2FN9A 2OENG 3QX8A 3HV2A 4KZKA 4YS6A 3EULA 5IULC 5KWSA 3QLUA 4LE0A 2JBAB 4OATA 4OG2A 4O1HA 4LE1A 3LUAA 4YP9A 4Q7EA 1NXVA 5ABPA 2PE5A 1YS6A 2E4VA 3N0RA 3EODA 1T34A 3OM0A 1E2BA 3C6QA 3JPWA 4RXUA 5TQJA 1FQWA 4KK4A 2LIVA 3GV0A 1DRJA 3H5WA 4KQCA 5GOTA 1NXOA 3I42A 2FKAA 3H5TA 2PMCA 2LP4Y 3IP6A 4LDZA 4L4UA 1QPZA 4MR7A 1A04A 2RDMA 4PICA 3T38A 1HEYA 3H6HA 2FMHA 1MIHA 1USIA 6CHYA 2F8TA 1NY5A 2CWDA 3OMWA 2OQRA 2GX6A 2QXYA 1XHFA 3NNSA 4IMJB 7ABPA 2WMYA 4FE7A 4MQFA 2E4YA 4KV7A 4YLEA 3LUGA 1YMVA 2E4WA 2PUEA 4ZPJA 2HSGA 4RKRA 4JAVC 2V0NA 1NXTA 2YHBA 2IOYA 2H0AA 2RGYA 4MRMA 1EWKA 1TM2A 4UHJA 2H3HA 3KSMA 5DCLA 4YCSA 3E3MA 5KQMA 3SQNA 4IRXA 1DBQA 2O20A 3M9WA 2JCGA 2QV0A 2ZAYA 1PHRA 3Q15C 4MGEA 4RK5A 4Z9AA 5JS2A 3DGEC 3KLOA 2CD7A 2FSPA 3IP9A 1F4VA 3FDFA 1QP4A 2IPNA 4G0PA 3O2QB 3OQNA 4RS3A 2N9UA 5IX8A 2CHEA 2WRZA 3C3KA 3FGZA 3IPCA 3QLUC 4RWEA 4D74A 3HJFA 4RU1A 1LJUA 5HM6A 1U0SY 4KNYA 4O5AA 3RVOA 4F06A 2LUOA 3K9CA 4G0YA 4S04A 3EDCA 1NATA 3JY6A 4E7OA 3O21A 3T6KA 4PZ0A 5BRJA 4ETMA 1C4WA 1D2AA 4W5RA 4EGSA 1E6MA 1QNLA 4QICA 1GUDA 5FBHA 4Z4CA 1IIBA 2VYCA 2FMKA 5TE9A 1L5ZA 1DG9A 3D8UA 3N0XA 2IPMA 1JHZA 2AYXA 1PNTA 2P9HA 3HZHA 1KGSA 5BRAA 4YRZA 1FFGA 4FE4A 4Z4GA 2B1JA 4EYOA 5JS1A 4G0ZA 1XWWA 4EUKA 4ZYLA 4RXTA 4RY9A 3HUTA 2M98A 3RQIA 3FFWA 3K4HA 2GBPA 3Q41A 1URPA 3LUHA 2M1ZA 5C5CA 3MYYA 4RK4A 4XFKA 4MLDA 3HEBA 4HNRA 1ZHHA 1ABFA 3GT7A 3RVPA 3LTEA 4MS3A 3H6GA 5KC8A 1GCGA 3NBMA 3IP7A 1ZAYA 4MR9A 2NT4A 1JYFA 2IPAB 2FQYA 3IDOA 3BREA 3Q9SA 1M2FA 4D6YA 1JDNA 1DP4A 3N8IA 3H1EA 4RXMA 3QEKA 3BILA 1D5WA 5DLEA 1Z2EA 3KTOA 3EQZA 3LUJA 2DRIA 4NICA 4Z0NA 1QQAA 3QK7A 5D2CA 2X7XA 4M88A 1BAPA 4OLBA 3TMYA 1Y1LA 3LFTA 1BDHA 3DGFC 1PNRA 2E4ZA 3UUGA 3SM9A 1E6LA 4MS4A 1OXBB 4RV5A 4HYEA 1B00A 3KCNA 3LKBA 1YMUA 1JFSA 1USKA 2NUBA 4JASB 1VPWA 4Y9TA 1U8TA 1LBIA 1MB3A 3LMKA 1PEYA 2PUAA 5EWLA 1MB0A 4JOQA 1JFVA 2GKGA 2J48A 4OBBA 4Z9BA 1EWTA 3GBPA 4CBVA 3HVRA 3CZCA 5CNMA 1M5TA 3OQMA 5JNTA 4MQFB 3HK2A 1ZH2A 1SXGA 1W9HA 4Z99A 2FN8A 3DBIA 5JNRA 2PUBA 3GRCA 2PL1A 2JVJA 1SRRA 3CS3A 1Z12A 2FEWB 3FFTA 3QLVA 4Q6BA 4MRMB 5FWXA 2TMYA 5EWJB 1YTUA 1LBHA 4G86A 4TMYA 3ROFA 4EVSA 1JH9A 3SNKA 4F3TA 4RSMA 1KRWA 4XASA 1U2QA 4NQRA 1U2PA 3EGCA 2HQOA 3C97A 4PYRA 2WWVD 4EYGA 3ILHA 4DQDA 2WY2D 5C5EA 4Z4FA 1AB5A 2FEPA 2AYZA 4MYRA 5CNKA 1JBEA 2IDMA 5T3YA 2WB4A 1USGA 3O1HB 4KMRA 4TLMB 2HJ9A 4Z4EA 4O1IA 2IYNA 3HDVA 4YWHA 3HDGA 5TPZA 3UKJA 2PL9A 4MR8B 3ROTA 2FQXA 1FFSA 4JB0A 4N47A 1KRXA 3I5AA 1ZH4A 5EWJA 1FFWA 2MSKA 3CKMA 4WUTA 2FMFA 2JVIA 3HXMA 2QZJA 3KG2A 1PEAA 2XDYA 3EJWA 5GQSA 1TJYA 5TQ0B 3OLWA 5IBQA 3N53A 1D4ZA 3FFXA 1YS7A 4NV3A 1LJLA 3IPAA 1GCAA 3MA0A 3MF4A 4RK7A 3UK0A 1DC8A 1DZ3A 5PNTA 3QLVC 1EFAA 4XARA 5DGCA 3RVRA 1EHCA 1ISSA 4EVRA 4JP1A 1ZN2A 1AB6A 1FSPA 4D6XA 5JNVA 3S99A 1RNLA 3RH0A 1OXKB 2NZVG 2GWRA 4MS3B 4YGXB 4MR8A 4MR9B 1CEYA 1S8NA 4KRFA 3RVLA 1NXSA 2VK2A 1VRVA 4LRQA 4G0MA 5KQGA 4KFCA 4KVFA 3L49A 3P9YA 5HSGA 5JNSA 5CNJA 3C3MA 3SY8A 3NHMA 5TQ0A 5TPZD 2FEKA 1LK0A 2PUDA 1GLGA 2MYPA 3Q7RA 4KREA 1E6KA 5DTEA 4Z4IA 1QQBA 3H1FA 3QLTA 4MS4B 1P6UA 1EAYA 4F12A 1JLKA 1QO0D 5KQPA 1MVOA 4OLAA 2L18A 3C3WA 3LUCA 3O75A 4EYQA 4G0OA 2RJNA 2LPMA 5HQJA 5EWLB 3JS5A 4N0QA 3VNBA 2FVYA 3SG0A 2NT3A 3M6MD 3KLNA 1M2EA 2RJOA 3F7NA 1DBPA 4GPAA 5IUNC 1DRKA 3O1JC 3TB6A 2MYNA 4RK1A 5TPWA 3H5LA 3LKVA 3OLYA 3DLHA 3F73A 3QELA 4XXHA 1L5YA 3GWGA 5FBKA 5FWXB 1Z25A 3MMNA 1ZESA 2PUGA 1A0OA 2CHFA 2YHAA 4JA2A 5F64A 1DCFA 1PUXA 2P4UA 4WWHA 4NCAA 3O2JA 3O2SB 2IPLA 1NTRA 2QU7A 3N0WA 3H5IA 1ZVVA 1QP0A 1U04A 1Z2DA 4PE5B 3HM9A 2R48A 2LBPA 5DKFA 2WJWA 5BQ3A 2HQBA 1H9CA 2MYTA 2Q5CA 3N75A 3OO1A 3LUFA 1VLZA 2R47A 3RVMA 2A9PA 4P1ZA 4EVQA 5B3JA 1ZY2A 2QR3A 2E4UA 3ILYA 3O74A 1QMPA 3OLXA 3IP5A 2FQWA 1ABEA 2VUHB 3DZDA 4Q6WA 1SXIA 4MAAA 4W5NA 1MAVA 3FMVA 3RVNA 4QPJC 1TLFA 1QKKA 3QX9A 4TLLB 4ETNA 3M9XA 4UHKA 5IEBA 4MS1B 2MSLA 3B2NA 3F6PA 2ID9A 2MYUA 4FB4A 3LOPA 2HPHA 3A3KA 1P6QA 4TN5A 1KMIY 5EWMB 3CLKA 3MM4A 5KQLA 2JRLA 3BRQA 2BGGA 1RPJA 3BRSA 3I09A 2I6FA 3RVKA 1BDIA 4IGAA 2FTKE 5T7BA 1P2FA 3D02A 3GYBA 4ZJPA 4E7PA 1XHEA 1DBWA 4XLTA 1RXEA 3CU5A 1CHNA 1ZGZA 2WJAA 3LUKA 1JL3A 4H3KB 5FWYA 4F8JA 1NXWA 2L17A 3MQ4A 4N03A 2VUIB 4DN6A 2QW1A 3OQOA 4QYMA 3R0JA 1QO0A 1TMYA 4ZMSA 5IEJA 4GNRA 4XAQA 4EYKA 4W5TA 4JB2A 5B3JC 2NZUG 1GUBA 4MQEA 1DJMA 3QEMB 3GBVA 4MS1A 3CFYA 1RXIA 3JPYA 4QYWA 3URMA 1CYEA 1Z17A 5JNUA 5EWMA 3EAFA 1D1QA 4HNQA 2QVCA 3EQ2A 3CHYA 1Z13A 5KC9A 4KPYA 1DCMA 1BDJA 2PJUA 3T8YA 2FXIA 5KI6A 4YR7A 3BBLA 3HO1A 2JK1A 4ML3A 4WXEA 1UDRA 2JBAA 4G0QA 3OM1A 4H60A 2JB9A 2FW0A 1W25A 4MPTA 2A9RA 3Q7SA 4LZLA 4NCBA 1YK0A 3JVIA 3DLBA 4G97A 4LX8A 4YV7A 2MSWA 4Z4HA 5TPWB 3RVSA 1SD5A 4YO7A 2B4AA 4WT7A 2PUCA 1I3CA 2PAFA 3QELB 3SAJA 1QP7A 5BR1A 2PLNA 3KKEA 3L6UA 1A2OA 3QEMA 1YIOA 2FMIA 4L85A 1ISRA 4G0XA 4RK6A 3A0RB 2E4XA 1Z18A 3KYIB 1SXHA 3CTPA 3NNNA 2L19A 2A9QA 3HSYA 3O1IC 5IUKC 4WZZA 3H5VA 4RY8A 3H1GA 3KYJB 1D1PA 3GL9A 3F6CA 3TD9A 5E3JA 4ETIA 1JFTA 4MLCA 4HNSA 3OO0A 4P98A 4IMIB 3RVJA 3CG4A 1JYEA 3TO5A 4W5OA 2KYRA 3A10A 3KS9A 4B09A 1NXXA 3T95A 2FLWA 1NXPA 1P8AA 1F51E 3MIZA 9ABPA 1RZRA 3RVQA 2A9OA 2F8SA 4RY0A 4RK0A 4DADA 3Q7TA 1BA2A 3E61A 2ID7A 3CG0A 1APBA 2R4QA 3OLVA 5TQ2B 3LUDA 5CHYA 4W5QA 2W42A 3JVDA 3CRNA 8ABPA 4IF4A 1JX6A 5I4CA 4N76A 5IC5A 1EWVA 3OMXA 1Z26A 3HCWA 3OLZA 5IUJC 1Z16A 1YVUA 4RDCA 5CNIA 1YK1A 4H3HB 3CZ5A 3TX6A 3VNAA 2L2QA 2GI4A 3NHZA 5JNWA 4LDAA 4KK3A 3CNBA 1R8JA 3H5OA 2FLKA 4PEVA 4WXMA 4IILA 2JVKA 3A0UA 4EY3A 3HS3A 1JDPA 3KHTA 1VKRA 3G1WA 4LE2A 5HKOA 4RZSA 3W9SA 4N0PA 1BVHA 1JWLA 1JF8A 2ZWMA 4RKQA 1Z15A 2IKSA 1ZITA 5FWYB 2PKXA 1M5UA 2R25B 1C0EA 1DCKA 1ZDMA 3HUUA 1J56A 5TQ2A 4S05A 2QVGA 4ZMRA 5ED4A 4MQEB 4OTZA 1DC7A 3KJXA 1TVMA 2PUFA 3NNDA 4MR7B 4F11A 3G85A 3GA5A
chains in the Genus database with same CATH superfamily
4F46A 5EZ6B 1KDPA 3ITEA 1ZGGA 2J0SA 4G8CA 3LIIA 5H83A 1S7CA 3H2IA 3CEAA 1OFUA 4P7FA 3PC4A 4HEA1 2GPAA 5GWXA 3REFA 5EJ5A 1VE5A 1G64A 4OGGA 3DPUA 3E53A 4N7JA 2NU8A 2JNWA 2VPYA 4MW5A 1WS6A 4M0DA 4TSKA 3C7DB 2R8RA 5GMOA 5BMVB 3AVTA 3B1WA 5C1PA 1U1EA 1FMTA 1U0GA 1GTG1 3KJNA 5FJIA 1VYUA 2BI7A 4MVJD 4W1RA 4FOLA 3VDXA 4B73A 2ZQ5A 2P8SA 4GPZA 3UF0A 4Q01A 2BLNA 3CNHA 1B23P 2CNOA 4PPGA 2RDMA 3T38A 4D6PA 2J4DA 2ZW9A 3RUIA 3TDKA 5IJ0B 3CBQA 2Z3VA 1J42A 5DH9A 3I2KA 4RTRA 5KX5A 2Q6KA 1LK7A 3RVBA 5KBYA 2E4YA 1J6UA 3GGDA 2FUCA 3DO6A 3K8QA 3MMZA 4FHEA 5ALVA 2ECQA 3MCVA 2X1LA 1PZFA 1OBCA 1ODKA 2ODEA 4K1XA 4O4LF 4XDHA 4UHJA 4YDHB 4EJMA 1P4HA 2JHAA 3H84A 2JEZA 2ILTA 2NUTA 4ZTUB 3A9SA 4YTEA 5L3ZA 3TKYA 1ZNXA 5E1OA 2V8OA 4BZPA 1NNSA 1WD7A 1T6YA 3NS7A 2ZYSA 4ZQEA 3QTTA 4OHMA 1NJ8A 3WY9A 3GC6A 2NO7A 3KZMA 4LJ5A 3LYUA 2G1PA 1H9BA 2OMEA 5FXMA 1EP1B 4CMBA 3AF6A 2OKCA 4YC7A 2WNHA 4YUZA 2GN8A 4F9EA 1TYZA 1KK1A 3BXEA 3I05A 1XFAA 4JX8A 4F86A 1U8CB 1YZ3A 4BKOA 3HJFA 1ZJZA 5B6PA 4F3YA 3IBYA 3PEUA 4P3OA 5HM6A 1RRFA 1WKVA 4MULA 5LXTF 4MO9A 1JXOA 1E0SA 1J07A 1TU0A 4X24A 4BVFA 1GG5A 1I5EA 2Y2UA 2X8JB 5HOEA 3PC2A 5E4FA 4B9EA 3QTLA 2C29D 1PIWA 1UJ4A 3G59A 4D92A 2DUJA 2NXCA 2OMKA 4EKDA 2NXJA 2QENA 2J6IA 3PGXA 4R0VA 1W75A 5BRJA 4L28A 2D6FA 2W58A 3H7AA 4LMAA 3SYMA 3LX4A 4AY4A 1GUDA 2FQQA 3EK2A 3OQBA 5FBHA 3ZIAA 5G0VA 4I1PA 1LRJA 1YZLA 2XLCA 3KKMA 2AUNA 4RD4A 2WZQA 1ADJA 1PT5A 1SMKA 2ZIVB 5DEOA 1UBHS 1B4DA 1QZUA 1CUAA 1L4YA 1RXUA 1I1NA 1KGSA 1EMDA 2HO4A 3Q9UA 4ZV7A 3AKZA 5ALUA 1RWOA 5ALWA 4RTMA 2FZCA 4ZVKA 4FCCA 3H7IA 4EA8A 1PEKE 2GPSA 1KI6A 1XZIA 1P91A 3OEYA 4ZA2A 2O8FB 4JI5B 4EG6A 4X65B 2NADA 2W4QA 2OCGA 3I76A 4C7OA 4DSOA 3SKYA 2F8MA 1MEOA 4YBZA 4CQLB 1AUQA 1UIRA 5KC8A 3H6GA 5JW6A 3LV8A 2QYOA 4NENA 4ACBA 3AUKA 1JYFA 1CQJA 3OY7A 1X94A 4MVJA 4OFWA 4Y2PA 1F7VA 2GEVA 1FQOA 2AN1A 2WUDA 3ILXA 3NPMA 4RM3A 5LBTA 3H1EA 4LJ9A 4I66A 4I46A 4BU0A 5DHSA 5BV0A 5COBA 2PD6A 3BILA 1P4SA 1D5WA 1DAGA 1XDDA 3QMVA 4KXMA 3FPCA 2WW8A 1EX9A 5AM5A 4MCJA 5SZIA 5BVGA 5CYFA 3DEJA 1SIOA 2PWPA 1RJ9A 2OFXA 2AMYA 1Y3IA 2O2XA 3FWKA 1ZISA 3Q6IA 2VXOA 3LI2A 4ZCSA 4UUBA 5KYXB 1S2MA 1JDVA 1LRKA 1EI9A 2D0OB 5JCOC 4Y2QA 4F2GA 3WHIA 3DKIA 2R65A 1HDGO 3TG2A 1MV8A 3T5BA 3U4GA 2AW3A 2QI9C 2Q2NA 4E32A 3NJ8A 1ND5A 1A4UA 2BBOA 4NOMA 4ZVRA 3FF4A 1CR4A 1H1LB 2BP7A 4ZOAA 5EHQA 3SC2A 3AR4A 5KHAA 1YS9A 3HVRA 1QCDA 3HK2A 3E9CA 4Z7OB 1F0YA 1PNQA 1RJDA 2QGNA 2X19A 1NVAA 1V7ZA 4QHTA 1MRNA 4XUCA 3RWBA 3DDZX 3VC2A 1NBWB 3EQ7A 2JVJA 3WWZA 1U0TA 1IK6A 1XRQA 4HFJA 2I2DA 4QNNA 1EX1A 1LBHA 1ZGJA 3L41A 4BGDA 3RRBA 1JH9A 4KI7A 1CS0A 3DMHA 3K70C 1AKNA 1T91A 3KD3A 3KSUA 4GSYA 3N2KA 4UBJA 4WN3A 1BE0A 5AKXA 4ZALA 3V1TC 3CLTD 3OUUA 4YUXA 3CBGA 4QNMA 3DVRX 4LOAA 3DQPA 4JBWA 5EIXA 2WQ7A 1L3BA 4NV0A 4WMLA 1I0ZA 4Q4DA 5FPYA 5F51A 1E2EA 1LBEA 1U0OC 1U9IA 4DMKA 2ZIUB 2Q49A 1NDQA 4LECA 2WB4A 1C2TA 4KMRA 4UE3S 3M4NA 4HN4B 1XN4A 2P40A 2SICE 3I34X 2DFKB 3KEGA 4US2R 4Z6KA 1R27A 5T4EA 2ZB8A 2HDWA 3NATA 4XGIA 4JP2A 4N47A 2PKCA 2XDAA 2AJBA 4URWR 1D1SA 5K8VA 1QE5A 1T36A 1EVJA 1KYXA 2VTVA 2PWYA 3BSWA 3SK0A 1QCCA 3OX4A 3WJ7A 1XAIA 4YMUA 2QY6A 3BH7A 3LM8A 5AIAA 4BB5A 5HKAA 1TU3A 2Q4OA 4KGZA 4EGAA 1Y89A 4DZTA 1JR6A 4O4LA 4FHCA 1UPCA 1FJXA 4HPWA 4F92B 1NLYA 1Q0TA 1N5MA 1ZVQA 3B1FA 3HRHA 1QFYA 1XAHA 4GUAA 4F96A 3OOWA 1SQ0A 1ZCAA 1LJLA 4WH0A 5G3ZA 4A6DA 3MA0A 2HTEA 3LHIA 1SC4A 3AYZB 3IIKA 4LJSA 2HLNA 3M5DA 1VOTA 4TKMA 2F3RA 1GQRA 4U8GA 3N7TA 2YW9A 2D1QA 1HMPA 4AJKA 3O7MA 4HJXA 3DTVD 5LOVB 5JALA 1I3OA 2KQUA 2VNAA 1KZGB 1AB6A 1XNJA 1YZKA 5ALXA 1PGNA 1JSCA 3WLHA 2HBRA 1PYOA 2C2XA 2W6QA 3DBHB 1RACA 2DPXA 2WT9A 3KPJA 2NU7A 2CVPA 4G41A 5EG5A 4DZRA 4Z7QB 5BSGA 2DEUA 4G0NA 2O48X 4RELA 1GITA 4H77A 2C1ZA 2GN4A 2QT0A 3HVJA 3QOWA 5DBHX 4RE6A 2VPTA 3SJBA 3NAGA 1HEUA 2H1RA 3GQBA 4I7EA 2OVFA 2IITA 1G63A 4PO8A 4V2UA 1W4ZA 5E1MA 5EP4A 5K51A 4D4MA 3OZWA 1Q1BA 4M1ZA 2XEDA 1FDTA 3ORRA 5FIUA 4ZHQF 3TUZC 3ELWA 1NASA 4HNAA 3SY8A 1E1RD 4DV7B 2WSMA 1EFCA 4M9ZA 5P21A 5KYYA 1UOEA 2D5IA 3RRNA 4E13A 1BNCA 1ZOPA 3BD9A 4A26A 4ESEA 3QXGA 4QE3A 1FVXA 2WIDA 2ZE6A 1KVTA 1OYVA 4OHVA 3W8RA 5MF6A 1CJMA 3N76A 4OK5A 1NG9A 5KQPA 1U8YA 4P84A 4DBVO 2DKNA 2OC9A 3K7EA 3TBFA 2ZJ8A 4PCVA 4Q9JA 3RS9A 1US8B 3IS3A 1U11A 1IUNA 1FFAA 4FBMA 1NVGA 4WCFB 4ADSG 1W4AA 1TJNA 2OSVA 2QAIA 3G2IA 3SG0A 1KMNA 3T9FA 5KDDA 4MGHA 2IZZA 2J3HA 3LE8A 1OXXK 1T5LA 4D98A 1X13A 1NKTA 4DE5A 3NDBB 3QX3A 3MAGA 4GMKA 1YZNA 4JD5A 2JI6A 4EHAA 1NC1A 2WIKA 4MW9A 1X7WA 1T5IA 3QELA 1K5HA 1E4OA 1PJ4A 3WKAA 3VYRB 4FMCF 4L50A 1IFXA 3AJAA 4RMIA 3WYGA 2VPQA 2HPAA 5KCMA 1F6WA 3AF2A 3WGMA 5CXUA 2QZ9A 1BG6A 1ICIA 2VH1A 5BQFA 1Y1QA 1N8NA 4ECEA 5L45A 1T1JA 2V7XA 1NNLA 3AM4A 3ZD8A 5BNZA 3BJEA 4BPRA 3KJFA 1V9SA 2FUEA 1QRSA 1EU1A 1I7PA 2A14A 3MJVA 5D3KA 4ARZA 2V9PA 2CJYA 1SVMA 1XZDA 3RVMA 1ZOLA 4DDHA 2W2PA 1MOPA 3OPMA 2VJMB 3BYZA 1Q1AA 1VI5A 3SKVA 3TRFA 3MINA 2A67A 4KFUA 4D9CA 1E3WB 3CSUA 1M7GA 4TRNA 3K2IA 3A1DA 2NPOA 4BWFB 3T7CA 4RPJA 4P3KA 1IWOA 1YUMA 1WZCA 2X0NA 3HCFA 1VGQA 4GECA 1PZEA 3ZWMA 1N0UA 4CG0A 3ZIUA 3KQTA 4PZAA 5COAA 3NQ41 5B2ZA 1TJPB 5NULA 4B3CA 1PX0A 1TFRA 3ZHVA 2WHRA 5CAEA 1YZFA 1K1EA 3BA6A 3L82B 4NCIA 4BN0A 4OAQA 4RF2A 4WK4B 5F33A 2ZE5A 4NBTA 4QVGA 5THKA 2HIAA 4Q7QA 1AO3A 2ODAA 5SYAA 1GZUA 1XALA 4F2DA 4G63A 4GYYA 1KEVA 5EEHA 4GHWA 3QKRA 1SKUA 5KQLA 5KSYA 1IQUA 4P6VF 3UVEA 3S68A 2XWJI 4BFUA 3E9QA 1ENPA 3H65A 1AX9A 2SKCA 4G4IA 1JHYA 3DD5A 3G6KA 4IJWA 5T7BA 1E1RA 3SZLA 2C97A 5JEEA 1VSTA 5K8TA 4IGKA 3ZD7A 3AUYA 2P6PA 3I9NA 1M76A 3LUKA 1JJIA 1V2GA 1Z2PX 3O83A 3QKTA 2FPPB 4TV9F 3EY4A 4B8WA 4TV8B 5BWCA 1E1DA 2O8BA 5KWEA 1P1FA 2BMAA 1W30A 1E5TA 1T2FA 2C57A 2X22A 1U9JA 1THGA 4WBSA 1DQYA 4XPIA 4QTYA 2Y1KA 1GGEA 2VF5X 4UM9D 1JSZA 1G7CA 4CUZA 2ZJ6A 4CQMB 5B6IA 2UUPA 5CP8A 4I4TB 2H4YA 1TTTA 2DG2A 5BP7A 1P8JA 4UHFA 1ZRNA 5TEVA 3TINA 4JUAA 2PIDA 3TTVA 1Z13A 4QUEA 5IDXA 1YFZA 3EGIA 1K5PA 4IV0A 2IYPA 3QKSB 1T8RA 2OD2A 3I2FA 5IKXA 1WTAA 3Q10A 4E11A 2Z04A 5GTDA 2VK1A 4AQYB 2XYHA 1G8YA 4FM9A 5EJEA 2BLLA 4HDKB 5GIOE 3ID6C 4URFA 2C2OA 1H8ED 4G5XA 9LDTA 4IX1A 4WLOA 4C4ZA 5CT6A 2BZSA 4BN5A 3FA2A 1BOFA 1MHPA 3DAFA 3JVIA 3O5AA 3TGPA 4NCBA 1T3GA 4JQCA 2Y93A 3BFJA 4UVEA 1RYYA 3ZTWA 4GLBA 5G0UA 5LQUA 1W6RA 2A0XA 4KE8A 4UXHA 1F2TB 1V9LA 3AX6A 1A96A 4MUHA 2C88A 1U81A 3TOSA 1WZ2A 2ZSIA 4DG9A 1O2DA 1JEDA 2VHCA 3SS7X 4MW1A 1RHJA 3NTLA 3Q8MA 5H1YA 4U0KA 4K6CA 3KB6A 4BVAA 4HAWA 2GETA 4I6EA 5GINE 1VBNA 5KYGA 4ZHQA 5IDYA 4MKXA 3OEWA 2OG2A 1LLUA 1W581 2PFSA 3AR2A 3ITDA 4PYQA 4X92A 4O33A 5IUKC 2VJAA 3H83A 3INGA 2JD0A 3DLPX 5K8LA 2GKSA 5IFLA 4ZT5A 3IEPA 1Q57A 4BNLA 3JQAD 1D4AA 1KI1A 3CNNA 3B9RA 4E88A 2QX7A 1NQAO 5BNWA 5FFNA 1FZQA 1XDWA 2G71A 2A0KA 5GOZA 1XMJA 2PO5A 3KOUA 1XU4A 2I78A 5K3CA 4JP3A 2F8SA 1ZL0A 1YA8A 1BA2A 2CFSA 2O0KA 1WABA 2ID7A 2XUOA 1VKNA 4DBZA 3BMNB 2ZRBA 3T5PA 4JCCA 1KI7A 3M49A 2DWCA 2W42A 2IYTA 5F2NA 2G0TA 1DKPA 1E0DA 1VE7A 4WA8A 1PP4A 4LNHA 5D3MA 5IC5A 1GYRA 4URZR 3PLAE 4TWIA 4AKHA 3HVIA 3CIOA 4J0QA 4RIIA 3NHZA 5TC4A 2Q4TA 2G28A 5AW8A 3GFTA 3KKOA 3M8KA 2DT8A 3VPDA 4HSEA 5CA0B 1HNXB 3TVYA 1U94A 1NY6A 3KSAC 4QFBA 2I62A 5EXPA 2D62A 1UOQA 1IZYA 3QBTA 4M1OA 5EKTA 1I1QB 1XTUA 2JIPA 4AZ3B 2IC5A 3CO5A 5BW8A 1N5JA 1Q84A 4KYIB 4RKQA 4ZQIA 1H0RA 4DIFA 4N65A 1CDOA 2SHKA 4F38A 4UM5A 4IUBS 3SHFA 2LE0A 3EZNA 1BS1A 1ULHA 1Y7IA 1YAHA 3FG9A 4EHBA 2V7WA 2ZIZA 1R3UA 1HZZC 1V71A 2EL9A 2OORA 2P7IA 3IVCA 1XZMA 3QYJA 4KIWA 1H8EA 3DT6A 3MIIA 3BIXA 3T35A 3TR0A 2GJAA 2K6GA 4BQNA 2PUFA 4QLAA 1LW7A 3EMBA 4JMPA 4QJBA 5A5VA 1MQ9A 2OHOA 4GU5A 2G5PA 1XDSA 2HDHA 4B7XA 2HMYB 1WL8A 2HI0A 3LLVA 3WRYA 3PFHA 5CVVA 2IPOA 1F38A 1SC1A 4Q7KA 4UBIA 2FPGB 1ZMXA 2ONCA 3HV2A 4CL0A 3KLBA 4NE2A 1Z6AA 5AYVA 1M83A 3Q6NA 3RYTC 1JAIA 2RIRA 3L7LA 1SCUB 1Z0KA 5D01A 3VNUA 4LE1A 1D0IA 3DLCA 3K5PA 4I9HA 3FTCA 3ZJVA 1PR5A 2ZP1A 3D3JA 1Y4SA 3L40A 3MGBA 3WWCA 2FW8A 3ZJ4A 1R5OA 4B3RB 1RXVA 4QTZA 1DELA 2QUZA 2E6KA 1ZJWA 4G85A 4P3YA 4XTRA 5FUQA 4D0GA 4KQCA 3EARA 3NOVA 3WK4A 4LF6B 3RAEC 4E1VA 4FFNA 4FK8A 3JQAA 4TV9A 4X3OA 4E2WA 4E6EA 4ND4A 2AH5A 5FOXA 4J0JA 4R2MA 4XZ3A 2FP4A 2UZ1A 1NVMB 1PK9A 1HDEA 1ORHA 1Z36A 5A04A 3IMFA 4CKWB 4M55A 2EFHB 3EGOA 1NUSA 3I2IA 1S2IA 4MQFA 4YLEA 1GZ4A 2IVZA 3M1IA 5GVRA 4YPFA 4RBNA 3LC2O 3ZHOA 3SVTA 1M34A 3O3NB 4OXIA 4EHJA 2LR0A 2PUEA 2YY7A 3ESZA 2O05A 1I3KA 1ST2A 4FFLA 1NXTA 1VCMA 3H3FA 1PBNA 1LGYA 1CY7A 3G9QA 3CVOA 3OUZA 3PQDA 3SQOA 3NALA 1LQUA 3U7GA 3WLMA 1CG6A 1BXRA 1MJHA 4PX3A 2GVNA 4OFXA 2XMZA 1DBQA 4JXXA 4HLUC 5JS2A 3TZHA 1A1SA 1S6YA 4FNAA 3U4QA 5ITZA 4NG4A 3BE4A 3BIFA 3E0XA 3QVGA 1WXHA 3HN7A 3UEOA 1FMCA 1VL6A 3BJRA 3E05A 1A72A 3C6ZA 4RWEA 3WDLA 1XLUA 3QJ5A 4QO8A 1MRZA 2HLPA 1A8HA 3WAKA 1YU6A 5AHWA 4P58A 4DEYA 4YIHA 4Z53A 3OF5A 4MZDA 2BDTA 4S2UA 1KQGA 4KIFA 1BHQ1 3WBKA 3WLQA 4HLCA 1ESZA 4PC2A 4NVRA 5AKIA 1QGAA 9MHTA 1DXYA 3MRVA 2QD1A 2H2DA 3KM0A 3O21A 2OGTA 2QLJA 1R3DA 4FYMA 4K5QA 1Q44A 1NRJB 4ARVA 6Q21A 5IDQA 1JHAA 3ACCA 3UUEA 2NP7A 3BM5A 1QNLA 1YCGA 4H7PA 4MH0R 3SF8A 2CNLA 2BTQA 2D4AA 3I9FA 2JAXA 3KAPA 2BGIA 3LT4A 4L1KA 4TKLA 2IHTA 4MWOA 3O2NA 2DFVA 3DMDA 1H6BA 4WL0A 3VPFA 1M75A 3TQSA 3QIAA 4B6EA 5JSYA 5IJ9A 1GO2A 2Y1CA 4F1WA 1QANA 4WDQA 1CW2B 1YSCA 4QUBA 1NBIA 4UXJA 4EABA 4MA5A 4FEGA 2UUCB 4OXNA 4INPA 1F2UB 1DAPA 4GKAA 3EMKA 3OJOA 3LY8A 4TXLA 2ANCA 3FYTA 2JCVA 1T2VA 5ULLA 2AEMA 4JJGA 3TKAA 5CDUA 4HRYA 1W85B 3HEBA 4LYAA 1QYIA 3F78A 1NPYA 4Q4JA 1E3EA 4CE6A 2A7XA 3T1YB 3QVSA 3TCKA 1R8SA 2C3OA 3K2BA 2DP4E 2YS6A 4URYR 3HMKA 1YB5A 3PXEA 4C0KA 2SBTA 2W0SA 3N8IA 4XM0A 1L1QA 5C35A 1CQIB 3BWDD 4IIJF 5BXQC 3TAXA 1W47A 2GESA 4JVNA 3QUSA 2Q28A 4RV4A 1KVUA 5LQRA 3UAOA 1LFDB 5G1NA 3URKA 3AGQA 1ZIPA 4RVCA 2VDVE 2VNIA 4BQOA 1M6VA 1BDHA 4H1VA 2AFIB 3O4IA 3N7AA 5E6UB 3WDSA 1HM5A 3DOOA 1UP6A 1BEUB 2A6PA 2JFYA 2YR0A 2O3UA 4L8YA 2GO7A 4U63A 3VNQA 1YDWA 3GH1A 4KKVA 2J1LA 3UXEA 3C98A 3G49A 1CE8A 4MV0A 3SEZA 3B9QA 4MVJM 1QV7A 1CVLA 1PEYA 2V7PA 3PQCA 3MJCA 1L7RA 3ZCPA 3A8TA 4EH1A 1P0IA 3UC9A 1YXMA 4IH9A 5B4VA 2P6RA 1PT7A 2XPCA 3BGSA 1SXGA 2WDPA 3HWRA 3GWZA 1VJDA 2ZB3A 3IAS6 1U98A 1G4UR 2J0VA 2VL7A 4H6XA 1YB4A 3FFTA 3VU3A 1Z12A 4C7BA 3INRA 3W6UA 4MAMA 4MRMB 2TMYA 4O3FA 3RUEA 5CB4F 3ENQA 1KJJA 4A91A 2JASA 3ROFA 2P2ZA 3RSLA 1GQSA 1TIPA 3JD3A 4JFAA 3WYAA 1MABB 4K9SA 4WSOA 2E21A 1XNQB 1EINA 3V5NA 1TVCA 2Q4BA 3KK0A 4LN1A 4OJNA 3C1OA 4YHHB 2CV0A 4PZZA 2FX3A 5AHOA 1HRKA 1E4EA 3C97A 3CINA 2QA5A 2W37A 3H1PA 3MT0A 3PIRA 3PFGA 1D3AA 2H7XA 5EE5B 3ORSA 1A9XB 1AUPA 1NM5A 2XUPA 4ZAVA 5TSDA 4II7A 5KTMA 5H8WA 3AVYA 3JARB 4R68A 3BJIC 3GNSA 2JFXA 3UAVA 4CV3A 1E8NA 2I29A 1QWOA 3C3EA 4EGFA 5EUCA 3PEYA 4UDNA 5IF3A 4FYYA 2BBWA 4FGSA 4YWHA 3K05A 1RWWA 3UKDA 4Z3KA 2BFAA 2QAGA 1HDYA 5KMGB 1F8GA 2CFTA 3HQ4O 1KRXA 3EQ6A 1UBFA 1XD2A 2J59A 2FWAA 5HFNA 1HE4A 3EVFA 3ZZUA 5JAZA 4DNQA 2J4CA 2JFOA 3RSZA 1BKSB 2XQKA 1OQAA 1OX4B 4Y7DA 1XTIA 2EX1A 4DB2A 1G8FA 1IZ7A 3BKXA 3UO8B 3IALA 2D00A 4RHTA 5TQ0B 3IAM6 4EEZA 4IMRA 3FFXA 3IJPA 3ZW7A 3HGMA 2XMRA 2XV1A 3EGDB 3K9QO 4GE0A 1DZ3A 4S24A 3EOBI 4MP8A 2Z83A 1L0BA 3KYDB 3O8LA 3LX6A 1ISSA 2WJ4A 3KSDO 5HS4A 2O3SA 3TM5A 2GK7A 5CJJA 4IHAA 2D1RA 1GZ6A 2D8MA 1QTQA 2B94A 5IVDA 3AFOA 2O7RA 4WLNA 1JW9B 1U3UA 2ZR7A 3SJAA 3RBVA 4DUZB 4LNUA 2CXOA 4YRMA 4FT2A 3RR2A 5FI0B 2VPXA 1DO2A 3UJDA 3QEJA 3RVLA 4D0SA 3H9CA 3AH8A 5EXEA 3V7YA 5ARBA 4EVIA 2A9VA 4RWZA 1DLJA 4KVFA 4QAQA 5K0NA 4KR2A 2BFDB 4I9NA 4QU9A 3UG6A 2CDBA 3OFVA 5HIAA 2YIDA 1ZSNA 3O84A 4R2JA 1BDMA 4B84A 4LOKA 5A71A 5HIMA 3BB4A 3NBQA 4E5SA 4U3JB 2G40A 2VSQA 3OIUA 1E6KA 1FDSA 3L4EA 4HWTA 5KOYA 3P7MA 1LBSA 3ABZA 2GD6A 2A35A 2BDUA 2Q2OA 2PGJA 4XQEA 1JVBA 2VJBA 1VCIA 2C3MA 3FDZA 3ODPA 3C3WA 4WZBA 4OI0A 2HGZA 2O54A 4EYQA 3W6OA 5FYDA 4NMMA 1H2BA 2YICA 521PA 1RQXA 1X1RA 4RF4A 3P2OA 4OSOA 4YI5A 3ZLUA 1A9ZA 3F5FA 2I33A 2C96A 2FVYA 3BAFA 3JVVA 4HY3A 4TWAA 3DZHA 5C8YB 3G0DA 5I4BA 1D6JA 1A2KC 3U17A 3TGLA 2GARA 1DRKA 4DCNA 3ZGNA 1GV0A 2IA5A 2VRNA 2J3MA 1O08A 3MELA 2NTEA 2VYFA 1XZGA 5HFAA 3BN3A 4IIGA 3VU9A 4CLOB 4D4GA 3VRHA 3MMNA 3JRWA 1RLOA 5GZ1A 2CZCA 1DXQA 2CNWD 2WU4A 1RPZA 2VF8A 3PE3A 3AMVA 1IEQA 2H4WA 1PUXA 2YOGA 3B7GA 4IIJA 4LY3A 5EJIA 4C3OB 4PONA 4YJHA 3O2JA 3O2SB 3VZBA 3G79A 4R1MA 2ZAOA 5AVKA 3VPCA 1G2OA 4J4BA 1ZGBA 1VJ1A 3DBRA 1JVSA 1E2PA 2QL5A 4NBSA 3OWXA 4YRGA 3HNOA 5TGDA 1H9CA 3QSYA 4QULA 1TECE 5IH7A 3EPKA 1K08A 2MINA 5DOVA 1L4BA 7YASA 3UAXA 5F12A 1JS1X 2BGJA 2E7ZA 3AB3A 4WOKA 2I2CA 2Z6QA 2II6A 3C85A 5AR1A 3DEHA 2FOLA 2VJQA 3FKQA 5DK6A 3VZRA 1S0UA 2FQ1A 1II0A 1TIKA 2QAJA 4REMA 4DQVA 1G38A 3FMVA 1BX1A 1LSSA 3DWIA 1Z45A 3W9UA 3W3AD 2C5HA 4R5HA 3BSYA 5GJWC 1P5ZB 3T4EA 5IYZF 4Y9SA 1KH1A 1YI0A 5BWMA 4AZ0A 1B6RA 4FGWA 2P1ZA 2OV1A 2C8KA 2WFLA 3B2QA 3MCUA 3O8QA 4GGMX 4D8VA 5KNBD 1Z37A 1IBLB 1EWYA 3F5MA 3WYFA 3NBUA 4ZU6X 3CJTA 3L02A 4CM8B 2FE4A 2Z5VA 1WSDA 2JLQA 4OM8A 1B7GO 1O95D 4C6TA 1WXDA 1ZK0A 3MM4A 1BC5A 2X5NA 1N25A 3KL4A 4P9NA 2FRXA 5JRZA 1YZTA 4CMJA 7MHTA 1ZA2A 2IFTA 4I5GA 1Z2OX 2I6FA 5CVEA 5C3MA 1REQB 3Q1KA 5MFPA 1RRKA 2YCBA 1NTOA 2IYSA 2FW1A 2FTKE 3TKLA 4AY3A 1U2DC 2EV9A 4LYFA 4YJ3F 4Y7CA 4CXMA 2POCA 3T1QA 3P20A 4LXIA 4IGFA 1OR8A 2QTVB 4J7AA 4UHCA 3GHYA 2L17A 1FDOA 1RLIA 2R6FA 4EWLA 4AP9A 1MGPA 1OI4A 3GQVA 1QOPB 1S3SA 1X38A 3EIXA 4WQMA 4FMBB 4DCUA 4DLPA 1TMYA 1FUIA 4FLMA 3VKWA 5HUHA 1PFUA 2QN8A 2ZI3A 1E7SA 2ZTSA 4L4YA 5LZ8A 1R4NB 3X1XA 4MQEA 3L1UA 3TOXA 5AOCA 2WSIA 1WP9A 4RORA 5DV9A 5FV7A 3IBFA 4B81A 4LYYA 4V3BA 4ER3A 3AP1A 1SXJB 1L3CA 4IKEA 3NTXA 4Q9AA 5E9JA 1XTTA 1J09A 2XRYA 2FY8A 2Y9MB 5B57C 3M33A 4RA9A 3OA2A 5D5PA 1VB5A 1J00A 5KI6A 4PN3A 2BSAA 1C1DA 4URXR 3AETB 5E7IA 3WLRA 5DP2A 2Y1LA 3TAHA 3ADBA 1Y42X 2GO1A 4XYMA 5ESXA 1TVKA 5KHLB 1N36B 1OBHA 1O4VA 2WOOA 1H22A 3F67A 4RJ2A 3MQ2A 4HH1A 3MJHA 5HK9A 5GVSA 3ZE8A 5IU6A 2H7YA 4IUDS 1JEQA 4V0ME 2QKYA 3MERA 4KL8S 4OQXA 4Z4HA 1Z83A 1K7XB 1AS0A 1WVGA 1P9NA 4HWPA 1T9DA 3L6UA 1OH8A 1HLDA 2E2WA 3IOBA 3Q3IA 4L85A 1SIWA 5ICGA 4IM7A 4C4PA 2Y0DA 4G0VA 1VXRA 3ZV3A 2AK3A 1AKWA 4JXKA 4NJEA 2FRDA 2F43A 3KXLA 1JAZA 2YC4C 3O73A 2DULA 3FAKA 4Q3BA 2ZS9A 3KCQA 1WMEA 2QK4A 4G01B 2AL7A 5EC8A 2IJGX 5HCIA 4ZYVA 2DPGA 4KVZA 2OLJA 5L3RA 4RTPA 2XDQB 1TDJA 3PITA 5EEGA 3PK0A 3TL2A 3RUAA 3VU1A 2YBEA 5ELLA 1CUCA 4KPGA 4TTAA 2G9ZA 1X7XA 3GEIA 1JHVA 1UJ6A 1JR4A 3E1KA 1O97D 1WMSA 1WKBA 2B8TA 2VJOA 3NUGA 2SKEA 5DP1A 5KNBA 4KVGA 1GUYA 3MG9A 1JLMA 1XPOA 4RFLA 5D87A 5I8WA 2MR5A 1NXPA 3OETA 2RGRA 2Z1MA 2XAUA 2JZOA 1O95A 2PBFA 3ENZA 4ILKA 5AM3A 3E22B 1TTQB 1E96A 1XQ9A 4AZTA 1TQ6A 2REOA 3V6LA 2DCUA 3DZFA 3OLVA 3SC3A 4YV0A 1KZ4A 3UWPA 1APBA 5FTLA 1NQVA 5ETJA 5LUAA 5IBPA 1P44A 2Y71A 1VKHA 4P32A 1F5NA 2P2NA 1YH3A 2F4VB 5IUJC 1FS6A 1RPAA 1JZSA 1KQOA 3GNLA 3P5SA 3WGLA 5K45A 4LQLA 4Z8XA 4ODIA 1Z82A 2FX2A 3NJRA 4JEUA 3W4JA 1F9EA 1PJ8A 3EXEA 1QV6A 1Z4OA 1B0AA 2OCYC 4EHFA 4BHTA 1QTIA 3V6MA 3GVXA 5AKEA 5AJYA 1AHPA 1D4OA 2I71A 4Z49A 1YULA 5DXAA 5CDTA 4C2UA 2H1VA 3L7BA 1P7ZA 2Y6UA 4F04A 3LQKA 5KNCD 4BYMA 3CF0A 3HKBA 1JF8A 3P9QA 4JI1B 4DM7A 4FZJA 1A76A 3A28A 1BJKA 4KIJA 3RKSA 3DHYA 2UV8A 1LV8A 1O0SA 4R2XA 5CYGA 2ONYA 2XX3A 2OAQ1 2ZUBA 1HURA 1XRSB 3OC6A 3QPAA 1K06A 3R6TA 4J9UE 2OTCA 5FHQA 5JMWA 3WA7A 2E55A 8MHTA 4YT5A 5M2QA 2VPWA 4PVDA 3WIEA 2V98A 4MWTA 4KIUA 1N8KA 2HRCA 3DR5A 4C0XA 1V25A 3WZ2A 4ZOQI 3SIRA 4R71A 2B21A 5IYZA 2H1OA 4ZD6A 3I45A 4PC6A 3UJ9A 3B2EA 4K9NA 4ZP1A 3L6RA 5LYJB 3IR6A 4DIDA 3LHSA 3ESDA 3Q87B 3N6VA 4OP2A 2I2WA 1NLZA 3E7WA 3WXBA 3COJA 2QU8A 1Z5GA 3INNA 3PKJA 3EULA 1YF3A 1ZUWA 1H66A 2ZBFA 1RBQA 4ZREA 3D3WA 5J47A 4Y1RB 1XXHE 3Q98A 1SHZA 1AQIA 3IE1A 1QGOA 2J0QA 5FPKA 3IBGA 2IODA 2QB5A 3ADKA 1F1BA 3VHXA 3PDCA 2ILVA 1N1DA 1JQDA 1ZXXA 1FQWA 4MWZA 3BGWA 3ABQB 3PUZA 2LIVA 1QRRA 1DRJA 4YJ3A 5GOTA 5JZOA 1PGPA 2Z5LA 3JASA 3IUNA 4JN6B 2WWGA 2WYOA 2ZRLA 3JZDA 2FSVC 3P45A 4LJYA 4CTMA 3SQXA 2LP4Y 5F77A 1K7EB 2WBLC 3U4AA 1A04A 4PICA 1QPZA 1P5HA 4O4IA 5DM0A 3I52A 5JSZB 5LKAA 5KVQA 1H3NA 4H9GA 2D1SA 1TUGA 1ZGAA 4OYHA 1Q12A 1YA4A 5GONA 4AX8A 2E1PA 3UXHA 3Q3HA 4I8DA 1A9TA 3K16A 4KP7A 1WQ3A 3S2FA 5B7GA 3VI3B 1RD4A 1J8VA 2F2TA 2DQ4A 1TM2A 3DUFB 3IOMA 4FINA 3ANTA 4LRTB 5BOSA 4LF4B 4GS5A 4J6FA 4JK3A 2H3HA 1EJ2A 5DCLA 2X15A 4BO5A 1Y9EA 4CL8A 2O20A 4RK5A 3PNYA 3RU3A 1RKXA 4E4YA 3IO5A 5KOHB 2DHRA 1W5FA 1ZM3A 2IYYA 1FTWA 1ZIXA 3HB1A 1J97A 1EJ0A 3H42B 4RCYA 4AS2A 5L95A 2UYYA 3JQ7A 3NH6A 4KMSA 1SEPA 4IEFB 2IUFA 1KYYA 2ZRMA 1QRAA 4LC0A 4R31A 2ZPAA 1ZHFA 3PNSA 1RC1A 4DKXA 5KNCA 4DBLC 4HRXA 3GA0A 2IY7A 4LXYA 4NX2A 1WV0A 3ZG6A 4R81A 3U39A 3FHJA 2ZYHA 4GH5A 2X14A 1TC1A 3OTOB 3KU4A 5GV8A 2JHPA 3VR4A 4C0JA 1HBJA 1YJQA 3GLVA 4GP6A 5K3FA 1N32B 3KJEA 5CEJA 2BDEA 3KO8A 5H3CA 4QU5A 1L7QA 5BV8A 1LPPA 1JIXA 4PNHA 4Z4CA 4GX5A 3H3XA 5EJMA 2WHPB 1KEUA 2KI5A 2ZXFA 3CSDA 5HDQA 1P7PA 3TSOA 3LLSA 2AT1A 3RHTA 3RJ9A 2Q27A 4TVKA 1TF5A 1M1XB 2P9HA 3GRRA 3LXXA 1HLFA 3P27A 3IKLA 2IOFK 5C18A 3UB3A 2Q0XA 4MCAA 3BEDA 5KYTA 3T9AA 5HCNA 1ACMA 3HUTA 4QSMA 3WICA 3BCRA 4KTTE 2CLMB 2J08A 2G3YA 2I8AA 4O4JF 2PCLA 3CNOA 2IOFA 4XFKA 5E6RA 2HCTA 1FX0A 2TECE 2MT9A 4DV0B 1N2SA 1TT5A 2A0UA 1IJBA 4TT3D 1XVAA 5H4HA 5BSWA 4MS3A 3FCUB 3TZ6A 2K2QB 1BJTA 3UMRA 4Q7MB 2G83A 3LC7O 3T06B 4FQ8A 3GVHA 5TX7A 3T3OA 1I4WA 3JQFA 4TUYF 1XRLA 3TDMA 2B1RA 4MEAA 1ENZA 3I0NA 3I9OA 2P9BA 2M6SA 3PENA 5EGSA 3CR8A 4QEDA 4D99A 4DTIA 4DUYB 4ZAXA 2AZDA 3BTUA 3WYDA 2RAVA 3NHKA 4ZAYA 3ZGXA 2NVUB 1W5EA 2XCUA 2V3VA 3TMYA 1Y1LA 2O3TA 2GCNA 2SKDA 4BNNA 5K0ZA 1BKYA 4M0EA 4EK9A 2QLFA 1PNRA 1E7RA 2P4SA 4L4SA 1PWXA 2X42A 1XD8A 3K5WA 4KPUB 4PFQA 4PRLA 5EUMA 4YXWA 3DW3X 3FI0A 4XD7A 3ETHA 1JFSA 5JQGB 2AX4A 5SZKB 3IMEA 1W46A 5AW4A 4Q9LA 3VYVA 3VPSA 1GEGA 1W88A 5LDGA 1XDBA 3ROXA 5GONB 1B3BA 4U5QA 5CGZA 4ROTA 1RAGA 3UENA 4DLLA 2F48A 1R9GA 1W4CA 5JNTA 1ISGA 2ZRAA 3EIQA 1PUJA 4HDAA 1RVDA 4WBNA 4BGIA 1MT3A 1YS4A 2VF7A 1WZUA 3CS3A 3QLVA 4LVNA 5U9CA 2VHJA 2DPMA 1QGUA 1RQ2A 4HQKA 2IYUA 3GZNA 1WPRA 4IVNA 4M37A 2XCIA 1KHTA 4D9BA 4RJLA 4XIFA 5DASA 3P8ZA 4F3TA 1MG5A 4FFOA 4CKCB 2O5CA 1SKBA 3ZBQA 3IFSA 1EE2A 2P8JA 2R1ZA 3F6YA 3FKJA 4ALIA 5FWDA 2EFCB 5TS3A 3V32A 1D04A 3E9DA 5CX1B 2WWVD 4XWAA 4QOEA 3V97A 4LJ7A 3VA7A 5FOVA 2NOAA 3UW1A 1U5AA 3O7WA 3PDJA 5ALFA 3MCZA 4BATA 1AGNA 2IHKA 2JAUA 4AG6A 1YRBA 2R97A 4QDXA 1ORDA 3CWZA 3B5JA 4KC0A 1A88A 4FFSA 4N6OA 1M8PA 1SOWA 1XVIA 2WU3A 4XWOA 1VP9A 4IDQA 3KQYA 1KI2A 1CQPA 3H16A 2VBIA 2CHQA 4QBTA 4QGGA 1U3WA 2FQXA 3UG7A 5IKEA 5JYCA 2DFNA 3C3XA 3U7QB 1NN5A 4R1TA 1FSSA 1JG6A 3BWEA 5ERGB 1FFWA 1PS0A 2PRJA 3UCXA 4AJEA 3DQQA 3Q2KA 1VJTA 4AP5A 5HDBB 4DANA 4X6LA 1D03A 4IDNA 3T41A 4EHDA 4EG1A 1OLUA 3FPFA 3I6MA 3HA2A 3JD2A 2BAGA 2Q2QA 1VE3A 2WJIA 3BHIA 3CLRC 1IE3A 1M3SA 4TT3A 5KTTA 5LIRA 2Z57A 5GQSA 2B61A 4HB4A 4RTQA 1NBMD 1WUYA 2GPWA 4L5BA 1Z28A 1EDZA 1HORA 1V0JA 1PNVA 1XCBA 1NVUQ 2C4MA 2ZJ7A 4RK7A 5PNTA 1TXGA 3NO4A 3NC4A 3PTLA 2CHVA 4B87A 3BICA 2PX4A 4DQLA 1R0ZA 4JVLA 5B55A 2ZTUA 3HXOA 3NGMA 1QTNA 3V2HA 2NG1A 2NXEA 5CA1B 4AYXA 5I6DA 3WQSB 3NYIA 5D7NA 5I9MA 3ZCRA 2BONA 1U7ZA 3S1AB 3SZMA 1CZNA 1ZWKA 1D0SA 1T3SA 1UZLA 2QG9A 3PPWA 4WUVA 1QIGA 4AJ9A 4B76A 5J58A 2FJ0A 2Q3LA 1RAIA 3NWPA 3TEMA 4L4RA 3UT6A 3S7ZA 3GXOA 2H51A 4N9QA 4Y2UA 3WL4A 4JYZA 4LF9B 2G7ZA 2Q1UA 3F97A 2OQVA 3WRXC 3IIIA 3CN7A 2B4TO 4BNIA 1C5KA 4YCDA 2JATA 5E6SA 5JU6A 4K40A 4OYRA 1J9ZA 2A4KA 1HXHA 5JNSA 2A86A 2D0DA 1OI7A 4OI4A 5TPZD 2PV0A 2HD4A 2BHRA 5JH7B 1V16A 4X0EA 3FCYA 1KYVA 3PZBA 4U02A 4FHDA 4REOA 4TYPA 5A2QA 1QQBA 3NHSA 2H9YA 2VPZA 3RAJA 1R0LA 2F1RA 2DWOA 4LZWA 1V43A 4ND5A 1A98A 2JCYA 1GQQA 5JVDF 5JZ9A 4RVNA 1T8YA 4BC1A 3RUFA 5AJZA 1G3MA 2YDYA 3NRJA 1BHSA 2JKYA 4DG5A 1JGTA 4IIDA 2B4QA 4O4JA 4E3ZA 2RJOA 5AXDA 3CZ4A 2ODPA 1Y7TA 4GM4A 4IVQA 4C5BA 4W8HA 1PLKA 2AOUA 2Y0EA 3EIFA 3CKLA 1JQ5A 4M89A 3HU5A 3RRYA 1FNBA 1BO6A 4FJ2A 1FNMA 4JLMA 4DIMA 3W3AH 3QTBA 4XSGA 5FBKA 3OCYA 2UYHA 2WNIA 4XGRA 5LQDA 2ONJA 4G1BA 4RMJA 1ZEJA 1CIJA 4TUYA 1ES9A 1D6NA 5DTMA 3W34A 3JW8A 2AHRA 4UUQA 3NEPX 3V34A 2Y27A 3MCAA 1V2HE 5IMBA 3C5CA 3L0OA 4ZEMA 4PW0A 1I0LA 1MW8X 4EL5A 1QP0A 5LD2C 1CJSA 4OMUA 4OPMA 1U0BB 1L5VA 1LI7A 2WVAA 3FOEC 4YFVA 2VIIA 3JRNA 4KRXA 4BUZA 2ZGVA 3D2AA 2ZTLA 3N2YA 4DRYA 4YDQA 3MLAA 3NBKA 3W05A 4TYQA 3X0DA 3FGOA 2BFPA 2NZ8A 1KRHA 2B9EA 2Q1WA 1O8CA 5IVIA 1V1RA 2I2AA 2VNKA 2GK6A 4X7MA 1XG5A 1CNFA 2PWAA 4KBGA 3JQGA 4Q6WA 4XH9B 4BX8A 4EB0A 1FLNA 2UYOA 5K3EA 3RG2A 4DCPA 4XIYA 1X9HA 4HB2A 4M99A 4HGPA 1MCZA 3BHJA 1XCLA 3IUSA 2XTJA 3G1UA 2R6ZA 4BKPA 4Y6LA 4JC5A 4JXJA 5BUQA 3OQ1A 2JANA 2PUWA 2XWPA 3KZCA 2I76A 2RHLA 4V1CI 5AK3A 3LF2A 2ODQA 2UVDA 4RENA 4BLVA 3QYFA 1V47A 4UOQA 3AM5A 5ENDA 1DADA 2AG1A 5B1IA 1G66A 1ODJA 2HL6A 3AKDA 2HWWA 3DCNA 3NFRA 4XVRA 2H57A 1ZM7A 4R51A 1M2OB 4Q9IA 3T0FA 5INTA 3QE2A 2OV8A 4YUVA 3GLIB 3DULA 3USCS 3RSQA 1Y6RA 3E2IA 2EBFX 1BOOA 1TAGA 2PKEA 3ZH9B 2H6EA 3L1KA 1C9YA 3TS1A 2Y8EA 2NX2A 5BWLA 2OFPA 2Q5QA 1CUWA 2RHOA 3L01A 4M8SA 4BFZA 2XXAA 1R0WA 4GBMA 4YLGA 4R1UA 1OXSC 1EAMA 2XT6A 4B3FX 3ECAA 4WKCA 2QW1A 3WP1B 5BN1A 4J6EA 4B4VA 1LW6E 3EW9A 3CTMA 3D1VA 3KB2A 4KXFB 3TNYA 1I1OA 1TCBA 4OUKX 1BH2A 3BHNA 3ZU2A 5FUWA 1GUBA 1ZRMA 3N58A 4L8VA 2XXJA 3HBLA 2QN3A 1Q7RA 2GFIA 4B2YA 1R6TA 1C2YA 3KTAB 1GILA 1Z2CA 3IEIA 3U3OA 2IY8A 4NBKA 1K88A 4OHXA 4PS0A 1DIHA 3W1WA 3EIEA 3CUEF 2IHNA 3CHYA 5A5GA 1FFYA 1CJVC 4P3XA 2FXIA 1L1RA 5E0KB 3CVWA 3VHQA 1AC5A 1ZRSA 1WG8A 3IUEA 3JQDA 1HNNA 4G84A 3AJEA 4KX3A 3AHGA 4LHSA 3W6NA 5LDHA 2AGVA 5LJLA 4FN4A 3LBYA 2WF5A 4IQ0A 4WESB 3LGXA 4GO1A 1I30A 4PZPA 3DVAB 5J2UB 3HFRA 3SIXA 1GPUA 4QRHA 4YO7A 4YHBA 4BNTA 3SAJA 4QFCA 4FS3A 1AF4A 4Y0VA 4H6VA 1SVNA 5IDVA 2CJWB 3TRIA 3SEQA 3E2MA 1JAYA 1YQUA 4NATA 5E95A 2OZKA 2ZS7A 5FWNA 4Q1EA 4BNMA 1UEIA 3V7NA 1D4FA 5JANA 1OXUA 3ZXXA 2VTDA 4YPVA 1XQXA 5A4IS 3W1VA 3FUTA 1T5HX 4O1MA 4GYJA 2ON6A 4EY8A 4G5SA 3H1GA 3QUTA 4AMBA 4L0CA 3I6QA 5CR9A 5HKBA 4WFKA 4KR3A 5FP0A 4A92A 1V7PC 1W52X 4QXMA 1WE2A 4H7EA 4U6NA 2HMAA 4CKZA 3AIIA 2QL9A 4KXYA 2DBYA 2GNOA 4HNSA 2VSXA 5KIAA 5TIIA 2NQ2C 1QDEA 1VLLA 3A6KA 1IM5A 5LZ7A 3A10A 4CHTA 1ADGA 4QHYA 3T7DA 3WIUA 5C4MA 4KHPB 5JDIA 4W5JA 4DIUA 1VJCA 4DADA 1RRVA 3Q7TA 3CG0A 4W1SA 1J8MF 3DOIA 5K4HA 4MUBA 2AOXA 2P68A 2G76A 4BNUA 3ANSA 3TOCA 3PG5A 4RJTA 5B64A 4UPDA 4IMPA 5AKLA 1JA9A 5G4LA 8ABPA 1UBRS 1PG5A 3GCGA 3OMXA 4H0CA 4J4HA 1I7NA 2C5BA 4JJEA 3DFUA 4P0PB 1B93A 3VNAA 3ZNQA 4PLVA 3B1XA 1E98A 1YUNA 3MLBA 3ZUPA 1G8PA 3G7SA 5CLQA 4QLBA 5KVCA 4AYTA 4NCKA 4NSNA 5A06A 4WXMA 4ZCIA 1K86A 2JVKA 2PR2A 2OHJA 5TLSA 1D0VA 2OEPA 3FNEA 4ZKEA 4RJKA 3E9YA 3HVUA 4OJTA 4Q3EA 3KWFA 4RD6A 2QRZA 2I2FA 1VMDA 2NU8B 5KS2A 3CCBA 4JKIA 1EFVA 4DLVA 3QFHA 2XCSB 3QMMA 2HA0A 4JLAA 4CLHA 1RABA 4Q12A 1ZDMA 1CETA 2YN2A 1M0TA 4ARSA 4KQMA 2WD7A 3QE3A 3WTCA 3E35A 4U1RA 3FR7A 4LA4A 2BRUC 1R5NA 1PW5A 3IILA 1JNXX 3DLAA 5JDCC 1YQXA 4F11A 2QYSA 2Q0HA 3L2OB 3LCJA 3LWNA 2VBFA 2HQRA 4N41A 2IT1A 4J49A 6ABPA 3UOWA 2IZ1A 4MTCA 5HYVA 2H52A 3DLTA 1FYEA 1DIGA 1TCVA 2I4IA 5FUXA 3EC7A 3LTNC 1EFLA 4H1WA 3AYXB 7GPBA 1DJOA 1GM5A 3QLUA 3VPBA 1B2LA 3KVNA 2FW9A 1OW3B 1MAWA 3RAGA 2ZDQA 3JV7A 2GD1O 2JJ2A 3OAAD 1MAHA 4J29A 5AHXA 3UJNA 1QDUA 2GK3A 3C3AA 2VCHA 3B60A 4POOA 3VFDA 5HUJA 1E79D 1X42A 1CD5A 4IY1A 5HX7A 3RTDA 1UZUA 2LZ0A 3EDOA 5AVRA 2OXEA 3IYLW 2F9LA 2V6BA 3V9PA 3I9V1 3DDOA 1SH7A 3KPWA 3R3JA 1EVEA 4KQWA 1J0BA 3TZLA 3N87A 3VZDA 1K7SN 2WQZA 2FGKA 4EQZA 3A6PC 4K2HA 4L4UA 4FGJA 5K4GA 3DNPA 4GRDA 1TNDA 1TPYA 4BDSA 1MV5A 4B6JA 1SG9A 2AFHE 4YO8A 2OQRA 1UODA 3NNSA 4P82A 2D3WA 2WMYA 2IE0A 5SY6A 2J9XB 2ZIAA 4GC9A 1VTKA 3EZXA 3TQTA 1AUVA 1FCJA 2IHZA 1VFPA 1MKYA 2OHIA 1YNOA 3OZUA 1F14A 3E3LA 3WQRA 5I4KA 2WKPA 4EFLA 5AKGA 3A32A 2IH2A 5L51A 3LQQA 5TMEA 4EYSA 3M6AA 2PT7A 4YCSA 4NCNA 1MENA 2QV0A 2XT0A 3GFVA 4MGEA 4Z9AA 1UPTA 3OZTA 4BV2A 4G2TA 4KB5A 2PGNA 3A25A 4URUR 5J4YA 4XDYA 1J0AA 2YX1A 1JKFA 3AC0A 3C3KA 1XTSA 3EBLA 1TJ5A 1LPSA 4ZPXA 4AULA 4L76A 1R0KA 5AI5A 1E69A 3ME5A 2ZSHA 4KWTA 3EFOA 4W8OA 3PYMA 3SLGA 3A70A 2BHLA 4CL2A 2W0MA 3DP7A 1T2AA 1JFFB 2BZ1A 4V1CA 2C7PA 3FNRA 2A1UA 3ZCUA 4OHUA 4NENB 1FMJA 5ARCA 2ZYUX 2XT9A 3NC0C 3T6KA 4WLEA 4C21A 1NDHA 3DEZA 4CF3A 3WBJA 1OILA 3BD6A 4DSNA 3LK6A 5F3DA 4QG3A 4WY8A 2FPUA 1EX7A 4DRXB 3IRVA 4KXXA 1WB4A 1DJPA 1RLMA 2V97A 4EA9A 1V8BA 3I4LA 1TUBA 1DG9A 3RT7A 2PGAA 4DA0A 1C8KA 1LBQA 5FNZA 1T5OA 2QP9X 3GFQA 4YDSA 3OT1B 2J3LA 1ECFA 2QJOA 1YKFA 2V03A 3CUYA 4UFNA 4EYOA 5JS1A 4Q3LA 2V7BA 4FONA 1DOZA 2GA8A 4YRFA 4OCZA 1GNLA 1U3GA 5F7ZA 3DTTA 2GBPA 2C42A 3AF1A 3GPCA 3OHMA 1MNQA 3O8CA 2XMQA 3AI7A 1QTRA 1U6IA 4A73A 4L08A 1H2FA 2C84A 3G5UA 5SZJA 1ZUIA 1QH0A 5IJWA 1Z5UA 4LRXA 1E79A 3UJHA 4UDXX 3LT2A 4K9OA 2BP7B 1OXVA 3SC2B 1EEXB 2FKNA 3NBMA 3WQBA 3JQ8A 1Z5VA 2NXNA 1E2IA 1W1IA 3C4QA 1QE0A 1RC0A 1YL5A 2CLEB 3X1ZA 4G0UA 1BMTA 4HDCA 3WSWA 4MYHA 3RK1A 1OOEA 2X8BA 3W2TA 2PQ0A 5AOVA 4KGDA 1B41A 2JRCA 1TKCA 5D00A 1ORIA 3S8EA 2QQ5A 2A4MA 4QKQA 3PC6A 1JKJB 1G20E 5ALSA 3EYAA 5DHRA 2HA5A 1WSWA 5IAGA 1P1HA 4HD8A 5ECGC 2NO0A 2ZT8A 4XI9A 3UYKA 4L7QA 4FFBB 5EXSA 1JWAB 4B3GA 2ZZMA 3DV0B 3LA8A 1F3OA 4B3SB 3L1IA 2VSFA 4CR7A 1YCFA 2WA1A 2RGXA 2ZJYA 3HNPA 3OU6A 1Q7EA 3EH1A 4L5JA 2YS7A 2P2GA 3DKRA 1T6ZA 1JG3A 3A26A 2QYTA 1R0XA 1L5KA 2X2OA 4C6RA 5A5FA 2C2KA 2CLLB 3IB3A 5WRFA 4CBVA 5JPCA 5ILOA 4LG1A 4NABA 3WSVA 3BDAA 2BT4A 3JZMA 3ICCA 5E8JA 3ISJA 2ZUSA 4MHSA 3DBIA 4OFBA 2KLBA 1T4MA 2R6GA 4F9FA 2XH8A 3A14A 3R7FA 1TTHA 3CPEA 5HZMA 1HK7A 1K6EA 2GXSA 1Y8CA 4EVSA 2BHTA 3ZD9A 1E5LA 1Z4NA 5LLSA 2UVPA 2ZSAA 4QC2A 1UJ2A 2I7XA 4RSMA 3SBXA 4J2OA 4DDWA 5B1DA 1V39A 1KQPA 3JAKB 1CRPA 2DB3A 1DC4A 3TZKA 4TL6A 4GQBA 1FXUA 4CM3A 3WTBA 3PSAA 2CUZA 1P9OA 4DSUA 3R74A 1JPUA 4KH1A 2Q2WA 3ZDYB 4NRDA 4G4SO 1U2SA 1J22A 3ONFA 3GLGE 1G8SA 1ECCA 3NTOA 4Z9YA 3RKUA 4BECA 5I01A 2ZG6A 3HA3A 6REQA 2HJ9A 1FDWA 2FFHA 3QFCA 4MIOA 5D1NA 2HEGA 4ZTBA 3EHEA 4KYVA 3VMFA 3ZQ4A 3UMGA 1OT3A 4I55F 5JFTA 2JEYA 5EINA 5JROA 3L7JA 1W5AA 2CLDX 2NVWA 2PZKA 2I7TA 3ZNNA 1DGQA 2G72A 3KHUA 3MBIA 3VBCA 5KJ6A 3LCMA 4YV2A 1Y3FE 3GDWA 1JU9A 2I3AA 3CLRD 4EJSC 4PXAA 4HNAB 3VGPA 1LCIA 4ITRC 4DCOA 3EXFA 3AF4A 2XOEA 7ADHA 1SZPA 3IPRA 1L5GB 1N4AA 1YASA 3TVDA 4HDMB 3ZS8A 4AB1A 3IPAA 2DXIA 3CUVA 1DC8A 1YBAA 3IODA 5EAIA 3WDKA 4MA4A 4R98A 3R7SA 1DI0A 3MTEA 3EVBA 5EUQB 4MQBA 2NN3C 5BMVF 1Q6YA 4JP1A 1TO2E 3VR6D 5C5DA 5IP5A 4PQGA 4FR0A 3ZNOA 4BBJA 3F96A 2PS1A 3A6JA 4E12A 5BPHA 5KPDA 4KR7A 1WUTA 3PFFA 4A8JA 3A2NA 3H0CA 2FDRA 4WOBA 3RVDA 1AQJA 4ZMBA 2BN4A 5DU2A 3O3CA 1KOLA 4UTVA 3LWZA 5HIKA 3ECSA 3WWDA 1HYEA 2ENWA 4CCYA 5L6MB 1Y4AE 1SELA 1QB7A 1ZW1A 3NIFB 5T64A 1UANA 4DTCA 1GCUA 4ZEVA 3W5AA 2PJZA 2VHVA 1YR2A 1GTSA 4RLHA 4LMBA 2XSZD 4CM9D 3G2NA 1NIJA 4HQRA 1SBCA 2A3NA 3JQRA 5DTEA 1WUJS 4ZO8A 1U28C 3WLKX 4DMMA 4AS1A 3DMYA 1TKRA 4D4LA 5DI3A 2B8JA 4US0R 4XSHA 2GD2A 2J6HA 4UM7A 1X8LA 2L18A 2Z8ZA 4TTJA 2B82A 5AJUA 2YDXA 5I7EA 2DFLA 1V3UA 4N0QA 3LQ4A 3M6MD 4GZ5A 1M2EA 2GBGA 3FVQA 5L9AA 3RYHB 5DNCA 1XR3A 3ZDQA 1KMQA 4WKPA 4L02A 4LCEA 3AI2A 1N6HA 2Y0PA 3C3CA 3KUUA 3OHSX 3PNOA 4LRWA 2QYHA 4LTNA 4UZEA 5DSTA 5K3AA 4ZI2A 3F73A 3RUCA 3DAYA 1F2DA 1DT3A 1ORWA 4CLXA 3G8AA 2I99A 2WTXA 2ZBGA 3HEAA 3U3ZA 2JHCA 1VJ5A 3JWPA 1ULAA 3ZZMA 2PUGA 3DTVB 1Q1GA 2BEWB 4HDSA 4JA2A 2WM2A 1YZYA 1IQ0A 2V6FA 4P4SB 3UN1A 1E2JA 1VL8A 4QUIA 5F5NA 2D59A 5CAEB 3S8MA 1WDLA 3U09A 2V59A 5EJ4A 3P9NA 2PMFA 4KR6A 4PLGA 1CYDA 3SHQA 1QFMA 3H9EO 2YYYA 3MOSA 3UJPA 3VHRA 2MIIA 4QO7A 3VDRA 3HE3A 3B52X 5BQ3A 3L6EA 4CEIB 2BY4A 1R6UA 2D13A 2AUMA 1E7MA 4N3AA 3ZJ5A 1AKVA 3AP2A 3PDIA 5I9LA 1YONA 2BMDA 3KJQA 1KDRA 3T99A 1CY4A 1QMPA 1OC2A 1VG1A 1W76A 2BEKA 1OCEA 3L0ZA 2YXLA 1Z3CA 2C4UA 4TQGA 5AI6A 5CW1A 4W5WA 1TLFA 1L7XA 2VUTA 3D1LA 4BRUA 2O8BB 3DPIA 2FWNA 3BMQA 2G09A 4TLLB 1FSZA 3WMXA 1D8TA 3EWSA 3UXMA 3VR6A 2ZUWA 5FPPA 1MFZA 3A3OA 3KP1A 4IH4A 4L9SA 5A5EA 3PVSA 3MQFA 2HRZA 2CL5A 2X6QA 2ZI9A 2VJNA 4RL4A 4B1FA 3DFFA 4B43A 2FPXA 4WGFA 5CTJA 2OUKA 4CIVA 3K94A 3DF7A 2JRLA 3KV3O 4YRDA 1CUXA 3AKCA 3O03A 2WSYB 4OBWA 1H3EA 2EEPA 1SOMA 3ZE6A 4HVLA 3MD0A 5JMOA 5CBPA 4JL6A 3GYBA 1X39A 1Q11A 5DTQA 2XSZA 4CM9A 3ICVA 3R9IA 4ENVA 1CHNA 3OLQA 3KEOA 5HF8A 2P3LA 5C34B 5KTKA 2QM7A 4RKWA 5D6NA 1PDVA 1WY5A 4GSLA 4MUGA 4Q3CA 4IGEA 4RHCA 3TJZA 2EERA 3D8NA 3GARA 1PSDA 3PR3A 4J1TA 5B3JC 1DJMA 1U31A 5G4KA 3DVLA 4I55A 4MYDA 3JQQA 4CLRB 2MSCB 3KC2A 3ZWDA 1D7AA 2BCEA 4HGRA 1BGWA 1RWPA 3JQBA 3M82A 3HBMA 3ZOKA 1AHHA 4FUQA 1Z17A 4N3CA 1GUAA 3PXGA 3W7BA 4HNUA 2EP8A 3NUQA 4Y2VA 1DFIA 2ZSUA 3ELUA 3FTNA 2GR9A 3RARA 2IEYA 5FLYA 1Y1TA 3S5JA 3BBLA 4JJ4A 4ON9A 2WICA 4P0TA 2JK1A 2RK4A 1P81A 5I9BA 2NZJA 4O08A 2QN7A 5JLJA 4BNJA 1X8XA 4YR9A 3EH2A 4H60A 3ZY2A 1F5SA 1W25A 1OVGA 5BMVA 4QDZA 1COWD 1POXA 4AJOA 3D4BA 3RE1A 4A2QA 2CV1A 3OZ7A 2F8LA 3WRVA 5SYMA 1UDXA 1JSRA 2PLNA 2A78A 3KKEA 1TJ4A 5AI8A 4KQIA 4D3FA 2VI5A 5E2BA 2I22A 2PSDA 4DW8A 5C52B 3A0RB 1RYMA 2MDTA 2O4CA 3HKEA 5IJ0A 1AS2A 5CYOA 4F8EA 2RB5A 2PGXA 1KWGA 2V1UA 4M22A 5BUCA 1I3NA 4GFDA 4A0FA 1SXHA 5ELXA 1HSOA 5D3MB 5HE8A 1Z34A 3WXMA 2P30A 1CZUA 4D3ZA 3HSYA 1ZMBA 4JYPA 1II9A 1OUMA 2VVTA 4QODA 5DGHA 3L9WA 4NMXB 2QNIA 2XNDA 1JHDA 1HC7A 1N1EA 4NU5A 1WNFA 2MWMA 4YP7A 4C2TA 1VLMA 2HMWA 3D6MA 2NO6A 4UM9B 1TRHA 1WEKA 2R96A 4G5OA 4P98A 5AHRA 5CVDA 3TO5A 1ZLYA 3D43A 4W99A 5EIFA 2C9DA 4YXFA 1GNQA 1ZBDA 3FNHA 3MIZA 4TS3A 4X6YA 2Q6IA 3RVQA 2F6RA 1RKUA 3G0OA 4RY0A 4AG5A 3L6CA 4NESA 1VPEA 2C5GA 2PWBA 4GXNA 4MWSA 3SQWA 2B0CA 3LL4A 3CZQA 3FWZA 4QTUB 1GAQA 1TADA 3D8HA 4IH1A 1KDTA 1IPEA 1GFWA 1NZDA 3EVTA 5K99A 4ZT7A 1WQ4A 1GSAA 4QGHA 3QY9A 3N9IA 2B5WA 4IF4A 1PFWA 1H8HD 1EWVA 4DGSA 2XHEA 4UHDA 5ANRB 3ZWBA 1WVMA 1YK1A 4UW9A 3UK6A 3X1JA 2Q3EA 1MX5A 4PSUA 1GVHA 4L6IA 1ETHA 2G6BA 4RO0A 3RSFA 3GOQA 5F9HA 4M8KA 1KMMA 2YJTD 2NUAB 4BMYA 3V00A 4C01A 4IS2A 4BMVA 4BWYA 4XJVA 5J4VA 2QM0A 4C6SA 1SUDA 4ZDJA 4RZSA 1B6TA 3CLVA 2R0QC 1J1ZA 2ZTVA 4HEA6 1GCOA 1EB9A 1KBZA 4RHEA 2OOSA 4OXYA 2YJ3A 4JVSB 4IV8A 1IJEA 4MX8A 5JCZA 3ICOA 2XKKA 1XT6A 1N2JA 4OH7A 4Z2YA 3TJRA 1RMYA 1U0RA 3GFRA 3M70A 3T94A 1VBKA 2PWZA 4BFWA 4HNTA 2IZOA 4BNWA 2WJJA 4IFBA 5EKXA 1A71A 1E9FA 3GPIA 4B6PA 1WZIA 4TMKA 2JCSA 4N7RA 2O5EA 1TVMA 3G2QA 4CQLA 2JARA 1OX5A 3IMCA 2FP4B 4IX9A 3DCIA 3U16A 4E6PA 1GU0A 4EATA 1COWA 2CF6A 1G19A 3FZYA 2I5PO 5E9AA 3T1HB 1RZRD 1Z8NA 3GGCA 2XGSA 3L7AA 4AMGA 2OXIA 3T3EA 2FMXA 3X1DA 4D1YA 4KZKA 2L0XA 3CX3A 3HFGA 2ZTHA 3C4VA 2R79A 3KV1A 3LNCA 3ORQA 4B80A 2VT6A 3D7KA 1TW3A 4YP9A 3WAGA 1VL1A 4BO6A 1IXKA 1P9WA 1NXVA 4G65A 3VXKA 1B74A 2YBDA 1BXRB 3ICEA 2YQZA 3KDAA 3EODA 1WCWA 3U13A 1E2BA 2GJKA 3U4QB 5ITZB 5KYXA 2BJHA 2ZJFA 3EEFA 3F1KA 3OTIA 1JBKA 3NT2A 4MPJA 3TNLA 1XQ1A 4XVQA 1M2NA 3H5TA 4KIGA 4UZFA 1ZD4A 1ZIOA 2FFAA 3I5XA 2J9FB 4RS4A 1B42A 2QP3A 1XE3A 5KYWB 2QLBA 4IDHA 3TSZA 1H1LA 2GDJA 1QRDA 2GNAA 2UUBB 3OWOA 2OBLA 3ZHYA 4EPRA 1QVVA 4Q9KA 2QXYA 5D1HA 1D9ZA 4HSGA 2WP0A 3AIMA 4N3BA 4WOJA 4Z1OA 1Y6QA 5JCPA 4LYHA 3R0XA 4CKBA 1TQ4A 3VAZA 3HCCA 2X9GA 1AKEA 3EZYA 2Q62A 4JX9A 1XOIA 3CRW1 4RKRA 4V39A 1RI5A 1RDFA 4FNGA 2HB6A 4H59A 2PKQO 4RUKA 2LRHA 3Q5DA 4C1NA 4HN2A 1P80A 3ZWXA 4CTJA 1T9BA 3SF8B 1E3JA 4M8NE 3V4LA 5D7BA 1QQ5A 4PY2A 1H8HA 3E3MA 5BUZA 3DDCA 3M7IA 4Q18A 4COKA 4KNWA 2HIMA 3E70C 3DCJA 5CCDA 2GZDA 4C08A 4YYZA 5IJ9B 4I1YA 4BV3A 4WNCA 1DTEA 2B1IA 2OC4A 3KVRA 3O2QB 4NYIQ 4DR6B 3OQNA 3HXPA 2CSXA 1E60A 3LQ2A 3LPCA 2RH9B 2P67A 2WRZA 3NWEA 4IIFA 4FYVA 2IV7A 1DE0A 3D7MA 3ENVA 1H42A 4TWZA 2PQ6A 2Q8QA 4I5FA 4O5AA 4TV8F 2HNAA 2V55B 4Q4JB 4HEHA 4FJ0A 3DEIA 4LOJA 5FEUA 2BKAA 3GCDA 3D0KA 4Q19A 1T1RA 3T7TA 2D4HA 2Q50A 4TXMA 4GR9A 1G17A 1E3SA 3MWEB 5J40A 4EGSA 3A1NA 3TDNA 1ISMA 3TZQA 4I4TF 1BD4A 3T5AA 4IZHA 3EAGA 4C9BA 4TMTA 1HA3A 2D2EA 1OAOC 2O2IA 2VYCA 4EMUA 3FB4A 1PDOA 4X97A 2GQ0A 2X6RA 3M81A 4Y1GA 1PNTA 5AUQA 3VC3A 5ICSA 1ATZA 2HGSA 1XNRB 2P0AA 1C7RA 2BVNA 4FE4A 2X5JO 1E2HA 5JD3A 1ZR4A 1KFEB 1M6VB 2VZLA 3OX1A 3D7SA 4MV8A 3EDYA 5C8XA 1W4BA 2V4ZA 3HACA 3VR5H 4YT4A 4OB7A 2Q7XA 1E7WA 1DMSA 1LLDA 2DTDA 5J2TA 4KACA 1XSEA 3IT0A 4RK4A 3W6PA 4EGJA 1Y0BA 1BXGB 2IHUA 1P0CA 2C9YA 4KSBA 2BGRA 1XZ8A 1JEEA 3DBHA 3TX2A 3RS0A 1ZK1A 2CLOB 2ZWPA 1Z06A 4BLUA 4Y2SA 1L6IA 3PUXA 1IN8A 1P1KA 2YCLA 3BREA 2OP0A 3TQQA 1NR7A 3IIJA 2XB9A 4YUAA 1DRVA 1PGQA 1U5BB 1EP2B 2PSJA 4UDYX 1CJUC 4BKMA 4O4HB 2FZLA 2ZI6A 4BVGA 2DRIA 3R76A 3JR7A 4J90A 2ACWA 4PSVA 4PQEA 1I4TD 1Q7BA 2C9ZA 4OQ4A 5J5VA 4H7HA 3TOZA 4XX0B 2PUTA 4H18A 3I28A 1UFQA 3C5HA 2FSHA 4YY3B 1C7IA 3EZ2A 1RCTE 4E07A 3EUFA 1UXKA 3H4IA 1MEJA 2ZZNA 1G42A 4H7FA 4RANA 1I80A 1DKUA 4WNAA 3VKUA 4E46A 4OHCA 2GAIA 3RODA 3VR0A 2CVQA 4I3FA 3SWWA 1EZ4A 3T4PA 4JASB 1C7FA 4B3DA 5FPSA 5JPIA 4DMFA 3ZWYA 3GMIA 3PA8A 3PTZA 2KW5A 4MPDA 1KJIA 1Z0JA 2J48A 3DBLA 2FB9A 1SKAA 2EBWA 2HRRA 5JWOA 4JBLA 4E2YA 3CJQA 2XVZA 1EDBA 3PC8C 1N9KA 2YJ6A 2V65A 1TA9A 2W2QA 2ZR0A 1BYUA 4XB6B 3HCAA 1VA5A 2PL1A 1KAGA 1TAUA 3IP3A 3CWQA 4UEOA 4XUGB 4AP6A 1KBOA 1QQ7A 3G9XA 4LXTA 4NAVA 4IQGA 3F3KA 1XZQA 4ZU3A 2G70A 5G0TA 3P9PA 3WNDA 2PRKA 2EDCA 1XVLA 3K8OE 1YR9A 1BX3A 3S55A 1AK1A 3OIVA 4XUDA 4MK4A 5FORA 1ESDA 3CWCA 3KZOA 5KDLA 5CA0F 3PQ8A 5ALOA 1NDUA 1NV8A 2FUKA 2SCUA 3MPUA 5DN6D 3GLHE 1FBTA 3V1NA 3F3YA 1J1UA 1WTCA 2CYBA 3MHTA 1ODFA 2Q5LA 1T26A 3KXDA 1E0AA 5DYYA 4AN0A 3O1HB 4MI1A 4QFDA 4QX6A 1NG1A 4E14A 1YQGA 5FPQA 4RKYA 3U7FB 1ZICA 4KWCA 5AP9A 1M7HA 1YS2X 1YRWA 2Q3DA 5DDIP 4ZN6A 4RSHA 2R5WA 5I7AA 3ZD6A 1VGRA 2C2YA 4IXMA 4K87A 1F4PA 5EWJA 3OICA 2MSKA 1QK5A 5CEFA 3K35A 2J5BA 4BQFA 4HGNA 2FMFA 4E09A 4C7XA 4NZNA 4WECA 1UBSB 2H1LA 5DM1A 4ARCA 2XDYA 4BJ1A 4LK2A 3R3WA 5FAXA 4IDAA 1SRQA 3TVTA 4MYUA 4Y2YA 2J46A 2PAAA 4FTWA 5IBQA 4DB4A 1Y8ZA 2OOKA 1N75A 3UK0A 2YIVX 3A3PA 5KHOC 1CDDA 1N2CE 1JP7A 1Q15A 2Q1XA 4D8TA 1L1EA 3OZEA 1Q77A 1Y6JA 3KSZO 4HS4A 1CNEA 4LZJA 2HQSA 2W6PA 1A8SA 4XFJA 5JYDA 3CB2A 4R1QA 3AILA 1LZLA 4NIMA 4ZHSA 3VYSB 4BO0A 1E1QD 3Q2OA 2HF8A 5JBIA 2GWRA 1KO4A 1XAGA 2D54A 3BIJA 1YJ5A 3LY5A 1JQBA 1RI4A 2WWWA 3W78A 3PKIA 3IDQA 3ZEAA 8LDHA 3A7EA 4JBNA 1ZHOA 4TV8A 1AMUA 2DETA 1Q92A 3OE7D 3DMTA 4GF5A 4GICA 2WT8A 4GPEA 1KL7A 4GR4A 1T3TA 4Y9UA 2EC5A 2QRUA 4YQEA 3T3HA 5BURA 5T4HA 1ZUNB 4WY2A 3RIGA 3UJCA 2XEXA 2XWBF 1CX9B 4L0QA 1I4DD 1AKYA 2H2GA 1O58A 4R69A 4FYWA 3UICA 1LQ2A 2ZUEA 2QX9A 2ZRCA 4HFNA 5HF6A 1DARA 1G55A 1J5PA 1DRWA 1Z6XA 4YJHB 3AF3A 2V7VA 3OZAA 2CXTA 2Q41A 1RBYA 2WUEA 1XMXA 4MZXA 1UM8A 4XJTA 3KYBA 3WB2A 5CD1A 3DBRB 4ZEXA 5CITA 2AYYA 1JLKA 1L7AA 3H0KA 1PJCA 4XX1A 4FFWA 3ZDRA 1IJKA 1XMPA 4HDKA 1CDEA 1H69A 4MJLA 2Y4OA 2LGJA 3L1VA 5T41A 2MINB 2ATEA 2RJNA 3VH1A 4PBSA 1UADA 4M1MA 3VUEA 4BX9A 1GU7A 5DM60 3CF2A 5BVHA 5I3ZA 3UHOA 4ZCRA 3KLNA 4XIJA 1JZQA 4FYIA 4XIGS 4H1UA 1KJWA 4MB0A 4B4DA 5GADl 4LHZA 1QO9A 1OHHA 4DUPA 5M7EA 2XB4A 4X3PA 4HWKA 1G3UA 2XNCA 2VHEA 3JRXA 3CO0S