1NATA

Crystal structure of spoof from bacillus subtilis
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
119
structure length
119
Chain Sequence
NEKILIVDDQYGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Regulatory protein
molecule keywords SPORULATION RESPONSE REGULATORY PROTEIN
publication title A response regulatory protein with the site of phosphorylation blocked by an arginine interaction: crystal structure of Spo0F from Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 40
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 1997-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1natA00
4OLBA 4LE2A 1D5WA 1D4ZA 1YK0A 3KCNA 1JYFA 1LBIA 3BRQA 1C0EA 1P2FA 3OLVA 3VNAA 2VUIB 3IP6A 4W5QA 3I45A 3OLYA 5GQSA 4LDZA 1Z17A 1Y1LA 2FMKA 4O1HA 3HZHA 4Z4IA 4G0QA 1EHCA 4ZJPA 4KRFA 1FFGA 3HDGA 5IEBA 4G0OA 3NHZA 2PL1A 5JNVA 4KV7A 1PHRA 1ZESA 2PUDA 3D02A 2LPMA 4MR7A 2GI4A 2L17A 4N03A 4F11A 4NCAA 1U2QA 5BRAA 3H1EA 1F4VA 1BAPA 3NBMA 5CNJA 4LX8A 1KMIY 3C6QA 1JX6A 1QO0D 1VPWA 1JLKA 4YRZA 3OLZA 4PYRA 4N41A 2QZJA 3KYIB 2GBPA 3EODA 3OQOA 3HS3A 1MIHA 3RVPA 3O74A 3BREA 3Q15C 3JPWA 4EYGA 3QLUA 3EQZA 3QEMA 3KSMA 3HO1A 4D6YA 5T7BA 3BBLA 1ZVVA 1E2BA 3S99A 4DQDA 1J56A 3RVMA 3MIZA 4KVFA 1P6QA 4IGAA 4ETIA 2LIVA 3LMKA 5KC8A 1USKA 1EAYA 5JNRA 4Q6WA 1NXTA 2WRZA 3LUDA 3TX6A 4UHJA 3FFTA 4QYWA 4RXTA 2OQRA 4WWHA 6CHYA 3RVLA 2MYUA 3EAFA 1XWWA 3T8YA 3O21A 3Q41A 4G0MA 4Z9BA 2A9PA 1ZDMA 3FDFA 4ZYLA 5GOTA 4CBVA 1YS7A 4KK3A 3LUHA 1NXPA 1Z18A 1A2OA 3H75A 4Q6BA 1Z2EA 4H3KB 4RY9A 1PUXA 4RK7A 3L6UA 4TLLB 5HKOA 4Z4GA 4ETMA 4KPYA 3QLTA 1JDPA 3HM9A 3IDOA 9ABPA 3EGCA 4KZKA 4W5NA 3CG0A 5JNSA 2FTKE 1Z26A 3H5OA 1K68A 1JFTA 1RXEA 1Z13A 5HSGA 1RZRA 1JHZA 4TMYA 3CZ5A 2FEPA 4G0PA 4KREA 1AB5A 3GWGA 5JNUA 2E4ZA 1VRVA 1PEYA 2NT3A 1YVUA 2PL9A 4WXMA 3K9CA 2FN8A 3VNBA 2FW0A 3ILHA 3QELB 2L2QA 5DGCA 5KC9A 1LBHA 2F8SA 3CS3A 5CNMA 3BRSA 5B3JA 5EWJB 2MYNA 3SQNA 2HQBA 3F7NA 4UHKA 4E7PA 3HEBA 1QKKA 2N9UA 2PUCA 1A04A 1ZITA 1NY5A 1BVHA 2NUBA 1GUBA 3GA5A 3QEKA 1P8AA 2X7XA 1LJLA 1DC7A 1MVOA 1DZ3A 2J48A 5EWMB 3CHYA 8ABPA 1NXOA 3OMXA 5DCLA 3IPCA 2FMHA 2E4VA 2NT4A 3LUAA 4OLAA 1YMUA 2MYTA 4PE5B 3N53A 3MQ4A 3H6HA 4H3HB 3H5IA 5KQMA 3FFWA 2ZWMA 2CWDA 4G86A 5TPZA 4HNQA 1CHNA 2PUEA 3GL9A 3LKBA 4S05A 1ABEA 1TLFA 5FBHA 5BR1A 1ZGGA 4Y9TA 3QLUC 3ROTA 1GCAA 3OM1A 2IYNA 2R48A 3LUGA 2M1ZA 3CFYA 3NNSA 3EULA 3GBPA 4TLMB 3CLKA 2FSPA 3JPYA 4MLCA 5IEJA 2FKAA 3ROFA 3LUCA 1EWVA 1DBPA 5EWLB 1BDHA 5TQJA 3O75A 2P4UA 3N8IA 1NXSA 3LKVA 1JFSA 3QK7A 1GLGA 1SXHA 2IPAB 1PNTA 4IMJB 4RZSA 4MAAA 1M2FA 3M9WA 4YV7A 4Z4FA 2NZUG 1M5TA 3G1WA 1DJMA 2R4QA 3JVIA 4XARA 3KTOA 4G0YA 1PEAA 5KWSA 3G85A 2L19A 3QLVA 2QSJA 1DP4A 2QW1A 5FBKA 4EGSA 3C3KA 5TPWB 4QYMA 1T34A 5KQLA 3HXMA 3RVSA 1MAVA 1YIOA 1FFWA 1JL3A 3JS5A 3MM4A 4RKQA 5IUNC 5BRJA 2JB9A 1GCGA 3NNDA 1ISSA 2QU7A 2FVYA 3M9XA 2PUFA 2RJOA 4D6XA 5E3JA 3RVKA 3QX8A 2H0AA 2FQWA 3R0JA 4MQEB 1U04A 4YLEA 1BDIA 1D1QA 5KI6A 4RV5A 3IP5A 4RK6A 3T6KA 4FE7A 1DCKA 2JVJA 4H60A 1QO0A 3RVOA 5B3JC 4EYQA 2LP4Y 3MF4A 3C97A 1TMYA 2TMYA 3GV0A 4LDAA 3QELA 2HQRA 4KQ9A 3P9YA 3ILYA 4EYKA 2PUBA 3H5VA 3F73A 3HSYA 5EWJA 3O1JC 1SXIA 2MYPA 1DBWA 2VUHB 3KJXA 4MS3B 4RXMA 5FWYB 4F8JA 5KQGA 3KKEA 3RQIA 2FLKA 2CD7A 4F3TA 3CTPA 3JTEA 2WY2D 5DTEA 1DRKA 3Q7SA 4KMRA 4YGXB 1NATA 2E4UA 2GWRA 3GRCA 3O1HB 3KLOA 1U8TA 4L85A 3DGFC 2IKSA 3Q9SA 1QP0A 5EWMA 3DLBA 4B09A 1BA2A 3TB6A 2WJWA 2M98A 2JBAB 2PKXA 1WETA 3Q7RA 3RVRA 7ABPA 2AYZA 4IMIB 4YR7A 4YS6A 4NV3A 1L5ZA 4RU1A 4WZZA 4O1IA 1Z2DA 4LE0A 1FFSA 3K4HA 3MYYA 1ZGZA 1RPJA 5TQ2B 3H6GA 1QP4A 3N6VA 2IPMA 3SG0A 3IP7A 4PEVA 1OXKB 1JBEA 3B2NA 5FWXB 1NXXA 3I09A 1F51E 1ZAYA 4S04A 4LE1A 4W5TA 2FEWB 4N0PA 1DC8A 2YHAA 1NXWA 2FXIA 3LTEA 4DN6A 4YWHA 2NZVG 4YO7A 4M88A 1LJUA 4ML3A 4OBBA 1ZY2A 2IPLA 3O2JA 4LZLA 2BGGA 2A9OA 3N0RA 1U0SY 4XFKA 2QXYA 2HJ9A 3W9SA 2FMIA 1W9HA 1ZN2A 2R47A 5DLEA 4EVRA 5EWLA 4WUTA 2PAFA 4RSMA 5TQ0A 2LBPA 1E6MA 1I3CA 3I42A 3CKMA 4LRQA 5HM6A 2QVGA 2WB4A 3H5LA 3OQMA 2B4AA 2XDYA 1XHEA 3MMNA 3QLVC 4MYRA 4WT7A 3SY8A 4GNRA 4ETNA 3CRNA 1DCFA 4Z99A 3LOPA 2V0NA 5JNWA 3LUJA 3F6PA 2JVKA 3CZCA 1XHFA 1CYEA 2MSKA 3KG2A 4P98A 3Q7TA 2Q5CA 5TPWA 3O2QB 1YMVA 1C4WA 1QMPA 1S8NA 2ID7A 3GBVA 4MLDA 1RNLA 2E4YA 4XASA 3N75A 4F12A 1LK0A 2DRIA 3UK0A 3A3KA 3O1IC 4MS4A 1R8JA 3HCWA 4Z0NA 4RDCA 2FEKA 4MQEA 1EFAA 4W5OA 3HJFA 1IIBA 2E4XA 1HEYA 4RK5A 1SD5A 3M6MD 1VLZA 4JB2A 3CG4A 4RKRA 3CNBA 2CHEA 2GX6A 3KHTA 4O5AA 3HDVA 3SAJA 1QQAA 5TQ0B 3E3MA 3HUUA 5TE9A 3A0UA 4JA2A 4EVSA 3L49A 4MS1B 2I6FA 6ABPA 3H1GA 1Z16A 1JDNA 2JCGA 2WJAA 1DCMA 4Z4EA 2P9HA 5JNTA 5CNKA 1FSPA 4Z4CA 2B1JA 3A10A 3FFXA 4JOQA 5FWYA 3KLNA 4MS3A 1SXGA 2HQOA 4MR8A 4PICA 3SM9A 3QX9A 1JWLA 4PZ0A 4FB4A 4HYEA 1JF8A 1ZHHA 3OO1A 4MRMB 3FGZA 1ABFA 1USIA 2FQYA 2IOYA 2PUGA 1Z25A 2F8TA 4EYOA 2JBAA 3NHMA 2JVIA 1NTRA 3BILA 3FMVA 3TMYA 1DBQA 2O20A 4MS4B 3HV2A 4WXEA 4RY0A 5CHYA 5PNTA 5IUJC 5TQ2A 3HUTA 4RY8A 5I4CA 1QQBA 3C3MA 1QNLA 4MQFB 5FWXA 3E61A 1YS6A 1JYEA 4P1ZA 3OMWA 2HSGA 4XAQA 4YCSA 3KYJB 2YHBA 4MR9B 4JP1A 1EWKA 1URPA 2PUAA 1D2AA 3O2SB 2RGYA 4RS3A 4KK4A 1Z12A 3EDCA 2MSLA 3OQNA 4MR8B 4MGEA 4NQRA 4G0ZA 5JS1A 2A9QA 2FQXA 3MA0A 4XLTA 5IUKC 3TD9A 4RK0A 4RK4A 3EJWA 4ZPJA 5ED4A 3H1FA 3RH0A 1M2EA 4RXUA 3GYBA 5IX8A 5IC5A 1ISRA 4ZMSA 3IPAA 1L5YA 4QPJC 1P6UA 1TM2A 1TVMA 2R25B 3N0XA 4KQCA 2QR3A 2AYXA 2ZAYA 1JH9A 3SNKA 3EQ2A 3RVNA 4JAVC 5CNIA 4G97A 1W25A 2OENG 3OM0A 4MR7B 4D74A 5KQPA 3RVJA 3HVRA 3UUGA 1H9CA 3DLHA 2H3HA 1NXVA 3A0RB 3D8UA 1GUDA 4KNYA 2WMYA 3JY6A 1RZRD 2JK1A 5BQ3A 2QV0A 1AB6A 1YK1A 4GPAA 3H5WA 5DKFA 4OTZA 4N76A 1D1PA 3URMA 4Q7EA 2FLWA 1USGA 2MSWA 4F06A 1UDRA 5D2CA 4ZMRA 4IF4A 4NCBA 1JFVA 3N0WA 4OATA 4EY3A 1E6LA 5ABPA 2JRLA 3UKJA 3QEMB 3OO0A 5JS2A 4YP9A 4MS1A 1EWTA 4QICA 5HQJA 1TJYA 5IULC 1KRWA 4G0XA 2CHFA 1ZH2A 4L4UA 2LUOA 3C3WA 2RJNA 4E7OA 1BDJA 5IBQA 3TO5A 5F64A 1DRJA 1E6KA 1FQWA 1KGSA 2VYCA 3CU5A 2HPHA 3DGEC 3LUFA 4W5RA 3GT7A 3T95A 3JVDA 3LFTA 3I5AA 2W42A 3OLXA 4HNSA 3KS9A 4XXHA 4N47A 1QPZA 4RK1A 1RXIA 1QP7A 2WWVD 1K66A 2PJUA 2IPNA 4MRMA 2PE5A 1M5UA 2FN9A 4NICA 2ID9A 3OLWA 1VKRA 5T3YA 4IILA 3T38A 5TPZD 5C5CA 1KRXA 1MB0A 2PLNA 1MB3A 2GKGA 3IP9A 2KYRA 2IDMA 4TN5A 1CEYA 1Z15A 2RDMA 3DBIA 4Z9AA 1YTUA 1DG9A 2VK2A 3DZDA 4EVQA 1B00A 4MQFA 2QVCA 5C5EA 4JB0A 1A0OA 4MPTA 1ZH4A 1OXBB 1PNRA 2PMCA 3RVQA 3F6CA 1APBA 3NNNA 4MR9A 2A9RA 4DADA 4Z4HA 4FE4A 4RWEA 4IRXA 4EUKA 3LUKA 2L18A 4N0QA 4HNRA 1SRRA 2E4WA 1U2PA 4KFCA 3HK2A 3H5TA 2FMFA 4JASB 4OG2A
chains in the Genus database with same CATH superfamily
3RODA 1G0OA 1Q3TA 2ALJA 3INRA 4IO0A 3OX4A 3RO7A 3BRQA 5DNDA 4BRSA 1C0EA 1IJEA 3EVAA 5AM0A 4OHRA 2WF5A 2VTEA 4FZRA 2PR7A 2QQGA 1HX7A 4JQSA 1YB5A 2ZVQX 3SCZA 4E5SA 2JBWA 3AINA 2YS6A 4CFZA 1V8ZA 4G0QA 5JXHA 4PNPA 1JJBA 2P30A 5DW0A 1SPXA 2XD9A 3GA0A 1GG5A 1DFIA 2B8EA 3HHEA 3PFCA 1LB1B 1MKYA 2V8BA 2A78A 2GN0A 2WP0A 4MR7A 2G9RA 3BMCB 2BEUB 3EUWA 4MDYA 3ZWXA 1E9RA 4PPNA 4FUTA 2XE7A 1KDZA 2XGSA 3U7IA 2JIPA 5AVJA 1ZMOA 1YKSA 4AWAA 1PZHA 1SC9A 2WHXA 3RHSA 4B6RA 4QTZA 3SSOA 4BVBA 1NPYA 1QWSA 4P5EA 3SMVA 3ND5A 4L0DA 5AXAA 4TQAA 1M6YA 5KQRA 3S27A 4JEIA 1IBLB 1SC1A 5TMEA 4KXWA 4V0SA 3RV4A 2PANA 3AV3A 2WHPA 4M9RA 4KWTA 2O4CA 4NEGA 5DF1A 4QXAA 3E22B 2VZ0A 2B25A 1MIHA 1KYZA 1RC1A 1T1JA 1G4AE 2EIHA 2UUOA 4JNKA 2W2LD 1V95A 4RANA 2B4QA 3RVPA 1F0YA 5CIYA 3KKQA 4YECA 2JLYA 4FC6A 5DGXA 5IH7A 4X1KB 1U3TA 2I78A 4URVR 1NIPA 2JL1A 2LDXA 2W98A 4IGAA 4NFLA 2H29A 4Q7QA 3R9XB 3RHZA 4BWGA 1W19A 4ACBA 4DLNA 3K0AB 3JASB 5LQJA 4YAKA 2HIAA 2JFUA 4F2PA 3BYZA 5JLJA 1XYGA 2M6RA 5EJ4A 4HLUA 3MCVA 5EXTA 1SHUX 1ESNA 5JZ9A 4OHPA 4NJEA 4BO3A 4B75A 4F5EA 1J1IA 3H2BA 2AJ8A 1SU4A 1ZK1A 2WOOA 1XDGA 1TK2A 1BFKA 3HVKA 3KWFA 1QCYA 4IJQA 3VZPA 3FR7A 1D03A 2AH5A 1SOUA 1MX3A 4BU0A 1J8YF 2JH9A 5JJIA 2IK8A 3BTOA 2ZWOA 1NXPA 1QHIA 1P2GA 2D2VA 2H57A 3N7AA 1JLLB 1D4FA 2KBFA 4FXPA 4GI1A 4K6CA 5FQNA 4MHTA 4C4XA 1AN0A 3B3FA 2LE0A 2GBFA 3TE6A 3ZXYA 3B1YA 3CG0A 2I67A 2GLXA 3JQBA 3LF2A 3M0EA 3FN4A 4H7PA 5ESDA 4YXWA 5JZVA 2NXWA 1N5RA 3E3AA 2V59A 4TMYA 2A88A 2Q5OA 1LTKA 1DV2A 4QDTA 2VAVA 3RR2A 3X2EA 4ENTA 1G20B 1HETA 1AB5A 1WOMA 2I6TA 2OHFA 3FKSD 3OETA 5C1PA 2OGUA 3LLCA 5CT8A 4F8YA 4RAQA 4ZVTA 5GVRA 2XWBF 5FO1A 2FN8A 4RBNA 3BMOB 3KUXA 2G4VA 3ZHOA 4C87A 4ISCA 5KNCA 2HA3A 3B36A 3HPQA 4JJZA 4LXQA 1DHRA 1W1UA 1PLJA 1YQEA 2P5UA 2XGGA 1GTSA 4ANFA 5EA2A 5E9JA 4ZHQB 2BMFA 2YWRA 4YFYA 5CD1A 3UMJA 5FPPA 2O8CA 4L51A 4C9BA 3BXZA 2VZ8A 3OZCA 1A9SA 2IV7A 3DAFA 3D3WA 1KK1A 4OK5A 3N2IA 1DC7A 1N6IA 1HORA 3NZEA 3N76A 1KYTA 3OMXA 4RX1A 3P2JA 4LYDA 3THYA 1X7ZA 4ZAXA 3DFKA 2HMYB 3COSA 1NHGA 3B1FA 2GN2A 3FLBA 3T9DA 1NVUQ 4OLAA 1J24A 3JQ9A 2H52A 4UU8A 3V4SA 3NP7A 2P6MA 4QDUA 5LQAA 1NY6A 1S8FA 1M1NA 4E2YA 3C15C 2Q1SA 1Q20A 2VJLA 4K6MA 5TPZA 4UZSA 1TLTA 1G5QA 3JYLA 1XF9A 4C78A 2X9VA 1RM0A 1YR2A 3OURA 4GLOA 4GUAA 2FUNB 4OK6A 1F12A 2Y9PB 4Q18A 2ZAIA 3QLUC 5IJWA 1NVGA 1M7BA 3FZQA 4J0IA 5IANA 3I2FA 4DR4B 1DIAA 4QTYA 1W85B 3WISA 3HCEA 3JYPA 3EPLA 4PQEA 3HWRA 2CNKA 4JITA 2ZDGA 4DEVA 3AU8A 1V25A 1U8FO 5AP9A 4F1WA 2VBCA 5FI5A 3VRHA 2JIBA 1T4CB 4J1NA 4EB3A 5JS8A 2O8FB 5G0VA 5AICA 1X1BA 1N2HA 1Q11A 2JIZD 3ZGYA 1A9XB 5LQKA 3PQEA 2H2AA 3TZ6A 1IY8A 3RD5A 1B2RA 1SVOA 2G9UA 1M5TA 4I4TB 5IKOA 3ZD7A 5DBOA 4FEGA 1OI4A 2COEA 2DKNA 4QNNA 3G3EA 2SCUB 4WASA 4BWFB 5CLFA 3UB4A 1XZDA 2L19A 2QUKA 2XT6A 3R7LA 4DBLE 4EG8A 1ZOPA 1MF7A 2QW1A 5FNVF 1LLDA 3LSYA 3UTCA 2WYHA 3ECCA 3KJFA 3K2IA 4FOTA 4KQ1A 2B8WA 1SVSA 2H31A 3PGXA 3QUTA 1U9ZA 5JCJD 4OQZA 1T34A 1IBCA 3QKUA 4E3ZA 1KRXA 3SHWA 4DZZA 4MKGA 1WDMA 3C6YA 1IB6A 3BD8A 1KH3A 1VCIA 3NNDA 2W22A 4UEJA 3BIOA 4KR9A 1IIRA 1V8OA 2FFHA 5LA6B 5B6IA 1UK6A 1BE0A 5AW7A 2PUFA 4D3DA 4KUGA 4BHTA 5JAIA 3RVKA 4LUCA 4M9QA 3I58A 1U04A 4KFUA 4KR0A 4RKEA 3UKDA 1ZBDA 2EFHB 2GYWA 3SYMA 1XMOB 1PCXA 4G5GA 1S8AA 1D9ZA 4FE7A 3CINA 1C0LA 2J09A 1BNCA 3AJ9A 3KQPA 3SX0A 1VP3A 3ENQA 1ZOIA 3ZHZA 2ESRA 3O73A 5DLYA 1QRRA 1RRCA 1GV1A 5B6JA 1QIHA 5NULA 1A95A 3TQCA 1ZJ4A 4QFDA 5IJXA 2HDOA 3UWPA 4E08A 4D0NA 5DM4A 4CKWB 1XNHA 1DKUA 2ZT7A 4XX0B 2WY2D 1JHOA 5DTEA 4KYUA 1WDTA 1O9HA 4W4TA 3B51X 2Y4NA 1X6VA 2FF7A 1CY0A 2JW5A 3DGFC 2V0GA 3O5AA 1HY3A 1AKQA 4A8JA 4I4NA 1KEWA 1TA9A 4JC4A 3KVYA 5K3BA 4F91B 2AD5A 4LJ6A 3GEEA 2GVNA 4QLOA 3ETNA 1BHSA 2I4NA 2JZCA 1AKRA 1SHJA 1T3HA 2PWAA 4O2AF 1RWMA 1USUA 4RU1A 4O1IA 1BCRA 4CNBA 1UPCA 1TMKA 4LE0A 3TVDA 1CRQA 2N75A 2O2DA 2QR2A 3Q12A 5KSPA 2EKBA 4GKBA 4YRLA 2XB9A 2LDBA 4K46A 6REQB 1NP7A 2IZ5A 1NLYA 3UEOA 2VJMB 3OWHA 3SG0A 4OCZA 3USCS 5ALHA 1XQ6A 3U6KA 3KOUA 3KT6A 4GHWA 3DAHA 2CJXA 4PSAA 3U1BA 4QARA 3WKBA 1FP7A 1VIYA 4NFSA 1FP4B 4E5VA 1OZGA 4DV1B 1KMHA 4M88A 5KSZA 2BUBA 2H4JA 2FQQA 4HHEA 5DTQA 2WAXA 1C7FA 1MB4A 2QZ9A 5EIBC 1BHQ1 4PC1A 4MV0A 4A1FA 2EC5A 2CYCA 3A1DA 4ZVRA 4US2R 2BMVA 3ZLBA 1H6BA 3CRVA 3CKMA 4LKRA 2QVGA 1LGYA 2YFKA 2BGUA 3BC1A 1ZVMA 3FUVA 3KBBA 1EVIA 3KXIA 4HYQA 1GGVA 3FTNA 4FIZA 3RASA 3E82A 4B3DA 2REXB 4G65A 3TFOA 4WFIA 1CJKC 2IHBA 4KUEA 3BWXA 4B74A 4WBNA 4AZ0A 1YVEI 1NN3A 3SKVA 3IKJA 4ETNA 3GLIB 1DKQA 4TUYB 1RCFA 1O0CA 3T7RA 2X15A 4GX0A 4HP8A 5CH3A 3DE5X 4Q4HA 1R6UA 4P4SB 4EJ6A 4IUCS 3REQA 4HV4A 2PFKA 5I7UA 1CS4C 3BK2A 1KTIA 1SXJC 3AI2A 4IIEA 1DXQA 2VHQA 4D9CA 4F5ZA 1EAMA 2DPYA 2YMPA 2QTZA 1QTNA 5D51S 2AFVA 4R7GA 3C4JA 1IEXA 3MCAA 4K8OA 1H0SA 1QIDA 2VWGA 3AF4A 3SXUA 2YV2A 1B0AA 3SYTA 3WWCA 4CEJA 4DTCA 1P73A 1B3RA 3HI4A 4DFDA 3OP4A 5LP6C 1JAXA 1GDHA 2FR1A 3P2IA 5HFAA 4HH4A 1SJ9A 4RDCA 4J3NA 2OZLA 2KJQA 1XCBA 4DUGA 4EO4A 4FILA 4L4YA 5DYNA 2CCGA 2GJSA 1J9EA 1QRAA 3NJ4A 3BIWA 1PFGA 4BVGA 5I47A 4AX4A 3P5SA 1WZCA 2BE9A 2IGTA 3VHLB 1TU0A 1HTTA 4HBZA 2ORIA 3AL2A 4UOEA 3A2KA 3G9ZA 2J4DA 4RKYA 4DWJA 2PKYX 1C7QA 4LYGA 4CDMA 3M4XA 2B1JA 3RIGA 3AF1A 3VPDA 5BV8A 3A10A 2O8BA 2NUTA 4X7MA 2CLSA 3UJHA 1GO2A 1D9XA 3TMAA 3R4VA 2FY8A 2FI1A 2PH7A 1J0XO 4PZYA 3ODPA 4PAQA 4Q4JB 3DO5A 1FP2A 1HE1C 2XT0A 4P4UA 3V5NA 1JF8A 2UZ1B 1T8RA 3IBGA 5EHIA 2MOKA 2XMDA 1ZZGA 3VX4A 1XKXA 2ZAMA 1DO8A 4WCFB 5ICSA 1BMQA 3FZEA 2P3OA 3LC1O 4WCDA 5TF0A 4QBHA 3L92A 3PQ3A 3R3YA 4KO8A 4OF4A 3GGSA 3QXCA 5DHFA 5HIMA 1WB6A 3FPLA 2R1TA 4PVDA 3TMYA 4CL0A 4EQZA 3HDJA 4IIJF 1II9A 1G7CA 3R5KA 1E7MA 1K92A 2HF8A 4WXEA 1N0VC 4G09A 4S3MA 5LZ2A 1UANA 1ZX1A 3C7CB 1PJLA 3L7OA 4EG5A 4F5YA 2QMHA 2UZ4A 2C2BA 1C2YA 2XB6A 1QQBA 3IUSA 3VV2A 3TUIC 2ZUSA 3OFNA 4JVSB 4L4ZA 4C2AA 4UCWA 3ZX5A 4YCSA 4JD5A 3WL8A 2X4IA 3HKCB 4MR9B 4XQEA 3AJEA 1RYHA 2GZAA 5KTYA 4A6XA 1YZ3A 1WV0A 3CZAA 3OSZA 3PUXA 2L0XA 2HHHB 4CKZA 1ND6A 4RFVA 4XYBA 1TPZA 2O3UA 4YMGA 4UNSA 3TRDA 4RVHA 4GG1A 1K89A 4RIGA 2KI5A 4MLPA 3MJRA 5HCIA 3R7FA 4DQLA 4ZICA 5IF9A 3EDRA 2RHHA 1N3BA 1OFVA 1VMDA 3A36A 3G89A 1W48A 4E14A 4B3SB 3ICCA 3K0CC 1C3VA 3L8ZA 4BMCA 3IFSA 4EDHA 3WAGA 3AF0A 1E0AA 1PR0A 2VUTA 3AYXB 5T8KA 1DJPA 1E32A 4C7BA 1DOHA 5K0BA 3PXGA 2UZIR 1L5MA 4GP7A 3MTJA 5CU7A 4RVNA 3ZZUA 1MPTA 4KITB 1KWGA 3IJ5A 4Q1DA 2JGJA 3ZE2B 1G6OA 3R6DA 5BN3A 2P7HA 2YHIB 3PE3A 2W0MA 5KKAA 3DDZX 1FS6A 3PC8C 4TKVB 3RIYA 3QWFA 4HVLA 2FPSA 4KSBA 1JEAA 4J49A 1U81A 2WMYA 4TMWA 1RZRD 1SKQA 4KNYA 1U28A 2IEIA 1AGYA 2J33A 3GGOA 3E15A 2QROA 1YK1A 2O14A 4IKOA 4US0R 1ZIPA 1VI2A 2DQKA 3BQ9A 2CMDA 4GU5A 1FNMA 2IW1A 2FLWA 1YV9A 3L6CA 3MSCA 3UJ8A 5AJYA 4P3XA 2A5YB 1RRKA 621PA 4YJ2A 4OATA 3I32A 1OTHA 3RUPA 1LWOA 3AW8A 2VBFA 4QOJA 3J7TA 4HFMA 2N0SA 2QA5A 4BWVA 3M70A 1WIWA 1UPAA 4UFPA 2FW7A 3EGXA 3ROXA 4JYPA 1DIGA 4OL9A 3H4TA 4L4UA 2G1UA 1RBQA 3O31A 1DLIA 2Z8ZA 3BZUA 2B35A 4F4DA 1A9RA 1C9KA 1UMBB 3IQGX 2C61A 3QWBA 1GOTA 2W37A 4XLZA 2HJHA 3GRYA 3T5TA 2C3OA 2OBBA 3AVTA 4WZBA 4RTKA 1JHXA 1Q21A 2WFLA 3IUYA 3I6QA 3H13A 3PHJA 4MZDA 2FR0A 1BRMA 3HJBA 4L3OA 1Z4LA 4GYWA 3VI4B 3WO1A 2WJJA 2PMDA 3FB4A 1UC5B 3EVTA 3F78A 1I4OA 5G40A 2V3WA 3WBBA 3OPYI 2PE5A 3Q6MA 1B93A 1D6JA 3SOZA 3WGQA 4B85A 1BW9A 4GLLA 5CCEA 3E5MA 2MJLA 4W9RA 5B1HA 4CLXA 5IAAA 2CFIA 5B3LA 3WJ7A 1M6WA 4CMEA 2IYZA 1VA5A 4UZEA 2FPMA 5AM2A 4W8OA 3GVPA 4I1IA 1OOEA 2R68A 3DBIA 1ZXXA 2IYLD 2VTVA 2NTNA 4EVQA 1NMEA 1NBWB 2VXCA 2ZRHA 4RESA 2DERA 1NLZA 5IT4A 4W7HA 1UPUA 4A10A 1QC5B 4L16A 3V6LA 2Y99A 2JARA 3LXXA 2A9RA 4D96A 2CE7A 3C3CA 4BDTA 3RSQA 4X1IB 3U9SA 3HUFA 5I4IA 1S9DA 3PPVA 4HATA 1GPYA 4HWPA 3S4YA 2DYKA 2FH5B 2PZ8A 3RBXA 3ZHUA 5B64A 1UM9A 3AP2A 1OI2A 4Z0TA 3D9QX 2BTEA 4BZQA 3HLYA 4LE2A 1H8HD 2P4QA 3S68A 5CDHA 1VL1A 2EARA 3IJPA 4GVLA 3EZNA 1FA9A 1L1RA 1LBIA 3DC2A 1HG1A 4LC1A 4PIMA 5HZGA 1II0A 1PS9A 5K3FB 2GASA 4XW2A 1OVGA 1KJJA 4BFYA 1EEHA 2Z1DA 1AXGA 4UTZA 4KOEC 2ZFUA 3VYTB 2ZBUA 3L4BC 1X3SA 2WFMA 1JIKA 2R65A 4S0ZA 4TMXA 5FA6A 2WM2A 4MVJI 3RANA 1Y5IA 3G7NA 3OCWA 3T4EA 1AGXA 4F84A 2VCYA 4X62B 5DT9A 3NJRA 2FZWA 4EPYA 1L8LA 2H5IA 1GRNA 2H1VA 3C5VA 3AETA 4IV0A 4G26A 4G63A 4IS3A 3P27A 3D6AA 3NV9A 4B7ZA 2QGFA 3FNFA 3Q4GA 1U1EA 5CNJA 2B36A 2CVFA 1FW6A 2D00A 4POAA 1GYRA 1Y5NA 3GPIA 4PTZA 2CLDX 4YK7A 3HXQA 4U6SA 3CNEA 2OBMA 2XB2A 3PTAA 2BFDA 4NYMR 1O89A 2DWQA 1BQEA 1Z4QA 4Q1AA 1A9PA 2IXAA 1U6IA 1GRRA 3G6WA 3GLQA 4OJQA 4OHOA 4QHYA 3ZWVA 1M2OB 4BVLA 5A03A 5KYWA 3HHPA 4O4JF 5THXA 1NVKA 2G83A 3DZHA 4QGSA 2OPHA 1XD2B 5SYNA 2IWRA 4Q03A 2D2XA 3OE4A 3USES 3VJLA 3H7IA 1B3BA 1CY1A 1JU3A 3H0KA 1QBGA 5EE3A 1JWAB 3TKLA 1VZ2A 1GNLA 2GDJA 4PAOA 3DV2A 4PWZA 5IT5A 5AUQA 1CFZA 3KL2A 3P0IA 1AKVA 1ZINA 3RAEC 2CLLB 2FN3A 2YRXA 2BJHA 4ZAYA 4L2IA 1CUYA 2ZB3A 2O1EA 2GJKA 1RPNA 3R6WA 1E9BA 1JXAA 2RIRA 2RIPA 3U4QA 1YDFA 3C8UA 3EXG1 3FDFA 1A2BA 3Q9NA 5GOTA 3D81A 4ND7A 1M2HA 3C3PA 4EARA 4MVJE 3C6MA 5C31A 1PK9A 3R0QA 1C50A 3EEFA 4NVRA 4F4CA 3WGTA 1J8MF 1FZQA 3NLLA 1Y33E 3KR0A 1J8DA 2ZR9A 3Q8XB 2ZRKA 4YI5A 4IDQA 3C85A 1CDZA 1SQ0A 3T3IA 3ZCXA 1JFTA 1IH8A 4MITA 3C8ZA 5G1OA 4BCDA 1BMTA 1W73A 4LDQA 4C0JA 3G9QA 5HNKA 1VHJA 1SBNE 2HO5A 4HRAA 2Q1TA 4J16A 4GZ3A 4J4BA 1IQPA 5YASA 1YDMA 4G4GA 3W8DA 4R0MA 1T1RA 4GYJA 2ZUWA 2JFZA 3OZFA 1KJZA 5DGCA 2JHCA 4HQOA 2FDCA 3CWQA 3FSJX 3CXRA 4PCUA 3KM0A 1LW6E 4Y2XA 1E5TA 1CETA 2DCMA 3HEBA 4DVJA 3ZTWA 1TADA 1L9KA 2XOXA 3DM9B 1XQ9A 3G8YA 3MJEA 4PZPA 1YL7A 1FTYA 1HM5A 2C9DA 1JQJC 5TSDA 3P2KA 2D2IA 5AI9A 1GZDA 3VO9A 3PCTA 4P32A 3EBPA 3KT8A 5DCYA 5L7YA 2FFBA 1PSZA 4EHKA 4FHCA 1DQYA 3F7MA 2UZ0A 3CHYA 4BBAA 3GRRA 1QKJA 1JQKA 1UBFA 3A27A 1NUHA 1Y3BE 4HD8A 1Y6JA 2WDPA 3CBGA 3CJTA 3MC1A 3JQCA 2IPOA 1VJ5A 2QVYX 4Y1GA 4G5QA 3FPHA 1OAKA 2H1LA 4ROTA 2XZLA 1RMQA 2GWHA 1U99A 2OO7A 2QYSA 3MQ4A 4IRMA 1JG3A 4MWEA 4PPQA 4U2FA 4D6PA 5JEDA 1XEWX 1WUJS 1ATIA 2GTIA 2JGMA 1EVZA 4MKIA 2FUCA 3Q0IA 4EOGA 1J39A 1C4KA 5GONA 1XZ8A 4V0MA 4JCCA 3AFNA 2QIOA 4ZT3A 5H68A 1UZNA 3V1TC 1TXGA 5AVRA 1YCFA 5IZCA 4I50B 5D3MB 4NC9A 4QUJA 3U3MA 1HT0A 2O4UX 1RYMA 5K9ZA 3GCWA 1W76A 3FHOA 4KRYA 4KHZA 4RF3A 1KK0A 1XHLA 2B4YA 1GT6A 1BDHA 1V1RB 4MMZB 3KDPA 1M6NA 4GXRA 1NU6A 4GP9A 2VZ9A 2CUZA 4LYAA 2OCXA 1UQRA 4K2AA 2QP9X 4L8LA 3QHPA 5LMZA 3JVUA 4LJ9A 3SFVA 5LDDC 2NZUG 1TCUA 3G1WA 4ZC1A 2ON6A 3R9IA 3DBRA 3J81A 3MRTA 5JE8A 3SNHA 4ZFNA 3CZMA 1SC6A 2XSZD 4IIBA 3OFJA 1KTVA 5DM1A 3VA7A 1PSWA 1QPBA 4EL5A 1A8IA 2ZXEA 1E7WA 1YRQA 4JI0B 1V11B 3H0CA 3V33A 2QL6A 5IUNC 3ICVA 4MVJG 2R79A 4P93A 3CONA 2GCPA 4ZXFA 2EKLA 1YA6A 3B6MA 2CDAA 3UV6A 4YHHB 3O82A 2GPBA 1ZCBA 2BGTA 2IF2A 1JKJB 2HTEA 2BISA 4F3NA 3TNDA 1JDBB 4TTVA 1A1SA 1M66A 1KGDA 4BFTA 3FYUA 4H4CA 1D09A 1T9GS 2R6CA 5JCOA 5K0EA 1UZMA 3KSUA 4HEQA 2JEOA 3SC3A 3F4LA 4K3UA 2C4UA 3CR7A 1E1RD 2IX3A 5D85A 4PCAA 1NBAA 2LP4Y 5HQ3A 2PH5A 4CQNA 1H4SA 2DH5A 2XECA 1Q7TA 3RS0A 1EVJA 3QELA 2FGKA 3RKSA 4PRZA 4U7JA 2BHLA 2JC3A 3IMEA 1RAEA 3HI6A 1OH6A 1IZ9A 1P91A 3IXLA 4HK4A 1JFLA 2YJZA 4EAQA 1W59A 2B78A 3ETDA 1LV7A 3PS9A 4FFBB 1IVNA 1I4EB 5IN5A 2VK8A 3KKEA 1GR0A 2OO3A 5HMLA 4ENWA 1EX9A 1Y8AA 3DTTA 2QDKA 1DRKA 2WNHA 4YGXB 4IKPA 7YASA 3GRCA 4DIUA 1ZK0A 4EKIA 1IM2A 1PWYE 2RC6A 1NUUA 1SUIA 1Z6XA 1GPAA 2Q3JA 4KAAA 3T5GA 5KIAA 3DDNA 4NMXB 2PO5A 2AFHB 3EZ6A 1WETA 5LYJF 1CY4A 1B8UA 3STVA 3WSTA 4AYTA 3OJOA 1PS8A 3IDQA 4OQMA 2I3AA 3NUZA 4XFDA 3THOA 4YS6A 1VYHA 3ZJTA 2VTDA 3BWYA 3WQRA 1GPLA 3CA8A 2CL5A 4ERXA 5TC4A 1KSGA 1O94C 1U0FA 5DN6D 5GP1A 5KYNA 5HOQA 1XZBA 4C4PA 4BUCA 2FOIA 4RWZA 4CKEA 2R8YA 1HEUA 1SKYB 1IN5A 3DEIA 3I4LA 3QFSA 3ZWYA 4N6OA 4W5TA 2R97A 4LE1A 1KFKB 3A1CA 1TB4A 3O8OB 2ZRIA 4JBLA 3H2HA 1RXYA 4PR3A 1YR1A 4YP0A 5JXGA 1ENOA 2WU8A 2GA9A 2GKSA 3VU9A 5KKCA 4LHZA 1RM4A 1NASA 2QXYA 3ML1A 4ITUA 1W9HA 2EJUA 3QUQA 1SQ5A 4PIVA 1WB4A 3M9LA 4JVLA 3WAJA 5BYBA 1UK8A 1FQOA 1ZFNA 4DA7A 1Z6AA 2J6HA 5CA1F 2XCUA 3K70D 2JJ1D 3I4CA 1IJKA 1U2EA 2Z9DA 2FPXA 4OQ4A 1VJ1A 4C0XA 3IO3A 2VZLA 4IVQA 4CMIA 5CYGA 3ERCA 1XP8A 3IPYA 4M1EA 4FHZA 3ZDCA 1TJPB 5I45A 2Q6IA 1FS4A 2AK2A 2DHCA 3BWBA 3HNOA 5D5PA 3WGZA 1SUCA 3PJGA 2JAWA 4PFSA 2VNAA 3OESA 2AA3A 5DOZA 1SCJA 1SELA 3A1WA 3KJZA 1LBTA 4NCHA 2FKNA 4AUNA 4FSHA 2QRNA 1XCOA 3VVMA 1QZUA 2E4YA 4DNOA 3N75A 2J32A 4MEBA 3HN2A 3TTXA 4YP7A 2IJGX 1QWOA 2HC9A 2Z57A 3R9WA 1RACA 3IMCA 5BVHB 2JZNA 1E7RA 3C5EA 3L7NA 3TG8A 4OGWA 2FFQA 3CO5A 3HR4A 2DTXA 5E4JA 3SJ7A 3HXLA 3S55A 1J1UA 1QQAA 1WXXA 4GM4A 5BUSA 3T1YB 3L5KA 3V7FA 1DEKA 4YO8A 5TQ0B 3WWYA 5AK5A 4RE6A 5JJCA 4CCWA 2MR5A 4WK6A 4QQRA 2X8JA 4PLZA 2QTTA 1HDRA 1K6JA 5DWQA 3X2SA 4G25A 3EFBA 3AEXA 1TYBE 2BV3A 2QTCA 3LNTA 3OHSX 4UVDA 3AG6A 1G55A 3T5MA 1PT8A 1AQYA 1WXEA 4DC1A 3E9DA 3EXEB 2GFHA 1ZHHA 2AN5A 2IYTA 1AMNA 2YN4A 2Q2VA 3HCDA 3K73O 4E5PA 1U7OA 3IT1A 3ZE1B 4NLLA 4DC9A 5HRAA 3HFJA 3KU1A 5B3KA 5IBPA 4D2IA 1QVZA 1H2HA 2HU2A 5IAKA 3HDTA 1TM1E 1G41A 2VH5R 3PYXA 5H82A 2QQEA 3EFHA 3R7BA 2O20A 1ECGA 2XOEA 1I5EA 2OAGA 3HV2A 4NH0A 4RPJA 1G3MA 5COAA 3WMRA 5JXIA 3SVTA 1CQJA 3SDSA 3FPGA 1MJGM 3IV7A 3R6LA 4UPDA 3HUTA 1MABA 1HE2A 3H17A 4NJMA 4B2YA 1CY6A 2QD2A 1W2HA 3DTVB 4L3VA 4IZOA 4ZAFA 5HGXA 2VA8A 1JS1X 2NIPA 1SULA 3ORQA 1EUZA 2XE6A 5BR7A 2BJWA 1HQYE 3C8DA 4F86A 2ZYAA 4FGWA 4LHVA 4AKHA 2YHBA 1LW7A 3GGJA 4JP1A 3PHIA 4GOND 5FBLB 3SI7A 2YVQA 5E6UA 2H1RA 1P18A 4OHBA 4I08A 3RTEA 4ZZ1A 2Q7OE 1MGPA 2AG8A 3K8ZA 3Q10A 4PHCA 3U48A 2SHKA 3DM5A 4MR8B 1SVLA 1DGQA 3R6GA 4Q9IA 4MA4A 1NUPA 2BFAA 3IEMA 1QHHA 1UT5A 1IUOA 3RJ5A 4FE3A 3MELA 4IEIA 4PX9A 1E9EA 1I01A 3VU8A 1M2EA 2GFIA 4CYMA 4DNQA 4WN3A 5BOSB 3O9MA 4HAOA 4XH9B 1KAQA 5C4MA 1TZ2A 2NN3C 1QRSA 3N0XA 1AZLA 1E1MA 3QVVA 4PGMA 4LIPD 2QBYB 4JWTA 1WB9A 5KVCA 1L7XA 2D1TA 1FU7A 4KXVA 2I6SA 3L4EA 3H6KA 2R6R1 1UZLA 4FFVA 1Z0IA 4O2AA 4PX5A 5UKDA 2G1AA 2Q5LA 5DNEA 3IDSA 1P81A 1RPTA 3GRKA 4PHGA 1F6BA 3K5WA 2PGOA 4WUVA 1GUDA 1WL8A 4M1SA 5DIFA 4DTIA 5JPCA 5B7PA 4I1RA 2WNSA 3E35A 4TRJA 1QZ3A 1YDEA 5E95A 3L41A 5HDQA 4IIXA 5KYUA 1YBFA 4CUZA 1D1PA 4GMDA 1UDAA 4Q7EA 1GPWB 221PA 4M9ZA 1VLQA 2W2MA 1QDUA 3H3JA 2H9YA 1J97A 3ER9A 5EZYF 1E6LA 4W8HA 5ABPA 2NO0A 4B34A 2I7XA 1RMTA 2MCFA 3OO0A 4L28A 2AI3A 4LXTA 5DOVA 5B1EA 2DUMA 4CZ2A 3QXHA 3D43A 4LXYA 3DBOB 1OT5A 4EX6A 1NBHA 2A3RA 1I6WA 2GHTA 3R0IA 2VYND 1DRJA 3BWCA 2VYCA 3M49A 2DUUA 4CLRA 2JLRA 3EG5A 1PFQA 1WBDA 3CF4A 1HOTA 3HWWA 1JAIA 1GUAA 2ZRBA 2C5SA 2RBEA 4LXXA 1JMVA 1HFEL 1JR2A 3FWZA 4MUYA 4OYHA 4RSHA 1KZGB 5FLKA 5HK8A 1FUIA 2P6RA 1JQ3A 4MRMA 1WVGA 5BSTA 4C4SA 1ZH0A 4ER5A 5E1BA 4C0AC 2YW9A 3WLTA 3F5SA 2C57A 1JECA 2PMFA 2VWHA 3M34A 3UBTA 3T1HB 4IILA 1ZAKA 2XOKA 4TLBA 3FCEA 1UAAA 4Z5XA 2GVZC 2PLFA 3LP5A 1S96A 1U0LA 4K2HA 4YQFA 3G1TA 1DUIA 2RHDA 2ES4A 1HYHA 4C4OA 4PYJA 4DV0B 1NRIA 1VDZA 1GQYA 2PSDA 2SICE 3KV1A 4AZVA 1YH3A 1Q95A 1DG9A 1FCJA 4N6NA 5AW2A 4AJJA 1G2OA 2D54A 1WQ3A 3FPEA 3WX0A 1SUWA 2VDLB 1NFRA 2XYGA 2HHJA 3QV2A 5CXUA 1M34E 1ICEA 5BR8B 4N48A 1COWD 2EW8A 3DMDA 4YUAA 3IKVA 3ROGA 2ZI3A 3W8RA 1BJKA 1IXKA 4KU4A 4WKPA 1VYUA 3TW8A 3H1TA 4H1HA 3HUEA 2BUCA 3ZGXA 3MFQA 1VGVA 2KW5A 1RI3A 2CDBA 2ID8A 4JLUA 1R8SA 3VR3D 4OG2A 4CM8A 3DTYA 1IL0A 2A5LA 2P3QA 4RD4A 1FFEA 1EUQA 3LVBA 2V7BA 4U1RA 3M6VA 4ESOA 4DJ5X 4YRBA 1KAMA 2P35A 4GQBA 2O7VA 3HU1A 1KC1A 2IDKA 4MW7A 4P3KA 5DP2A 2VHUA 5GJWC 4OHYA 3LPCA 1ZCZA 4I2NA 4YP6A 5K0NA 3N2KA 3AOGA 4MQBA 3G0IA 1X86B 4GMGA 2VP3A 2A58A 3BIXA 4BNUA 2IBTA 2J5BA 2Q5QA 2QLFA 4YBRA 3VJKA 4DQUA 5JNVA 1CQPA 2GN6A 2AJLI 4HG2A 2WTBA 2YFQA 2VPWA 3VHQA 1FJXA 4M55A 1E99A 5FV7A 3T3PB 4BLWA 4WINA 4MROA 1K8XB 3AEQB 1G3QA 4CLEA 2P6OA 1HNWB 3T4UA 1P6XA 1QF7A 3IVAA 1PGJA 3G5LA 1GAWA 4MHOA 1UFQA 4QYIA 4BS9A 1D2MA 4ECAA 3KKOA 4U9HS 1KIMA 3KYIB 3OZEA 4LGVA 1DO0A 4BMDA 4F1JA 1XMXA 2H59A 4WEQA 2ZPUA 3GAAA 4BQPA 3T0GA 4N8DA 4XA8A 3LPNA 4C7OB 3G5UA 1UADA 4RJIA 5C34B 3PJEA 3R3UA 4QFMA 3SFTA 1NMQA 1R3UA 3TLMA 2ODWA 1K6EA 3S99A 4F85A 3I12A 2NAFA 1USWA 1UXJA 3EF0A 3MIZA 4M37A 1UPXA 3AB8A 4RMIA 1F2UA 4AY6A 2DF8A 2NOAA 2V58A 4PFKA 1CJVC 2O48X 4AN0A 1P5FA 5JAHA 3DB1A 3IH5A 2YJTD 2CF6A 2ZR0A 4DQ0A 4ZHQF 4NESA 4PY2A 2HRBA 2X7JA 4E46A 1PL6A 2HREA 1FIUA 4K05A 4XGIA 3ZVRA 3QFCA 4Z49A 3CTMA 3GR6A 1ETUA 3H4VA 3LQKA 4JELA 4UJ3A 2HGSA 1G4HA 3VAZA 2XKKA 2NSHA 5ERYA 1FNBA 2FZCA 1QIIA 3O4GA 4TTRA 1Z9BA 1QGZA 5BXQC 1BOOA 4Q00A 2WKWA 1UWVA 4XB6B 3LUHA 2H9IA 2M32A 1ZNZA 1E9DA 4B45A 4ETMA 1X42A 3IUPA 1YOBA 1XJ0A 2WTXA 4QJIA 4W5NA 1I4TD 5TARA 1AXRA 2HDWA 2L82A 3A3OA 1OH7A 1YZUA 3AL3A 4BMZA 5IVHA 4Z9FA 2GD1O 2BKAA 1EM6A 4HB0A 4TXNA 3HA5A 2J5QA 5AFSA 2GRUA 4LZJA 4XWGA 3OX2A 5A62A 5ADWA 5ADHA 3WGVA 5CH5A 4S1NA 1MRSA 4G0PA 4R5HA 5DRYA 1Z7YA 1GGFA 3JAKA 4JOCA 2CXNA 2HMAA 5JQWA 1LPPA 4R01A 1H0HA 3C0KA 3CH6A 2PX0A 4KQFA 3Q6NA 4MUFA 5K7SA 5B3JA 2PXXA 3R40A 4KUHA 2ATEA 5HIIA 2VAWA 3KSAC 4V03A 5M7EA 3KKNA 1QKIA 1OPXA 1ZJWA 1WF3A 3RTGA 4KN9S 3MJVA 3TIXB 3PDCA 5H3LA 4BQEA 1ZITA 2W2TA 4WZBE 2JLSA 1KYVA 1MO3A 4P82A 4XRGA 1G7RA 1QH0A 4KWIA 1NURA 1EQ2A 4NFHA 4BMSA 2CBGA 1FBNA 3AIOA 3HCOA 4G8BA 5EIFA 3WADA 4I4TF 1SA0A 1XRMA 5DJ5A 4BNKA 5EPUA 1UMDA 4ZVUA 4RHTA 4AP9A 5KNDD 3ROQA 3O7MA 2X9NA 1AV7A 5ITZB 5C51B 3OFVA 1R88A 3E7WA 1M83A 2EKQA 1W29A 4G8JA 1QLWA 5DWDA 5FI1B 2NYAA 2XDAA 1I9CA 4ZVPA 4X8LA 5K8UA 2GN4A 3RHFA 1JIVA 3FFWA 5J2UB 1UC8A 1GPH1 1PJQA 5LA6F 5CA0B 1AGNA 4BFXA 1YBHA 2OCIA 4O4LA 3WNBA 1D8TA 2R5NA 3OTOB 3MINB 1NW6A 3ROTA 4DCCA 3JQFA 1QFMA 3W5CA 2V7UA 3FFAA 3BK1A 3K30A 4X5OA 2DBZA 4MRNA 3OZSA 2QJRA 1HPLA 2VT7A 1UH5A 5ALGA 3GBPA 4QFCA 1XC7A 1CHDA 1F8UA 2EATA 2QRZA 1XLTC 2FKAA 2ZJ1A 4GPZA 3S2ZA 3GRVA 4EBFA 5LZ9A 5I48A 3LQRA 3IUMA 3PEYA 4U0KA 5FPYA 1EWVA 4TM7A 1F5SA 4JUBA 5EWLB 4KN8A 1JXMA 1VBNA 1XRLA 1YGYA 2OGWA 2XAAA 3CVJA 1BN7A 1FDTA 4HQ6A 3UAWA 3ZJ4A 5G4LA 4AXXA 2B8NA 4EI9A 1ID8A 5A71A 5JJ5A 5JC8A 1JFSA 4C6HA 1Z7WA 4LY9A 1G3IA 5CYOA 5ARDA 1U2TA 1C81A 3GLIE 3DEHA 3K6SB 3PNSA 3TLYA 4ZCSA 5K6AA 2IFTA 5J4KA 2JGDA 2QX4A 5GAJA 4LDRA 1M8GA 3F7TA 2B21A 2ZITA 5HCUA 2ZTLA 4KXYA 4EF4A 4YROA 1WMFA 4EGSA 1T1GA 2RGEA 1Z88A 3LBIA 3GLHE 1I0IA 2X76A 2X4LA 1P4RA 4V24A 1GZ5A 1MAVA 1YIOA 1IMJA 1OAOA 1ENZA 1VJ0A 4FLEA 4GO1A 3U3JA 2J5RA 1QG4A 3EISA 4DMGA 1HR0B 3SHTA 4JLOA 4A2CA 5LP6F 4P6VF 4QOFA 3DW1X 4Y1RA 4EB6B 2XUKA 4FMBB 1Q22A 5IT9A 2ERCA 4C2UA 5JAQA 4Q01A 1CUIA 3SS8A 5IYZB 2XV1A 1XTKA 5DEIA 2H2IA 1NULA 4BP9A 4GI5A 2D7CA 4O4JA 1EQUA 2GJ8A 2JGNA 5HIAA 1RE0A 4IWNA 1C2TA 2JEZA 1X13A 5BNWA 4Q82A 3WL7A 3I2HA 1Z4KA 5ARCA 2IWHA 1R0CA 3ILYA 2RH8A 2V7TA 1ZIDA 4FGKA 4GWLA 4Q93A 1UOOA 1T9KA 2AMJA 3L02A 3ROKA 3RRFA 5B1SA 2X42A 2A9VA 2HF9A 5FWYB 3WIEA 1MOSA 1LU9A 2GBGA 2JIRA 4DCGA 3OC0A 4RPCA 4DF3A 4P4TA 1GD1O 1GAXA 3MTQA 3G02A 2GWRA 1S2GA 2P65A 2F00A 3L7MA 4GM1A 4M0EA 3U9TA 1UJBA 2AX4A 4TUYF 4MVJD 1LTHR 3T5DA 2TECE 3ROZA 2FX2A 2EJBA 2MSEB 1QG0A 1IN1A 2M98A 2VP0A 1QGDA 4J7AA 4GT1A 5I8PA 5JDIA 2O5CA 3GBSA 4GX2A 3RSLA 1B43A 5LBIA 2IV3A 5I9IA 1WTAA 2G3YA 3WWZA 3ZIAD 3HB0A 4YYZA 5C35A 1BJTA 1TF5A 3P0EA 1C9YA 1RJFA 5F73A 3FCUB 1QHXA 1G8GA 5BN5B 2FRXA 3N6VA 3HYLA 3C39A 1ZD4A 2ZWPA 3EQ7A 1V35A 2EZ4A 3RTCA 3UXYA 1W88B 3CLTC 4WOKA 3EWIA 3KT0A 2N42A 1T6BY 1LNQA 1XO1A 3MJCA 5AXBA 5BOVA 4JI1B 3D3KA 4C0WA 3CVUA 1YASA 1SHTX 2OCGA 3OZAA 4B76A 1NXWA 2N1BA 2QUAA 2GK3A 1P80A 3DL2A 1JQLB 3V7UA 1EESA 3FYSA 4D41A 1DTSA 1G5PA 1EGQA 3KTAA 2JCVA 1KDVA 5FRDA 3W5IA 3AVUA 2CUNA 1B23P 2I4OA 3QJGA 1KY3A 3KXLA 3HABA 3A4NA 3WO0A 2B2CA 3DXFA 3KQVA 2DHRA 3QMWA 1B0ZA 2ZJAA 2QD4A 4H7IA 4GD3Q 4GXTA 4KTTE 5JXWA 4CMAA 1ZN8A 2EDCA 1JU9A 2Q8QA 3G0GA 4M46A 4WESA 1IHPA 4X64B 2Z4RA 4LNAA 4F3YA 4ZZ0A 2PUTA 1SO8A 1TYCA 3SY8A 2VVTA 4C88A 4W9NA 2PZLA 2JAQA 3CLRC 2XWPA 2AQ8A 3JD4A 4ENUA 4W1PA 1E59A 2F1IA 4IPTA 3ZY3A 1UBRS 1IU9A 3HBNA 5SZJA 2RGNA 2MSKA 2K2QB 1GN9A 3DZKA 2YJ4A 4RF4A 1FFDA 1ZCFA 3FAZA 3I92A 4O29A 4FYKA 2CDNA 5DLQC 3NYRA 4BZWA 4S2UA 1XVAA 3E9RA 3DL7A 3KZVA 1WVMA 1RKUA 2M1XA 3LY9A 5A6SA 5H3HA 5IJ9B 2Z3WA 4BEVA 2CMFA 3NRCA 3KOOA 3TXAA 3QYFA 5EUQB 2ZDQA 4Z0NA 2JCSA 1FDOA 4W63A 3OCZA 2XNKA 3NWJA 5DBHX 5GY7A 4BRWA 5AVQA 2UXBB 4YAEA 3KHTA 2AZTA 2Q2NA 2ACKA 1ZNQO 3M5WA 1N5MA 3B89A 3ZLVA 1GADO 2HRCA 4C29A 3BH0A 4BFWA 3ELDA 1G2IA 3H1GA 1A9OA 3KNZA 1GTL1 1ZM4A 2GN8A 1AJEA 1KL7A 4TZTA 3X1YA 1E60A 1J2RA 3F6SA 3G2JA 1N5DA 5CNKA 5K3EA 1F7UA 3GLVA 1PQUA 1WDKA 3NHJA 4RMNA 2ZW9A 1JG1A 1A4RA 3EYAA 1IN6A 3D4PA 3QMVA 1WBBA 4MWCA 4DXAA 1SCDA 2OXIA 2FW6A 4UU0A 4IKEA 4GSYA 1CNEA 1I24A 2KE5A 3II6X 4XM2A 5G4KB 3ZY5A 3HNRA 2FFRA 2PGDA 4EI7A 3ITNA 2OM6A 3R0XA 1Q57A 1XQWA 3FMOB 4YRNA 4JVMA 5ALVA 3BGOS 1E2HA 5EHQA 4EB0A 1L4KA 4KG7A 2PWZA 3AP3A 4FMDB 3E7XA 3S2FA 5JSQA 2GF9A 2JA2A 4TV9B 3T3EA 1V4NA 1ZUNB 3HYNA 4LMRA 3CR8A 1KKLA 2ZJOA 4I3GA 2CC2A 5DCWA 2BP7B 3VR5H 1WUTA 4KPFC 3FPBA 1Z68A 2QW0X 2QLMA 3AGQA 4P3NA 2HZBA 1EFDN 4JJKA 2YHSA 1CZRA 1SKUA 5EQDA 5KS2A 5ADUS 4HNAB 1FDIA 1V7PC 3ZZ1A 5J47A 1FVOA 2RGYA 4RS3A 3U9LA 2BD0A 3H8JA 1GFSA 3I0ZA 3OPVA 2I66A 5AHXA 1RRVA 1AHNA 3OZTA 1JEQB 3NOVA 3C45A 2P9JA 4QBGB 4TMVA 3LY7A 2VYFA 5KYYA 3NFYA 2A9QA 2J9XB 4LN1A 3ZH2A 1JJAA 4FLMA 4JLDA 4XLTA 4ZCLA 4HDNB 4CCAA 2ZB2A 3IQXA 1FRNA 1YCHA 1L7QA 3OIVA 4TN1A 3GEMA 3PXEA 5CW1A 3GYBA 4JIMA 4MH0R 2XUGA 4D4MA 3KFXA 3GLGB 2VJCA 1TK3A 1U0RA 4KQCA 3B9PA 3BFVA 4IOMA 4F0JA 1U02A 2D5CA 3HH8A 3H9BA 1EFLA 1OWMA 1G64A 3ANTA 3PT9A 4MKRA 5LYJA 4D5EA 1KE1A 4ZT5A 1W25A 4DA4A 3PSHA 1QUFA 1BA3A 1PWEA 2WZQA 1TEZA 2A8YA 3HNPA 1PZMA 3QF7A 1M73E 1TGYA 3VISA 3A0RB 5BSGA 2AHOA 4AK9A 4EF6A 3UNXA 2R7MA 2Z4SA 1SUFA 3UATA 4JODA 3F6YA 1GPNA 3H5WA 4XQ0A 1R4MA 4HUTA 2RGRA 4MGYR 3GMDA 5F51A 1W6UA 3UH0A 2ZRMA 3CW2A 5F1YA 1JFVA 5GIPE 3M1IA 3ECAA 3Q5GA 4UUQA 3CYFA 4ZVLA 1FJGB 2PU5A 1XMSA 5KOJA 5KNCD 4GSKA 1J8QA 4MS1A 3TLCA 3EMBA 1P74A 1P2UA 3EGWA 2D4HA 1FL9A 2VDWB 3MT0A 1SCAA 5KVQA 4UVIA 3OEHA 1ES9A 4PG6A 4QPDA 1GTMA 3AHGA 3GZJA 2P6NA 2PSSA 2QUIA 4NBUA 3V1UA 1TRKA 2WM8A 3B6ZA 4E4TA 1E2EA 1H0RA 2VJDA 3DMRA 4ND2A 3UMBA 3HCAA 3HB4X 5IC6A 4AN1A 3KZXA 1NQWA 4HAIA 2NYRA 1K75A 2B3DA 3HUDA 4ZQBA 4XKJA 3ACBA 3E7PA 1YZLA 4Y1FA 4N47A 3NGXA 1H9AA 1OA0A 3B1ZA 2WWVD 4DLPA 2K6GA 1KQNA 3VR2D 3UMMA 2IUTA 4YAWA 2QRPA 1UBNA 5DSTA 3AMVA 1DAOA 2VQ6A 4B3CA 4ND4A 5TPZD 1YUMA 5FORA 1C8KA 2GKGA 3AQIA 4LX0A 2W2KB 4P7FA 3RC9A 2IDMA 2DJIA 3ZI0A 4P92A 2CHQA 2E89A 1M0TA 3JZAA 4NBRA 1W1WA 4LCBA 4E13A 2HFJA 4N5HX 1I80A 2WNIA 4KBFA 4BKPA 2GUWA 4TYQA 2CJPA 1A4IA 2I29A 1WF6A 1SKAA 2PS1A 1HKHA 1UUFA 4Y2QA 3H84A 5FBQB 4EATA 1OLOA 1FFAA 3PFKA 4BRZA 3JVVA 2C84A 5IAOA 1ZUIA 3I1FA 1IVYA 3O8NA 2P67A 2OV6A 3OT4A 4CT0A 1UBOS 1F1BA 2R7AA 1I2MA 3HN6A 3LUKA 1OYOA 3T9BA 3FWKA 4ZT2A 3L43A 3R20A 3VC1A 2AWNA 2FMFA 3AI1A 3TIGA 2WG1A 4GQIA 2OQVA 2G04A 5D5HA 4OLBA 1AUPA 1Y3FE 5E7MA 2VT3A 1L5NA 1L4UA 1JYFA 2W6OA 3KLMX 4R0NA 5A9SA 2FZLA 4DNPA 2HADA 3T0FA 1Q0LA 2J9FA 4K6OA 3CZ4A 4JHLA 2EX0A 3EG9B 2GTHA 1RWBA 2ZJ6A 4G07A 4JJFA 4O1HA 4AF8A 1IY0A 1AUQA 2R8EA 3OQ6A 4BFUA 3N0TA 1PJBA 1RYYA 2PX6A 3NWPA 4ZVVA 4X45A 4POOA 3S29A 2WF7A 3HDGA 1TIPA 3EOAI 2QAIA 3MTAA 4I1VA 2R00A 1U65A 4NZPA 4OFWA 1BGWA 2BTQB 3HY3A 4REQA 3ZCRA 5KOYA 5DHTA 5AK4A 3DOHA 1KYIA 4J1SA 3QKTA 1HF3A 2FR8C 3QVLA 3VPXA 1HRKA 1NLFA 2Q1XA 5H81A 4BJ6A 3EC2A 1RADA 1PR4A 3L8DA 1BAPA 1IDOA 1Z6ZA 2VT2A 4TZKA 3GVCA 1EQAA 1N9ZA 1UQUA 4LX8A 5DLDA 3C6QA 1F60A 1B8VA 3NBXX 1MV5A 3PD7A 4AXBA 1NI4A 1IOVA 3K53A 5DGIA 4LWZA 1CP3A 2XVXA 3CSUA 1SAYA 3L01A 1SBIA 2W8BA 4NENA 5AXDA 1I3KA 1KP9A 2E1RA 2WD9A 5KDLA 1ZJYA 1JUDA 3VGPA 3THWA 2BMAA 3KEMA 1HL3A 1T36A 2FU5C 4OHMA 4D6YA 4R2JA 1J56A 2IS2A 1WKBA 2ATCA 4KVFA 1QQ6A 2CMKA 3A3YA 4OREX 3DVAB 5ICCA 2PH3A 5FWNA 2VQEB 3IAAA 4WK0B 1MV8A 3H9EO 2F2TA 3HCCA 4Q6WA 2YXBA 4COOA 4M0DA 4AD8A 4OAOA 2LRHA 1HA3A 3JWHA 1Z0FA 1ZK2A 2C2XA 1ZKDA 3MWGA 1AO3A 4GZ6A 3WS7A 4NXMB 3PTZA 1ESDA 2ZTVA 4EGCB 1TQ2A 1BE8A 1WV1A 4HGPA 2E6KA 4D56A 2ZUCA 4Z9BA 1GU1A 1HDCA 1PI3A 3I6MA 4G5SA 1U8CB 3DMHA 3U7HB 1Y6GA 2FUG1 2BYTA 4PX3A 2AOTB 2H1IA 1JHVA 1SCQA 5FEUA 2O3RA 2ZM5A 1UDWA 4RHEA 3HDHA 3JV7A 1R66A 1TW3A 3HACA 1JEJA 3NP9A 4Q3CA 2DLNA 5ICMA 4XR4A 3UAZA 4QGFA 4CDGA 2FTKE 1NQUA 4R81A 1HTWA 1K68A 1FYVA 2IELA 2CZCA 1ZL2A 3B20A 3FMPB 2GD2A 3LYLA 1Z13A 4WNAB 2GESA 5EZYA 4BCBA 3WQHA 2ZSBA 3BE5A 5IXSA 4P7KA 4G8CA 3K9HA 1A72A 1IRXA 2VJQA 2Y66A 3LC2O 3FETA 1PT7A 3MTBA 4I50F 2E37A 4L8GA 1Z0KA 3NR2A 5M34A 3T5PA 1I3NA 3D54D 4E33A 3HN7A 1TEHA 4K1XA 4OXQA 3W9UA 1P2DA 3R1IA 1K7SN 3B6EA 3CB2A 5ESWA 4FHGA 3KZMA 3QV1A 4D26A 2V3VA 3JATB 4OK3A 1KYXA 3TSYA 4BB5A 5A3VA 2G0NA 2W93A 3FCYA 1D8AA 1D0SA 2PUCA 1UJ5A 2C7BA 2P2GA 3D6HA 4DSTA 3M3PA 4LVOA 4I4CA 1JSRA 3RF6A 1P8AA 1QUEA 4KQWA 3PHCA 3PHHA 2EWVA 1TJ4A 4PR0A 2I7CA 4EECA 2W7TA 1JDTA 2O2XA 1E9VA 5EFOA 3UICA 4QXMA 4XB2A 3QU7A 1CR2A 3NU1A 4LY0A 5GV7A 4OUKX 4EG0A 1UBUS 3FUWA 3NALA 3PUWA 1UKVY 5BWNA 2ZIFA 1NNI1 2FDXA 3KPVA 1ZLXA 2H3EA 3STTA 2MYTA 1NP6A 2PO7A 2BEUA 3QTBA 5B4VA 3D0QA 4ND8B 4BCCA 4V1CA 1JYSA 1QLHA 3I73A 4MK4A 5AI6A 4OI2A 4DUGD 1KDOA 3VPGA 5AOVA 4YV2A 3HP4A 3X1KA 3DOOA 3BGDA 4L9SA 4EFNA 2OGZA 3AOEC 5LKRA 4RJKA 4TQGA 3QTTA 3SE7A 2NV2B 5F2NA 5H80A 4H7KA 2V4UA 3BEDA 5KDOA 5JG7A 2FK7A 1ULAA 2IYPA 2NTVA 2GXSA 4LC0A 3U7QA 3GFOA 5EP1A 2C2ZA 3ZTYA 3A9SA 2LZ0A 3H7AA 5FFFA 1DKRA 2ZB8A 3EA0A 3FTDA 4JLKA 3VX3A 2C9CA 1QX4A 1HTBA 1OGYA 4ODIA 2G71A 4QYSA 3SX4A 3WL3A 3JWGA 4XZ3A 5F2EA 3ZHYA 3OOYA 4RM3A 4X1KA 2YWJA 4HLCA 2CLMB 4L07A 5JADA 1LDYA 3F3YA 2P4UA 1TRHA 2P7IA 3SHOA 1UWKA 3TAHA 4YRGA 3R9XA 3A7EA 2C4VA 4B3GA 1LDEA 3B13B 1R5OA 3K0AA 3TM5A 3VDMA 3W0LB 1Z0ZA 3S28A 3V1MA 4YPOA 2V7QA 5K0TA 3KTOA 3D1VA 1MAHA 1TGVA 3WLFA 4MNTA 4PO9A 4QUKA 1XQ1A 2BW0A 3ETCA 4Y6GB 3LF1A 4OFXA 1RS0A 5KTRA 3BTUA 1XVUA 3EEYA 1JAZA 4LF5B 5EE5B 4YRMA 1A98A 3KUDA 4II2A 3OFND 2QX8A 1YQDA 4J0QA 1JLLA 5CT9A 1M2GA 2BEWA 4KMOA 1MO5A 4EI2A 4H35A 3LPDA 4MICA 4GF5A 4JT8A 5L3ZA 3IHKA 1JGTA 1WKCA 1WUIS 3QX8A 1A8QA 2FQWA 4KQJA 3YASA 3AJDA 3LECA 2F64A 5A7FA 3IP5A 3ZNOA 4YTEA 3A2LA 2YY5A 2X6TA 2ZSFA 2JNWA 1G20A 2H6EA 2JVJA 3OEWA 3VNRA 4DR3B 2ZQYA 3INNA 2GNPA 3AUKA 4X63A 1X1TA 4JXXA 1DOZA 1S7GA 2LCIA 5AOAA 2HZ7A 3BMOA 1G8PA 4DM3A 1K5DA 1U4OA 3MOIA 4Q15A 1I4DD 4F2GA 3T1TA 3ZV5A 3Q0TA 4D9EA 1R2QA 4R1SA 2VUHB 1D7AA 3GRPA 3I01M 4ZHQA 3GOQA 5DHQA 2V3CC 1T9HA 3HYSA 3JTEA 3MTEA 2XITA 5E6SB 2C97A 9MHTA 3PYMA 2XTJA 1MJFA 3BM5A 4FPXA 4NEHB 1WEKA 4O25A 3RT7A 4AIRA 5JC1A 3HXOA 3LYAA 2WAMA 4UW9A 5DHSA 3S1LA 4EW6A 2LVBA 3LT2A 1SCNE 1WCIB 3BHIA 3TAXA 3DT9A 5GVSA 1YB7A 1XVVA 3DYVA 3EF1A 4OHKA 3RC7A 4YR7A 2DFKB 1AN9A 5HJEA 5A4IS 1DBRA 3N6XA 1SCBA 5D8DA 2OC9A 4QUGA 1D2CA 3D8TA 4DMHA 5A5EA 3RFVA 3HDQA 3B2NA 2J87A 3W5HA 1NXXA 4B83A 3VR4D 2J4CA 4CTOA 4E31A 1UF9A 4ZO8A 3MWFA 3ZE7A 1E62A 3BHMA 4W1RA 4KV9A 4RAOA 4JQCA 4Y6SA 4DMLA 4INAA 1W85A 1IHOA 4DMMA 4U2CA 1PV2A 5AQ1A 5ALJA 2FEOA 4MW9A 4WERA 3ZS9A 3G17A 1MZVA 3U49A 1T4CA 1F38A 4EEKA 3U39A 1DADA 1Y98A 2J3IA 3I42A 5BV0A 1YQ9A 5JYDA 2O8FA 1EIWA 2EYQA 3RS8A 3FVRA 2Y0DA 4MB2A 4RNDB 3W8FA 3GA7A 1BWPA 3P9QA 4Y7CA 1YJ5A 4CUJA 5A0VA 1LPSA 2V54A 3IKMB 5ALEA 3IP8A 1PNOA 3L3BA 2DU8A 4I4TA 4EJSC 3J7AC 1T2CA 1Y5LA 4X90A 2ETXA 2IYOA 2SCUA 3LUJA 1JHQA 1UKYA 3WL4A 1K3TA 3CRZA 4B47A 4CIWA 2H1HA 1Y1KE 1XF1A 2P8JA 4A4DA 4N8EA 3R09A 5E1OA 1NVFA 3W77A 4EG4A 2OSVA 3QPWA 4RD6A 3R75A 1KQOA 1IZYA 3B3GA 3MTGA 1IHDA 3EMDA 3I52A 1TDJA 4OHVA 5T67A 4B6GA 2VCEA 4TXHA 3BDVA 3W1WA 3WKDA 1ST3A 3KQQA 2R2GA 3AJ8A 1Y1QA 3OOHA 1OI7A 3RC1A 4ZXPA 4BZZA 5KSYA 3OQJA 1NJ2A 2JI6A 2FEKA 2WD7B 1M2KA 4LNHA 2ECPA 2I6GA 3AUSA 4FEYA 3C4VA 4PU0A 4K6KA 3L4KA 3TDNA 4GMFA 2GZMA 3JARB 1W8DA 3DEAA 3E53A 3P2EA 4X92A 3ZZNA 3SQLA 2V74B 1O4WA 2WVAA 4YIKA 3WQBA 2WAYA 2BWJA 1BTOA 1FNCA 2RGAA 3CX4A 5DYYA 2B1IA 1U9CA 2ZR8A 2B0JA 1CVLA 2CXTA 4JSRA 4NCKA 2GZRA 4QREA 1YUBA 2J46A 3KWMA 4OFZA 3N39C 4Z4EA 1QJ4A 3VZBA 3U7GA 4C4YA 4P08A 3T35A 5LQDA 1V26A 1VMEA 2C8LA 2ZB4A 5EJAA 1L3BA 4LS3A 1V8FA 5KHLB 3TR6A 1QHGA 3SM9A 5F76A 4CKWA 5GZ1A 2PGNA 3CCBA 4UZFA 3JVEA 4HAVA 4XX0A 3RU3A 4GDFA 1VJTA 3AEZA 5AVWA 4CIDA 4MGHA 1X7XA 3MAJA 2VNKA 1Y34E 3BXPA 3OKFA 4L5BA 4PSKA 1E6UA 1USIA 3RUEA 3IIMA 1I7NA 1UJMA 1X3LA 4MKFA 4R7TA 2I6XA 1O9GA 2I2DA 2YIDA 1TUEA 1TZBA 3CUTA 4JH0A 1LV8A 3A2NA 1US8A 2O19A 2XH8A 5FUBA 1J2TA 1HUQA 4GOJA 2LR0A 2QMOA 1M2WA 4I55F 4L5IA 3G7SA 4NI5A 5CVDA 4Y0NA 4BNNA 2FPLA 3Q7QA 5F7OA 1UZAA 4G2NA 3I2IA 2WG2A 2Z6VA 4IXMA 5TVGA 4AKTA 5I7RA 4KZPA 6REQA 3MVEA 4IGFA 1OF1A 2H5JA 2VATA 1SB9A 1S1CA 1TJNA 5DX8A 4IQ0A 4UCXA 4XI9A 4ZTBA 5FADA 4JC0A 5GGXA 3HVJA 2EBHX 2H65A 3LG2A 1G6KA 1EWKA 1PYOA 2CFOA 3HA7A 4HY3A 3UF0A 4B0OA 4MI9A 4KRGA 1ULSA 3UPUA 4FP9A 4MVJP 4DV4B 4B79A 2WWGA 4JJIA 3QMPA 3NC0C 4Y2RA 1DLJA 2AUMA 4L8FA 1R6DA 4BLVA 1WXQA 1XLWA 2VQ3A 5KOHB 4RACA 3GLTA 3ZV4A 1E2PA 3VSAA 4F7WA 4INPA 4Q3KA 1R0RE 3AHJA 5CDFE 4AMZA 1T1IA 2Y92A 3WG9A 4AKEA 1ZIXA 4KC0A 3VNQA 4O63O 4UD6A 3KB1A 3GLIA 5LOVF 4CF5A 4TUYA 3RI3A 2XTZA 1JG2A 7REQB 1KARA 1D1SA 1OSNA 4NONA 3NM4A 2DHEA 3WLJA 2ZBPA 1GZ4A 2PAAA 4YA6A 5EMMA 4L15A 4NMHA 5KINB 1FPMA 4K9MA 1LSJA 1QAMA 4YHBA 4M1WA 1EVKA 3LK6A 2BDEA 2IIPA 2ONCA 5KTMA 4PYNA 3DLTA 3HWX1 3M6WA 1TZJA 4MQ4A 2W6MA 3JY6A 3WFZA 4MQMA 4RM2A 4QM7A 4E3WA 5F77A 2ZXUA 4BO4A 4UM8B 1Y5MA 1EFCA 1MEEA 1NF3A 1E58A 1U8YA 3A28A 3D0RA 4HDMB 2BKUA 3RNLA 1VGQA 4WNIA 5AXCA 5BN4B 4Y6RA 5D2CA 4ND6A 2Z58A 4AICA 3HVUA 3HJCA 2HX1A 2JRLA 1VHTA 4IDDA 4B3RB 4CTNA 3TQFA 6Q21A 1V9SA 3OCYA 2DAPA 1TJYA 2HJGA 4ON9A 2E2WA 1SBQA 2EP7A 3RRXA 3DP9A 4QT0A 3TB4A 3WDKA 1BEUB 1MIOB 1ZH2A 1ZM2A 4KNVA 4U4AA 1P75A 1GGEA 2PGXA 1YB1A 2GPYA 4RVFA 1AKMA 3N3AC 1EFPB 3UT0A 3U3XA 1U94A 2B4KA 2PWYA 1IUPA 1BQ4A 4S1OA 3UYKA 1Q5PA 1ORWA 3ZWBA 4LVNA 2BSQA 4XPZA 1HOXA 5EMNA 2W42A 4XXHA 5EYPB 2UZ1A 3RROA 4CLHA 3NKLA 1QH9A 2IPNA 3I23A 3M2PA 4WCFA 3VTZA 4BLRA 5JLAA 3BG5A 1Z4JA 4ER7A 1NRWA 1QH8A 3RS2A 3RS9A 1VKRA 2X77A 3LNCA 1ORVA 2QMUA 4AMUA 2GXQA 3V3TA 3IOBA 3MEQA 2SNIE 4HAWA 1OC4A 1PNVA 1I51A 2NPIA 1BVUA 1GITA 1F9EA 4CMCA 5K45A 1MJHA 3ZGVA 4C4RA 3KJHA 1W581 5C8VA 1UMCB 4B4OA 3RS4A 5AK3A 1YTUA 4OU4A 3ONVA 1FRVA 4Z1OA 3SYKA 3O83A 4LF7B 3KAQA 4Q66C 5AKXA 2OL4A 3PQ5A 3HJHA 5EJ2A 4OX9B 4FW9A 1NVEA 4FFNA 1XEAA 1K6MA 1Y8RB 1VL0A 3QG5A 3K5HA 3HKCA 1JSXA 3L8GA 3EAQA 3ITDA 4MR9A 4BNYA 4QDOA 4FE4A 2QMYA 3A6KA 4UEWA 3UMRA 2AW3A 4EDFA 4DMRA 3TBKA 3H3FA 2L18A 2AC7A 4HNRA 4IBOA 3DFZA 4CUKA 1KSFX 1VC2A 3DE6X 1YKFA 2WJ4A 2A35A 2IHJA 1ZVKA 1HE4A 2J07A 1K7YA 4N54A 2H5LA 2OV8A 2NACA 3E58A 1X70A 3I53A 2HMSA 1YDWA 4CL3A 1GSHA 1UBKS 1YE3A 1CSEE 3KCNA 5IARA 1YE8A 3E8SA 1XZKA 3LGAA 5DULA 5G2OA 2CNWA 2QD5A 3KYCA 5JQGA 1QE5A 1R0YA 2G36A 5E1DA 2BGIA 3ESAA 3PNQA 2DFLA 2VUIB 3IP6A 5B37A 3DAYA 4GEGA 3ISTA 2UUBB 1F2VA 5K2MA 3OJWA 2BFFB 2YINC 5GQSA 2CNBA 2YVKA 4ZCPA 1IK6A 3FTEA 4TS3A 4K86A 1XZMA 3TBFA 4HRVA 1UR5A 1WKVA 3MERA 1ZC3A 1FFGA 1JSCA 4MI6A 4ZU1X 4B7UA 1F6WA 1CJTC 3EXHB 2GJ4A 3GROA 1I1HA 3QPAA 4NBVA 3PWKA 4PZAA 5ECYA 5B30A 2PUDA 2YHIA 1T5BA 5FPTA 3TLJA 1PQYA 3IMFA 3ZHXA 3IDAA 1YRLA 4NCAA 1MO4A 1YJQA 1AGRA 3R7WB 3WNCA 2I62A 4DV6B 4XYGA 2OK7A 5AR1A 4CKCB 5CM9C 1F8GA 3OE1A 1VB3A 3IB6A 3M4ZA 4E70A 2OBXA 4TRNA 1KI8A 2VL7A 1FUEA 3GUYA 1BIFA 3M6FA 1AA6A 5REQB 2W6NA 1IOWA 2HXYA 4TL6A 2JGAA 4TKUB 3OOSA 4ABYA 1U7WA 1V7CA 5EXXA 4IS2A 4U6QA 1FFYA 1U9IC 3AUJB 1CVRA 1Q0UA 3JRXA 4A26A 3BREA 1IG0A 2DOKA 3JPWA 1AK2A 3Q15C 4LSWA 1N1GA 1NDQA 2OWDA 3EB9A 3O8BA 5T7BA 2VTKA 1MUUA 2IPXA 1P4GA 3FJ1A 4L22A 4UAJA 5HFJA 4ZKEA 1XZIA 1GY8A 3OY2A 2UVQA 4QOEA 4L7VA 2EOAA 2D5AA 5BW5A 3K9FC 1A2KC 4RZUA 4XIFA 3NEPX 1YZNA 1UMBA 3M6UA 4LCEA 2I2CA 4FYXA 5KC8A 4F4HA 4C0LA 5MF6A 1H4VB 3UJ7A 1UFOA 2YZNA 5HIKA 2UYHA 3WZLA 1ZEJA 1ZLYA 4KSYA 1K9VF 3TEJA 4RV4A 1RPZA 1BSVA 4CR6A 4GP6A 1ODLA 3WZ2A 3X44A 1DKPA 1RKBA 2YMMA 3W3ZB 4M7WA 2SECE 2A9PA 3FNGA 4B6FA 2ZUTA 4NL4H 2YWEA 1QV7A 4XB1A 4CBVA 4PS1A 2I03A 3GXBA 4ZEWA 4UVGA 5AJWA 4XYLA 2ECFA 1AZSC 1GA6A 3F4BA 2J08A 4H3KB 3A6DA 3B6IA 4H7HA 4S1VA 5A4DA 2PX8A 3HRIA 2YCBA 5C5DA 1SBCA 4X65B 3PNBA 5F9FA 3F8TA 3NASA 3HM9A 1KMNA 3EGCA 3WLRA 3E9EA 4ZV9A 3LL7A 5J2UF 4UFOA 5K99A 2XKAA 2YMQA 4J1TA 2GARA 1FFXB 2GDZA 3WWEA 5CA0F 5KYKA 1IE3A 2FWPA 1QC5A 3QUAA 2IZZA 3QFTA 1AURA 3PZRA 4R1QA 5ECDA 5EEHA 4A8TA 1W5EA 3CZ5A 2FWIA 4IVPA 2RG7A 2NSLA 3GWGA 4GR9A 1MENA 5DI9A 1XTRA 3DG9A 3ZVLA 2X2OA 3B1XA 2ZJ7A 3GUHA 3MMSA 3PUYA 1BE6A 2GBLA 3ZW7A 4B3XA 3FOBA 2AD1A 2IYWA 5FYDA 2CCJA 2L2QA 1P77A 1MW9X 1ZMRA 3LL4A 2IDJA 3KALA 4UREA 2V1UA 1L7MA 1U8AA 1V5FA 2W90A 1SFRA 1SG6A 3ADPA 4FN4A 4TTAA 4D3ZA 1QF6A 1XT6A 2XZTA 3UANA 1LC3A 2VNSA 5JJKA 2ZTUA 3KJIA 4WKBA 2XE4A 3IVMA 1CF2O 5K3FA 1W5BA 3ZHSA 1EUDB 5EE1A 1GUBA 1KO7A 1CUWA 4BB6A 10MHA 2J48A 1MB9A 8ABPA 2OTCA 4OQNA 2QS9A 2YVAA 4E07A 1NKSA 4NU6A 1VZ3A 4LMAA 5EINA 5I8ZA 1CUEA 1I14A 3FVQA 2FMHA 3I6BA 2QPTA 3PHGA 4P22A 3UUFA 3FOEC 2IZ6A 3HRHA 4PE5B 4MVCA 3ZDBA 1E1QD 1J33A 1VG1A 1E64A 2Q4OA 3O3CA 1Z28A 1QU2A 1L5WA 1P9WA 3H6HA 4H3HB 4V3BA 5E4FA 3T5CA 3QE0A 2CWDA 3I8OA 4NG5A 4RDHA 3Q2OA 2DFVA 2D7DA 1YJBA 4I2VA 1F8YA 2WIAA 3QXXA 4LRXA 1EZ4A 5BSRA 3DFMA 4ES6A 4HNTA 2AZ4A 2G70A 2Q2WA 3BSFA 3NTUA 1M72A 4HVTA 1Y4DE 1QRDA 1ZXBA 2BKLA 1M2OA 5IYZF 4OI1A 3ZKWB 3SVLA 4RGQA 3D7RA 3FYHA 3RRBA 4I99A 1M3SA 3GLFE 1C3XA 3NEJA 4LKOA 1XD2A 3DV0B 1NTOA 1EE1A 4C4ZA 4KPUB 3AH8A 2WLSA 5MGBA 1AKYA 2QTVB 4LTMA 2O05A 4MYHA 3COJA 3PENA 4J3FA 3U61B 5KSWB 3R23A 4JU9A 4QQKA 4TYMA 3TOVA 1NIJA 4Y2YA 5C8XA 2NVWA 1GLGA 4FHDA 1S6YA 4OBWA 2H06A 4R2XA 4URFA 3SSNA 1JPUA 4MAAA 1CUGA 1LFAA 4JLMA 4J0GA 3A9TA 2F8LA 3LCMA 1IEQA 4RIEA 3V4FA 5A1JA 3HB7A 1Z5UA 3EC7A 1YVRA 3RAPR 2E18A 1NR1A 4A92A 2J31A 4ZI7F 1W46A 4LZAA 3TXYA 2EDAA 3F2IA 2VDVE 4OMCA 3CEPB 2OHHA 3PXAA 4U7WA 5CD9A 4BGDA 4IXNA 2APJA 1ZU4A 4QRDA 4E1BA 4EG1A 1Y6FA 2G5CA 4G56A 1FFWA 3HU5A 4ZOAA 5HE9A 1SU8A 2JB9A 2FSUA 4UULA 4U7PB 4XGNA 1VHDA 2R1UA 3PJRA 2E7ZA 1KZHA 3T34A 3C16C 5E0KB 5FTMA 6YASA 2PMKA 2WTMA 4MQEB 1NE2A 4JLAA 1A77A 3B3QA 2O3JA 5CGQB 2F59A 1LDMA 3CUSA 4Z53A 2PRZA 5CBKA 2RHOA 1HLFA 1SOAA 1QO0A 3BH6A 3C3JA 4GOMD 3F46A 4MEAA 5EQJB 5HX7A 2DWPA 3A1TA 6AT1A 4EBBA 4DDHA 5A5GA 1CF4A 3K4QA 1GL9B 5FTJA 5T6BA 4O08A 2C7OA 5CAEA 4ZIRB 5E7JA 1YO6A 4PQGA 1B6GA 3MJTA 4YP5A 5BWMA 3NTLA 3Q3CA 4MI3A 1T5IA 4MWGA 1WW8A 3Q7SA 4PG4A 2J5KA 1RABA 3RAGA 3G2IA 3CRRA 4RZHA 4XSVA 4Z54A 4S35A 3SC2B 1O5OA 2NZJA 2F3TA 2WT4A 4IH1A 4L85A 4Q3DA 4O2BA 1GNVA 4AUEA 3NS7A 3ZK7A 1KKUA 2GAAA 3K1AB 4E1VA 1IVSA 5EUMA 2GYUA 4V1CI 1DBIA 5D5QA 3O95A 3RVRA 1EINA 3E0QA 4IMIB 4EEZA 2G76A 3SP1A 1W0JA 2PTHA 3ISVA 3WL6A 2RK3A 4WZZA 5A2GA 3TTUA 5KZMB 4AZ3B 2OORC 1GWNA 4WK4B 1GTZA 2QJWA 3ENWA 1ZGZA 1RPJA 2ANCA 1VGRA 3JQ7B 4M8IA 1Z07A 4HXFB 1RZVA 1G9SA 2H1WA 1P4HA 1D07A 2W2OA 1N1MA 3K6RA 3EYWA 2ZJ8A 1BROA 1MG0A 1X0VA 1E7QA 1W6RA 1ANKA 3MGBA 3R3ZA 2IYXA 1AMOA 2GF0A 2HBQA 2X13A 1PD1A 4AQDA 2P78A 1J2UA 5HRCA 4R2IA 4I50A