4QRIA

2.35 angstrom resolution crystal structure of hypoxanthine-guanine-xanthine phosphoribosyltransferase from leptospira interrogans serovar copenhageni str. fiocruz l1-130
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
171
structure length
157
Chain Sequence
SDILHPRFSREDISQKVKSLALQISEDYKKLNPIFICVLKGGVYFFTDLTREIPFSVEINFVQARKIELLKDIDIDLSDRHVIIVEDILDTGFTLQYLVRHIFTRNPASLEIVTLLLKEEFPVKYIGWRIPDEFLVGYGLDFDGRYRNLPDIHVLEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 2.35 Angstrom resolution crystal structure of hypoxanthine-guanine-xanthine phosphoribosyltransferase from Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130
rcsb
source organism Leptospira interrogans serovar copenhageni
molecule tags Transferase
molecule keywords Hypoxanthine-guanine-xanthine phosphoribosyltransferase
total genus 45
structure length 157
sequence length 171
chains with identical sequence B
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 2014-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4qriA00
4RQBA 3OZGA 5IAOA 3LPNA 4JITA 4WN3A 1A3CA 5JSQA 1P19A 4M0KA 4QYIB 1DKRA 3MBIA 1ECJA 2H06A 2XBUA 2PRYA 4P81A 2WNSA 4RV4A 5JV5A 4JLSA 2EHJA 2P1ZA 1R3UA 2H08A 4RANA 1A4XA 3LRTA 1JLSA 3ACDA 1FSGA 2JI4A 5ESXA 1O57A 4M0PA 4LZNA 2C4KA 1P4AA 1XZ8A 1TC2A 4TWBA 1VDMA 5BQOA 1BZYA 3N2LA 1A98A 1ECBA 1YFZA 1QB7A 2PRZA 5BSKA 3GGCA 1QK4A 1DKUA 2H07A 1I0LA 4RACA 1I0IA 4F8EA 1QB8A 1G2QA 2AEEA 5E38A 5BRNA 1QK5A 1TC1A 4RHTA 3ACCA 4RHYA 1P17A 4OHCA 1BD3A 1JLRA 4X45A 1V9SA 2DY0A 4Z1OA 4LZAA 3M3HA 1G9SA 3OZFA 3DAHA 4QRIA 4RHUA 4WMLA 5IPFA 1WD5A 1ZN8A 1VSTA 1A96A 1O5OA 3QW4B 2IGBA 5HKLA 3KB8A 2FXVA 1UPUA 3DMPA 3DEZA 4IJQA 4P3KA 3G6WA 4FYMA 4P84A 4ZFNA 4M0UA 1VCHA 2GEBA 1GRVA 2JKYA 3ACBA 4LZOA 4P80A 4RAQA 1ECGA 4RQAA 4RAOA 1G2PA 1U9ZA 1HGXA 1XTTA 1ECCA 1MZVA 3EFHA 1OREA 1AO0A 1U9YA 2PS1A 5KAMA 1A97A 4X44A 1OPRA 4MB6A 1I5EA 1Z7GA 2JBHA 1I13A 1L1RA 1DQNA 2YZKA 1ECFA 2HCRA 2JKZA 1DQPA 1CJBA 4RHXA 3MJDA 4PFQA 1BD4A 4QYIA 1DBRA 5ESWA 3HVUA 4RADA 1A95A 3OHPA 3S5JA 4LYYA 1GPH1 1XTUA 1ZN9A 1ZN7A 1OROA 1PZMA 1QK3A 4P86A 5HIAA 1XTVA 2E55A 1D6NA 3NAGA 1W30A 1P18A 3H83A 4RABA 4P82A 1UFRA 5K51A 1Y0BA 1STOA 1L1QA 4LYGA 5KAPA 1IBSA 1QCDA 4S2UA 1G9TA 3GGJA 5BQPA 1UPFA 4PAWA 1LH0A 1NULA 2VFAA 4KN6A 1QCCA 4P83A 5EUCA 1I14A 1J7JA 3O7MA 1XZNA 1HMPA 3GEPA 1NONA
chains in the Genus database with same CATH superfamily
1H2BA 1X87A 3CXRA 1TIPA 1ENZA 1EWRA 3NGXA 4KAFA 1CHNA 2YN4A 4HAUA 1F38A 2A5FA 4PANA 2WPDA 3RS8A 1NNEA 3BFPA 2GSWA 4KCGA 4ER0A 1ULSA 3Q5EA 4LXTA 1UJ5A 2QY9A 3HP1A 1JKMA 4G5QA 1QRDA 3ZOKA 3OT4A 1L5NA 1QIHA 1Y1PA 4E3WA 2IX9A 2AD5A 4XD7D 2CNWD 3WWCA 5ITZA 4WCDA 1X94A 3D5EA 5E6SB 2PL9A 1T3GA 4HNAA 4PLWA 3V9AA 1C8BA 2BH9A 4AJKA 2OM6A 3NR2A 4TKUB 1XZ8A 1G8SA 1AQJA 3GI1A 4DJAA 4E7PA 5I8WA 3PC6A 5FF9A 2UU9B 3WFJA 4HRVA 5A5FA 3FGPA 2XMQA 1TCUA 1GUDA 1TJNA 4MW7A 3PL1A 2I1QA 4MROA 4MYUA 3THRA 5CTAA 4QBIA 4TQAA 2QN2A 4NVRA 4NJOA 1BE0A 4PX5A 1CQIB 1HEUA 1MC8A 2CJYA 2GS9A 2EZ9A 2B2NA 2WHXA 2ZSJA 5K0ZA 1X1RA 3ACCA 4RLQA 5EQFA 3IP7A 2HA4A 4DSNA 4HEQA 2QLBA 2UVQA 3EIXA 1F3LA 2ZSEA 1T5OA 3KOMA 4IS2A 3WLHA 4CGYA 2JL1A 1CEEA 1W4ZA 3BWYA 1KI1A 5A3QA 3SIWA 1HOXA 1N9GA 3KQYA 1UZUA 1FFSA 3B13B 1ULUA 3IR5A 4TLEA 4W9NC 1HQDA 3FFXA 4FLEA 1EDEA 3RIEA 5BQFA 5IJ9B 2QBYB 5BYKA 1E4EA 1MT3A 2ZJ8A 3R5SA 1UIMA 4XR9A 5KWIA 1AA9A 4D5EA 1TECE 4JXJA 4UDYX 1F0YA 2PSEA 4OP3A 4G23A 4DIMA 3LTNC 4DXHA 2V9CA 4EW2A 4E08A 2C2GA 1T3ZA 3S5UA 1U0HC 2Y66A 2YRFA 2L69A 1Y5NA 3B36A 5J5CA 4US1R 4CF4A 4NXNB 3PUZA 1OI2A 4FHEA 1XA3A 1B00A 1BE6A 4HO1X 5LQJA 5FPQA 2ZRAA 1KOGA 1SXJE 4F5DA 2D2VA 5I48A 4HZGA 3RS0A 1A97A 1FDSA 1YF3A 1SMKA 1XEXA 1GDDA 4MB6A 3GXBA 1NPTO 2H57A 3EQ8A 3DHVA 2TRSB 2Z6AA 1U99A 2VPXA 1U3CA 5CVTA 2CNDA 3ESDA 1VKRA 2ZXFA 3S44A 1ZJWA 5I7WA 3SR4A 3TWOA 1V7ZA 1HZZC 3MRVA 4BBZA 4LWZA 5ERXA 3GHYA 1GG9A 2Q5LA 1RYDA 2G77B 3MAGA 4HGPA 5F5NA 3STHA 3DXYA 3A1SA 4BIMA 1YB2A 3NT5A 4DAEA 1K8QA 3OT1B 4QXMA 3DHYA 3T9CA 2GCNA 4TYWA 2VAMA 2IXAA 3FIUA 8ADHA 2FEKA 4XFDA 4B71A 3L0IB 5KOYA 4PYNA 3OFJA 1GTL1 4DV5B 1CW2B 1Y9JA 2F43B 1Y98A 2ABWA 2GAJA 4X64B 3KCNA 4TN1A 1DAEA 3X1ZA 2OZPA 3ZVRA 4DS3A 1XYYA 3KJEA 3L18A 4JJZA 4DZZA 5J63A 5T64A 1FDVA 2BPOA 5DNYB 4CE6A 1ETHA 3MTBA 5JD3A 2JW5A 2YV3A 3GYGA 5C32A 5JFTA 2PV7A 4TV8B 1FDUA 2O07A 4RGYA 1XV5A 3GJSA 1GUYA 4LAFA 2UYOA 5DNDA 2P2SA 2V4ZA 3W6OA 3ZCTA 4BO5A 3S8YA 4OP2A 3EPHA 3EIFA 1U8FO 4FD2A 1DXOA 2E85A 3S2YA 1LS1A 5BO5A 1SRQA 1Q0SA 4IQ4A 4L27A 3SXJA 1YBAA 4JJ8A 1U02A 2O8NA 1E7SA 2PQMA 2ZSUA 4FYVA 5EQDA 4BN0A 4BCCA 3NNDA 3KOYA 3C45A 1RKXA 1CZNA 2VPYA 3LRTA 5CDYA 3O74A 1Y48E 4MV3A 3IHWA 5ALKA 4RVUA 3HU2A 2C95A 1W52X 2PZFA 4Q7KA 2UVPB 4XAQA 3IT2A 4RLSA 4BTLA 5KNBD 3B3GA 2I6TA 1KK1A 3Q7PA 3DNFA 3I01A 3IR6A 4ZARA 1G41A 1N92A 3HNOA 5CBKA 2EF1A 5HF8A 1U0OC 5JDCC 1F7UA 1CBUA 4UMVA 4RDHA 3TEMA 1GPKA 1PR5A 3MMPA 4I9UA 3CC8A 2XCTB 4RC9A 2BGJA 2ID7A 1YDEA 3PEVA 4WY5A 5EERA 2NPFA 4TRNA 2PLRA 5A1JA 2KQUA 3OE4A 4TKLA 3C1TA 3CF6R 2PWAA 1EUZA 2BV3A 2HL6A 3H9QA 3PQ8A 4Q4CA 4ZZ3A 1I10A 1OXMA 2HPZA 2GJ8A 4JBIA 5A06A 2WUFA 3IPXA 2A0WA 4BCBA 1A4UA 1Q0TA 1CUGA 4UULA 3Q4GA 1FNDA 1GUFA 3HJAA 3WWYA 3C97A 4GZ6A 4LRSB 1QZ3A 1XTSA 3IPLA 2VWPA 4OXRA 1YDMA 4WLFA 5T4FA 3AUJB 4MPDA 4I1YA 1IYZA 2BBOA 4KWEA 4JP8A 3SQMA 5BNTA 4K86A 2GEDA 4GBGA 1QHFA 4C6HA 1G6HA 3U4DA 4WXEA 1GQRA 3QU4A 1Z6TA 4HTAA 4TQ9A 4YJHB 4YMIA 5HZMA 4ND8B 1DP4A 1F9AA 3CCFA 4B35A 2EERA 3IVMA 1XC7A 4HH3C 4HZUA 4LDPA 3QY0A 4ON9A 4P80A 3PQ7A 2AK2A 2DBYA 2I1VB 3TS1A 7MDHA 3RSQA 2BF7A 1FPMA 1GLVA 1XF9A 4M55A 2ZPTX 2HSWA 1B76A 5ALZA 2OWDA 5ES3A 2B1QA 2V45A 1FTWA 4KQKA 4Q3NA 2PBFA 3ETEA 4HS4A 5AUNB 1Q0UA 1V4BA 3DQZA 3PVCA 1C4WA 2X13A 2XZTA 3AQIA 3NDIA 4M8LA 5HBRA 5JSFA 4XQGA 4Z53A 1ZXXA 4QXAA 4R2WA 1GFSA 3THWB 1QTNA 2B6NA 4ZHQA 3W2FA 2CNLA 3MWLA 2XB4A 4G5SA 5HEKA 4HZIA 1CDOA 2F64A 2LKCA 5LMCA 4GDFA 4RSHA 1ODTC 1YBMA 1XZLA 1XTQA 4HKTA 2VC2B 1QS0A 1F51E 4K9NA 2WSSD 4FUTA 4Q3DA 2PM8A 1QYRA 1U8CB 4FKBA 1N0HA 1LPAB 1Z4LA 1UODA 2WJYA 1CQWA 1P7WA 2AR7A 3DTNA 4WXMA 4D4KA 3L7MA 2ZI6A 1BH6A 1AGYA 1UFRA 1EJ2A 3T1VA 3EN0A 3OZIA 1CFZA 1TT5A 1IBSA 3MILA 2RH9B 4NATA 5FBWB 4Z3OA 1LVHA 1DL5A 3PDWA 4KBFA 5BQPA 4MGKR 3RYFB 1QC5B 2VKTA 4ISCA 5I3CA 5ILOA 1WXDA 1KIMA 3VH2A 3IFSA 4IIYA 3DLCA 2DUWA 4U7WA 1YZFA 3ZQ4A 3M5DA 1UH5A 1ZEJA 3L0DA 3NETA 3UF0A 3E15A 4CIDA 3LUBA 5LDDC 3UGJA 1OBFO 3HR8A 3BXFA 3B52X 4INOA 1R8XA 4MDYA 3TKLA 3HXOA 3I3SR 5IVKA 4MKIA 2JJQA 4QO8A 1MVLA 2BL4A 2Z2YA 1UR5A 2GASA 3TK1A 2OXFA 4WXPA 3HH8A 4EECA 5T7BA 3OFKA 3WSTA 4KLCA 1KEVA 3FETA 5FKJA 2JEYA 2XUHA 5C7LO 2WR8A 2F1RA 2ZPUA 4RCZA 4QT0A 5A7GA 1E2DA 4YK7A 2WDPA 3H9BA 3JALB 1E6LA 3SQLA 1K6EA 3QX9A 2HU2A 4D02A 4I8IA 3G8YA 1N32B 2B8JA 5HGJA 5BXYA 3KQKA 4QUDA 1DJPA 1YMQA 1U1GA 2FUKA 2B2XA 2V65A 3B6ZA 3H11A 3OFND 3BWXA 5FLKA 4ARUA 3MLEA 4RHFA 1Q0LA 2C4WA 5SYAA 2NP7A 5EIBC 3HCOA 1MC4A 1E94E 3WAJA 2F3PA 2BN4A 2UYQA 5JJBA 2P2DA 1I0LA 2XUDA 2ZU0C 3KELA 4OHFA 3NBAA 1Q0PA 4QJIA 2PPLA 5F51A 5FBZA 2HCFA 3WQSB 3EUAA 2XMRA 3G85A 4ZT3A 2IUFA 2H4FA 4OHKA 2QTWB 4TLLB 4KZPA 5C4GB 3SJUA 2HWKA 4D0SA 3PC4A 3FDJA 2XZOA 2AR9A 2QRZA 2WLSA 3UUEA 3G17A 3KKLA 2QMEA 3TLJA 3JAWB 4U7PB 1LRKA 3UTCA 2YWEA 3JQ9A 4NK5A 3RGGA 1SR8A 2AYZA 2LWIA 3FJOA 4YHHB 2WYVA 3AB7A 4IHAA 5K0LA 5I4IA 2KPOA 3G0GA 3SBDA 1GNTA 1VHDA 2I4RA 1SKQA 4KYUA 1AKNA 2P6OA 3BE8A 3ANNA 3BJEA 4CDNA 1EUQA 3EDOA 1L0BA 1ZVJA 3V1MA 5ALSA 3KEQA 4O02B 1ISJA 1Q14A 3R6WA 1E2QA 1N0UA 1U6IA 4XDZA 1EESA 4EUSA 3A0UA 1R6BX 3WXBA 4CNBA 3E9NA 4MKRA 5FJJA 3W7VA 3GC6A 3QFTA 2RH8A 4UHKA 1Z7BA 3DUWA 1NBEA 2EFHB 2GHTA 2HU8A 1P0IA 4GNRA 4O63O 1ADGA 2NACA 1L5LA 3AW8A 4Q4HB 1D07A 1FNNA 1EZZA 4IDPA 4PZEA 3BMNA 1OYYA 4MEJA 5BN4A 2NSJA 3JZAA 1ODKA 2JKZA 2XVXA 2D5LA 4KK4A 3I1FA 4EJSA 4ZI7B 2GAIA 3IRVA 5ITWA 3RYFA 4TS9A 3KSAC 4X63A 4YRCA 2LZ0A 1EB9A 2ZCJA 1VLQA 4IP0A 2QXYA 1CDDA 1VZ2A 1GT91 3LHIA 3RHSA 4JBYA 5GM2A 1JEAA 4FSHA 4X3OA 1WZNA 3VJMA 3Q11A 2AOTA 5KVCA 3TPFA 3Q12A 1GV1A 1Z47A 2B3TA 4R5HA 4WW0A 3SP1A 1H9AA 2IQIA 1IL0A 2E55A 3F71A 4N40A 2AE1A 2PVPA 3D8HA 4AYXA 4UTRA 4PG4A 1OFGA 1Y8RA 4ZT5A 4IDBA 1XEFA 3R3JA 4J0CA 3PFKA 2ISSD 3N07A 2VF5X 2PX4A 4PZUA 2PX6A 5AJVB 3RUIA 4D81A 1NQXA 4D0RA 1DLJA 5CPBA 3K16A 1G5RA 3Q9SA 4KMRA 2QL5A 4BQSA 2BFFA 2R7AA 2KM1A 5E3JA 1TQ4A 3CG4A 5EJEA 2YFYA 3RBVA 2OXRA 3W2HA 4PLZA 3O0TA 4CKZA 3UCXA 1DDIA 3BGSA 4QU5A 1I7QB 1RI4A 4G4JA 1KVSA 2H16A 4IS3A 4JEIA 1M6HA 1MAVA 1P61B 1KC3A 4J7AA 4L6AA 5B1DA 4AJ2A 4D44A 2M98A 3BG5A 1Q1NA 2DZDA 1R6UA 3ESQA 4DWJA 4C04A 1O5IA 4WAUA 2Q45A 3DE1X 4GPD1 4K40A 4WBNB 1LBIA 1DKNA 5SZIA 4PNPA 1YULA 3ZXUB 1J22A 4BVBA 2ZIGA 5J58A 2PKYX 3K0HA 4LRYA 1DBIA 2B36A 3ROTA 1CB0A 2D00A 1QVAA 2VQSA 1KWKA 1A1SA 4RA9B 5F1PA 1ZXLA 1ADJA 1VFNA 5LFAA 2I76A 4JA2A 3IGFA 5CRIA 4A23A 1Y6ZA 5C53B 2NO6A 4U7HA 1A2QA 4B4DA 3KPYA 3W5CA 1O96A 4N4AA 1KK0A 1GTZA 2COEA 3GFVA 2Z5FA 1EFTA 4Y2TA 5D01A 4BMNA 4BWGA 4O1HA 3AETB 2VYFA 2H3EA 1XCLA 4V3BA 4BX2A 2XI4A 1CK4A 1AQNA 1PEYA 2WM8A 4MUFA 2VEDA 4C7OB 2QR3A 3FVRA 2FJUA 4GU5A 5F7XA 4I4LA 3SX2A 2P68A 2YOFA 1YL7A 4K46A 4EI8A 3LXMA 1ZOSA 1IRXA 2X3UA 3CT4A 2DM6A 1XPRA 3VBEA 1RD4A 4FMPA 3SBOA 3ABRB 1GAXA 2VBFA 3T7DA 4IEIA 3QSYA 5JNTA 1VSTA 2B8EA 2C2WA 2F90A 3M1YA 2X0FA 1PGPA 1D1PA 1J8MF 5B6PA 4HDRA 4P2GA 5C35A 1UPUA 1XZJA 1JQEA 4NJEB 1T1EA 3DV0A 1NNSA 3D2LA 3LA6A 1GRVA 1OYVA 4J75A 3DAGA 4R0VA 3A05A 4EUKA 4O0MA 1JFTA 4XTCS 1J56A 3LP6A 4DIBA 3SU8A 2GXAA 3OC0A 5CT8A 3ZN2A 4KFCA 3DQPA 3EFHA 1TYBE 4JNKA 2O4CA 4TUYA 3NCHA 4UNNA 4MV9A 1NAHA 2KHZA 1TAUA 5LPNA 2V3CC 2ZJ1A 4I3HA 3WNVA 4JZYA 5DT9A 1OUMA 3JARA 2V7GA 3RF7A 1FTNA 2WQ7A 4L8GA 4DR6B 2YZKA 3T61A 3HBAA 3L1UA 1WUKS 3W3AD 4JLAA 2HJ9A 4J0DA 4TWRA 1AHPA 2FSFA 1CRLA 3T7RA 2F9MA 1I4EB 1O87A 4CXMA 2IXTA 1PP4A 3OO1A 1IEQA 2XAAA 2X0KA 1GG8A 2VP2A 3CINA 3FMPB 3P5SA 4LI0A 4MZDA 3QFSA 4RL6A 5A3VA 3FUXA 3NATA 3WWZA 4EF5A 1SVOA 1GGNA 4F97A 5L3QB 2W2KB 3UJCA 4ZCSA 1UWLA 1S2DA 4NIMA 3MJTA 4S0ZA 3RT1A 4B9AA 3I6YA 4RMIA 3DAFA 4CRWB 2NVOA 4AD8A 3OPQA 5G41A 2O7VA 2A86A 4J49A 3UWKA 1FSZA 4I5IA 5JO0A 3PD7A 4J3JA 4KYVA 3QE2A 4W5NA 2XQVA 4JVNA 1M1ZA 2A5YB 1HT1E 5FR2A 2C7RA 5DNUA 2WJGA 2AGVA 2Z43A 3OJFA 2LV8A 1RRMA 4MQEB 1FX0A 4J8PA 2IUEA 5CK4A 3LOPA 1R10A 3GD7A 5D3ZA 1PT5A 1E2JA 1O6ZA 2B25A 4FOLA 1BO6A 4FX5A 1R0WA 5CYPA 4NI5A 3N74A 4QPNA 5CFNA 4EO9A 1P19A 3PF8A 3F97A 1PTKA 1BROA 4P81A 3K70B 4Q34A 5CM9C 1ORTA 4PLTA 4QJ3A 4Y2YA 5JTUA 3KJGA 3NWOA 4CKCA 1MTOA 3MK31 2G9RA 4HFMA 4IVNA 4WZAA 3VQTA 5JBQA 4LMRA 3CX4A 4DZRA 3DCYA 3D4OA 1C3VA 2VYQA 4O3MA 3OBBA 3WGVA 4BO3A 5D8DA 3C3AA 3DTVB 1AG9A 4UAVA 5LXTB 5I7SA 3X1DA 3HB1A 2FF7A 1BZYA 2VRCD 2ZJ6A 3MWDA 1Q2UA 2G0NA 4EIWA 1ZESA 3ZWYA 3J7AC 4EHHA 2QDKA 4RVFA 3FDZA 1T5TA 4DWWA 1GG2A 5B30A 3GJ0A 1YZNA 1FMJA 1BXRB 1D6MA 3DFFA 4KE6A 4KDRA 5AKYA 3RUHA 2NVUA 3U4CA 5AK3A 4CUZA 2OXEA 3NH9A 3OCXA 3UBTA 1KE2A 4TYPA 1B93A 1NVVR 1SHZA 3ZV3A 3AHIA 2WYUA 3TI7A 2P2ZA 3EMDA 3PNMA 4INJA 5D6NA 1QJCA 2YY7A 5H83A 2XRZA 3EDMA 3WK7A 3HU3A 3KT8A 4LFCB 3IAS1 1LPNA 1YE8A 2HDOA 2Y1XA 4G36A 4HDSA 4RJLA 1GFIA 1R5BA 4CMAA 1E6UA 2WJWA 3ZDBA 3AL0C 1U3VA 1FP7A 2IZ5A 2ZDQA 5JCZA 2C9MA 3M9LA 1OTHA 1K6IA 1IN4A 1KFKB 5JHGB 2CCGA 3TFQA 1C50A 4CLHA 4NRDA 3SHFA 5BV8A 1L5VA 4QJ5A 2ILTA 4ZO9A 4B75A 2HWWA 3CPSA 1DAKA 5HWSA 2QQ5A 2HC9A 3AJ9A 2FR1A 2JKYA 3K6SB 1O54A 3DR3A 2E4WA 3F8TA 3IXMA 3TFOA 3NMUF 3NXKA 1KZ9A 1Y3AA 2B4KA 3BB3A 3NX4A 4GLOA 1ORDA 1MZVA 5KHAA 4WBNF 2PD3A 3FZYA 4KQ2A 3DL2A 5IJ9A 3CJTA 3KQUA 1GZUA 1Q21A 2DHQA 2O2YA 1B1AA 3NB0A 3IOYA 4X44A 5DXFA 5IP5A 4A0SA 5DH9A 4LWOA 1HFWA 4DQ0A 4ND3A 4YR9A 2G7ZA 4X7RA 1NXVA 1R4NB 3IAM6 3RJTA 3KPUA 1VCMA 2J9ZB 5ELMA 5HQTA 5L4LA 4B6SA 3IILA 2PLNA 5KTRA 3KZKA 1CUDA 2XE8A 1WCV1 4TRJA 1E6KA 1TMGE 2I1WA 2OO7A 3LUJA 1XTPA 4FXOA 2VP3A 2E6KA 2E4XA 2O8EA 1U5BA 5BW5A 3A9TA 3IO5A 3U9LA 5LZ5A 2I99A 3M4ZA 4FOPA 2IHVA 4OAOA 2YXLA 4WEOA 2ZE6A 2X5JO 5BPHA 3NVAA 3FMIA 2PUVA 1FE8A 2FEPA 4FEGA 1QO9A 4HI0E 3F5DA 4CQMA 5K51A 3PE6A 1M0SA 1BFUA 2GLXA 4FSXA 4M99A 5F98A 5A1TA 4Q1EA 2C00A 2FPPA 1WB6A 3KKEA 3ZV6A 1ILEA 4HXYA 1B14A 2HQRA 2BEUA 1RBMA 4Y2RA 2CBZA 2PEZA 5B7QA 2XNHA 1HUQA 3C3XA 5CXXA 4ZO8A 2G67A 3SZGA 3UOGA 5FAKA 4HJXA 1Z88A 3PVZA 3MPUA 2AEJA 3B3FA 3MCZA 2PUHA 3VGJA 1Y6RA 3TF5A 1JDBB 2ONCA 2GZDA 2XBUA 4ZXFA 1Z0ZA 4MVJP 4B79A 2Z6UA 4BRUA 4PCVA 5J4YA 1DUIA 1YB1A 1DG9A 4IVPA 4CL3A 4KXLA 1XTBA 2I9PA 4K6MA 4W7IA 2HMWA 3AETA 3GA7A 4M60A 3OPVA 2R8XA 3VYUB 4BBJA 4LKRA 5FHRA 4FYKA 1B6TA 4BFXA 2CNKA 2G9UA 2G76A 3NRBA 4MS3B 4YUXA 4R8MA 4OATA 1RTTA 4ZO4A 1S8FA 1ZM4A 2Q7DA 4DRYA 1KFBB 1K1EA 2N1BA 2X9NA 4QOIA 4BWVA 3E1GA 3AI7A 2BRUC 4G85A 3W8NA 4EB8A 5HIKA 1X8LA 3MEQA 3SYKA 3WJ2A 3G8DA 1NJ1A 4WKOA 4M9XA 2RG1A 4JI8B 1OXSC 3JYLA 4RK5A 1RLIA 5C80A 3QLUC 4K05A 1IONA 1E32A 1LSSA 1OAOA 2EG5A 5E38A 3A6JA 3ANSA 2J7KA 1KJQA 2OFXA 3FNRA 1JAZA 3L7IA 4KQ9A 5LBTA 5KMGA 2UVPA 3NOVA 2Z9BA 1Y1TA 4ADSG 4NMLA 4IHJA 1KEPA 3DDWA 3IE2A 1HE5A 1RKQA 2F1JA 1IJKA 2DBRA 1YIDA 1ODIA 2YW9A 2ZJOA 3CNLA 3O1IC 4LZAA 3BMQA 4GT1A 4MV6A 1KI6B 4F85A 4JCCA 1AQIA 2BMFA 3OZFA 3P2EA 1M6WA 4WK0B 1S9DA 9LDBA 5A9SB 2ZXEA 3H9JA 3LV8A 3GGSA 1W5AA 2C61A 1NFFA 1WPXA 1M54A 5K8IA 2PGOA 2X2PA 3FJYA 4QWWA 4S24A 5EWMB 5B64A 1Q16A 3PP8A 1K8YB 3OWOA 3K0FB 4TSFD 3DPIA 3TJMA 4PPQA 3TLYA 4BLSA 1WE2A 5FWYA 2PGDA 1KHHA 3DOFA 4JFRA 2BJHA 4RCYA 1SC3A 1KOJA 3DL7A 4OHXA 1A8QA 3CLUD 3Q8WA 3MJ4A 4S3MA 4NQRA 3THXB 5F4ZA 1WS6A 4DW8A 3Q7QA 4FFSA 2ZRPA 3KZXA 2C2OA 5J4LA 1PFKA 1VHQA 4WI1A 2BGMA 1E8DA 1GGFA 1R50A 1XCOA 1DZ3A 2H1HA 2JAOA 4MR8B 4V0SA 3IUPA 5ED0A 1BW9A 3LAWA 2VL7A 4BO7A 2M6LA 5JQGF 2HCJB 1KPHA 4Y8VA 3ZEAA 8GPBA 5DGDA 1CJBA 1JDNA 2R62A 5CCDA 1IN6A 1J5XA 2GRAA 2PGNA 3HJUA 3KQTA 4U7GA 2HV8A 5T3YA 3DZBA 3V6LA 5AUPB 1DRKA 2ACVA 2I2CA 1MGPA 2YWFA 4RQTA 5AVUA 2PMCA 3MJFA 2X0RA 5DSZA 4MXDA 1JR4A 1MR3F 4NBRA 4YRGA 3VR2A 1X14A 4OQFA 4C4XA 3T9FA 1QK3A 4FR2A 5H1YA 4A82A 2CV2A 4L5IA 2V7XA 2KYRA 2WTXA 1E5XA 1E7WA 2Y92A 2ZRIA 5J59A 5K9ZA 1CC1S 1W73A 2ISCA 1FUKA 3NHAA 1UJCA 1WLSA 2H9YA 1G63A 1YRQA 3EIUA 3LXUX 2RE8A 4C0QC 1KDRA 3NP7A 5JVDF 5DM60 4C07A 4U5QA 4PG8A 2DQ4A 2XQKA 3ZDQA 3W5HA 2CY0A 5LMUB 5LZ9A 1IPFA 2FTKE 2PRIA 4FK8A 3HEMA 5SICE 3UWSA 5EJ4A 1TA4A 1NVKA 1W0KD 3A8TA 3NASA 4NAHA 1T0PA 4IM7A 4TL7A 4KBGA 4UU1A 2ZBEA 5B6IA 1RBZA 2WWGA 1IEWA 4REQA 4KODA 1TA9A 4P3OA 1MIOB 4QYIB 2JLXA 2HMVA 3VMFA 1R9JA 4TMXA 5BNZA 3IQGX 3LUHA 5JCPA 1EK0A 2EHJA 1T8PA 1JG3A 4KU4A 5FEMA 5T5QA 3A2KA 1FUYB 3TCNA 4V0OA 5T6MA 3Q8LA 4KBYA 1PGJA 4HDQB 5AIBA 2IYQA 3WNBA 4H0NA 4KRFA 3QWFA 2W8BA 4TYMA 4YP5A 2GWRA 1RADA 4XQ9A 3A1TA 3OFSA 3MFYA 1GGHA 1G20E 3H5OA 1VPDA 1ZLYA 2BIFA 3LQRA 3SHOA 1W0KA 3HEAA 3JQCA 2H1VA 3Q5DA 4ZVPA 1VYTA 4B4KA 2WB2A 1D8AA 1V11B 2CUZA 3K4HA 1KKLA 2W2XA 4F0JA 1U1IA 4NENB 2P2NA 4RVNA 2NXEA 1Z18A 1KDZA 1FYXA 1DVRA 5FTLA 4I55F 3U9SA 2ATXA 5MFZA 1WVIA 3OI7A 1SCDA 3OMXA 3OZEA 3S1AB 2FE1A 3JX9A 2WG0A 1IPHA 3R6DA 5TS2A 4M86A 3V4LA 4D8VA 5LP6B 4OJYA 3FMOB 5HM6A 2OG2A 3FXAA 4GE0A 2XZDA 5ELLA 4DMLA 3ND8A 4PYIA 3GH3A 3KU1A 1DLIA 2XOKA 2FMFA 2IIBA 3L0CA 4I99A 2PYIA 4I55A 1K7YA 4IR7A 4NE9A 4UM9D 5AJXA 4PSUA 3K5WA 5BUSA 1BYUA 1JUDA 4C88A 2CLSA 1GWNA 2C98A 3EDRA 1YXMA 4FMBB 5CP8A 5C8YF 2IX3A 1L7XA 2G1AA 2QVXX 1BFKA 1FU8A 2XYQA 1P2VA 2PKRA 2YV4A 5CJPA 5BV1A 1J0EA 4S1OA 5JAZA 5JZMA 3E5MA 1SHLA 2LE0A 1CYDA 5CAEB 3PPXA 4LGVA 4PPGA 4E51A 3COVA 4QBGB 1N78A 4IRMA 3HXTA 4F12A 1MV8A 3L4EA 1GEEA 3RVRA 4ZK2A 1T6YA 2XZPA 3VTZA 1YKGA 4MWOA 2BFNA 1H8ED 1KBZA 1P9NA 2Y1EA 3ANYB 4IFTA 3ASZA 2OOKA 1R8QA 2B0JA 1PX0A 2W2NA 3L4SO 1LDNA 4LSGA 4R3WA 5EKXA 2D1YA 1WB9A 4UE3S 1WM1A 1YZYA 4RXMA 1NDUA 1WXIA 3MD0A 4NP6A 3ADDA 1OGJA 4XIIA 3DE3X 4KAJA 2ZIVB 4A5OA 1PGQA 1DQNA 2WUGA 4NX2A 1E9SA 4EX6A 4D9NA 4L2IB 4DG5A 3AVUA 3K2QA 4MVJI 1O97D 3HL4A 4NBWA 3PFBA 4JOCA 1BN7A 4YR7A 3NBFA 2AE2A 3EQ9A 3K8ZA 5GGYA 3HVUA 1OX5A 1SOMA 4P3NA 9MHTA 4MHTA 4DA6A 1JHAA 3C43A 4YAIA 2C1EA 3UJ7A 1P3DA 1KORA 5EZYB 1ULAA 1RXVA 4NBSA 1WP9A 3EGXB 3FB4A 2VG8A 5DK6A 3RJMA 2ZLBA 4E0BA 1LDMA 1PJ4A 2BGLA 3T99A 1VRWA 1CRPA 1BSVA 1E5LA 4EJSB 1ORIA 3ZWBA 1MQ8B 2JASA 2H0RA 2I6SA 4GMKA 5DX0A 1IC6A 5KQGA 2I6XA 2R4TA 3LQ2A 2XZLA 3GP5A 4Q9LA 4Q4HA 5CUQA 3T34A 5C3MA 5BWBA 2EFGA 1WUTA 4QREA 1M5RA 4K28A 4P83A 2AJTA 1U31A 5ISMA 4MS3A 3ZZUA 3LKBA 2D2EA 3L0PA 1SB9A 3D3WB 1QH8B 3P2IA 4Q9DA 5C1PA 1L5QA 1P5JA 4DJJA 4PYQA 4RFSA 5DTRA 5BP7A 5IT9A 2G4VA 3KR2A 3I6BA 2I80A 1U2ZA 5JEDA 3PRJA 3V4VB 4E70A 3Q87B 1BKDR 3N8KA 2GHRA 4GW3A 2P3OA 3I5MA 4DG8A 4HK4A 1Z2CA 4N8EA 1YR9A 2NYVA 4W5WA 1LSOA 2JH9A 1T9GR 4DJEC 1NOKA 3IEKA 2I87A 4H1UA 2EATA 1C5KA 2ICAA 1OIVA 2N42A 1T1JA 1FFHA 3DV9A 4ENUA 16PKA 1I7LA 4QG3A 3P4UA 3A4NA 2GQ0A 2PSSA 8LDHA 3UFBA 3AFIA 3KDPA 4CMBA 4NDZA 2I2WA 3IE1A 1JG4A 1Q0HA 1Z5PA 1GXSB 2VDWA 3KJQA 2R00A 5JMWA 3N0WA 2EW8A 5A4FS 2JVKA 4XYLA 3V4PB 3DUFB 2C3OA 1EFCA 1YCGA 1L6IA 1RKVA 1SOWA 3KSZO 4NH4A 3H86A 2QAIA 1VL8A 3BE6A 5T4BA 3NBQA 3EGEA 1XHLA 3DNPA 3EXHA 3GCGA 4MW6A 4RKEA 5DULA 2BLLA 3AMVA 2F3UA 4ALJA 5CA1A 1BGWA 3E5HA 4AN4A 2QP4A 1XKQA 2WFLB 2WYIA 2YQ5A 3COZA 2DUNA 3PWZA 1GZVA 4JYPA 3A1CA 4ANFA 5DHTA 3QKRA 3LO5A 4FDAA 1GUAA 3JARB 4FHZA 4HPWA 3OZ7A 5GP1A 4WOBA 1M75A 2GH1A 2IY8A 2IYAA 4V0KA 4XJTA 5FDFA 1VCHA 1OXKB 2ZTVA 1OXUA 1PG5A 2LTAA 4KFUA 1B15A 5J2UF 2Q5CA 3CF2A 3ZWPA 3X44A 1V7QA 5TPZD 4FVTA 2CL6X 3DUFA 5AW9A 1TCCA 1M2VA 4RF2A 5CH3A 2QYHA 5EZQA 5F5LA 3SDBA 1K7EB 1MTZA 4FBMA 3HQ4O 4JLJA 3USES 5MGNA 4RHEA 1WXGA 1WMDA 2O2IA 4B6JA 1IZ9A 1ZNYA 4PGAA 1U0SY 5ENVA 3DBLA 4IIUA 4J43A 1SY7A 1AF4A 3K4QA 4N12A 3RYCB 5I45A 5FPKA 3EF3A 3L49A 5DK4A 2V0NA 5LD2C 2X8JA 2RHMA 5D5PA 3IT3A 3R5TA 4I3GA 2GVZC 3TB4A 2W6PA 4F4IA 1OWPA 2FHSA 3LP8A 3IH5A 1Y6QA 3CRVA 2ZITA 3PNKA 4TUYB 3WDMA 4EY5A 3GRCA 4XWWA 2Q2VA 3DVRX 4H6WA 1SOAA 3LPAA 3O4GA 1CY7A 4G37A 1QH1A 1D9ZA 3OIGA 3KDAA 1DC7A 5J1TB 4ES6A 1E1YA 1J2EA 2PA0A 3EBLA 3JQGA 2PX8A 2IYEA 2F55A 2WIDA 2NZ8A 4FGWA 4CU2A 2B1JA 1OLXB 3PLNA 5DBOA 5KC9A 1M0WA 3A28A 2ZAYA 3ADKA 4OUDA 2WAMA 5LKAA 3HZRA 2VJDA 4GM4A 1Z15A 3KQPA 3U6BA 1SQFA 4YCDA 4Y2UA 3R7WB 1Y1KE 5DISB 4BOYA 2ZETA 5AOAA 3J80A 1D3AA 2GESA 4RH1A 3GEPA 5BSMA 1ZIDA 2R1TB 4AKHA 2QS9A 1PYOA 2BHTA 2L18A 2WZBA 3IYLW 4AURA 2Z2XA 2DFLA 3NV9A 2A9RA 4M0LA 1TM1E 4TV9F 4ENTA 4PFSA 4R7TA 2RSLA 3DBIA 2HHAA 3BL5A 4FFVA 4UNQA 3ZWOA 3AVOA 2CXRA 4WFQA 5B1YA 1AA6A 1UBSB 3I3OA 1KRHA 3EF0A 1H85A 4L50A 5EPOA 2PKCA 3ICPA 1XBTA 1L4LA 2G5TA 1YR7A 4TS3A 3ORYA 4W7SA 4F4JA 1F48A 1MXFA 3DE5X 2OR3A 1KJIA 3OQIA 3VSBA 3EPKA 4E2FA 1ZWLA 5BY2A 3ESYA 1R1DA 2EJCA 3MZ0A 4RJKA 3V7WA 3SF0A 1OBOA 3MGCA 3JVUA 1KBOA 2P6UA 4QIHA 3W1EA 3P0FA 4EG5A 5JYDA 2CZQA 4Q1BA 2WU1A 1V6SA 4M1QA 4UVDA 3UOWA 1YR3A 1R8SA 3VVCA 3A14A 4CFSA 5BVGB 1HYBA 5BWCA 4JNCA 1H05A 4IFIA 5C31A 3P26A 1T6BY 2WWTA 3FMFA 3GFRA 3L7JA 3PPYA 4BQPA 2X1LA 1TZ2A 3C8DA 3MMXA 4BN5A 1JJIA 4V0MA 8ABPA 1R4MA 1Z3CA 5GMOA 2C04A 3AWDA 2IS1A 3KXDA 3ANLA 3GLUA 1S3IA 4K6GA 1RLOA 3H19A 4JQCA 4N9QA 1O5TA 1QGYA 2SBTA 4MP6A 1IN7A 2A6PA 1OD6A 2QNBA 1YGPA 3IDAA 2W4QA 4MOWA 4CQMB 3L6DA 5L53A 3UIEA 5SZHB 1VE3A 4UE2A 2JS7A 3CNNA 4KXYA 4OYLA 3IP3A 2Z8YM 1U3GA 3N5KA 5HMLA 1FTQA 1IDOA 1U3TA 2G72A 4ARAA 4D80A 4R51A 3IX7A 4YV0A 3OUTA 1ADFA 1PK7A 2NTEA 4X1OA 4BX3A 1Y5RA 3ACBA 2JK1A 3DL4A 5K5EA 5KQMA 4RVGA 3MRXA 4TPKA 4CR7A 2FK8A 4NZOA 2Q3EA 4BLRA 5DZSA 5EP4A 3E8MA 3HYCA 4G5GA 4KEAA 3NGLA 2CGEA 3T54A 4R2JA 4MVJG 1EFAA 1T43A 1TM2A 2ZI3A 3EXEB 5BV2P 1Q2XA 1QHYA 1NRWA 1CNEA 1SG0A 4LXHA 3LVFO 3TLEA 4AB1A 3NYRA 1WUHS 4Q3CA 2NAPA 3O47A 1FXWF 4UTXA 1QQAA 1KK3A 3BWMA 5SZJA 3CEMA 3VPXA 2IS2A 2ECKA 4PFQA 5H02A 3O95A 4CZ2A 3CONA 1JFSA 4B8WA 1I7DA 4IINA 2J5XA 3I2KA 3PCRB 5BW4A 3A2MA 4YS6A 1MJGM 4IV8A 4LX8A 2VQFB 2XOKD 4UUOA 1K5DA 1BXGA 1FZQA 1YCDA 3EVGA 4O29A 3QV1A 4UUAA 5CCXA 2PSJA 5FO0A 2V7QD 2GDJA 1NHGA 4WBSA 2NQ2C 4IGEA 5EVJA 3OZRA 1PFGA 1Z4NA 2DUUA 3ITKA 4GGPA 2C3UA 4TYQA 1W59A 4XQCA 1TB4A 1O6BA 2TS1A 3VSEA 3ENNA 4YJ3A 1JXAA 1PFVA 4IHQA 1CUJA 1A50B 1DKPA 1SXHA 4GKVA 4OHZA 1JKXA 4ARSA 1GKYA 5DBHX 2W0MA 3SYNA 4ZMSA 3AVTA 3FTCA 2FR8C 1ZCFA 3SSOA 2Z8ZA 3GLQA 5P8WA 5A0VA 4RMNA 2YVLA 5HOEA 3KSBC 2GZSA 5IDXA 4JDUA 1MOSA 1OA0A 5A4MS 3NOQA 2B61A 3BUSA 4K2HA 1TTHA 2JHPA 4I4TF 1XSEA 2CLFB 3K2IA 3NHWA 3QWBA 1Z29A 4PICA 4RIFA 1VE1A 2F8SA 4YUVA 5KNDD 1ZISA 4KWCA 2DKNA 4Q39A 2E48A 2I4TA 2PL3A 4UC0A 5T8KC 3L82B 5JANA 5DTQA 1RYZA 2X0EA 2W6JD 3L6UA 1EFPB 3ZCVA 2IDKA 1N33B 3VKGA 5L6LB 3WQBA 1JG7A 1G8AA 3EVDA 5HE8A 3JD0A 5IM4A 2FLVA 4IIJF 1RXEA 1Y7PA 3OX1A 3TLGA 1Y7HA 1Z5UA 2EJVA 2VK8A 3RSGA 3A4MA 3K53A 1MEOA 2B34A 1ZIOA 4L02A 5LA6B 1FW6A 1NRXA 3HJCA 5KPJA 2VATA 2XMDA 2CK3A 2V8BA 3A1DA 1GUBA 1TAGA 2IELA 1AUXA 3JRXA 4OJNA 2HFJA 1QQTA 4OKSA 5TJHA 3OURA 4GF5A 1VC2A 2QL9A 4W1PA 1KMQA 4FFNA 2ZBGA 4WV3A 5C7YA 1ZD3A 3OTQA 1PSWA 3DEFA 2VRWA 2DP4E 4NZZA 3WB1A 1NMEA 3OQJA 3WIVA 4BWFB 2IDJA 2GXUA 1G1MA 2CFIA 1ML3A 2VTVA 4NCKA 2G88A 5CNMA 5TPZA 2PS0A 4AECA 1HO3A 1OW3B 1U7DA 4M7WA 3EB9A 5LYJF 3UKJA 4M1EA 2C4TA 1GTG1 4D4MA 4GAEA 1DSSG 1PN3A 1HNNA 4TM8A 2VYND 3TCXB 5TNXA 1JU4A 3HHPA 3TN7A 4B1FA 1WZIA 1A7JA 4MMXB 3GVHA 4I5DA 1E60A 1UDAA 5ILGA 5KOJA 5IJ0B 5DIZA 4Q9AA 2GARA 1K98A 2MSCB 2PZJA 4YGXB 4RAQA 5D1HA 1S6YA 1CJKC 2CXXA 4ZVKA 2ZROA 3OQPA 3H6GA 1VMDA 3RUEA 3W34A 4X90A 1TI7A 2IHZA 2RHRA 1D2NA 3H2HA 1I5OA 1IUNA 1UM9A 1IJBA 2FN8A 3QLUA 3IKJA 1J1ZA 3TW8A 4NL4H 4LGYA 4YQYA 2ZIFA 1E4OA 2AA3A 1N1MA 2PMBA 5TX7A 4YLYA 4OFXA 5AWFC 3ZVMA 1DJQA 3OVMA 3Q98A 2PMWB 5JS1A 3RSZA 1SVLA 4MCAA 5CXSA 3G88A 1L8XA 4IUCS 5FOTA 4IDDA 3AOEC 4QUGA 3TL6A 3KYCB 3AEUA 4YRKA 1N2JA 4OBEA 3VZRA 2GBLC 3HB4X 4KIWA 2NM0A 4EFMA 3EJWA 4HQ0A 2EKQA 1I1NA 3X2SA 4HGZA 1ZRSA 4Q15A 1QHIA 3A6HA 2Q5HA 4RK0A 3DZCA 2VN8A 3BRWD 1PEAA 3F96A 2NIPA 1LTHR 1IPEA 2AFRA 3HDHA 5F12A 1UEXC 4H7EA 4GP7A 3SIRA 1MRSA 3IVGA 5DNVA 1Z63A 3QBDA 1R4ZA 3LH5A 1ULBA 1XXLA 1W30A 3GF4A 4Q4AB 5DHQA 5I6DA 1U0BB 2BEUB 4HN2A 2RGRA 1KY3A 3UJ8A 5AESA 3PUHA 4H4EA 4IDQA 4J2OA 3SJBA 4CG2A 3PC8C 1G9TA 1C3OB 3DE4X 3UATA 5FWDA 1MJNA 2ZTUA 4KQHA 3SNKA 4DVJA 1WKBA 2HU5A 3DMNA 3DC7A 5AXCA 1J7JA 3RYIB 4H1HA 2BRUA 1F0PA 1PKXA 4CMEC 1JDVA 1RQ7A 3IXQA 4V0QA 3UPUA 4A8PA 1BDMA 2PVCA 1WF6A 1XLTC 3E9YA 3IESA 4GYYA 1P81A 4P32A 3ST7A 4DHEA 1T9ZA 2ZR0A 2CMFA 2G06A 3QPVA 2ZBDA 4H18A 4IWYA 3G2IA 4L75A 1O2DA 3OP4A 3KVRA 4OB6A 1SULA 3D6AA 4RTPA 3EXFA 4L85A 2Z3WA 1T0UA 4ARCA 1V9CA 1WD7A 5C34B 4A0QA 1AVTA 1TYDE 2ZBPA 2V7EA 4IILA 1G4HA 4LGCA 4Q7LA 2M32A 2XBLA 2C5LA 3P9NA 3PE4A 3F9CA 4YUAA 4PIMA 5HM8A 3O8RA 4BAZA 2ZVPX 4QELA 3WK4A 2GM5A 2IEDA 3TZKA 4IMRA 4NTZA 3TUIC 2QMYA 2J09A 4MR7A 5L3RA 4C03A 5BQOA 2JFXA 5K0SA 2WOOA 4EHAA 3OJEA 4AY6A 3HUFA 5CM8B 3L06A 4CETA 1Z28A 4WEQA 2Q6OA 3OPNA 3PXXA 3JQPA 1K66A 2D4AA 4W99A 2H8GA 3I4FA 5AOVA 4HV4A 4HXEB 2PGAA 2ID4A 4N7RA 1I0IA 3CKMA 5AK4A 5ICMA 3PYMA 3TVTA 3PTAA 4KO1S 4I9NA 1SUSA 1T9BA 3OJXA 1USWA 3D2AA 2FEOA 3G02A 4JC4A 2B8NA 2QA5A 1AZSC 1NIPA 3NU1A 1S0UA 3K94A 2AJLI 2XLBA 3VOAA 4BQIA 1JDUA 4EG3A 2FZWA 2VJKA 3IJRA 4IMPA 4ZO6A 3C70A 4XVUA 1T2VA 4TKMA 4XJXA 1YZUA 1USVA 5CDFA 2O8BB 4BMCA 9ABPA 2H1OA 2OM2A 3OPXA 4EG6A 1VP9A 1IIRA 4KVZA 4YFVA 4DLLA 3AZQA 4D3YA 2CLMB 1LLUA 1K7XB 1KR5A 3EG9B 3QPAA 1LBTA 1XRSB 5IC6A 4EY4A 4FCVA 4HH4A 1R64A 2AF3C 1NASA 1P3JA 1P91A 3PTZA 5ALOA 2W6CX 5IU6A 1XNGA 4F3TA 2H18A 1H9BA 2FVXA 2XMBA 3FZQA 3DYBA 4JL8A 4TLAA 5TEVA 3V97A 4DHWA 3NTXA 3QG5A 4A92A 1PDOA 4CT0A 1U7ZA 2GAFA 5ETJA 4CEHB 3PT9A 2OZLA 4U6SA 4C0JA 4IBOA 5EGSA 3JYHA 2C2MA 3NHBA 3UXEA 4G4GA 3E2MA 2HU7A 2VNSA 2D59A 2E4YA 1PJTA 4XQ0A 4DUZB 4JYAB 3KETA 3KEGA 4BPBA 1LX7A 3RABA 3OBIA 2PD6A 1QKKA 3PLAE 3BF7A 4Z8YA 2V4UA 4FE7A 1MBZA 1FS5A 2V7VA 3T8YA 3R3HA 4IJUA 4IXMA 1AIPA 1Y8ZA 4R3UC 3PEUA 4YASA 2BEWA 2NTJA 1IBCA 2JFGA 2ZYVX 3Q7SA 4HNQA 3INGA 4MUYA 1UFOA 2EGUA 4FEYA 4C3OB 3H5VA 3I73A 3UCEA 5G0VA 1NATA 1X0VA 2VJBA 2EAUA 4KUEA 4YLEA 5C3UA 1DRUA 3NWBA 4QPDA 4QDZA 3OQ6A 1JEOA 2OLEA 3UT5B 2ZIWB 3QWIA 2PY6A 3OZBA 1IY8A 1AUQA 2NUPB 2P9QA 3H5IA 4QDKA 3UFXA 2H2DA 1GSHA 2XNCA 2H63A 1DMSA 2FQYA 4QEDA 4AF7A 1X2EA 4REMA 4C76A 5HJ5A 1ZVVA 2GZMA 4UU8A 4QATA 3I42A 1VIVA 1FXSA 2QY6A 2C8JA 3LPDA 4OMFG 1VOTA 5FTKA 2AOUB 1TEXA 4DYVA 3AV3A 2V6BA 1NQOA 4CLDA 1A2BA 1FP1D 5JAPA 3UJAA 2DB3A 2CUTA 5BV7A 3WMXA 4MUGA 2H08A 4C14A 2NYAA 4ICIA 3ELYA 2V0CA 3FPCA 1XTJA 1JTFA 4BGUA 4MWCA 3TKAA 3CIFA 2W2TA 4CV0A 2CF5A 3JD2A 2JIZD 3PLRA 3EZXA 4E1AA 4C87A 2AKEA 1EVJA 1IEVA 2IQ5A 5IAJA 3PQ3A 3K0FA 2GBCA 3FA2A 5EWMA 3TNDA 5CDFE 5EIEA 1KZ7B 2YYYA 2ET6A 4LV6A 4NEGA 3Q2OA 4G63A 4DA0A 2D1RA 4HH1A 4M49A 2F1OA 1IOWA 4KWHA 2OC4A 3VPDA 3VDQA 4OXXA 1FIUA 2QZJA 5IT4A 1NKTA 4HWTA 3H7IA 4BVGA 1U6JA 1N6NA 3TDKA 4L3WA 1QMGA 4GPEA 3B78A 4NZYA 4HYEA 4DT1A 1WCYA 1LVGA 1N9GB 1HV8A 2FPPB 2FF5A 3TLAA 2R66A 1G6Q1 2YJGA 1LK7A 1C14A 3SMVA 4DEYA 1ID8A 3OCJA 5DBIA 1JAXA 3BICA 4G1BA 5TT0A 4HAIA 3B3JA 1ONBA 2VNJA 3EHEA 2GBPA 2XMZA 4QJBA 4YALA 4BKOA 4ECAA 1MQ9A 3DOIA 4PC1A 2HF9A 2VHWA 2XNDA 1N5OX 2YHIA 1MJGA 1TLFA 1ZC3A 2FP4B 2SECE 4HFJA 3RREA 3O2SB 1UJNA 4EPWA 1OTXA 3W4JA 5KTOA 4B4VA 1A9TA 2WF7A 1VRVA 5CVDA 1UPAA 4WZZA 4M9SA 1TJ4A 1H2YA 2WSMA 4K3VA 4RAOA 5DYYA 3NORA 3L40A 4KTTE 5FORA 1HTTA 3FI9A 5TXGA 1EFLA 3C3CA 1DQYA 1WUJS 5FNZA 2FJPA 3SYTA 4LJ7A 4WZ6A 3GJZA 4N8SA 2YWCA 3HU1A 5KSYA 3W77A 2NNLD 1YT5A 3QA3E 3FZGA 1EZ1A 3LXRA 5G1NA 3V2UA 4ALIA 1P1RA 3DG9A 1PR1A 1QGUA 2DPXA 2ZSIA 3C15C 4OQLA 4RIIA 4XPIB 2JCXA 2XDQA 3MPOA 3PNOA 3FYUB 1PVOA 2HMSA 1BHQ1 1L4MA 1ZH2A 1XRRA 1W25A 2LW7A 2ODWA 4Z6KA 1YZLA 5BT8A 1KWGA 1N5LA 5JAOA 1P1CA 3H4TA 3OHMA 4NECA 5EOVA 3SEZA 4BE4A 1U4OA 5JJIA 5IANA 3ZZMA 3U39A 4YAKA 4HQLA 2CMGA 2WKWA 5FULA 3S2IA 2ZUWA 4M7PA 4MNTA 4C7OA 2COKA 4IH9A 2MYTA 4N5DA 1ZBDA 3UAOA 3SVTA 3LYUA 1JXQA 3MCVA 1SD5A 4KZKA 4MGYR 4RV5A 3ILYA 4WLVA 3I8SA 4A0HA 4ZP1A 1ZUIA 3OQ1A 1IWOA 2IYWA 5IJAA 1YC2A 1JX6A 4DYDA 4HLCA 5EEGA 5EXPA 1TD1A 2P7IA 3A25A 3L7CA 1D1TA 2JFWA 4FGLA 4RDCA 2O06A 4OIMA 2GR9A 1OFTA 2ZWOA 3F2VA 4GL2A 5HCUA 1X2BA 2J41A 3KD2A 2HHHB 2DPLA 2AFVA 4BUZA 4KXXA 3E2PA 4KK3A 1G4AE 4PX3A 1TIKA 1QQBA 3RHZA 1P2BA 2GPWA 3AUFA 4ID9A 2ZZKA 5TQ0B 1Q7BA 4YJDA 4K1XA 2TMDA 2M2IA 2FI1A 2W6QA 3TQFA 1KVRA 1NLFA 1NUQA 3OF2A 4RA6B 3IA2A 3K2EA 4JOSA 3OOWA 1HZJA 4MW9A 4JLMA 1P2GA 3WLIA 2WILA 3ZGLA 1TT5B 1NOJA 4NU8X 5EMMA 1Q11A 1H0SA 2DULA 2E82A 4EKNB 3PNYA 3V8NA 3IMCA 2OORC 1TCVA 4M53A 1N5KA 2REQB 1P4RA 1G5PA 4XEHA 1V1RB 1B6SA 4BNJA 2FFRA 4KSYA 1DARA 4EEZA 4WZAE 2QW0X 4DRXB 1H6CA 2P2LA 3V2IA 3A6EA 3E03A 4RTSA 2HRZA 1SU8A 5MHTA 3G1WA 4FDLA 4FGUA 3RJ9A 1WB5A 5JFOA 4OCZA 3UM9A 2CFOA 5KYWA 1E1RD 1E3MA 3RRNA 4Z3KA 4GBJA 4PU0A 5EJIA 3OAAA 3RWMB 1UBGA 3Q40A 2HNBA 3ABIA 3HL0A 3OWXA 4PE5B 1OQAA 1JFFA 1U2EA 4GM0A 4YT4A 1KRXA 4AJJA 3IR7A 5KVSA 1SXQA 4FWIB 4GMXA 1VMIA 1WX1A 3SCZA 3RVBA 4QTUB 2C9CA 4K81B 1ZL2A 4YRTA 4A8HA 3AONB 4TXJA 4BP1A 4O1IA 1Y37A 2PZBA 4PRYA 2RD2A 2EKZA 3KIPA 2JATA 4PSCA 3VSCA 3AVVA 4X97A 4BHTA 4E5MA 3VOTA 2H00A 4LDRA 5A6SB 4BNGA 2QIPA 3C3JA 5GJVC 1YQDA 2Q7OE 2GNPA 3OOEA 4MV4A 1COWD 4J6FA 5EKTA 2QWXA 2AN3A 1CQJB 1HORA 1PZXA 1ZOLA 1ZUNB 2FRVA 2ZJYA 4GGMX 5LZ2A 2E6UX 1EK2A 2FWNA 1IB6A 4EF4A 4FILA 1P1BA 4R98A 5LQMA 2FUCA 2REQA 1BOOA 1Y8AA 3CGGA 4KPUA 4EFKA 2ZSKA 1M1NB 1OLSA 3RYHA 5M34A 2LXNA 1AT1A 1R6AA 5LA6A 2AHRA 3LCJA 2C29D 1NKVA 2JHCA 1WHSB 3QW2A 3NFRA 1H4VB 2C82A 2FPKA 3CUVA 3RUDA 3M5WA 1J21A 3AHGA 1ZN7A 3IQZA 3PB3A 4NJMB 5A71A 1PDWA 5THXA 4J07A 4PSKA 5CNJA 4EYOA 3RVQA 2NQTA 1R74A 4L3OA 2OHHA 4PHTA 4PN3A 2FZKA 5HIAA 1O94D 4WOJA 5BOVA 4UZSA 1YBHA 2GN4A 1FRQA 2NWQA 4YA6A 2J31A 3DNMA 1QC5A 3S2EA 1GZSA 4D74A 2GYWA 3SIPA 2IE0A 1WPQA 3AVQA 5H59A 4J3NA 4DSOA 4RIGA 3M83A 4EZIA 3I9NA 1URPA 4XCXA 5BSUA 3TBHA 3ZWVA 1SBZA 2ECQA 2OTCA 1YU9A 1QVWA 1R0KA 4WXRA 3WGKA 2OXCA 1GL3A 2VT7A 4R9VA 5B3AA 3UHFA 2RCYA 2MWMA 4JITA 2F3QA 4EHLA 5BN1A 3WLRA 2H4ZA 3E3MA 3L1IA 5JYEA 5LU8A 4BPRA 1ECJA 5DBEX 4NE7A 1WLYA 2FWAA 1MPTA 5FFFA 4RU1A 4PW0A 2A7QA 1MC5A 1ZH0A 1IUKA 4S1NA 1WPGA 3HK2A 4PC3A 4TTIA 2ERXA 1DX9A 4IHKA 4C22A 5DEIA 1DMRA 2IXEA 2MINB 1P1IA 1FRNA 2GAAA 2KMLA 4TQUS 4FMDB 4BNHA 3WDLA 1JVSA 3GLHB 4QUJA 4AU1A 4F93B 4GR4A 3ILHA 1A1VA 2Q9BA 2QJWA 1CERA 3AKZA 1JDTA 2XGGA 4HYYA 5AJHA 4J03A 3K9QO 4NE2A 4DM4A 5HZKA 2KE5A 1T8RA 3ZBPA 1DBSA 1PJAA 3OIVA 4ASUD 2X6RA 1JHPA 2ZVDA 3GEMA 1N2GA 2EXXA 5LYYA 5C51B 4KGVA 2B7CA 2HUPA 1HC7A 4FW8A 3VHRA 4QDJA 4V03A 4FU0A 4C5CA 3FPSA 2WE8A 1DIOB 3DP7A 1B2RA 2H31A 3PDJA 4LOLA 4EJFA 2X40A 3NV7A 1O6FA 1JSRA 2OQIA 2B98A 2O2SA 5EIAA 2C9OA 4D3XA 5IF9A 5EXTA 4B3MB 5IN4A 1NWHA 1CHDA 2YXDA 2ECOA 3DZJA 2AV6A 3ESBA 4M76B 4WX2B 3OP1A 4QBKA 4LYJA 2AN4A 2NVBA 1O94C 1Q7TA 2X4GA 3SM9A 3M6XA 4KQJA 1JECA 3RS2A 4R6WA 2EG9A 2BTQA 2JLAA 3IV6A 3R0QA 1K3UB 2XTZA 2QU7A 3FPHA 1LPSA 2H4XA 2PJUA 1PL6A 2X8AA 2XA2A 3DLTA 3DXXA 3DL0A 3EMKA 4QBTA 3KOUA 5HIIA 4C2AA 4ZHSA 1K97A 1EUDB 3HCBA 1SU7A 1A8IA 2NO7A 4E2WA 1FVHA 1QIKA 1YR2A 2JJMA 4MK4A 3BERA 1L8OA 3EH1A 1H93A 1R4MB 1B73A 3OF3A 1E1DA 2TMYA 3ZWQA 5E3HA 4MW1A 1UDXA 1IY9A 1EEHA 3NS7A 4EYEA 1K6MA 6CHYA 2CLOB 1U9YA 13PKA 4YMTA 5JSZA 2ZYDA 5BN4B 2J0UA 4B6GA 1QX3A 5DW3A 3ZWKA 3VUEA 3ZBUA 3L4JA 1CRQA 2JCSA 4B4OA 2JZNA 2CNWA 4B4WA 2K87A 4HUQB 3LT5A 3ZY4A 4HWGA 2HW8A 2AXQA 3UFXB 2DFTA 1PG2A 3U3DA 4JYCA 1J6UA 2ACKA 3HBMA 3ZD8A 1ISRA 3EY4A 4FNGA 3MA0A 5DSTA 1DFHA 3PUYA 3ZZ1A 2WF5A 2JGDA 3RYIA 1XQYA 2FCAA 4GI7A 1J0BA 2EFJA 2QEQA 2ZYTX 3DVAB 3IJEB 4A26A 3VAYA 1GO2A 2GPJA 1GPLA 4MHOA 3ZW8A 4ROTA 3JWJA 2D62A 1R9MA 2ZT8A 2X77A 3ORQA 1UK6A 4LE2A 3OZXA 4YJ3B 4EJMA 2VHZA 2FFBA 1RHQA 1Z6GA 2XUOA 4N6GA 4ZRDA 4TLCA 3GVPA 1H69A 4YC7A 3FPJA 3RRZA 4C0WA 1U2DC 2NPIA 2PGIA 3MS2A 1WUIS 3PWSA 4IJKA 3K70C 1M10A 3CKYA 1M6VB 2R8EA 5HF5A 3K0AB 3SX0A 2VXBA 4RA6A 5C8XA 1BEUB 4P98A 4WJLA 5I9TA 3U49A 3P2MA 1EQ2A 3GXOA 4OPMA 5JE8A 3F46A 5JZBA 1N1EA 4C0SA 1DUSA 1TKRA 4IEEA 3BGVA 5AVXA 3STVA 2V54A 5ARDA 4EMSA 3EVFA 3RV4A 3K70D 3KBOA 2H1WA 3VR5H 1YJCA 1Z4JA 2VK1A 3NBUA 3LBNA 3H0CA 4NULA 4N8DA 5F3DA 5TEWA 3TO5A 4PNEA 1BW9B 4CIAA 2PJRA 3AEKA 2Q4BA 2PZAA 1GPAA 2BBTA 5AXDA 3GAFA 5ALDA 5KYXB 1GKLA 3FBWA 1B8PA 4X6UA 1IWPB 5F76A 3RRMA 3LCRA 3OM9A 4EA6A 1KNXA 2ATVA 3G0DA 3ERCA 4ECEA 2DBVO 3O9MA 3HUTA 4OBWA 1QTRA 4M1ZA 1FVFA 1NF8A 5AI8A 1O08A 1D0IA 1B7GO 2NXCA 1NMZA 3FCSB 4QUKA 4W6ZA 2Y77A 2X76A 2J4DA 1CQXA 1ZW1A 4FNOA 4G65A 3ZZNA 4EO7A 3SQXA 4F60A 4EUFA 4F8EA 3EUWA 1XAJA 3OIUA 4E09A 1KDYA 2ZRFA 4Q4LA 4ZODA 4MVJM 4HDMA 4B6OA 2CL7X 4OQNA 1LZKA 2GYUA 4Z0NA 4OLFA 5CW2A 3I37X 1KNQA 3CLRD 4JLVA 4K1LA 4QFBA 5BSFA 3R0ZA 3WLOA 2VPZA 3FNBA 2BEJA 2DQSA 3BYZA 2A67A 2FW8A 2Y0BA 4DDHA 1IZ8A 1SIOA 1JSLA 1QLWA 1T1RA 1YNSA 2A88A 3Q1LA 5DLEA 1U2PA 3PL5A 1JDJA 1THZA 1UUFA 3V00A 4EQZA 1ZKDA 2QP9X 3A31A 4L4ZA 4GWLA 2VZ8A 4NBTA 4UVHA 1VPLA 3L7YA 4CMIB 3FKSA 4JLBA 4M6WB 2RHDA 4EFDA 1XT6A 3I0ZA 3AGPA 4L73A 3CEHA 1ISPA 2C4NA 3KUDA 1Z5WA 3PC2A 4RQAA 4UD2A 4OHUA 2CVPA 1E9AA 2XGJA 1MORA 3VHQA 1IVNA 3PQ5A 1B8VA 1G21A 5KSZA 1NF2A 1O8CA 2X2FA 3PDIA 2GX6A 2KW5A 1YTUA 3OZSA 3CNBA 4E1BA 3BRWA 1ZSNA 3CUEF 1TLTA 3QI2A 3LYHA 4HB4A 4PRKA 4QOJA 5IVDA 2BMDA 2IY9A 4X95A 3OPMA 3WMRA 1H1TA 1BE1A 2GK6A 2P5UA 2H5IA 1E1QD 3FWKA 4RYLA 4A1OA 2OCDA 4YROA 1ECFA 1YI1A 4UHFA 5FA8A 5H9VA 4N3AA 5BN5B 4WGFA 3FOBA 1WSWA 2Q07A 3JVEA 1CKEA 3DZDA 1N2IA 3DGFC 3WO0A 1QHGA 3LBAA 5FXMA 3HKBA 5I8ZA 4ZKDA 2R48A 3ISVA 1O3YA 2Y68A 3VSDA 2C5FA 2ZIAA 2AMVA 3OCVA 4GUDA 1N1DA 3AQ4A 3M6AA 1O6GA 3OLCX 3SS9X 1ORVA 3TTUA 2VS1A 1Y4ZA 4XDGA 2P41A 2Q4OA 1PQPA 4OA8A 3IUQA 1CT9A 3HUDA 2PS3A 3UK2A 1JEQA 3W9UA 3FR7A 4IIGA 4Z1MA 3F3YA 1H3NA 1XDBA 2YIDA 3V55A 2JIQA 2QGZA 3LW8A 3T4XA 2YC4C 3NLLA 1NNI1 2HEIA 2PT9A 1HTWA 2FHPA 3IEIA 2AHOA 3MN1A 1P1HA 4ZC8A 3IEUA 2B2CA 5BSGA 1W35A 2AFHA 2R6HA 3CPHA 1NV8A 2F67A 5J2UB 3TPCA 5EJ7A 4JUCA 3DDCA 2EFEB 5DM0A 1P2DA 1CVIA 2J6IA 5IXJA 1DRWA 2I0FA 2IPXA 1W29A 2J4FA 4JHXA 1SXPA 4KXWA 1XVTA 5DTJA 3WBBA 1FJXA 1V25A 2BT4A 1E7MA 4UUQA 4Q4AA 3T5DA 4CQNA 1GFZA 2J1LA 3DBHA 4V1CB 1LY1A 2VCYA 4RCVA 4EVIA 1MMFB 2XVZA 1L5WA 1AXEA 4C7VA 2XWJI 2PXXA 4BQFA 3NIWA 1EDDA 3MD9A 1GQFA 3C6QA 5CB4A 3KJHA 6REQB 1IVYA 1IM8A 2CD7A 3U3XA 1AN0A 2GN9A 3FHJA 4XYEA 3LOUA 5JNLA 1D2AA 2VHVA 3QBVA 1ZR2A 5FFMA 1NVWQ 2JJ1D 4X94A 3EZYA 4RKFA 2BCEA 3GZJA 4Q66C 4ENSA 1EI9A 2ZJ4A 2BJVA 2Q4DA 4YJ2B 2PMDA 5T4EA 4YV7A 2IYSA 4CTKA 3WRXC 4F3CA 1VXOA 2DOKA 5AJTA 1ZH4A 1NZJA 1Z2DA 2CCJA 3D43A 4YRRA 2ZBQA 4FT4A 5DKFA 3TRIA 4BO6A 1CZUA 1I8TA 2YY5A 1X1CA 3G7NA 1ZITA 2Y27A 3H5TA 1LRJA 3HB9A 3MLBA 1YGYA 4Q9NA 4YRLA 4LJYA 5DU2A 1RQNA 2PX0A 1VE5A 2Q0SA 1EA5A 3L8EA 4N01A 2VF2A 4DABA 4Z7NB 5DLDA 4F56A 3L9XA 3CQ9A 4ND4A 5EHNA 2XT9A 3WIEA 2WP0A 3F7NA 4M0CA 5FLXA 2F4NA 4P4LA 3T5AA 3VO2A 4Y1EA 5LYJB 3K8OE 5IJWA 1H42A 2XW6A 5BWLA 4L28A 2C0CA 2QT1A 3BX1A 4QJ4A 1OZAA 5AI0A 4EPYA 3ND7A 1K0UA 2I2XB 5KX5A 5DYTA 1RCTE 4DPLA 2JANA 4N3NA 4C7BA 4DCOA 1ATIA 3KQOA 4MUJA 3RAPR 1S4MA 4HVTA 4CMCA 2PUAA 5CEJA 4UEOA 3FCCA 3R41A 3QVGB 4XRRA 4HAZA 4BZZA 1LK5A 3ZNPA 1SO8A 1KAEA 2GZ1A 4Z51A 3PX7A 1OZ0A 3G5MA 1VJ0A 4KQMA 4XZ3A 3O3NB 3DCNA 5CHYA 4OXKA 4IH4A 5DRYA 3ZJVA 3V6MA 5CU7A 2QTAA 3CLSC 3CU5A 3MUOA 4BDSA 1MW8X 4FPXA 3MGAA 3QEJA 4YJFB 1DQSA 5AHOA 1USIA 5SY6A 3GRPA 1NR5A 1NVXQ 4YRIA 3ILVA 2O8CB 5K0JA 1OSNA 4J91A 1Z73A 5ENZA 2YJ4A 1GCIA 2X2OA 3WLEA 1FL9A 5DGXA 2NU7A 3IERA 4YTEA 3T7SA 4XXHA 3AP3A 2G28A 4WJZA 2VLIA 3FZEA 1KGSA 2Q3MA 3ORHA 3PNVA 4X8LA 2AYYA 3QVSA 3SKYA 3U7QA 2ZUEA 1CUEA 4URWR 5AXAA 4DNFA 4CEHA 2C2XA 1T9CA 3L79A 1NUSA 4HWOA 5FEUA 4Z9YA 1QWSA 2HWUA 2XE4A 3NHZA 5M2QA 3OM1A 1K5GA 3M2TA 4YCJA 2Q0QA 3WFIA 2GSDA 1AHNA 2H5JA 4DLPA 1WSDA 5CW1A 1FB5A 1H1DA 4OVKA 2VTKA 4J9VA 5CLQA 3VPAA 2JZCA 1RR6A 2DETA 4RVSA 3D6UA 3NBZC 3OPYA 4MO9A 4OGFA 5CVCA 5E2AA 4CKYA 4K0KB 3O93A 2RB4A 2FZCA 2K5UA 1KKMA 4HOYA 1UBNA 1D4OA 4BNKA 1XWIA 4ZEOA 5I7AA 2X8WA 1O8BA 4BBAA 3R7AA 3U56A 4FN4A 1YNOA 1JJVA 1Y34E 2WUWE 3E81A 5JAUA 2B3DA 7YASA 5LWHA 5KOHA 1FDRA 3NHMA 1CEYA 2O8VA 3E9MA 1Q15A 1U94A 4ZHQB 1KETA 1D04A 2Q2NA 3K1YA 4LK2A 4MEAA 5ARCA 3MC1A 2NZYA 3NDPA 3T1NA 4Z54A 2DWQA 4LNUB 4AL4A 5DDIP 1CUUA 2Z2KA 6PFKA 2J3IA 2EIHA 4BKMA 5FUQA 1N2CB 3Q6NA 2K7FA 3AY3A 1PQUA 1WMEA 5K3DA 5IULC 2R60A 5BWNA 2OD7A 3OOHA 4OMDA 4DA9A 5M7EA 1RLJA 1ZEMA 2BM8A 2P5YA 3NEAA 1R6XA 2C96A 4QGFA 4JVLA 1JSCA 2B1GA 4JD5A 4M88A 1VKZA 1ABBA 4PZCA 3RLIA 1EUDA 3AH8A 1BX3A 1J5PA 3E7PA 3M2PA 1TQ2A 2A84A 2B82A 3M9WA 4YCCA 1JLRA 1X1QA 3TIFA 1RC1A 2MMGA 3TIIA 4JOBA 3VNRA 5JQGB 3QZUA 1C0EA 1OLOA 3WYFA 1QYWA 2RK3A 3NT4A 3PJFA 4LPKA 1CR0A 5A0TA 1J39A 3D64A 5I5EA 2R2GA 4JB2A 4HG2A 4X54A 4B34A 2RGEA 4BGVA 1LBSA 1CS0B 2HIHA 1VMEA 1ZA2A 1SXIA 4EA7A 1JB1A 2GA8A 1EP1B 2FKNA 5EMKA 3ZIAD 1NM5C 1SVUA 2IE8A 5HKLA 3W79A 1NW4A 2FPIB 4DMCA 3USZA 1E99A 3KR9A 1UKVY 1IG3A 3P94A 4TKUA 3NIFB 3F4BA 5TGZA 2HLHA 1OLUA 3RRJA 4AQDA 3O9ZA 1O58A 4NJEA 5B1IA 1V8OA 1X8XA 4U2EA 3F4LA 1U9ZA 2J0QA 1MG5A 1VM6A 2VDOB 1G8HA 2H5EA 1S9HA 2W6OA 4WACA 3QYFA 1VG9B 5KTYA 4RF5A 1F8UA 4QUAA 3BSWA 3EA0A 5JVDB 4MMYB 4WGGA 3RK4A 1N6KA 3E8XA 2FMKA 3FHOA 5L4NA 1RVV1 1QVRA 1VPEA 2D0PB 1JFVA 4JIGA 2QN3A 2VDRB 1ZL0A 3HJBA 3HZOA 5FOUA 1GY8A 5ECWA 3LNCA 4S1PA 3J81A 3H8SA 3STXA 1PYDA 3MRSA 3SS8A 1HI9A 1N5DA 1U7WA 2B30A 3LZ6A 1RQRA 2IEBA 5LJIA 2BGKA 2V4MA 5CNIA 2EL9A 4O4IA 2XSZA 3R0JA 1W19A 5DMHA 4NWIA 1PR2A 4E94A 5KNCA 3JQ8A 2YRWA 4K9QA 4QLBA 3SJZA 1QHHB 1MIHA 5IC4A 1DKQA 4L0MA 4AMBA 3E7XA 1TPZA 1ZC4A 3CS3A 3JD3A 4GPIB 3NBXX 3TTYA 4DLXA 4BO0A 3WOVA 2OB1A 1DC3A 3S1SA 5F33A 4B6EA 4QD3A 1VKNA 3EWSA 1BCSB 1YVPA 4TZKA 3CF4G 3THWA 3R9XB 1ESCA 1WMAA 2HBRA 1H6BA 3EARA 1G8JA 2CJFA 1NVEA 3W6ZA 1QYVA 3F9IA 1PZEA 5AVRA 2V7QA 1SGWA 1MUUA 1YFJA 4DMRA 4KH1A 4QNNA 2ZUBA 3TL3A 3MTEA 4LVCA 1DT5A 1Y7LA 4LHZA 1V43A 1D2RA 5T41A 3IP8A 3U80A 4UMDA 1L5SA 10MHA 5I7HA 4DT1B 3V46A 1P4SA 5I8PA 4YCSA 1XI2A 4U1RA 3OTHA 3OZVA 4IIFA 1BHSA 5LB4A 1F8XA 4HLQB 4UVEA 1ZINA 4EJSC 3IUBA 4NMWA 1UZAA 3TZLA 4GECA 1FSGA 4X62B 1QNFA 3VHXA 4D5GA 1IUOA 2R97A 1O0SA 3KT6A 4AYTA 3OE5A 3S29A 5JS8A 1SD2A 2FOLA 3FX2A 3UO8B 1ZS9A 2O3RA 3SDSA 5KEIA 3GLIB 1EDOA 3HBFA 4PZLA 3WLAA 2WVJA 1QIDA 4GNKA 5BSWA 3DMHA 1D0VA 1IK4A 2OYSA 4AYWA 1EQAA 1K68A 1UBHS 2ZYUX 5JZ9A 2M1ZA 1JA9A 3FPEA 4ND2A 2H9IA 1WAMA 4CMIA 3JTEA 1XVAA 3SSMA 4CM7A 5CIQA 1X1BA 1YWGO 2QG9A 1RJGA 4ZOLA 3WJ7A 1Z3IX 2X14A 3IDSA 4KQCA 1HG0A 4MYTA 3BXPA 3KEMA 3K9HA 5U1PA 3CUUA 3FFWA 2RHOA 1Q1BA 4W6QA 1DIAA 3N86A 2F1IA 2O54A 3SX4A 1M74A 3AR5A 2QXUA 4TSRA 3HDGA 3ZQUA 4CM4A 5GZ3A 1A8PA 4A10A 5FFNA 1NW5A 3GLTA 4FDUA 1PFUA 1OYOA 3U6KA 3AX6A 1SCBA 4Q21A 4G25A 4DDUA 2LCIA 3FKQA 1DAHA 1LF0A 4HN4B 4YNBA 3FSEA 3RBAA 4CLRB 4LF9B 2VQ3A 2R6GA 2G9NA 3HDQA 3EPLA 2GI4A 3GFPA 1OFHA 3DFZA 3LKVA 2MOKA 1T8TA 1REQA 1GGMA 4HEHA 1TYZA 4K87A 5FUBA 5KSWB 2YS7A 4QTTB 3LVBA 2PMKA 4XB6B 1Z06A 2RI6A 4E88A 1P73A 2OGUA 4E21A 3IHTA 1K8XB 4J76A 5EP2A 2A9FA 1IXYA 4BCDA 1P60A 5HK9A 3ZD9A 4ZHQF 2JGFA 2NZUG 3P9KA 4U02A 1O1YA 2EDAA 1FTYA 3H2GA 4AULA 4BN4A 1DINA 2OVBA 5J47A 2FH5B 4FHCA 1YBVA 4WN9A 2HJHA 3SD7A 4MITA 4CQMD 2FMTA 3TLXA 3CRMA 3PNSA 4GWKA 1LCIA 1K63A 4XGRA 1TAQA 3A3YA 3GRYA 3CUWA 1MCZA 1P2UA 2A9PA 3G5UA 2WWIA 2H17A 3B3AA 1G4UR 3QLJA 4RTJA 1Z0AA 5BUZA 1GG5A 1GPH1 1L7QA 3BHNA 3MB8A 3MT9A 2JLVA 1GCAA 2GJKA 3PNLA 2QPLA 1JYFA 1QZTA 4IZIA 1D4FA 3ICVA 1EG7A 3HA7A 3RVJA 1L7PA 3AZOA 2NYRA 4B2PA 4DJDC 5F77A 4AMVA 1ZD1A 1VHTA 3IQHX 3SEAA 1C1XB 1DXQA 2P65A 5CA0B 4X92A 5H16A 1G0OA 3G2MA 2HTFA 3BM5A 3WGTA 4JIMA 3MXTA 4EDHA 1Y4SA 2L19A 3ED1A 4G07A 1V1RA 4AZTA 3O90A 1XMVA 2O7NA 3BXHA 3DEZA 4DANA 5B3KA 3RDPA 2R25B 2I7DA 1QO7A 3P9IA 2BOVA 2V55B 2WWVD 1IN8A 4KE7A 4C6SA 1GDTA 1HFJA 1N2ZA 2DTDA 2ZTHA 3A2LA 4E4RA 4DMKA 1U9JA 4D1YA 1EWKA 4L6CA 2DX7A 4H3KB 5ALXA 3UA4A 2BP7A 4ZPXA 1G21E 4CNQA 3PJEA 1R16A 4GVLA 5COQA 1JKIA 2JI4A 1TKAA 2Q1XA 1ZCJA 3PWKA 4GPAA 4Y2SA 5HVNA 1LEHA 2ODBA 2MYNA 3CR7A 4N03A 4RJ2A 3G79A 1GHTA 2XCIA 2JFZA 1HRDA 2C3MA 4RE5A 3KQSA 2DBQA 3ND6A 4JYMA 3VGPA 3ZHCA 2HA0A 2XRFA 1EG2A 4KVGA 1HNWB 4RESA 4OSOA 1L5YA 5K4GA 5I7RA 4DZTA 2OCBA 2QGNA 3GJYA 1L4FA 2II6A 2J0EA 5H3CA 3SSAA 4DNPA 2PXHA 3THYB 3P4XA 2YIJA 4JJ7A 3JQ7B 4R1SA 1US8B 1ZCBA 2FXIA 3DVSX 4BFTA 1E2MA 2B5OA 3TLKA 4OK6A 1X9IA 2P3QA 4HNHA 1RS0A 3TD9A 4ZYZA 2FUNB 4WBXC 4MRSA 3UXMA 3P9SA 1UIRA 3EZGA 4XWGA 3D3NA 3LHSA 4F4FA 2Y1KA 4IIBA 3DAHA 1Z4QA 4ZYTA 1HKHA 2FPOA 4HB0A 3S28A 2QUJA 1DKLA 4HSGA 1KH2A 2PWZA 3J81k 4FIZA 4KYTA 1MGOA 3KX2A 4D98A 1GTRA 4U2GA 3BZBA 2PJDA 5HTOA 1RHMA 5BVGA 3I4LA 1L8LA 1SAYA 1TZCA 3VR2D 3QENA 1TVKB 4MQLA 2HJSA 4QFDA 5DYWA 1JEYB 3E22B 3E3LA 2ZUTA 3WOHA 5DXJA 4A1FA 2BYTA 2Q6LA 2JIMA 2PFGA 2XMPA 1T9KA 2VP6A 3HCCA 4AUNA 4HSEA 1VL6A 3ZG6A 2OLKA 4HNUA 4H17A 5COAA 1JLKA 3HRIA 4MYSA 2G36A 2TECE 4IMJB 3FN4A 2ZQYA 1K88A 2VSYA 4J4BA 1TEZA 1DO2A 2BFDA 3IL2A 1GTSA 3UK1A 4ZOQI 4JX8A 3VR1A 2OBBA 2GNOA 3KYJB 4LRQA 2BFPA 5D3MB 4ZAZA 2L2QA 3HSYA 2C1ZA 2IBSA 4FR5A 3LCVB 1XD2A 4H16A 1Z17A 3UA3A 3DXFA 4NZNA 4Y2HA 2FWIA 4TWJA 1QH0A 3IHLA 1CU1A 1OI4A 4P8RA 3GLGB 2WHPB 3AIOA 3I6MA 5LM3A 1QU2A 2A58A 1W4AA 3A37A 3VR4D 4JH0A 2PYZA 2W93A 4QTYA 1C9JA 4O2BF 4RDXA 2XQIA 2HSDA 2ZJ2A 3UJHA 5F2NA 2ZAGA 4L57A 1P3Y1 3K6SA 2B4QA 3FLAA 4I19A 5L3QA 4CGZA 4J16C 2JEOA 2WLTA 1E79A 3IT0A 2LP4Y 3CCCA 1GPBA 1ICIA 1DFGA 2V97A 3VSAA 4CDMA 3HFGA 4Y3UA 4M36A 4TMZA 2PANA 4JLSA 3TLZA 4JGIA 3K9GA 5E8JA 3PIRA 4ZICA 2IU0A 5FJIA 2NPOA 1E7QA 5CA1B 1ZK4A 3RUPA 3EPPA 1J2YA 3HP7A 3VR6D 4NS1A 4E2YA 1YH3A 3T9BA 1MRZA 2ONZA 1B6GA 2PN1A 2XOEA 4RX1A 5A9RA 4WJKB 5K7SA 1TZJA 3M6LA 4NCNA 1C1DB 2R8BA 4WNIA 4CG3A 1MHPA 5BWMA 4AF6A 1XVIA 2OV3A 2DUJA 4RSRA 4WXYB 2A5DA 4HDMB 5WRFA 6AT1A 4EENA 4OQQA 4YQFA 4PGHA 3CVVA 3NDBB 2CXOA 4F86A 1PQYA 1G18A 4NBNA 1Q1ZA 1ACMA 3II6X 3EJ6A 5DASA 1FLDA 4QTXA 1NM5A 2BHSA 3GCDA 3BIOA 4GVPA 1EE2A 5CEFA 2Q3CA 3NQ41 4LQCA 2J8ZA 4W9NA 5IDQA 1EJ6A 4EJ2A 1O9HA 4OFBA 4G81A 4UM8B 1RW4A 2TSYB 3KAKA 2FETA 3BXEA 4EITA 4L9WA 5AVJA 4AJ4A 1C7QA 4NU6A 3ED5A 3MCUA 1PKEA 3PEYA 4TM7A 2IU3A 3U3MA 4D4JA 1DUVG 3DZHA 3H9EO 4QUBA 5IBQA 5JDIC 3WV5A 4MS4A 3RYTC 1RFLA 4H7JA 4COOA 2NSYA 3TZEA 2DCUA 1Q44A 1TAHA 2BBWA 3AV0B 4O2AA 3LLCA 1XO1A 3AUXA 3DB2A 2VPIA 2QUHA 4BIIA 2Q7XA 3DE2X 1OI3A 4B85A 3K0AA 1RI3A 1QRTA 4PNZA 1TTPB 4LHYA 2ETXA 2EWWA 2NG1A 2ZJ3A 1N7IA 2GKOA 3EEIA 2EKLA 1HDXA 2ATCA 2CK3D 5EUMA 3EZNA 2B92A 1IU9A 1IH8A 4Q6WA 3TXAA 1VIDA 4X9XA 1TGYA 4IO0A 2P4EA 3I34X 3MQ2A 3WIBA 4JL6A 3TMKA 5E9WA 2NO0A 3EQ7A 5AVKA 1W88A 1QP7A 3QYPA 4FCCA 4IIHA 4QPPA 2YFHA 1B23P 2B37A 2UYGA 1QHXA 1M83A 2YJZA 3KAQA 1KJYA 4OJMX 4JODA 5KDLA 4PZ0A 3ZHOA 1YFLA 3IC5A 3WC4A 1XTVA 4C01A 3KLBA 5FBQB 3SGLA 2JF0A 2YH2A 4YUYA 2QVCA 3WTBA 4M9UA 5LA6F 1Q1QA 1F17A 1ZCAA 3B5EA 1WXWA 3NKVA 4ZPJA 1IQRA 1KJZA 1Z0DA 5DSXA 5GJWC 5GPBA 1JP7A 3FBTA 3B9RA 4K2AA 2WZQA 5JYBA 3DKIA 2G63A 1H8HA 2YVKA 4K26A 2PZMA 3N6VA 4ABTA 5DW0A 4PZAA 4DLKA 1GQQA 2OBYA 2LCQA 2J08A 5BQ5A 3JTMA 2IZ0A 3R4CA 4X20A 5CJJA 1OFUA 2VHTA 3I09A 4M0KA 3TNJA 3LO8A 3TX2A 2ODPA 4E1VA 4V1CA 2ZI7A 1GNSA 4IJ6A 3W9BA 3UMFA 3AUUA 3DWGA 3UH1A 3NYQA 2YZGA 1C81A 2M6KA 4CLOA 4GP6A 1G6OA 4YT2A 1C7IA 1YB6A 2WMOB 5L51A 1EXVA 1FFYA 3TSYA 3GNLA 1SIWA 1TX4B 3GJ3A 1DCFA 2BI4A 3PNQA 1GIAA 1QBKC 2RJOA 4KGZA 2FN3A 1DEXA 2GNAA 3B12A 5AVQA 3F8SA 1AK1A 3GNTA 1QAMA 1WP4A 2SCUB 2WU4A 3MT0A 1A4RA 3K5HA 1RJEA 4E12A 3L4KA 4RHCA 4Q5IA 1GR1A 3UK0A 4ACAA 1P39A 2ST1A 4R83A 1GRQA 5I9LA 1GQOA 2J0VA 2FP4A 2I4LA 3M1LA 1NVGA 1RM3A 1ZI9A 1UBMS 1U7PA 5E95A 1ZJJA 4RK4A 3ZIAA 3H7AA 2ONKA 2ANBA 2WP8J 4HTFA 1D03A 4WRRA 3L8GA 3OT5A 1DAOA 3BD8A 3Q8KA 2KBEA 3M5PA 4LOIA 1V4VA 2P40A 4MRAA 3VBCA 3DPSA 3U3JA 4HAXA 4DA4A 1SCJA 5FADA 1E7YA 3ABSB 3CLKA 4LXQA 5DHSA 5HJ7A 4R54A 4TVSA 2O2JA 3C39A