3G9UA

Crystal structure of este5, was soaked by p-nitrophenyl butyrate for 5min
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
296
structure length
294
Chain Sequence
b'AGPEIVKLKKILREKAVPPGTEVPLDVMRKGMEKVAFKAADDIQVEQVTVAGCAAEWVRAPGCQAGKAILYLHGGGYVMGSINTHRSMVGEISRASQAAALLLDYRLAPEHPFPAAVEDGVAAYRWLLDQGFKPQHLSISGDSAGGGLVLAVLVSARDQGLPMPASAIPISPWADMTCTNDSFKTRAEADPMPGGINKMAARYLNGADAKHPYASPNFANLKGLPPLLIHVGRDEVLLDDSIKLDAKAKADGVKSTLEIWDDMIHVWHAFHPMLPEGKQAIVRVGEFMREQWAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Esterase/lipase
publication title Structural and biological characterization of EstE5
rcsb
source organism Uncultured bacterium
molecule tags Hydrolase
total genus 104
structure length 294
sequence length 296
ec nomenclature ec 3.1.1.-:
pdb deposition date 2009-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3g9uA00
1K4YA 5AI6A 1JMYA 1E3QA 1Q0RA 3O4JA 3A6ZA 4JYMA 4B80A 3VJLA 3VXKA 2JGLA 3MUNA 4TGLA 3IUQA 1CLEA 5IVIA 1C4XA 3CXUA 4U2BA 3SX4A 3KSRA 5C8ZA 1B41A 1A8UA 1PV1A 1EA5A 4KRYA 5JD6A 4DTCA 2OAGA 3DOHA 1JJBA 5AKZA 2AJCA 1X70A 4S0XA 1N5RA 4U2CA 5ALUA 1XQYA 4G4JA 3WJ1A 1LPBB 5AKGA 2ZVDA 2VAVA 1EHYA 5T4EA 1D07A 4L3WA 2QVBA 5LYYA 3TJMA 2O7RA 3WIBA 4OB8A 2QUBA 5T4BA 1EVQA 1YSCA 5HF9A 3ZLVA 4DNQA 3ZLTA 3ESAA 1H2YA 4X7BA 4GDMA 1AC5A 5ESRA 5HF5A 1J1IA 1CVLA 5K3CA 4N8SA 1N1MA 4O08A 3QVMA 2ZYRA 3MGAA 3G0IA 4X95A 4Q82A 4E11A 3PE6A 4H18A 1F6WA 3DS8A 1GQRA 1EDBA 1HBJA 1X2BA 3GROA 3WK6A 1PFQA 3K6KA 4GXNA 3C6ZA 3DCNA 4QDZA 5HKBA 3R41A 4PSUA 1LPPA 4C4XA 4UPDA 3S2ZA 2O2IA 2Y6VA 2OG1A 4FBMA 1EVEA 2B9VA 3CCCA 4L72A 4P9NA 1U65A 3EIOA 1CUAA 3I2GA 4GECA 2BGNA 5LZ5A 3N0TA 1ZI9A 3WKEA 4LIPD 5HFAA 3RM3A 5DNVA 4QWMA 1SC9A 1K8QA 3Q0TA 2DFPA 5AI0A 3DNMA 4CFSA 2Y6UA 3I2FA 2O2HA 1QIHA 3D4LA 4WJLA 2VATA 2XDWA 4KJXA 3BIXA 3WWDA 2ZYHA 4BE9A 4AO8A 4KYVA 1YR2A 5IVDA 5AKKA 3E1GA 3WL6A 1TCAA 3PF9A 4BE4A 2RI6A 5E2IA 3C70A 4AZ0A 4KAJA 5ALIA 4MYSA 4UFOA 1XFDA 2BCEA 3I2IA 3ZWQA 3ED1A 1CUCA 1EXWA 1P0MA 3FCYA 4J0DA 4EY7A 3BE8A 4C01A 4A5SA 1QIFA 3WIOA 4RE5A 4BC0A 1VOTA 3QMMA 4KACA 1CUGA 4B0PA 3H19A 1R9NA 1VE6A 5EFZA 1YS2X 5ALRA 1DTEA 5ALGA 3CCBA 3CN9A 4EBBA 5ALXA 5EHXA 4GHWA 1ZD5A 3ZLUA 4UHCA 2HDWA 2PVSA 4Y2QA 3A2MA 3BWXA 1U4NA 5AI9A 2XE4A 4OYYA 1OXMA 1EK1A 3IA2A 2B61A 3I2KA 3AJAA 5CT8A 5JANA 3E4DA 1CUZA 4BCDA 1XZJA 2VJBA 3ZPXA 2DHEA 2CUTA 2WIFA 5A2GA 5C8VA 5AP9A 2J3DA 4UHBA 3CN7A 1DU4A 2XQKA 1UKAA 3WWEA 2QRUA 1BCRA 1TQHA 1JT2A 1ZIYA 5JALA 3IB3A 4FWBA 2PKYX 3D59A 1R4ZA 5FV4A 1ODSA 1EI9A 4QEKA 5AK4A 2JBWA 2QR5A 4OSEA 2JEZA 4FBLA 4C87A 2OCLA 1HPLA 3T4UA 4AMZA 5AOBA 3WWCA 1TCCA 3K2IA 1E89A 5ALDA 4EY4A 5DTJA 2ZJ6A 4W1QA 3STWA 1TAHA 4B83A 4BP9A 4GI1A 3GELA 3C6YA 3FAKA 1GPKA 1XZEA 4B9AA 3STYA 1XLWA 4JH0A 1NX9A 5ALSA 2JGIA 1VXRA 4Y9SA 3C45A 1AQLA 2EEPA 1UK8A 2QOEA 2JGJA 3IIIA 4DGQA 5AI8A 5A6VA 2XI4A 1P0QA 3C87A 4FKBA 4X6YA 4C88A 1ZICA 3AIKA 4U2GA 2XUQA 4Q34A 5HZGA 5ALLA 3C8HA 1SFRA 3HXKA 1XLUA 1RP1A 3C5VA 5HQ3B 4B7ZA 2R11A 1XZFA 2XUJA 2Z5GA 4QLOA 1CUSA 4B84A 1P0IA 2XLCA 4FNGA 3WA7A 4M0MA 1TK3A 5EHNA 1IVYA 4JYPA 1XRMA 3O95A 5AKXA 4ZXFA 3OOSA 3BF7A 3H04A 3HEAA 5I9IA 5ALVA 5HK8A 4CG2A 4G9EA 4HZGA 4N8EA 3B12A 2YYSA 4AB1A 1CUJA 3O4HA 1DT3A 1FFCA 5JAHA 1UK6A 4K6GA 3EQ9A 4QDTA 4BYMA 4U2EA 4C89A 1YB6A 2BUBA 3U0VA 5AM3A 1CUFA 2PSDA 3WL7A 3V1MA 4CCWA 4QZVA 4DSZA 2BGRA 2QJRA 3WA6A 3G0DA 1ISPA 5KWIA 2WHPA 2XUAA 4Y2XA 4DMFA 1IUNA 5JASA 1VZ3A 1L7RA 4WCVA 4FMPA 3QH4A 3QZUA 1TKRA 1HQDA 2WFLA 2H9YA 4MXDA 3C6XA 5AM5A 5DTIA 3EBLA 4BZZA 4DLNA 1XRQA 1N8SA 3WKAA 2VA9A 1MPXA 1THGA 3LCRA 4KEAA 3BJMA 2Y2UA 2QXTA 3SC2A 4LKOA 1QTRA 3DQZA 2WTMA 5IH7A 5C81A 2RGUA 2QXUA 4KAFA 1H2ZA 5LZ4A 1WB4A 2WHQA 3V1LA 1DINA 5E4TA 1ORVA 1BROA 1K63A 3C6BA 4QA9A 3V48A 2GZRA 3JYHA 1MJ5A 1IZ7A 4U2DA 1VA5A 1NU8A 4Y2UA 2BJHA 4GWLA 2WUDA 1DT5A 1EDDA 4W1SA 1FFEA 2C5FA 1MT3A 2BFNA 5ALWA 4IQ4A 4H7IA 3H2GA 1XQWA 5AKYA 5C8XA 1LPNA 4LYDA 3HI4A 1IUOA 3FYUB 1QIDA 1MO2A 3H1BA 2WIGA 4MQMA 4WFJA 5AOCA 3HYSA 4AN0A 2ES4A 1O6GA 4Q1VA 4ZV9A 5CH8A 3W04A 2W22A 3I6MA 4N8DA 1YB7A 2XUKA 3NUZA 1BRTA 5D3ZA 4BDSA 1CUDA 2ZYIA 3WL8A 1VJ5A 4Y2PA 2WJ3A 1G42A 5AI4A 2OCKA 3G8YA 2VQ6A 2LIPA 2PSEA 1UOQA 5AM0A 5DNUA 1IMJA 2C58A 1QTIA 3IUNA 1XRRA 3D7RA 4X94A 4AX4A 4BDTA 2PPLA 1EINA 1NU6A 3B3QA 1BU8A 1GT6A 3DD5A 3L1HA 2HU8A 5JAUA 1CR6A 5CTAA 1P0PA 3WYNA 3A2NA 3BDIA 5FUMA 3HJUA 3WL5A 4PO3X 5FDFA 3M83A 2CEKA 7YASA 4UHFA 5YASA 4N5IX 5ISMA 4F5ZA 2E3JA 4P93A 5CH3A 2VJAA 1ZD4A 5ALOA 1C7IA 1CEXA 2PX6A 2WIDA 3G9TA 1MN6A 1JKMA 5JAPA 3DKKA 1Y7HA 1BCSA 3STUA 4ARAA 1QO9A 5BOVA 1TCBA 4UFPA 1L7QA 3E0XA 2WFZA 2O7VA 4OU5A 5AM2A 4YASA 4ARBA 3STXA 1W6RA 1EK2A 1AGYA 3F8SA 2ZJ7A 5SYMA 1YAJA 5H3HA 5FRDA 3LIIA 4AMYA 1Z68A 3W06A 4H35A 2G4LA 4UUQA 2WG0A 2XQGA 1HKHA 5LP1A 2XMZA 5K3FB 4X85A 4UBMA 3VJMA 3FBWA 3SWWA 1LLFA 2Y2VA 1VXOA 4ROTA 4UBIA 1CQZA 4G4GA 1GKKA 4L9AA 1DX6A 2AXEA 2WUGA 3JW8A 4F21A 2J4CA 4NMWA 2QT9A 2I78A 2XUFA 5JZ9A 1E5TA 2CBGA 2JF0A 3H2KA 4E14A 2WJ6A 2HM7A 4HXEB 5A71A 1R3DA 4J0CA 1BN7A 1GZ7A 4X97A 4BZWA 5LIPA 2VTVA 2OPHA 1QLWA 1UK9A 3C43A 3I2HA 3PDCA 2H7CA 3L1JA 4H7JA 3WI7A 4KAAA 4KE6A 3MVEA 4LHEA 1GPLA 1FSSA 4FLEA 1BEZA 4Z49A 5CT4A 2B4KA 2VT6A 3G02A 2ZSHA 2RIPA 5T4HA 3F97A 1XZCA 4AO6A 1M33A 4PNZA 1UKCA 1QONA 1MNQA 2XMCA 1J06A 1WHTA 4CCYA 4I3FA 2Z3WA 4J3JA 4UBNA 4UFNA 4A23A 4M0EA 4DNFA 2I03A 4OD0A 2J4FA 4BP8A 1LBTA 3RARA 2WG1A 3DOIA 1QIEA 1E8MA 2OGTA 3R40A 3ANTA 4FFVA 3DKRA 5DYYA 5ALNA 1XROA 3KWFA 2OQIA 3D2AA 3I2JA 1VLQA 3OC0A 3OM8A 2JIDA 1YCDA 4XIIA 3IURA 1F8UA 1CPYA 3QPDA 1ZOIA 3FVTA 5ALYA 4FDMA 4L0CA 5DYWA 3QPCA 5AIBA 3AZPA 1YAHA 1WPXA 2XMBA 4J03A 3KWJA 1Y37A 4MEAA 3PFCA 2ACEA 5CXXA 1AMNA 4H7HA 1Y7IA 3LLCA 3TGLA 1WOMA 3E3AA 3DLTA 3H2HA 1MU0A 1XZBA 4DMHA 4OB7A 1IUPA 4M0FA 2WM2A 5JATA 1UT6A 4H7DA 1J2EA 4K6HA 5ALMA 2WUFA 1L7AA 4EY5A 3HZOA 2HFKA 5KWJA 5T4FA 4UHHA 3HRHA 4PV7A 3H0CA 4H77A 1PJAA 3ICVA 5BV7A 5EHZA 3KXPA 1CRLA 3LP5A 3KOOA 3WWOA 4IH9A 3ANSA 4JNCA 5HFNA 5AKHA 3WQHA 4A16A 1JFRA 5LLSA 2XUIA 5EIAA 5EGNA 4MYDA 3DYVA 4WFKA 1UOPA 3D0KA 2GBIA 4PW0A 5K3DA 5J3JA 1ACJA 4NS4A 1H2WA 3DL4A 4BATA 2XB6A 1QIMA 4CI9A 4PSDA 2XMGA 4X90A 3H17A 1H23A 3W05A 4Y2YA 1FFAA 1MAHA 2WTNA 3LS2A 5HF8A 1CUHA 5LZ9A 5AJHA 3F67A 4K2AA 1S8OA 3GBSA 4ZV7A 4BTVA 5JAOA 1UKBA 1BEEA 5A7GA 4Q3KA 4CG1A 1TIBA 3HLKA 1LBSA 3I1YA 2C0PA 4FFWA 3HSSA 1YS1X 3WK7A 4BVLA 1UXOA 2OAEA 3PUHA 4PF1A 3O9VA 5HF6A 2W6CX 1EDEA 5EHQA 1SCKA 3PI6A 1T2NA 4EZIA 5AK5A 2JEYA 3R3ZA 3U1TA 2XLBA 5K3FA 4MQLA 2ORYA 2V98A 2RONA 2C7BA 2WUEA 4DNOA 3OPMA 2DR0A 4KE9A 5JADA 1LPAB 3AZOA 1XZDA 3RK4A 3DYIA 2H7YA 2HA3A 4GBGA 1CUEA 5JD5A 3FCXA 2HRRA 3F96A 2XMRA 4HTAA 3NGMA 3O9MA 2GYUA 3QBJA 1KU0A 4FHZA 2WU4A 4BVKA 3W9UA 2XQFA 4OYLA 2XUGA 1XKLA 2HIHA 4X93A 1AKNA 1MX1A 3A2LA 4FOLA 1XQVA 4OU4A 2DHCA 5JIBA 1ZGBA 2HFJA 1XQXA 5ALQA 4PSCA 1SOMA 3HACA 1ODCA 1Q84A 1ZGCA 4YPVA 4JUIA 4BB0A 1EH5A 2VT7A 4YX9A 3K9BA 1CUYA 2G63A 4QE3A 1IZ8A 3WKBA 5AKEA 2CB9A 1DWPA 4Q05A 5D7BA 3R3WA 2AJ8A 1XZLA 1XZKA 4X6UA 2FJ0A 3R3YA 5ALFA 1QGED 4WDRA 4BCBA 3F98A 3FNBA 1A8SA 4ITVA 4E46A 2JGKA 3H18A 3BDVA 1GGVA 4ZI5A 2XQJA 4BRSA 4HVTA 1K5PA 3RKSA 5CRIA 1KU6A 2JGMA 3IDAA 1ETHA 3H2JA 3EQ8A 3GUUA 2DSNA 1B6GA 3DDUA 4G8BA 1CUWA 2WHRA 2XUPA 4N5HX 1UK7A 1LNSA 2V96A 5CT9A 4H7FA 5K3BA 1YA8A 3WZLA 4MEBA 4ETWA 5ALKA 2WJ4A 1W75A 4DNPA 1O6FA 2FUKA 4UBJA 5ALPA 2XMSA 5IVHA 2XUDA 3A70A 3WMRA 1QE3A 5A62A 4RGYA 1SCIA 3R3XA 2OLEA 2PBLA 1CIJA 2VF2A 3IULA 4LXHA 4ZGBA 3IVMA 2WIJA 4EY6A 3Q8WA 4PQEA 3YASA 3DEAA 2G5PA 5HK9A 4ZREA 1WHSA 1XZAA 1QOZA 2VAXA 4GEGA 2RHTA 4AXBA 2OXEA 2J3QA 3TEJA 2VSQA 3UMJA 1XLVA 5FP0A 5FXMA 1QO7A 2GBGA 5D3KA 5D6OA 3ILSA 2WU3A 3AINA 2WIKA 3ESDA 3KD2A 1UFOA 3AILA 5LKRA 4X3CA 1CFJA 4J0JA 3ESCA 2EDAA 1QIJA 2WLSA 2YXPX 4KE8A 4DSAA 5AI5A 3G9XA 1E66A 3W9BA 3V1KA 3X3HA 2PL5A 2GYWA 3HABA 4W63A 2QMQA 5E4JA 1BS9A 3I6ZA 4FTWA 2DHDA 2HA6A 1WM1A 1SCQA 3C8DA 1THTA 5ALZA 3VJKA 4BBZA 2D0DA 1YA4A 1AZWA 3I1IA 4FLMA 5HQ3A 2XMDA 2NW6A 2I3ZA 5ALHA 2H1IA 4RE6A 2P8SA 1R1DA 4B9EA 2VJCA 1WB5A 4XJVA 3FLBA 5DNWA 2PM8A 1R50A 1I6WA 5EIEA 3AIOA 1JJIA 2RHWA 3WK4A 5LZ2A 3B5EA 2WQZA 1WCYA 1QZ3A 2GBCA 3P2MA 1EX9A 3GA7A 4LXIA 4X92A 4UHDA 5CW2A 3G7NA 4BCCA 4IH4A 1JU3A 3T52A 5ALEA 2ZJFA 2XT0A 3WZMA 3GFFA 4EHBA 4XWGA 4J7AA 1VA4A 3JWEA 4XVCA 1W1IA 4G1FA 1JJFA 3WLAA 5JD4A 4BAZA 5HKAA 3IBTA 4AO7A 3M3DA 5ALJA 5AKJA 4CG3A 2OCGA 1DWQA 3V1NA 3OG9A 3V9AA 5DJ5A 2R8BA 1XRPA 4H0CA 4WY5A 3ZV7A 4TVKA 4J0KA 1A88A 5JYCA 3AUKA 5CH5A 4UBLA 4LYEA 4V2IA 3QMWA 1OCEA 2H7XA 3M81A 1ODTC 4KR0A 1AURA 2UZ0A 2HA7A 1DWOA 4K6KA 2WILA 5AKLA 1VZ2A 5BWBA 4U2FA 2HA2A 1JMKC 3PUIA 1LZKA 2VEOA 3BIWA 2YH2A 1W52X 4AN1A 5HCUA 4DYHA 4BRZA 4RNCA 4NVRA 2G5TA 1ZIXA 4Y2TA 3ESBA 2QUAA 4P08A 2GBFA 4BAUA 4CIBA 3STVA 4Y2VA 2WHPB 3G0BA 1QIKA 5ALTA 4HXGA 3SK0A 1DX4A 2PU5A 1Q83A 4B81A 4X91A 3WKDA 3S8YA 1ZJ5A 2BKLA 4Y2JA 1VE7A 1RWQA 5AHXA 1GQSA 1W4LA 3QYJA 4HAIA 4J0HA 2IITA 3UUFA 1VKHA 2WFLB 3D3NA 3G9ZA 2IX9A 4W1PA 4G4IA 4BAGA 1YASA 5I8PA 2YASA 5F4ZA 2ACKA 2QZPA 3FLAA 4AQDA 2XMQA 4Y2RA 5FPQA 5I7UA 5EI5A 4DMKA 5JARA 1JU4A 3ICWA 1Q0ZA 1ZI6A 3FYUA 4MWTA 1GXSA 4XX1A 4IHAA 1E8NA 1ZD2P 4HRXA 4I19A 3D5EA 2PSFA 1UOOA 1CUBA 1FFDA 3M82A 4MWSA 4Q3LA 2BUAA 2HA0A 2Z8XA 3GZJA 1E8DA 2Q0XA 4J0GA 5AIAA 3L1IA 2C5GA 2HRQA 4X00A 3W2TA 4P92A 1TRHA 1LPMA 2DQYA 4X71A 4AZ3A 2QM0A 1CUUA 1CUVA 2VJDA 1BE0A 1QIGA 2HADA 4EB0A 3BL8A 1A7UA 2BUCA 1EB8A 2C0QA 2B20A 4HRYA 4C4ZA 3BF8A 3DJYA 2PUJA 1FFBA 2QTBA 3C5WP 4LXGA 2FX5A 1UWCA 3NOXA 1XRNA 2PUHA 3FYUC 1UZAA 4G8DA 5AOAA 2OQVA 3PF8A 2Z3ZA 2OGSA 5FLKA 5CURA 5AKIA 3O4IA 5K5EA 2CJPA 4X6XA 1XZGA 1XRLA 2D5LA 5KBYA 3WYDA 1H2XA 1DQZA 1H22A 2X76A 3FSGD 3LIPA 4BC1A 2CKMA 4CIAA 3STTA 1CV2A 4HXFB 5AK6A 5AM1A 3AZQA 3RLIA 4QDUA 5CBKA 1RYYA 1ZI8A 3PICA 3G0GA 4W9RA 1LZLA 3UUEA 3O4GA 1JI3A 1HDEA 2ECFA 3WK9A 2Z8ZA 3R0VA 1GKLA 4WY8A 4KRXA 5LKAA 1R9MA 5DWDA 2HL6A 1ZD3A 4DM7A 1X2EA 1DQYA 4B82A 3DL7A 4W1RA 1F0NA 4KE7A 2K2QB 3EF3A 3VKFA 3QPAA 1ORWA 5A7FA 4ZRDA 3WJ2A 4ZWNA 2PSJA 5IVKA 2HU7A 6YASA 4NZZA 4B0OA 4D9JA 3FVRA 1CUIA 2JGEA 3IUJA 4BTLA 5AK3A 1J07A 2GYVA 3HC7A 2JGFA 1KEZA 4Q3OA 5C7YA 2AJBA 1AX9A 4EY8A 4OCZA 3QM1A 4Y7DA 3O0DA 4UBKA 5CT6A 2XQIA 4J0IA 1R88A 1ACLA 3WK5A 5KREA 2WFMA 1USWA 3BXPA 4WFIA 5LZ7A 3FWHA 2QS9A 4WDQA 2IIVA 4BVJA 2QKYA 4GLBA 3F9CA 3FLEA 4JEIA 4OPMA 1N5MA 2HU5A 5LZ8A 4I4CA 3WK8A 5AH0A 4INZA 4MJ3A 2O2GA 3PFBA 1T4MA 4K5QA 4QNNA 3VDXA 3R3UA 4H7KA 4G8CA 4QWWA 5EIHA 4HS9A 5IKXA 2WSLA 4DMCA 1LGYA 3VVLA 3QMVA 1U8EA 1QFMA 1MAAA 3OTQA 1ZJ4A 1WPRA 1XZIA 2X5XA 1MX9A 5JZSA 3G9UA 2V97A 5A7HA 2EDCA 2XUOA 3EQ7A 1FJ2A 1K6EA 2ZSIA 5CT5A 5SYNA 3FOBA 3AFIA 4C4YA 1XKTA 5JZBA 2XUHA 5K3AA 3WWPA 2WG2A 4Y2SA 1C7JA 5E4YA 4B85A 1W76A 5K3EA 2FJPA 2CZQA 4GW3A 4B6GA 3G0CA 3D2CA 4QDOA 4DIUA 4EA6A 5FOQA 5FKJA 4F0JA 4QLAA 2PSHA 5AM4A 1U2EA 3FSGA 1A8QA 4H7EA 2ROQA 3H1AA 4RPCA 4E15A 1WB6A 2GZSA 1G5FA 2QJWA 2DQZA 4FLFA 3AIMA 4FNMA 4CCYB 1GPNA 3I28A 2OGZA 3VVMA 2AJLI 2BAGA 5DYTA 2Y1KA 5CXUA 3NWOA 2PU7A 5FPPA 2WKWA 4OB6A 1LPOA 2X8BA 4EUSA 1AUOA 1OILA 2HA5A 2I3DA 2RAUA 4C6HA 1F0PA 2ZYSA 1CQWA 1MTZA 1EB9A 1QIIA 1G4HA 2V9ZA 4IO0A 3ZI7A 3H2IA 5CMLA 4QDXA 1HL7A 1MX5A 1HLGA 4G9GA 2DCMA 3TRDA 4IH1A 2AJDA 3MUOA 1CUXA 1QFSA 4F60A 4OUKX 2ONCA 4TPKA 1G66A 3OURA 3FYTA 3N2ZB 4G5XA 3WKCA 1QJ4A 3IUMA 4UBOA 5DLPA 2OCIA 3QITA 1BN6A 2C4HA 1MNAA 2HA4A 1XZHA 1LPSA 2HHAA 4YK7A 3VISA 3R3VA 3KDAA 1XZMA 5AO9A 3BJRA 2CMFA 3I6YA 3D2BA 4UHEA 5AICA 5BWCA
chains in the Genus database with same CATH superfamily
1JR3D 1KBQA 5TGDA 3CX3A 2RGCA 2PRKA 4M86A 1L4FA 2QGZA 4JL8A 1X1EA 5BSTA 3EQZA 4MZDA 1N1EA 3O4JA 3T4PA 2OCXA 3A6ZA 5FULA 2VEDA 3SZUA 3VJLA 2JCYA 4UMVA 1Y4SA 3V97A 2UDPA 3O1IC 1BS1A 1USVA 3MG9A 9LDBA 3W1EA 3KAQA 2AXPA 4YT2A 1IJBA 2LCIA 4TGLA 1NJ5A 4ZT7A 4HMPA 3LG2A 3IUQA 3I37X 1XEWY 1HQYE 1T2CA 2CE2X 5AW8A 5AW6A 3L41A 3CONA 1C4XA 4Q18A 4YMIA 4Z8YA 4DZTA 3WLNA 1ZKMA 4U7DA 1TKCA 5HYVA 3UT5B 4U2BA 3OPYI 5I7SA 4YWHA 3USCS 4EKEA 3KOZA 1BD4A 5SZJA 1B6SA 1X8JA 1BVUA 1QFXA 4YJHA 4DV0B 3SZRA 4KPFC 4KVGA 1ZXBA 1UXHA 3KHKA 3NHUA 1WL8A 4IQFA 5JD6A 3T95A 5G1NA 2ZAIA 3GVIA 4LSMA 5HFJA 4F4HA 2IYZA 2QG4A 1P2TA 3PT5A 1JJBA 4MQBA 5AKZA 5EJIA 1N5KA 1RLTA 4DBLE 3JR7A 2IZ7A 2NP7A 2PLAA 3M3HA 3HKEA 2EP7A 1PJ8A 3IR5A 3PIRA 1ZIPA 4Q9AA 2GK7A 1KFBB 3PC8A 3G49A 5H02A 3VU1A 1XQYA 5HDBB 3JQAA 4G4JA 3QX7A 1SQ6A 4FR5A 5ESWA 3TSYA 4JT8A 1N4DA 5EZSA 2EWVA 1BX1A 1F2UB 4XUCA 4MKFA 2JJMA 5LNK1 1GKUB 1X7YB 1E4YA 1C50A 3JYPA 2NVBA 1Z5VA 4CZ2A 4YEDA 4TUYB 1AF4A 2IYXA 3TJMA 4AJJA 2PUDA 4GX5A 1W4ZA 4IQ0A 4N0DA 4IDDA 3OQMA 5BQ5A 3FMPB 4BO1A 2NUPB 3OZWA 2BD0A 1SA0A 1JALA 3DO5A 1N78A 2CVQA 1PQUA 2AOVA 4YP7A 4ED9A 3NR2A 4IHQA 3H5TA 3QXXA 1XMOB 1XDSA 3QKRA 3B78A 3RRYA 3H2SA 4YACA 1JZSA 1FYWA 4O2AF 3WLPA 1D2RA 1YRHA 1U7HA 2JCBA 4DDMA 4UTOA 4WK2B 1TCUA 1RJGA 4MI6A 3SVZA 4E0BA 1PBNA 1QV9A 1E2JA 1HDOA 5LWQA 1J1IA 5AJZA 7MDHA 5JC1A 5KTNA 2G6TA 2I66A 1HE3A 4D1YA 1CVLA 3RH0A 3DLAA 4PINA 4OY3A 1LNZA 4N8SA 5ILGA 1ZM2A 1HY3A 2PRIA 2CSXA 2DKFA 4X1YB 5B1IA 4NNJA 1D2GA 2RK3A 2BFFB 2FR0A 4QOEA 4M54A 2PZEA 2YV4A 4O6VA 1L5HA 3PUJA 3MGAA 1ZOPA 1CD5A 2BDTA 2Q4RA 2HBRA 3GCDA 4HWGA 3RU7A 1B26A 4MPRA 3MWKA 1UXIA 4XGRA 2ZFUA 2ZB4A 1GQRA 1EZ4A 1X2BA 3PD7A 4PGAA 1IQRA 1KYYA 3WRVA 2QQEA 1UQUA 3C24A 3OEEA 5D5PA 3RHTA 1UBKS 4NYIQ 4RK0A 1F60A 4AJPA 4EPVA 5TQ0A 1MAVA 1DDIA 1FRQA 2V65A 3GPCA 1I3MA 1R4AA 5HKBA 2VPXA 2B1QA 2VZEA 4M9XA 4L8LA 2NUTA 4WT7A 3HPRA 3PWZA 3SQMA 3AUAA 3PXDA 5G0SA 3V3KA 1WSBA 2V7PA 4BFYA 1WDMA 1SVOA 2WE8A 3MD9A 1U9JA 4TTTS 3V34A 4CBVA 1K3UB 5KTYA 2BI4A 3EA5A 3H3FA 3HYTA 4KX5A 4Q4LA 3A0UA 4Q93A 1CUAA 4H3SA 2PTHA 1W36B 4C21A 1IUKA 2ONKA 2NU6B 2FMTA 1GDTA 2WA2A 4OYRA 4QYMA 2ZIAA 3C1TA 1Q3HA 2JBHA 2VT2A 5LZ5A 2NPFA 4B3RB 2GK6A 4MUXA 1E4OA 1DS6A 1F4LA 2ZYTX 2HZ7A 4EK9A 1O9GA 3B1XA 3S27A 2VDKB 5DPMA 3KD3A 3RW9A 1BGVA 3R7LA 1B76A 2EX0A 1KYXA 4HRVA 3OPYB 4JL6A 4DCMA 1XDUA 5C5CA 1RTKA 1BMDA 4YRMA 1DEKA 3KVOA 5ITZB 2YHIA 2Z6VA 3Q2KA 3TZ6A 4IVQA 5AI0A 1EBFA 1P1KA 1TA0A 5E9WA 3E4CA 1FLVA 2Y6UA 2GZ3A 4XUEA 4DLBA 1HE1C 4XFKA 3TOSA 3N2EA 5E4FA 2E49A 3I2FA 4FDAA 2XOKD 1N57A 5FHRA 1QOPB 4WLEA 1H4TA 1K3FA 1VSQA 2PX8A 2XVAA 1ZU4A 1J7JA 3ORHA 4WJLA 1C4KA 1R5BA 3CRVA 3V7FA 2Q21A 1KEEA 2XDWA 1I2ZA 4P4UA 4YMSA 4MVCA 4ZC1A 3WWDA 1XWWA 5HGJA 1RAEA 1Y4AE 2A5GA 3GUZA 4AO8A 2A9FA 2VFAA 4KV9A 2Z9CA 1O5OA 1WTAA 1DHTA 3E1GA 4CQJA 3ZKWB 1V1JA 1J2UA 1JR3A 4MYRA 3KB1A 3WL6A 5I45A 3AOGA 5EEHA 4FYWA 4PTZA 2XY4A 5E2IA 4AJ1A 5JUWA 3DBLB 3A7DA 3ZGYA 4S12A 2P0YA 3GGDA 1GN9A 3JZAA 4HDNB 4DKXA 2WD9A 5ETJA 4X24A 4MYSA 1PL7A 4KR6A 5BN3B 2DXIA 4WGGA 2WF8A 2GUWA 221PA 2Z4RA 3OOYA 4E13A 2X8JA 2DQSA 4DBZA 1GYQA 3SXUA 1EFUA 1NNEA 4MHTA 3KELA 2QRZA 5DO9A 4NFYA 3LHKA 4MHOA 4GL2A 4XIGS 1P0MA 1PT8A 4EY7A 4RK7A 4FGJA 4JMPA 1RKBA 3GF4A 1RPJA 1SELA 1SUFA 1N34B 4A5SA 1FNMA 4BC0A 1PZNA 1T3TA 5KSOA 2PL1A 3NRBA 1PI3A 2G36A 1IEVA 1TUIA 1Y3HA 4NR0A 3WRYA 3SDSA 5GGYA 2BR5A 2IP1A 3EHEA 2P4SA 3K30A 2I99A 4KACA 1ZH2A 3MUFA 4JVLA 4V1CI 4JEMA 2PZJA 4BO0A 4U9UA 1K66A 2Q8QA 2JD0A 3I9FA 4HNAA 4V0QA 5E7MA 4RLFA 3D2LA 4YRDA 2HK7A 4K81B 3ZDQA 3VYUB 2IDKA 4C6TB 4PHGA 2QJOA 5B3JA 3ZK7A 5AXAA 4E5SA 2LXNA 4JFRA 1RXUA 4PO1A 4AQYB 4KFTA 4HLDA 5GZ6A 2O5CA 3GGOA 3IOCA 3WLQA 1SXJB 5ALRA 1DTEA 1MORA 1PT6A 1X38A 5ALGA 5FWXB 3BIFA 4E03A 2ATVA 3FBTA 4DLUA 5F3WB 1AN9A 3G79A 2W71A 3QPWA 5FFNA 3TRKA 5KJCA 3AVQA 5ECDA 5EE0A 4DIEA 4EBBA 2WJWA 2P6PA 4EEXA 2PZFA 3PTAA 2XRFA 4ZYLA 1UM9B 5EHXA 1AOXA 4FFDA 4LWOA 4P7JA 4PLGA 1R6AA 3DEIA 3ZLUA 5CBKA 3Q87B 3A1CA 4FYVA 3DZFA 3U7JA 3AQ4A 3UW3A 2OO3A 3T7RA 4RV4A 3TX2A 2O1WA 3L6BA 2QTNA 1M2GA 4N0PA 2XE4A 2QAIA 3EXHB 3PQEA 4BQEA 3MILA 1KJ8A 3LC0A 4F5DA 2B0JA 2I2WA 4H4DA 2I29A 4YJFA 5LMUB 2V7GA 1UINA 4DCJA 3TAHA 3I45A 3HVHA 5K2MA 3TCNA 5E1BA 3LRXA 3D3QA 3Q10A 1J2TA 4B6OA 2A9JA 5FI1B 2E4XA 3VPFA 4AJOA 3E4DA 1LF0A 3QUCA 2C2MA 2PWZA 3GLIA 4ADSG 2JAUA 4QUGA 4N76A 3KKPA 1OLXB 3EVTA 1NURA 2BWJA 2PV7A 3ZPXA 1E2BA 2D4HA 5L3ZA 2FSVC 5TQ2B 3CJQA 4YRGA 3L6OO 4ZO7A 1G20E 1YVPA 4QG3A 4HZUB 1XVLA 1U04A 3GJ4A 3ZV5A 4BFVA 2AMJA 1H3NA 2X0NA 3R6WA 5KS2A 4PZZA 1JNXX 3D3WA 4QGAA 5AP9A 1FP4A 3QKWA 4KN8A 4V0OA 2HDHA 5FBZA 2XQKA 3TLJA 2C2OA 3K0FA 2KLHA 2P5TB 3L0SA 2QRUA 5JROA 1WHSB 4C2TA 3I9V6 3UMRA 1PNRA 3IB3A 2H52A 1YZYA 4FWBA 1PQ4A 3D6MA 1MIOB 5MGNA 1R4ZA 2GJAA 1DRJA 1ODSA 4K3VA 1M2EA 6Q21A 1NJ6A 4QEKA 1CY2A 3MFQA 1IFXA 2SKCA 3FGPA 1H2BA 3HGTA 2QR5A 3MJFA 4OSEA 2N3ZA 1KQPA 2G7ZA 3LL7A 4E2FA 1T9ZA 1P29A 2JEZA 4LDJA 2WP8J 3WRWA 3MHPA 3FKJA 5C1IA 3V7NA 1TO2E 4FBLA 5LOVF 1DXOA 4CN8A 1BDHA 1FTNA 3QUBA 2OCLA 4AMZA 3QNWA 1Y6RA 1U31A 3OIDA 2GXQA 5FOUA 3TTWA 3WWCA 4KP7A 3VOSA 1U2QA 5CFMA 3K2IA 1W5FA 1E89A 1O58A 1QVRA 4PO8A 2ZJ1A 3RAJA 1YI8A 3BN3A 1V7CA 2IZ1A 1V25A 2NQ8A 3LT1A 1R74A 3SF8B 2ZJ6A 1MXFA 2A0YA 2KB0A 1N77A 1DBIA 4QTYA 1E3WB 5TS3A 4BNGA 2I2XB 4G01B 1UC4B 2IRWA 3HSKA 4L8FA 4LXUA 2VHYA 3ZZ0A 3FAKA 3VO1A 4HAZA 3GQVA 3RS4A 4DA9A 1ECBA 4Z7NB 1N0IA 4B9AA 3DZJA 1Z08A 2Q5HA 4FDUA 4M9UA 1CDZA 1YDFA 1Z4IA 4Q24A 2P67A 4KSCA 5ALSA 3MYYA 5EEGA 3TD2A 3DTTA 4KVFA 1X7DA 3HCAA 1SHJA 1O08A 2AFIA 3C45A 3JWIA 1I36A 2X9GA 2EEPA 1JKFA 5EQJB 4YP1A 1O3YA 1QM5A 2HTFA 3PU6A 5EE1A 5B1HA 2GEUA 4C06A 2F3SA 4PSVA 1MVNA 4N65A 4WK4B 3REGA 5IDWA 1KFEB 4V1CB 2XOKA 3GK3A 1CLUA 1G8HA 1L4YA 4MUIA 4UARA 3ROEA 7AT1A 3H42B 1T15A 1ZN2A 4I50B 3HUUA 2PMFA 4V38A 5AI8A 3BFJA 1CFZA 3RVBA 4FB5A 3CBQA 1ZH0A 3WLEA 2PGDA 2R97A 2ZRIA 4PZDA 3C98A 2C2XA 1NC1A 1KEUA 3AVYA 4QQ8A 1M2NA 2DE0X 5CEEA 5KYYA 1OXVA 2CCGA 2NM0A 2P1DA 2XUQA 4KQCA 1SGWA 1FQKA 1X7GA 4LXTA 1DAHA 4HNHA 2RCYA 5FTMA 3C8HA 1B74A 1KZ4A 3OHPA 1OSNA 4TLLB 1BYIA 1SQFA 2C9YA 2NZXA 5CVJA 3SZMA 4FX2A 4L75A 2QZSA 3WGKA 1S89A 4L5BA 4KK3A 4U5XA 2NO0A 4I9FA 1EZZA 4XAQA 2P6NA 1P9LA 1QHHB 1Y5RA 3K15A 3W2IA 2G06A 1PK8A 2KYRA 2R11A 3A4LA 5BVGA 5IXSA 1T1GA 1XZFA 4QHTA 4KI0A 1PJ2A 3GV0A 4IJ6A 4K88A 4EWLA 1E2PA 1BVYF 1TM4E 2Z5GA 3RAEC 3EJ6A 4UNSA 3RVRA 5ADHA 3JQBC 3HL0A 4MUMA 4LSWA 2XLCA 3RG2A 4DUZB 4IIXA 4FE4A 3LLVA 5AVZA 4ZVRA 2P9JA 3VAZA 2FI1A 2YXBA 2J1LA 3TYXA 3WDSA 2BGWA 2HCJB 3BK7A 3S4YA 2WZQA 1IVYA 3DE7X 2F8LA 1FDOA 3IRVA 4IMPA 2G0AA 3CKMA 4JYPA 4R2KA 4XYEA 3ZJYA 4HUTA 1F5NA 4PZAA 4BXOB 1I10A 1PVOA 2GEVA 4HCJA 3I9LA 2P41A 2WD7A 3QLVC 2A4MA 4B35A 1PZMA 1NQOA 4FHGA 1RZVA 1NONA 5KYGA 2ZAMA 4RVCA 1KSHA 2IH2A 5LUBA 1JAIA 3HEAA 4OP2A 4RA9A 2R84A 2AUNA 2I2CA 2ODNA 2BZ1A 4J90A 4KGZA 5HK8A 4G9EA 4N8EA 3RNLA 3B12A 4DY4A 4JX9A 5JMWA 1WD7A 2YYSA 3BCRA 4ARZA 4B4KA 5KINB 1CUJA 3O4HA 1G2IA 4O29A 1G21A 1AIPA 4YO8A 1Y6ZA 1T0UA 1X7ZA 3KZXA 3RTAA 3V4FA 1Z0JA 5BRNA 2V7UA 4AS2A 2ZQZA 2GD0A 3LQ2A 2CXHA 3B6MA 2BONA 2GNOA 5REQB 4U2EA 1HFJA 3ECCA 4YJ3A 4O2RA 4RVNA 3D8NA 4C89A 2GM4A 1VSVA 1N2CE 3B85A 5EE9A 1FL9A 1OX6A 3U0VA 2IQIA 5AM3A 2PSDA 2JAWA 3JXEA 1INLA 1G5IA 3QXGA 1IHOA 2KJQA 3BMNA 4LE1A 3WL7A 1H93A 4QZVA 3SYMA 3PKIA 4DSZA 1UDWA 2GWHA 4MVXA 4BWYA 3HYLA 4OG2A 3L4EA 2I8CA 2BGRA 4CU2A 1CRQA 4J1NA 4R4JA 1HEUA 1PGQA 4Z9FA 4DPMA 1R66A 1YB5A 5AJYA 4BP1A 3HP7A 3CSUA 2XUAA 3NHYA 5FOXA 4DMFA 1JBQA 1XCGB 2F90A 3GT4A 1E61A 5F2KA 1YZVA 1OIVA 3GZTB 2GT1A 1I3LA 2W2KA 4WCVA 5CB4B 4F3KA 1CE8B 3GVXA 2Z2ZA 1X13A 1UQRA 3MINB 2ZWOA 3HEBA 3V1YA 3AEXA 3OQBA 1BQEA 1Q15A 4GPD1 4QUBA 1II8B 1I9CA 3FUXA 3PFFA 4NBKA 5DIFA 4OUDB 4EKIA 1WULS 2ZR7A 3BGSA 4P82A 1Y8RB 5H9WA 1L5FA 4OM8A 1ISFA 3LBHA 1OXKB 5CDYA 2WAAA 2WTXA 3H2BA 4RIEA 1S3FA 2IZ5A 2QSZA 3LDAA 4JB8A 3O3OB 1J70A 5JH7A 3PGVA 9MHTA 3H7AA 1CQJB 1T8UA 1YE8A 4NJOA 5CNJA 2FWJA 1ZMOA 1LXCA 2YWHA 3NBYC 5CBPB 2DOKA 1H05A 5KDLA 1PHPA 1U11A 3EBLA 1C8KA 4DRZA 4RDCA 4BZZA 1M2VA 4M1WA 4QXOA 1X7WA 3KYDB 4LOLA 1YDWA 5C8YA 4DLNA 4GX1A 3U49A 3K1YA 5CFPA 4PQYA 4XZ3A 4K9NA 1MPXA 5DW3A 2BMWA 1K68A 4FX5A 3R7WB 3TL3A 3ZUGA 4A73A 1E6UA 3HWX1 2ZUFA 1DKOA 5CLIA 3RC9A 4P98A 3ZWVA 5ILOA 4MWEA 1FJXA 5AUPB 2IBSA 4YDHB 3TMYA 1DARA 2FQQA 1OIXA 3D8SA 4LZJA 2XNDD 4GKAA 3L82B 3RUCA 1O4VA 3N1UA 4D97A 4AWAA 4MVJI 5HOEA 1Y6GA 1U9IC 3RIYA 3NV9A 2VJKA 5FTJA 3VO9A 5K8IA 2EFJA 1YUBA 2WTMA 3GCWA 1V11B 2GDZA 2IPXA 3MFYA 3SC4A 2RGGA 3V6LA 4GMKA 5C81A 1QWOA 1QZTA 3HP4A 1HLDA 3NNDA 3ZJ4A 4ZRMA 1IXRC 1H2RS 1ZG3A 3ET4A 2PZMA 3FWYA 3W8EA 2GEKA 4MAFA 1FYDA 1ZVMA 4MQUA 2DKNA 1NFQA 1YE5A 4Y6PA 4NOMA 4JOBA 5I4CA 1QO0A 2YFYA 4KXVA 1WSWA 1JDNA 5BSVA 1CQXA 2B2CA 1KOFA 2O0HA 2ZIVB 1K63A 1P91A 4G24A 4AICA 3PPVA 2SNIE 4BLTA 1XLTC 2EIHA 2B21A 2VRCD 2A6PA 3B6IA 3EEIA 4Y9UA 2A78A 1G2OA 5K0BA 1Z37A 1P31A 1AS3A 4B76A 1U7UA 3QWFA 1T2FA 3NTRA 3GRCA 4TMZA 3SXPA 3EXAA 4Y2UA 5JJ5A 4GWLA 1LI4A 1XWIA 2ZE6A 3BQ9A 1DVRA 1JA9A 2WUDA 3CISA 3SLRA 3DE4X 1N3IA 1MZPA 1B8UA 3SKYA 5AMXA 1QHSA 1VJRA 1Z6GA 2PZLA 1C1HA 4P81A 1JDJA 2GUGA 4YB8A 3QJYA 3V55A 3U7QA 3UK7A 3A6DA 3BWDD 4H7IA 1YF3A 4HDRA 1QSGA 4ASUA 1A9TA 4O59O 5K0NA 3B9RA 1MW9X 4LYDA 4LY0A 1BA3A 5BW8A 3GPLA 4HQRA 4PZ0A 2NGRA 2YUTA 3JAKB 1WPGA 3S99A 1O0BA 2D7DA 2RHDA 3RODA 4QYIA 5LQCA 1XNRB 1QIDA 1SUPA 1SOAA 2F9FA 2G82A 3C3JA 3CPHA 4IWNA 3T7JA 2CLHB 5AOCA 4W7SA 1VKOA 4RD4A 5LMZA 1NXOA 3R6DA 5EWMA 3R5KA 1MOZA 3GAZA 4HB3A 4AN0A 2O8DB 1A7JA 1IB0A 3T15A 1P8JA 3ZE1B 4BU1A 1O6GA 2PHZA 1Q1GA 2F1IA 1C0PA 5CH8A 5ER9A 1J49A 2ACWA 3SXJA 2J8ZA 1KMHA 1HDRA 2NNLD 4IIHA 1OD6A 4N8DA 3OVMA 3S7TA 4BJHB 2XUKA 4B4DA 1KERA 4DMMA 2JL1A 1JEYB 4EMBA 5JXJA 3I1JA 2GJKA 1FQJA 2PAFA 2FLVA 1H4VB 1VJ5A 1YQDA 3WL8A 4PGFA 1Z0KA 5CNMA 1TYZA 2IBMA 2ZE8A 1ECGA 4RJ2A 3IL2A 2OCKA 4C05A 1F0KA 2DUUA 2VQ6A 2ZRFA 4F56A 3N2LA 4XQGA 3T3PB 4BMYA 2LIPA 5DTQA 4H59A 1RPAA 2PSEA 2X9QA 3VSEA 4JI1B 4GPEA 1ZM9A 5ILQA 1VRVA 1B0AA 3ADBA 1UZLA 1IMJA 4YMHA 1ZNXA 3F71A 2IS6A 4DRYA 3B3FA 2PFKA 2CVOA 1WVIA 2DWCA 2PKQO 3IIJA 2LCQA 1FRFS 6REQA 7GPBA 1MJGA 2QQFA 2JLBA 1G7CA 5KCMA 4YMLA 1XSEA 4MA0A 3OJOA 4J9VA 4JELA 1NTRA 1XRRA 1XVIA 1VL2A 1V1RB 2Q3HA 3D7RA 1EX6A 3K9CA 4AX4A 1EWYA 1W48A 1NU6A 1BHJA 1IJFA 4JENA 4EAQA 3FOEC 4P1ZA 2VQEB 1V4BA 3L1HA 4NEQA 5JRZA 2HU8A 3LY9A 3UHFA 1ZM3A 1DTWB 2WA1A 1DC8A 2HXYA 4Z4FA 1P0PA 2UYQA 1M54A 1D6JA 2OV4A 3QWHA 3BDIA 2CNDA 5JSZB 4P80A 3A3NA 1T5LA 1K8ZB 3WL5A 2QTCA 5A4AA 1CZOA 2GD6A 1UUFA 3LYHA 5B6JA 3DCIA 3PNPA 1E9FA 2FSGA 4HXYA 4KXXA 5FA8A 3QKSA 3T7IA 3PXUA 2QN6A 4DIDA 3ZV3A 5CA0B 1B7GO 1TVKA 3NT4A 1A3CA 1J4AA 4UHFA 2NQTA 4F4DA 3NC0C 5DRYA 2PX4A 2HWYA 5ISMA 2UVQA 3EIEA 5BNFA 1GZVA 3WMXA 1UJ4A 2VJAA 3I1FA 3NGLA 1XP8A 4IDNA 3OTHA 1EFKA 1KR2A 3JD0A 5ALOA 4K0KB 1I0LA 5CAEA 2H57A 3NT2A 4ZPJA 2WIDA 3G9TA 3G2KA 1WXEA 5AHOA 2OQRA 3GLKA 5DIZA 5F9HA 1BCSA 3STUA 2MIIA 3ROTA 2IEDA 4R7ZA 1Y7TA 4YRLA 5KOIA 3QE9Y 4LE0A 1AZLA 2WHXA 3SP1A 3UXHA 4YHHB 2ZM5A 3E23A 1AHNA 1CNEA 4L85A 1NVDA 1TVMA 3BMQB 2M98A 3RJ9A 1DAKA 4AY4A 2XNKA 1XK7A 2O7VA 4KPUB 1V3VA 5AD1A 3HGMA 6NULA 4N7RA 3OZIA 4YASA 1U5CA 5J2TF 3STXA 5EJ9A 3DDSA 3T3EA 3K1JA 1F2TA 3X1ZA 1FLDA 2D0PB 3ZI7A 2W6QA 4M1ZA 2EQAA 3LE8A 1Y8ZA 1S2LA 3F8SA 3CW8X 3H5AA 4YCSA 3T3OA 2J3LA 1CQIB 2XNDA 3A6HA 1YAJA 3FROA 3KAPA 2R00A 4O02B 2H7VA 4U6NA 5K0FA 2LP4Y 3O2SB 4UNNA 2BHSA 2E1RA 4H35A 4PX2A 1WKVA 2VDWB 5AHKA 3T6KA 5BYKA 3BE5A 4F9EA 4CKEA 5E3HA 5LP1A 3GZ4A 4ID9A 2XMZA 1OGYA 4Q3AA 1ST3A 2DG2A 4NZNA 4E32A 2P1RA 4JI2B 5DB4A 5CGZA 2Q9CA 4UASA 2NACA 5HTOA 4IEIA 4RCYA 1QZXA 1JU9A 2VLIA 3VKVA 2QX9A 4O4IB 4YRTA 4CV3A 1VTKA 4CF6A 2VRCA 1M2KA 5F78A 2Y2VA 3KYCB 1Z3CA 3B20A 4KDFA 4AECA 1PV2A 4AC9A 2ZRMA 5EQDA 4D6YA 4G6ZA 3VKHA 1RVDA 1I3CA 3FUTA 4KIGA 4LTDA 1HRKA 3JW8A 4AZTA 1JBKA 5M5BA 2ISQA 2IZZA 3MYRA 2I78A 3TGWA 4J07A 2H4XA 2HO4A 1TJ4A 3ELUA 2XUFA 5JOQA 1EIZA 1Q22A 2ZAOA 3NC1C 4G85A 3D0RA 4BMZA 1I94B 1E5TA 2YC4C 4P2GA 3HCDA 3PE3A 3EMDA 3LHFA 4CMGA 1XTVA 3E27A 1KA9H 3TDNA 5DEIA 5ULLA 3H2KA 2Q6LA 3CU5A 4EHHA 4PRZA 2BJVA 3SEAA 4F85A 2Q28A 3B3GA 4WTOA 1VYHA 3CKKA 2FW6A 1ZQ1A 2QMEA 2HOQA 2YJNA 2HM7A 1WU7A 3NEYA 1R3DA 4NE7A 3NYQA 4R1QA 1OFUX 1SO8A 3GOQA 1V3TA 4BQOA 4UNQA 2DLNA 4IJMA 1BN7A 1UFRA 5A5GA 3WTCA 5FEMA 1GNVA 2B6NA 1PWHA 2BFBA 4NU6A 3MTAA 1EUCA 1C41A 3C43A 1UK9A 3DLBA 3UB2A 3I2HA 4Y1RA 1OAAA 1U2PA 3EZ2A 4XD2A 3UCXA 1IY1A 2Q6KA 2ID8A 2A0FA 3LKDA 2JGDB 1Q0TA 4CTMA 3L1JA 2IPAB 1WBJB 1XTUA 2CNBA 4DR6B 3H11A 2CZCA 2XITA 1P62B 5E6UA 5D51S 3QI7A 2D1RA 3KDPA 1B1CA 4LHEA 1XOIA 1GPLA 1Y6JA 4LYGA 2C7PA 3DVLA 1BEZA 5CT4A 5BNZA 1TTHA 3GXBA 4FB4A 1MEEA 2ZSHA 1EGAA 4BX8A 3CVXA 2FY8A 2QRQA 5KHAA 2ODPA 1XPJA 3KL4A 3RAPR 2IHNA 3F97A 3NATA 3O21A 4Q66C 3NVKI 3D7NA 4A0QA 2YWRA 4AO6A 1L4BA 1M33A 4PNZA 3FDFA 1XALA 4JP3A 3GDHA 3K20A 4JBXA 2P4HX 2N42A 2R8YA 2DSTA 4FQ8A 4U6QA 4XJSA 4EO7A 4ZZ0A 4RULA 4RPHA 4HAOA 2AUMA 2GEDA 1BD3A 2AZMA 1GTRA 1C0KA 4FHDA 2J3HA 1DLJA 3CY6A 1L8OA 3HXTA 5B3KA 4BGDA 3KR9A 1KDVA 4F9GA 4MKZA 2WICA 4HTFA 1QYCA 1WW3A 1YQXA 4TT3D 3GQBB 3JQ8B 3ODPA 4I3FA 1D1TA 2P9QA 1ZK0A 1RWMA 4UBNA 1CZRA 2VUSA 1E5XA 4A23A 4M0EA 4GRIA 1P9OA 2BBOA 2Z09A 2HK9A 2IU0A 4EJ2A 4E1AA 2F9LA 3MS4A 1LBTA 1C3OA 1MEOA 4NK4A 1Z4NA 1M6HA 2DMRA 5L3RA 2ZQ5A 4JXJA 1Z8DA 2YQ5A 4F4CA 1XZQA 1DB3A 4KWCA 3DKRA 1QVVA 5DYYA 3DAGA 2WKPA 1AKWA 5ALNA 3EF0A 3QGMA 3UG7A 2GDJA 5JXHA 1JFVA 3C7KA 2ODEA 3I2JA 5HVNA 4LJ5A 2CVFA 3WTBA 1YWGO 3MWGA 1KIFA 1YCDA 2QROA 1ECCA 4XIIA 5JI3E 4DV5B 1X6VA 3IURA 1FSZA 3RBXA 2ZYWX 1NJSA 2DFVA 3INNA 1CPYA 1KO7A 3SYKA 4XYGA 5I5EA 2FPWA 1SC3A 2O3SA 1G0OA 1T1EA 3DFMA 5KUTA 1ZOIA 4IDQA 5FADA 3FVTA 3I73A 1C9NA 2JRLA 5A5DA 3CPJB 1XHEA 3T9CA 4ALJA 2VH2A 5DYWA 2QTLA 1EFPB 3QPCA 4DDTA 1DUVG 3KJXA 3FNIA 4V0RA 5DM0A 1M83A 3ZIUA 3NOQA 5CDSA 1F1BA 2WSSD 4JJFA 2ASEA 2ZTLA 1QGZA 2PBRA 2G9UA 5EP3A 1M34E 1HE8B 1WPXA 4M7OA 4XVUA 3EXG2 2XCOA 3PFCA 5BMVA 4OLJA 3DKIA 3KT6A 1GFIA 1XD2A 2XVXA 1AGRA 4AF7A 2A0KA 2R44A 3WR5A 2R4QA 4H7HA 5CDGA 4QUKA 3WYBA 1E6EA 5KVVA 4JITA 1FE8A 3RNOA 2B2NA 2XWJI 5J5CA 4EZEA 4TTJA 2X13A 4Z3KA 5H8WA 2GN8A 2VSXA 1YL6A 3DLTA 2Q45A 3H9GA 1RACA 1VJ0A 3VPAA 5EJ7A 3BGWA 2QYTA 4EYQA 1MU0A 3VSAA 1GFSA 1XZBA 4RH3A 1SD1A 5F2OA 2ZVJA 4DMHA 4JIGA 4I55F 3E22B 1NZJA 2B1GA 3BERA 4KWIA 1VIMA 2Z5VA 2WZDA 3N7AA 2R6CA 1MO6A 2WUFA 3FSJX 1L7AA 3KLOA 3GT7A 3OKPA 3DUFA 4PLTA 2X9VA 1YQUA 1HT2E 1MVLA 3FZEA 3HZOA 4K9RA 2ZIZA 2ZKIA 4CTKA 2IEAA 3W4JA 4Z9YA 1MRZA 4MLCA 3D31A 3H0CA 4EGAA 5L45A 2D1YA 2JCVA 5B2ZA 3HCWA 4XDGA 2Y77A 5JCOC 1J8MF 1KJJA 3UK2A 2D2EA 3SQNA 2VS1A 3GNLA 4OAPA 5BNWA 3A28A 3LP5A 3IQXA 3QUQA 1JQEA 4EELA 5KTMA 4MP8A 3H5LA 3PJDA 3KS9A 3R7NA 2YFKA 2HV8A 2NZ2A 3WWOA 4IH9A 4KG7A 4KPYA 3WGUA 1BZYA 1O87A 3NKFA 2Q49A 2XHEA 4JNCA 1ZN7A 2PQ6A 1JAXA 3GUCA 4U9HS 5AKHA 2PN1A 2Q7OE 3T5BA 5MFZA 1KRXA 3HXOA 4M1EA 4UM7A 3BORA 5EIAA 2I8LA 5I7WA 3UTDA 1NUAA 3AM5A 3O94A 4EA7A 1RJ9A 4Y9RA 2CWDA 3UH1A 2DFTA 5DLEA 3ZDFA 3EE6A 2W2LD 3GRFA 3EMKA 2WU0A 3DYVA 3HADA 4XTRA 3LYAA 3SU8A 4BLPA 4A36A 3O90A 3GLGE 3K09A 3W8NA 3HPQA 2IXDA 2W37A 3ZE7A 5J3JA 2J45A 1Y4UA 4IICA 1ACJA 1IDOA 2QL9A 2X8WA 4MSUA 5JQWA 2VF8A 3DL4A 4N0EA 3QELA 3MPUA 4AUKA 4CEIA 3Q12A 2GFHA 2QUIA 5K5EA 1OZHA 4HYQA 5JRJA 4PSKA 2ZRJA 2HBZA 4PSDA 5KAPA 4K9QA 4CI9A 4EFMA 3THXB 3WGHA 5A1TA 2P11A 1JG3A 1V1MA 4QAQA 3VX3A 2X1HA 5I9LA 1E5DA 2AYXA 3MJRA 1FFAA 2FPKA 3EGCA 2G76A 4B1FA 4KGVA 1L1EA 1YE3A 1S3SA 2FZVA 3BBLA 5U4QA 4ZO8A 5BR1A 2Y67A 3QVLA 3IPXA 4Y1EA 1PSZA 1L1RA 2XD9A 2J5KA 4TVOA 5IJXA 4AX8A 1X0XA 3Q8KA 3C3AA 3KZVA 2J3KA 4ZV7A 1EG2A 2I4LA 3CJTA 1WLYA 3SIWA 1XDDA 3K1TA 2AN4A 3AUUA 5JAOA 1YRAA 2G0TA 2EF1A 3AXSA 1V7ZA 1Q3KA 1FDUA 4GRDA 1KFJB 4LY3A 1IK4A 4X20A 1Z5WA 4Y6QA 1QUEA 1G60A 1T43A 1ZHHA 4OQYA 4PR3A 3COYA 1TIBA 2QTHA 3HLKA 4CG1A 5I9TA 3ZWPA 4MR8A 4OHBA 1TEXA 3U26A 4FFWA 1RRKA 4XIFA 3HSSA 2EERA 4BS9A 1E96A 1R6BX 1SXHA 2DQ4A 2VVTA 2RH9B 4YJHB 4TSKA 3AHFA 2Y1XA 3EZ6A 1JTEA 1L7VC 1M1ZA 3IC5A 1N2HA 4G37A 5DNDA 2QIPA 4ZAZA 5FUYA 4YRFA 5FWDA 5DYGA 3C8ZA 3DV0A 5IT5A 1FMFA 1POWA 4EZIA 4OBEA 1WJGA 5AK5A 1BXKA 2H2WA 2OYSA 1D6SA 3R3ZA 4GPAA 2WTUA 3MW8A 1BDMA 2OV2A 2IYLD 2XTNA 3AYZB 1J0EA 2VF5X 3FHJA 4AIRA 5DI9A 2H6EA 4BX3A 3X1JA 3Q5GA 1KI4A 1NN3A 1E6KA 1I8TA 2WABA 1K8RA 2V98A 4IKEA 1T91A 5DNCA 2C7BA 5KHLB 2OCAA 3HKEB 3KZCA 4LJSA 3IEMA 4OX9Y 2VWGA 4MYUA 1YNOA 1ULAA 1CDOA 1GOTA 1J9ZA 2ZTSA 2V7VA 3JQAB 4FNOA 4IOLA 4MV7A 4RHUA 1QCZA 1IHUA 1QRDA 1UKEA 1JDPA 1UADA 2QTZA 2GOYA 1W35A 3EG9A 4UUBA 1GARA 4P5PA 1XZDA 1FK8A 2V6IA 2MJLA 4NKRA 1EX1A 4OHRA 4KDCA 4ITUA 2UZ1A 3RK4A 4HK4A 2LZ0A 2H7YA 2OV6A 1EGHA 3DYIA 1E59A 3EBPA 3LQQA 5I9BA 5K0JA 5KYXA 2XVMA 4EI2A 5J1SB 3AHHA 1JHPA 1GQFA 4JI5B 3ZTWA 4C20A 1WMAA 3F1LA 1PDOA 3TIIA 5B7QA 1HG1A 1USKA 1GEEA 2G83A 3DFZA 3I53A 3NYRA 3B36A 5AXCA 4NPAA 5IHXA 5E95A 3NGMA 3PC6A 3QKRB 1L3IA 1GIAA 3CLTD 2Z57A 1X7XA 3QTLA 5GAJA 4E7PA 1OXTA 3LOQA 3HNRA 1G7TA 3GRUA 3B7WA 4ANFA 2VDQB 3HJFA 1KU0A 2FA9A 3IIMA 4RJLA 2IF2A 4R0MA 4F1WA 2X40A 3G23A 4MYCA 4RF3A 3S1AB 4CM3A 2C5AA 4L08A 4WKCA 4DDHA 1QYIA 3B48A 4AJNA 1E0SA 1BA2A 1NBME 1N7JA 2WSSA 2HIHA 3NHFA 2OBXA 3PLNA 4X93A 3UJDA 1AKNA 1P4RA 1C1XA 3JTMA 5GOZA 3K70B 3C6MA 3IERA 3FPAA 1MX1A 3FDZA 4V0NA 4MPTA 3LYUA 1RQ7A 4X44A 1LQTA 4YUXA 1L5HB 1PUXA 1HE5A 3KKZA 1IC6A 2O7QA 2JNWA 4FOLA 4JS0A 4KFUA 1J5EB 3EUEA 5F51A 4TX1A 1GT91 2DUWA 3ENZA 4MV6A 1Y8AA 5AT1A 1YS7A 3G2IA 1J39A 2DHCA 4IUCS 4JC5A 1E2IA 1Z0FA 3BIOA 3OLCX 2ZPAA 1ZGBA 3H13A 1KNQA 1OPXA 1M1XB 5ALQA 1Z12A 1SY7A 1E1MA 2BBTA 4QYWA 2XNSA 1KZHA 4J6EA 4DLLA 4Z2AA 4F93B 1JFTA 5KTKA 2X7JA 3AVTA 3M70A 3F6BX 3G6WA 3FPFA 3R3JA 4CMKA 5CVDA 1XEAA 3B38A 5BVHB 3BB4A 3C7AA 2FF7A 2NUTB 1ZGAA 3VR5H 3OTGA 4YPVA 2QRMA 3DUWA 4NDNE 4N4AA 2A3RA 3PQ6A 4W7IA 1EESA 4UXJA 2OAP1 3K4HA 4PRYA 3T4EA 1EH5A 3PUZA 1BAPA 4ZU3A 4QBHA 1LS1A 4RGBA 4YX9A 5BUQA 3UKDA 1ZNZA 2R66A 5F2EA 1VHDA 2XB4A 1NAHA 3WKBA 1ISMA 2GN2A 2CLKB 1C8LA 4NF2A 1EIWA 2HCRA 2M2IA 2J5BA 4W9MC 1Z6AA 4LDQA 4Y7CA 3U62A 4LWZA 1SMKA 2F4VB 2AJ8A 4MRSA 4QDKA 4X6UA 5KJFA 4PFSA 3R3YA 4L7VA 1ML3A 4KMOA 3I01A 3GYBA 5DHUA 2X77A 1EFAA 2FQWA 3FIJA 4ZYWA 4BCBA 2P91A 4OXYA 5BMOA 1EFCA 3W5UA 1A8SA 2YHIB 4X84A 4E46A 4TN1A 2ZBEA 3IXMA 4O4HA 4E2ZA 2XQJA 3OKFA 3OE1A 2BT4A 3P27A 2W2LA 2I62A 1CR2A 3D1JA 4BRSA 3ULKA 2B25A 1K5PA 3RKSA 5KC8A 4JUCA 1GG2A 5DLYA 3W7BA 2B3TA 4PSAA 3K0KA 2L2QA 1MC4A 2FEAA 3D3KA 1KU6A 3SD7A 3DAYA 2C1ZA 2IHKA 4FOPA 4V0LA 1ZGGA 2JGMA 2J6CA 1ZUIA 4JZYA 3ZY5A 1VIAA 1T0IA 3EQ8A 2OR3A 1TU4A 2CEAA 4HJRA 2JEOA 2BMVA 1CY0A 1WY5A 2P5YA 3Q3EA 4G8BA 4XM1A 1EE1A 2WHRA 2XUPA 5K4HA 4N5HX 1KQNA 1JS1X 1LNSA 2EP5A 1UZNA 1Q11A 3EW9A 3ONFA 2NU8A 3S29A 1AUPA 1W4BA 4KGDA 2ZBUA 5CT9A 1YBMA 4C07A 2D54A 3OUUA 4IW3B 1JGTA 1WBBA 2Y66A 1Q91A 4WPGA 1XNHA 5KOJB 1S1MA 5JNUA 2EX1A 4TKMA 2JB9A 2WJ4A 4PO9A 4CMIA 5ENVA 1T8TA 4MUYA 2QM8A 4QBIA 5AW9A 3VDQA 3DDHA 4FYPA 3ND8A 4DNPA 1JN0A 1P7ZA 2X8JB 1O6FA 3JD3A 1EAYA 1C7ZA 3K9NA 4TWJA 3RI3A 3SXUB 2A5FA 4C2BA 2XUDA 3FNQA 2C5HA 3AW8A 3ZW9A 5JNSA 4UULA 3U9SA 4LWPA 1KXJA 2JKZA 2PRJA 2AD5A 1BWQA 3A70A 3FMGA 4FK8A 1OWNA 2H1FA 3ZDYB 5A4FS 4D79A 1DEXA 1E3IA 2FV8A 4I99A 4B8ZA 3HO1A 3LUJA 2NXNA 3HCBA 3HYNA 3F0TA 1L4UA 4TXMA 1O57A 3PCTA 4AY5A 2EGGA 2EZ8A 3ZDDA 3NHJA 1UM8A 1CHNA 2PYZA 2F43B 1TT7A 4G1MB 1S1CA 5B6IA 1XXLA 3L1VA 3ED5A 3DDZX 3MLEA 3D1LA 4GT1A 2ZB3A 3I72A 4MNTA 5G4KA 4BFCA 1Z63A 3TKAA 1F5SA 1P1JA 2Z4TA 4HNAB 1EP2B 4LRXA 5IMSA 3N0XA 4EKNB 3YASA 2FUG6 2G5PA 5C4GB 4TQUS 1JNYA 1F2DA 1SULA 4B5KA 1N9KA 3C6KA 2Q50A 4D8YA 1HWYA 2OYCA 2VSYA 2ST1A 3WSWA 4YRZA 5JNWA 1ORHA 3ZWYA 4UU1A 1RAFA 2LNDA 5HILA 5LC1A 2GF9A 3SJUA 4BMNA 2JAPA 3N6RA 2AYZA 1OYOA 4NCBA 4PFJA 5LM3A 1HZJA 1WCIB 4IUDS 4C7MA 1JEEA 4ABTA 2IS4A 1F8YA 2WQ7A 3QUTA 4JA2A 2AN1A 2GO1A 4NFHA 2JI9A 2XUZA 3OQJA 3EIFA 4ABYA 1JF8A 2H63A 4MDYA 3AWIA 1SXJC 1K1EA 4YIKA 1X8LA 3F6EX 2QSUA 2HSZA 4AP9A 2X3UA 3B2EA 3EN0A 1M7GA 3SEFA 1JZTA 2REOA 3ILSA 2EG5A 4LHVA 4WN3A 3THSA 4X1KA 4C0JA 2FPXA 3VA7A 2H4WA 3C97A 1MA0A 4DJEC 1E62A 3KD2A 3N8NA 3RSZA 1ZUNA 4J2OA 2VN8A 1MB3A 4RY8A 1PN3A 4JBIA 4AKIA 3PHBE 3HDJA 3WO0A 1OI3A 2BHLA 2IXGA 4ENQA 4LFBB 3C5CA 4RKFA 5CDHA 3EXHC 3AMVA 2VTEA 2FR8C 4HWSA 1U0RA 3ESCA 2CXRA 5J9FA 1NFFA 4CFYA 1VHWA 1G17A 3QXCA 2Q3MA 3PR1A 2F2TA 2QL5A 4XRGA 4MV5A 3GGJA 4P4SA 2MSDB 3TECE 3K4QA 4Y6SA 4BNJA 3AUYA 4BQIA 3AF0A 4YCBA 1QUFA 2FN4A 2G40A 1ZXXA 3M6XA 3PQ3A 3ROFA 5BY2A 2QMQA 5L4SA 1XBTA 3JVUA 4PX5A 5A4MS 1B00A 3D3WB 5MN4A 3NT5A 2VYND 4Q1BA 1FP4B 3D4PA 2C9DA 3GFRA 1BS9A 4YRCA 2C2YA 3S0JA 4AK9A 4D3FA 4D74A 4BLOA 5CA0F 1S2NA 5AFSA 4UD2A 4PCVA 1RXVA 5JDCC 1OYVA 1HQKA 3BM5A 4H4EA 3GC6A 1A9YA 4OJMX 4AKGA 3VJKA 4LC0A 1GU0A 4BBZA 4LHYA 3AQIA 4ESOA 4KLCA 3OZXA 4AYTA 4P36A 8GPBA 1C7FA 3I1IA 4J29A 2JG3A 1JQKA 1LEHA 4FLMA 2ZYGA 4CCSA 3FNHA 3VDNB 1U4SA 3VU8A 3O2NA 4EDHA 1L5YA 2JGAA 3ONEA 3H3XA 4WN9A 5TNXA 5IP5A 3QLJA 2WYOA 3RLFA 3TPFA 4BP3A 1DBQA 1FDWA 2QV0A 3EULA 2IHJA 3A25A 4TV9F 1ZX1A 1YNSA 4FFMA 3K0EA 1GDDA 1YB1A 5EP2A 1ZRNA 4LZAA 3PEWA 2IA5A 3CVOA 3DV9A 3LCVB 5C7LO 4BO4A 2YHAA 1RQPA 1U6IA 3FLBA 3OJEA 3PDJA 4TL9A 5DNWA 5DSXA 3A6GA 5KSZA 1LLCA 2R4TA 1EGMB 3G2QA 1IZYA 4FS8A 3PUYA 3ZW7A 1JA1A 1CNFA 1YACA 1YZ3A 2FU5C 5A3QA 2RC5A 3KFVA 3N53A 3OHSX 1YDMA 3KM0A 3UFXA 4KQEA 2XNHA 5JNRA 4WNAA 2VO1A 3N86A 4OK3A 5CIYA 2HMWA 3BAZA 1M7HA 1FQWA 2V5VA 5IX8A 2NV2B 4FR0A 4GLLA 4WK0B 3IKJA 3UUWA 5LD2C 2D5BA 2ERCA 1IHYA 3IAUA 4UEWA 1WCYA 1QZ3A 1GRNA 2OHGA 1SXQA 1C7RA 2ZS7A 2IXTA 1BMFD 3JQPA 3PP8A 5EJGA 1E18A 3H5WA 3MWLA 3DQPA 5IARA 2GPTA 3W5HA 1ZSVA 3GFTA 3EX7C 4K26A 1J22A 1TAQA 1AKYA 5F9MA 2NLOA 3KAKA 1FBTA 1GTZA 3NS7A 4RKQA 2B5WA 4DCVA 4OHPA 5C53B 5LYJF 3CWZA 2YIVX 4BCCA 1GVHA 1JU3A 5KYYB 2POCA 4AMBA 5ALEA 3S1SA 1J00A 2XT0A 4FGWA 3IEPA 4JP1A 4JI6B 3BD8A 2CT8A 1EP3B 4DM3A 4J7AA 2Z8YM 3LBYA 1BNCA 2XIJA 3DP9A 4MCAA 1JDUA 4LOIA 4FD3A 4XVCA 1E3SA 1J8YF 1PZFA 2CUNA 1O8CA 3TW8A 2HT1A 3GLTA 5T8KC 5ARDA 4O2BF 2E82A 1LLDA 4UMDA 3SNKA 1BEUB 3AW9A 4FUQA 2H5IA 4B3MB 2LCFA 4U2KA 3M3DA 1KE2A 3CS3A 4OIMA 4ZU6X 5AKJA 2LKDA 3TLKA 3F8WA 1E6CA 1FDIA 3ZHTA 4WASA 3SSNA 3RIXA 4MGIR 3V9AA 4DSUA 1DJPA 5I7AA 5DJ5A 3W6ZA 2R8BA 2AS0A 3F2IA 4IEFB 4OKNA 4PLWA 1NQUA 1FMLA 2C92A 1DBRA 2CL5A 2EU8A 4K40A 4R16A 2GEJA 3IPRA 3TZEA 3IMKA 2CLCX 3GJXC 1AQUA 3KKNA 1D03A 2IY7A 3BMCA 3O5AA 4J0KA 5GJCA 2GVDC 4KWTA 5JYCA 3STHA 2RFLA 5CFRA 4GC5A 2ZJOA 2VKQA 2WD7B 4RANA 5MGBA 2ZI6A 4I8XA 1XTBA 5CA1A 1X1AA 3M81A 4JEUA 2O8CA 1VPLA 3ELYA 4G5RA 4IV8A 1DC3A 4KR0A 5BN4A 3IBYA 4X3PA 2XOXA 2WE7A 2ZB7A 4DXDA 5EZYF 5IF3A 1ETUA 2HA7A 5BWOA 3MLAA 4K6KA 2NTYC 3R3SA 2WILA 1LV8A 5KYNA 2MT9A 3O3MB 3LSYA 4ARZB 1G3QA 1G21B 1VZ2A 1FVFA 2HSWA 3EIHA 1S4MA 4GRAA 5B58T 1EM6A 2HY7A 2JKYA 4KKVA 5FOTA 1X7ZB 4D5GA 5AW4A 4CEHA 2ZM6B 2HA2A 3JWPA 3BWBA 1T5TA 2RGEA 1SD2A 1R8JA 1MA3A 1W30A 3BIWA 3QFSA 4YJ3B 4UNIA 4YCNA 5BXYA 4ZYTA 2EX4A 3A37A 4L5IA 4JVSB 5HCUA 4DYHA 2X0KA 2OXTA 3DEKA 4Q01A 4J1TC 2CDNA 1M74A 3AUFA 3BTSA 4KMMA 4NVRA 5HX7A 2LV8A 4Y2TA 5EC8A 4ZT4A 4MV8A 3VI4B 5AVQA 5ICMA 2WAXA 2GBFA 1EFLA 4PE5B 2MINA 3SICE 5JAMA 3QMPA 1ODKA 1RHUA 4QPPA 4RC9A 3BK2A 4Y2VA 3LO5A 2F62A 4OKIA 2QP4A 4FPXA 4G65A 3QV1A 4IX9A 1QIKA 5ALTA 1FSFA 2XV1A 1JQDA 2ZIWB 1BHQ1 4YH1A 4CI0B 1Q2XA 3PJFA 3FLMA 4WEOA 2JLQA 2X6TA 3BZUA 3EPLA 5P21A 2PU5A 2W2KB 4JV5B 3HGQA 1NAIA 4LJAA 5CVUA 2ZZKA 1JDZA 1P1BA 1PNOA 2A58A 3QRWA 1LSUA 1N2SA 3D02A 3LF2A 1ZJ5A 4WXMA 5EJ6A 5LA6A 1EA7A 5B58C 4GE3A 1GNSA 4GOMD 1J5XA 4MWCA 4AG3A 3DBIA 2QLMA 4IJKA 1M34A 3QYJA 1OGIA 4CNBA 3QX8A 4HAIA 4GOND 3A05A 3GJYA 3LP8A 3RSQA 4PGHA 4YMWA 4N7JA 2XNCA 4N5DA 2JI4A 4HWKA 3G9ZA 3HA3A 5LPNA 2BH9A 4RS4A 2JDID 3L05A 4BAGA 3L8CA 3RTCA 1YASA 1BE6A 4ZHSA 2VYNA 3PV0A 4I1RA 3VPSA 5K9ZA 1DI0A 2CNOA 2QZPA 4FCWA 4LJYA 3QSYA 2O2XA 4Y2RA 5DM70 2RIRA 4IXMA 2OZVA 1NBAA 5I7UA 1QPGA 5LBUA 3VR3D 1ODLA 2OO5C 1X7WB 1PFVA 1H42A 3DAOA 4TQGA 1TMOA 4M4SA 4V39A 4EW3A 2NO4A 3O75A 3ZKAA 4K87A 3SE0A 1N1GA 1E9RA 1OZFA 5KC9A 4TLBA 3MWEA 3LZDA 3L07A 5L3QA 1NM5A 2G08A 1JZQA 4P84A 2F8SA 1O8BA 3IQGX 5C34B 2FPLA 1ZH4A 2HHJA 1LJLA 4XX1A 2LVBA 3GNSA 3HB4X 3EGDA 4HWTA 5D2CA 3RU2A 1F20A 3GVHA 4LF9B 5C1OA 3LY8A 3T3MB 3AKYA 5B5SA 2QU7A 1DBWA 1SBIA 2F1OA 5HKLA 2WMOB 2BGJA 4JLWA 4YECA 2VK1A 3WG9A 4KHZA 5FFMA 4IGAA 1UT5A 1ADCA 5H4HA 2WWIA 1K98A 2BMEA 4EZBA 1XEWX 3PKZA 2ATIA 1U2TA 3BUSA 1HDCA 1YQTA 1L7OA 1RKXA 3DKPA 2DUMA 2HN9A 2HUNA 1Z28A 3LHIA 4AJIA 4OI1A 4AMGA 5LYJB 1F17A 3GZJA 1MHPA 2EYUA 1BRMA 3MQ4A 5U1PA 2EFEB 2XIQA 4UEJA 4XQCA 3WQBA 4RPLA 2FCAA 1A5ZA 1F6BA 1KYWA 2PKEA 4R2JA 1Y7LA 4FMBB 2P8JA 2Q0XA 4J0GA 5CB8A 1ZHOA 4ICIA 3O3NB 4C7XA 5JVDA 5AVRA 4MW7A 3O31A 1Y3AA 4FFNA 1E98A 1BMFA 4FWIB 3VKWA 5TF0A 1MCZA 3W2TA 1TRHA 1NR5A 4F2DA 2QM0A 4N9QA 3KB2A 3E8MA 3VO8A 1XVAA 2Y9MB 1NSYA 3K0CA 4LAFA 1RMTA 2VHCA 4OBBA 3K9LA 1A7UA 2AFVA 2J33A 3IAAA 3OWOA 4OQMA 4XSHA 2WI8A 5HE8A 2XCUA 3U7QB 4HDRB 3JAMA 4C0AC 3AB7A 2CL6X 4G2NA 2B20A 1UDCA 3D6FA 3C8MA 1VJDA 1GUAA 1T1IA 4MR9A 2PUJA 1FFBA 2R86A 4Z2YA 4CHTA 3GLSA 4POOA 3FVWA 1H1LA 3T1TA 3E58A 4WESB 1JX6A 2W8BA 1UWCA 1V7QA 1XRNA 3DTVD 3PDHA 1M2OA 2FG5A 5TT0A 3GW8A 1QFZA 1KC1A 4DB2A 5EWMB 3L3BA 3GG9A 2FEMA 3BOSA 4DQUA 5AOAA 4Z1OA 3PF8A 3PJRA 1HEIA 2FF5A 3WAGA 1EE9A 3AUSA 5EZYB 1Z2EA 5C5EA 1OLOA 3UATA 1MDBA 3PC4A 1G3UA 3O4IA 5ED4A 3PQCA 3RQIA 4YJ2A 2CJPA 4IFBA 1UJCA 5KBYA 1JTVA 2CVZA 4ZCPA 1OH8A 3FYDA 1QTQA 4NULA 1IOLA 1H2XA 2FQ1A 4PYOA 3BL6A 3DVQX 3N2GA 3H83A 4P22A 4E12A 3G17A 1H4SA 3TTSA 1PCXA 3VR4H 3OIFA 3FSGD 1WV0A 1ATIA 3VDRA 3PRKE 1NWCA 3ROPA 2D0IA 3NEJA 4I4NA 1W9MA 3AZQA 2R6ZA 3TLMA 2HSGA 2XGGA 4JU8A 3WGLA 5CIQA 1IQPA 1X1SA 3COZA 4E2WA 1FTYA 4K03A 1RYYA 6REQB 1GWNA 1ZI8A 4M55A 1Y42X 4HVAA 5JSKA 3RS0A 1FRZA 3TL2A 1LZLA 3RAFC 2WNSA 2AEFA 4HWRA 1BE1A 1CJKC 1CZHA 1IJKA 3E35A 4G41A 1XI2A 1T34A 2FMKA 2QGNA 4IHKA 1BE8A 4H31A 4JI8B 3IRUA 3ROKA 2BR4A 1B23P 1AQYA 5BPFA 3RANA 1TGYA 4KRXA 5LKAA 1YBFA 5C2JB 2NSYA 3BREA 3Q3CA 1ZR2A 4JT9A 1YFJA 5HIKA 2HL6A 4YRPA 3G5MA 1RDFA 1V4VA 4EYSA 4M9ZA 2ZBFA 5DW0A 4DM7A 4HBZA 4ZCTA 1DQYA 1KYQA 1L7MA 1SHLA 1SQ5A 4UTPA 2ID9A 4F2HA 1JG7A 1XCMA 1PF7E 1GU1A 2GNAA 3GJ6A 2VUIB 3OZTA 3DLCA 2VJPA 2PD6A 3EISA 4KZKA 3E1SA 4N12A 3NHZA 5FAKA 5J2UA 3PX7A 1DDOA 3AEYA 1ORWA 1PEDA 2PD3A 1JSLA 1Y1LA 4FZRA 5FD8A 4ZRDA 3BHNA 4O33A 1D8TA 2IX3A 1P2UA 4EITA 2PMDA 4DXHA 2EG9A 2F3TA 2OXIA 2AOWA 1LS6A 1L5WA 4NZZA 1Q1ZA 1GZUA 3BZWA 3DAFA 3HKCA 5F21A 5TS2A 3PQ7A 1CUIA 2VDLB 3PWTA 4A2PA 1XPOA 1AKEA 4JUFA 3IUJA 1ZMTA 1H69A 4XGIA 3OESA 3GDGA 5CAEB 3OZFA 1J07A 4IVPA 4ZD6A 4U63A 5KSYA 4LY6A 3SJAA 3R4VA 2CL7X 2JGFA 3FG9A 4E94A 4AD8A 4O3MA 5E2AA 5FPYA 2JDIA 3DWIA 1Z06A 1LX6A 4U7HA 1HL3A 5H81A 3FMVA 4L4RA 4R1TA 5EY5B 2EJBA 3L43A 1HYGA 1YFZA 1VDZA 5DXAA 4ZQFA 3K72B 2HZBA 2Z98A 5B1DA 2D06A 4WZBE 1AHPA 1HURA 5CT6A 5DBEX 2B9EA 1JE0A 3CLVA 1PQPA 3OCUA 2A67A 4LHZA 3VR3A 1U0BB 5A5EA 1ZOSA 1T3LA 2B78A 1GCOA 4PVCA 4C7KA 4ER5A 4I46A 5KREA 4D6XA 2WFMA 1E9AA 1PV4A 2FCRA 2ZU6A 3I6IA 1YFLA 3FFAA 3SSOA 3T4XA 3FWHA 1J42A 1SU8A 2IIVA 2V8BA 4BVJA 4QECA 4JP2A 3UHOA 1KARA 4DCSA 2YC2C 4M46A 1FU7A 3KEMA 1DFHA 2OBFA 1RI5A 5JFGA 3L77A 2FWPA 3KFXA 5FJIA 2BCJQ 4MV1A 4QNRA 3IUSA 4KLZA 2G8NA 5CEJA 1AQNA 4JU9A 3PITA 3TLXA 1QYRA 3CRZA 1NXXA 3KQOA 4EUEA 2WM8A 1WZUA 4HGZA 4L8WB 5FUBA 5B7PA 3W5IA 1RHMA 2B1IA 5PGMA 3OTWA 1UBMS 2O2GA 2QVXX 3SYLA 4HVLA 1XL0A 4LYYA 2FG7C 4DA8A 1CY4A 1NULA 2ODTX 3R3UA 3BTUA 4P35A 2ZTVA 2JIZD 1B1AA 3IQIX 3V8NA 2VHUA 2BYTA 1P1CA 2O2ZA 2BH2A 3LOUA 1DE0A 4J91A 1LGYA 3VVLA 4DG8A 3G8AA 3QMVA 3P9QA 1U8EA 5CYPA 3OPNA 1MAAA 3G2PA 2B5OA 1ZJ4A 2EWWA 2QTTA 1MR3F 1WPRA 3C85A 5LQDA 1XZIA 2HI0A 3AETA 1E7SA 1MX9A 2H16A 4URWR 1O9BA 3HUTA 1KSJA 5JZSA 1N2IA 3G9UA 3LHSA 2EEZA 3KQTA 1GQQA 5G02A 4ROSA 5FNVA 4LFCB 3TNYA 1PLLA 2QTMA 2X9LA 3M3PA 2F1KA 2GPBA 4OI2A 4UOEA 1QP0A 3ROGA 4WKGA 4IJVA 1SCJA 1OA1A 2BLNA 3MJHA 1VHTA 2ZRPA 1T9KA 3P0JA 4G0QA 1W5SA 3E3NA 2P2YA 2BY4A 1Y9AA 3RRMA 2HW8A 2CBZA 1E0JA 1VBFA 4D3ZA 3CZQA 2P5UA 2VQ3A 1TYCA 5IHPA 2JIPA 2WKQA 3DTVA 3WWPA 3QU4A 4ZV4A 3FUUA 1BC5A 1HYBA 5E4YA 3NASA 2ONJA 2BFBB 2RBGA 1EUCB 1DG9A 2YKGA 5KWSA 4NH4A 4Y1RB 5F98A 2ZUEA 3AR9A 5CLFA 2FJPA 1NDQA 2CZQA 3IEKA 4LGYA 2IYOA 1S3GA 2A8YA 3LPNA 2FPSA 3D2CA 4F3NA 3AIIA 5C5DA 3CH7A 5KU7A 3VJRA 1TOAA 1U5BA 3EHDA 3H11B 5TV2A 5A3RA 1U2GC 5E6UB 5F5XA 1BSVA 2O2EA 5F1PA 3EVBA 3Q4GA 4DREA 1BYUA 4AUEA 3K1AA 4IOJA 2H11A 3L9WA 3TSCA 10MHA 3ZVNA 3FPEA 2A4KA 2ZWMA 3A36A 4TMYA 3TQQA 2OP0A 3C3YA 4UKDA 4WKBA 1U7ZA 3F3KA 1U1EA 1DXQA 3FSGA 3HB7A 3CVVA 2J59A 1MABB 4BKMA 4OIFA 2X5OA 2J9GA 2VL7A 4JJIA 2ROQA 5WRFA 2QYHA 2GCIA 3HJBA 4RPCA 3HBAA 3WWZA 2R1UA 4Q4CA 2W6MA 4E15A 2JFVA 3O38A 1S8AA 3M5WA 4ZVPA 1WB6A 1RWKA 3LDHA 1VYTA 1NJGA 5K8TA 4H3VA 2OFXA 3CA8A 2OGZA 4F86A 1XRSB 5CLHA 4HTFB 1Z6YA 5DYTA 1DZIA 1F8FA 2R8XA 4B3CA 3PR3A 1DCKA 2VK8A 4Q47A 4BVHA 1KP2A 2VT3A 3DHYA 1OH6A 4NYJQ 5PNTA 5FH9A 2WKWA 3OAAD 3ADKA 1U0OC 2F1JA 1O5IA 5LQNA 1Z0ZA 1C3OB 2AG8A 2J67A 2Q0QA 3GMDA 4CGYA 1AUOA 3PD1A 1GNTA 5IM4F 1BQ3A 3HZRA 3NM5A 4C6HA 1VI6A 3T1OA 5DNEA 2ZYSA 1CQWA 2B83A 2JVIA 1MTZA 4EAAA 3JARA 1FU8A 2D13A 4LRTB 4WECA 5KSWB 1SUWA 2IYEA 4R7TA 3R75A 2WMDA 2BGLA 5J5AA 4R1UA 3DNPA 3VPHA 2E87A 4I9UA 1MF7A 4GKVA 3V4PB 4HR7A 6CHYA 1P2BA 5CMLA 5IULC 3MN1A 2JJQA 3V80A 1WPQA 4CIXA 4CR6A 3BXEA 3OJFA 1IN5A 2AJDA 2CHVA 2OHJA 4IH1A 3ETDA 1IQUA 3RC1A 2OMKA 2IWRA 5KX5A 2IUEA 1U9CA 4NBLA 2H31A 1G66A 2V5UA 3OURA 2XPCA 3ZZUA 3N2ZB 2K7ZA 1PJTA 1JKXA 3DXYA 1HF3A 4MW0A 3HCOA 4YXWD 2E89A 2Q1SA 5ADVA 2TMDA 2C20A 4QTZA 1XMXA 2HPAA 2OCIA 4GMDA 1Z62A 4NZYA 3FY4A 5G0TA 1BN6A 2ZP1A 4ZK2A 4OQEA 1HOXA 2C4HA 2YIDA 4E1VA 2CKDA 4DY6A 5BMVB 3PEUA 4NZ9A 5CR9A 4EJSC 1MNAA 1XD2B 3MTQA 1I2BA 1E2EA 1N9GA 2N46A 3QOXA 4EGQA 5HUQA 1SCDA 3OPVA 3L0CA 2A1UA 1IIBA 1KVQA 3KDAA 4C1NA 1L8LA 1EJ2A 1CIP