4QRIA

2.35 angstrom resolution crystal structure of hypoxanthine-guanine-xanthine phosphoribosyltransferase from leptospira interrogans serovar copenhageni str. fiocruz l1-130
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
171
structure length
157
Chain Sequence
SDILHPRFSREDISQKVKSLALQISEDYKKLNPIFICVLKGGVYFFTDLTREIPFSVEINFVQARKIELLKDIDIDLSDRHVIIVEDILDTGFTLQYLVRHIFTRNPASLEIVTLLLKEEFPVKYIGWRIPDEFLVGYGLDFDGRYRNLPDIHVLEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypoxanthine-guanine-xanthine phosphoribosyltransferase
publication title 2.35 Angstrom resolution crystal structure of hypoxanthine-guanine-xanthine phosphoribosyltransferase from Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130
rcsb
source organism Leptospira interrogans serovar copenhageni
molecule tags Transferase
total genus 45
structure length 157
sequence length 171
chains with identical sequence B
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 2014-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4qriA00
1Z7GA 1QK3A 1TC1A 1I0IA 4RHXA 1I14A 1G2PA 4ZFNA 2DY0A 5KAPA 5JSQA 2E55A 1OPRA 2VFAA 5EUCA 2HCRA 1G2QA 2JBHA 1BD3A 5BQOA 1BD4A 1DBRA 1I5EA 4M0PA 1D6NA 1ECJA 1NONA 1O57A 4RV4A 4M0UA 3OZFA 3LRTA 4S2UA 5HIAA 1JLRA 3EFHA 1A96A 1J7JA 2JI4A 1IBSA 4P86A 1A4XA 1V9SA 1ZN8A 4OHCA 4P80A 1Y0BA 4TWBA 1JLSA 5E38A 4LZAA 1YFZA 4RANA 1QCCA 4WN3A 1A98A 1QK5A 3DEZA 4P3KA 4P83A 4RAOA 3ACDA 5ESWA 2P1ZA 4RQBA 1VSTA 1XTUA 4PAWA 4RAQA 3KB8A 1XZ8A 3MBIA 4LYYA 4QYIA 1ZN7A 1VCHA 4RHYA 2FXVA 4LZOA 2JKYA 1WD5A 3ACCA 5BQPA 1STOA 2PRYA 1LH0A 4WMLA 5K51A 1ECCA 2JKZA 1P19A 3DAHA 3M3HA 1A95A 4X44A 3N2LA 4RABA 3HVUA 1OREA 1P17A 4Z1OA 2H06A 2H07A 1ECFA 1ECBA 2IGBA 1TC2A 4X45A 1GPH1 1DQNA 2H08A 4FYMA 4P81A 5BRNA 1DKUA 4JLSA 1BZYA 4QRIA 1U9YA 1VDMA 4MB6A 1UFRA 4JITA 4RADA 1L1QA 4RACA 3S5JA 4IJQA 1W30A 4LYGA 1PZMA 4RHTA 1OROA 2XBUA 1HGXA 3QW4B 5IAOA 2C4KA 2YZKA 4PFQA 1I0LA 1O5OA 1U9ZA 4M0KA 2PRZA 3ACBA 3H83A 5JV5A 1A97A 4F8EA 1L1RA 3LPNA 1HMPA 1P4AA 1CJBA 5KAMA 1UPFA 4RQAA 2EHJA 1MZVA 1XZNA 4RHUA 1XTVA 1P18A 1A3CA 1DQPA 1G9TA 3MJDA 4P82A 5ESXA 1DKRA 1QB8A 1QB7A 5HKLA 3GGCA 3O7MA 1QCDA 2AEEA 2GEBA 4LZNA 1I13A 5IPFA 1ZN9A 1FSGA 1GRVA 2PS1A 3OZGA 1AO0A 3GGJA 1ECGA 1UPUA 4KN6A 3OHPA 4P84A 3G6WA 1G9SA 3DMPA 1XTTA 4QYIB 3GEPA 1R3UA 1QK4A 1NULA 2WNSA 3NAGA 5BSKA
chains in the Genus database with same CATH superfamily
4AQYB 1SZPA 4H27A 3P52A 3TPCA 1BQEA 2WHEA 5F7XA 1NT2A 3DFIA 3PEFA 3V5NA 4BFZA 4ANFA 1K06A 4BO1A 3ABSB 2BF4A 4PLPA 4EKIA 2VSYA 1QFSA 2RHBA 4D9CA 1D2AA 1I9GA 4KVAA 4YT2A 3UJ6A 2B4YA 5A0FA 4E4RA 2AT1A 3Q12A 4GAEA 4GW3A 2FDRA 5AHXA 3LKBA 1JYSA 5CU7A 1X0XA 3TLXA 1CQZA 4F9TA 2H9IA 1KO8A 1E2KA 1OAAA 2LKCA 3DBHB 4HH0A 3ZQUA 2P9HA 4OYHA 3MWDB 5LA6B 3E5RA 3THSA 3W5SA 1BN6A 3E5HA 4AJHA 1EVZA 2R25B 3OJLA 3ASUA 1AHPA 3K73O 4CR6A 3TOZA 1T1IA 4QC2A 4IDFA 1U2QA 1EHYA 3L7NA 2JB9A 1G8HA 1JFRA 1XHLA 2ZJBA 3AJ8A 2MDTA 3F7NA 5AMXA 2XGOA 1XRNA 2JDID 3AEUA 3VZQA 3QVJA 3KT8A 3L7DA 2OOKA 3ACDA 3MM4A 3KAPA 2E4ZA 1K3TA 1ULAA 4R41A 4HLUC 4INJA 4LDAA 4QEKA 3EK2A 5EHNA 2CYCA 2PZGA 4Y2PA 1WUYA 3BILA 1NXTA 1Z2OX 3MWYW 3IQGX 4Z0TA 5DISB 5AHOA 3FUCA 1OH6A 4OQXA 2PVCA 1VSVA 1KZ6A 1PX2A 4G1FA 4GOLD 4RIFA 3I64A 3I6QA 2CV1A 1I5RA 1N25A 3R5JA 2ERXA 2PBRA 3N2LA 3AL2A 3HU1A 2H06A 3M8KA 3SSNA 3UATA 2YIDA 3AF2A 2X2OA 1M5UA 2G67A 3K9WA 4YP0A 1J0EA 2ODAA 3NHBA 3OKCA 4FYMA 5JI2E 3CLHA 1YXMA 2CE7A 3Q11A 2Q27A 5IC6A 2P30A 3C3JA 1UKEA 4KOAA 4JXZA 3IE0A 3RI3A 2B4TO 3ADBA 4KDRA 1D3AA 2WT4A 1R8SA 4LNHA 1II0A 3JRWA 1A8QA 3PQEA 4HAOA 3NRJA 5CH5A 3RSQA 3IXLA 1QIIA 3BE4A 2JIDA 1RAIA 3BHNA 3OKPA 5JXGA 1U80A 2ZETA 4RJJA 2FPIA 3GLIE 4B87A 1W0JA 4AZ0B 5C8VA 4D9JA 4IY1A 3QNWA 4G5FA 3GXOA 2AN1A 2MYTA 4IWNA 5EA2A 1LLUA 2UKDA 5C3UA 1WPRA 4UDYX 1KK2A 2JGRA 3SKVA 5JSKA 4AMGA 5FUXA 1U7TA 3AFMA 1ZZGA 2VCEA 3AR5A 3JYLA 1DFHA 3JD0A 3DOEA 4EGFA 3DW3X 3MW8A 1KFBB 2MYUA 4NBUA 3VI4B 3ABQB 3SD7A 2ZAMA 3G7SA 1F4LA 1GUYA 3CLSD 4GRDA 4P9NA 1AXRA 1IDOA 3KXPA 4FFVA 2GCIA 2D1QA 1PWZA 5CYPA 4L08A 1T9CA 1U0JA 3R9XA 2YYSA 3VNRA 4KWHA 4NJEB 1DG1G 3PZBA 4HTAA 2ZJYA 4GE0A 4TQ9A 4WUVA 4BNVA 1OE0A 1J4AA 4PAOA 5LMUB 2JFXA 5EHQA 4XIYA 4YPFA 1Q5PA 1YBMA 2BOVA 2EYQA 2B1RA 3Q6NA 4K6MA 2WG1A 4IWXA 4OHXA 1M1UA 4RK4A 4DLBA 5BVHA 4EJFA 4ETWA 2WSIA 3DV2A 3K5HA 2YYZA 3OX4A 4R2JA 1X94A 1EX1A 3GFTA 3LIIA 5E0KB 5JD6A 4MRRA 2HGSA 3FGPA 4BO3A 3KXKA 2FCRA 1SZJG 3DF7A 4ZJUA 1L5YA 3QVTA 3FSGD 5HF6A 4FFWA 1YE5A 4ZAYA 1II8A 4HZIA 3VAAA 3WGVA 3DDUA 1QQ7A 4MVJE 1AU9A 1CRPA 3N5CA 1B14A 3ZK7A 3NH9A 5FPHA 2K6GA 2O0MA 3D4PA 1UMDA 1AQ6A 1KYQA 2G76A 3NXSA 1JHZA 3OQPA 4MVYA 2YNMD 3C98A 1AX9A 4TS9A 4UDXX 1EESA 2VTVA 5FYQA 2H59A 1KYVA 4AIRA 4F3CA 4ZO4A 1SIOA 1TYAE 3LQRA 5HPYB 1PKEA 1Y0BA 5C7LO 2H5IA 4Z4IA 3U1BA 4UTXA 4AF6A 4KPFC 4PIVA 4OXNA 4OGKA 5GQSA 2CD7A 3GT3A 3PHCA 3DUWA 4BZXA 5AQEA 1YA4A 2A5FA 1NFFA 1XJWA 1TAUA 4OATA 4ZV7A 1P73A 2QZSA 2X1VA 2PG3A 3OZUA 3T4EA 3ACCA 2H1IA 2IUYA 2UVQA 1ODSA 5SYMA 4QLAA 3EEQA 3E18A 1GAQA 1PL0A 3BQ9A 1POWA 2QTRA 1GEGA 3PQ5A 1AQUA 5J4HA 3D5EA 2LD4A 3LL4A 5L4SA 4Q5IA 4CW7A 2ZVDA 2V0GA 3Q0IA 4WK4B 2EF0A 2VSNA 4BFTA 4CXMA 3RK1A 1G41A 2J0UA 4GI7A 1QRUA 1Z7EA 5JCOA 1ZK1A 3IKJA 1PK9A 1JXMA 2WFZA 2XWJI 1OI2A 4I6GA 4CPDA 5ALYA 2A57A 2R68A 1Q0HA 1H2ZA 3H7AA 1GTSA 3GLHE 4MKHA 1QQ6A 2G83A 2KYRA 1WF6A 2M1XA 1IY9A 3CT6A 2EX4A 2M2IA 3ILHA 2ZYWX 5EXTA 5F51A 4ZVUA 4PEVA 3RFXA 4D02A 4DSNA 3EXHA 1HGXA 4E4YA 4JUAA 2D1TA 2Q49A 4XUEA 5GADl 5CEFA 1K98A 2QWXA 2VWQA 3G02A 1QOZA 2BZ1A 1ISHA 2M6SA 2VHCA 3DNMA 3B7WA 3IQFA 4MTLA 3TIXB 4C0HA 4P32A 1IY1A 4D46A 3LPNA 2DJIA 1P4AA 2PT5A 1DAHA 3OCYA 5COBA 5ISMA 2R7KA 2Q4TA 4XWAA 4N41A 2OCBA 4DMRA 5LDDC 1BX3A 3PUVA 5U4QA 2PGIA 3VR2A 4K9DA 5ER9A 1E64A 4FQ8A 2L0XA 2ZEJA 4QPJC 1NY5A 3GJTA 2OBYA 3K09A 1SK8A 1LQ2A 1XC7A 3WC4A 3U13A 1XPUA 1IPHA 1EI9A 3I8SA 4YRCA 1R37A 3PT5A 2VT6A 1V45E 5IVDA 2OMEA 3VKWA 5K2MA 1Z0KA 2BFCB 2KLHA 2P9GA 1U7WA 3AUKA 3IKLA 4I9HA 3AOEC 1PL8A 3BK7A 4BGIA 2PUAA 5F73A 4OXRA 3OLQA 3MUEA 1U6IA 2NZ2A 1ZL0A 3EDRA 4JROA 4NAHA 4YBRA 4EG1A 3GARA 3VKHA 1ZO8A 2O1WA 3HLTA 4DJFC 3WNCA 1X1BA 3AI3A 5CBKA 2QENA 2IA5A 3Q8LA 3UB3A 3TEMA 3VVBA 2NAFA 1IWBB 2BR4A 4IGIA 1QWOA 1ZUNA 3OPXA 3EGVA 3HDQA 3BZWA 3EZ6A 4L0CA 2BIFA 4C4ZA 1N6LA 3K1AB 3V8RA 5AQ1A 3LY9A 3FZYA 1TYZA 2NO5A 1XUOA 3F9RA 1IJBA 1YZYA 3W9YA 1NL3A 3EFOB 3BTOA 2B1GA 3WK6A 2PGDA 3IUPA 2YV2A 2V7GA 1Y7TA 1PJRA 4TUYB 3AEKB 1QZTA 4GXRA 1DELA 1M1NA 3OLWA 2ERYA 4YJ3B 1LW6E 5DBHX 2GCEA 4AMBA 5C8YA 4BVEA 4BV9A 5LMCA 2QTCA 3KYJB 4U0JA 4WHMA 1DUSA 1RT9A 3EVZA 4BFVA 2IZ1A 3KSBC 4MLDA 1U3WA 1ZA2A 4RQUA 2ZE6A 3A0RB 1T2EA 4KRGA 1SBZA 1QLJA 3F3KA 3UJBA 3DKVA 5FL3A 1JEYB 2XAAA 1DC5A 4HJRA 2GBLC 5EMMA 2WD7B 1L8OA 2A9PA 3I9V6 5F23A 2VJOA 3UMVA 1H8ED 4OB8A 3DDSA 5LQDA 3OFJA 3AR6A 3AP3A 3UAGA 1ETUA 3WIEA 2B7BA 2EAUA 4DSAA 4FWIB 4K7JA 1XZPA 5BSUA 2WHXA 3D7SA 3DXFA 4ZCQA 1H22A 2O2GA 4JR0A 1NVDA 3D8NA 3W8EA 1HY3A 3N0TA 4KLNA 2G4VA 4OI0A 3UM9A 1O97D 1Y1QA 3WIBA 1A76A 3EJ6A 3INYA 1GPBA 4WADA 3P19A 4TTVA 4EEXA 2J09A 2NZWA 4MO2A 5BVGB 4ZVRA 3TAXA 3ZCTA 4BMZA 2D1YA 1NRXA 3LMKA 5L95A 3RJZA 1IWPB 1TU4A 3PC8C 2WWYA 4OJQA 2AVDA 3NORA 4ADSG 4D97A 4Q1BA 3S28A 6ADHA 4KBYA 2HQOA 1O4WA 1ONPA 3FWNA 5CRIA 3S2YA 2XYGA 1SCUB 3SQDA 1VLVA 1SUCA 3I2JA 4ZI7B 1KNQA 1YNSA 2PSEA 3GT7A 3SLKA 3TR0A 1HK7A 2Y1KA 4Q9DA 2A9FA 4G36A 3T3PB 2ORED 2YJNA 3MN1A 4HB2A 4UARA 1QKJA 4MQFA 4PYIA 4M0KA 1H2EA 1KBOA 4K40A 4JUFA 1QYWA 4IZHA 3TKLA 2XCLA 3VR3D 2VTEA 2NXJA 5AVOA 2CZCA 2ONCA 2XKJE 3CUTA 5LB2A 4ZXFA 5HQ3B 3HLYA 1HLFA 4K9NA 1P18A 3COVA 3ADPA 3HXKA 3CHYA 3CG0A 1JB9A 3SZOA 3WK4A 3ROMA 3ZDRA 4BKPA 1E7WA 3R5SA 3VNBA 2VR1A 2GB4A 5A02A 1IATA 4LMAA 4NH0A 4RU1A 1JTFA 4G24A 4AWAA 1E3SA 2HRCA 3PC2A 1ZMTA 3OSZA 4WRRA 1V0JA 3M6FA 1ZNXA 1HLDA 2CKMA 2YHUA 1ZSNA 2PU7A 4OREX 3A37A 2O8EA 2ZXEA 1GTJ1 4IP0A 4UM5A 4JI4B 1KJ8A 4X1YA 3WDLA 4XD7A 3QMMA 4EB6A 3N2ZB 1JU4A 2R84A 4WXEA 2GM3A 5J5CA 3QX9A 2J0EA 3FHOA 1XD8A 4LVUA 5TQ0A 1QF6A 5LU8A 2CF5A 2VYCA 3BQNB 1AKYA 1J21A 2I6FA 2G8NA 1VSUA 3HA3A 1JYFA 1U8FO 4PLHA 2Y1CA 2EV9A 2QYOA 4M46A 1GR0A 1P9LA 1KJQA 2CLSA 5CTJA 1B42A 1HZZC 1TZCA 1NLFA 1FL9A 2C9ZA 1O9GA 3OWXA 3RC1A 1HZJA 4BMNA 1M73E 3RK4A 4DJTA 2V7TA 5KNCD 4RFSA 5DM4A 4RD3A 2ZUUA 1EZ1A 3CT4A 2WY2D 3I9JA 3NBXX 1V8OA 1IAQA 2XQFA 4TUYF 1ULZA 2DUMA 2PH1A 4HDSB 4IDGA 4MV8A 3UJCA 1HT3A 2PJZA 4RMIA 3ZWMA 4YJ3F 2JIRA 4G25A 4MRVA 4NESA 4Y2UA 2ZS9A 1NIJA 2ZJ7A 2Q28A 3T3IA 3VC2A 4R2HA 3LDFA 2JLRA 1I7DA 1GDTA 1RM0A 3DE7X 1GCUA 2I99A 4BNLA 4XARA 1A8PA 3K9LA 3GRUA 4A36A 2ZJ5A 4JD5A 3VTFA 1DX9A 1P61B 4WFKA 1UBOS 3EHEA 3VAZA 1OIVA 2HREA 3RUPA 3QWFA 4E21A 3H5WA 2O59A 1OGYA 3MBIA 3ROGA 2GLXA 4J03A 2I8AA 3QXHA 1E9VA 4DFDA 4DNXA 1M75A 1GHTA 3PQ4A 4BKOA 3QBTA 3QKIA 4KLZA 2P8SA 2A5DA 2A9QA 1DZ3A 2WZDA 3GBVA 1DV2A 1NP3A 2BHNA 3FTQA 4G89A 4H7JA 2AJBA 4JLJA 4QO8A 1K7XB 4H6XA 5HKOA 2PQ2A 3KU4A 3L6RA 3WK8A 3CKMA 3EUAA 1ID8A 2CXXA 2W2OA 5BW4A 3X2EA 2ZSHA 4K81B 1R4MA 3GFQA 1CJMA 3K53A 4DRXB 3AOGA 3ANSA 1GQOA 3BWBA 1C1DB 4INPA 1KDTA 2I3BA 1TC2A 3JW8A 3UKJA 4BVFA 5DGDA 3BXZA 4BMXA 1HBJA 1Q0RA 5LP6B 2C4VA 4ALNA 4ENWA 1WNTA 1U0NA 2AN5A 4XUGB 3U1VA 3V33A 5GVSA 4J7CA 1TEZA 2R3SA 4JITA 2PT9A 4ZI7F 1BXRA 2DEUA 3OEWA 1YJQA 4V2IA 3BFXA 3SM3A 1U8EA 4JUCA 4ZO8A 4M53A 2VPTA 2PSSA 1KS9A 3TX2A 5GIPE 4W6QA 4IIDA 2J7PA 3SC6A 5BPFA 2QVLA 5K4AA 3DC7A 2LZ0A 3K9FC 5AJUA 3OA0A 3PXGA 4YGXB 3RH0A 2KW5A 1DOZA 1FPQA 1PWEA 4ZVQA 3DA8A 5D3ZA 1AKMA 1W94A 2NQ2C 2QLJA 4HN4B 2VQ6A 4HN9A 1UBTS 1W85A 4AG5A 5G1PA 4KLRA 3C8MA 2GF0A 2H9AA 2YV5A 4TKUB 1Y8ZA 4IDNA 5JJCA 1X42A 4OAPA 4EX6A 2PZ8A 4OKNA 7ADHA 8LDHA 1AM4D 3IERA 2P68A 1QTIA 5AOAA 1GV1A 1GFZA 4DDHA 3HXMA 2BJHA 3BB1A 3C1UA 3O83A 4QWWA 5TNXA 3DMYA 1HQDA 3MQFA 3ZV6A 1SIWA 3O73A 1NKSA 3T9EA 3Q7EA 4EB0A 1E0JA 2W2LA 2AYYA 5AK3A 1U3CA 1B0AA 5JOQA 3TI9A 2QORA 4RJTA 3WNVA 3K15A 1NF8A 1VBMA 2QMOA 2XNDA 4CLOB 2AUNA 2CVHA 3LZDA 3WZMA 1PFKA 3E7DA 1NWCA 1YQDA 1I2BA 4HAUA 5A3QA 1ENZA 3KDSE 3FKSA 3WMEA 4U6SA 2FA9A 2P6NA 3VA7A 4QUGA 2I33A 4PCUA 3AKCA 1MVOA 3IIMA 4FSHA 4MJXA 5LUBA 4ZGGA 3CM0A 1SHZA 4MUJA 4B34A 4JKYA 2P5YA 2BFFB 3SSAA 4NIMA 2F3TA 3E1GA 4O2BA 4R2MA 3UGJA 3DE2X 3B1VA 2W00A 4HXFB 4BVAA 2EBUA 2JHCA 3LPDA 4EPVA 2C3UA 3S8YA 1PK7A 2FZKA 1UDAA 1V96A 4R2KA 1EEXB 5AKKA 1XTRA 3K8ZA 3AHIA 1QNLA 5FOVA 1H3EA 1C2YA 4JFRA 2I4IA 5B1YA 4KTVE 1ADCA 1X7YB 1YCGA 2JCXA 4WACA 3L4JA 1ZN8A 1A04A 1XRJA 2OC9A 1L5KA 5FA8A 2BL4A 3IUYA 4IYJA 4OSOA 5TY0A 5F9MA 4MV4A 2OYCA 3WV4A 5K05A 1J33A 4ZAZA 3LUCA 2WP0A 3H7IA 4R2XA 1M34B 1SU8A 2PH3A 2X6RA 3DT9A 2QMZA 5LDGA 4DUGD 1KGSA 1UC4B 1DMSA 3PXBA 3Q7IA 2J87A 2Q2NA 1B6RA 4B8ZA 1UPAA 4QTZA 1IEXA 4XQEA 1DC6A 1HRDA 1Y34E 2JFGA 2Z1DA 3KB6A 3B3GA 5FLKA 4NFYA 5TF0A 5KYGA 1RD4A 2R6R1 5K51A 2V8OA 5BSFA 3WNQA 3ZHTA 2R2AA 1PR2A 2DFPA 2IEDA 2LNDA 3K8YA 5D1HA 2FZ5A 3OA2A 5CNKA 2YZ2A 1EM8A 1RWOA 1L5LA 3FE2A 3W78A 2FN3A 4WX2B 5AKJA 2H57A 2G09A 1W0CA 5LP6F 3GP3A 3V1LA 3ADDA 2YJTD 4A8JC 4ODIA 3H1PA 1QIGA 4N7JA 1KNXA 4OJYA 4QARA 2E9SA 4GSYA 3EDMA 4BIMA 1XA3A 4EA7A 4IKOA 2J33A 3GJSA 4B17A 1CTQA 4LG1A 4KXYA 1MT0A 4IIJF 2RG1A 2WTBA 2JJ1A 4H7EA 3OX3A 4Z0HO 1JJBA 1DVRA 2F3PA 1ZISA 1AKVA 2GCNA 4PLWA 1CR2A 4TS4A 3WQQA 3NGMA 3RODA 2C4KA 1V3TA 5FORA 4TN1A 3ND6A 3OFVA 5D7BA 4LIPD 3ZHOA 3AZPA 2YQZA 5FWYB 2XE6A 2QG4A 1KSGA 2ZTSA 3GEEA 4J0JA 3I04A 3SJAA 2IS4A 5DI9A 4IVRA 1DC8A 4RPCA 4F97A 3EXEA 4BQIA 3DVSX 4WT7A 1RBZA 4DS3A 2N0SA 2XMGA 5FFMA 4RS3A 5EAIA 4R9RA 2GAJA 1KSJA 2JS7A 1SEPA 1EDOA 2IYVA 2RHRA 3B2QA 1AK9A 4FONA 5CIWA 4RTNA 4C2TA 1UMBB 2DUWA 4IQGA 1QB8A 4WJZA 2HMSA 3MWLA 5HKLA 4BLQA 5KMGB 1MIOA 1JR3E 3FCOA 2VYQA 3RU7A 3HJUA 3CINA 5KYUB 2GUWA 3FPFA 4RF2A 5I5EA 3G68A 3L0IB 1GRVA 3RS8A 3GPIA 2BMJA 1XVIA 3C5VA 1AO0A 3FNIA 5BXQC 1VJ1A 5K3FA 1SZCA 5AJXA 2OPBA 3WRYA 5ESDA 3ETJA 4EVRA 3Q8XB 4GYJA 4MI9A 2HXSA 3MJCA 3ZJ4A 1P9RA 4PAGA 4UE3S 1CUAA 1SXPA 1LV8A 3C43A 1XCMA 2XJ9A 3KZXA 2Q6OA 2GPJA 3M7IA 5L4NA 4HEQA 1PLJA 4V02A 1PW7A 2CVZA 2PK3A 3SPXA 1COWD 1MAHA 1C81A 1W4LA 3WTBA 4CKEB 1BJRE 1G2PA 1JEJA 1RC1A 5THKA 1DQSA 4EHJA 3ZI4A 4CG0A 4FB4A 3IX7A 3LLUA 1DKPA 1NZDA 3N28A 3UGKA 1VDZA 4MKGA 4D57A 4MUBA 1NHWA 1QDLB 8GPBA 2GTIA 1DXYA 3P9YA 4FN5A 1BKDR 4KH1A 4OJKA 5CD1A 5ALWA 1GSOA 3ECCA 2ZRAA 2BKXA 2WI8A 3I0MA 4NYIR 5CVTA 4IEIA 1NVFA 3DC2A 1TA9A 3U31A 2C97A 4TM7A 3IUMA 3NTQA 3QVKA 1M3SA 1O95D 2B99A 4PPNA 5D00A 2BGNA 3U56A 1Z4KA 3BZUA 1E1CA 3H2GA 3QYFA 3LRXA 5JS1A 4CG3A 4E5NA 4LZAA 1U1DA 1YB1A 1BHSA 2AI3A 4MH0R 4FDVA 4J1SA 3UMJA 2RG7A 4L2IB 1X86B 3IAS1 3MYYA 3T7EA 3ZVMA 1DHTA 1QLHA 2H4ZA 2Q5HA 3TTUA 4F4DA 1XZ8A 2ZT7A 4G56A 1PSZA 2NIPA 2BWJA 4FNAA 3L4BC 2R47A 4MPDA 4DRYA 4GOKA 4BL5A 5KKNB 4X8HA 1NUUA 2JI8A 4KJZA 2JLVA 4FGZA 4PYKA 3ZLBA 5TS3A 1Z0SA 1RPZA 2I2WA 4ZYUA 4A15A 2F9FA 4PBSA 5EIAA 1ZR2A 1VLQA 2VNIA 2XGMA 2SECE 4XWOA 4I2NA 3V1TC 5BOSA 2EGGA 4TYPA 1J5EB 1ULTA 4MJ3A 4WINA 1GUZA 2HK9A 2P90A 2YZGA 1GAJA 3L4EA 4RCYA 4YAEA 3U3ZA 2XWQA 4BCBA 4CF4A 1SVUA 3DHYA 1DKUA 3PFIA 1VBFA 2BEVB 2X5JO 3JQCA 4WN9A 1CSEE 3IUBA 4JSTA 3OKFA 4TTIA 2JL1A 4O0LA 2R6FA 3KSDO 4QUDA 3RNOA 2ZQ5A 4ZIRB 3MELA 2Q8PA 2UZ1B 1PZMA 3R6WA 2DFDA 4B7AA 2OCIA 1U94A 2FFHA 3AUTA 3WDKA 1IPFA 1EK1A 1VHJA 1MC1A 2OCDA 1MGOA 2FEPA 3DAGA 3DCNA 4KHZA 1RPAA 2OHXA 4P4SA 3CRMA 2QI9F 5LD2B 5CAEB 1WJGA 3KHUA 2Y9MB 2O07A 2FJUA 5J59A 4BE9A 5DNAA 2VJYA 4D81A 3BDIA 3WGLA 1N6HA 4HHEA 4MHSA 4RY2A 3TBHA 4U4AA 1PD1A 2IYNA 3NHYA 3ANMA 2FFBA 3NUZA 1C7ZA 2D2IA 2CLLB 1B2RA 1QIJA 1EFRD 1QCYA 4B3FX 1KH3A 1C1XA 4NU8X 1UODA 1TVMA 1OBOA 2FSIA 1NDQA 2YY6A 2C5EA 4GSLA 4X8LA 5TQ2B 3F49S 1T9BA 3H18A 3RU2A 3I2KA 1X7WA 5FUWA 3FX2A 5CA1F 1JEAA 5DBOA 5CB4B 1XYGA 2Z4RA 1DP4A 3C3WA 1NN3A 3PNOA 2O54A 4EB8A 3QBVA 5D3MB 1CJVC 1Y8AA 3EOBI 3A3PA 4IIBA 1XQ1A 4IKEA 3RVKA 3RRZA 4D3FA 1FDOA 4MDEA 3NTVA 1R0ZA 3G5UA 2J3DA 5L6MB 2UXCB 2MIIA 2G9VA 3FTEA 1RXUA 1BCRB 1WDLA 3ROQA 3WKAA 1XCOA 2O3QA 4LDQA 4C6TB 1KBQA 3KUUA 3H99A 4ND8B 4OU5A 5LQAA 2QRVB 5TLSA 1Q0ZA 4LQCA 4TOIA 4GI2A 1W48A 3A6EA 1NG1A 1T34A 4OEHA 2XNKA 1NF2A 4M8KA 4DW8A 4TYNA 5BQOA 1I3NA 1ONNA 2NACA 1MBZA 1WL8A 4NAUA 1DAFA 5JBQA 4LPKA 4PANA 3TXYA 3DKKA 4Q47A 4QAJA 3ZCPA 3DDOA 3DEAA 3WJAA 3GJZA 2AI2A 4IV0A 2X58A 1O0CA 4XFDA 1V5WA 3E9EA 2H4JA 5EIBD 1FU8A 5ENZA 1PJBA 1KP9A 2I65A 4UM9B 5JU6A 3L7KA 3ONFA 2OAEA 2Q8QA 5BWBA 1OTHA 4WY2A 2Z3WA 2VK2A 3PLRA 1A27A 1P0PA 3UJ3X 1F2UB 3I52A 4FDUA 1G20A 3FIUA 4IIVA 3O1IC 4Q3EA 3OUZA 2VJLA 4PSUA 4UU7A 4K6OA 3BTSA 1IG3A 2OO3A 4ZOQI 3DE3X 5JWOA 2AXPA 2H54A 3OQHA 5DFAA 3T7JA 5KMGA 3X1YA 4GZ6A 4YRNA 4NZOA 3VBEA 4GXTA 1XEWX 4QD3A 4ZKDA 3AP1A 1CBUA 1RBYA 3HFSA 5GV7A 3TD9A 2NTVA 2CVQA 1IBCA 1YR7A 3LC2O 4R0VA 3U7EB 3PTAA 3QFTA 1U4NA 4HFNA 4FR0A 1N2BA 4MYDA 3G5AA 4FXPA 3FBGA 2AFIA 2HH9A 1LC0A 4OJMX 1YB5A 1LDNA 4XIJA 5FRDA 5A9TA 1PQUA 1MF7A 2ZBPA 3WISA 3DFUA 2I3AA 3U4QB 4C89A 4C0JA 4TMKA 1IVSA 4RVCA 1UCFA 2UZ4A 1GPH1 1M34E 1RNLA 3O8BA 1N2CA 5LLSA 4LSMA 2ZB3A 3O8LA 3JWPA 5EZYB 3N3AC 4XRGA 5CG1A 3KVOA 1T5TA 3PUZA 2FG5A 1RFLA 2W6NA 3D6AA 3W1EA 2WMYA 2PBFA 3QF4B 2I78A 3EGEA 4OFZA 1R0WA 3P9PA 3ZWAA 1S8OA 2ZJ2A 1UKCA 1M9NA 3HKCB 3IXQA 4XLLA 3OQIA 4PO9A 3F9IA 3ZKWA 4ZHSA 1B1CA 3A1FA 3M9LA 3R0JA 1VKNA 1UP4A 2Z5FA 4D5EA 2JBAB 2ZJOA 1QU2A 4D4HA 3UT5A 3E61A 1UC5B 3PDIA 2GRJA 5JQGB 1XAGA 5KJ6A 1W4BA 4FD3A 1LPOA 4FFRA 1Y9JA 3GG9A 3HB9A 4OO3A 1A9YA 5IHXA 2IBTA 2HX1A 3WL7A 2EHJA 2EDAA 3SR0A 4UTOA 5DT9A 6LDHA 2QTGA 1GUFA 5DTRA 4ICIA 4F38A 1KETA 4EGJA 2B20A 4MPRA 3E9DA 2HK6A 4C21A 1F9AA 3EXAA 1X1SA 5CEEA 3VO8A 4M0LA 4A0FA 3A4YA 3BSWA 1K1EA 2JVKA 5MHTA 4OJTA 1V8PA 3HGTA 3B78A 4PPYA 4NICA 4TTPA 2C42A 4PINA 3L43A 1TJNA 5FPSA 4BJ1A 1SKYE 2BEWA 5D84A 1NJGA 2E4VA 2PL5A 2QD2A 2X9QA 4L9WA 3KK0A 4PZAA 5ALQA 3W3AA 1C3OA 3DO8A 1JW9B 2EGUA 2WF9A 5HK9A 1GRQA 1ZMXA 2OZLA 2PA0A 3PRKE 4W6ZA 4WXHA 1R1DA 3R3XA 2JD2A 1QG6A 3MJFA 3HO6A 4D9FA 1X0VA 4QG3A 4O4HA 1HDEA 3NAGA 4DA9A 5HYVA 3D6JA 3E7FA 1RZUA 3MOIA 4F6LA 1CY1A 2R66A 4U5QA 2AMLA 5TRTA 5FHQA 1GPMA 4Z0PA 2ON6A 4RKQA 4ZOAA 2ZJ8A 2WYOA 4RKWA 2Z6VA 2FEAA 1LTKA 1Q91A 1U2DC 2FH5B 1X8XA 4Y9UA 3UK2A 4YMLA 4FGKA 3H9CA 4QTXA 2BGUA 3U40A 4UHCA 4GYWA 4MKRA 4X92A 1Z0AA 3M0EA 3Q3JB 1DO2A 5CX1B 2QX6A 2DPXA 4X7RA 2GZMA 2Y1GA 4HDKA 3MJVA 1V5IA 4LK2A 2CNNA 4UM9D 3JD4A 1J2RA 3C1AA 1T2NA 4JOCA 3RVPA 1IL0A 1DRKA 1MHTA 4WESA 2POCA 1YS2X 1EQAA 2RGCA 3MLEA 5E7IA 3WMFA 4AZTA 1B6TA 5I01A 5I48A 3PDJA 3AINA 4XIFA 2OAQ1 4D82A 1W47A 3H6HA 4D99A 3CNLA 1L4FA 4J1QA 2HA2A 1KMNA 2VXYA 2FR8A 3MA0A 5LYYA 4KBGA 2JCBA 2YCBA 1WQ4A 2JA1A 1R5NA 4TL6A 1TZJA 2ZYAA 3D2CA 4O63O 5AHRA 4Q7JB 2OQIA 4N1AA 3JAWB 4LJ5A 4FMPA 2AEFA 3MRTA 4UATA 3NM4A 4D4KA 3I5YA 2YV3A 4R1NA 4QGSA 2NU6A 4FFBA 1O4VA 1JQBA 1Y42X 4BMOB 4D0SA 3BJRA 1LPBB 1NN1A 3FRJA 4GBED 1CC1S 2ACVA 3WADA 3ZS9A 2ZIUB 3MMSA 2Q5JA 3JR3A 2DPLA 1PE0A 2NVWA 3HXQA 5GONA 4TRNA 3I1YA 4U7GA 1P91A 1JEQA 4WERA 1KI6A 2ORWA 3TRIA 7REQB 5JFGA 3G88A 2IXAA 5EZYF 1G3RA 2HRRA 5C34B 4C7XA 1NTOA 1C1YA 2JGFA 5BSVA 3P5BA 5FJIA 2P9YA 1IZ0A 1RYFA 2RSLA 3EVEA 5KCMA 4A5SA 1CR6A 1LSUA 4KX5A 5J5VA 2BCGY 1IM2A 2W6CX 1DQRA 4GKJB 4Y6OA 3YASA 2MT9A 4K28A 1MTOA 2PPVA 3PE4A 4L0MA 1Y1SA 2GWRA 4FZJA 5JMTA 3D2AA 5KOJB 5HRUA 4R0MA 4Z5XA 2A2ZA 5JQGF 3FSEA 1BOFA 5K8VA 4C2UA 2BGJA 4YBZA 1UEJA 3GPBA 1AN0A 3O2NA 3T34A 2RK6A 1GILA 2ZJZA 1U0BB 1GU0A 2BM8A 3GVIA 2BMVA 2A1IA 4KGXA 1C29B 5EIXA 1CNFA 2YHIA 1CY0A 1O96B 1XVUA 2EW2A 4Z49A 1IHUA 4RDIA 1V6CA 2HU7A 4KXFB 2O8CA 4LZNA 2OXRA 3SQNA 3K70C 4LV6A 1W1UA 1JMKC 2KSQA 3G85A 4C4SA 5A06A 2BGWA 4M98A 2P3OA 2JVJA 3ITNA 1ESDA 1HG1A 2C2HA 1HQYE 1G9SA 1OYVA 2C07A 2WUEA 3KIPA 1ONSA 4HLUA 4JMPA 4OH1A 1F8FA 3TIIA 3IAXA 3LYLA 3A6LA 5HRCA 3IEUA 2IKSA 3KT3A 5JTUA 4CEHA 3QKRA 4XPIA 3IUSA 2HF8A 1WDMA 4CE6A 2GXSA 1KEWA 1GGVA 3JQFC 3MAAC 2JHFA 3OMLA 3HO1A 3CPEA 3TZHA 5G0UA 2C4HA 3QWIA 2ZFUA 5AKLA 4B2PA 1KAGA 4JI5B 4JK3A 1TQ6A 1OPRA 3H1GA 1HEUA 1RWQA 2HWKA 4UREA 1I5EA 4XI9A 1HOXA 3DZHA 1Q7BA 3R3WA 1ONOA 3NTRA 3HB1A 5BUSA 4YFYA 1HNWB 1RYEA 2XYVA 2QTMA 1YQQA 4B9EA 2HA3A 3I6ZA 4YALA 1OSNA 3UJ9A 1CQWA 4EYOA 4B47A 5T4EA 3VDRA 3HKDA 1T5SA 2BONA 4JJIA 2VKQA 3L41A 3AFGA 3T95A 3WWEA 4A1FA 1MB9A 3C41J 2PNJA 3PX7A 1DB3A 3VKGA 4M49A 1THMA 4WA7A 3UB2A 4QGFA 5BWNA 5AXDA 3T1YB 1RM5A 2BBSA 5AW5A 1UUFA 1F2DA 3ZZUA 1C9EA 1SXIA 3DULA 4R31A 5I9SA 2DBQA 2HSZA 3C6XA 4RIEA 2H1WA 4OGLA 1YFJA 5IAJA 1S3IA 3SZMA 1G0OA 5FTKA 1HL7A 2II6A 4B83A 4HYQA 2IYTA 4B7XA 4N9WA 5FWNA 1GKYA 4DLSA 1Q2XA 4JKIA 4M1TA 5LOVB 4EZBA 2VJNA 4MR8A 4P3PA 1S0UA 5CCBA 4AKGA 2EP8A 1DS6A 4L76A 2NUPA 1YQXA 3ZZTA 2XYRA 2Y0PA 4R54A 1T9GR 1EWQA 4ZEXA 2H4XA 3NCTA 1W87A 1BZYA 4Y18A 2WKQA 3ZV3A 4BTLA 5JG7A 1NT4A 1WXXA 2DR3A 2JLSA 4D74A 1AH2A 3P9XA 3VH2A 4DLRA 4BRSA 1RHJA 2P5UA 1IIBA 3ZWKA 2FEWB 2XMSA 1LDYA 1KVRA 2ZDHA 3I9NA 4RV9A 1WUHS 4QAQA 1W19A 4Y98A 1IHDA 2GASA 4ND1A 5DOZA 4LFBB 1BU5A 1M2OB 1MJGA 1E3JA 4M1MA 2PEYA 5G0TA 2AG5A 1KDPA 7GPBA 1YRBA 2X6TA 3LE8A 2A35A 2GPTA 2MWMA 1JQAA 1XEXB 3GN1A 3CU5A 4KSCA 2VSFA 4UTZA 4WCDA 3VI3B 2IHNA 5EWLA 3RW9A 3A6PC 1Y98A 1VL6A 4QT0A 5A4AA 2HDHA 3P96A 4QUKA 4CLXA 3QE9Y 3RBVA 4B4VA 4Z8YA 4CMGA 5GJVC 1S3GA 4PCLA 4NNPA 4M9CA 1LF0A 3GLTA 2XA2A 4DM3A 5EIOA 1G98A 4KODA 4FI3C 3P0EA 1KDRA 4LXHA 4ALKA 1P2FA 2HXYA 2AQIA 3AEXA 1HNNA 4BNJA 3DBRB 3U4AA 2R86A 3R77A 1A4UA 5CLFA 1GV0A 3O0DA 4BX9A 2R48A 4DV6B 3AJAA 3IVAA 3K96A 5EYPA 3GLFA 2PUFA 4PSDA 2AK3A 3MLAA 1DINA 1PR6A 3UA4A 4KKVA 3BX1A 1T10A 5A6SB 2VT7A 4KYTA 4P7JA 1I0IA 4C5BA 1HL3A 2R8XA 4PRYA 4JLNA 3HS3A 2WUGA 1OLXB 1PDVA 4GHWA 4LNUA 4TKMA 4CTMA 3U2QA 1YZLA 2VJMB 3H1FA 3HWX1 2DGDA 3LPCA 1YS7A 3PQ7A 4II7A 4LBYA 3LYAA 3ZE0B 3JQEA 3SQOA 1TYDE 1J0AA 3W5UA 3LBYA 3E48A 1KI3A 2D2EA 3BWXA 1CVRA 5IWCA 3ETDA 3ZJVA 3V34A 4OB6A 5LBTA 4IHJA 4QDKA 3GJRA 4DMFA 1ISPA 3NTOA 5K4GA 2RFLA 3K7EA 1EAYA 4DC0A 2H3EA 4YUYA 2WYUA 5FHRA 1QDUA 1VCMA 2P6UA 1NAIA 3FG9A 4M9XA 4CQMA 2WJVA 1DWPA 1Z62A 2HEGA 1K8XB 1AGYA 4OHKA 4UMFA 3FPCA 4X84A 1Y5LA 2QMYA 3CTPA 3SXPA 4F5EA 1MX3A 3UV3A 3S2IA 3PZRA 2V6JA 1SUBA 4LN1A 5DTEA 1VLHA 4Q9LA 2BM9A 5EE1A 4PR0A 2VRWA 4NXMB 1T4MA 1M7GA 4ZANA 1F3OA 4C6HA 1O08A 4DZRA 4E5YA 1BH6A 2BSXA 1YT5A 2V03A 3VPFA 3VYRB 1E1MA 2OM6A 3BN3A 2Q3DA 3PX2A 4PLZA 3WWPA 1MU0A 1ULUA 3WDMA 4G0UA 3LUBA 2O8VA 4Z4GA 5JVDB 1VOTA 3DEJA 4H6VA 4NYMR 2DX7A 4DMLA 1RHMA 2H1HA 4NPAA 4IUCS 2HV9A 5IJAA 4J7XA 4R2WA 1Z34A 2O3RA 2R1TA 4WMLA 1E5DA 3X1KA 4EPXA 5JS7A 1TK2A 1G8PA 3OHSX 4OLHA 5L53A 1BS1A 1IXRC 3OM0A 4TQAA 4OX9B 4BNNA 3BL5A 1LVGA 3AOEA 1YBHA 1FTWA 4KMOA 1G59A 1KH2A 3KUDA 1LJUA 3VC1A 1V7PC 5JEDA 1T1GA 2RBGA 4JNKA 4LE0A 5ALSA 3QUBA 4OP1A 4PX3A 5TPZA 4PO3X 3ADOA 4P7FA 3F6CA 5FBQB 4DR3B 1TTHA 1Y1LA 3EFBA 3L0SA 4II2A 2PKWA 3LPLA 5GMOA 5A03A 1YB6A 4NHOA 5G53C 1JR6A 1BMDA 1SR8A 3F7MA 5L8VA 1ZK0A 3OIFA 2YBEA 1L4GA 2GOYA 4RA9A 5EMLA 2J6BA 4CTNA 4CM8B 1YVEI 5AYVA 1PV4A 4MVWA 1WB6A 5AJYA 3RWBA 2XQIA 1EINA 4HXGA 4DBZA 4A27A 2ZYVX 5KOHB 4G9GA 2GN0A 1PDWA 1JMYA 1AKNA 2EIHA 2ZT6A 1WQ3A 3PXXA 5D01A 2EKBA 3HCAA 3M83A 3S2FA 2PGXA 1J7KA 1YR6A 3KPVA 4LRQA 3K4QA 2FK7A 2FR0A 3B8EA 4J16C 4Q9IA 2ZCJA 3ZLJA 3V7YA 3LTEA 2R96A 3LXUX 3MMNA 3OEEA 2KB0A 3Q10A 5I7AA 5IPFA 2WUFA 2QRMA 4K26A 3UQYS 1IOZA 2GBLA 2Z2JA 4YCBA 3UO8B 3AILA 3WNZA 3EGIA 4OHYA 4H0CA 1E6LA 3H5NA 3SC3A 2IIQA 4G41A 2WLTA 3LKVA 3QF7A 1RI3A 4RZXA 1ESZA 4FTWA 5K0SA 5BWLA 3E53A 5EFOA 2PE5A 3H6GA 3ZWBA 4XRRA 3MD9A 1QHXA 3AVXA 3F74A 4QRHA 4GC5A 2EKZA 3FPGA 4W7SA 1Y3AA 4ABYA 1PT9A 1O5IA 1DCFA 1Y9ZA 2WU0A 3LI2A 3E2PA 2HMUA 3OAAD 2B83A 2AX3A 2H1VA 2UAGA 5KDOA 2RE8A 3MT7A 3A7DA 1ZMOA 4LRUA 3BE8A 4PU0A 3OZWA 5BP7A 4EHAA 4LMBA 1ISGA 1LPAB 2NUTB 3PFCA 3Q3HA 5BR1A 3PC8A 3C8UA 4V0ME 4EENA 3FLMA 1BD4A 2BW0A 2FJ0A 2O1EA 3B89A 4DDUA 5B4UA 1VPDA 4AMVA 1D6NA 4NMXB 4CV3A 4N01A 4DMGA 3N8KA 4KAAA 1F6WA 5DNUA 4L7QA 2C9YA 5ABPA 3CMMA 2WTXA 1Q11A 3FKQA 4XYEA 2FW0A 3TX6A 1LU9A 2ECQA 2GSWA 5DKFA 1LRKA 1AOXA 4RA6B 4J9UE 1EYZA 1SXJD 2D0IA 2QTWB 3Q5EA 1VG9B 2AOUA 3LQ1A 3GROA 3SP1A 3UMYA 2J3IA 2O2ZA 3KQYA 3ZH9B 1R0CA 1Q0UA 3ZZ1A 1NMYA 5AKXA 2C4TA 4E7PA 5JBNA 3FCAA 2PFGA 2ID7A 4C7OA 1NI4A 1H1LB 2IEBA 3AHFA 3INRA 5DIFA 1USGA 5K1ZA 1EZ4A 2WAYA 3Q3CA 1MO4A 4E5PA 1LSOA 1O6ZA 3S81A 2RBKA 2GVDC 2Y0CA 4HFRA 1BW9A 1SQ6A 3MMXA 5BORA 1HT0A 3QA9A 2HF7A 3DFZA 4P3YA 1AMOA 1E4YA 4TV9F 2CLIB 2BFDA 3MMZA 1J9EA 2PFSA 1KH1A 1VKOA 1TA0A 4UE6A 3B70A 4A0SA 3V42A 2G9ZA 4FB5A 2AFHA 3JATB 3GUCA 1L7OA 3MOSA 3VZCA 3MBKA 1N0IA 1DO8A 3WLAA 4YPOA 1HQKA 5KTOA 1MXFA 2YXNA 3I6BA 5KX5A 1DCMA 1V8BA 2GEDA 1WSWA 1U7ZA 3M49A 4QBFA 2VTBA 3DVLA 2NN3C 2ZBRA 1FTSA 4YCNA 3ZV7A 1HZZA 2GJAA 1D2CA 3GRCA 3SK0A 4NI5A 3CW8X 4BVGA 1K5HA 1Z73A 3DYBA 4PRZA 4HDCA 5JAPA 3MRXA 1A9OA 3OHMA 3TJRA 4ZYLA 3EPRA 4EGQA 3HB4X 1QIEA 4DR7B 2Z95A 3C70A 3WGQA 2P0AA 4DG8A 1R0LA 4GXQA 2AUTA 3TVTA 1VCIA 3H5LA 3I5MA 2XUQA 5JDCC 3S2EA 2XRMA 1Q57A 2C5HA 5THQA 3DLHA 1TM1E 3MCWA 1N8NA 4XSGA 1GL9B 3GMTA 5BSRA 2OOSA 5EJ5A 5CFRA 4BLTA 2DSNA 3A04A 1DKRA 3E22B 1WUTA 5FL7D 4X0EA 3BXGA 2AMFA 3E7WA 4R1SA 3FUXA 3QVGA 4FZVA 5HZHA 5IXSA 3QYJA 2XZPA 1I13A 2VJBA 4ARZA 1NVXQ 1U5BB 1T6NA 4ZQEA 5HUJA 4TV8A 2XDYA 1FW8A 4U2CA 4HGZA 4WK0B 2V54A 3QMPA 5AI6A 4RO0A 5FKJA 3TRHA 3WRVA 4C4YA 5ENVA 1LI4A 3PHHA 2PPLA 2G82A 3A1NA 5I4BA 1SC3A 3ZTTA 4CV1A 3CF4G 4ZV4A 4U7TB 4U9UA 1EVYA 1YVUA 3B7PA 5G4KB 3SN6A 1XKTA 1HDOA 2MMCA 2Q4BA 3QSYA 1G5RA 2EFGA 2ZBEA 3P2EA 1FP1D 1RRKA 3R6TA 2ODPA 3DWEX 4GPIB 2B2NA 3DQPA 3L6OO 4YV1A 3LLSA 4E6EA 3QBEA 3BXHA 1N5MA 4N8SA 4WV3A 2PVPA 2QJFA 1L3IA 2ATVA 2V7XA 2XADA 3I1IA 4FEGA 4IFIA 4F5WA 5HKAA 4AS2A 5JI3E 3NYIA 2VCHA 1O9HA 3SHWA 3V48A 3AJRA 4MV6A 4A6DA 4E1AA 3IVMA 4B3IA 1GGNA 1WABA 4MROA 4Y30A 3H3XA 1RRVA 4EWLA 4MOWA 4KR2A 1K4KA 4M9RA 5DX8A 3ZLVA 3RG8A 4YAKA 2I54A 4H18A 4WKPA 3I05A 1EVEA 4Q00A 4XUDA 2X2FA 1OX6A 5CEJA 2WF8A 2FWPA 1E9EA 3MWEB 5AM2A 5IAEA 4K9LA 3RKUA 4MVJP 3CPJB 1AJEA 4R6WA 1BMFA 2CFRA 5LQMA 2IWRA 1GDHA 9ABPA 1SNYA 4Z9BA 2ZB4A 3I30X 3CLUD 1VIDA 1KKMA 3MTDA 2BI7A 3EULA 1GUDA 1FDRA 5REQA 4F0JA 3CUSA 2B5WA 4YT5A 3C8DA 3WGZA 3JWJA 4B81A 1N1MA 3H9EO 4U3JA 1SO8A 2UDPA 4L0QA 1S9DA 2I2DA 4KSBA 1AURA 3UZUA 3ZJ5A 1IXYA 5B12A 2QD4A 1VSQA 2G72A 4B6SA 1USIA 4IDAA 1T6YA 1EXMA 1AVTA 4YJFA 3VZDA 1UXKA 1MLDA 1WXGA 2F59A 3GFFA 1Y1PA 4NCKA 3DVAA 2O7QA 4U6NA 4A0GA 6REQB 3MZ0A 1HT1E 5EMNA 3SICE 3L02A 1C1HA 3V3TA 3C4QA 4UZSA 3SBEA 2ZZMA 2Q5CA 5ELMA 3UCFA 5IG2A 4JI2B 3NEYA 1FUEA 1QONA 4RXUA 2GN9A 2V5VA 4MIYA 4ZCPA 4CQLB 2CHVA 3GY0A 4F5YA 1ACLA 5GJWC 2FVYA 3WY9A 1GD1O 3GRRA 3GRZA 1ESEA 1XU9A 4M21A 5EJ8A 3OQMA 2AMVA 4RADA 2CF6A 1C9JA 1H65A 5U4XA 3C15C 1Y3IA 2J3MA 4PG5A 1U0LA 2XB6A 4UZEA 2VDWA 3KTAB 4R4JA 2QBYB 1ZVVA 3SHOA 3LVQE 2Y6VA 1FRZA 4ZODA 3ZI7A 5KTSA 2V7PA 3OCJA 4MAMA 4YC7A 4YWJA 4NK4A 3IEKA 5AJTA 4A2QA 4K0RA 5AESA 2VQEB 4MICA 5JE8A 3AH8A 4DQKA 2W8BA 1RADA 4XOIA 3C85A 3O38A 4B6OA 3V8PA 3C4VA 4OUKX 4YQFA 5BQFA 3N6XA 5AIAA 4ZICA 4D3SA 4UAUA 4KVFA 3KQMA 4HSEA 2IEIA 2P75A 2QF7A 2ERCA 4RPIA 4JWKA 5TEVA 3ZHQA 4NJMA 1RZRD 4YR9A 1FDUA 1P2VA 1QYRA 1T2AA 2D4HA 1KDVA 4NTZA 1JLHA 2QT9A 3TUJC 3OZSA 1Z88A 5E6RA 4ZZ0A 2A1UB 4TKZA 3LU1A 3VR4A 3BT7A 4R83A 2C0CA 4Y2TA 5H81A 2Q8NA 2B1IA 3FYSA 3UHFA 5A4MS 2X4IA 2F43B 2J3LA 4MW0A 1FUKA 2PS0A 3CYFA 1E32A 2PMBA 3AONB 1ODIA 4L8WB 4TZ6A 3FMFA 3DF9A 2DBZA 4HWTA 2A67A 5DLDA 4BBAA 1Z7GA 3U60B 2LKDA 5T4HA 3VJRA 1T0HB 1YAJA 1XXHB 2AXQA 2OHHA 2ZSBA 4YAOA 1B43A 2CHQA 1AGPA 3RVJA 3WLNA 4OF4A 3THWA 2PL9A 1ZIXA 2YWJA 4DCJA 4JOBA 3H2KA 1KS2A 1CYDA 1AZTA 5F4ZA 4Q1FA 4QQ8A 3V8NA 1BVHA 5D85A 4REOA 5DSTA 4ZT4A 1OAKA 3EF1A 4RKYA 1AA9A 4QJ5A 3L04A 5HIAA 1N1EA 2JATA 2WIFA 2Y3IA 1JDSA 1CUWA 3HA2A 1OIWA 1KK1A 1T5OA 1NM5C 2BMWA 3L40A 2H18A 4QU5A 5DULA 3VMMA 4UEKA 4BNFA 2X8JB 4QT4A 1LSJA 2HSDA 4TPKA 3S29A 3DZBA 1EX6A 2BF7A 1MN6A 5BWOA 1C50A 1FTNA 1YE8A 1LLDA 2PU5A 1YFZA 3PQ6A 4NJOA 3TO5A 4D9GA 2HRZA 4ZTUB 3U80A 1GITA 5DCUA 5KNDA 1WCIA 5ENDA 2VDVE 2ANCA 3LBHA 4Q1CA 4X1IA 1E2FA 5E2IA 1N33B 1C3VA 2R5WA 3TLGA 3ZX4A 3V4LA 2P27A 3CXUA 5C80A 1SCQA 4PGMA 1MFPA 4J90A 3BERA 4BQQA 1G66A 2XUIA 3WVNA 1XL0A 2HW8A 3I5AA 4KSYA 3E0QA 3R7DA 4EHKA 3OC6A 3N8NA 5LUAA 3O74A 3OMWA 1KXJA 3IIEA 2PEZA 3FCYA 4DG9A 1VRWA 4QTTB 1W581 3G9TA 2ECOA 2F9LA 5BT8A 4YRGA 4MMZB 5KVVA 3ZQJA 1JE1A 2JLQA 1SB9A 3CE6A 3IQDB 3L0DA 4ASUA 2A9OA 2UYGA 5CB8A 2G9UA 1N6IA 2L42A 3HN7A 2OE2A 4DIMA 2H48A 5ULLA 4BO7A 2CCGA 3QKWA 4M2LA 1A7AA 4PBRA 3PE3A 3ICQB 1TUBB 5TB5A 2JF0A 4LX0A 3F5FA 4JI3B 3E3LA 4ID9A 3H04A 4B75A 4BB9A 2YOGA 4NRDA 2IHYA 4LUCA 2QN8A 1E1YA 3DE0X 2D0DA 3HABA 5K0FA 3Q40A 2C3YA 4CM3A 2Y27A 2IIBA 3ZE9A 2BI4A 3IODA 1P81A 4F46A 3L7BA 4NZZA 3UGQA 4LWPA 2G0NA 1Z8FA 4ZAWA 3JYQA 2ZSDA 1O2DA 1NVWQ 3H1EA 3T12A 4KXMA 1KJ9A 1FSPA 3EGDB 2A86A 4BQEA 3TQIA 2IPLA 2WWFA 3ZZNA 5C5IA 4FUQA 1YZQA 2Y1EA 1QCZA 2OECA 1DE0A 3VYWA 5KVCA 2EFCB 1BMQA 4NV1A 4E31A 3F90A 1SPXA 1N9GA 1ZDMA 1KFEB 4DCTA 4U7JA 1ZJ6A 1ZUHA 3OFKA 2NAPA 1S96A 4WLOA 5E3IA 3WWDA 1KAMA 2FFJA 3R44A 1E7YA 1PG0A 2OFOA 1KZYC 2HQRA 2VJPA 4GEKA 1VIYA 3EEIA 3UUFA 4F12A 4NY1A 1DTWB 3VQTA 5EXSA 4TROA 4N6OA 4L5BA 4I5DA 2ID4A 3KJZA 1U4OA 2AOTA 3VYSB 3QHQA 5IHPA 3UWSA 3L0OA 5TS2A 1ES9A 2ZLBA 2GESA 2IOFA 2CBZA 1P7ZA 3RS5A 4MHOA 4M8LA 4Q3DA 4F4JA 4CEJA 3L4BA 4RK7A 2R8YA 1H4VB 4JQYA 4UPVA 3THXA 2GMWA 4FSDA 3STWA 2IFTA 2X42A 1TE2A 2UV8A 4BJ3A 3IE1A 3H05A 3AM1A 3KKNA 1Y3CE 3R41A 4BPRA 4I1UA 5KOIA 3GHYA 4BX0A 2QXUA 2I62A 3NYRA 2CV2A 4L74A 1LSSA 4JJ7A 2R6HA 4N8EA 3PV0A 1KJWA 1G2QA 1V11A 1DIRA 4PLCA 4RZHA 2JEOA 4G1MB 4EMSA 3MPOA 2QJWA 1U1EA 4JY7A 2E5FA 4EY6A 1OKKA 4LJ4A 1IBRA 1OIXA 1TKCA 1GFSA 3TSZA 4FFPA 3VUFA 3ASYA 1J90A 3BREA 1TO1E 4MYUA 2FPGB 4BJ5A 3RHFA 2C1ZA 2WV9A 2IE0A 4O4JF 1B2LA 2F3SA 1NXQA 2YBDA 3VU1A 3D0KA 5IH7A 3AY3A 1MEOA 4OMCA 1XD2B 1XX6A 2D0PB 2YNMC 2C3MA 2GBGA 2ZKIA 3LSTA 2JZNA 5SY9A 1PS8A 1Y1TA 4NCNA 1SAYA 1ZNQO 3OJOA 2PGOA 5DXAA 1LJLA 2L17A 3C3PA 4JLMA 1MNQA 4MIOA 3NYWA 2A58A 2X7XA 1WX1A 4AKSA 1KYWA 4KE8A 1EG7A 1WSAA 2NGRA 4J0IA 1ND5A 4FN4A 1ARZA 3EB9A 1KOJA 3G59A 4X65B 3HJFA 1OFGA 4FLMA 4LGCA 4XE5A 3KLBA 4DYHA 1MQSA 4ZVSA 1BDIA 3I9V1 1L7DA 4WOBA 4YJHB 1VGRA 3ZNOA 4DDKA 4CGZA 1DC7A 4LECA 4GPZA 2NU8A 2FHPA 3A1TA 2XVYA 4M54A 3R1IA 4ZOEA 4UCWA 1K2WA 3EIUA 1I4EB 3UUGA 2JIQA 2XTNA 1Q84A 2PH7A 3ITEA 3UV6A 5A0VA 3X1XA 5J4VA 1VFNA 4CCYB 4KYIB 2IP2A 5AM3A 1KY4A 4TGLA 3KPJA 2RC5A 2WJHA 2PSJA 2WSSD 3A9UA 2HI0A 3GBPA 4LV8B 4M89A 4WLFA 1YD7A 2RHHA 2FLVA 4REMA 5KVAA 3DAYA 3IDSA 2YJ5A 3QW4B 5HX7A 4I55A 1K66A 4IJ5A 3U81A 3MCTA 1WKBA 6GPBA 3CF0A 1QO9A 3KOMA 2A4KA 2JFUA 3O95A 5EKUA 3F5QA 3AY6A 5A71A 1G8AA 5FBRB 1EX7A 1SWWA 2FMIA 4D0GA 2IS6A 2ZTVA 3L0BA 1SPBS 1BIFA 2CZGA 3EAQA 2PD3A 1ML3A 1XRRA 4QXOA 3G1TA 3G9XA 4YQZA 2WIAA 2RH9B 3PNLA 4IVPA 1PV2A 3ZBQA 4HGNA 3PB3A 4EG4A 3ZIUA 1Q95A 2RAVA 2WQZA 1BJTA 3KCQA 1RP7A 4QDTA 4Z9AA 1Y8RB 2JLYA 1L5NA 2BGRA 4JB3A 3ZXUB 4NBTA 3T1NA 2HT6A 4KQCA 2IZ6A 2G5GX 2Q5QA 2OVBA 4Y6SA 2PNFA 4CIXA 4Q37A 1JIIA 4N6NA 4FYPA 3GVPA 4ZREA 4JJGA 5KQRA 3DXYA 3B20A 3ROKA 2ZJ1A 1DSSG 3IIKA 1SVLA 2VUUA 4JLUA 4R3WA 4RELA 5FBZA 4BLWA 5JNVA 2V9PA 3NGXA 1A1VA 5IK2A 3TZLA 4UQPA 2F9MA 2OGWA 3M81A 4X9XA 2R85A 2R97A 2WT8A 3N39C 2XKAA 1NPTO 2SCUB 3AR8A 1XD9A 2HCBA 4GO1A 3K9HA 3V4ZA 4D4GA 3M1AA 4Z2AA 1PJZA 2LPMA 4M7PA 2B30A 4O4HF 4F3RA 4IINA 2R751 4IEFB 3UHPA 4CWAA 2QZ9A 4Q4AB 3S2UA 3UK1A 5HDQA 2VFAA 2QR3A 1JTEA 1W6UA 2W6IA 1L9KA 2ECPA 4KPUB 4ARAA 3HMQA 4CM4B 2XOXA 4B3MB 3TNFA 4DEXA 5KYWA 5LIRA 2QW1A 4MUMA 5CFMA 4TRRA 4EFKA 1U2SA 2D59A 1IN6A 4PX9A 4RV4A 5HG0A 3TW6A 5TIIA 3E1KA 1CUVA 1DQYA 4N6GA 4BX8A 2BTEA 5HR5A 1I33A 1Z06A 3VH3A 1UJBA 3CUUA 1ORVA 1MW9X 1A9QA 3PWZA 3SVTA 3AL0C 4X1OA 1CHNA 2ICAA 5B3KA 5GOZA 3EX7C 2H8GA 1DAMA 4MI3A 1YWGO 2O0LA 3HDGA 1REQB 1XXHE 2O5VA 2OHGA 1ZJZA 2Q1XA 2ZYTX 3BTUA 3FWPA 2HJGA 1YCFA 1Q7TA 1LKZA 3IUEA 3LVBA 1MO2A 1M2WA 4L50A 1C7FA 3NFYA 1KMHA 2OLKA 4L9RA 2FW7A 4PZ0A 1T0BA 4V0KA 2BP7A 3HP4A 3LBAA 5HS6A 4B6GA 4KR6A 4QDZA 1K68A 5BV0A 2QSUA 3N6RA 3EXIA 4HB0A 3O93A 3IEMA 4PTLA 3H5VA 1A8UA 3ESXA 5SYNA 3AERB 1K7SN 1OPXA 1YQ9A 3P4XA 3KQSA 3V9PA 1S5PA 3HI6A 4Z8XA 5DLEA 2J3QA 3V55A 3QWBA 2B69A 3UJHA 3SYTA 3BXEA 2FTKE 3GCWA 4CEIA 3TI7A 1PKXA 5JDIC 3RU3A 1WXQA 1Z6XA 3AP2A 2W9XA 5IM4A 2PTGA 2C2XA 3LT0A 4DV1B 1NMZA 10MHA 4MS3A 4Q39A 1WWKA 3KVYA 2OV4A 2X0IA 2QM3A 3EGXA 4PZDA 2FK8A 1NPDA 2BFBB 2BEKA 1Y5NA 4RPLA 4WKGA 1PYDA 4BNZA 1UKZA 2VI5A 4E03A 5KYNA 1BA3A 5F2NA 1EFLA 1WLYA 2ZIVB 3T7DA 3ANNA 2JCVA 4ZGBA 2E4UA 3W2HA 2O5EA 2CK3D 3EVCA 3RRMA 4BBZA 1IJKA 3R76A 3TLAA 1T2FA 3NB0A 3VNVA 4GL2A 4MGEA 2R6GA 3SFVA 4D8VA 3L8HA 3W2TA 3F2IA 4MVJG 4YCSA 5BRAA 4Y7CA 4KBFA 4X61A 3MSCA 3RVBA 5JJ5A 2AH5A 1T8PA 4YUAA 4HUQB 1SZDA 1JHAA 1IYZA 2B8WA 1GZ6A 3E8XA 4HQ0A 1ZLYA 2AC2A 4RFLA 1BHO1 3AWDA 4EUNA 2WQ6A 2HTFA 1A3CA 1UM9A 2ZS7A 3FFAA 1DADA 3PI6A 5FIUA 3U7GA 1QZUA 4LF7B 4TTTS 4GF5A 3A2MA 3C3YA 3E03A 2RGBA 4IUDS 4KDFA 4UOZA 5JAMA 5IC4A 4I1RA 1KHTA 5A5FA 1SCDA 2LTAA 2BI8A 4EQZA 2C5FA 4GP9A 4N9QA 5CNIA 3TNDA 4V03A 4CMJA 3V2IA 1QZXA 3O82A 4LSGA 4B09A 2A0XA 5ARBA 2CCJA 2AW3A 4F3TA 1T2DA 1PS0A 2R8EA 4HDQB 4XCQA 4EHDA 3QJ5A 2P2NA 1ORWA 1N5KA 5KSPA 1WHTB 1N2IA 4KQ1A 3BCUA 4ITUA 3P2KA 4Q19A 4LI3X 1IUOA 3USES 3REQB 2MU1A 3G5TA 4QXMA 1KARA 3AB8A 4KUHA 5H9VA 1ESMA 2GJKA 4AF7A 2RHGB 3OCWA 5AVZA 3BIOA 1E77A 2G1JA 1HF3A 2I2CA 1EE2A 1JT9A 1SUEA 1F0PA 4KI7A 3UG6A 1T91A 2RIPA 2V97A 3AUXA 1RKUA 3ITKA 3KQNA 4ZXPA 1U8CB 4ZMSA 3ENQA 3SSOA 3KKEA 4HX9A 4JXKA 3I6IA 4JR2A 1M7HA 4G1EB 1FRFS 1L2TA 4EVIA 2ZRLA 5AW1A 4RMNA 4AMYA 1XMOB 1CUGA 4S2UA 2Q62A 2QX9A 2UZ0A 3ZU2A 3B12A 3MCVA 2APJA 3WKCA 1K5GA 3FN4A 1JSLA 1KEPA 1OW3B 3NBUA 1U63A 1E7MA 5C46F 3OOSA 4P86A 2XNSA 3RRYA 5GZ3A 4OQ4A 4UNPA 3EDOA 1M2NA 1ODKA 1W4CA 2VNKA 3M3PA 2JC3A 4RANA 1QV7A 2R7LA 5CXSA 3RE1A 2LUOA 3ZGXA 4CUJA 5JPIA 4S12A 1DMRA 3T0FA 1NPYA 4LF6B 3M6MD 4I4CA 2WWIA 4PZEA 3I9KA 2IEGA 3DMRA 1ILEA 2QD1A 3LX8A 1NMQA 1PQYA 1NATA 4QGAA 1RABA 3DSRA 1MPXA 3TDNA 5MFZA 3FMIA 1M0WA 5JS2A 4YJ2A 4OXXA 1TKBA 1B0ZA 1QE0A 4FOLA 1QYCA 1CUJA 3NALA 3C7KA 3PNQA 3GPLA 3U44A 4D3ZA 2XZOA 2REQA 5CM8B 3WRXC 3QWHA 2WAAA 4LF4B 1TRKA 3FF1A 5H70A 1Q0TA 3ASVA 3AHJA 1YKFA 1SD5A 3PRHA 5HJEA 2XCSB 4CHGA 3I83A 3KL4A 4L8YA 1L7VC 3O4VA 3HVUA 4BXOB 1WKVA 1Y5RA 3VNUA 2AJLI 3EEYA 1TEHA 2R2GA 3JQGB 4BLRA 4NMWA 4D45A 3QEJA 3QKSA 3QE4A 3RIXA 3KV1A 2AS0A 1JKJA 1S2LA 5FBWB 5IFKA 3FYCA 3L8YA 1VE7A 2HFKA 5HF8A 3UXYA 4KIGA 1EVIA 4RH0A 2HDWA 5G4LA 3O0TA 4EY8A 1CVLA 1EG2A 1XF9A 1WHSB 2YC2C 4C6SA 4ZYVA 4FM9A 1Q16A 1ORDA 1OFHA 3KEFA 2H2IA 3EBOA 1I2DA 1UBFA 3BFJA 3BJZA 1VPLA 1F4VA 2V7QD 3N2KB 3ORRA 4CM5A 5JY1A 2CE2X 2TRSB 5DYTA 3WRWA 3VPCA 5I8PA 2V5AA 1SU7A 3F6PA 1SGWA 2Y1LA 3KKLA 4FLEA 3RRXA 5K7SA 3W06A 4JBXA 4JFAA 4B7CA 2I87A 5EXXA 1PR4A 3DTVD 4AP6A 5BNTA 3OZEA 4RD6A 4KVZA 4YP9A 4EO7A 5KSYA 4XVCA 4PYRA 1XDSA 4KXXA 4MW4A 5U9CA 1OH7A 1K3FA 3GDWA 3PQCA 3AU8A 5CDSA 4I1OA 4XD2A 2FQWA 4DQVA 1GCOA 2PRIA 5KYYB 1P0MA 3WIDA 2DRIA 4QHYA 3L6UA 2GQ0A 3QTTA 3HXLA 4GT1A 5J40A 4X6XA 3IJPA 5LC1A 3KYDA 5I5GA 1UF9A 1PJCA 4FS3A 5JMWA 3LGXA 1PYOA 4RNDB 4D26A 3LX5A 1C7EA 4X6UA 1E98A 1VMEA 1WXIA 3HL0A 1C4KA 2O7VA 3NOOA 4O4LB 3WYBA 4D98A 4DA8A 4DLLA 4EEKA 5B6IA 3HVHA 1H2YA 2QLFA 3KTDA 4I5FA 3QPCA 4AKEA 4UCFA 2PYZA 5B37A 2HYIC 4W82A 3ELDA 3L01A 3WMWA 3WR5A 1FRVA 3OF3A 2AR0A 1T13A 4OHZA 2JGLA 3CNOA 2A78A 1C0PA 3KBBA 4MW9A 4Y6QA 3S44A 2BBTA 5L3SB 1YZNA 1XTSA 3O3MB 3G79A 5C4GB 4RTQA 2DUNA 2VS1A 3TW8A 4DBVO 4EATA 1GNQA 4AM8A 5I6DA 3HY3A 3LIPA 1SXQA 2NOAA 5HCUA 2DTDA 3ZUPA 2ZU0C 4DMMA 1GL6A 3LUDA 3G0GA 4F85A 2XTZA 4CLHA 1Y63A 2PXAA 2XMZA 1FY2A 3NNDA 2BBOA 3RQIA 3W5DA 1Z9BA 2HIHA 5HW0A 4AI6A 1R88A 3BMCB 4QATA 1UBGA 3K05A 1FYVA 3CWZA 4J75A 1E1QD 1MO3A 2JI4A 4M0MA 5B36A 4Q7MB 1A72A 4PHFA 5LZ7A 2YZMA 2A84A 4CGYA 4LYHA 1PJAA 1JLSA 4UNSA 4RHFA 1R6XA 2ZIXA 2ECKA 2BY4A 2JFYA 4PQGA 1MB4A 1Y7LA 4Q93A 4CL0A 5BR8B 2JFBA 4YLEA 5CFOA 3VNAA 3VPDA 3O7WA 1ZPDA 3LH5A 3RARA 2PMFA 3DD1A 2GAFA 3EXFB 4LYYA 4R16A 3PHBE 1WXFA 5EHXA 4X8OA 4G0VA 1H2WA 4Q0MA 4MWSA 1XG5A 1CU1A 2PUGA 4R9VA 1SUWA 1IXSB 1K86A 3QRWA 1U1GA 3B9QA 3BS4A 4C1BA 5C31A 3WA6A 4ENQA 3DPSA 1WXEA 4GLOA 4OLFA 3DMNA 3H9BA 2DWOA 1KYYA 3JXEA 4HZGA 4NHEA 5DHRA 5DI3A 4A4DA 1W2GA 2VYFA 5HGJA 2W6QA 2BEJA 4BHTA 1JDJA 3QV2A 4UXHA 2H07A 3L0YA 4DL9A 2LBPA 3E0XA 4HAXA 4QYSA 4YACA 5CIQA 1SA0A 2HHAA 1D09A 1Q1QA 3BZBA 2P2ZA 1RACA 1K27A 1XTKA 2H7YA 5BYJA 2B2CA 1VI6A 3AIIA 3I9FA 1XA4A 2J9RA 3AM5A 1GA1A 4CLRB 3GLUA 5LP6C 2IV2X 2HDOA 5AVYA 4GX2A 1Q1ZA 1J97A 3ZY4A 4NCJA 1D2GA 4JT4A 1GZHB 1TPZA 4FCTA 2FN4A 2YMQA 4Y8VA 3VU8A 2FB9A 2QOEA 3H2IA 2C2YA 1A9XA 4X7BA 2WUDA 3OIGA 1WIWA 1XQYA 4KIJA 2GTPA 2XW6A 5A05A 4O8CA 3W34A 4URFA 2H4YA 3AESB 3DTYA 3S7ZA 2YRXA 4DCMA 3WYEA 1ZD9A 5FT9A 3E82A 2Z57A 1UZNA 2ZBGA 3B3AA 1YR9A 4DM4A 5AUQA 4F71A 4IXNA 4FMBB 1CF2O 1NU6A 3G0DA 3TUZC 1GQQA 5JMOA 4YRRA 1FMCA 1G63A 1BRTA 2M32A 4JL6A 2HBRA 1JDTA 3T54A 3KTFA 3RAFC 2BV3A 1RQGA 3HN2A 3JS5A 5G1NA 3LP8A 2WU3A 2QN2A 3CX3A 4HDRA 3ESDA 1JLMA 3JARB 1UPUA 4EUEA 4JT2A 2AR9A 2WJZB 3PG5A 2WWXA 1O5TA 4O4LF 1FFHA 1NX9A 2VLBA 1ICIA 5C1BA 1KVSA 3EH1A 2O3UA 3VJKA 4PPQA 4QXAA 2I55A 1ZNZA 3FRHA 1KO5A 3HB7A 4IG4A 5KZMB 1ND6A 3U49A 3FETA 1Y9AA 1LDBA 1RIFA 4MKFA 3LXRA 2XY4A 2NNLD 4HRXA 4EKDA 1B8UA 1E18A 3IURA 1W1WA 2ZJ0A 3DS8A 4L8VA 3FYTA 1CVIA 3LKZA 4Z4QA 2C7OA 1Y3DE 1L5GB 4LHYA 4R69A 3OZ7A 3F7TA 5K8UA 4C76A 2VPWA 3E27A 5H83A 3RFCA 1JLRA 3UVEA 2LXNA 3PNPA 5J43A 2I7DA 3O8OB 3ZQ4A 1Y80A 2WRZA 2QT1A 3LT2A 5TX7A 5ARDA 5CVDA 1PG5A 1GU1A 5DNYB 4ZQGA 4BLPA 3W1VA 1GL7A 1JVNA 2XUJA 3V1NA 4DB4A 4OMDA 3F97A 4PSAA 4P36A 4YROA 1RQNA 2OL4A 5ILQA 5DWVA 3BGIA 4MEJA 1JIQA 2FPPB 2WHPB 1Z3CA 4CT0A 1PEYA 4I6EA 2P69A 5G3ZA 2PS9A 2R7AA 3IR7A 1PRYA 1GZ3A 5NULA 1YRHA 3KV3O 3ZD7A 2EX0A 4LI0A 1BVUA 2BN4A 2V0CA 4J16A 2F1RA 4RK5A 4QXQA 1PNTA 1R9NA 4Q3OA 4P4NA 3P97A 2JAWA 2K2WA 4S35A 3IELA 1EA7A 5H3CA 2BKLA 3DYIA 2VZLA 5EE5B 1TCCA 1ZRSA 3O9VA 3V00A 4BVBA 4JLKA 3A11A 1E0DA 3M5CA 3U9TA 5K0CA 2O57A 3DUFB 5DGCA 4DIDA 4F3NA 1R0XA 1O3YA 2CMDA 3MTIA 4F21A 4BAUA 1F1JA 1KR5A 2H63A 4S24A 3QPWA 5ADVA 1XYYA 4FJ1A 3GQBB 4KIFA 5FBKA 4TMWA 4L6AA 4HUTA 2OCLA 4UQLA 4FHCA 4ZQBA 1KOLA 3T15A 5KX5F 1VB5A 2B0JA 4S3MA 2A0YA 4KNYA 6AT1A 1P1RA 4HAVA 4IFTA 4KAXA 3ZN2A 1VA5A 4LQDA 1FXWA 1QGED 4O2RA 3ACBA 3VKVA 1T5HX 1TT7A 2G06A 3GGOA 1RZ3A 3ADCA 3VX3A 1LWOA 1RKBA 2O6LA 4U2EA 2NUAB 4QVKA 3A9VA 5E9AA 2EF1A 2ZRDA 5LM3A 4UASA 1QMGA 4UBKA 4PLTA 1RCFA 2ZRKA 1CP2A 2QI9C 2RB5A 3DBOB 1HT2E 1W36D 2VDPB 2IUTA 4KQ9A 4RQTA 4XSHA 3ZIAA 3SWWA 3HWRA 5HOEA 1KRWA 3HGQA 4HLNA 4Q1AA 3WLHA 2XYHA 1LFDB 5G0VA 1MDBA 5FI5A 1A7UA 2BGIA 1T5DX 2OLEA 3RDPA 4A16A 4CMIB 3V4FA 1KPGA 4YASA 4Z9XA 1PZFA 4DNOA 4AMZA 1NVAA 4JCOA 1RBQA 3ONVA 4WKCA 3OUTA 1D8TA 4X85A 4H0FA 1PFYA 1EXNA 5DWQA 4TXLA 3PENA 1P0CA 3QSGA 2F1KA 4EQ6B 3RFTA 1KFCB 4HEA6 2JIBA 1J1UA 1B76A 5JJKA 4YIKA 2CBXA 5DIZA 2PBLA 2PT7A 4GS5A 1PSWA 4B73A 4OG2A 1FMJA 1KU0A 3Q7SA 4S1NA 4U9HS 3TTYA 3GVHA 5KWJA 2C29D 1F3LA 2X5XA 1Y1RA 2XB8A 7AT1A 1QRTA 3C3BA 4CMEC 4EUFA 4IMJB 3G2PA 4V1CB 4KXLA 2V7BA 4PS0A 3ZEIA 1Y7IA 3KB1A 2PT6A 4AECA 1HI9A 2HCJB 4LA4A 3KM0A 3AZOA 2C4MA 3IB3A 4OHMA 1NC1A 2DVMA 3KHKA 4QYXA 3UJAA 1P1CA 4LMPA 4MZXA 4WZ6A 1W4ZA 1TECE 3A2NA 3ONDA 4LXIA 1G1MA 1JR2A 4ISCA 1K89A 3D4NA 1W0JD 2P3SA 1YJ5A 1XGKA 2C4WA 1TK3A 3ZNNA 1M2VA 2OLJA 1Q14A 1TJ4A 3OLVA 3U6KA 3WKEA 1YL7A 2BC9A 2QE6A 3TIFA 1LTHR 4CIBA 1SVWA 3ROZA 2QMQA 4EDFA 4PZZA 2QQEA 1GZ7A 5EIBC 2NZ8A 2QE7A 4K9KA 3SEQA 4E70A 1P5ZB 2BBWA 5JDCA 1SBIA 1WP9A 3FGZA 2CB9A 1GZVA 2NU7B 3Q4GA 4IJWA 1M76A 3EZLA 2VP0A 4L4ZA 2Q3EA 1RIIA 4P54A 1EUZA 2DTXA 4Q01A 4RVUA 1CZOA 1T8TA 2V3WA 2VNJA 4G4GA 1SC1A 1YK0A 4P53A 3HJGA 3S1LA 3RADC 2X5OA 1UEIA 1U02A 1Y4SA 2FN9A 4UQOA 4OBWA 1BTOA 3ECSA 3AJ9A 5DDIP 3QKTA 1WMEA 3JSXA 4UTPA 2A4MA 3TZEA 1VPWA 2B8JA 3R3YA 4RETA 1VG8A 4I36A 2ZAIA 5TGTA 2VQSA 5EKSA 3A1EA 1G5QA 2ZCUA 2BZSA 3QU4A 4KZPA 3F0TA 3HZHA 3QP9A 3QEKA 1FIUA 3D7KA 1PQPA 3BTVA 4DKXA 4DCOA 3C2QA 5EWMB 1RC0A 4ZRDA 2VNAA 1E3TA 2C77A 1PGOA 3IEIA 3T9CA 4K6GA 3TB4A 3HVKA 1V1MB 4TKVB 1V3VA 2FEKA 4QUBA 3DM5A 3IGFA 4HR7A 5E6SB 2V4ZA 4QX6A 5JSZB 2A5LA 4GQIA 3SCZA 4AZ3B 3LUFA 3TFQA 3LRPA 5BNZA 4UMVA 1ADBA 2O0HA 1U3DA 5BUQA 2A9JA 3DJYA 2QQ0A 4Q02A 3LT4A 1IN1A 1GGJA 3ZQKA 4BV2A 4HNGA 3ZBPA 2XIJA 4YRZA 2JRLA 5C8YB 1ZGJA 3G0CA 1XVTA 2JIMA 3UTDA 4RLQA 3VPGA 1Z28A 5LD2C 4YMIA 4DY6A 5TSDA 4X91A 1JPUA 5AOBA 3H2BA 2NTNA 1IXZA 3DD5A 2PZAA 4MW2A 4DQDA 3THYA 5CT5A 3FUVA 3DBLB 3HB0A 1AKQA 4ZOLB 2FMTA 4IOLA 2NTYC 3O4GA 4AZVA 1S1CA 3DWIA 2J0QA 4HMPA 1BVRA 3TTSA 4J6EA 4FW9A 4YRKA 5KTTA 2YC4C 3C3KA 1JWAB 3SIPA 2OV1A 2BMAA 3H3FA 1PQ4A 4J9VA 2BISA 1M72A 4HYTA 4LE2A 1U3TA 2WJIA 3BB4A 3TQQA 1N8TA 1KQ3A 4CKWA 5TARA 2RBEA 5E6UA 1BSVA 1V4VA 4MQEB 1SG6A 3W3AH 3NDRA 2B2XA 1QV6A 2HCTA 1WVIA 1H2XA 4D9MA 4ERXA 2WJJA 1TMYA 2YS6A 2HM7A 2H5EA 4G0OA 5KAPA 1JDPA 3GNSA 5F77A 2OP0A 2CYBA 5IARA 1XZAA 1F6DA 1T6BY 1N8KA 4WLEA 5BNIA 5IBCA 4I9FA 4MI6A 3GLIA 4X94A 4WBNB 2I1LA 1KE1A 1NQUA 1MA0A 3FB1A 1HYHA 1H0SA 4J0KA 4M86A 2HA7A 3BULA 3CN7A 2A1TS 1V1RB 3N9IA 4ZZIA 4AVYA 1U6JA 3C6BA 4PY2A 2CLHB 6ABPA 1NJ2A 1E2LA 1NMSA 2XNHA 2X0DA 3WKDA 1OZHA 1NYTA 4V39A 3KKPA 5JAIA 1V7ZA 3B3JA 4M76B 5CLLA 4JLVA 4B3GA 1SG9A 1N2OA 3VPAA 1JR4A 4IDOA 1THGA 4TTSA 5CCEA 4JVMA 4J3JA 1ZXXA 1KKUA 2RJ3A 4KNVA 2OK7A 2YFHA 4HH3C 3VR2D 5KSOA 4ZD6A 5FX2A 2EHDA 1UQTA 1R8XA 1XLWA 5JROA 3SXJA 3LECA 5I4KA 2ZIEA 4OP2A 1YOVB 4IOJA 4XQ9A 2A9KA 3F96A 2YWRA 1QP0A 4IDQA 2RK3A 3SMQA 2HLDA 5FLXA 4ZHQA 2UUBB 5KTMA 2CLOB 3QI7A 3O31A 4GNRA 3S1AB 3X1DA 2GK4A 1CY4A 3KU1A 4GMXA 1P4GA 4QDUA 1DPGA 2GYWA 1XRMA 1Z6GA 2NUBA 3GEBA 3EJWA 2P79A 4K1XA 3EUFA 5LXTB 1FFEA 2RCYA 3AK4A 1EFAA 1BGWA 1U0RA 1WY5A 3DL0A 3KO8A 3P2IA 5DNWA 4QTYA 1L7XA 4MVJA 2D1SA 3A05A 3FIJA 3KWJA 3MGKA 3RTAA 4DTCA 3HU5A 1QP7A 3MJRA 2NVUB 3HPRA 2WM9B 1WD7A 2CDRA 4Y1RA 3O2QB 4HX5A 2XQVA 4OQDA 5HFNA 4BRZA 1M2KA 4MAAA 4OAQA 1ZK4A 2VPZA 5DCYA 4X5OA 2ZPTX 4OBXA 3W77A 5FUBA 1GYQA 3LVRE 1J22A 1E66A 4HDOB 3VSDA 1TCAA 2CSUA 4GM1A 2YVUA 2PRZA 2YIVX 2YUIA 3HJCA 4EHHA 3KD3A 1GJRA 1GXSA 1R16A 1XXLA 3B1WA 3PITA 1BKSB 4B2IA 5MN4A 3T7AA 5F9FA 3PPIA 1T2UA 1ESNA 3UMSA 1A9ZA 2V7UA 4DIBA 2PLNA 4RVHA 2XZLA 1EB9A 4LAFA 5LMNB 3OQJA 3V2GA 1SXHA 2Z6QA 4ENRA 2YCLA 1C2TA 4GPAA 4Y2YA 3BRSA 3EWAA 3KAQA 5EJ2A 1NM5A 5EP4A 5B7NA 4CETA 4K9MA 1HUQA 4CTOA 5AO9A 1ORIA 5T5QA 1QX3A 3OPYI 2GZAA 1SRRA 4HLQB 1SCAA 2FSHA 1WA5A 2FG7C 4WOCA 3GGJA 4D8TA 1OLSB 4M0DA 1VHWA 2I3GA 1EP1B 1AQJA 2IYLD 3JPWA 1A0OA 1VJDA 3L0ZA 1IBKB 1LI7A 1V2HE 2CNBA 3ETCA 4GBGA 4DPKA 3QVWA 4GYYA 1OI3A 1YKGA 4DXAA 1JPJA 2WJYA 4YRLA 1NVVR 3VOBA 1FLDA 3FPEA 2RHWA 1FK8A 4L07A 1JU9A 4YAWA 1ENYA 3AUUA 1MVLA 3GF4A 1E60A 1BOOA 2ETXA 1ZH4A 5DTMA 4K05A 3W5JA 5JXIA 2ZDGA 4Z99A 4UBJA 3V2HA 3GLHA 4Q7KA 1FNBA 2VPPA 3TMYA 4KFRA 3LUGA 5C2JB 3ZCUA 3LT1A 1ZKDA 2EU8A 5AUPB 1ZAYA 1POXA 3CBQA 4QODA 1Z2PX 2A3NA 3HKEA 6NULA 1TCUA 3CEMA 1KAHA 4WBNF 1KA9H 3TMAA 2Q4EA 2Z3ZA 4DZTA 1ECJA 2QRJA 3HYCA 2PX2A 3MUOA 3EQ8A 3P26A 3NP7A 4IIHA 1BXRB 3RB8A 3TEJA 3UWDA 1KK0A 1PHRA 3CMCO 1QGOA 3VJLA 2PUBA 1E2BA 4BY9E 1OWNA 3B2EA 2PSDA 1JUDA 2YRFA 4BV3A 4LCEA 3S55A 4KWCA 2AD5A 4MR7B 2V6IA 1E3EA 5L3ZA 3FNRA 4DV3B 1QYXA 4U6QA 1U7PA 1QHHB 1H94A 3Q7PA 1EA5A 4IIUA 1Q17A 2NQ8A 3D6MA 1HLPA 4V0RA 5GIOE 1DL5A 3TZBA 1RVV1 1QS0B 2OAP1 4IL5A 3D6FA 1DCTA 2B0CA 3KB8A 3TGWA 1HWYA 1W85B 1YIDA 5A9RA 2GN8A 4BECA 4ZVVA 2BHRA 4C0SA 2FG6C 2VAVA 1FP4B 4A26A 5K3BA 2ZQZA 3ZVRA 4GZ3A 2LIVA 1NA5A 3CSUA 2C83A 5JALA 5KHLB 1ZHOA 3JZIA 2I4OA 6YASA 4KRFA 2BHSA 2RMKA 3S8EA 1PU2A 1LTQA 3R24A 3LQFA 3RIYA 1CETA 1D4OA 3PXUA 1TF2A 4HDM