1NATA

Crystal structure of spoof from bacillus subtilis
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
119
structure length
119
Chain Sequence
b'NEKILIVDDQYGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SPORULATION RESPONSE REGULATORY PROTEIN
molecule tags Regulatory protein
source organism Bacillus subtilis
publication title A response regulatory protein with the site of phosphorylation blocked by an arginine interaction: crystal structure of Spo0F from Bacillus subtilis.
pubmed doi rcsb
total genus 40
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 1997-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1natA00
3I09A 1P6UA 1Z13A 4F12A 4PICA 1USIA 4G97A 3F73A 5KC9A 3FFWA 3UK0A 3D8UA 1BDIA 2HSGA 1NXOA 1RNLA 4JA2A 1D5WA 3OO1A 3H5IA 5KI6A 1FQWA 2JBAB 3B2NA 4TLLB 4KRFA 3OM0A 1ZGZA 1GCAA 2GWRA 1J56A 2GKGA 4HNSA 4RDCA 4MR7A 1H9CA 1F51E 3C97A 4MQFB 3OQOA 1D4ZA 4PE5B 1U8TA 4KK4A 5TPZA 3L49A 3QELA 4XXHA 3GT7A 1JDNA 4RSMA 1RZRD 3CU5A 5FWXA 2B1JA 4KZKA 5KQMA 2ZAYA 3QEMB 3O21A 3CG4A 1ZN2A 4Q7EA 4OLBA 3OLVA 2JB9A 2FEPA 5IC5A 3GBVA 3JTEA 2PUGA 3QELB 4FE4A 3BILA 2OQRA 1LK0A 2NUBA 1ISRA 4GNRA 3SQNA 3KCNA 4MR8A 4FB4A 4MGEA 4D74A 2FN9A 3F6PA 1ISSA 4MS3B 5T3YA 4LE2A 4EYOA 3M6MD 3GWGA 3HCWA 2JRLA 3OLWA 5HQJA 4E7PA 1DBQA 3N53A 5GQSA 2E4XA 4S04A 3FMVA 4UHKA 4ML3A 5JNTA 3H1EA 1SRRA 5FWYA 3SAJA 3TX6A 1LJLA 1RXIA 4RY8A 1ZHHA 1R8JA 3O2SB 1DRKA 2HQBA 3Q7TA 5HM6A 1IIBA 3NHMA 3NHZA 4H3HB 4RU1A 1EFAA 3Q7SA 5TQJA 2O20A 2VK2A 4JAVC 2VYCA 4MQEB 2FMFA 3I5AA 3OQNA 4N41A 3BBLA 3KTOA 4KK3A 1L5ZA 2LPMA 4RV5A 3OQMA 2E4VA 5ABPA 4LE0A 5EWMB 1ABFA 1JDPA 4Z4EA 4DN6A 2ID9A 2L18A 3IP6A 1JHZA 3OLZA 1ZAYA 3HEBA 3HM9A 3KLOA 3EQZA 5E3JA 1M2FA 1Z16A 1PNTA 3W9SA 2ZWMA 3M9XA 3QK7A 4LDZA 1A04A 4MQFA 3IPAA 3DLBA 4OTZA 2JVKA 4IMIB 4WXEA 3HS3A 3O1JC 2FVYA 3MQ4A 3N75A 4OATA 5IUKC 3RVKA 2CWDA 1I3CA 2QR3A 5KQLA 1KRWA 2IPLA 1UDRA 2JBAA 3GBPA 2MYPA 3IDOA 1DC8A 1XHEA 3S99A 3HUTA 4PYRA 3DLHA 1M5UA 4F11A 1K68A 1P6QA 5TPZD 2JK1A 3BRQA 4KV7A 1YIOA 1U2QA 3C3WA 3TD9A 1VPWA 1DC7A 2JCGA 4N76A 5TQ2B 3TO5A 1YMUA 1Z12A 2PUAA 3CNBA 4MS3A 3RVRA 4B09A 4F8JA 1M5TA 2HQOA 5B3JA 4OG2A 2NZVG 1Z26A 2IPMA 4N0QA 5DCLA 4MS4B 5JNRA 2JVJA 2P4UA 2FLWA 2H3HA 4RKRA 3QEMA 3H1GA 5GOTA 5IEJA 5BQ3A 1DCFA 1CYEA 1Z2EA 5CHYA 5HKOA 3H6GA 1FFGA 4RXMA 4KPYA 5CNIA 2R4QA 2TMYA 1QKKA 1ZVVA 2NT4A 3MMNA 2AYXA 3RQIA 4PEVA 4YO7A 4D6XA 3LKVA 3N0WA 1ZGGA 2QSJA 2CHEA 3HK2A 4IGAA 4Z9BA 3KS9A 2HPHA 3DZDA 3G85A 1D1PA 2WY2D 3OMXA 4YWHA 4TLMB 2W42A 3EGCA 1USKA 3CZCA 2RGYA 2V0NA 1C4WA 3D02A 5FBHA 3SG0A 3T6KA 1QMPA 2LBPA 2XDYA 3T8YA 1CHNA 4EVRA 5T7BA 4MR7B 3VNBA 4O5AA 3NNDA 3Q41A 3JS5A 4EYQA 5C5EA 2WJWA 3O2JA 4NCAA 2NZUG 4O1HA 1AB5A 1EHCA 1DJMA 3LUGA 4MR9A 5IULC 2YHAA 1QP7A 4ETIA 3EQ2A 1USGA 1ZDMA 2JVIA 4Z4GA 4Z4FA 2FMIA 3HVRA 3KYIB 4KFCA 1QP0A 1BA2A 3KJXA 1JFTA 1VRVA 2B4AA 4RK7A 2R47A 5KQPA 2FW0A 3QEKA 2J48A 3RVQA 3FFXA 4PZ0A 1U2PA 3O75A 5CNMA 1Z15A 4NCBA 1M2EA 2FXIA 1MIHA 4RKQA 3JPYA 3FFTA 1A0OA 3A0RB 3EODA 3LKBA 3HUUA 5KQGA 2MSWA 3C3KA 1PUXA 1VLZA 4LX8A 1DBPA 3RVLA 3A10A 1Z18A 1F4VA 1ZH4A 2FLKA 1EAYA 3N0XA 5DLEA 1FFSA 2WJAA 3H6HA 1WETA 1APBA 2PUEA 2FTKE 1DBWA 3GV0A 4O1IA 2IPNA 4ZMRA 4W5RA 2GBPA 4CBVA 4RXTA 2PUFA 2HJ9A 1YS6A 4XFKA 1SXHA 1K66A 1TJYA 4ZPJA 4EVQA 4G86A 1YMVA 1E6KA 4IMJB 1PEAA 1MB3A 4MYRA 1LBHA 1DG9A 2R48A 5FBKA 4EUKA 5TQ0A 5BRAA 1EWKA 2FSPA 9ABPA 1GUDA 2FQYA 4ETNA 1DZ3A 3CLKA 4G0OA 4EYGA 2F8TA 4D6YA 3BREA 3CRNA 4IRXA 4MRMA 2VUHB 2A9QA 3LFTA 4FE7A 1PNRA 1L5YA 3OLYA 1ZESA 2VUIB 1NTRA 4MAAA 1NXSA 3CTPA 1KMIY 3MF4A 3QX9A 4RK6A 5JNWA 4UHJA 3RVPA 1BDJA 1ZITA 4EYKA 4ZMSA 3O74A 4G0ZA 3HXMA 1LBIA 1ZY2A 3H75A 4KREA 4RK1A 1T34A 2WMYA 4DQDA 5IUJC 4S05A 2H0AA 4WZZA 4LRQA 5EWJA 4H60A 3K4HA 4W5NA 4WWHA 1D2AA 1VKRA 5IEBA 2A9RA 3MIZA 4Z0NA 1RXEA 2PUBA 3O1IC 4L85A 3F7NA 3T38A 5BR1A 3EDCA 3UUGA 5D2CA 2BGGA 4MS4A 2M1ZA 4JOQA 4Q6BA 4EGSA 2IDMA 2NT3A 2PUCA 3HJFA 2FQWA 3HO1A 4W5QA 1FFWA 5EWLB 3A0UA 1U0SY 2PJUA 2IOYA 2IKSA 3O1HB 4OBBA 3E3MA 3RVOA 1Y1LA 3LUJA 2RJNA 3H5LA 2KYRA 4Y9TA 4F3TA 3LUFA 3NNNA 2LUOA 3T95A 1D1QA 3JPWA 4KQ9A 3RVSA 1DP4A 2E4UA 4NV3A 4XARA 1QP4A 1NXPA 3OO0A 1JLKA 3HDVA 4G0QA 2MSLA 5EWJB 3RVNA 2PE5A 2WRZA 4QYMA 5EWLA 1MVOA 2P9HA 1YTUA 4ETMA 2E4YA 4RK5A 3SM9A 4MPTA 3VNAA 4YR7A 2A9PA 1E6LA 1NXXA 4HNQA 5KC8A 1QO0A 1JYFA 4EY3A 3DGEC 1W25A 4KVFA 2L19A 4KQCA 1JH9A 4YV7A 4MS1B 2AYZA 1NY5A 3LUAA 2IPAB 1OXKB 3BRSA 1JL3A 4WT7A 3ROFA 4RY0A 4W5TA 3GL9A 1JFVA 3Q15C 4IF4A 4MLCA 4RK0A 4MS1A 3KSMA 2FMKA 3LUKA 3P9YA 4N47A 3EJWA 3LTEA 4LDAA 3IP5A 1JWLA 3H5OA 5CNKA 2GI4A 3LUCA 2PL1A 4IILA 3LOPA 1MAVA 3QLTA 1TVMA 1HEYA 4QICA 4JB2A 1GCGA 2WWVD 1NXTA 4Z4HA 3KHTA 3MYYA 4XASA 5JNSA 4G0PA 1QNLA 3I42A 3HV2A 2E4WA 4JB0A 3SY8A 3Q9SA 1BVHA 4RXUA 4RK4A 1P8AA 3GYBA 4DADA 4ZYLA 2M98A 7ABPA 5TQ2A 4RY9A 4EVSA 2QZJA 2FEKA 1XHFA 1BAPA 4MR8B 1OXBB 2PLNA 3KLNA 4H3KB 1C0EA 1YS7A 4NQRA 2PUDA 1SD5A 3IPCA 2FN8A 4ZJPA 3ILHA 1E2BA 4YLEA 3SNKA 3HDGA 5EWMA 3QLUC 3M9WA 5BRJA 1URPA 1PEYA 1A2OA 2PMCA 3C3MA 4E7OA 6ABPA 1JBEA 3FDFA 3IP7A 3QLVA 3TB6A 4MQEA 2LIVA 1YVUA 5TPWA 5KWSA 3DBIA 4G0YA 2PL9A 2DRIA 3EAFA 3OM1A 4HNRA 1B00A 4JP1A 8ABPA 3QLVC 4LE1A 4OLAA 4L4UA 3N0RA 1DCKA 1W9HA 3QLUA 5DTEA 5TE9A 4TMYA 5C5CA 3A3KA 3H5WA 3H5VA 5FWYB 1NATA 2OENG 2Q5CA 1JX6A 3QX8A 3RH0A 2MYNA 3CFYA 1NXVA 4YRZA 3C6QA 1KRXA 2L17A 2WB4A 3CS3A 3E61A 3JY6A 1GUBA 4QYWA 3OMWA 3G1WA 1JF8A 5TQ0B 4Q6WA 2MYTA 4N03A 2MSKA 3F6CA 1XWWA 2CHFA 1JFSA 2FKAA 1TM2A 2RJOA 1LJUA 4RZSA 2QW1A 4G0XA 2RDMA 4WUTA 1QQBA 3NNSA 3K9CA 1Z17A 3MM4A 4Z4CA 4WXMA 4F06A 4KNYA 5IBQA 3ILYA 1P2FA 1CEYA 1TMYA 3CHYA 1NXWA 1TLFA 3RVMA 1QPZA 1ZH2A 1S8NA 4YP9A 3N8IA 1GLGA 2R25B 3H5TA 1QQAA 3TMYA 2I6FA 2F8SA 1SXIA 1PHRA 5JS2A 1Z25A 1ABEA 4RS3A 3ROTA 5FWXB 5ED4A 4GPAA 2QVCA 2IYNA 2A9OA 2QU7A 5JS1A 3CZ5A 5F64A 5B3JC 3H1FA 5HSGA 1DRJA 3OLXA 2N9UA 2CD7A 4M88A 4TN5A 4QPJC 5DGCA 4P98A 3GRCA 1E6MA 4YS6A 2LP4Y 1AB6A 5PNTA 2PKXA 5I4CA 1KGSA 2FMHA 3L6UA 5JNVA 3N6VA 3Q7RA 4RWEA 5IUNC 3GA5A 3NBMA 4MR9B 2FEWB 5DKFA 1U04A 3HSYA 4Z9AA 3MA0A 4Z99A 2ID7A 4P1ZA 3UKJA 1RZRA 4Z4IA 3RVJA 4XAQA 2YHBA 4W5OA 5IX8A 2FQXA 4JASB 1BDHA 2QXYA 3LUHA 4HYEA 1DCMA 4MLDA 3EULA 1EWTA 3CKMA 4XLTA 1YK0A 3FGZA 2HQRA 2GX6A 4N0PA 3DGFC 4LZLA 1QO0D 5CNJA 3I45A 4YGXB 3IP9A 1MB0A 2X7XA 1Z2DA 3HZHA 4MRMB 5TPWB 3CG0A 3JVDA 3R0JA 2QVGA 1JYEA 2E4ZA 1EWVA 2QV0A 3O2QB 3LUDA 6CHYA 3KYJB 3JVIA 1YK1A 3URMA 3KKEA 4YCSA 5JNUA 2MYUA 1RPJA 4KMRA 1FSPA 3LMKA 4G0MA 1SXGA 4NICA 2PAFA 3KG2A 2L2QA
chains in the Genus database with same CATH superfamily
1WLSA 5ITZA 3K0SA 3U7GA 1FUEA 4AUEA 1FP6A 1CY2A 4RTLA 4KBFA 2FSVC 4QGBA 4FUQA 3GO4A 1H93A 1UOOA 4KUEA 2PSHA 3UJ8A 1JECA 1AJEA 3W5CA 2ZXFA 2ZJBA 3PDIA 3T7KA 1YJCA 2DTXA 4FKZA 3TLKA 3M4XA 1ZNXA 4A8JC 2FRDA 1EFKA 4KW7A 3PSHA 1D2HA 2I2DA 2UVDA 4W7SA 2BFCA 3T3DA 3UH0A 1HNNA 5KSPA 1JJAA 1KVTA 1UZMA 1ZN7A 1ZKMA 3ZIDA 1WSBA 1JI3A 3CZPA 3OPQA 4YJ2B 3TOXA 1OFUA 3OQOA 2C5HA 1ACJA 1YC2A 4K9PA 1W8DA 5EIFA 2RAPA 3DDOA 2X5NA 5TXGA 5BVGB 1UKYA 4ZQEA 1MZVA 4DT1B 1FUKA 3B1KA 4GO1A 4S3MA 2ATCA 1N0IA 2QNBA 4CCAA 5GAJA 2P1DA 2C88A 3OPYI 1OVMA 4FOSA 4QXAA 4LXUA 3ETNA 1CW2B 1N34B 4ZHQB 2NNLD 3CMMA 2ZRBA 3LPNA 2D59A 2Y3IA 3D5EA 3L5KA 1VXRA 2OQRA 3M5DA 3TQSA 1YIAA 1GSHA 1LWOA 3BCUA 4GEKA 3RJMA 2Z4SA 1FQJA 3DTVD 3AJEA 2Q5JA 4GP9A 4IR7A 4XR9A 4YMIA 4MIEA 4HI0E 5C18A 5EKUA 1Q0QA 2OHVA 2J31A 2R8OA 2VF7A 4I1VA 3RT9A 3TE7A 2E4XA 2YFQA 3R6TA 2PLAA 5AKHA 4DWVA 5BYAA 1SXJE 3SAJA 4W63A 3TTSA 4DSUA 1E99A 3UA3A 3VYTB 2UZ1A 3PFCA 4KIUA 1OU4A 5CLFA 4YP1A 1T1JA 1YRAA 1ONBA 1ZL2A 1D0VA 1K6EA 4ID9A 3THYB 2PIDA 1YD7A 1DQRA 1R37A 1S7CA 5FOXA 4XEUA 2AXQA 3WVNA 1B3BA 1XZHA 3NHMA 4QXPA 3PRHA 3QJYA 3PR1A 1T4CA 4PYLA 5LKAA 3K0BA 4LRUA 2VP4A 3Q10A 4I1IA 4IOJA 1AO0A 1T9CA 2XE7A 1Z8HA 2I3DA 2I66A 4XQGA 4AROA 2GXQA 4RZ3A 3S3TA 2AZXA 1UOQA 2B9VA 2FPIB 3L8GA 1NW5A 4B6PA 2V6FA 3EVDA 2NTEA 4NBUA 4R6XA 2P3OA 2G6BA 3C1AA 1L7XA 4WLFA 3VNUA 4P3PA 1FB5A 3ZWMA 1A04A 3RF6A 3D9QX 1RYNA 4JJ7A 1FYFA 3AOEC 3EY4A 1IPEA 1EA7A 2ALJA 3ZOKA 4NU5A 2H16A 2GBLC 4YUXA 2A7XA 2AXEA 3H9JA 3UMRA 5K6TA 3TUZC 1NQTA 1HV8A 3IAXA 1T5BA 4DIEA 4ZYYA 1M3SA 3GRRA 2XBMA 2PWBA 3IJRA 3S99A 2D7DA 2C7OA 2QTLA 2H51A 5DGTA 2I2CA 1JUDA 3RSGA 2FDXA 4ON9A 3DXZA 1VPWA 3UFXA 4HXFB 1KI2A 3BK2A 3OHSX 4RYLA 5CDSA 2E2WA 4FZRA 1CQIB 2QNRA 3I64A 1AXGA 2VKTA 4MS3A 4F86A 3T5GA 2H3EA 4IVPA 4OG2A 2JLBA 3A9VA 1G8KA 2BF4A 4CJXA 4EY8A 3CJRA 3QEMA 1POWA 3RYHA 4D9EA 5BQ3A 2HF2A 1TQ2A 3L7IA 3OQ1A 2JI6A 1RZ3A 3AV0B 3R1IA 3IDSA 5TV2A 1EEHA 4B84A 4YPOA 4CLOA 4F46A 4DBVO 3AVOA 4ABYA 1CEEA 4M37A 4EELA 3ECAA 1ZVVA 3P27A 4ZQHA 5B37A 4Y2UA 2VP6A 1KI4A 4MVJA 4KLRA 1M2VB 1B76A 4RKWA 1Q77A 4JU8A 3ZW7A 4BAZA 5FRDA 1GRNA 3PLRA 4H1TA 5H8WA 3CRQA 1VZ3A 3D0OA 3VR6D 4AZVA 4URXR 3F8TA 3PDCA 1ZL0A 4U2KA 3RKSA 1OYOA 4EHDA 2O2EA 2A0XA 1K2VN 3ZE9A 3D02A 2VA9A 4AKSA 2HDNB 1UDBA 4LMPA 4D9FA 3JQ8B 3A37A 4WZAA 4HV4A 3G8DA 4B6EA 2IYOA 4EYQA 3L6EA 4J0QA 3L1HA 5HZKA 1G0OA 4U9HS 1RI5A 3ER6A 1HKHA 1JQEA 3A6KA 1TK3A 4Z0PA 4E08A 2YWCA 3ES9A 2XNHA 1TUBB 4GMKA 4EMTA 3AVXA 1LWNA 3IHKA 3P2IA 3MMZA 4N39A 4Q16A 4QD3A 4ZCIA 4BQIA 3GPLA 1ENYA 4X1OA 5A2QA 2XF8A 3ZY5A 2AUTA 2BMVA 3DE0X 4B71A 1BA2A 4OQEA 2O05A 3WIDA 3LRPA 1Q92A 3A9SA 4HSGA 5IJWA 2FW0A 1KKMA 1ZOLA 1U0FA 2X1LA 4QUJA 4AECA 1SB9A 2J30A 2P41A 4TMKA 1NVXQ 2DFPA 1W88A 3ROGA 2WD7A 3OPNA 4DNQA 3PCTA 5E7QA 4HG2A 2JAQA 1H22A 2ZWIA 3A0RB 3PQ5A 4F3YA 2RGEA 5JRDS 1KWGA 2BI4A 1IXSB 2LRHA 1FY2A 5ARCA 1V6AA 2EWMA 3ZGYA 2XGMA 5ULLA 5KBYA 3KQYA 2IGBA 1CZOA 2QL9A 1WZEA 4I8DA 4LX8A 3ESRA 3SQWA 3A10A 2NO6A 5CFLA 5EXEA 2LTAA 5L8VA 1BOFA 4MV9A 3ZOZA 1E63A 2ZRDA 4IZOA 3UV6A 5AVOA 2G67A 3U4HA 5DN6A 5J4LA 5JJCA 3NCTA 2VWPA 4IG9A 4ZMRA 4RADA 5K1ZA 4OQZA 3GJ3A 4BGUA 2GETA 4FDTA 1XHLA 4G67A 2IS4A 1C3OA 1GJRA 4C7KA 1CERA 3F49S 1KYYA 4OP2A 4C7JA 1EQAA 3RYCB 1QV9A 4URFA 1IUPA 2WOOA 1R66A 3EXIA 1CDEA 4IQFA 4HN4B 5TR9A 1IZ8A 5CM2Z 4Z49A 4UM9D 1EVQA 3L7NA 1GUDA 2XE6A 1T5LA 1UBSB 1VSVA 2GMWA 2WU3A 2PGDA 3BA1A 3H8VA 3KCQA 4L73A 4TTPA 4WAUA 2IV7A 3F3KA 3SC2B 3VNSA 3WADA 3WOVA 5JD6A 3KZNA 4G5QA 2H52A 4ASUD 3T12A 1XZMA 1DI0A 1NN5A 2XMQA 4Q4JA 3ZD7A 3BD9A 1MAWA 5EHQA 5C4IA 1MBZA 3VO2A 3S2FA 2EW1A 1F4LA 5P21A 2V7GA 2QX7A 2VLBA 3A26A 3MBOA 3ZWQA 2C4KA 4D0LB 5JNWA 1ZITA 3AY0A 2ICAA 1HLPA 4UW9A 2CJFA 4KREA 2JLUA 2Y4NA 3DHEA 3TGLA 1CPYA 2QLJA 4JI2B 3R4CA 3N2EA 4YQEA 1W5TA 1JE1A 3L41A 1Z4KA 5CXSA 2B21A 4KIJA 4LG1A 1Z0UA 2GWHA 5CDTA 4WRRA 1SUCA 4TUYF 3A2LA 1VKRA 3BD6A 2O2CA 1MC5A 3MIZA 2XRZA 1RXEA 2D2FA 1Z7GA 2Q1XA 3JZMA 1T3LA 1G18A 3QGMA 4XOUA 5I3CA 4JXKA 4OJKA 5D2CA 1EA5A 1MO2A 3HKBB 3NBXX 5HBGA 4EX6A 3VU9A 3UMCA 2CFRA 2R2AA 5J40A 4EJ2A 5CXQA 1TZMA 4BQFA 4DDVA 3R20A 3A8TA 3O26A 3CSSA 2K7FA 1HE4A 4ESOA 1KZYC 1ORDA 2QTAA 3KVNA 5BWOA 1MDFA 2AYYA 4YXFA 1Y3BE 1UJ4A 2JIZD 5JC1A 4URWR 3LSTA 4MH0R 1VB3A 4OUDA 2EV9A 2LUOA 2W37A 4O4HA 1D1QA 3W34A 2GS9A 4IGFA 4JIMA 2AJBA 5BVHB 1QP4A 1YR1A 4UNRA 4AZWA 3JZAA 1XLTA 3W2FA 1RYZA 3VSDA 5EWJB 1ZVQA 5KVQA 1WMSA 4GX0A 3MWYW 3DKVA 5CW2A 1UOEA 4AJHA 1QANA 1P5ZB 5LM3A 1E6LA 3NLLA 3FBGA 1QO0A 3EUWA 4ZVTA 4YPFA 5SY4A 1Y63A 3PC3A 4B7AA 4C4OA 1RJGA 3NHKA 4G36A 1KEZA 3VYRB 1YZNA 2QRVA 2JJ1D 3FOAA 1F0PA 3LUAA 3OFNA 5EIHA 3RABA 3BXXA 3IKTA 2BBSA 2CZCA 3DDWA 2CEKA 4O2AA 2VDLB 4N7RA 2INGX 1NULA 1T25A 4IG4A 2YQ4A 1PZNA 3FUCA 3P9YA 3EXEA 1CUVA 5A02A 2XD9A 1NBMA 3B3FA 4W9RA 4UCXA 3A7DA 1GGFA 1QK3A 2C82A 3SYRA 1VKZA 3TCKA 2WKRA 1P44A 2AN9A 3B1XA 1TKAA 1ZRNA 3DZBA 3LBHA 1VXOA 4Y2XA 4Y1GA 1N3YA 4P0TA 1X7WA 1GSOA 3WWPA 4Z4HA 2PKQP 4FYKA 2CVOA 5EG5A 1JDSA 2OLJA 3H2GA 4G5XA 4YRQA 5I4IA 3KELA 1Q83A 4FOOA 3NOOA 4TN1A 5CU7A 5B7NA 3ETHA 3LRXA 3QRWA 1S8OA 3DAPA 4OXKA 4DR4B 1QX4A 3AOEA 4MHOA 4BN0A 1LQ2A 3DF7A 4L07A 4YAOA 2BL4A 2E1PA 3JSXA 3AEUB 1YS1X 2E82A 1TFUA 4LJRA 1AUVA 4MKZA 1YDEA 4NXNB 1NMXA 2P7IA 1QSGA 3R3UA 3BOSA 2BWJA 2EFYA 3VH3A 4ZCPA 4RNCA 3KWLA 3T3OA 2HWKA 1CVIA 1V1RB 5F2KA 4IKEA 1ZNYA 4BX8A 2QMUA 3WRWA 4S1WA 3TGPA 3RTBA 4EKEA 1FJGB 4P4TA 4RDIA 4BFCA 3WX0A 2J09A 3ANNA 4BTVA 2ZBDA 3CZ4A 3RROA 1TMKA 1Z5WA 2VZ9A 2XUIA 4BQNA 1GVHA 4FSHA 4MV5A 4OHKA 1YJXA 1RZVA 4L6AA 1VRWA 2PGXA 3F7TA 4KVZA 1EI9A 3A1TA 5TVGA 2BUAA 2BE7A 5AUOB 2CL6X 3HFSA 4LE1A 3I9KA 3IOCA 3U6KA 4F56A 3QE9Y 1ZM9A 4XVQA 1W76A 1ZVKA 2ZITA 3F1KA 3DOJA 2Q2QA 3HUFA 3K8OE 4C4ZA 1TM1E 2GBFA 3C3PA 3KU1A 1L4KA 1RXSA 3O8QB 3QX8A 4BJ6A 2HU5A 1W2GA 3BXFA 4EX7A 2HCRA 4A6EA 2OHOA 5C5IA 5CYGA 3BFKA 1J5EB 1OBOA 2OZLA 4MULA 1BXKA 1P80A 1BKYA 2XCLA 1HL3A 2ENUA 4QEDA 1AGNA 2HC9A 4WECA 3AHFA 2Y9PB 3RGWS 1YVRA 2MSKA 1JAZA 4ZO4A 1DS6A 2HCFA 4EF4A 4OJQA 2CUZA 3WRYC 6YASA 5IJ9A 5FWDA 2VSQA 1KH3A 3S28A 1K1EA 1BNCA 2QUKA 2YS6A 3MVEA 3WA7A 5IM4A 3O8NA 4LCBA 2XXBA 4CF4A 3M83A 5GINE 3HEMA 4HB4A 1GAWA 2AQKA 3ILYA 3QUQA 5IBQA 3KSAC 3NBYC 2YCLA 3TH5A 3SCZA 3ZTYA 1QAMA 2PZFA 4CI9A 2ZYUX 1OGIA 3H5TA 1SCIA 5EESA 1RLOA 2JRCA 2Z2XA 3WRYA 3MJHA 1P4HA 3T4PA 3RFFA 4PPQA 3Q0IA 2PQ6A 2R751 3THRA 3IRUA 2BFNA 2SHKA 3ROTA 2XCTB 2WNSA 4RULA 2QVCA 2EX1A 2A9OA 4LVCA 4O4LF 3EQ6A 4G4IA 4UHHA 4CLRB 4TS9A 3TOSA 3V8PA 4BKMA 1QV6A 1AK1A 1JQAA 2FPXA 3TLZA 1J33A 1FZQA 1N6RA 1T4CB 1FPMA 1CDDA 1P7WA 4LZNA 2ZRQA 3OY7A 2FHPA 1BW9B 1XEAA 4HS4A 4MVJD 4P98A 4YYEA 1AB6A 4ZANA 4DB4A 3T9CA 1KGSA 1RBYA 1U8EA 1E5VA 3MTDA 4J0FA 4FS3A 4N01A 4F04A 1T5DX 5KKAA 2DWCA 2F1IA 2AXPA 4KXVA 5KTRA 5TARA 2RHLA 4KEAA 5DKFA 2HIAA 1PVVA 2CYCA 2QUJA 2RMKA 3BH6A 3MA0A 3PQ2A 4GYJA 4R8MA 5ICFA 3OJEA 5EJAA 1QFSA 4MKIA 3P32A 1RHQA 5IVPA 4JASB 3LUHA 3UF0A 2OFFA 4OHMA 3WL8A 1X8KA 5KJFA 3QYPA 4Q02A 3SOPA 4B9AA 1FNDA 5A0TA 1E9VA 3OCVA 1KPHA 3IVGA 4KR2A 3JD4A 2PEYA 3ZZ0A 3B70A 2R1VA 4LZLA 1Z33A 2IHJA 4BHTA 1T9DA 4RZUA 3NKLA 2BAGA 3L7LA 1XK7A 5DTIA 1RE0A 3M33A 1H3NA 3EG5A 3E03A 2F59A 4IP0A 4EGCB 5AI6A 1ECPA 3QXJA 4MYCA 5JFOA 3DOOA 3JVDA 2H2DA 2Q1UA 3EQ9A 1U8YA 3I5XA 3NHRA 3R0JA 4UBOA 5DHPA 1J70A 5HPYB 3FIUA 3TM4A 1J9EA 3GLQA 2XZLA 4DAOA 2AUNA 4OJMX 1Q84A 6CHYA 3MILA 4J6EA 1MKYA 5EJ5A 3QFRA 5C3MA 1RXYA 3LC2O 1P2SA 3I5UA 4CM5A 4PQYA 3R4VA 1SD2A 3GVIA 2Q1YA 2GK3A 3RS2A 2PWYA 1SC4A 4G0MA 3FWPA 2DERA 3ONFA 4B6RA 5JD5A 4KGDA 2I8LA 4WBNB 2P9BA 4M1WA 4DC0A 4FONA 1RAHA 1W2HA 4IIDA 5EEHA 4FEGA 2HRQA 3P7MA 4GC5A 4JB8A 4AULA 4QHSA 3HSKA 4I14A 4L8FA 3KC2A 3V1LA 2IW1A 2VNKA 3G9ZA 2G06A 3HXTA 5CA0A 1L4EA 1WB5A 2WQ6A 5C35A 4JI8B 3RBZA 4KRFA 4TTTS 1P75A 5T4EA 4TLLB 2ATVA 4Q9NA 4NEGA 5LA6A 4M7RA 3IQIX 4OXIA 1G8HA 2Q7DA 2OXCA 5H02A 3OA2A 3TSAA 3WGMA 1LPPA 2W2KB 1JB9A 1S2DA 1ULTA 2MMCA 3JQ8A 3C8ZA 3DQPA 3MPOA 3QXHA 3SZRA 1VIYA 2O57A 4MVWA 1U8TA 3NOQA 1X0VA 4WACA 3U7IA 2P1ZA 2XODA 2Q3FA 1MENA 4MQUA 3W90A 3PBKA 3ZHVA 1A5TA 3WB1A 3PUZA 1JKFA 1QFMA 2IIPA 3K1YA 1R9GA 2XMSA 4OLBA 1T9GR 2Q1TA 1NJ5A 5FV4A 2FDCA 1D7AA 4ZAFA 3AESB 1XRQA 2H4FA 2OKCA 5KDLA 2AEFA 4NBTA 4Z7QB 3GLKA 1DIBA 3HUEA 1GWNA 2Q8QA 4NATA 1I2ZA 1QYDA 5GPBA 2X7JA 3BIJA 1C9NA 4P7GA 2ZBVA 3IGFA 1T3HA 4JSRA 1X7YB 4RC9A 5DK6A 2VTKA 1UQTA 3Q2IA 3T1HB 2A4MA 1VSQA 2L82A 4Z5XA 3PC2A 4HGOA 3HPQA 4FDLA 1HT3A 1FTQA 2ZIGA 4G5YA 4O2RA 1RXIA 4B79A 3WGVA 4LXHA 4EARA 2C29D 1E3IA 1JQ3A 5K03A 5KNCA 4NAUA 4DV4B 1P4RA 4RAQA 1PZFA 3O2SB 5E6UB 3GOQA 1PR2A 3LT4A 3KT8A 4CDNA 4EECA 5JJLA 3T5CA 3GOHA 3L93A 2WI8A 3N2GA 4NYIQ 1NP7A 2ES4A 4IVNA 1JHXA 1JG4A 1O5OA 4NCNA 5AK0A 4CGZA 2CXTA 2IZZA 3QKRB 1E18A 2O20A 4LVOA 4HDQB 4QNNA 1H2WA 1EYZA 1GGHA 1GNSA 4KYUA 4LJ6A 5JDCA 2A9FA 5KJEA 1IM2A 1R8QA 5DXJA 3ASVA 3Q3CA 2I4TA 5F2EA 4DR7B 2L42A 4C4TA 2SCUA 1C7RA 3DYVA 4QELA 5HIIA 4DSTA 2JD1A 2JFNA 2PJDA 3NDRA 2PZLA 3UY4A 1DXYA 3L6OO 1AS2A 3C5WP 4IUCS 3FRHA 2GBGA 3ICCA 2QB5A 2Y1XA 5JZVA 4S1TA 3T7JA 3THYA 2GTPA 1ES9A 2QW8A 4PBRA 2XUPA 4KJXA 4ZO9A 3M5PA 4CG1A 4B3GA 2QW0X 2PX4A 1BS9A 4XB6B 4PRLA 3FNQA 4MPJA 2JFVA 5KYVA 3HFJA 1R6UA 2ZDHA 1R50A 1K68A 1EX9A 1HDXA 1FQOA 1HSOA 3QKRA 4TMZA 1Z7EA 4TSFD 5LZ5A 1WMEA 4IEFB 1ZK4A 1R4NB 2EW2A 4IDAA 3QVXA 4WXRA 1KOFA 4G01B 4EL0A 3TUJC 2PMEA 2MIIA 1Z0SA 1NYQA 2YWRA 3KIPA 1HSZA 3KQHA 2Y6UA 2W2LD 1I7SB 1YTLA 3FF4A 1LXCA 3E48A 1YA6A 4L5YA 4I9NA 1FU7A 1DAFA 5CHYA 1BIFA 3SJBA 3D8HA 3EIWA 2VRWA 4QGFA 4GZLA 1M2GA 4YMUA 5AESA 1Y8RB 4LXTA 5L3RA 3ZIAD 1KYIA 2GD1O 2PXHA 3RHFA 3NUQA 3LT2A 2TMYA 4E1BA 3A9WA 3LP5A 1E7SA 5IXJA 2HW8A 2D0IA 2Z2KA 5TY0A 5HE9A 2P79A 1NRIA 1RI3A 2CHEA 5MGNA 5CLHA 2K4MA 2IVFA 2PDAA 4MQBA 4RLSA 3ZQJA 2VYNA 1EFVA 5IJ0A 1U0HC 1NNLA 1IRXA 1LV7A 2IODA 1SXJD 1I4WA 2DWQA 3KPJA 3QYAA 4JELA 2YYSA 5EUQB 5HF9A 5IMBA 2QPTA 1AG9A 1GPNA 1ZH0A 1IG3A 3IP3A 4I4NA 4C7MA 1EXWA 3BXZA 3R6LA 1I1QB 4C9BA 1ID8A 2VP5A 1CHNA 4I4TF 2E0IA 1VCNA 2NYVA 3KQSA 3WMXA 1J21A 2WJWA 1T1IA 3NTVA 4E5MA 2I4RA 4NCAA 2WFZA 3SSOA 2XDAA 3WQHA 1O94D 1BROA 2FPOA 5KPDA 4NDZA 2BM0A 1QVRA 2C5AA 5KWVA 3EQ2A 1X9HA 2XUGA 5DYYA 4Q3DA 3GLTA 4WVLA 5AKYA 2QTMA 2ZYTX 5LJLA 4ZJZA 1PLJA 3MCAA 5FLXA 4MPDA 5KJ6A 4BE9A 2J59A 2WTBA 1H8ED 3C16C 4Y9SA 2B0JA 2UAGA 1TA4A 1E1YA 3VAYA 4OQMA 3KYBA 4GM1A 5EC8A 4B5KA 4A15A 1PJRA 4HVLA 3KZKA 1AKYA 1U7PA 2YVAA 5LU8A 1AQUA 1H2BA 3D4NA 1DZIA 4HDOB 1KDVA 1N7IA 1Q50A 4Z2AA 3DAFA 4Z54A 2ANBA 4F4DA 4TKUA 2XNDD 4HTAA 1PZHA 3E1GA 3ZU3A 2IYSA 3LHKA 2BCGY 2CVQA 4UMFA 3RVLA 3B9QA 3JATB 3VR6H 5CPBA 1ZH8A 4B3JA 5CAEA 1QAQA 3FCEA 3IKVA 3CLSC 1OC2A 2EGHA 3TIIA 4REQB 3EIQA 4GP7A 3UHAA 1DBWA 2II6A 2Y1DA 4NVRA 4TV9F 4FN5A 4W5RA 3T1OA 1JE0A 1HFKA 2EKLA 4I66A 4RXTA 3D7KA 2XQGA 4Q4CA 4DQXA 1R6VA 2JH9A 4ZPJA 2QG6A 2QUHA 3TZLA 4DJTA 3G7NA 2GNOA 4K88A 4IIVA 5GTDA 4HB0A 4I5FA 4AKEA 1F0YA 1NBWB 2R7AA 2RKOA 1XA3A 2X76A 4Q9LA 3G5MA 3T7TA 5IC4A 1PVOA 2E21A 3NRJA 3IUQA 4BOYA 3WMEA 2V3CC 2FSPA 4UQPA 2QL6A 3ZHUA 3KFXA 5CURA 1DZ3A 4K81B 5IANA 5D01A 4TSKA 1KE1A 4S1VA 1UT6A 3L7BA 2PFKA 2CBGA 4M87A 5KREA 1L5SA 1PNRA 5TDHA 3OLYA 4BMSA 3VPXA 2FNAA 2B3TA 5K6AA 2HSJA 3OIGA 5EXDA 4TZ6A 4WEQA 2YIMA 3BAZA 3K09C 1N6LA 1QZ3A 2VNIA 1O95D 2YW9A 2QTTA 3O90A 3PUXA 4GQAA 4JGGA 4YCLA 5F9MA 4ZZIA 3HI6A 3Q1LA 4YJHA 1BDJA 1Z45A 5JW6A 1B8UA 1W8IA 2IDJA 4EYKA 3AWDA 4MARA 3BGDA 3LKZA 3L07A 3U4DA 1T34A 3HKDB 1J7JA 1FMTA 1RRVA 1FRZA 2N47A 3NC4A 2D5LA 4M21A 2OPHA 3I2JA 4CQJA 3MCZA 1QPBA 1ZQ9A 2QYTA 3MTQA 3I2HA 3R0ZA 3I6QA 1W5BA 3EZ6A 2XB2A 3KSDO 5EA2A 2CVPA 3GP3A 3FTCA 2PUBA 2HHHB 2VL7A 5DPMA 1AZSC 5COQA 4B7CA 2GHRA 3BZBA 3R9KA 2GZRA 4MS4A 3T9AA 1KI6A 1Q3TA 1RHKA 4IVRA 1GTL1 1GKUB 4LY6A 2OZEA 4FYWA 5KTSA 2BC9A 3MXOA 2GM3A 3P2EA 5ITSA 3HZZA 1A2BA 4TM8A 2VT7A 4IVQA 5ALSA 5E2AA 5FF9A 3F6RA 4TVBA 5J5CA 3SOZA 1G7CA 1JXMA 3LUJA 1ISGA 3M5WA 3A11A 3UMYA 2KYRA 5LDHA 5B58C 3EMVA 3Q7PA 4UAJA 5CH8A 3QSGA 2B1IA 5I7FA 3EFOA 2IVZA 1BGVA 1CU1A 2QTVA 4X7PA 5L53A 4BMXA 2HJSA 4C0LA 1JLKA 2J5RA 1N5DA 1D2NA 4FGSA 5BUQA 5MF6A 2O1XA 1WPQA 2DHEA 5DO9A 5JFGA 3UT5B 4AY5A 2GPTA 1B0UA 2YASA 4WFJA 4V1CB 1O6ZA 2I22A 3NGLA 2UUBB 1M1YA 1DRVA 3LWDA 5HJ2A 1THGA 1ECGA 1W25A 1ESNA 2BKLA 5HP4A 4CL0A 3AJRA 3O8BA 4LGMA 1BS1A 2Z83A 1XF9A 2BISA 3N6RA 2BEUB 3DWIA 3O8OA 1H2FA 1T2AA 2IL1A 1NAHA 3EW7A 3WSTA 4KRYA 3EA5A 2JJ8A 1JFVA 3Q15C 4HFJA 4JVLA 4NECA 3ZDFA 2ONYA 1Z4LA 1ZR2A 4IS2A 3LCRA 5FL7A 1N6NA 1E6UA 2GRJA 1EX1A 3G88A 1OJ7A 3CUSA 3JQBC 2BTOA 1T0HB 3DVSX 4FX2A 4O08A 4PO8A 3ZNOA 1OV4A 2OAGA 3VDNB 2DLDA 4BATA 2DY0A 3N7AA 4JUIA 1SVNA 5J4YA 4Y2JA 4Y2TA 1C7EA 1F5NA 3E27A 3BL8A 4F4CA 4Q3NA 3JQRA 3L01A 4JBWA 3UUWA 2NXJA 5FA5A 4DUZB 3S8MA 4K6GA 3L5OA 1BMDA 4L3WA 3RHZA 3SJAA 3O4FA 1HUQA 3OUTA 4A10A 2NUPB 1VDZA 5J43A 2WAAA 5KZMB 4RK4A 5GADl 2O2ZA 3C7DB 3KKMA 4F5EA 2VJMB 3T9DA 1J8MF 2FPWA 1B7GO 1ISHA 2JGNA 4D4LA 4EVSA 3UBTA 2HHJA 1WB9A 1O94C 1OXBB 3DAGA 3B7GA 4G65A 1LW6E 4MJXA 1DPGA 1HDRA 5AJTA 3DH0A 3L43A 5F5LA 3E9NA 2HHCA 3G6WA 4XEHA 3PI6A 3C43A 2CYAA 4P0QB 3CLTD 1DTEA 3EGEA 2JKVA 2XXAB 1NQOA 4EYSA 1AMUA 3TQOA 2PZBA 1J0CA 1YE3A 5FUQA 3MD9A 4W1QA 3FDFA 1V6SA 1QVWA 4Q7JB 3W06A 4PN7A 5ICCA 2QMEA 2RIRA 1CWUA 4L8LA 3NG1A 1II8B 1YJAA 3DBIA 1IN1A 4MUNA 3I9JA 1QRAA 1B00A 1MGPA 4UUBA 1J49A 2PZGA 3B6MA 3D8TA 4ODIA 5GOZA 1INLA 4HAYA 5CA1F 2IYXA 4FS8A 4G1FA 3NPMA 4ADSG 1QAOA 3K0CC 4UDNA 5F5XA 4EVIA 1O77A 1C29B 3K73O 5EE0A 2OCYC 4YPVA 4RD4A 3SPXA 5LIPA 4W9MC 2GN9A 3H9BA 2Y0BA 5HNKA 2MSEB 3E61A 2HO4A 3I8XA 3ROKA 1SUAA 3BH0A 3ZWAA 3ISTA 4RENA 4C1BA 1KEKA 2NUAA 2YY7A 4N03A 3CEHA 5AW6A 1ABBA 4JYMA 2H2GA 1SGWA 2PZEA 2WWIA 1XVUA 3SE0A 1W46A 1Y1PA 1ZD4A 4ZOLA 1JIKA 4XDGA 3AJ8A 3GU3A 1DSSG 3HYSA 3T7RA 1SVWA 1L7QA 2BEVB 3RSOA 1RWNA 4F1JA 4QFMA 4RJTA 3J81A 1U28C 3K53A 3UV7A 5HJEA 4DOMA 1XVLA 2WTMA 3GLVA 3AB8A 3TE6A 1PJLA 2PKCA 2YWGA 1FUYB 4GOXA 4P9NA 3SVZA 4DA8A 4CTMA 2HBZA 1GEEA 4MYSA 1S8NA 4LPSA 3SXJA 3WIEA 5EVJA 4UZFA 5J3JA 2F3PA 3D43A 3NATA 4TSRA 2V1UA 4NXMB 5K0GA 3AXSA 4R2WA 2M9MA 2X5XA 4INOA 2EEPA 4G8JA 2BRUC 3NVMB 3S29A 1E60A 2HTFA 3V7UA 2QRVB 1NI4B 1P17A 4H0NA 4Q3AA 2J6IA 1B14A 4C0JA 3G3EA 4RHYA 1QH1A 4TROA 1CUAA 1AS0A 1KP2A 4OGWA 4B4UA 1WOYA 1W73A 1ZZGA 3UJ9A 5DGCA 4N65A 3BS4A 3D3JA 1TJNA 3GGJA 4ZCTA 4RTJA 1XGKA 2GBIA 2WK1A 2X13A 5PNTA 3JARA 3QOWA 2ZYDA 4ZVLA 2FYTA 5IN4A 2VPYA 2H2IA 4RIIA 1P0FA 1DXHA 3Q7RA 2PX3A 2O1EA 3MTIA 1KOGA 1Z08A 3C85A 4TT3D 5DN6D 2GASA 1JJIA 5EZ6B 1P7PA 3PNBA 1H0RA 2A67A 3KKQA 4Q24A 1TEHA 2UVPB 1BVUA 2HMWA 4WN9A 2YN0A 2CY0A 5EEGA 1ZU5A 2ORIA 2QXYA 4L5BA 1CF4A 2ZIUB 3EULA 4NNPA 1ATZA 4PBSA 1NVTA 3Q12A 4PLZA 2R62A 3K2EA 4N0PA 3KBOA 3VSEA 1U8ZA 4DIFA 2EBUA 1Z4PX 2P9QA 1NI4A 4F38A 4XUDA 1CUDA 2D7CA 3FTDA 4BMYA 1RQ7A 4YGXB 3FUVA 1W93A 2REBA 2CT8A 1TYEB 3KPUA 1DAMA 2R60A 2H06A 3NM6B 1TOAA 4MV4A 2R5FA 4DUYB 2MU1A 4OHZA 3ZWVA 3AI1A 3SLGA 1FYDA 2RHOA 3FHTA 3WLJA 2E18A 1YNSA 2X5KO 2V54A 3G9UA 3L84A 1AHIA 4B48A 5C7YA 2HJWA 2OORC 2E4ZA 1AHHA 3Q6MA 3QHQA 2BSQA 4AKIA 4J8PA 1UAAA 1AH2A 4U4AA 2J67A 3EWSA 3H8SA 3DPIA 4EPTA 1RYBA 5AYVA 1GZ4A 3UWOA 4RGBA 3F9CA 3IB6A 1NV9A 4BVAA 4R40A 1P18A 2BGJA 2O7SA 2AD5A 1ZA2A 5CITA 1ZEJA 1NI3A 2JK0A 4GXNA 1OWOA 1XC7A 4IDCA 3KG2A 3CINA 3QY0A 5BN3A 3I09A 2VF5X 2VUUA 4Y0NA 5C5DA 5DE3A 5HKKA 2Q3JA 2IXFA 4XSGA 3UXEA 4IDHA 1DX6A 3S8EA 4GC9A 1EK1A 3OTIA 3D8UA 1DE0A 3FH0A 1XQ1A 4BASA 5L9AA 2PN1A 3MOGA 2ZFUA 2PRKA 4L1KA 2OXFA 4MGKR 3IVRA 3WAGA 3OM0A 4WGGA 1K86A 2PBFA 4DV1B 1QU2A 1M7BA 3A7EA 1G5FA 5HRUA 4GI3A 4EJSC 2P4EA 1VBMA 1FMCA 4MQFB 5LOVF 2D2IA 1V45E 5I3ZA 1PT5A 3FYUB 3UN1A 1TLTA 1V5WA 4XXHA 2VEDA 4FFBA 3CNQS 5IVKA 3WLMA 4FFRA 3ZE1B 1JAHA 4HCJA 1M33A 4G63A 3DQZA 5ENZA 2IOFA 3OT4A 2PPVA 3MCVA 3OZVA 2GO7A 1G38A 1IQUA 2O6HA 2EYQA 1L4FA 3BIOA 4QASA 4BP9A 1V39A 3DEYX 1I5RA 3F5SA 3GT3A 3CZ9A 4BQSA 1AGYA 4FZVA 2FN9A 4PZEA 1JJBA 4JNKA 1P3JA 1NW4A 5B7QA 4LHXA 1N3BA 2HMVA 3MUNA 4MMYB 3TK1A 3N58A 2NU6A 1DARA 1JHVA 5C2JB 3FMVA 3P9KA 4BYGA 5C7OO 3MWFA 3OSUA 2XUKA 4WINA 3IJ5A 3IFSA 4R98A 3BWYA 1RIFA 2ETXA 2VBIA 4KX3A 4RZIA 5I45A 4PYOA 3U39A 1JKJA 2GYWA 4U5QA 1X87A 2DUUA 4P86A 1Y8ZA 1GTJ1 1M6VA 3L9XA 3BHIA 5HILA 3HACA 2ECQA 2EZ4A 3I9V6 1GCOA 1IIBA 1T0UA 4JODA 3U4AA 1FIUA 2AQIA 2CFOA 3MFQA 3MJEA 4D4GA 4M0FA 4V0OA 3Q7SA 1AS3A 1G1MA 3KXDA 1XD8A 5DLQC 1FU4A 2BOVA 3DBRB 1GADO 1B15A 1XMVA 2E6UX 4S1NA 4B4VA 2EBHX 4HDNA 5B6IA 1XQVA 2GJ8A 2LPMA 1DJPA 3IOBA 2CK3A 1EK0A 3JASB 4HNUA 1Y6QA 1JKMA 1XTVA 3PYLA 2ZSJA 2H4HA 2C3OA 1ZM2A 4TUYB 4WPGA 2HLPA 1GZ7A 1Z38A 3LNCA 1YGYA 3KZVA 3MERA 4GNKA 4JKOA 2DC1A 5H3CA 4MHSA 3WWOA 3EGWA 2CMFA 4YC7A 5IWAB 3R7AA 2ZWMA 4OB6A 2XMBA 4G4SO 3CCBA 2UYHA 1HH4A 2CXOA 1LZLA 1K08A 1GQOA 5CCBA 3LHIA 2JVKA 1VFPA 4FFPA 3L7AA 3FOEC 2PMBA 5A05A 1T9ZA 2P67A 3PQ3A 4PF1A 2HKIA 3W5JA 3S8YA 2YTZA 2J8ZA 4NCXA 3I05A 4JP8A 4WW0A 1D9ZA 4MAMA 3PE4A 3CEJA 3T3PB 3BWCA 3KLPX 4NMMA 4RJKA 4HWGA 3TTVA 3LK6A 4P4SB 4JC5A 3T4UA 2JFZA 1S2MA 5LZ2A 1EJ2A 4NH4A 3WBKA 2BGWA 3CVJA 4EQZA 1U98A 1M6YA 5B3JA 1UPTA 3UENA 3V80A 1PJ8A 5EY5B 4N0QA 2X4IA 1JDTA 2P2LA 5JNRA 4ZCSA 3VU8A 1PL7A 4K05A 2QDKA 1F2UA 2QN8A 1OU0A 3E3NA 3EUAA 1YB7A 4ZC1A 2H3HA 4RKRA 2BI7A 2OCDA 2VZEA 1KC1A 3B6KA 3IBTA 3PJDA 4QUDA 3INTA 4KGVA 3UTDA 4IXDA 3AHJA 1P3Y1 4HLNA 1JN0A 4Z1OA 1YRBA 1Y4SA 2R8YA 1UZUA 4U0JA 1BW9A 5LQRA 2R4QA 3K4PA 3RRZA 1W4CA 2F1JA 4UQLA 2NT4A 3PC8A 1Q0LA 1T2UA 5HFJA 5CK4A 1IU9A 5K4GA 5GJVC 1QH1B 2AD1A 5AJUA 2LDXA 4LJ5A 3A6ZA 1JR4A 4LI0A 1RPTA 1Y8CA 3DS8A 1F14A 3AINA 4HBGA 1MB2A 1PFWA 4NMXB 3V8VA 2NYRA 1RQXA 4U2CA 3RWBA 3PQCA 3TW6A 3PVSA 2PKWA 1XT6A 3RC2A 3F6BX 4D8TA 3X1KA 1ZA1A 5LYYA 4BO0A 3VDRA 5KVAA 5LDDC 1C4WA 1R6TA 3GMSA 3V1KA 3L40A 1C1XA 1QMPA 3T8YA 4CF6A 3NOXA 2J1LA 3UGTA 4CTNA 4BB5A 1BMTA 2WQZA 1FU8A 4J3JA 2GR9A 2QE6A 3Q5EA 1PWEA 3OOWA 5A3SA 1GTZA 4Y8VA 3ZK7A 3A2MA 3K20A 2W48A 1LQTA 4HFNA 3WK5A 1NC1A 2ADOA 3R7FA 4KYTA 5KNLA 3ZS9A 3ACDA 1NC3A 2ONZA 1SUEA 5AK3A 3S6JA 4RBNA 3R2JA 1Q3HA 3LSYA 1H5NA 3KAQA 4WVFA 3W4JA 4DDKA 3Q6IA 2JVIA 4OKNA 4REOA 3SHVA 1GTVA 2R8PA 3ND6A 1RSZA 4YRBA 1RYYA 3G7UA 3JD0A 1T8RA 5KQPA 3RB8A 3SVTA 1SCUB 1YKGA 2GDJA 1O5IA 3JU3A 4DNXA 2PT6A 4FFSA 3D3EA 1JKXA 1RKUA 3ENKA 3DCJA 3M6VA 2C04A 3NASA 4GGPA 4Y98A 4O4JF 4NBKA 4NBSA 4Y2VA 4V0RA 4I55F 3SF0A 4DVJA 1TAQA 2O3JA 2PANA 4MROA 2I7VA 2D0DA 3EBOA 1EFLA 2R96A 1UDAA 2XADA 2BT4A 3MWDB 5K3AA 1SQFA 4GSYA 3KALA 4JKYA 3C3KA 3K9GA 2WIAA 4N0DA 1VLZA 1S2LA 4TWJA 4X84A 1QRUA 3FDZB 3NEJA 1PRYA 2CB9A 4WXHA 3K6SA 4BFLA 2HRCA 4M49A 1EAYA 5DLEA 4HPXB 3QPWA 4DJ5X 1R5BA 1NKTA 3FPBA 4RFVA 5DXAA 1GZ3A 1P5JA 4CMGA 1HZJA 3RK0A 1HDIA 5JG7A 4CBVA 4CMIA 2PQ2A 2EP8A 1NF9A 2O3UA 1F5SA 1WV1A 2PZJA 3C14C 1HT1E 1TJYA 3FZEA 3I12A 4G86A 2QRJA 1E6KA 1EUDA 4LZJA 3SBDA 4N5HX 5CX1B 1SOVA 2AFIE 2CXUA 1B0AA 3C8DA 1MOPA 2W6NA 2ZK7A 1WULS 4RIFA 4J0IA 2GK6A 4QT0A 2IU0A 1DV2A 4E88A 4WY5A 5HRCA 1ZRMA 1W5FA 5AT1A 3EF0A 5FI0B 2HK9A 2QPLA 3PNVA 5KYYB 1PDWA 4KNWA 4XX1A 4PC6A 4YEDA 1N5MA 1KQNA 2G76A 2R9VA 5REQA 2WZQA 1IK4A 1NF3A 1HFJA 1ZKDA 2PPLA 3AJ9A 3MWDA 3WYEA 1IZ0A 4I4LA 2X0KA 1AUXA 3C5HA 1E77A 3HYRA 4ZOBA 3I2IA 3QX9A 4EIWA 1MN6A 4EPWA 3RVPA 4OHWA 4QTUB 4D99A 1AA6A 3NBQA 2TRSB 3W6PA 2PVSA 3GJTA 1S5PA 1XG5A 3I39X 2HPZA 3I2GA 4GKBA 4ND8B 4KOEC 1NDQA 1VMEA 3CX3A 1HORA 2WMYA 2GF9A 3AHDA 3PWKA 4B0PA 5IUJC 5CCXA 1N1MA 3A58B 4LNAA 3LW7A 1U5AA 2AE2A 3H86A 1LDMA 4BNYA 4B1FA 3D7RA 3DL0A 1TW3A 5MFZA 5KYUA 2Z5GA 4XX0A 2QRKA 3GJ0A 4WA8A 1TZCA 4R1QA 2IXTA 1XCLA 1EDZA 2OZPA 5E6SB 3E5MA 3FYDA 5CRIA 1VPVA 4DSZA 5JU6A 1DGQA 4OHVA 5K2OA 4EZIA 5BUCA 3ORQA 2NXEA 5LCXA 4PLYA 4B6SA 1SKAA 2UUPA 3RVOA 2QSYA 1IBSA 4JHXA 1I24A 1N5JA 2Q3DA 1W19A 4FW8A 3RUPA 5KEIA 3KSUA 3D8BA 1DINA 3QKTA 3PLNA 3EVTA 1TUBA 4JJ8A 5FHRA 8GPBA 5KYWB 2ZUSA 4JIGA 4FFWA 5K99A 4O8CA 1E1RA 1Q7TA 4A26A 2D1RA 4QAJA 1P29A 3REQB 2YWDA 1TKRA 4NESA 3RSSA 1GPYA 4GWGA 1UANA 4BNIA 4B76A 2X6RA 1DAPA 3BK7A 3KKOA 2GT1A 2WVAA 2R66A 1ADJA 2HRZA 3RT1A 4CM8A 3SS9X 2JIDA 3C1OA 2VPTA 1VL2A 1I7PA 2KLHA 2VJYA 4I1OA 4J03A 3QHAA 1DAEA 2MJLA 4YJDA 3K6KA 5CYFA 5CCDA 1M2HA 4D97A 1VE7A 3AEQA 2WD8A 3L18A 3C98A 3G2JA 2R1ZA 2XNKA 3G0OA 4DMMA 5CD9A 3EVNA 4RDXA 1QTIA 2EBFX 2FMKA 3KSMA 4QBHA 3FAZA 5ERGB 3IP5A 3E3OA 3IAFA 4NX2A 3WWEA 5A5GA 2H54A 2ZIVB 5L51A 1FVXA 4XZ3A 4BB9A 5GV8A 1GNRA 2VUSA 5DH9A 2XHEA 2QMYA 5JY1A 1JDUA 2AGVA 4JB2A 4Q1DA 5T4FA 3U3KA 5IYZB 3VU1A 1HMYA 1QBKC 1T91A 1X1DA 1Z5PA 2GZSA 4TKVA 1E2EA 3NRBA 1NQUA 4MXDA 4ZTBA 4A2QA 4IV5A 2YMPA 3NO4A 1ZD9A 4JB0A 4LQ4A 3R5JA 1U81A 2GD2A 1CUEA 3WLKX 2JFOA 5KO2A 4OU4A 1CZUA 1L5KA 3M6WA 2G9ZA 5BSEA 4M0UA 1FTNA 1JFFA 2QX9A 3AT1A 3D1LA 4FZJA 4CMAA 5LQKA 7ABPA 2GPNA 2WSMA 4LN1A 2FEKA 1RRFA 4X7BA 2OLEA 2XEDA 5JWRA 2NSDA 3RKRA 1M7GA 4EI7A 4YI3A 4TWZA 5A7FA 1PI3A 5I7UA 3G2QA 3QYJA 3SSNA 2YYYA 1WE2A 4PY2A 2QT1A 5I9SA 5K0CA 1G0NA 1EFPB 2IEDA 1MG0A 3CWQA 2BIFA 1X1QA 3QLUC 1JPNA 1LDNA 1G19A 2ZETA 1ZXBA 4ZYWA 5JS8A 3ABOB 1VGRA 2OV2A 2PMCA 3I8OA 4FD2A 4I1PA 3OZIA 2H2FA 4AJ4A 3NP9A 1BQ3A 1ORTA 3HWRA 2YZ7A 1HC7A 4HNRA 2DRIA 3OM1A 1I0IA 4HOYA 3QPDA 4EI8A 2CHVA 4YJFA 4YJGA 3DZ8A 1UXIA 3FVVA 4GHWA 4LYFA 2FOIA 2NUPA 5C37A 1GXSA 2YIJA 1VOTA 1MRZA 2W4QA 3G79A 4PHGA 5EJ9A 2ZRNA 3W78A 5FORA 2QF7A 3TECE 4JYAB 1SNYA 3R6WA 3LE8A 1FF9A 4MI6A 1K8XB 3H9GA 5DI9A 2DHDA 4V3CA 4CLEA 2IZ7A 3RAPR 4ENTA 4BO8A 3HCDA 1AQ6A 3P5SA 4OU5A 2REOA 1XBTA 1C9KA 1PSDA 4HWKA 4YP6A 1J5XA 1G5TA 1EVZA 2FG7C 4DV7B 1VI2A 1E89A 1SXQA 4RZSA 4U7PB 1GP2A 2QW1A 3QOFA 2X4DA 4OGLA 4UEQA 4YRPA 3PDUA 3WP1B 1Z39A 1WY5A 2AB0A 1RKQA 3D8RA 3R5XA 1QQBA 4JCOA 1UJ5A 1KDRA 3O4VA 1DKOA 4U00A 1XLVA 1EIZA 2DQ4A 2QYHA 4RABA 5T5QA 1QE3A 3MJDA 3SM3A 1DG1G 2QEQA 3TRKA 1ZP6A 3DOCA 2X2FA 3AG5A 1ZH2A 3HA5A 4IZHA 4JX8A 1O97C 4RD6A 4YP5A 3ZYCA 5CLLA 4N5LA 5DJ5A 3N2YA 3DR3A 4G4JA 3FZNA 5AVYA 2BP7B 5G0UA 2Y1KA 1XALA 1Z7YA 2Y77A 4O2AB 1SZPA 4UVIA 3NFRA 5HDQA 3WB0A 1M66A 1E59A 2QA5A 1QZUA 5IVIA 1NVMB 3G6KA 5AJWA 5F64A 1P19A 1KYXA 3EC1A 2ODBA 3T0FA 2I7XA 1WNTA 2P5SA 3TEFA 4E5KA 1I4EB 1MQ9A 1WCIA 4WX2B 1I3LA 4YT8A 4PBTA 2VDKB 4DLKA 4GFDA 3M6LA 3OC6A 2QM8A 2OHIA 1QG6A 3K35A 1MB4A 1MD9A 1IXZA 2O5VA 3NBMA 1EQUA 2AUMA 2R87A 1L5HA 1JH8A 1RJFA 4Q1AA 2XZPA 2JGLA 2AOUB 1SU4A 3UAGA 1V1MA 2WF6A 4YCAA 5IEJA 1WEHA 2H5LA 2VZ0A 4X8LA 3GEGA 1HLDA 1KETA 3A1NA 1UBUS 3R8CA 4HYEA 4JBGA 3BJRA 3TNFA 1D6SA 3PSAA 3EDQA 1CZKA 5IAEA 3DGFC 1PK7A 3DEJA 4EEZA 5THQA 1QO0D 4C6TA 4QZVA 1GUAA 3QTTA 1MFZA 4GKJB 4CMHA 2Q27A 3U62A 1SIOA 3WO0A 2SKDA 3NGXA 4GKKB 2D8MA 4GBGA 5JAOA 1ODKA 3P4XA 4HGPA 4TYPA 3DXFA 4ZQCB 3S2IA 2O6LA 4AZ3B 3IE2A 1JHAA 3T5PA 3ZU2A 2PLFA 4LF5B 2XUAA 4U2GA 3PC8C 3THWA 2GPJA 1UKCA 1X3LA 2IH4A 2XB9A 3CXRA 5DGDA 1HF3A 2DWUA 3FRIA 3AQIA 3SYMA 5DX8A 4JH0A 2AOUA 3MRTA 3HCEA 4R0NA 4B87A 5TEVA 1QMGA 2R6R1 1CS4C 1A96A 1ZICA 4QM7A 3K94A 2RGUA 1IPFA 4QARA 2GXAA 4I50B 5E6RB 1P6UA 3MGKA 4R84A 2IOHA 4PICA 3BQNB 3OCUA 4GH5A 5K4AA 1CQXA 3DPSA 1OSNA 1KI8A 3UQZA 5KC9A 1PL8A 1M2OB 2DT5A 3IAUA 5K0NA 3RG8A 4GKVA 1I1OA 1GYQA 4QUAA 4EGJA 4EKDA 1D6NA 3A1VA 1GR1A 2JBAB 2X8JB 4NJMB 1A8UA 2A14A 2VT3A 3B3GA 2VJQA 1CNFA 2GB4A 1X7WB 3PZRA 2FEAA 2C9ZA 3PE6A 4DLTA 4PC1A 1K3TA 1F8UA 2GCIA 4G0VA 3SU8A 3H4IA 4WL0A 3R9WA 1H9CA 3L4BA 2DECA 1QHXA 1D4ZA 4JT2A 4PFKA 2OC9A 3QELA 3MS2A 2H1FA 3I01A 1F12A 2I8AA 1JDNA 4LZAA 1F2DA 4JA0A 3KTAA 4RSMA 4UARA 1OFTA 2E6KA 1VYHA 5DT9A 1MW9X 3CB4A 4ILKA 2KB0A 1L4HA 1J6UA 1I30A 2UU9B 2O7NA 4Q7EA 4YRCA 2R79A 2I3BA 1SA0A 3L2OB 5LBUA 4BVLA 4PAWA 4OMUA 2NSHA 3GBVA 3CIOA 3HNRA 1NLYA 1QTNA 2CNDA 4FCVA 2HD4A 4MUXA 5L3VA 4TS4A 3SQNA 5HS4A 3KCNA 4NYIR 4F96A 2P3SA 3I6IA 3WHIA 4B3DA 5TMPA 3E6AA 5HTOA 3UMMA 4TMTA 3LX8A 1U2EA 1VP9A 1IC6A 2RKWA 2OBFA 2GCPA 3CZAA 5EZQA 3V00A 1C2YA 1SRRA 5JNTA 3GJYA 3U4IA 5BWMA 1LJLA 5LDGA 2YYAA 3PUJA 2Q4BA 2XOXA 3HB9A 4CG3A 3RRMA 4I1SA 4CL3A 4F2GA 1KNXA 2DQKA 2OM6A 1YR8A 2WTEA 4X9XA 5KDOA 2EWWA 3NTQA 5D7NA 2HQBA 2V0CA 1HE5A 2D2EA 1CQIA 4GKAA 3B6ZA 1PD1A 3DVAB 1IZ7A 1KIAA 2EL9A 2IEYA 4OD0A 2CDRA 5GONF 4MOWA 5TQJA 2OG2A 3M6IA 4CUZA 4KITB 4ZI7F 1FRFS 3ZDCA 1QHFA 4KK3A 4YUVA 5E4FA 3U9SA 2UDPA 1OGJA 3ZWNA 4LRWA 4LE0A 4EY4A 1R7RA 1VKHA 2G7ZA 5AXBA 3TL2A 3ZLUA 2B34A 3AR3A 2QS9A 1UPAA 1XTSA 3FWZA 3C5CA 2LCFA 5A4DA 1PKEA 5CLJA 1B8OA 2PS1A 5HMLA 1Z16A 3BULA 3VH2A 5FNVF 3G0IA 2X4LA 2C84A 3ABSB 4FWBA 4G1MB 1U80A 1QIDA 2H6EA 3IEPA 2FCRA 1GILA 1RYEA 3ANMA 5KSWB 3Q87B 2EDAA 1Q21A 4OTZA 121PA 5DYNA 3TPCA 2X9GA 3HA7A 3R3ZA 1NUTA 4DF3A 1KNQA 1G8MA 4PZAA 1ZI8A 1PU2A 2H0QA 3L0YA 2EX0A 3L02A 1M8KA 1EFHA 2CUTA 1I4DD 3A25A 1GYPA 4K0RA 1U3CA 1GN8A 2IOQA 4NEQA 2ISCA 2ZU6A 1AKEA 4YRGA 2ACWA 2NAFA 3NWPA 1DAHA 2ZBUA 3OKAA 4GQIA 2FPGB 2WLSA 4IZ6A 4QDZA 3RRNA 4G5OA 4YRMA 4HQKA 4DJJA 1IOLA 1UMDA 2R7LA 2R86A 4RF3A 1LV8A 1X9IA 3GJ4A 2NU7A 1KR2A 2WHXA 3CX8A 1P0CA 5TJ9A 4E5NA 5K0SA 2A1UA 4ZT4A 1M5TA 1ZYUA 2YUTA 1E9RA 2VJOA 1TO1E 3OOYA 4TV9B 2ZRHA 2WQ7A 1ST2A 2RB4A 1B2RA 4LZWA 4ZPXA 3PYMA 4D3SA 2GPYA 3DDNA 2J9FA 4BQPA 1CYEA 2IY7A 3I6BA 3HLYA 3KXKA 3O7WA 5FUVA 4NZNA 1JKIA 1GL3A 4KDFA 4BLPA 4DG9A 1V1RA 3FKSA 1YAJA 3QPUA 4DC1A 1KPGA 1FFGA 1RI4A 2CLLB 3A1UA 3OQIB 5KVCA 2IV2X 3ZWXA 3K0EA 1UJ6A 1VECA 2A5GA 2XSZD 3P0HA 1EXMA 2NOAA 1KDPA 2HGZA 3MMNA 1BCRA 4KQKA 2Q5FA 1E79A 3TL6A 1UKVY 2DH6A 3N0WA 1ZHFA 4IEIA 4MDYA 4Q7KA 1W0CA 4QBGB 2ZR7A 2HPHA 4TRMA 1JEQB 3RS3A 5BUZA 4TLDA 3KLMX 1W6RA 2Q3CA 1ICEA 4GXRA 4J7UA 4DLXA 2QUBA 1VFNA 3G59A 3H4TA 3T61A 1Q1GA 2WKQA 3IMGA 4TLMB 5C51B 3UYKA 1T5OA 2G0TA 1W96A 2QZ4A 4IWNA 3WLHA 2QU8A 2PZAA 1NRWA 3H2ZA 1NAIA 1HDYA 4MR7B 1GQYA 2JA1A 3VDXA 1WXQA 3A3NA 1Q0ZA 2BEKA 4TTQA 3RUHA 3GVXA 4A36A 1L7OA 3MHPA 4V0NA 1C3EA 3GLSA 4RANA 1WMDA 2NZUG 4O1HA 3HVIA 5DTRA 1FTSA 1AB5A 4AJLA 4ER5A 2XECA 3WBFA 1ZUWA 3FWNA 4GZ5A 4RL4A 1T29A 2XMDA 3O3OB 1KJNA 1SUWA 1SZDA 1XZAA 5BYJA 1ZDMA 5CB6A 2C9BA 1UM8A 4KVGA 1H9AA 2FMIA 3MTAA 1H2XA 2I78A 3GEMA 1OAAA 2EJTA 3ITEA 3TPZA 1UMCB 2Q3BA 3UJ3X 1VLLA 3O6VA 3H16A 3O75A 5U4QA 5J4HA 3DSRA 5KNBA 2O8DB 2ZOSA 2IJGX 3KOWA 1Q11A 3Q9UA 1TPYA 2CNNA 4FYIA 1YV9A 1RXUA 4ME6A 1JVBA 2GHQA 3EIUA 4OK3A 1GY8A 3FHOA 5AVXA 1TQ4A 2C7PA 1L7VC 2F8LA 3F6EX 3DE2X 3QG5A 4MX8A 4B2LA 1ND6A 1T6YA 1IH8A 4B4DA 4FNMA 4D9NA 4KPUA 1II9A 2HJGA 1L1EA 4O25A 3VKVA 5KNBH 4XIIA 3LY8A 3JYQA 3BICA 3CKKA 4BCDA 4MV7A 1N2XA 1XN1A 4WA7A 1XOIA 5F3WB 1SCDA 3PHCA 1H6AA 3BEOA 4BTLA 3SHQA 4IH9A 1SELA 1GPJA 4LNUA 3TLMA 4EO4A 1DO0A 4E1VA 1YMVA 4EVQA 4IMJB 4W5HA 4BMNA 2D06A 3O95A 1ZUD1 3PHHA 4YRNA 3KRTA 5BR8B 1QVZA 1LTKA 1UBLS 2Z2ZA 1E3JA 2QSZA 2ZANA 4G37A 1OLXA 4KDEA 4MI3A 3ZUGA 1G4AE 4R01A 5LP6C 3MD0A 3B5EA 4MGIR 5CFPA 3PF9A 2FN7A 4FFDA 5LBIA 1Q95A 1T0JB 1AKUA 3WGNA 5LUBA 1NONA 4X3CA 1IUNA 4HN9A 4NBVA 3STHA 4FE7A 1CUZA 2ZWOA 5F2OA 3UATA 3PUVA 1ZVJA 5CDHA 4CMBA 4X3PA 2XE8A 5JBIA 3OZAA 4XPIB 1ISIA 4BBAA 4MWOA 5EKXA 4K1LA 2R8ZA 3MCWA 3NP7A 2WHQA 2VHXA 4PW0A 2HMYB 4ZZ3A 4R51A 1XU4A 4FOTA 1HYBA 1H8HA 3UHFA 2WBLC 3MNFA 1JPUA 2YN2A 1UL1X 1KH2A 2XWPA 4FGKA 5JZBA 4X60A 5DWQA 3C74A 1GZ6A 3MWEA 3CX4A 4ZO8A 3OI7A 3HWWA 3OWXA 2RHGB 5E6UA 1JVSA 5HFAA 5DOZA 1C9EA 2A9RA 3KSZO 5F9HA 1TQ6A 1VJDA 3WB9A 4ND5A 3F7NA 4RA6A 1SC9A 4Z9YA 3EDCA 2ATXA 2WHEA 3P2OA 1VL5A 1SIWA 1SPBS 4FM9A 5E1BA 3QEBZ 4TMXA 1OMOA 2VDMB 4E94A 3AI7A 3VKHA 3BMNA 4D5GA 3CNOA 1TCCA 3BTVA 2DGDA 4JL8A 1J1UA 1HE2A 2J32A 4NZYA 4OO3A 1EE1A 4P81A 4PM4A 5EWLB 4FX5A 2GA9A 4OI1A 1EAMA 2XMGA 2Y1OA 5AW3A 1Y1LA 1BE6A 3ZDDA 4TL7A 2QRPA 4J2OA 4DTIA 3HYLA 4EG4A 4GPIB 1E8MA 3MT9A 3OFVA 4PYMA 4MWZA 1SY7A 3LC7O 1WBJB 3O93A 2WIKA 4XLLA 5DIZA 5JYDA 2MSNA 4KQ9A 3RVSA 2PZ8A 4UMDA 3CZMA 5DHFA 3FPSA 3AKEA 1ZMRA 3HDVA 1U2ZA 1TNDA 1E1MA 1AVTA 3T4EA 4EB6A 1OFHA 4R2XA 3KTFA 4OMDA 1WW2A 2XNCA 3HN6A 4QYMA 4WEOA 1HLFA 2NXNA 4RK5A 4HWRA 2VDRB 3VNAA 4BZPA 4HNQA 1E2HA 1CVRA 1FNNA 1P5FA 2DTDA 4BLTA 1PJQA 5H9WA 4KB5A 2HEIA 1GG9A 3WDLA 2A0UA 1OBFO 5HM8A 1E7WA 3DKPA 3DNPA 1IEVA 2ZYAA 1Z8NA 4MITA 2Q07A 4NDNE 3IQFA 4CMEC 2UXBB 2FI1A 2WJIA 4JX9A 3P20A 2Z57A 4IF4A 4MKGA 3W3AH 3M70A 4L50A 4MS1A 4CVNA 5EGSA 1CC1S 2CLDX 3LTEA 1NZDA 3KD2A 2VO1A 4GEGA 2ZT5A 1NF2A 3HO8A 1BEUB 4U39A 2PGOA 4PVCA 4ZZ2A 2VATA 1E9BA 1CB7A 4NY1A 2RH5A 4R0MA 3DBHB 1S2GA 4AXXA 3ML1A 3QLTA 3TRFA 2QBYA 3DB2A 4A1FA 1OFVA 1W94A 2YDXA 1OAKA 2ZJAA 4FKMA 3WQQA 1DRWA 1WCWA 1J8FA 3NAQA 1V48A 4TLEA 5GZ6A 1JQBA 4JLPA 1SXPA 1BVYF 4B32A 3I42A 2R68A 2VRCD 5TVKA 1HY3A 1O54A 4BNWA 3JQDA 2XZTA 4ZA2A 4C22A 4TQ9A 4WQMA 2XYGA 3VHLB 2ZSUA 4X3OA 2JGMA 1KS9A 3SR4A 2Y1GA 4MKXA 5EJ4A 2J46A 3UC9A 4XQCA 4O5OA 5LOVB 3DWFA 3HDQA 4FMDF 4X8OA 3MJSA 2FN8A 2W8BA 1QHSA 4OL0A 3ILHA 1S3SA 1PJAA 4HEA1 4OEHA 1KHHA 4OP1A 4ER0A 3B5JA 1A5SB 3FNBA 4YRDA 3H8JA 1YIDA 5K0TA 2SICE 4YLEA 4AMVA 4EI9A 1LVHA 4YX9A 4ACAA 4RJLA 2IBMA 3WL3A 1XCMA 2J3JA 3GEEA 2F9LA 4YJ2F 5IYZA 4EG3A 2WJPA 2IPOA 4MW5A 4UBKA 4FDAA 3WXMA 1U1GA 2FMTA 1UMBA 2NNWB 3IDAA 3BSFA 4FQ7A 3ZJYA 5BWLA 1OFGA 2ZROA 4GVPA 4BO6A 2WHPA 4HNGA 1USWA 5KWSA 1F4PA 4JS0A 2WJGA 4BRUA 2D1FA 4WHMA 4JP1A 1NN1A 1R6AA 1V16B 3A4LA 5H80A 5HW0A 1E94E 1KO8A 4MCAA 4YRJA 3DZCA 4LZOA 4CIYA 3L1IA 4DSNA 1PJBA 2WWGA 2QD1A 4MPTA 1QU3A 4LC0A 1M6EX 2YRXA 1UFOA 4PQFA 3GZTB 2AHRA 3QU5A 5FBRB 1NATA 3C3AA 4HPWA 3VYSB 1YUMA 4YRZA 2B4RO 5C8DA 2C5SA 1KRXA 3G5AA 3N70A 4HFRA 3H3FA 1KBOA 3IRVA 5L7TA 3HGMA 2IE0A 4QRDA 2OQIA 3GT4A 1CQJB 4EWLA 4N1AA 5EQDA 5H81A 5G3YA 1GA4A 2X0RA 4M22A 1LJ8A 2PMFA 2GF0A 1RD4A 4A4DA 2QXUA 3ZW9A 1JHUA 1SIUA 1Z36A 2XKAA 5JZOA 2ZQ5A 1GRRA 2RJ3A 2VPXA 4WUTA 4LHSA 1D9XA 1L9XA 3KKNA 1M8JA 3A1SA 2C4MA 4A27A 1X39A 2RHBA 4E14A 2I91A 4YJGB 2PJRA 1J25A 1PBTA 2MCFA 1QS0B 5DYWA 1KEVA 2Z3ZA 3P2KA 5EINA 4WGFA 4B9EA 2A33A 1FP4A 3N8IA 3OJCA 1GG5A 3G2MA 5EVCA 5J63A 2QM0A 2NYUA 4N49A 1JLSA 3P26A 1E8DA 5ESDA 1ODTC 4AFNA 4MUJA 1PNVA 1OB2A 3EPRA 2F8SA 3KR2A 4UQOA 4Z7OB 3GDFA 3OLQA 4HNAA 1SCQA 5ALQA 3A3YA 4Q4LA 4FIDA 3QOXA 5EE1A 2ZB3A 3DBLA 1W1WA 2RHHA 4PSDA 1X2BA 3TNLA 2N1BA 4FMBB 1DB3A 3OLXA 2NPOA 4AWXA 2VDJA 1BDBA 1Z4NA 3CR7A 1BG6A 4V24A 1UOPA 2EFEB 3X1DA 1KFCB 4YI5A 2FMUA 5JYBA 4RTNA 3TLXA 1E3LA 3TRJA 4ER6A 4DV6B 1FFDA 2VSXA 3NYWA 3ONNA 1PCXA 3I72A 3AI3A 1PJCA 4R3UC 1FPQA 3ZDQA 4FFNA 4WNYA 5A3VA 2YOHA 3N6XA 1NVGA 3STVA 4IJKA 1I6MA 1VGVA 1Z2OX 2IY8A 3EIOA 3CLHA 2EL7A 2CNLA 3LRTA 2FQXA 3V4LA 3VDMA 3W6ZA 4BNLA 1U5CA 1U2DA 1I36A 2VHYA 1F20A 3ENQA 4K9KA 1JAXA 2X41A 1CUXA 4JC8A 1DJQA 3ZDEA 3AC0A 3AR7A 1KZ1A 5G0TA 3WL7A 1Y80A 3ZV5A 1DFGA 4R9UC 1UKEA 2YY6A 1ADYA 3CVOA 3DDSA 2XPCA 1Y4AE 3NOVA 1U5BA 4BECA 3EA0A 4MVJG 3FNGA 1MB0A 3H11B 3ER8A 1CY1A 4JEMA 2CJWA 7REQB 4R83A 4FYYA 3LQKA 2GLUA 4AP6A 1L6RA 1YR3A 2A1UB 3G0CA 4L51A 2ZSKA 1UZLA 1WD5A 4QL3A 3RLIA 2QV0A 1Y42X 3TF5A 4Q9KA 1IHYA 2AN1A 2UKDA 4KXLA 3EQ8A 2XMRA 3IQZA 1UPCA 3DVLA 3HJBA 3LC1O 4IWYA 3LY9A 4MI9A 2YUIA 5AK4A 3N9IA 5BWCA 2AR0A 3A6FA 1BC5A 2AQ8A 4NMHA 1JILA 1RRGA 1CD5A 4XM1A 4EHJA 2GCOA 3VHXA 3AR6A 2XDWA 1JJ7A 1CJCA 3CBGA 4R8RA 1E3EA 1GNVA 1YHNA 3L79A 2B5OA 1UDCA 4A6DA 1RC1A 2JLSA 2OSBA 1KAQA 1NBHA 2POCA 2VXOA 4N8EA 2ZGVA 1V95A 4LDQA 2QJRA 3O31A 1QYVA 2V7UA 1RNLA 4UEKA 5BSMA 3SC6A 5KI6A 2ZE8A 3KXPA 4BYMA 4Q39A 3PL5A 1JTVA 2PMWB 4OL9A 2QQEA 2JLCA 4GR5A 4Y1RA 2BM8A 5IABA 1QTQA 4PN3A 4RVCA 3QV2A 3ZHZA 3W7AA 4K6KA 3UBMA 3NT2A 1XNHA 2VF4X 4RDCA 3TW8B 4MR7A 4KYIB 4B8WA 1G5PA 2CZQA 3R5FA 1FQKA 3HA3A 1NP6A 1BWSA 2QYSA 2ZYGA 4IIGA 3PHBE 4O63O 2JI8A 3DZGA 4PX2A 2IY9A 2VAPA 4YDSA 4BNDB 1BFUA 2OCLA 3ASZA 3AGPA 5DM4A 4DPKA 2FSIA 1WZUA 4X0EA 1RKVA 2P5TB 4KQXA 3EVBA 1KZ9A 3D2CA 5ALEA 1U8FO 3UMSA 1ANKA 1P7VA 1IK6A 3VR0A 2QVBA 2I65A 1TVKB 2W8ZA 1O0SA 1ISRA 2B7BA 3G1TA 4UTZA 4CTJA 1RJEA 4UNQA 4CEIA 3LQYA 3ZZUA 1JZSA 4ZALA 2X9VA 3HCPA 4WNCA 3V8QA 2BZSA 2W6PA 5G4KB 4I3HA 2PQ0A 2JFFA 5EFOA 5A6SB 4C88A 3H1EA 3CE9A 4H7PA 1UXHA 2EU8A 2GN2A 2B9EA 2XX3A 3T3NA 4TZ0A 3PA8A 3P19A 3QWBA 2GK7A 3FE2A 3VX4A 2HWXA 3PXCX 4OMCA 4WCVA 1RWBA 2OCKA 3ID6C 4DDWA 1SBZA 5IC6A 1BHSA 4F92B 1SUFA 1Z7WA 4YQZA 1Z75A 2VRCA 3GG2A 3LGSA 4NAHA 4RZ2A 2QZ9A 4NP6A 3V4ZA 1UWKA 4BNDA 1V35A 1EFAA 1KZ6A 3PLAE 4BO1A 1DTWA 4MWEA 4QGGA 4HEJA 4Q03A 3DMFA 5CGZA 2PBZA 2CNOA 2BV3A 5WRFA 2XF2A 2ZBQA 4R9SA 1YU6A 4Y67A 4QOFA 4WI1A 2I1QA 4DN6A 3D54D 7ADHA 3OLZA 1QPGA 1BFKA 3GRVA 1EXDA 1AK9A 2PWPA 2VHQA 1YOBA 1KI3A 3RRFA 4DMRA 4OHCA 3TQIA 4BAUA 5CBPA 1KMMA 2XWSA 1H85A 2CLOB 4CG0A 3RSHA 2IS6A 1YS9A 5ENDA 3IPAA 1RBZA 4Y2QA 3TX2A 2HMUA 1NSFA 4QJBA 4O3MA 1KSFX 1KJ8A 1TVCA 3EJ6A 4L22A 3TM5A 1RJWA 3FPEA 1LSSA 4MWGA 3RAJA 5IKMA 4GGMX 1AXEA 2QJTA 4NNJA 1REQA 1EFRD 3GBPA 2MYPA 4GP6A 4KTVE 1BH2A 2WAYA 2I2FA 4G3XA 2WPDD 4WDQA 2BVNA 4OF4A 2O8NA 1M5UA 3VNRA 1Y81A 1T3TA 1GV1A 3CXUA 3LA8A 4RO0A 3C3WA 4A1OA 5DLDA 3QSYA 1HE8B 4TT3A 1PZXA 1U7TA 1KQFA 1I2CA 4DLPA 3ONEA 3BGSA 2OCAA 3B53X 1ZBDA 1JIJA 1Q7EA 3I4CA 5HR5A 3JXEA 1C4OA 4RHUA 4BO4A 1WWKA 2ZRMA 3ZZ1A 4ITVA 1UBNA 2O2DA 1MCZA 2EX4A 3A6GA 3DO6A 4I9HA 3MPUA 5SV2A 2QX8A 2XAUA 2F1KA 3ENVA 3N7UA 4RA6B 1KQOA 1S1MA 1E1CB 2ASEA 1GFWA 1MAUA 2JGJA 1Z2EA 3BE4A 3JD3A 4PWYA 3W05A 4BNMA 4BGDA 1KYWA 3AI2A 3AKDA 3G49A 5JCPA 1OI3A 1QK4A 3BWEA 3GNSA 4KBGA 3S2SA 3ZBTA 2GJKA 4R9RA 1DIGA 4GWKA 1EB9A 4JD5A 4R1SA 4YTEA 5D86A 4CODB 1CZRA 3GT0A 2NV6A 3QITA 5AIBA 1C7IA 1M6NA 4XCVA 5KX5A 1AGRA 1GO2A 1OFIA 1QF9A 1E3TA 1Y5RA 2JGDB 3IODA 1V9CA 4J7XA 4QXRA 4DYHA 2Y68A 4HHEA 5CDGA 2WT8A 1MEEA 1YJ5A 3OPXA 4ID3A 2V6IA 4V39A 4DLLA 2CVZA 5JIBA 3PNKA 2G82A 3EGCA 1KK0A 1USKA 5CIQA 3C3EA 2ZAMA 3SYTA 4BPBA 4LHWA 3ZDXB 1XMJA 2QJFA 1CY7A 3K9BA 4C04A 4O5AA 4FINA 3SKVA 3NT4A 4LECA 5D6NA 3WYDA 3PX7A 5AO9A 1PDVA 5CVEA 2HV8A 5C5EA 4MVXA 1APBA 4DV0B 1DQYA 2K87A 4YUYA 3F2IA 4MJ7A 4C7BA 3WGKA 2FZVA 5FBZA 4B3MB 1QQTA 1XFDA 2HNKA 3K0CA 1DJMA 1G21E 1HTBA 4EOGA 1Y89A 3W8FA 4AKHA 3BXHA 3HP1A 5FBWB 5KNDA 3PUHA 5K8VA 1P5HA 5E2BA 5KAMA 3JSAA 3F74A 4DW8A 2VF8A 4ZYZA 3ZHCA 3KUXA 1ZCAA 2JAXA 1FYXA 1PNQA 1C7ZA 3KJXA 1VRVA 1Y9DA 2CUKA 1JHQA 4JITA 3EFBA 1GQRA 1Y4UA 2UZ3A 1Y1TA 1Y9ZA 4UREA 2C9DA 5U1PA 4F2HA 1J8QA 1DAOA 1H6DA 1C30A 2I6QA 2YVKA 4S1OA 1QFYA 2XNJA 4U7JA 3GA7A 4YMLA 3UJPA 4YV2A 3U9TA 4OHYA 3NV9A 3VKWA 4M0DA 1JMKC 5KQGA 3HRKA 3T41A 4CV0A 1WSWA 3T9EA 1PUXA 5I7HA 2WE7A 2IS2A 3BE8A 5AXAA 1Z18A 3IUBA 1R4MA 5EQJB 3QH4A 4A8HA 2JPDA 2WV7A 3GLUA 4R8SA 3OCJA 2VJMA 1YCGA 4LDNA 1T2EA 2Z98A 2EFHB 4O1IA 4ND4A 3WGTA 4RTKA 3P1JA 1SM4A 4I55A 2X4GA 2R84A 1SXHA 2D4HA 4EBBA 4F7DA 2WFLB 5IAAA 4DEVA 2NW6A 1GSIA 3DMTA 1U0NA 4DIBA 4I7EA 1MB3A 3B6JA 3KJGA 1DOZA 2G77B 2BZGA 3AF0A 3PDHA 4JYPA 5ETJA 5FBKA 3TQRA 2EJUA 1CJKC 2F3TA 4E3WA 2JJ2D 6AT1A 1FMFA 2JGFA 4Q7QA 1TJ3A 4KFSA 4QJ5A 3QXSA 2VAMA 3O3CA 1BYIA 3GVCA 4F4IA 4O0LA 1QB8A 5JO9A 3KQPA 1NT2A 3CW9A 1GG2A 4JJFA 4WBXC 4YMHA 3BMXA 4UCQA 2A9QA 2YQZA 4K28A