3G9UA

Crystal structure of este5, was soaked by p-nitrophenyl butyrate for 5min
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
296
structure length
294
Chain Sequence
AGPEIVKLKKILREKAVPPGTEVPLDVMRKGMEKVAFKAADDIQVEQVTVAGCAAEWVRAPGCQAGKAILYLHGGGYVMGSINTHRSMVGEISRASQAAALLLDYRLAPEHPFPAAVEDGVAAYRWLLDQGFKPQHLSISGDSAGGGLVLAVLVSARDQGLPMPASAIPISPWADMTCTNDSFKTRAEADPMPGGINKMAARYLNGADAKHPYASPNFANLKGLPPLLIHVGRDEVLLDDSIKLDAKAKADGVKSTLEIWDDMIHVWHAFHPMLPEGKQAIVRVGEFMREQWAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Esterase/lipase
publication title Structural and biological characterization of EstE5
rcsb
source organism Uncultured bacterium
molecule tags Hydrolase
total genus 104
structure length 294
sequence length 296
ec nomenclature ec 3.1.1.-:
pdb deposition date 2009-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3g9uA00
4ARAA 2QXUA 4OB6A 3PFCA 4X6YA 5J3JA 4E46A 1HBJA 1BCRA 2HA3A 1K63A 4EA6A 4B9AA 4Q05A 3ESBA 1EB8A 4QWMA 3HLKA 1HLGA 4LXGA 4TPKA 3VJKA 4U2DA 1N5RA 3OOSA 4GI1A 4W1QA 3O4JA 5ALJA 4H7EA 4H0CA 3WWEA 1AURA 4AMZA 4ZRDA 1ZIYA 4JNCA 3RK4A 3STTA 2YH2A 5ALQA 5EHNA 1CUAA 4G4IA 1R1DA 1DX4A 2OCIA 4AZ0A 2ZYSA 3F96A 1IZ8A 2JEYA 3KWJA 2E3JA 4X94A 4BC0A 5AKIA 3ZV7A 3AIMA 3LP5A 5HF6A 1R88A 2C5GA 4EBBA 1P0IA 1XZMA 4ITVA 2WJ3A 1BROA 2HA6A 2YXPX 3I6ZA 3E0XA 4MWSA 1QGED 2W6CX 4FNMA 3RARA 3OC0A 3QMMA 1DQZA 4W1RA 4CIBA 3CXUA 3FLAA 2PU7A 4L72A 3PUHA 4OSEA 4J03A 3A2LA 1G5FA 3WZLA 5ALZA 4WCVA 4Y2XA 4QE3A 4X92A 5K5EA 2WSLA 2WIJA 3R3VA 3R3ZA 1XZFA 5AM4A 4A23A 3VISA 3OG9A 1ZI8A 1THTA 5JIBA 3D2AA 2DHDA 5LYYA 3AJAA 3B12A 5HQ3A 1LPAB 3WJ2A 3QMWA 1QZ3A 4YX9A 5HK9A 1A8SA 5T4FA 1L7QA 4LIPD 2XQIA 1QFSA 2VT7A 4DIUA 4KYVA 1GKLA 2O2GA 1XRMA 3G9ZA 3DKKA 4AN1A 2ECFA 3WK6A 5LKAA 4MXDA 1CUCA 1Y37A 2XQFA 1CIJA 3H2JA 3I2IA 3BF7A 3WJ1A 4OUKX 3H19A 1F6WA 3D5EA 1CUGA 4DLNA 1JFRA 4UHDA 1FFAA 3G0GA 4FFVA 2Q0XA 3AZOA 2GYUA 4DTCA 2DHEA 4ROTA 4BATA 1JU4A 4BDTA 3CCCA 1LZLA 4FBMA 1PFQA 4H7KA 3G0IA 1ODTC 5SYNA 3D2BA 2BAGA 2OCGA 1MO2A 4EHBA 4KE9A 3X3HA 4A5SA 1JT2A 1EA5A 1E89A 3I1YA 4ZI5A 4U2EA 5AI4A 2V97A 2PSJA 2OGZA 4MEBA 5LKRA 4OB7A 4H7FA 4JYMA 4CFSA 2R8BA 4H7DA 4UFPA 5JADA 1RYYA 2HM7A 4FLEA 1QFMA 4UBLA 3CCBA 4FOLA 5LZ2A 1ZGCA 3I1IA 4QDZA 5DTIA 1YAHA 5HF5A 3FYTA 2Y6VA 1XZJA 1ZI9A 2UZ0A 2OXEA 4G4JA 1CUWA 1QOZA 1Q0ZA 5ALWA 3DD5A 5JARA 1UWCA 1TAHA 1XLVA 5EIAA 4TGLA 3S2ZA 1ETHA 1K6EA 2WIKA 4KEAA 4X93A 3H04A 4Y2YA 2GBFA 3B5EA 5K3EA 2BUAA 2XMBA 1VE7A 3DL4A 4L9AA 2BJHA 1QIJA 1BU8A 3G0BA 4Q34A 4CI9A 4FNGA 3GROA 1C7IA 2XMZA 2CB9A 5C7YA 1Y7HA 3R41A 2WHRA 1YAJA 5CURA 1CUEA 2ES4A 1H22A 3MVEA 3O9MA 3ESCA 2X76A 4GW3A 1K4YA 1B6GA 4EB0A 1O6GA 3F97A 4IH4A 2IIVA 5A7HA 5E4YA 2ZYRA 1XRRA 4C89A 4I4CA 1UT6A 3BIXA 5AKEA 2X5XA 2BUCA 4K6KA 3DOIA 3VKFA 5KBYA 3Q0TA 3BL8A 3VXKA 4KR0A 3F67A 1J1IA 2H9YA 4WJLA 1EB9A 5BOVA 4B83A 3DJYA 5AK5A 1WHSA 3WKCA 1WOMA 5AI6A 2PVSA 1W6RA 4YPVA 3OM8A 4UHEA 2O7VA 1QIFA 3IA2A 1FJ2A 2DCMA 4PNZA 3F9CA 1JJBA 4X7BA 2HL6A 3QBJA 1THGA 1VLQA 4AO8A 2PKYX 4BBZA 5HF9A 4QDUA 3NGMA 5C8XA 4QNNA 5CW2A 3FSGD 5ALGA 2O7RA 3SC2A 1A7UA 3IB3A 3BDIA 3WL5A 3D4LA 4FTWA 4PO3X 4QDOA 1IMJA 2H7YA 5FOQA 1WM1A 3MGAA 1UOOA 4QEKA 5FV4A 1W1IA 2XMDA 5ALKA 4UBIA 2H7CA 1TIBA 1GT6A 5I9IA 1XKLA 5IVKA 5FPQA 3HRHA 3JWEA 4X91A 2HHAA 4GLBA 2NW6A 4EY5A 2XUPA 5BWCA 4QWWA 1XZHA 3KD2A 4MWTA 2HU8A 4M0MA 1CEXA 4B0OA 4C87A 5A6VA 1ODSA 2WUFA 3H18A 2AJCA 2DQZA 2GBCA 4UBKA 2DQYA 3TJMA 2VJCA 5AIBA 4GWLA 3KXPA 1WPXA 5K3CA 4TVKA 1LBTA 1YA8A 1UKCA 3G9XA 2Z3ZA 3FWHA 3IUNA 1F0NA 2WILA 3BWXA 4Z49A 5CT5A 4GEGA 1H2WA 3IULA 2WFLA 4DNPA 3KOOA 2GBGA 4HS9A 4I3FA 3SK0A 3O95A 3PF8A 4DMFA 1ACLA 4OB8A 3SWWA 2C4HA 3ANSA 4Y7DA 3HSSA 4N8SA 1QIKA 1AC5A 5AHXA 1OILA 4HXFB 2CUTA 1IVYA 4XIIA 3IUMA 3G02A 2QUBA 5AO9A 5ALMA 4X85A 4UBNA 5IVIA 1A8UA 1S8OA 2QS9A 3G0DA 4BAZA 4QLOA 2P8SA 2BGNA 1MAHA 1PJAA 1EK1A 2HA0A 7YASA 2QTBA 1DT3A 1UXOA 4KRXA 1O6FA 3H2GA 1WB4A 3WYNA 4E14A 2CKMA 5BWBA 2HIHA 4PW0A 2IITA 2JEZA 4GBGA 4Y2RA 3DL7A 2QJWA 2VAVA 1N8SA 1MU0A 1UK9A 3G7NA 2JGJA 4MEAA 5YASA 2O2HA 1EVQA 4HXEB 3MUOA 4MJ3A 2QJRA 4C6HA 1I6WA 2RHTA 1YA4A 1FFCA 3WI7A 4KJXA 5AKGA 1YB7A 4NZZA 1RP1A 2FX5A 3WQHA 1LPSA 2OPHA 4OU4A 3ZI7A 4KAAA 3QVMA 1W76A 1ZOIA 5FUMA 4AN0A 3BDVA 2WLSA 2DFPA 1LLFA 1EDEA 5EFZA 1EK2A 2VF2A 4QDXA 1XROA 3WL8A 4HTAA 2QT9A 3C70A 2XB6A 4X6XA 1QIIA 3K2IA 2RGUA 4P92A 5ALIA 2Y6UA 1QLWA 1ZGBA 3V1KA 4JH0A 2QVBA 1TCCA 3WL6A 2QXTA 2CBGA 4UBJA 2FJPA 1TRHA 3O4HA 4Q82A 3WK4A 3H17A 3BJMA 1F8UA 2XUDA 1HQDA 4EY8A 3AZPA 3L1JA 1R9NA 1LPMA 3BJRA 5JYCA 6YASA 3RM3A 4UUQA 4BRZA 4P9NA 1QIDA 5AOBA 1H23A 1TQHA 1ZD5A 2WUGA 4Y9SA 1WPRA 4CG1A 1UOQA 5AI5A 3G9UA 4DMCA 3U0VA 3H2HA 5AM1A 1MT3A 1R4ZA 4WFKA 4L3WA 4YASA 5ISMA 3A2MA 2ROQA 4J0IA 2WFLB 3LIIA 3N0TA 3IVMA 4Q3KA 1SCIA 2WTNA 3PI6A 5E2IA 5JD4A 3AIKA 3S8YA 1FFEA 2HA2A 2BGRA 2XQKA 2J4CA 2BCEA 5AK6A 1YCDA 4QLAA 4RE5A 3EQ7A 3GA7A 1H2YA 4BCCA 3ICWA 3V1LA 4F0JA 5A62A 3WKEA 2VATA 3GELA 5D3ZA 2WKWA 5AI9A 5CXUA 5AKZA 4X71A 1UKAA 3PDCA 5HFAA 3D2CA 3ZWQA 4BCDA 4BB0A 1VZ3A 1GQRA 3KSRA 4P08A 1K8QA 1XFDA 3H1BA 5ALTA 5AM0A 2H1IA 3H0CA 2FUKA 4FLMA 5EIHA 1CUHA 4C4XA 5ALOA 1GPNA 1XZGA 2D0DA 2VT6A 1GZ7A 3T52A 1XRNA 3D0KA 2WM2A 4N8EA 1UFOA 1VOTA 4B84A 3OURA 4H7HA 3I6MA 3FAKA 1XZIA 3OTQA 2OAGA 2OQVA 5LIPA 1XRLA 3O4IA 4H7JA 2DHCA 2OG1A 5AKXA 3IIIA 2PL5A 2WFZA 5HFNA 5A71A 5T4BA 4CIAA 4ZWNA 3RKSA 2HA7A 4HXGA 3U1TA 3IDAA 5FXMA 4FWBA 4OD0A 3DYIA 1CUFA 1LPOA 4G8BA 1MJ5A 3I28A 4G4GA 4WY8A 2Y2VA 1IZ7A 4DGQA 2XUGA 2VA9A 3A6ZA 3I2HA 4DSZA 5JAUA 5JZ9A 4WFJA 2C0PA 4BAGA 1LBSA 2D5LA 2HDWA 3G0CA 5AI0A 5K3FB 4AB1A 1XRPA 1MX9A 5LLSA 1ZJ5A 5D7BA 5FLKA 3AFIA 3SX4A 1M33A 4LXHA 2HU5A 4JYPA 2W22A 5JAOA 2RONA 4BAUA 3C43A 3WZMA 2QRUA 2XUKA 5CH3A 1EVEA 1XZKA 2JGEA 3QM1A 5EGNA 1QJ4A 3A70A 1QIHA 5CH8A 1R3DA 1JKMA 2WU4A 4S0XA 1VKHA 1U8EA 3DCNA 2OQIA 1CQZA 2RHWA 4MQMA 3H2IA 5ALYA 2XMGA 1DWPA 5CXXA 4CCWA 3QPDA 2ZJ6A 2WUEA 1WCYA 1WHTA 5I8PA 2I3DA 5AKYA 3DQZA 4IH9A 4DMHA 3O9VA 1GPKA 1GQSA 2C58A 2XUQA 2WU3A 4AO7A 1CUYA 3C8HA 5T4EA 5HKAA 3M82A 4H77A 5AKJA 3A2NA 2PSEA 2ZJFA 4J0GA 3C6YA 4BTVA 3PE6A 2QR5A 1ZI6A 4HVTA 1GPLA 4U2CA 1EDBA 2WIGA 4LYDA 4LHEA 2WG1A 2K2QB 5A7FA 5JANA 3V9AA 1XZBA 4QDTA 5AM5A 2WHQA 3QPCA 5ALUA 1A88A 1UKBA 5KREA 5JZSA 2HA4A 1C4XA 1TCBA 1FSSA 1YR2A 5DLPA 1XQXA 1AMNA 5E4TA 2AJDA 1QIEA 3VJMA 1T2NA 1CUZA 3W9UA 5ALHA 5LZ5A 3EQ9A 5K3DA 1AX9A 3M3DA 2C7BA 1MAAA 1SCQA 3B3QA 2Z3WA 3NOXA 1E5TA 2XMSA 3WIBA 2V9ZA 4RE6A 3UUFA 4G8DA 5AKHA 4J0KA 2DSNA 2JGLA 5DYYA 1W75A 4BRSA 4UPDA 1QE3A 5AOCA 1VXOA 3FCXA 4MYSA 2AJLI 5FPPA 4C4ZA 1DWQA 3EQ8A 4Y2VA 3EF3A 1SOMA 4J7AA 3STXA 1DTEA 5CBKA 5DNVA 4K2AA 5D6OA 3L1HA 4QZVA 1H2XA 1EINA 1UZAA 3FVTA 4BDSA 1XZEA 3KDAA 1R9MA 5IH7A 1BS9A 4ZXFA 1YB6A 4X6UA 3CN9A 2WIFA 4NS4A 4BZWA 1AQLA 4GHWA 4IH1A 1N5MA 2OCLA 2WJ4A 4UHHA 3TRDA 3UUEA 4N8DA 2GYVA 2BUBA 3WMRA 4EY7A 2C0QA 3QZUA 1XQYA 2AXEA 5DWDA 1C7JA 4UFNA 1BEZA 3GBSA 4W9RA 4KE7A 4XVCA 3O4GA 1N1MA 5AH0A 2QMQA 3VDXA 1LPNA 1UK6A 3HI4A 2JGIA 5IKXA 2ZYIA 4BYMA 3PUIA 4INZA 4UBOA 2HU7A 1QIMA 1XRQA 4AXBA 5LZ7A 4BE9A 4PSCA 1BEEA 2VEOA 1E8NA 2CZQA 1E8DA 3FBWA 2AJ8A 2ZYHA 3ESDA 4Q3OA 3DDUA 3GFFA 5LZ4A 1BRTA 2YYSA 3W05A 2JF0A 5EI5A 5CH5A 3BXPA 4Y2TA 4XX1A 4EUSA 2CJPA 5ALDA 2HFJA 2Z8XA 3HYSA 3WKBA 4BVJA 4FHZA 3QH4A 2X8BA 1P0QA 1X70A 5JALA 4U2FA 4BP9A 1QO7A 1LZKA 5SYMA 1ACJA 5AIAA 2Z5GA 3WA6A 3AINA 4UFOA 2GBIA 3WKAA 1E3QA 2ZJ7A 1ISPA 3M81A 4LXIA 1DT5A 4Y2JA 3C6ZA 3W9BA 1U4NA 5C8VA 1VA5A 3HABA 3WL7A 3E1GA 3ZPXA 2JBWA 2WHPB 5ALPA 1QTIA 2R11A 2HADA 3ED1A 5CMLA 4U2GA 1XZLA 2ONCA 3L1IA 4PF1A 5ESRA 5IVHA 3DOHA 1XLUA 5C8ZA 3UMJA 4I19A 5AM2A 1VE6A 2VQ6A 1ZIXA 1CUXA 4CG3A 4B9EA 1Q83A 2IX9A 5IVDA 1HPLA 5LP1A 5EHZA 3H1AA 2VSQA 3E4DA 1MPXA 5HF8A 5JASA 5AJHA 4H18A 3LCRA 3W04A 2GYWA 4WY5A 2XI4A 5K3BA 5DYWA 5JAHA 2QZPA 1ORWA 1YASA 2HRRA 1SCKA 4B85A 2FJ0A 1CVLA 5K3FA 2J3QA 3BF8A 3QITA 4IO0A 1Q0RA 1ODCA 4WFIA 5FDFA 4B7ZA 3C6XA 2OGSA 3O0DA 3LS2A 5AP9A 3PF9A 2WG0A 2LIPA 4K6HA 4Y2SA 1PV1A 1Z68A 4PSDA 4BE4A 1NX9A 5LZ8A 1J07A 2Y2UA 1LPBB 2EDAA 5CT4A 4J0JA 2V98A 5K3AA 1NU8A 1MTZA 1OCEA 4OCZA 1DQYA 1MX5A 3EBLA 4AX4A 4JUIA 3HZOA 3QMVA 2WFMA 5KWJA 3ICVA 1B41A 4AO6A 3JYHA 1HL7A 1J06A 3V1MA 3FLBA 4D9JA 1LNSA 1BN7A 2HFKA 1XZAA 3GUUA 4W63A 1MX1A 1UK7A 1X2EA 4J0DA 4OYLA 4AZ3A 1ZD2P 4UBMA 5A2GA 3WA7A 3K9BA 4EZIA 3STWA 4E15A 4W1PA 5ALRA 1E66A 4BCBA 4F60A 3WIOA 5BV7A 4BC1A 3AZQA 1QO9A 4RGYA 5HK8A 1VJ5A 3NUZA 1W52X 5DNUA 3WWCA 1F0PA 3W06A 3HEAA 1BE0A 4J0CA 4DNFA 1VZ2A 4WDRA 1L7AA 5AK4A 2EDCA 3FVRA 1JI3A 2ACKA 1KU6A 5FP0A 4F21A 1JU3A 5ALXA 4B80A 4FKBA 4NMWA 4ZGBA 2XE4A 4MYDA 3Q8WA 4BP8A 3C45A 5A7GA 3ZLVA 1G4HA 3H2KA 2VJBA 2BFNA 4B81A 3G8YA 3ILSA 4PSUA 3I2GA 1CQWA 2PU5A 5AI8A 1XQWA 2GZSA 5ALSA 1H2ZA 3MUNA 3I2KA 2WTMA 3CN7A 2B61A 1LGYA 2WIDA 1A8QA 4NVRA 5HZGA 4XJVA 4DYHA 4GDMA 4G9EA 2XQJA 1VA4A 1IUNA 2I03A 2PSFA 3OPMA 1CRLA 1P0MA 2OCKA 4XWGA 4UHBA 1MN6A 3YASA 5JATA 3I6YA 2XMQA 3BIWA 2VTVA 1EXWA 1ZD3A 2PSHA 1EI9A 4ETWA 4ZV7A 1Q84A 5C81A 4U2BA 1T4MA 2J3DA 3TEJA 2XUIA 1DINA 3WWOA 4X97A 3STYA 1JMKC 2DR0A 4N5IX 5HCUA 1GGVA 4M0EA 5JZBA 3ESAA 1XLWA 3QYJA 1CUJA 1R50A 1TKRA 2XUOA 3WLAA 1EDDA 5JD5A 5LZ9A 5JAPA 3R40A 2RAUA 3PFBA 1HDEA 1CLEA 4OYYA 1YS2X 1CUIA 3E3AA 3VJLA 1QONA 1D07A 2ZVDA 4G8CA 5AOAA 3C87A 4W1SA 1FFDA 1NU6A 1AZWA 2QOEA 1W4LA 1AKNA 3FLEA 2ZSIA 5DNWA 4BVLA 4M0FA 1BCSA 1XZCA 3HC7A 3TGLA 1EX9A 3DKRA 1TCAA 1CUBA 1J2EA 3WK5A 4IQ4A 1X2BA 1YS1X 4L0CA 1USWA 2HA5A 1U65A 4H7IA 4Q3LA 4C4YA 2RI6A 1K5PA 2WUDA 5JD6A 2I3ZA 5ALEA 4DSAA 4KAFA 2PSDA 3EIOA 2XMCA 4BVKA 5DJ5A 1EH5A 4C01A 3WWPA 1EHYA 2Z8ZA 4CCYA 4X00A 4RPCA 4AQDA 1HKHA 3HXKA 1KU0A 2PX6A 4FBLA 4MQLA 3R3WA 3C5WP 4UHCA 5D3KA 3STUA 2OGTA 1Y7IA 5ALVA 1DU4A 2B20A 3RLIA 5E4JA 3C6BA 4PQEA 3FYUC 3IBTA 1IUOA 2WHPA 4LYEA 3M83A 3F98A 5DTJA 3C8DA 1DX6A 3IURA 4DM7A 1XZDA 4P93A 3R3XA 1ZICA 4HRYA 2VAXA 5I7UA 3FOBA 2VJAA 1FFBA 1OXMA 4IHAA 2OLEA 4N5HX 5FKJA 1TK3A 3I2FA 3PICA 2QM0A 2C5FA 4E11A 3FCYA 4H35A 1ZJ4A 1JJIA 5AM3A 4J3JA 5CT8A 1YSCA 1AGYA 5HQ3B 4FLFA 5EIEA 3AILA 4QA9A 3WK7A 5AICA 2XDWA 3DS8A 2XMRA 3QPAA 2XLBA 3ZLTA 1GXSA 4KRYA 5ALLA 3FYUA 3WK8A 1JJFA 3AUKA 4DNOA 1XKTA 3F8SA 3I2JA 3KWFA 3G9TA 5ALNA 5F4ZA 1CR6A 1CPYA 3C5VA 2XUHA 3D3NA 4UHFA 1CV2A 5KWIA 5FRDA 2G5TA 1L7RA 2XT0A 5ALFA 5AK3A 4F5ZA 1UK8A 4KACA 2XUFA 2CMFA 3WWDA 4HZGA 2G4LA 3DYVA 3V1NA 4Q1VA 3W2TA 2XLCA 4EY4A 2I78A 3V48A 3BE8A 4K6GA 3R3YA 2VJDA 5AKKA 4X90A 3P2MA 4A16A 4EY6A 4ZV9A 4BZZA 4ARBA 2V96A 2JGMA 1WB6A 4DMKA 3DNMA 2ZSHA 4OU5A 1QTRA 3ANTA 3DLTA 2EEPA 4O08A 4HRXA 1ZD4A 4Y2QA 4YK7A 1SFRA 4G9GA 3FNBA 2G63A 3STVA 3R0VA 1CUUA 2PBLA 3LIPA 4V2IA 2XQGA 2G5PA 2JGKA 3K6KA 4HAIA 3LLCA 1WB5A 2XUAA 3VVMA 4C88A 4GXNA 1IUPA 4FDMA 1E8MA 2J4FA 4CCYB 4PV7A 2QUAA 1RWQA 1CUDA 3AIOA 4AMYA 1GKKA 5EHQA 3D7RA 5CRIA 2B4KA 1XQVA 4B6GA 1CUSA 4G1FA 5CT9A 1UOPA 2PM8A 4FFWA 3FSGA 2ORYA 1ORVA 3WK9A 4B0PA 4Y2PA 4GECA 2PUJA 1AUOA 4X95A 2WG2A 4KE6A 1LPPA 1SC9A 3WYDA 3HACA 2H7XA 3T4UA 2GZRA 1MNAA 4RNCA 2CEKA 5CT6A 3GZJA 1QIGA 2PPLA 3IUQA 5EHXA 1CFJA 3WKDA 4JEIA 4Y2UA 4WDQA 3JW8A 1BN6A 1P0PA 1VXRA 4J0HA 2HRQA 3HJUA 2RIPA 2ACEA 2AJBA 2WQZA 2YASA 1DWOA 2QKYA 5H3HA 2O2IA 5DYTA 5T4HA 3N2ZB 1JMYA 4FMPA 4KE8A 4LKOA 1G42A 2JIDA 2OAEA 4OPMA 3ZLUA 4CG2A 3NWOA 1KEZA 3FYUB 1CUVA 3DEAA 4KAJA 4X3CA 4DNQA 2Y1KA 3VVLA 2B9VA 3D59A 4B82A 2WJ6A 3R3UA 3IUJA 5HKBA 2XUJA 4BTLA 5AKLA 2PUHA 4ZREA 1G66A 4K5QA 5CTAA 1U2EA 4G5XA 2BKLA 1MNQA 2JGFA
chains in the Genus database with same CATH superfamily
5IX8A 4QVKA 3RBXA 5JS6A 1F8YA 1ZJ6A 2QXUA 3Q3EA 4YLEA 4UM9B 4JP2A 3KT0A 5K6AC 3BGIA 1MOQA 1WABA 2OBLA 4G24A 2ZM5A 1SC6A 5D8DA 1OZAA 5HKKD 5FOTA 5J3JA 1DKMA 3A3OA 4G09A 5EZSA 3T4PA 4E46A 5KTOA 3PC2A 2I91A 2YL2A 2WB4A 4B47A 4M88A 2WTXA 5HSGA 4I2NA 2QEQA 3UXEA 1S96A 1QGOA 2X1HA 2ZBQA 5I6DA 1GA1A 1TVKB 2JC3A 3IDFA 4U9IS 1JKJA 2H8GA 2PIDA 3KPUA 1E4EA 1Y8RA 3PD7A 3RB8A 3LPAA 4YAUA 4GICA 4MVWA 3TUZC 3HLKA 2X5KO 1N0WA 4Z4IA 4TPKA 2ZDHA 5K4HA 1FFSA 5FT9A 4BN4A 1WKVA 2NGRA 3JYOA 4L76A 3ZW9A 4J8PA 3L7AA 3FAZA 1EVZA 3ZD6A 1ISMA 1DEOA 1U9CA 4A6EA 4X6LA 3ZWYA 1DBSA 1O94C 2D5CA 4NYJQ 2XBLA 3GEHA 2ZSEA 3LUKA 5IM5A 3B1KA 5K99A 5MFZA 4YRNA 1AURA 1H2RS 3S70A 3BZBA 3TINA 3FMFA 3TPZA 3V8EA 2QMUA 1XJ0A 3D8BA 2IYTA 3LT1A 3UFXA 3EZ6A 2OOKA 4JI5B 4OXKA 5DM2A 4N48A 1Y8QA 1UBKS 3M6XA 4IIYA 1VHQA 3FJOA 3ESZA 1A0OA 2G28A 1PFUA 3AHCA 4G4IA 1C7QA 4JOQA 4N3AA 2O8DA 2JLBA 1KPGA 1T10A 1U6IA 3QU5A 4OQYA 1DX4A 5E8RA 2QT1A 4XAQA 2B94A 4OFBA 3ETDA 5I4CA 4CCSA 1EJBA 3IT0A 3A05A 3PGXA 4QU5A 2WWRA 2F59A 3OJFA 4Y1FA 4TTIA 1RAEA 3HPQA 2OPBA 5ECWA 2H0AA 1WXHA 3H9QA 4BV2A 1OYVA 1MIOA 2IYLD 4G9BA 4BBPA 1RXSA 1ZC4A 5CLGA 3IVCA 4IRXA 5FF9A 5LU9A 1PVOA 2XUZA 1HLFA 1SHKA 2C8JA 3ZV7A 1KS9A 2CEAA 4L2IB 4Q1FA 3LDUA 4KLNA 2JVIA 1I7PA 4G86A 4KXMA 4UUAA 2CFCA 3SZUA 2OAP1 3LP5A 6Q21A 1JRLA 3NJRA 4D8YA 1C7EA 1P0IA 5E6SA 3ACCA 3OZBA 1E1RA 1E79D 5EHGA 1SD2A 3DKVA 1P74A 1VLHA 1E7QA 4CMAA 4BEBA 3KZVA 3ZDYB 5LOVB 2ZW9A 3OIDA 4KBYA 5ERXA 1BROA 1ID8A 3QIVA 4V39A 3X1ZA 1TM2A 3W5VA 4ZYXA 4ZPJA 3D31A 5BN3B 3BBLA 2W6CX 1M76A 1YCFA 4FNMA 1Q0HA 4IZIA 2RI0A 4NI5A 2QRGA 1WNFA 3DMHA 5BQOA 4O4LF 5K03A 2AYZA 1YTLA 2ZTSA 4NJEA 3H8VA 3QMMA 3IOCA 4W1RA 1WQ4A 2JD1A 1WXEA 2VNJA 3NTRA 4EK9A 4MAFA 5IJAA 2Q5JA 1QFZA 1O94A 3SHOA 2XA9A 1GU0A 4PXSA 1KYZA 4QUHA 5B1SA 5ALZA 4TL9A 4DXAA 2FQQA 2DFKB 3O38A 3RRJA 3IAS6 1NX6A 1SHTX 2WIJA 3R3VA 1OXXK 2QRPA 3MT7A 2B7BA 1KVRA 2WF8A 3KT3A 1G0NA 3R3ZA 5F5LA 1Z63A 1QYWA 3WGTA 2PGAA 1NRWA 4GSLA 1QKIA 2X1VA 4KNVA 1R74A 3M4NA 1XKXA 3UOAB 3VISA 2X0DA 2ENUA 4K2HA 1MRNA 3DVQX 5BN5B 1ZI8A 1F3OA 2OBNA 1A7KA 3H5TA 4X60A 3VR3A 4EEZA 4BXOA 1FSFA 1U6KA 1SZDA 1VHJA 1I4LD 2DHDA 4R1TA 4R8LA 4S2UA 1CEYA 3NT4A 3B12A 4FSHA 4D82A 1O95C 3KAKA 4BLPA 4HX2A 1S4QA 2Q5IA 3WJ2A 3WLOA 1HTTA 2EBUA 4EO4A 5BN3A 1YRHA 1T35A 4HD8A 2A4MA 1X80A 2EQAA 3EUFA 1DQRA 4MICA 4YX9A 2MTBA 3GGDA 5BSHA 1UMBA 4M99A 2XQIA 1GSAA 1WTAA 5CVEA 2OORC 4JQSA 4II3A 3AI1A 3ELUA 3O2JA 3HN7A 3EPPA 4PYJA 1JPNA 2CNBA 1P81A 3QFHA 4KN6A 4J7UA 1XRMA 2IP1A 4W8OA 5DI9A 1EJ0A 1Q20A 4UPVA 2HAEA 5GM1A 4AYWA 2J31A 3AR2A 3RRBA 5J1SB 1SAYA 1X92A 3ZVLA 3V00A 4TMVA 2OCAA 3HBJA 5T67A 3MA0A 3WK6A 5CFOA 1E9BA 2HTEA 4MXDA 4D25A 2ZZMA 5BSMA 1SD1A 1Y37A 3GGCA 4AY2A 1GU1A 4PC6A 2VRBA 1CIJA 2FWIA 2CVHA 1IN7A 3MMXA 4JLWA 1IDN1 4MK4A 2GKOA 3L6OO 4WXMA 1VG8A 2GCEA 1VHWA 1V35A 3DDNA 4TS9A 4EGSA 4HC4A 2W90A 1RQ7A 3WJ1A 4OUKX 2KHZA 4KXWA 4P8RA 3V7UA 3OSZA 1JI0A 2WSSA 2Y3IA 3FOAA 3B6EA 3G13A 5D1HA 3DE0X 4R2IA 2CFIA 2UYCA 1J2YA 3LAWA 2JRLA 4O4LA 4XUCA 3QE0A 1H6DA 2I4LA 2NTYC 1DHRA 4GR9A 4DSNA 1QRUA 3K31A 3Q7IA 1M8PA 1CIVA 2QGNA 3RS2A 1F17A 4TQUS 4XOUA 4FFVA 1EIWA 2C82A 1W44A 2Q0XA 1B2LA 1N5LA 3IKMB 4B73A 1SU8A 1Z22A 2GYUA 2QYHA 3N6XA 4FW9A 4OQMA 1BYIA 4NK4A 4UEQA 3CQ9A 4UMVA 5LQMA 1SBNE 1E1LA 1GCUA 2P40A 2DHEA 2XCRB 1YRAA 4WWHA 3NC0C 1MAWA 2Z2XA 5IFLA 1KKLA 4QU8A 3CCCA 4M21A 3F71A 4BNDA 1LZLA 3UAYA 1CWUA 1U2GC 5LJLA 3B48A 1P8AA 2OWEA 2PA0A 1GDTA 5A04A 3ZHQA 1B0AA 1Y3HA 2GZMA 1O95A 1U9YA 3T34A 2K6GA 1V37A 1XX6A 2C2XA 1U2PA 4PZYA 4ALJA 1XMXA 1MRZA 2WP8J 4LYFA 1V4BA 2MMCA 2ZRKA 5D01A 1ISJA 5HILA 4BNVA 3G5MA 3FPEA 3LC0A 4LVUA 4N7BA 3ZWMA 1R0BA 3MGKA 3RFCA 1JHYA 4PLCA 3S3TA 5KTYA 3WNQA 2X9QA 2YMLA 4TYNA 4RMHA 2JJYA 1JPUA 1E89A 2OORA 1WF3A 4V0RA 4ZDWA 5B6PA 4ZI5A 4CEJA 2YWJA 3VYUB 3ZLBA 2IIPA 2OMKA 1IPFA 4HUJA 1OT5A 2WK1A 4EKGA 2PPVA 3DULA 3IQIX 4ZEXA 1JKJB 1F2TA 2ECOA 2V97A 1E4EB 1Y8RB 3PFIA 3QE4A 2OGZA 4CMIA 3OBBA 3GLTA 4AY6A 4MEBA 4BQNA 4X8OA 4OB7A 5KTPA 2XTAA 3FPBA 1NHWA 3L77A 4PG5A 3C24A 1TDJA 4JYMA 4CFSA 3CUEF 3GUHA 1MZVA 4PX2A 3ROKA 2ATCA 2Q27A 5F52A 4I6JA 1RYYA 4FLEA 4TTVA 2JI9A 4LNHA 3QE9Y 4OGLA 2JFQA 4YP5A 1CRQA 1FK8A 1NJ5A 3MSXA 3TM4A 4B6JA 2JAPA 4OQQA 3WLEA 2JKVA 1PBNA 1QLHA 2QVLA 1YAHA 2ZE8A 3OKCA 3R20A 4GGOA 3NHLA 3FYTA 4UM5A 3K70C 3UFXB 2ZANA 1PF7E 2VP9A 4LZJA 4P31A 5M04A 1WCXA 3KLPX 2VAWA 1JTFA 4YY3B 3QW2A 2HMSA 3KYDA 1ZI9A 2UZ0A 3MLEA 1PLKA 1U8CB 1NIPA 4RJKA 2W0MA 5JCJA 1XB2A 4CN8A 2P9JA 3WMFA 1MO5A 2N3ZA 4H3VA 2G71A 2OXEA 3D02A 4HQOA 1CUWA 2O8DB 1F1BA 5TJHA 1ODJA 1XR3A 2BWJA 3DD5A 4H31A 5ALWA 1CHDA 4RK1A 3WGYA 1UWCA 1TAHA 3JALA 4EKYA 1NYLA 4UTZA 3WXBA 2PBZA 3VRHA 3HPRA 1IYZA 3S2ZA 4G5GA 4NCAA 1U2GA 4R01A 2R8YA 1QHHA 4PWZA 3SHWA 3NDPA 4ZI2A 3L41A 1MIOB 1X9IA 2RGRA 5K0FA 1X1CA 4GF5A 1J22A 1L8LA 3QP9A 1RYFA 2BP7B 3R0IA 4MKFA 1A2KC 1MHPA 1RE1A 1H9AA 1PJQA 2GF9A 3NKFA 3V7FA 1M2GA 2X9NA 4PC3A 1AUXA 4U7GA 3ND9A 1T9HA 3QVUA 3QXHA 3GAZA 4YUXA 2V1UA 5K8IA 4UEJA 5E6SB 4BP3A 5K3EA 1NJSA 1VE7A 4L08A 5ILOA 1AHNA 3F6BX 3GD5A 3E84A 3WWZA 3ZE7A 5AVSA 1CDDA 3NBKA 3KUDA 4K1XA 4N01A 4Q34A 4E7PA 4ER5A 3EXAA 4FNGA 1RACA 3S1AA 2JGAA 1IG3A 5JJBA 3Q2KA 4YUAA 3FNQA 5F76A 1Q92A 5E0OA 3WV5A 1T1SA 2Q7XA 1GPJA 1VBKA 3THWB 1UPAA 3LE8A 3NFYA 3NTVA 1KR2A 4NJEB 5BQXA 5C18A 4NZPA 1RAHA 2BOVA 4UASA 4C1BA 4BO8A 4C3VA 2C1EA 4ENQA 1VE5A 4CV1A 1F5NA 1B6GA 1BSVA 1M2WA 4MTCA 1T9GR 4IVRA 5KYVA 1POWA 1M6HA 4D79A 3A1SA 4N7MA 1UBMS 3L8FA 4YP1A 5TT0A 4PRZA 3FYDA 4C89A 2IXEA 1H0SA 3A26A 2QUIA 4LYAA 1CQJA 2BGGA 2X9GA 1GJRA 3FRIA 4FFRA 4RF2A 2NM0A 4Q7EA 5DHTA 1PFYA 1T4CB 3RVBA 3WQSB 5IKMA 2BUCA 5ECDA 2Y1DA 4DLWA 1FFXA 3AI2A 1C9MA 4K6KA 2BZSA 3AUAA 3GBPA 1ZK4A 2FUEA 4V0SA 4WNCA 1WP9A 5AFSA 5KBYA 3BL8A 4DAOA 4KR0A 4EHDA 1U0TA 1RLMA 3F67A 3T7JA 3ZE9A 1GRQA 1VLZA 3NBYC 2ZTLA 4M1KA 4AFNA 4OQNA 4E2XA 5EJAA 2BHNA 4B83A 1DCTA 3B9RA 1L5HB 4URZR 1VYVA 1UT5A 3KQKA 1WHSA 2QVYX 4XXHA 4AWXA 2A84A 1KOFA 4C9BA 2AL7A 2H2IA 2NYAA 2G9RA 1Z28A 3WICA 1UMBB 2W11A 2I4RA 3E9ZA 4UHEA 3CNOA 1G63A 4X45A 5CTJA 5IT4A 1QIFA 2WM9B 3CLHA 1OZ0A 2P2ZA 3R74A 2FEKA 1Q6ZA 1FJ2A 1KZ4A 2BPOA 3UCXA 2X8LA 1BOOA 2DCMA 5DLYA 4F5YA 1ZUD1 3I9OA 3TSOA 2ZG6A 3QLTA 1NA5A 3F3YA 2ZRGA 2VA8A 1P9LA 5HUHA 1A8HA 4D45A 2CVFA 2HL6A 1PZXA 3CZQA 2HQBA 3TG2A 1PZMA 3GMTA 1ULSA 2VJKA 2EKZA 4E1BA 2HW8A 3ASYA 2ZAYA 1K3UB 2H4WA 4GOLD 1U2SA 4QELA 5CX4A 4D4LA 1XVAA 4PHHA 5HF9A 4RK5A 1V8FA 4LOKA 3Q5DA 4QT4A 1G98A 3NGMA 3TR5A 3AG5A 4MHSA 4NBLA 2D59A 5ED0A 3GLFE 4B6OA 4GZ3A 1Y89A 2X5OA 2ZXFA 1GILA 2FFQA 2PWYA 4DMLA 3I23A 2GTPA 2KI5A 3LW7A 1CS0A 3IQDB 5EXXA 4O4LB 2B34A 2HV8A 4DR1B 1LW6E 1W1UA 4JSTA 4TMXA 4XCQA 1C1HA 1NW6A 4YMLA 4HS4A 3D4LA 4RHTA 3ESXA 4WUTA 2LWIA 5T6BA 5K0LA 1J5EB 4FB4A 1JUDA 4QU9A 2YOGA 2HF7A 5JXHA 3MGAA 1XZPA 4KI0A 1PR6A 3WE7A 4LA4A 3WBKA 5FV4A 1E5LA 5BSEA 5BWOA 3HDHA 2YFYA 2P5UA 1W1IA 2J5QA 2CLOB 2JAXA 3C14C 3WC4A 4GNRA 4E5KA 3UAXA 1GKUB 3A3YA 3WO0A 2AF3C 1GT6A 1QR2A 3NRBA 5J58A 4HDCA 4BNDB 5IVKA 3M3HA 2CLDX 4GO1A 1SU6A 4OLHA 3ZE0B 1UEIA 3GW8A 3JWEA 1ADBA 2WF5A 2I1QA 1K97A 3D6NB 3OSUA 4KIUA 1LQ2A 4ON9A 4X91A 1M2HA 2B2NA 2HHAA 4R8RA 4BZPA 3SXUA 2NW6A 2FMIA 5C5IA 2GF0A 1A5BB 5TS2A 2Q5OA 1Y3DE 5EVCA 1P1FA 4DCNA 3EG5A 1SOAA 4YACA 1U1CA 1RYNA 4QWWA 3OPYI 1IZ9A 4MWTA 2EGGA 2HU8A 2EOAA 3JY6A 4CR6A 4IKOA 1CEXA 4CEJB 3I42A 2KB0A 5JRZA 2MT9A 3FDFA 4FZRA 5SZKB 5A6VA 2OHGA 1FS6A 1Z4PX 3CWZA 5DN6A 3W1WA 4R16A 4D0LB 1F2TB 2IPXA 4QYIA 4QSHA 4CMIB 2EERA 1SPXA 5FTLA 1T15A 4A8JC 5TQJA 1YUNA 2P3QA 3QEJA 4IUCS 1DB3A 3GN1A 1DRWA 1GTMA 1GDHA 1RBYA 1THZA 2C3OA 1CR4A 2HBZA 2RJNA 3BXFA 3E1KA 3LO5A 4B3HA 5AIBA 3LLUA 1C7RA 3NHMA 3ZZNA 4EB3A 4B76A 1Q17A 4ZVSA 4H3HB 3UMRA 5FTKA 4N54A 3MQ2A 4TVKA 4Y98A 5JZOA 3HR4A 4HXYA 4JKIA 5HYVA 4GP7A 3IT2A 1R0XA 3BG5A 2QR2A 1UKCA 4ZVVA 3SC4A 5CB4F 3G9XA 5I7HA 2Z3ZA 3AQ4A 2FHPA 4E4YA 4JI6B 4PS1A 4XQCA 2DEUA 3IH5A 1X8KA 1JLLA 1SOWA 5EESA 4ERNA 3QLVA 1FTNA 2OD2A 1GN9A 5LN1A 2G3YA 1H2WA 3DAHA 1QTQA 3IULA 4QGFA 3O1IC 3O2NA 2WFLA 2IS2A 2DUMA 4UOEA 1CZOA 1UANA 1Z0AA 1NMXA 3OX4A 2GBGA 2XYHA 2YYYA 4MHOA 3ZKWA 3TKLA 4DABA 4HS9A 5KEIA 1KEUA 4YRPA 3TOVA 5DX1A 1UJ6A 3JQ9A 4CR8A 5M29A 3PF8A 3TD9A 2XZLA 1SWVA 3Q7TA 5HR5A 4O59O 1XJ5A 1Y3FE 3BGDA 1QO0D 1DG1G 4WJKB 3RVNA 1TK9A 2YJTD 3IJPA 1QHHB 3SWWA 1U7PA 3JD1A 3ZGVA 1UQUA 3H4MA 1P4HA 1G8KA 4KVFA 4LTNA 5DP1A 2C8LA 3KSUA 3FA2A 4LVNA 5AJYA 5EIFA 4CV2A 1QIKA 1BU5A 2HO4A 5E9JA 5AHXA 4CKWA 4BFWA 3CLSC 3FF1A 4DV6B 2W4IA 2C7PA 1AH2A 1TT5A 2P9EA 3QLJA 2ZYDA 1AN0A 2E1PA 1VYUA 1GAQA 5DOZA 4R8KA 2ZKIA 3HSYA 4GBED 1H4SA 4IWXA 1E3TA 1DIAA 3LKZA 4MW6A 4P3NA 4G0PA 2FPSA 3S1AB 3WMGA 5CLIA 5TLSA 1M0SA 4WHMA 1SVOA 1WBDA 1NXWA 1OQAA 2DF8A 4RHCA 4IDQA 4IXDA 4OP2A 4UBNA 5AHKA 5EINA 4Y67A 4I0WB 3DP9A 4UJ5A 5DYNA 4A8JA 3SQLA 5D87A 4Z2AA 4NE7A 1C41A 4JJ7A 2P8SA 2BGNA 1MDFA 2FH5B 3AEKA 2YV4A 4TLAA 1RZUA 1RLJA 1EWRA 2TMKA 4TLCA 2ODWA 2WYOA 4FINA 4RVDA 3W5UA 4MPTA 2YXBA 5IT5A 3W5BA 1XTVA 4C7XA 2QIPA 3EUWA 2JG3A 1AUVA 1Y8AA 1UXOA 1VDMA 5KMGA 3AXTA 4G01B 4R2HA 4EFKA 2TMYA 4EENA 3OMLA 4G5YA 4S1TA 2B1IA 2ZBVA 4OFZA 1QC5A 1DS6A 2IDKA 4U0KA 4X61A 4BJ6A 5CITA 4GP6A 1G18A 2F3PA 5CB4A 2JIZD 3WAGA 2HPZA 4LJ8A 2CKMA 1LBHA 1E1CB 1FFXB 2AJTA 2HIHA 3AVPA 3TMAA 3IR5A 2IWHA 3WBFA 2RIRA 2ZYAA 4G4SP 4WY2A 4B32A 3C15C 1S01A 2Q3FA 3DMFA 3UPDA 5IASA 1FVXA 4V02A 1OJ7A 1T5TA 4Y2RA 1PR1A 1CERA 3KZNA 3M6IA 5HGJA 3DH0A 4QEZA 3DV0B 3NT5A 4WCFC 3OZCA 2QN1A 4GZ5A 4I6GA 1WHSB 1Y3BE 2CMDA 2GHQA 4D3DA 3K9QO 5B5SA 3RI3A 1IIBA 1OTXA 1T9KA 2G1PA 4QBHA 4TS3A 2GTIA 4GLFA 1JGTA 2B4AA 3DZBA 2WBLC 5E7JA 1XBTA 1D2HA 3R76A 1PJCA 2OV4A 3L0IB 3CH5A 4ZQIA 3MZ0A 3MTBA 4KRGA 5T3UA 2UYGA 3RSOA 1A82A 2CCGA 1S9DA 1MG5A 4F3CA 3QEMB 4PZDA 4C6HA 3E9YA 6PFKA 1YMVA 5BSFA 1RI1A 1W581 1G7TA 2IFTA 2YHBA 2ZI7A 4NXNB 4JI4B 1Z15A 1BAPA 4KJXA 1QDUA 2G6BA 3N05A 2EFCB 1PV2A 5AYVA 1YB7A 1RP1A 3WQHA 1ZESA 1TYDE 1ORHA 4UM7A 3ZZUA 2CSXA 3ZIUA 5KTTA 4DSUA 1XCBA 4GNKA 1F48A 4OU4A 1GRRA 5F4BA 1M5UA 1KEWA 2C2GA 3X43A 2VXBA 4CM7A 2VDJA 3CF4A 2RGAA 4RGBA 4Z4FA 1ORRA 3NVAA 1U2DC 1LSJA 3EQ2A 1FW6A 3JWIA 4AN0A 1KDTA 1CS0B 4NJMA 4YMHA 5CJ2A 2Q2OA 4O2BF 4ZV4A 5G1OA 3UMYA 3COWA 5C46F 2ID9A 1NQ5A 2WLSA 3EA5A 4Q7KA 3JQRA 3HK2A 4UMEA 4F92B 2WJWA 4R0MA 1RXVA 1SB8A 3L7YA 3LLVA 1VYHA 1EK2A 4WKCA 5BW4A 4QDXA 1IBMB 1B00A 1YZQA 4G2NA 2AMJA 3MJFA 4OXNA 2FJUA 1ZD9A 5MGBA 1D5CA 2AC7A 3H2ZA 1YBFA 1Y1QA 1Z17A 1ZITA 1G7RA 2IVZA 1JJAA 2AKYA 1LRJA 1FDTA 1NRIA 3I1JA 4ZU3A 4WCFA 2GZ3A 1GL6A 2A7XA 4EF5A 5IVPA 1TLTA 2QE6A 3SNKA 4ZI3A 1KERA 1N8KA 1C50A 3PFFA 3Q10A 2W6JA 5KTKA 3AFGA 2BJVA 3QOFA 3SEFA 1GZ4A 1NVGA 1XDUA 2GQ0A 3UC9A 5IFKA 4PZ0A 2V8BA 3TRHA 3NX4A 3MF4A 4BQSA 4KIFA 3DDWA 4CR7A 1W85A 3IELA 2FJPA 1VMIA 3AQIA 4RWEA 2PWPA 5I01A 3LVQE 3U56A 3M6MD 4HAYA 1IVSA 2YX1A 4LF9B 4RA9B 2BGJA 2HJGA 3UG6A 4QC2A 4EI2A 1KO8A 3P9RA 4CT0A 5KNDD 1HXHA 3K5PA 1HT0A 4QYIB 1JDJA 1FA9A 5CPBA 1W0JD 1N2BA 2LUOA 1A9SA 3UFBA 3Q7EA 1G21E 4D0NA 1PJZA 3L1JA 4CUKA 4CIDA 4ARZA 1DFHA 4DY6A 1HE4A 1L6RA 3BJRA 3CVUA 3HFRA 2ZYTX 1KP2A 3KXLA 4UULA 4BASA 5H80A 3NDBB 1JXOA 3EA0A 4QM7A 1R4MA 2B25A 4YRJA 1CB7A 1ZN7A 4Y9SA 5DLDA 2JLAA 3CGWA 4KN9S 3U0VA 1WV0A 1U98A 4B6QA 4UNRA 5AM1A 1JAIA 1JLLB 3D3EA 2X86A 3RC9A 3IVRA 3RFXA 2EEZA 2HNAA 3VZRA 3ZVRA 2DY1A 3GNTA 2HV9A 3LY5A 4L3WA 2CK3D 4PYOA 4YASA 4P0QB 3ZWXA 5IJWA 1QNLA 1JALA 2BM0A 1QCZA 2WFLB 2JEOA 2XRFA 1U1GA 4MUJA 3UJHA 1N2OA 4A0FA 4O2BA 2SCUA 4C7JA 5KVSA 3ZKWB 1L5OA 3T0FA 2YY6A 2R96A 3UATA 3ZJUA 3QXCA 3S44A 4Q3KA 2DVMA 4LBYA 3DBIA 3I01A 1BMFD 1UJMA 1XEAA 5B3LA 3ZDEA 4CTNA 1IXKA 2F00A 2WTNA 3PSHA 1BJTA 3QUTA 4HBGA 4NMHA 5E2IA 5JD4A 1NBMD 3ZNQA 4K40A 2CXUA 2A5GA 2RH5A 3GCZA 3IA7A 4HSGA 4DRZA 5HKOA 2ZB4A 1BHJA 1U0EA 2G9UA 3WISA 2WV7A 3D4IA 3QHAA 3QTTA 3VGJA 3HJAA 3JQAA 4LECA 2X0RA 2MSKA 4LF7B 5L6MB 2YDYA 4LVCA 1TT5B 4HDRA 4QLAA 4C30A 3VNAA 3EY9A 5I9LA 1OV4A 2QTZA 3C3PA 3GFBA 4OX9B 2W43A 4IICA 3V1LA 2PTHA 1P6UA 4HNSA 3OEWA 1W46A 4GPEA 4ADSG 3OF2A 4TXNA 4QASA 3QXGA 4AJOA 4JEHA 4HDNA 2FEWB 4MSUA 2PMFA 1T2CA 3T5TA 1L7PA 2PYDA 3JTMA 4WI1A 5EUBA 3RU9A 1IBLB 1E0DA 3FUWA 2HOQA 1N6KA 5LDDC 4I9FA 3G8BA 1GQRA 1P2UA 4I4LA 3ZWPA 2BLNA 5CDUA 3FF4A 3P45A 4CIWA 5C5CA 1XFDA 3DW1X 3RS0A 3O8RA 3KLOA 4CPDA 2H1IA 4EGQA 2J41A 5KMGB 2GN1A 3ADCA 2ZCVA 4FLMA 1OA1A 5U1PA 4DVGA 4KPGA 7ADHA 1GTSA 3IDOA 3GYGA 1QC5B 4YIKA 2PWBA 3G89A 3TLCA 5CB4B 3GGOA 4JBXA 1CUHA 2YWBA 2QL7A 1ZR4A 1C30A 4HYEA 2IHJA 1N6HA 3GFGA 4LOIA 3UIEA 2FSPA 1OC4A 2BTQB 1RRCA 1XZGA 2VT6A 4BVBA 5J5CA 1XRNA 4MDYA 2FX2A 3JAWA 2ZCJA 2VOJA 1Q14A 2J5XA 4QPNA 4B3DA 1FDSA 2WM2A 3DGFC 221PA 2C96A 5EKDA 3BRWD 2BDUA 3JATA 4H15A 3OURA 4NE9A 1BWRA 3Q3CA 4AQYB 1YI0A 4UZEA 2LTAA 3I6MA 4GI3A 4TVSA 4G81A 3CEHA 1RFGE 1Y9DA 3PUXA 3S2YA 3F4BA 5REQA 1RHRA 4M37A 4YDSA 2CC2A 1GSOA 3M6FA 2OQVA 3SR3A 4BKMA 4H7JA 2VT3A 1FOEB 1GPMA 3K8OE 2QAJA 3RUDA 4PCUA 4K9NA 1SKYE 3GK3A 4F4JA 2BM8A 3IIIA 2WFZA 5A71A 4ROSA 1YVUA 4ETNA 1CQIA 3THYA 3I01M 1Q7TA 2Z56A 4UU1A 1IJKA 2P4SA 1KY3A 1PL0A 4NPAA 1JSRA 1NG1A 4FWBA 3TBKA 3Q6NA 2AOTA 1PJ3A 3EXHA 1J9ZA 4R1UA 1R9GA 3ET5A 3DYIA 2AWNA 5JTTA 1N8TA 4TWJA 1JW9B 5E1MA 3ZEIA 3Q3VA 4I3GA 4NMLA 4UQOA 5THKA 3L4KA 2CT8A 3CX4A 4FILA 5LUAA 3HI6A 1U7HA 1U5BA 1NLMA 4DA9A 3GFOA 1KQPA 2CXTA 1T5IA 3EPHA 1JHVA 4WY8A 3I5XA 1ACMA 1AK1A 3F3MA 3L7JA 4OFWA 3WGQA 4DYDA 2XUGA 4OSPA 1DUSA 3QFFA 3SICE 2PRKA 4HF7A 3ASUA 1P1BA 3BN3A 4B5KA 3KQQA 1JFVA 4DSZA 1O8CA 4RAQA 3RAGA 2YNMA 4LQ4A 3W79A 3P97A 2CNOA 1Y9JA 2OBBA 1R6BX 5TC4A 1OZFA 4YMWA 5BV0A 2BTEA 5DE3A 1ULZA 2D4AA 2J3MA 2Q07A 3BL6A 1WCV1 4F12A 2HDWA 1AGPA 5AI0A 4BUZA 5FULA 3ZIAD 4AB1A 1NZJA 3QVTA 1XRPA 1MX9A 4ZTZB 2HHHB 1ZJ5A 2QI9C 5FLKA 1HRKA 3A9CA 1M6VB 3C2QA 1M33A 3O4RA 5ADUS 3UPUA 2NPIA 1X7XB 2J67A 3FVQA 3RUAA 3FMVA 3KT8A 3C3WA 4GD3Q 4WCFB 4I1PA 4Q1AA 4A6PA 4DLLA 5ES4B 3G2IA 1A4IA 1VIDA 4AJ1A 4HOYA 5SICE 3UH0A 4F91B 1H2BA 4QSMA 5J4KA 3D7LA 3C43A 1I80A 1CU1A 1JA1A 2CLCX 4I50F 4KQMA 1QG6A 3T3NA 2YVUA 4ZZ1A 1KZ6A 2WM8A 3BQMB 3P0EA 4NHEA 1TKBA 5EJGA 4L9WA 5JFGA 5CH3A 1J9EA 2IA5A 5CP8A 5BR7A 1GD1O 3AESA 5EGNA 2W2TA 3AWIA 1K8XB 3A70A 4UQLA 3FX2A 3EVNA 4OAOA 3KS9A 4QBFA 3EPLA 1R3DA 2BEJA 2FCRA 3OPQA 1JKMA 1RRPA 1NI4A 2QVGA 3D4PA 4BQOA 1J90A 3HFGA 5K6AA 1XVUA 5TR9A 3T3HA 1K6MA 4BX9A 4RTPA 4OQXA 2WQ6A 4R8SA 3B8HA 1NVBA 1B8UA 1Z6AA 2OBFA 2IHKA 1V25A 4KDCA 5K0NA 3U7QA 3FKSA 3RVJA 5BNZA 4YO7A 3TK1A 1R4MB 2GD1O 3KWMA 2D0OB 3DDCA 3NBZC 3HKBA 5HJ5A 4YXWD 5IRCD 1IB6A 4C2AA 1EVKA 5DXJA 1MMFB 4YV7A 5I8PA 3IHKA 1I7SB 4G0XA 4HB4A 4CIXA 3FPJA 4PFSA 1FLDA 4UW9A 3PWKA 1FU8A 3LUJA 3TW8A 3RAFC 4B8ZA 4K9DA 5DSTA 4PG8A 1AA9A 1GPKA 4OQDA 1XYYA 4TS4A 2WVHA 2P9GA 3BREA 2GAOA 1BDMA 2FN4A 1KMHA 3LPMA 2XH8A 5HMLA 1AQJA 1LK0A 1PAUA 2H57A 4PLPA 5HKAA 2CXOA 4O2BB 2P41A 1L1RA 2ZJFA 4C76A 3RIXA 4EYOA 1JKXA 2J3JA 4KFSA 4F7WA 2GN6A 4WPGA 3X1MA 1JAYA 2W2VA 3AEXA 4GQIA 5BSVA 2QRMA 2XWPA 1H42A 2QR5A 3WS7A 2PEYA 1D1PA 2Q6VA 3V8QA 1ZI6A 1PEYA 4HVTA 3K9FC 3K0FB 4JI0B 1J1UA 3AR6A 4F2PA 1I51A 2DLCX 1GZUA 4FHEA 4LMBA 1LV7A 4U2CA 2X6RA 2NU9A 4H1HA 5FLEX 3NT2A 3WAJA 2Q5LA 1ISIA 1YE8A 1JSLA 3D4OA 1TU4A 5A7FA 1VJ0A 2D1QA 4Y6RA 3AGPA 1XZBA 4N3CA 1U0GA 3R44A 4HDRB 4TXMA 1RQRA 3LVBA 3URKA 2H51A 1OX4A 1A88A 3U19A 4BQRA 2O06A 1VL0A 5JISA 2CV2A 5J63A 2VPXA 4WFQA 2HH9A 5JZSA 2OTCA 4I50A 3AR7A 2ZAOA 4HFJA 1EGQA 2F3RA 5KS2A 4PS0A 2K7ZA 1B42A 2ABWA 1FSSA 4M9RA 4NESA 4HDNB 2AB0A 2BCGY 3CIOA 4YIHA 4I1UA 2FDCA 1QP8A 3SKXA 5K8JB 1QIEA 3DVAA 2P65A 1JQBA 1Y1TA 2IIBA 1WUYA 3ND7A 1ZQ1A 4Q3NA 2NVBA 3O84A 4A8PA 3G0HA 3KELA 5DNDA 1IY8A 3F1LA 1B3BA 4EVIA 1AXEA 1NAHA 3OLCX 2V74B 3ABIA 3RS4A 3UBTA 3EQ9A 5EJ2A 5JDCC 1NE2A 1CNEA 1TJ5A 4QOJA 3ICEA 4L9RA 3P7MA 4Z8XA 3ZWCA 3LF2A 3GDHA 4RKRA 3Q9NA 1H6BA 3OIYA 1FZTA 1FJHA 3NB0A 4JT2A 1SQGA 3D43A 1H3NA 2YFHA 4LK2A 3FCCA 3P9PA 3ROGA 1A96A 4P84A 4ZDKA 1C30B 1I36A 1KJ8A 1SQ6A 1WXQA 3BORA 4IYJA 3WQBA 1K9VF 3EEYA 1P7CA 4PGFA 1VIYA 4M1WA 1IRXA 2Z3WA 1FUIA 3ZDRA 3ZTWA 4DLTA 4JCOA 5DIFA 3K9GA 3LY7A 4DADA 2XMSA 4GZ6A 3O1HB 2NP6A 1N9ZA 3A6HA 1ZZGA 5TS3A 3ONDA 4OA5A 4RVNA 4ITRC 3G1TA 3K96A 5CFPA 1JXQA 1EWVA 4J0KA 5AKHA 1TE2A 2JGLA 1EFUA 1R18A 1V1MB 3G2PA 5C53B 1EXMA 1W75A 1DLJA 2FFAA 3FTFA 2BTOA 4L6CA 1YOVA 2W58A 5DSZA 5DF1A 3L1UA 4RSGA 1M34A 3PXEA 3ZOKA 1XCLA 3FCXA 4MYSA 3VNBA 3KB2A 4WE3A 3ZCPA 2Y9PB 4ZAFA 3VYTB 3HL0A 5HIKA 4WLOA 4YRTA 2ZE6A 1JZQA 2HNKA 3DEZA 4JIGA 4P34A 4Q66C 1W8IA 2B30A 1SCUA 2HSJA 5K8TA 1Z4IA 3THYB 1BWQA 1KRXA 1RHMA 2DPGA 3AL3A 2HRZA 1N2EA 2PT5A 4GX5A 4BLOA 2QJFA 3ER9A 3ZD7A 2BLLA 1BKYA 3AHGA 4LZZA 5IAEA 5HRCA 3BJZA 1ZYUA 2AOTB 3NNDA 2AFRA 3O3MB 4PQFA 3SIXA 3VAAA 1Z9BA 3C1TA 3RKUA 1UZAA 1E63A 3W2EA 2JI4A 4MO2A 1XZEA 3KDAA 4JYBA 1R9MA 4KR9A 4CWAA 5IH7A 1J7KA 5JO0A 3W77A 1Z2PX 1V0JA 1U5BB 3MK31 2MJLA 4ZOCA 1B8OA 1R8YA 1UR5A 2AG1A 3A7EA 1UP6A 3MRVA 4GPZA 4MWZA 1C7ZA 1CR0A 1UPUA 3F9RA 5KAPA 3VSAA 3QELA 3UPTA 3CHYA 2RC5A 3ELYA 1PK8A 1XNHA 2DMRA 2YZ2A 4Q00A 1LJUA 2UKDA 4IWNA 1ZC3A 1BJRE 3PD0A 3AV0B 3KXDA 2WT9A 4A7PA 1KRWA 3SBXA 4IH1A 4NBTA 4OIMA 2IPAB 3GP3A 4IOJA 3T1YB 2UZIR 4EDHA 5CIYA 2Y76A 3WLTA 3LO8A 4XYBA 5JOQA 1ZZEA 4M7RA 4YYEA 3UB2A 1SHUX 1TIKA 3JX9A 4EHAA 1KZGB 1YB4A 2E4YA 3O1JC 3DONA 1M2FA 2UU9B 2V54A 3Q85A 3COSA 3DNPA 2OM2A 4HH0A 4KG7A 3F2VA 4QQFA 3AI7A 3CG4A 2ZBEA 2PXXA 3VSCA 3NIFB 5LPNA 1MT0A 2VHZA 5F2KA 4W7HA 3I64A 1L8OA 1QYXA 1XQYA 2F67A 3FB1A 5DASA 4DDVA 3NKLA 4FXPA 2YOFA 1TQ6A 2A58A 3DBLA 1EHCA 3NTUA 4LOJA 4MR7A 4PYLA 3FWNA 1OWOA 1S8AA 2VCYA 3DTYA 1YHNA 2ZEJA 2VNIA 3W2GA 4XVCA 3AESB 1IDOA 5IJXA 1JE1A 2D7CA 2F90A 2R79A 3O4GA 2O54A 3T7RA 1ZMTA 2ALJA 1NI4B 3PHIA 4J4TA 4XJTA 1EK5A 1SN7A 1U02A 1LPNA 2I9PA 4I55F 3GHYA 4J1QA 3WNBA 3VFDA 3CPHA 2O8FA 1EWQA 4ZC8A 2WKQA 4M22A 3ZWAA 2XRMA 4F3RA 4INZA 1JVBA 1NT2A 1GFZA 1NASA 1T9CA 2HU7A 2QZJA 1QIMA 2X8WA 3CB4A 3H1PA 3HLTA 4KKVA 1OYOA 4N03A 3WXMA 2CL6X 1T6XA 4FC6A 2ODPA 1ESDA 4ND2A 3VPXA 4YAIA 2ZIAA 3CWQA 3HKBB 3DR5A 2BFFB 3GJRA 3M1LA 2AC2A 1F12A 4C0JA 2L69A 4JASB 2O5RA 4TLDA 3TW8B 4WQMA 2Y27A 3FBWA 3JRWA 1D6SA 3VHXA 2ZPTX 3QUQA 3ESDA 4PGAA 3AR5A 1EP3B 4S2EA 4BGIA 4BV8A 4F4UA 3KDPA 3WADA 1KMHB 4LXTA 2VTBB 1Q44A 3NEAA 5L9AA 2IYXA 5IAGA 3I5YA 4QX6A 2YYSA 1YCGA 4KGXA 1HRDA 1KVTA 2JF0A 2JLSA 4E4TA 2F3QA 1O9GA 3K1TA 1FPQA 1Y8CA 2QZSA 1R0ZA 2H65A 4W5OA 1N6IA 3BXPA 4Y2TA 5DNAA 5F12A 4C5CA 4DC0A 2H59A 2ZI9A 2QSZA 3I39X 4J0EA 3NRJA 1E3EA 2I66A 1N1DA 3Q15C 4LXQA 1X1RA 3IXQA 5E2BA 4MVJF 1LBIA 2HFJA 3AO0B 1MLDA 3OWHA 4OYHA 4LGVA 3BVPA 2PL9A 5IARA 2NU9B 3USCS 2YZ7A 2HK6A 1TD1A 3FKJA 2A9KA 4NDAA 4ZN6A 3RADC 2BHSA 2TRSB 1N6NA 3EIWA 3C3YA 3ZE1B 1MFPA 2YR0A 1GG2A 4RHUA 1OX4B 4HWOA 4BFLA 1N2IA 1T5SA 4A27A 5EAIA 4F2HA 1LZKA 1PT5A 3NAZA 3LQYA 5BW6B 1ACJA 4I50B 2ZT7A 4M87A 1QV6A 1T1GA 1DOHA 1ISSA 3EDOA 4R0NA 4FN4A 1G2QA 3ZDXB 3LZCA 5EMNA 3WKAA 2M6SA 2PAFA 5F2NA 1HEUA 2ISQA 3KJXA 4L73A 4DN6A 3U7JA 1IC6A 3M81A 4LXIA 3LCVB 4I5GA 3JV7A 5LB4A 3DVAB 3KE8A 4GOMD 3CLUD 1NWCA 3VZDA 3LKDA 4IQGA 1U4NA 2O6LA 3KBOA 2WE7A 3A4NA 3LT0A 2IHUA 2AXPA 2ONYA 1GAJA 2RHGB 4DFDA 3T3OA 1Q7RA 3NM4A 4I55A 4ZOEA 3WGNA 3WL7A 3QFCA 1H8ED 3HJFA 3CM0A 1CDOA 2NXEA 3VPSA 1N75A 2J32A 3W1VA 1QTIA 1P3DA 2RJ3A 4LFCB 2BF7A 3L92A 1C4WA 3DJFA 1GKYA 2EFEB 3G2QA 4WKOA 5A9RA 1APBA 1YMUA 4PF1A 3L1IA 5I8WA 1JNYA 2PRSA 1YF3A 2G72A 4U3JA 3P9SA 3GZTB 5IVHA 3Q87B 5CGQB 3JARB 3R6DA 4O25A 4ZO6A 3DOHA 3WTBA 5EZQA 1EDOA 1DDGA 2YS7A 5C8ZA 4JBIA 3UHOA 1X14A 2O2CA 4I19A 1G7CA 1P17A 2IH2A 3FFWA 4LDNA 1Q57A 2G6TA 4IVQA 4CQLA 3IAAA 1AA6A 1ZIXA 1DO8A 1CUXA 1HDIA 4HZUA 3WHIA 1T4DA 3CLRC 4YTEA 2XKJE 1UODA 4PCLA 3I62A 1Q83A 4X0EA 5IVDA 3VR2A 3U3OA 2YMQA 1T13A 1T34A 2BI8A 4YRLA 2GHRA 1EG7A 1VE9A 4UAUA 3P4XA 1ZFNA 2VJOA 4GS5A 5ERYA 1Q15A 3I9KA 3KFVA 3SI7A 3I8SA 2V7VA 1GGHA 1YOVB 4OHYA 1ZMOA 4X7RA 1NUQA 4YCCA 1N0VC 1QZXA 5FUVA 1PN3A 1M34B 3DFIA 5GJVC 2Z5VA 2OZEA 1SBYA 4MVJA 3EGDA 4J49A 3SXPA 3E4DA 1TAGA 1TA9A 1UPXA 3I9JA 5K0SA 2AYXA 1HTBA 1P7VA 4BIMA 1OLSB 3QUBA 4OBXA 2VLIA 5K1ZA 3S2SA 3KQTA 4TWAA 4LQLA 4M60A 3V80A 2PRZA 1FEZA 4RYLA 5GY7A 4EJ6A 5HF8A 3PHBE 3WBBA 1F0YA 6REQB 2NSLA 4YO8A 2C9CA 2OHFA 5B1HA 4NU8X 4R8VA 1DP4A 2QMHA 3QV1A 4II2A 1SB9A 3WB9A 4PVDA 1WD5A 2GYWA 4UVEA 3N59A 4WY5A 1GITA 3ZNNA 2XI4A 4HKTA 5T8KC 2O1EA 3S2IA 2LV8A 3ROZA 4HPWA 4R7GA 3E58A 4G8JA 4BGEA 3DCJA 2VDNB 1XQ9A 1W5TA 1ORWA 4UDOA 1ADFA 3SBDA 1CY4A 1YASA 1XOIA 3QELB 4N39A 4QODA 2X3UA 1FUYB 2B1QA 2PRIA 2JFOA 2BH9A 1NZDA 2ORED 5FIUA 3ER6A 1PJTA 4N40A 4JHLA 5EGSA 5EA2A 3W2FA 2J3QA 1LNZA 3BF8A 4IO0A 3C5HA 1NJ8A 3JAKB 4F84A 3B38A 4HP8A 1YDHA 5KSOA 3AEUA 1W34A 2ADFA 3LQ1A 1Q0RA 1VG0B 3O8NA 4JT8A 1CCWA 3V4OA 3RSSA 3CH6A 3PQ8A 4B7ZA 3SHVA 3PNPA 1OF1A 4OKNA 2VYVD 2JASA 4AG6A 4AJEA 2OILA 1XPUA 2IEBA 4K9PA 3O0DA 2EYUA 1KO1A 2FDRA 3B7WA 5HQJA 5BT9A 3T5AA 5KQPA 2WG0A 1QQBA 3MLBA 4K6HA 1F2VA 1X7HA 1YZLA 2EW8A 4ALKA 3FNEA 3MGBA 1Q5PA 4UNQA 3R4VA 5IDVA 1JJVA 1ZM3A 3K3PA 4YEDA 1C1YA 2WDPA 3RU7A 5LZ8A 3QU4A 3PC8C 3SJ7A 4DBLE 2E85A 4ZO7A 1SMKA 2Y2UA 4EA8A 4OF4A 3W7AA 2FCAA 4TYPA 2XWBF 3NUGA 4IV8A 3D4NA 4XQGA 1D2NA 4ZMBA 1ZMBA 3K1YA 3ONNA 2NZJA 1E58A 2ADOA 2X2EA 3HB5X 4TL8A 3ZUPA 2YJGA 3PEWA 2IF0A 1QORA 2ZIGA 5AW6A 4BFXA 1MTZA 3NHYA 4O4JF 4OCZA 2EZ8A 4KWIA 5JFTA 3IOYA 1MX5A 1VB3A 3UICA 4QQ8A 3QEAZ 4OMFG 2ZXUA 3PP8A 2M6KA 1PL7A 4QULA 1ABEA 2BR4A 4UC0A 2PX5A 5FOVA 2C4NA 4Y18A 3CNLA 2ZR8A 4J9VA 4RZQA 2AN4A 1Y4ZA 2J30A 3QMVA 2IV2X 4WEQA 3UYKA 3NOOA 1B41A 2PZKA 4AO6A 4MVJM 1B23P 1YR6A 1KYQA 1GQ2A 2ZLBA 3PDHA 3VHXB 3IAXA 3FTDA 5K51A 3DEKA 1COWA 3RUIA 1J06A 2H7VA 4IZHA 1K68A 1P4RA 1UC8A 3AETB 4HDMA 2QD1A 4MOWA 4N7RA 3RC3A 3V1MA 2PV7A 1JDPA 2FG6C 2IYWA 4Y2GA 4I8IA 3MJHA 4Y6PA 5EJIA 4D9JA 4F9GA 1E9CA 4NCBA 3M2PA 3RJMA 2EU8A 4RHYA 1PIWA 2FA9A 3HB1A 5FTWA 3U13A 4AZ3A 2ISCA 5GAJA 1E92A 4F5DA 3WA7A 3QE3A 5HHTA 3IILA 4JQOA 5CJJA 5AOVA 1TIPA 2R751 5GGYA 4EZIA 2GEUA 3EXFA 3FDZA 3STWA 1Z4JA 3PC4A 4UDNA 1G3UA 1N2CA 5I4IA 2AUNA 4Q39A 4IDPA 1ZCJA 1U28C 2DLDA 3DL0A 2YXNA 1XEFA 4RFVA 4RTLA 5A1JA 2QTHA 4LOHA 3SX2A 1R6AA 4BCBA 1WXWA 2CUZA 1MQ8B 2CXNA 3HNPA 4MB2A 5JHHB 3WIOA 1LK5A 2IOFA 3ZH2A 2W6IA 4IFIA 3ZXYA 5AW1A 3HBLA 4G3XA 4ZYYA 2GN9A 3FLMA 3K6JA 4RPHA 3H2YA 1KS2A 3LCCA 4KHZA 1PO7A 3ZV3A 4RELA 2H85A 4XIFA 3MS2A 5G0SA 3P2JA 1HMPA 4OHWA 1P45A 4U2KA 4JJGA 3EFHA 3K0KA 4TMKA 3ZCQA 4B6SA 3B7GA 2AEJA 3AFNA 3HEAA 4E5VA 2AEEA 5KC9A 2AGVA 5FLYA 3VYWA 1R8QA 2X9LA 2ZB2A 4O8CA 3AVYA 3NBMA 4DUGA 3HM9A 3B9QA 4W5NA 1A77A 4A2WA 1ZH8A 4LPKA 1LDBA 3LRXA 1TUIA 4B3SB 2ACKA 2G0AA 4O1MA 1ZO8A 1RZRD 3G8AA 2BI7A 3DA8A 4O4JA 4ES6A 1BXZA 2GA8A 4OTZA 2C4KA 4O0MA 3L82B 5JMOA 2I2FA 5KPJA 1Z16A 2R6AA 1T2VA 3IIKA 4FKBA 3HJNA 3L4SO 4RIIA 4U3JB 2I6QA 1UCFA 3BEDA 1Z0SA 2EG9A 4NMWA 5CJPA 1ZDMA 4CZ2A 4MHTA 1V3QE 3JD4A 3G8DA 2XE4A 4K9SA 3REFA 3SZ3A 3C45A 4BP8A 4XARA 1QCCA 1WV1A 4WBXC 5A7GA 2F62A 4L4XA 4MW2A 2PZBA 1KA9H 2GH1A 2V58A 4JKOA 1NKTA 1KSHA 3GNQA 2VRCD 3TNYA 4MUYA 2E37A 1WP4A 3HA7A 2ISSD 3LQRA 4HZUB 4XVQA 1IN8A 2JS7A 1CQWA 3TR0A 4F2WA 1H0HA 2CBZA 4JL5A 4P3XA 5DFAA 2GZSA 1B8VA 5ALSA 1L5NA 3U7EB 3VR4D 4C3UA 4TSRA 4E5YA 4EW6A 1UBCA 2QG9A 1DKPA 3PI7A 5KC8A 1UQRA 3LUAA 3QYPA 4QOIA 2IJGX 3NC4A 4ZT7A 3GMSA 1J9GA 1L5RA 2C78A 5LQSA 2C8KA 1SKQA 5T3YA 3RDPA 4NVRA 4BMCA 4ZK6A 5D1NA 1KDRA 3R7DA 4DYHA 1GCOA 2QLJA 2VYFA 1GYQA 1ARZA 1RKQA 3EGXA 3EGDB 1SBTA 1Z6YA 2K5UA 3U4IA 4Q15A 1VQ1A 1QH1A 3RS5A 3TAXA 1YJXA 5JI2E 3MYRA 2QX7A 4BGVA 1VPEA 3E5MA 1HI9A 1NTRA 4H16A 3Q8KA 3SVLA 1P61B 3JSXA 2GM4A 3IR7A 3RUPA 3BFJA 3ZQJA 4GEKA 4KL8S 1QG2A 3EG9A 5KWSA 1KJ9A 5JNTA 3AMVA 3GRCA 2QX9A 3KK0A 4I9GA 4DR3B 2YVAA 4WBSA 5C35A 1PUJA 1WUJS 2MR6A 1FDOA 1NI5A 1ZMXA 2B2XA 1DHTA 3KIPA 4BQIA 3AVVA 4LSMA 5CM9C 3EXEA 1YO6A 1X0XA 1DCMA 2C03A 4DEXA 4L5CA 4KHPB 4M0DA 1ZAYA 4YCLA 4UATA 4UVHA 3THXA 3N3BC 4ZV7A 2HREA 3ISVA 3P0RA 4PANA 3SEQA 1ZRSA 3N7UA 4U2BA 3UJAA 5FUQA 1N6PA 3DMTC 4IPTA 4DLPA 4WUVA 5DPMA 4NG4A 4TSKA 4COKA 3KOWA 4X97A 3M34A 3FWPA 2DXIA 4C4SA 3IQZA 6LDHA 2D0PB 3GFQA 2DR0A 2GK3A 3AEUB 4RX1A 3L8CA 3DE6X 4JJFA 1HR0B 5KVAA 4P98A 1VL2A 3T3MB 1Q21A 2XE6A 5HCUA 1QQ6A 2FVYA 3BD9A 1GGVA 3DW3X 4II7A 1ADGA 4B7AA 3BHMA 1NVVR 3WRVA 1J2JA 2FEAA 2QTCA 2WZDA 3G5UA 4KLRA 4CQMB 1N2ZA 5JZBA 1BVRA 4Y0NA 2HGSA 3ESAA 4YJ3B 3VZCA 1LWOA 3E7DA 1NP7A 3IP8A 1RAAA 4WLNA 3FPKA 3W1EA 1C9DB 1H2EA 1KBOA 1TO1E 3WLAA 2C0CA 2CKDA 1ATIA 2Q3HA 1XMVA 4FXOA 1YVPA 2QM8A 4TVBA 2VQEB 1U9IC 2F8MA 1NHGA 3MSCA 3R40A 4U8GA 4E5UA 2ECQA 2FEXA 2O0LA 3EULA 3UOWA 4B8YA 4L4SA 2YJZA 1HDEA 2PX0A 1CLEA 3DB1A 4MIOA 5LBTA 1HYHA 3TX6A 1V26A 1EWTA 4L5IA 4E03A 1C8BA 2VDWB 2JPDA 1ZK3A 2JI6A 2R97A 4U6QA 4DV7B 3VJLA 4AM8A 3OJLA 3TFOA 4LX0A 4FR0A 3KT6A 4GUAA 1K5DA 1LC0A 3MT8A 1WKBA 3FCOA 3H5AA 4QUBA 1BCRB 4LUCA 4D74A 1N0IA 3IJEB 4UTOA 1HLPA 2PMCA 3T1HB 1IEVA 1I7LA 3VO9A 1JIJA 1B1CA 3LA8A 3PGKA 4L8FA 3NIWA 4LZPA 4AJLA 3L7KA 3OD1A 2ZYUX 1GZVA 3B1VA 1YD7A 4LJ4A 4AULA 1LKZA 2BBSA 2V9PA 3AJ8A 4EHKA 1QPZA 1VIVA 5BO5A 1D1TA 1W4LA 2GMWA 2PZLA 5DX8A 1ESCA 4BV3A 4KDFA 1K7XB 2O50A 2E48A 3ORYA 2BH2A 1JTVA 1JQ5A 2H2WA 5DGXA 5DNWA 1W36D 1IQ0A 1GTL1 3HN2A 3AM5A 3TLYA 4M0FA 3DFMA 4JODA 4X44A 1TQ2A 1USGA 2JZOA 4KXNA 2O0KA 1EX9A 2GJKA 4JU8A 1CUBA 1TCAA 4G1EB 3WRXC 2QL5A 4HSEA 5FYQA 4TKMA 5KHAA 4Z53A 3N6VA 1YS1X 2BEVB 3ZU4A 4AZ3B 4Q01A 1D9ZA 2ECKA 1U65A 2DZDA 4Q3LA 2RI6A 1K5PA 4R0VA 4ZAYA 5F2OA 3EXFB 4C4YA 1E9VA 1OXBB 2ZUFA 2I3ZA 2VPTA 2JAHA 4RJTA 5ALEA 2Z08A 4K3VA 4WH0A 3RVOA 1ESEA 4AJNA 4JJKA 2BEWA 1CEQA 3H5RA 5DCYA 3CRVA 4UQPA 5J5AA 1NVFA 4NX2A 4EFNA 2XWJI 3DLHA 3N76A 2O8BB 3V42A 1FZQA 1PR5A 4JR2A 1MPTA 2B4RO 2P9HA 1U9IA 1KJIA 1RYZA 2ZUWA 1B8NA 2XT6A 4D3YA 5C8YF 1GZHB 5C1DA 4AQDA 1PP4A 3OE4A 3U7RA 3KVYA 4WOBA 4MQLA 3PDJA 1L4BA 3SQDA 1U3UA 1K8ZB 1GFSA 1U7TA 2OGTA 1BTOA 3H86A 4IV5A 4V38A 3WLFA 5WRFA 2B20A 2H1WA 1G4UR 1ELOA 1PWZA 4BMOB 3VYSB 1Y1LA 2RGEA 3IMGA 3VU3A 3FWYA 1R6TA 4AKIA 4AX8A 5HIJA 4EQ6A 2V6GA 3IRVA 4NQRA 2O8NA 2WHPA 3QOWA 3ROXA 2V1XA 2CV1A 2OLKA 3P0HA 4YAGA 1FDIA 2PT6A 1LRLA 1FS4A 1KDZA 3UH1A 5DYIA 5GM2A 4XFKA 5AW7A 2J7PD 2OXIA 4O4JB 3X2EA 2XEXA 2YJ6A 4RC9A 1YA6A 3OP4A 4G56A 4DM7A 2UYQA 3FFBA 4L5AA 1FP1D 3R3XA 4YECA 5EP1A 1ZICA 5ER9A 4JFAA 5JLJA 2PAAA 3P9KA 2J9GA 3HNOA 2YIDA 3LBAA 3OU2A 5DW3A 5DWVA 2WPDA 4REOA 3NHAA 3T7CA 4BNLA 1D03A 3FOBA 3G82C 3GL9A 4N0DA 2Q4TA 4EB6A 1CJBA 2J3IA 3H2SA 1RQXA 2H16A 4PIVA 1M1UA 1XVTA 3NWPA 1DAEA 4UDYX 3WRXA 1U7DA 4N5HX 5C34B 3ZN2A 2IT1A 4YCSA 3NIDB 1R12A 4FOOA 4L02A 2NO5A 4ZEWA 2D2IA 1OBFO 2C5AA 5BSUA 1SZPA 2JZCA 3OEHA 3CE9A 3DAYA 4IOKA 4MDEA 3K09A 4BUCA 5ICSA 4J3JA 5CT8A 3WO1A 3CH4B 1B2RA 4NONA 1AGYA 3G1UA 3CO5A 3ZJ5A 1QHFA 1AT1A 2V7TA 4ALNA 5EIEA 4HO1X 5F9HA 1KNXA 1L4UA 2G1AA 5CIWA 3D2LA 3QENA 3TXXA 1QH1B 3R0JA 4MR8A 3GDFA 2I2XB 3UG7A 2VYNA 4FFPA 2QAIA 4LY6A 5AICA 4ZVNA 3EPRA 3UA3A 3RIGA 3DS8A 4BVAA 5CDTA 5C8YA 1E7WA 3JQBC 4GR5A 1XHEA 3BDAA 1SXGA 1XYGA 3ETLA 4HWGA 5BUQA 3L18A 5LQCA 5DBFA 4HPJB 1PYDA 2CLSA 1D4AA 1RJGA 3BD6A 1JJFA 4OBEA 4OP1A 3TNFA 3WSWA 1QPGA 1VG1A 3H9UA 2B1RA 3KKZA 4L3VA 5EWJB 3H9JA 3EXEB 2QQ0A 3V8RA 3EMDA 3UJNA 3I2JA 1DC3A 3OFJA 1T8TA 3G9TA 2PJUA 2CDCA 1K98A 1QQ7A 2IHBA 1J25A 3E9CA 4H2DA 5B58T 4C7BA 4CTOA 4YT8A 3THXB 3LCUA 1X1SA 3IEUA 2XNJA 4RDCA 2WHYA 1F6BA 2C5LA 3C5VA 4YAJA 5LQUA 1EAYA 1YUBA 5M3BA 3CGGA 3EEIA 3ZYZA 1R0CA 1PQYA 2OBMA 4RZUA 1R0YA 5KWIA 2QXYA 16PKA 3TBHA 2NTJA 2V65A 4ZRNA 3A6EA 4LE1A 2A9OA 1L7RA 5F73A 4C6TB 5KYXA 3TL2A 2XT0A 4ZI7B 1ZVVA 4MVCA 5ALFA 1RSZA 3TRKA 2ZSUA 3I5AA 2FQYA 4HNAB 4ZGGA 3UMCA 1UK8A 4NC9A 2XCUA 2MYUA 3USZA 5HZKA 3SQNA 1D2CA 3N39C 3OE1A 5DMHA 1PJ4A 2Q3EA 3HP7A 2HLPA 1ST3A 3V1NA 3EY4A 1QH9A 1WPGA 1RYHA 3R5TA 4V3BA 3SYKA 1FP2A 2M32A 4MIKA 1FX0A 1RI2A 4XFDA 1DAFA 4NEQA 4P35A 1M72A 3AM3A 2G1JA 2H4HA 3N3AC 1W59A 3NHFA 4FYPA 4NK5A 3TSZA 4DB2A 3VC3A 2QJOA 1ILEA 3F5DA 5FORA 3AR9A 2GM3A 1CY0A 2W2QA 4ZAWA 1FTWA 1WD7A 1VE3A 2XOKD 2ETVA 1ADJA 2UVPA 1AV7A 3CR3C 3JQBA 3R24A 3K05A 3OMXA 1G1MA 5IYZF 2XR1A 3K9CA 2NZWA 2JI8A 2OCXA 3TRJA 4BZZA 3GRUA 5BYBA 4V0MA 2X0EA 1YFJA 3OBIA 5L6LB 3NUQA 3PQ7A 3U62A 1CYEA 3DNMA 4DXHA 2ZSHA 4OU5A 4YWHA 4EL5A 2C31A 4R1QA 2WYHA 3ANTA 4BVEA 4ICIA 3WV4A 3MJVA 1F2UB 3IS3A 2EKQA 2H4ZA 3AHJA 3GC6A 4F3NA 3PWTA 4NPCA 5JS7A 1TJ4A 3RJ5A 4UU0A 2CJXA 5HJ2A 3DDOA 3STVA 1Y81A 2BBTA 1COZA 1DC8A 4C08A 1SUPA 1VPTA 4FMCF 3CISA 1EZZA 3A06A 2AD1A 3ZCXA 5EE3A 3N2KA 4V2IA 3LY8A 2Z6QA 1YI1A 5TQVA 3W8NA 2W4QA 3PUKA 4L57A 2XQGA 2HQ1A 5F9MA 3E82A 4YREA 2M1XA 2WABA 1CZUA 2PXAA 2E82A 3L0SA 2PY6A 3OHSX 2Y1XA 3IESA 1ZISA 4GLOA 5H9WA 3V4RA 1JIIA 2I8AA 2E5LB 2BEWB 3OH8A 5JXGA 2BF4A 1XEWX 4YCMA 1TD9A 1IUPA 4TM7A 1AOXA 3CW9A 4XPZA 4ZD6A 5H4GA 4NBKA 1RLTA 1ZKDA 1UM9B 3ZNOA 1UC4B 2OK8A 2H2DA 1N25A 1XGKA 3C3EA 1DAPA 1RWQA 5LQKA 2HEIA 3AIOA 1SXJC 1GKKA 2FI1A 2WZCA 3D7RA 4PPGA 1WL8A 4AUEA 2JJQA 3KKNA 1B73A 1XQVA 4B6GA 1WXDA 1X74A 1K9SA 1CUSA 1IOLA 2TMGA 4FNOA 3O90A 5EKXA 1RRVA 4CNQA 5CFRA 3IV6A 2YZMA 3INRA 3NPMA 1QVVA 5JRDS 3V4ZA 1T8WA 3GGSA 2BM1A 2GPSA 1X1BA 1YQTA 2BGKA 3ORHA 1PLLA 1RTKA 2DY0A 4H17A 3Q5GA 4TL6A 4IFTA 3JWGA 5JJIA 2BDEA 1XTUA 3BK2A 4D4KA 3EMKA 3HYTA 4B3RB 4Z2YA 3EN0A 1Q11A 2CSUA 4PLWA 1AO3A 2HIMA 2WSMA 3E6AA 1Z07A 3KJNA 2YUTA 3DOCA 3PFKA 5IANA 1BDIA 3QYAA 5BRAA 2PVCA 4RHEA 1RABA 5IYZA 4Q4CA 1RXUA 4WK4B 2WG2A 1V5GA 3I72A 3UWDA 2IX3A 2ZWPA 4AC9A 3EZ7A 1A5ZA 5EIBD 1E2MA 3MT0A 1E1QD 1OKKD 3MD9A 2OD7A 1SULA 4B87A 1JA9A 5FQNA 1JU9A 2JFBA 2DOKA 1TYBE 3QWBA 4EA7A 4EB6B 4R31A 4E2FA 1HFWA 3OU6A 2F1OA 1JLRA 1QRAA 3OX3A 4EKDA 1ZH4A 4G6ZA 1UBLS 1TLFA 3O5AA 3JPYA 4CM9A 1KIAA 1UBTS 2I67A 1C9NA 4EYEA 1NXTA 4B7CA 1BVHA 4GKJB 3WFIA 4BMPB 2L42A 6AT1A 2JLXA 4J76A 4HQRA 3IHLA 4YONB 3CC8A 3UAGA 5C5DA 1I3CA 3EJWA 1CT9A 4M9SA 4X63A 4CHTA 4DC1A 5AUNB 3FHCB 3H9BA 4RZ2A 4AMVA 3RWOA 5IM4F 4MH0R 3WOVA 3H9CA 1RMTA 1P0PA 1VXRA 3OA2A 2II6A 3NXSA 3MXOA 1NPYA 1YWGO 2BC9A 2HRQA 3HJUA 3KPWA 4MGIR 1ISFA