3UF0A

Crystal structure of a putative nad(p) dependent gluconate 5-dehydrogenase from beutenbergia cavernae(efi target efi-502044) with bound nadp (low occupancy)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
249
structure length
249
Chain Sequence
GPFSLAGRTAVVTGAGSGIGRAIAHGYARAGAHVLAWGRTDGVKEVADEIADGGGSAEAVVADLADLEGAANVAEELAATRRVDVLVNNAGIIARAPAEEVSLGRWREVLTVNLDAAWVLSRSFGTAMLAHGSGRIVTIASMLSFQGGRNVAAYAASKHAVVGLTRALASEWAGRGVGVNALAPGYVVTANTAALRADDERAAEITARIPAGRWATPEDMVGPAVFLASDAASYVHGQVLAVDGGWLAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Short-chain dehydrogenase/reductase SDR
publication title Crystal structure of a putative NAD(P) dependent gluconate 5-dehydrogenase from Beutenbergia cavernae(EFI target EFI-502044) with bound NADP (low occupancy)
rcsb
source organism Beutenbergia cavernae
molecule tags Oxidoreductase
total genus 93
structure length 249
sequence length 249
chains with identical sequence B
ec nomenclature ec 1.1.1.125: 2-deoxy-D-gluconate 3-dehydrogenase.
pdb deposition date 2011-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3uf0A00
2CD9A 3C3XA 3RC2A 1PSDA 1WDMA 4UULA 3TL3A 3QWHA 3ZHBA 4D79A 4CLOA 3HB5X 1PJBA 4PLTA 1B15A 3U3XA 1GCUA 1JWAB 2R00A 3SJ7A 1TLTA 4OGWA 3WYCA 2YY7A 4XB1A 1EBUA 1I2ZA 5IFLA 3GF4A 3W8FA 2V7PA 1LQTA 1HE5A 2YV3A 3ETEA 4YAEA 4PLVA 5I8WA 2DUUA 3H9EO 1MG0A 3LVFO 4CM4B 3ST7A 1B8VA 1YWGO 1T25A 4S3MA 4DL9A 4ZHSA 4PLYA 2DT5A 4BV9A 5CDUA 3PQEA 4BKOA 5A5EA 1R4NB 1FMCA 4BNLA 2IZZA 1BDMA 3X2EA 3GZNA 4RVFA 4Y98A 2B4QA 4BNWA 3HB4X 3UHAA 1YE3A 3HDJA 4YCAA 1XGKA 1SB8A 4OKIA 1YJQA 5FF9A 3R3SA 4H7PA 1YH3A 2Y0DA 4P4NA 4WLOA 4IMRA 1E3LA 3WICA 4AJKA 5JY6A 3VVBA 4U0JA 3QWAA 1UZNA 3OF2A 3BA1A 2HRZA 3TDKA 2CDAA 1S6YA 5A9RA 2BI8A 1E6UA 2WYWA 4CJXA 4WLVA 4RVUA 4YAKA 3VC7A 2YHIA 3ZWWA 1I3MA 1PJ4A 4B79A 3R6DA 1OI7A 1ZZEA 4N5LA 2G5CA 1HWYA 2ZATA 1EVIA 1KVTA 3P2OA 1HRDA 3WLFA 1E0DA 4A73A 1WW8A 3A28A 3ZNPA 5A06A 1PJSA 4FFOA 4XRRA 3CIFA 2EW2A 5HRUA 4CUJA 1YQDA 4J9UE 5HS6A 5C5IA 3Q1LA 4R1NA 3JQ7A 3KOUA 2Q49A 3AJRA 4TROA 2RBEA 3FNHA 4QSMA 2DUWA 3ZV4A 5IN4A 1KEVA 3BZUA 4I9HA 2R00C 4PLWA 4CLDA 1GFSA 1HZZA 3INRA 4GX2A 1P1HA 2CNBA 1P45A 4E5PA 1ZIDA 4HKTA 2EIHA 3LC2O 4FGWA 4FFRA 3V5NA 1ADFA 4JK3A 4BNVA 4UAGA 3TL2A 3RUIA 4FGSA 4Z9YA 2YW9A 1ONPA 2ZB3A 3FWNA 4XRGA 3GVHA 5IDWA 3LLSA 1KIFA 4CMIB 4DLBA 1E7RA 1T1SA 4OSOA 3S8MA 3MJCA 4R01A 2DLDA 4HNHA 4U5QA 4UVIA 1SZJG 2X9GA 3WGGA 3M1AA 1RM0A 2I67A 1PQUA 3IS3A 4BB5A 4E2WA 2PGLA 4K1LA 3ASUA 4XIJA 3DTTA 1LLDA 3GVCA 2D0IA 1GD1O 3W4KA 2QW8A 3IP1A 3MTGA 2D5CA 3FHLA 3O38A 4UUOA 1Q0HA 4YT2A 2NVUA 1D7OA 4YT5A 1N8KA 1LLCA 2O4CA 3UF0A 2PH3A 1WP4A 2VHZA 4BV8A 3GVIA 5T57A 1TT5B 3HDYA 2P9EA 2Y0CA 2ZKLA 4NDNE 3Q3CA 1GEGA 4DREA 4CM6A 3ENKA 1E1KA 1WWKA 2H63A 4BOYA 3GGGA 1MFPA 4YAIA 4XQGA 1CDOA 3T7EA 3AM5A 1LTHR 2XOXA 2DFVA 5BT9A 1ENZA 4DIOA 2G0TA 1WZIA 3GN1A 4TKMA 3TZKA 1EFKA 3P7MA 1O0SA 1I33A 4J4HA 3F9IA 4PVDA 5JCJA 3LC7O 2Y68A 3UCFA 4EEZA 4CMBA 3WXBA 5L95A 2V6FA 4AJNA 3MWEB 2ZYAA 4DC1A 2JAPA 4GPD1 5KOIA 2E4AA 3PHLA 1BVRA 5DULA 4YXFA 1NQTA 1V3TA 3KETA 1I2BA 4GLOA 3PYMA 4IPTA 2VT3A 4DC0A 4PZEA 3IJRA 2X5JO 5JSFA 3OM9A 4YVFA 3UXYA 1ZCJA 2FZWA 3DBHB 4IS2A 4BL5A 3N74A 1BSVA 2I3GA 4MKZA 3RD5A 3GQVA 1HYHA 1GUYA 2DC1A 3P19A 3ZV6A 3DHNA 5HWSA 4XGNA 3JQFA 1Q7BA 4JBGA 1UJMA 3C8MA 4JJIA 4GH5A 4OKNA 1ADBA 1DC6A 1G6KA 2WJPA 2VHYA 3PYXA 6LDHA 3G3EA 1B7GO 2NADA 3I9MA 4L4XA 2P68A 1DRUA 2I76A 3JD0A 3ZHXA 4XZ3A 3ZNQA 4NNJA 4YAJA 4H3VA 5KVSA 3D7LA 5I9LA 1ZSYA 4RO0A 4JX8A 4BNJA 3VH4A 1I10A 1U2GA 1W4ZA 3OIDA 1U8FO 3TPCA 3BXXA 4IXWA 3KTDA 5AVOA 4BNKA 4NBRA 4NFHA 1GL3A 1H2BA 3QVTA 3D3WA 1FDTA 2Q50A 1HL3A 2BD0A 4HWKA 1B0AA 2PWZA 1W73A 1ZSVA 1QMGA 2PD3A 4WNCA 5HS4A 3U4CA 5L7TA 1DLIA 2HUNA 2Q99A 4PG7A 3ORFA 3WGOA 3VPSA 3NV9A 3W1VA 1QYCA 1C14A 1E5QA 1DRVA 2BLLA 2GO1A 1E7MA 1T2FA 4DIBA 4L73A 1X13A 3GFBA 1H6AA 3AY7A 1N5DA 4NJMA 1NASA 1J4AA 1E3WB 1OOEA 4J90A 4DYDA 5KVQA 3GUCA 1XDWA 5JBIA 5DBIA 1XHLA 1A27A 4GX5A 3JQAB 3H5AA 3HJAA 3JQFC 4CLRA 1VI2A 3WGZA 4JROA 1HDGO 1NAIA 2AQIA 2OBYA 2UDPA 3PI7A 3IMFA 5A1TA 2EKLA 3LT2A 4CMCA 1PQWA 3Q2KA 5T8KA 1DXYA 1BW9B 4EJ0A 4EUFA 4G65A 2FPPA 4MVJI 4XCVA 1YB5A 1WMAA 2PH5A 4GX0A 2HJSA 3RC9A 5I7SA 4IDFA 1Y8QA 1K89A 3IQDB 4Y8VA 1GCOA 3VTZA 1R6DA 2X5OA 1CYDA 2PGDA 2IDZA 3CPSA 5IXYA 4RF2A 1WLYA 3HWRA 3VKUA 4KUGA 4ZICA 3D3EA 1M75A 1ZXLA 3BMQA 1I3KA 1ZK1A 5B37A 4EZBA 3QVSA 4J1NA 2XXBA 1AUPA 2Q45A 3L6EA 3PJEA 2PZLA 2PD4A 1EUCA 4RPLA 1EZ4A 3PZRA 4BNIA 2A4KA 1XKQA 1LDBA 3GN2A 1U3WA 4PFJA 5AXDA 4IIUA 3RBVA 1IULA 3AUUA 1YOVA 1C0KA 3DZIA 4ALJA 3RJ9A 4D44A 4AG3A 3GDOA 4YB8A 5U4QA 1E1MA 3CH6A 1FDSA 3E1KA 1OFGA 3NGLA 1I3NA 4DGSA 1MFZA 4BO8A 4CM8B 1ZMOA 3FNGA 2B35A 3CMMA 3K96A 1HT0A 4ZQHA 1H5QA 1U4SA 3DFUA 1SPXA 4ZA2A 5IF3A 4D3SA 2JKVA 3JQAD 4ND2A 1GZ6A 4YRDA 5JE8A 2QIOA 2AE1A 4L4SA 1ZMTA 3K5PA 3JQ8A 2J6IA 4AJOA 3DHYA 2Y67A 1GAEO 3H65A 2HKIA 1VL0A 4WKGA 4D41A 3UVEA 3CKYA 2VHXA 2BRUA 3DONA 4ID9A 1P9LA 5CPBA 3O26A 3WQQA 1IB6A 4C4OA 1DFIA 3ZWPA 4RVDA 4E2YA 1QLJA 3ZI0A 4BKRA 1PL7A 4LCEA 2CVQA 3AUAA 3DOCA 4OO3A 3F1KA 4XD2A 1A4IA 4CMKA 4KWIA 4O6VA 3IAHA 3NUGA 1QXSA 2UAGA 4XKJA 3V2HA 1KY4A 2JD2A 4U6SA 2PZKA 3ZZNA 2EP5A 1VKOA 1EVYA 4MVJH 3B6ZA 4ZJUA 1K6XA 5DOZA 4FD3A 2JFHA 4JQCA 1LLQA 2X1HA 1Z73A 2HCTA 2YV1A 4JCOA 4UREA 4B4VA 4L8VA 2P5UA 3AI1A 3O9ZA 4Q3CA 2O7QA 2ZQZA 2X7HA 4O1MA 1R37A 1LEHA 3PLNA 4Q3AA 3WS7A 3JQGA 1EVJA 3G79A 3OJFA 3I6IA 3SEFA 3TZQA 3FF4A 4OXNA 1WPQA 2NVBA 3L07A 1VE9A 5EESA 1HETA 1MXHA 2PNFA 2V6BA 4E2ZA 5CEEA 3OICA 2I9PA 2C7GA 1E77A 4NZ9A 3DAFA 2R6JA 3AOEA 4M1QA 3IOYA 1GUZA 5COAA 1SOWA 3EY4A 3RROA 1A72A 3SC6A 2WYVA 4J0FA 4YJHB 3ZU4A 3KB6A 1YRLA 4UVGA 7ADHA 4BHTA 1KETA 1PR9A 2HMTA 1LSOA 5AXAA 4HXYA 4HV4A 4BNZA 5J23A 4M8SA 3EDMA 1ORRA 1O6ZA 1BWSA 4OOEA 4GVXA 1IPFA 1QV6A 4II2A 3VZRA 3GGPA 3N58A 3Q9NA 4WCFB 1F17A 3BMOA 1A9ZA 3P2YA 5ER6A 4BIIA 2IXAA 3KYBA 4H15A 4K6FA 1BXGA 1C3VA 3H9JA 1PL6A 3NX4A 1LLUA 3HNPA 4PRKA 5IZCA 1ZJZA 2C54A 3OQ1A 1DO8A 1OC2A 3V2UA 4B3IA 4D45A 1NVTA 5L53A 5BSHA 2HMUA 4PLCA 5JAQA 1DAPA 3PHGA 3E03A 4IZIA 4IQGA 1P3DA 3WMXA 3WGTA 3WQRA 4E0BA 4E13A 5JC1A 1BXKA 3VZQA 5JDIA 2W8ZA 4BS9A 3NJ4A 2PV7A 1YS4A 2UV8A 4GMGA 1JVSA 4BO2A 3SC4A 4KDFA 4DVJA 3F4LA 3ZDFA 4CQMA 3PP8A 3EYWA 3KV3O 4ND1A 3IKVA 1VSUA 2FR8A 3K30A 3O8QA 4R5HA 1PIWA 4QFDA 5I9MA 1DHTA 3ZW9A 3ZWXA 4KP7A 2ILTA 3MTJA 2VHWA 3UOGA 4XYBA 4YPOA 2NU8A 2GZ3A 2WD7A 3AOEC 3I9OA 3E82A 4HBGA 2P4HX 1WDLA 1YB4A 2JCVA 4L76A 3ANLA 3AM3A 2GNAA 2EKPA 4A03A 9LDTA 2XXJA 1NR7A 3ZN2A 4DQXA 4J7XA 2VRBA 4AJHA 2O2SA 4BNXA 2GF2A 2FSVA 1P1JA 1HSZA 5A5FA 1N9GB 1ZBQA 3U49A 1IHYA 4GL4A 2GGSA 4Q3NA 2PD6A 4QUKA 5H81A 4KWHA 1XU9A 4TRNA 5EL0A 3WNVA 4EUEA 4ZN6A 1ULSA 2VWHA 4NI5A 3FD8A 1CWUA 3RASA 1LSSA 3U4HA 2FN7A 4A7PA 4F3YA 3GNTA 1FJHA 4Q39A 2VUSA 4FBGA 4IJKA 1ONNA 5IZCC 1GDHA 3MJSA 4FC6A 3PVZA 2VNSA 2OXIA 3H6KA 3DBVO 5GMOA 5THKA 1YQGA 2DVMA 1IUKA 2CY0A 4BO5A 4RZHA 4B7UA 4MVJE 3VHRA 4BO7A 5JDIC 1L7DA 2PFGA 1H6CA 3DEYX 3CEAA 3H9UA 1GU7A 4NU6A 4FIZA 4WLNA 2XPCA 4CMJA 3PEFA 4OAQA 4EJMA 5BR7A 5A3JA 1DIBA 1UDAA 5T6BA 2O3JA 2X58A 3ONEA 2RIRA 2EJWA 3QV1A 4B4UA 5CPFA 2JCYA 3PHJA 3MJEA 3WDSA 5B4TA 4GGOA 1ZKMA 5CEJA 2QRKA 1TI7A 4GI2A 3RCBA 1T2EA 3F4BA 3S55A 1P74A 2P4QA 3F46A 5EQFA 1U28A 3CINA 2WEKA 3TOZA 4HX5A 1A7AA 3JCZA 3EZYA 2WWRA 3TWOA 4NFYA 3QA9A 3OJEA 4NR0A 1E1NA 2YQ5A 4KTTE 2ZCUA 2YV2A 4LVUA 3LDHA 2QHXA 3IC5A 5KKAA 4BGVA 3DBRB 1G1AA 1LBEA 1WAMA 4MVJA 3UGKA 4ONEA 2WDZA 1CQIA 1AHIA 4MVJM 4YTEA 3NT2A 3KHUA 3VDRA 3N7UA 1T2DA 3RU7A 4CR7A 1I0ZA 4Q3BA 4RL6A 2VQ3A 3H4VA 3QVOA 2VZ8A 2FHSA 2LDXA 4YACA 1K2WA 3KBOA 5CDGA 2BFOA 4MP8A 4I08A 4YDRA 4BVAA 3P5SA 1PX0A 2ZB7A 4WUVA 1JW9B 2Y1EA 2ZJ0A 4K26A 2LDBA 1U1IA 1H2HA 1B26A 1ZW1A 2X0IA 4RQUA 3U09A 1I8TA 2RHRA 3DFZA 3HUDA 1LC3A 3PGXA 2VOJA 3DMTA 3DOOA 3H7AA 2R2GA 1Y5RA 2I66A 3D4NA 2GSDA 4YEDA 1U3UA 5A3VA 1QYVA 4W7IA 4DBVO 1V3VA 4OJNA 2OORA 3L6OO 1XCBA 1NQOA 1CEQA 4FFLA 3GLQA 2P9GA 1J5PA 4K28A 5G0VA 3PPIA 1OZAA 1T2AA 1UXJA 2PKQP 4H16A 1C1XA 3BMNB 4TSKA 2PR2A 3M2PA 4RLHA 1PGOA 1NPYA 3ITKA 3MWDB 3DZGA 5BNTA 4WEOA 4G5HA 1F06A 3WTBA 4OMUA 1W8DA 1Q2XA 4IDGA 4LCJA 4RPHA 3AFMA 4E6PA 5B4UA 5U9CA 1IZ0A 3C85A 4GSKA 4E5NA 1UZLA 1N7HA 1YBVA 1R66A 3I6QA 4J16A 3TSCA 4WLFA 4J49A 4A5OA 2UYYA 1GV1A 4HP8A 1LXCA 4M54A 5TSDA 1CETA 1LDGA 1SBYA 3JD1A 3PXXA 5A4DA 3GC6A 4PG8A 3FN4A 4BMSA 4WASA 3OJLA 1PZEA 4FJ1A 3FPLA 1K0UA 1MC5A 3RUCA 3JD4A 4IGFA 1GZ4A 4Z0HO 2W2LA 3HFGA 3MJ4A 2VWGA 3NTOA 1HLPA 1KBZA 1NBOA 3OJ0A 3FI9A 4CM9D 4BGEA 4ESOA 4MP3A 3CE6A 3DMTC 3ZHZA 4ND3A 5F1KA 5A9SA 1F0YA 2C7VA 1G0OA 1PZFA 1I24A 3PJGA 2VTEA 3LF1A 3OBBA 1PGQA 3I23A 1H6BA 3ZW8A 3RKRA 1E7QA 1RKXA 3KYDB 5ITWA 4E3ZA 1P0CA 4JLWA 1HZJA 1VPDA 3U5TA 1PTJA 1B2LA 1O9BA 4AJJA 3ANMA 2VZ0A 3HFSA 3NT4A 4AFNA 2ZTVA 5GZ3A 4WLUA 2NM0A 1PJCA 4WCDA 5JXWA 3PTZA 3I9KA 2OP0A 4B3HA 5FEUA 1UP6A 1GV0A 3I4FA 3BHMA 4R68A 2BI7A 2A92A 2AG5A 1FK8A 2V6GA 3KYCA 4EGFA 3DHEA 2DQ4A 1F12A 3ZU2A 3VZSA 4O59O 1X1EA 4RPJA 4AJEA 4DQUA 2ZTUA 4CLHA 4QQRA 5DN9A 1N2SA 4CQLB 4CMEA 3CUKA 4A0SA 1YGYA 4IDBA 1JU9A 4FJ0A 4J91A 2W90A 2DM6A 5B1YA 5FI5A 3UCXA 1V35A 2DTDA 1TXGA 2HO5A 1UXKA 3VPHA 2PK3A 1R0KA 3QJ5A 2X22A 2GRAA 2J5KA 3O03A 3RUFA 2AG8A 3S2IA 4AJLA 5BSGA 3WG9A 1C1DA 2GCGA 2D1YA 5BNFA 4J9VA 2G1UA 1E3IA 4L4RA 3RIHA 1KC1A 4CLEA 4RPKA 3A06A 1K6IA 2Y05A 4IDAA 4YJGA 3WBFA 3ZV3A 3RAJA 3CZMA 3T7CA 2EP7A 3GT0A 3ZHYA 1ZK4A 3UFXA 4MVJP 3JQBA 1N92A 3MCVA 4ALLA 4JIGA 1DSSG 1ENPA 1JQBA 2OFPA 3EVTA 3DMYA 3L9XA 4WJZA 2OHXA 2GERA 3AY6A 1UP4A 2ZTLA 1VJ0A 4J0EA 1W0CA 4R1UA 1QRRA 3FWZA 3H9QA 4ILKA 1QLHA 2Q1SA 3GVPA 4U8GA 5AYVA 2GZ2A 3OQ6A 4WGGA 4WNIA 4IM7A 4MVJG 4ROSA 5B4VA 5COQA 2OMEA 2Q2WA 1NQ5A 1CIVA 3W4JA 4ZD6A 3NDRA 3L77A 3HADA 4IY1A 1N1GA 1X7HA 2GLXA 1HSOA 2ZIZA 1E6WA 3DQPA 1SMKA 4LMPA 1O8CA 1DIRA 1B8PA 2BGLA 3RFTA 2FMUA 4U0KA 3U62A 1EUZA 1Y8RB 2GN9A 2VYVA 1YJ8A 4ZVVA 1NM5A 4YJDA 3JYPA 3PFWO 3PZBA 4Y6RA 1BVUA 3OMLA 4N7RA 4R51A 3S2FA 3B20A 5JPIA 4YR9A 3DAPA 1M67A 4JNKA 1IHXA 1NVMB 3AI3A 2I99A 4JBIA 2Z5LA 3DBLB 1R4MA 5T5QA 5LDHA 5F21A 2A9FA 3ZWMA 5U1PA 3VDQA 1H6DA 1GQYA 5ES3A 2JD1A 2O7SA 3RQSA 4NBVA 4DLLA 1ZUD1 4WE3A 2DBRA 2ZJ1A 4CLXA 3JQBC 3G0OA 4PZDA 5BSFA 1PZHA 5ENDA 2POQX 2B0JA 4IDDA 4J43A 1PL8A 3GA0A 2Y1CA 2Q1TA 2EV9A 2W2KB 1P1RA 3UW3A 2UUOA 4DMMA 5KJFA 4XX0A 4WOKA 4W82A 3JQ9A 5KVCA 3W6UA 3IKTA 1R0SA 2VOEA 3MZ0A 4AJIA 4N18A 1I3LA 4YJFB 4MIYA 5EJ2A 3MJTA 4I8XA 5JAMA 1L7EA 5G4KA 1CJCA 2EJVA 3OEWA 2SCUA 3ZWNA 4AJPA 1GZ3A 2JJYA 1X7DA 1U4OA 1N1EA 4XIYA 1UAGA 1PJ2A 3NTQA 3Q6IA 4B3JA 2CZCA 2RH8A 1EFLA 4ITUA 3E48A 1JLLA 1U7TA 2EF1A 2FP4A 2NQTA 4MPDA 4R5MA 1GPJA 4EBFA 2CSUA 1P1KA 1EUDA 1GYPA 3A14A 4YAGA 2I5PO 3ROQA 2IZ1A 3HE3A 4PLFA 3X2FA 4DPLA 3EK2A 3B1JA 2FPGA 4UEJA 3DB2A 5F5LA 2BHLA 3G1UA 2IRWA 1JTVA 4YRBA 4XA8A 1U3TA 1V0JA 1Y5MA 1FDVA 1BG6A 2Z1MA 3GEGA 4HUJA 4LISA 2AQKA 4YRAA 3BMCB 1FF9A 5BSEA 2UUPA 3LF2A 5G2OA 1VM6A 5L4NA 5DNAA 2ZYDA 1LSJA 1XIVA 4BNYA 5IDQA 2AEJA 2NTJA 1WVGA 1R16A 1KS9A 4UUPA 3V2GA 3RBZA 2DBZA 1ADGA 2Y1FA 3G1TA 4YQYA 4BNUA 3HN7A 4M86A 1K5HA 3JQ9C 1NFRA 4KOAA 3LYLA 5EERA 1FXSA 2GN6A 2VYND 3GHHA 3I9LA 2QQ5A 1HYGA 5L9AA 3JYNA 1XG5A 1XA0A 5CG1A 4EYEA 1YDEA 1ZFNA 4RZIA 3UUWA 1KY5A 3DZJA 2VTDA 3EW7A 1GADO 4P4GA 3OFSA 4L75A 5FWNA 3WLEA 1V9LA 1PGPA 1Q0LA 2H6EA 2IZ0A 4YBZA 2XAAA 2J5RA 1UH5A 2EEZA 3FNFA 4FPXA 2NU7A 3GPDG 1D3AA 3AI2A 4IXTA 2ZB4A 4CM4A 1KVRA 2HAEA 4GKBA 5ILOA 3ICPA 3GMSA 3M6IA 4R3NA 2TMGA 2X0RA 1MLDA 3GRPA 2YUTA 1R4NA 2O3UA 3LU1A 3L4BA 1ISIA 4E31A 2FY8A 4X54A 1ADCA 1LDYA 3AM4A 3DR3A 4BO3A 4J4TA 4FFPA 3PDJA 4WK6A 2P91A 1PWXA 1H9AA 1LQUA 3C24A 1XEAA 4JGBA 2JL1A 1VJ1A 3WIEA 4CM3A 4MKXA 5ILGA 4NHEA 5T8KC 1VC2A 4E4YA 1SEPA 4Y9DA 2DBVO 4R9RA 2OGUA 4BQPA 2NTVA 1E7WA 1P1FA 5HA5A 4CLOB 4RV9A 5CG2A 1LI4A 1JWBB 2ZB8A 1EMDA 3ROMA 3K6JA 4K6CA 4UVDA 5JO0A 1C0IA 4PG4A 3NKLA 1N7GA 1DPGA 2FPIA 2YFQA 1CQJA 4ZRNA 4OYRA 4B4OA 4S1VA 1VRWA 1L1FA 4A26A 4XQCA 4HFRA 4J1QA 4L9RA 5H83A 4IBOA 3WNQA 5C37A 2HU2A 2EWMA 1KERA 3GUYA 4BKQA 4I5EA 1M76A 3GZNB 1OMOA 2DU8A 4HFNA 1DFHA 4FW8A 1DAOA 3S2GA 5KIAA 4MKRA 5TS3A 4A10A 5COBA 1NHGA 2FR0A 3NYWA 1ZVMA 4IJVA 3WTCA 4GMFA 4BNHA 3KLMX 1E92A 2PLAA 2ET6A 1V8BA 3QHAA 3BHIA 3EC7A 9LDBA 3WIDA 4NMHA 4B7CA 1Y1PA 5IDYA 1PJLA 3HZZA 4IINA 3EAGA 1YDWA 4YWJA 5L51A 4LSWA 1I2CA 2RCYA 4LK3A 1HLDA 3PHHA 2YHIB 4IJUA 1MUUA 4TVBA 1NAHA 4CMIA 4GVLA 1GYQA 3D5QA 3L4BC 3LT1A 4M49A 4CL3A 3Q11A 2HRBA 3NJ8A 3T4XA 2BFMA 4AJ4A 4BKPA 1AXEA 4XYGA 3JQ6A 4NBUA 1K3TA 1GY8A 2Q3EA 2DTXA 3F5SA 1Q7GA 3K2EA 2YHUA 3JQ7B 2PA3A 1QP8A 5CDTA 3TRIA 1KYQA 4ZQEA 5AXCA 2D4AA 3WSVA 1LDEA 2PKQO 3K73O 1QG6A 2CF6A 4RVSA 1V6AA 3GPIA 3PFFA 3GVXA 4PRLA 4F45A 4TVOA 1DFGA 3ETGA 3RUHA 5G0WA 1GYRA 3QWFA 3WSWA 4I9UA 4J7UA 1JKJA 3AW9A 1HE4A 3VPGA 4D0RA 4FQ8A 4OH1A 4J2HA 1EDZA 1TT5A 3UCEA 2PGJA 3ASVA 3JTMA 4BNNA 2UVDA 5DCYA 2IEBA 3V8BA 1QYXA 3SJUA 4BMVA 3DAGA 8LDHA 2ZTMA 4BO1A 1XELA 3JD3A 1PGNA 3PIIA 4UVEA 4RJTA 2O50A 3JYOA 1Z7BA 5I7VA 4J1TA 4M55A 4IUYA 5DF1A 4II3A 2PY6A 4PLPA 2IODA 1X0XA 4GBJA 1OBFO 3WGIA 5TC4A 3PWSA 3ZCXA 3E9MA 1KEUA 5JCXA 2WYUA 4E33A 1E7SA 4Z9FA 2RAFA 4BO6A 2O3QA 1G0NA 1PWZA 4CR8A 2EG9A 5G0TA 3A9WA 4PG5A 4DPMA 2VT2A 4J3FA 4KUHA 4LGVA 2NVUB 5TJHA 5TF4A 4B8WA 3KM0A 4O63O 2D59A 5JNLA 5JY1A 5KCZA 4PIVA 2GR9A 2NACA 1J49A 3KEOA 4GWGA 3ITDA 3CSDA 1HDZA 3R0IA 3DBHA 3WGQA 3BYZA 4QO8A 2VN8A 3TJRA 4CPDA 5CEFA 3ZWOA 4D0SA 3GG9A 2HMVA 4I5GA 1PQPA 3LZ6A 1PR3A 4GSLA 1E5LA 1UXGA 1X7GA 3WX0A 1KVSA 4DBZA 1XWFA 2A35A 4K9DA 1CRWG 4HFMA 4NK5A 3OJOA 4NBTA 5F1PA 1PS9A 2WE7A 4Y67A 3VPXA 2GDZA 4WLEA 3TNLA 1O94A 1U2DA 2HK9A 1J0XO 2Q4EA 2P5YA 1QORA 3SLKA 4C7JA 3QQPA 4Q3EA 4QX6A 2VHVA 4AJ2A 3NGXA 2JD0A 3KSDO 4BO4A 4P38A 2X5KO 4XJTA 4PG6A 4BB6A 1ZK0A 5DCUA 3UICA 4DIFA 1QR6A 4MVJF 1SO8A 4FOSA 4LSMA 4RQTA 2DPHA 1DIHA 4FJ2A 1JAXA 4GWKA 4MP6A 5F3RA 4DTIA 3BTUA 1GEEA 4E21A 3QRWA 1YB1A 4CR6A 1VL8A 1YXMA 1LDMA 4Z3DA 1D1SA 1PU2A 2O48X 4KTVE 1X14A 1OC4A 4XR4A 5L7WA 1V3UA 3UH1A 5G4LA 4URFA 4FOOA 4BNTA 1NP3A 2AEFA 2RH4A 3FTPA 4J6FA 5L4LA 4DQVA 1E3WA 1YL5A 2X8LA 3I5MA 3A1NA 1R12A 4YA6A 1HDRA 1HTBA 3AUSA 4EUHA 1U5AA 3JQAA 4LMRA 4RGBA 1R0LA 2BMAA 2NQ8A 3WJ7A 4FC7A 3CXRA 3I4CA 1DC5A 3RWBA 1NPTO 5JCJD 3ON5A 3ULKA 4KMSA 3FSRA 1BW9A 1EEHA 4OXKA 2GASA 3D3WB 1P77A 2DAPA 5MDHA 3VAZA 3NAQA 1PGJA 3WWZA 4J4BA 4MJLA 1WXDA 4IGEA 1MX3A 1A71A 2BF7A 5FFFA 4JJFA 1EBFA 4W99A 5KTKA 1HDXA 2VCYA 3C7AA 1NYTA 1YL6A 2H5LA 3DTYA 2WSBA 3TN7A 1BHSA 4ALKA 4ALMA 2Y1GA 3SLGA 2J3JA 4BNFA 2WE8A 4EI2A 1E3SA 2CF5A 3KXDA 4NJOA 1I36A 3ZWVA 4NJMB 3Q2IA 2HLPA 2G17A 1WNTA 4JP3A 3V1UA 1UP7A 1VJTA 1DEHA 2Q1UA 2EGHA 4J1SA 5DOVA 4CLRB 2D3TA 5F1OA 5ITVA 4RDIA 5DT9A 1YL7A 4YYZA 1T24A 4B8ZA 5TQVA 2OZPA 4TQGA 3FR8A 4WOJA 4XR9A 2VRCA 2B5VA 3HQ4O 3JQCA 2J3IA 2C5AA 5B12A 4NG5A 5IAAA 1JKFA 4Q3DA 1Y8QB 1DHRA 2PZJA 5JLAA 2GPTA 4CMHA 4A27A 4CM8A 4JBHA 3C1AA 2Y1DA 4PZCA 6ADHA 3QWIA 1GPDG 2B36A 3BMQB 4ZRMA 1M6WA 2HDHA 4E32A 3BHJA 1HDYA 1T2CA 3D5TA 3L9WA 2IXBA 5LDGA 3WBBA 5TRTA 4WEQA 3C7CB 2FSSA 2C29D 1H94A 1P33A 3INGA 3GZ4A 2FRDA 3BTVA 5TJ9A 1IY8A 4OL9A 4DXHA 3QLJA 3AFNA 5DP1A 1WDKA 1JA9A 2YFHA 3NTRA 5GZ1A 1YOVB 5GY7A 3RC1A 1MGOA 5KJ6A 4BGIA 5BQFA 1A7KA 3BIOA 3S2EA 3ICCA 3H9GA 1C0PA 1LX6A 3LK7A 3W6ZA 4E5MA 3JD2A 1DOHA 2J5QA 2AEMA 2GUGA 4OXYA 2CDBA 1DJNA 1B8UA 2CVOA 5ADHA 3F3SA 3B70A 1ENOA 3UAGA 4D43A 3TQHA 1PJTA 5TNXA 3D0OA 3PQFA 4TZTA 1BDBA 2NV6A 5DBGA 3E5MA 5A05A 3JQ8B 1XSEA 4W9NA 1RJWA 4EEXA 4N5NA 3DZHA 3FR7A 2B69A 4QEDA 4LRTB 2X9VA 5EINA 2EKQA 2GZ1A 3DWFA 1T1RA 1QSGA 1UXIA 2H1SA 5DBFA 3RVDA 4RVHA 1SC6A 2C0CA 1PEDA 3DOJA 5H82A 1UUFA 2FWMX 3C1TA 1ZXBA 4R9SA 1TEHA 3DL2A 3MJVA 4YJHA 2CUKA 1ZSNA 1R15A 3PYLA 1UDBA 5CDYA 3FCOA 3K9QO 4RF5A 5CFZA 1B14A 4FCCA 3V1YA 1AE1A 4KQXA 1DLJA 2ZYGA 4RVGA 4BMNA 2IYOA 1LDNA 2X0JA 4IIVA 4XGKA 3ZNNA 2ZCVA 4D3DA 1U7HA 1U9JA 2B4TO 4QT0A 3JQEA 1NVGA 1P31A 3PQDA 4WCFA 3PDUA 2OP1A 4E5KA 1FDWA 3F6YA 3WWYA 4XYLA 3AWDA 5C7IO 1EK5A 1NHWA 3O4RA 2FOIA 3GY0A 3JQGB 2AHRA 4EJ6A 4IQ0A 1Z6ZA 3W4IA 3DXFA 4Y6SA 2AXQA 3OECA 3KSZO 3ADOA 5THQA 2HK8A 3JSAA 3AY3A 1DB3A 1LNQA 4U6QA 3ZU5A 4DMLA 3NRCA 4I9NA 4CV2A 2Q4BA 1KOLA 1C0LA 4ALNA 3FTNA 3ANNA 4J7CA 2J3KA 1AGNA 2OO5A 3EVNA 3ONDA 3KVOA 4BNMA 4E30A 4GAEA 4R41A 1ZO8A 4W9NC 1ZEJA 1I01A 1DJQA 4D3FA 2I3AA 3KUXA 1ENYA 1ISMA 2Z95A 5JC8A 4CV3A 3GK3A 2NTNA 3L0DA 2O2YA 4B7XA 2Y99A 3K8ZA 1ZK3A 4OQZA 3BMOB 1GTMA 2HMWA 2JHFA 5F5NA 1B3RA 4CV0A 1PJQA 2C82A 3MOIA 2IE0A 5A02A 1EK6A 3ONFA 1BXGB 1ISHA 3B1KA 3NDJA 2YZ7A 4R4JA 4CUKA 4B4WA 4EITA 4MINA 2Q1WA 3GG2A 4GGPA 1P1IA 3E6AA 4ZQFA 4NH4A 5KKCA 4CMEC 4CM1A 3LT4A 4A2CA 4BNGA 1YQXA 4XB2A 1Z7EA 4WCFC 1MA0A 1N9GA 2VUTA 1YO6A 3IUPA 5EPOA 2NWQA 4KQWA 2QZZA 4Z9XA 2NSDA 4DYVA 3JV7A 3IJPA 4XYEA 1UDCA 4ZQBA 1DIAA 4F6LA 1ISGA 4CQMB 5A04A 3PWKA 5ER9A 3GNSA 3RUAA 4CM5A 2NNLD 3O8QB 4FDAA 1NXQA 1YONA 2YDYA 2WM3A 4AL4A 3EUWA 1DBVO 2D8AA 4IMPA 1A5ZA 4HFJA 2EW8A 2WD7B 2EHDA 4PLHA 1TB4A 2HSDA 4QTZA 4TRRA 4J2OA 5KJEA 1YKFA 1U5CA 3C7DB 3KO8A 4R16A 3F47A 3ETDA 1F8GA 1BTOA 1NTOA 2DBQA 4R1TA 3BAZA 3H3JA 3E5RA 4QFCA 3ZV5A 1O89A 2DTEA 1PJ3A 1M2WA 1XU7A 3TFQA 4YQZA 2PKRA 3Q9UA 5KNLA 4TZKA 3KZVA 5IZ4A 1GQQA 2WTBA 3PJFA 3ZWBA 4TWRA 3QVXA 3I9JA 2Z1NA 2CFCA 1Q7CA 3ZH2A 5TIIA 2O3TA 3IIEA 3EHEA 2D2IA 4XJSA 1A4UA 4JJGA 1ISJA 2QRJA 3GAFA 1IZ9A 5CP8A 5I8ZA 5A03A 1EQUA 1J6UA 1K6JA 3DDNA 3L6DA 1ID1A 2QG4A 2O3SA 4LRSB 5EN4A 5DZSA 3WOHA 4CUZA 4HADA 4RF3A 4AICA 3E9QA 4GX1A 2OBNA 2X0NA 3U4DA 1XLTA 4RPGA 2NU6A 2O23A 3MOGA 2D5AA 1A9YA 5K6AA 1Y9AA 3DBRA 1HF3A 3OSUA 4CV1A 1T4BA 3RUEA 2IEDA 5KWEA 1X1TA 4WPGA 4CQMD 2BFAA 4QO7A 4NK4A 1RYDA 2BFPA 5AQ1A 4XQ9A 3H2SA 3QP9A 3WMWA 1T4DA 1QV7A 1YBAA 2GN8A 1LJ8A 3BTOA 3TFOA 2Y1OA 3IP3A 3HHPA 1W6UA 4QECA 3H5NA 1DC4A 3KLPX 3DC2A 4TMFA 3HG7A 2C5EA 3D4PA 1Z45A 1F14A 5JAZA 4DUPA 4R54A 4I1IA 3PLRA 1FDUA 4RF4A 3SXPA 4IJWA 5TX7A 4CM9A 1Y6JA 3RSHA 4P22A 1B16A 3VH2A 1F8FA 1RM4A 1QKIA 3ADPA 4R1SA 3WGHA 5BNIA 1Q0QA 1HDCA 1S7CA 3E8XA 4KUEA 4ALIA 2CDCA 4I5DA 2DPGA 3IUSA 3S1LA 3QWBA 2QYSA 3VH3A 1NWCA 1VSVA 2ZQYA 4U7WA 1EQ2A 1LRLA 2E48A 4IQ8A 4CM7A 1SNYA 5JMWA 4UUMA 1X15A 4TRMA 5IG2A 5IXSA 5JMPA 1ZH8A 3AUTA 3LSYA 3PJDA 4G81A 4GQAA 3ZNOA 5JW6A 1WZEA 3BMNA 1E3EA 2E37A 5MGBA 1UR5A 4PLGA 4ZU3A 4FN4A 3QSGA 2WMDA 5KVVA 1LU9A 5K6AC 1TT7A 3W8DA 3QVWA 3E18A 1JAYA 1MB4A 4L0QA 3K2BA 2BELA 2PZMA 3CZRA 3B1FA 5EQDA 5A9TA 1I5RA 3GRKA 1ARZA 3CTMA 4JXKA 5AOVA 4Y6PA 1H93A 4JP2A 4O0LA 1MP0A 4ZGWA 1Q1NA 3IL2A 2WD8A 3VKVA 3DZBA 1IOLA 4HY3A 2B37A 2HK7A 1KVQA 3GGOA 3GDGA 1BRMA 4MIOA 1NX6A 5TGDA 4D42A 1YBMA 2Q46A 5C3MA 3EMKA 5JAIA 2CMDA 4ND4A 1DRWA 2QRLA 2C2XA 1RPNA 4PLZA 3ZGYA 1P44A 3RKUA 4Z6KA 4NU5A 2I65A 1C1XB 1LRKA 3GDFA 3V1TC 1XQ1A 3OEYA 4NFSA 4JN6B 1D1TA 4FFNA 3GAZA 3JYLA 4INAA 4UVHA 5TLSA 5I7EA 5C7OO 3WFIA 1B3BA 5FYDA 1Y9EA 4MVJD 1DC3A 3COSA 3I52A 3OHSX 2O4UX 3I3OA 1HYEA 3KYDA 4BQRA 4N54A 4NBWA 1LA2A 5JYDA 5EMHA 1YVEI 1O5IA 4RDHA 3KEQA 4TKLA 3AOGA 4OHUA 3QY9A 3VVCA 2BGMA 4M89A 2HMSA 2G82A 1TA4A 3JQDA 1D4FA 4CMAA 2Y66A 2VZ9A 5T67A 4KZPA 1E1LA 2VUUA 4NQZA 2AE2A 1LUAA 1MC4A 4OSPA 3HSKA 2JCXA 2OUIA 2VWQA 2X6TA 3PK0A 4PCVA 5HBRA 5KJCA 2W98A 4R69A 2NUAA 4CQLA 4PVCA 3E9NA 1JVBA 2CVZA 5LCXA 1LSUA 3EGOA 1XQ6A 2J3HA 3FPCA 3F5QA 5A9SB 5JDCA 2QZ9A 4DWVA 2NLOA 1MG5A 1U3VA 2ZK7A 3R1IA 3ZU3A 1H9BA 1LC0A 3ABIA 3VZPA 2X86A 1E6EA 5JO9A 1VL6A 4ZQGA 3ZWCA 3SX2A 2DKNA 1KC3A 4UEKA 4DLAA 4LW8A 2VRCD 1IYZA 1RWBA 1GUFA 5DCWA 3Q0EA 4OOFA 2QYTA 2JAHA 3H8VA 5L3ZA 3STHA 3ENNA 1HE2A 3SBOA 3RFVA 2JHGA 3F1LA 5IDXA 3VH1A 3SVTA 3ZWYA 2G76A 4FB5A 2EERA 1OAAA 2XF8A 3UKOA 3KYCB 4RORA 3PHIA 2B83A 2P2SA 3UN1A 1Y81A 3EZLA 3I1JA 4XDYA 2Y0EA 3LC1O 3ROKA 4HNGA 4W7HA 4IZHA 1MV8A 2JFFA 1AXGA 2IYPA 1UXHA 1NFFA 3CMCO 4MOWA 1BXZA 1CF2O 2X4GA 4PN3A 3PIDA 4UUNA 5HM8A 1SCUA 2GD1O 3RC7A 2OOSA 1P0FA 4I5FA 4O5OA 2HQ1A 5T64A 3RFXA 4CL8A 1ZNQO 3W8EA 2GN4A 3T4EA 2YYYA 2O3RA 5CHEA 4YT4A 3DO5A 4P4LA 1GQ2A 2FR1A 3TF5A 1VKNA 2Q2VA 3I83A 3U4IA 2EGGA 3RI3A 2W2LD 2VWPA 2Q2QA 2X9NA 3NT5A 1C1DB 3TZHA 4D46A 1HKUA 3WGYA 4KDEA 2Y93A 1IE3A 3WQSB 3GEDA 1CERA 1M66A 1NR1A 4C7KA 4YJGB 3WFJA 4OM8A 5JDCC 2C07A 2QX7A 3ZWAA 4F46A 1ZK2A 1RM3A 1Y8RA 1Z82A 2NVWA 1DDOA 3LLVA 3A4VA 3FBTA 3U9LA 2C59A 4Z0PA 5IJZA 1TVEA 3DZFA 1AN9A 1BMDA 5G0SA 8ADHA 3H2ZA 7MDHA 2NU9A 4GLLA 3AK4A 4L74A 4NIMA 4CODB 4XDZA 3BTSA 4DPKA 5L4SA 1HDOA 3GHYA 4WECA 1D8AA 3DBLA 1O95A 1ML3A 1EVZA 3G17A 3GMDA 3HN2A 4MO2A 2H9IA 3OIFA 5CAEA 1XYGA 2GYYA 5L7YA 1SB9A 3RBXA 3VPFA 1UZMA 2YJZA 1VLLA 2YQ4A 1IPEA 4OIMA 1H0KA 3WJAA 4E12A 5TT0A 4FFMA 2DFDA 4TRJA 2AQ8A 3NDIA 5G0UA 3K92A 2VNAA 3VOSA 1KEPA 1Z74A 4FS3A 3QIVA 3IDSA 4Q9NA 3GH3A 4PGFA 4XWYA 5KJ1A 2W2KA 3U0BA 3WYBA 2J8ZA 2HJRA 2PTGA 5AXBA 4N5MA 1PZGA 3WYEA 3PWZA 3D64A 1SAYA 4BKUA 1JDJA 3OETA 2VYNA 4IDCA 4M87A 3GOHA 4YJFA 3WB9A 5I9NA 1KVUA 1Z75A 1HEUA 2P9CA 1EE9A 4MIEA 3MEQA 1JN0A 2AA3A 3OA0A 1PS0A 4G2NA 3GEMA 3OH8A 4W4TA 1NPDA 3H3FA 3D1LA 4RCVA 3GFGA 1R4MB 4LVCA 1DIGA 3QE3A 3JYQA 5IN5A 5L40A 1I30A 4Z3KA 2EXXA 1E7YA 4E2XA 2I6TA 4QXMA 5LC1A 4EDFA 3HDQA 4IDEA 4Z0TA 3M1LA 1M6HA 3KRTA 4RLSA 4AVYA 5K0ZA 1Y7TA 2JFGA 1ULUA 1QYWA 3OA2A 3PGJA 1NWHA 5JYEA 3FBGA 2C20A 1KEWA 3OQBA 4F6CA 1T26A 3HDHA 4UEOA 3TZ6A 5FI3A 3RJ5A 4W6ZA 3ROPA 3NEPX 5EIOA 2E82A 1NFQA 2B5WA 2V65A 1SEVA 3BMCA 1ZJYA 2A94A 1JKIA 5CDSA 1ISFA 1BGVA 4XGIA 5G4KB 4D7AA 3WR5A 4R3WA 4XYMA 4GKVA 3L4SO 4BO9A 2BH9A 2AQHA 3VTFA 5C7LO 1RM5A 3INTA 1SOVA 1HE3A 2V6MA 3LQFA 3TOXA 2VYVD 2F00A 3K31A 1IL0A 5HTOA 4BUCA 4XQEA 5TT1A 3QW2A 2C2YA 3I9NA 1GR0A 1HXHA 1MXFA 2TMDA 1NQAO 3OP4A 4BO0A 1X0VA 1PS8A 3GR6A 3AU9A 2AMFA 5K9ZA 5L45A 4MDHA 1EE2A 4CMGA 5DP2A 1WMBA 2F1KA 4DRYA 3GNQA 2BGKA 5ICSA 5JS6A 2E49A 5I7FA 1UAYA 2OL4A 3H5RA 1LRJA 3FRJA 4XEHA 1ZEMA 3G49A 4FR5A 3OIGA 3PRJA 1E3JA 5JFOA 2X23A 2W4QA 4DA9A 4IS3A 4ND5A 5GZ6A 2B4RO 4FSHA 4BGUA 4E5YA 3D4OA 4YT8A 1XR3A 1U8XX 1ONOA 3AU8A 4EW6A 5ICMA 5ENVA 3C1OA 4OQYA 3M2TA 2FZEA 1EDOA 2RHCA 2YDXA 4NPCA 2E6UX 2AW5A 3TZCA 4AJ1A 3RU9A 4P8RA 1QYDA 4LN1A 1AHHA 3FNEA 3R3JA 1NNUA 3RUDA 3KSUA 3DZKA 1RYEA 2BKAA 5DDIP 1I32A 3LT0A
chains in the Genus database with same CATH superfamily
3DPIA 4Q5IA 2D0OB 1XB2A 1WJGA 4C0QC 2FUCA 3EEBA 2B9VA 5H1YA 3FNIA 5C5CA 3NKFA 4HGOA 3NHRA 3IUYA 4OY3A 1Y8CA 2AMYA 3CCFA 4PX2A 4US1R 4D80A 3U3JA 2O06A 3ZPXA 4TMVA 3K1AA 2YY7A 1OYYA 4XB1A 5IFLA 1TW3A 2V4MA 3GF4A 3W8FA 1LQTA 1ANKA 2PKYX 1TEVA 5DI3B 2NU7B 4Z7NB 2CLMB 5ELXA 1SCQA 1XOIA 2I4LA 3AL3A 4GP9A 1T25A 4QQ8A 4X1YB 2VSFA 3A4IA 4M88A 4Y2GA 4I50F 3TOVA 1EH5A 4ZHSA 3PQEA 3KUUA 4BKOA 1K8RA 4R81A 3FPGA 3G2MA 1R4NB 1QC5B 1WD5A 2P8JA 5BW5A 4MWBA 3DT6A 3QXJA 5D3MA 2PWPA 1ZKDA 1RQGA 3CEJA 4R8KA 4E88A 4EGAA 3UHAA 1XKTA 5IJ9B 4NY1A 5JI3E 3BWBA 3L7JA 4YCAA 1GTL1 3LECA 1XGKA 4L15A 1PK9A 3CUUA 2YVLA 1YK0A 4CGZA 2OT3B 4LPKA 5FF9A 4WLOA 3VHLB 1XFAA 3VMFA 3WICA 3UMSA 2DWOA 3QWAA 3OF2A 1GGNA 2HRZA 4FVTA 2CDAA 1S6YA 2BM0A 3JZFA 3LDFA 4K9LA 2ZUTA 2WYWA 4X60A 4QUDA 4ARIA 4PPNA 4YAKA 4J94A 1CY7A 3RSSA 2YHIA 4HWPA 1YA8A 4PHGA 3SHFA 2VNIA 4R8MA 4EO4A 5B6JA 2F3RA 1XZIA 2B7CA 2MSEB 2PYIA 2J9ZB 4NAUA 2D1QA 2F4VB 4ZVNA 1L5RA 4AX8A 5JSZB 4WZAB 2ID4A 2C9CA 1L7VC 1WG8A 3FUXA 1ZRSA 3NC4A 1KVTA 3P2OA 2JFQA 1T1GA 5FADA 3UOWA 3WLFA 3H5TA 4P08A 1B23P 2E5WA 2R8BA 2R3SA 3BD8A 4FXPA 1ZHHA 4NCHA 3EXHA 3CIFA 2PQ2A 4M1EA 4OLFA 4HDMB 4KXLA 1Z6YA 3DCYA 3EWIA 4TYQA 1FFBA 1PSZA 4MR7A 5AM4A 3LUKA 4TT3D 5K8LA 3GFRA 2ZUBA 3GJTA 1BHQ1 1MOQA 5IN4A 1KEVA 4FMCF 5K45A 3JRWA 2A9PA 4WA8A 4UEWA 4ZRDA 2E4UA 3RS4A 4X7BA 4AS3A 5JSHA 1X9IA 1LBQA 5JWOA 1MO6A 4R1OA 3R4CA 1LBSA 5AIAA 4E5PA 3OCXA 4ZTZB 3V5NA 1XRQA 4BNVA 3U16A 1HDEA 1PV2A 1I4OA 2CMFA 2PVCA 1VE3A 1QPZA 4FGSA 2BTQB 2MINB 5IDWA 3GVHA 3NVMB 5HE9A 3T5AA 1KIFA 1QE0A 1W6RA 2XMRA 2OV8A 1W36B 3OZFA 4KDRA 2W6ID 4UVIA 1TK3A 2GCPA 1HRKA 1MDFA 3OHMA 3WGGA 4LBVA 1MB2A 1TU4A 3EOAI 3M1AA 3WB2A 3SC3A 2AJBA 1WPXA 4LHYA 4QUGA 5BUZA 5KYWA 1H1LA 1UQRA 1RAAA 4JI3B 3WLJA 4E2WA 3IP8A 4QPZA 4NU0A 2I4MA 1QIHA 1WRBA 2G0AA 3BX1A 3MIZA 4UTRA 3CB4A 5IKXA 3PDIB 1QH1A 3KWJA 4F9GA 1G6OA 2YXBA 5ETJA 5HHTA 1U0FA 2IY7A 2O8NA 1V16A 3A9SA 4H60A 3FHLA 3O38A 1AO3A 1Q0HA 1UKEA 2ZRHA 2C61A 4PC6A 4UUOA 2WUGA 1KXZA 4B3CA 1ZNZA 2QOEA 4CI0B 1BX3A 1FVFA 1N8KA 4HS9A 2IF2A 1ISSA 3E22B 5FPKA 5FL7D 4YMGA 2A9OA 1JKJB 2Q0QA 3X1MA 1WSBA 4ZCTA 2AEEA 3T5BA 4EB6B 3A2KA 1UT6A 4DV6B 4REOA 1ODLA 3KK0A 3NPAA 3ZJTA 3M3HA 1E79A 1MO5A 3ENKA 2H63A 4BV2A 4G9BA 3GGGA 3LX8A 3QENA 4MB6A 5TEWA 1ZX1A 2NSHA 1ORVA 3EZFA 3IQIX 5DHQA 5EQJB 3K70C 2XOXA 4DIOA 5FJJA 2OKGA 2JJ1A 3TM4A 1V7QA 1EFKA 1UINA 1O0SA 3FOWA 4J4HA 4PVDA 1SKAA 4RKRA 4ZEMA 4RNCA 1SC9A 2JNWA 3M82A 1DAFA 4ZQCB 2PX8A 5A5DA 1OH8A 2ZRIA 2RB5A 3W9UA 1Z6PA 1QVVA 3O8OA 3R2JA 1E9EA 3HPRA 1XRPA 2ZYAA 3HMKA 3JVEA 3KVYA 3A0RB 1WUHS 4G23A 4QEZA 4GPD1 4WOBA 1M2FA 3PA8A 5KOIA 1DTSA 4TKZA 4DJTA 5MN5A 3CZ9A 1DC7A 1NQTA 4EH1A 4DZTA 1I2BA 1UFQA 3PYMA 4FMDF 4IPTA 3DKPA 3VR1A 4B9EA 5BVHB 5BV1A 2ECQA 2W2MA 4CVNA 4M9CA 3IJRA 1YDFA 1KDZA 3E2MA 2V3WA 4YVFA 3KP1A 3IJEB 1OGYA 2BYTA 5ALJA 3P5BA 3A26A 2H1VA 4IS2A 1GRQA 1UQTA 3CRVA 1VCIA 3KWMA 1S4MA 2G9VA 5IULC 2Z98A 3RD5A 1XNJA 3CUYA 1QP4A 1GUYA 2DC1A 2I7DA 3DHNA 2TMKA 3R7BA 2JH3A 3IXMA 4XGNA 5HWSA 3VYWA 1E1CB 1ZOSA 1UJMA 2DBYA 2C8LA 2PMCA 3V8EA 4GH5A 4RK6A 1QG4A 4ZVPA 2W5UA 2A9QA 1S01A 1Z0SA 2JGNA 3MMSA 1TYZA 2J7PD 2AZDA 2VHYA 5CHYA 1Z0FA 3PYXA 6LDHA 4LQLA 3ZLJA 3B9BA 2JK0A 3I9MA 4UQPA 3GEPA 5H80A 3NYRA 1DRUA 3JD0A 3PC3A 4GHWA 3SM9A 3VR3D 4UFOA 4YAJA 4KVAA 4MV3A 2ZJ3A 4Z9AA 2Q3FA 1L8LA 2HWKA 2W2VA 1E3MA 3FHJA 1HFEL 1WV0A 4KI0A 4KRFA 1EFRD 3WK7A 3CO0S 4BNDA 4C05A 3FX2A 2XIQA 4LJRA 3IQFA 3JS5A 3TPCA 4QM6A 4IXWA 4BNKA 1UK8A 3RIYA 3BCUA 3UK6A 1Y6GA 1KO8A 3MS2A 2WWTA 3D3WA 3W05A 1FDTA 1GGEA 3FDXA 2JJ2A 3FETA 2Q50A 4HAWA 1HL3A 3HLYA 2BONA 4IJQA 1JJ7A 4LCBA 4LTMA 1B0AA 4LDJA 3SGLA 2PD3A 4MUYA 4QOSA 4WNCA 3EQ2A 2C7RA 3A1VA 5L7TA 2C9BA 4UNRA 1OX6A 2ILVA 3ORFA 4QBHA 3E53A 3OKAA 4L2IA 4TUYF 1QGED 2WIKA 3GQBB 1WBBA 1E5QA 3L92A 1QKJA 2BLLA 1RWNA 3C6MA 4PQYA 2GO1A 1E7MA 2AMVA 3U4QA 4TWJA 2UZ4A 1X13A 3GFBA 1YJBA 1GG8A 5AW2A 3AY7A 3HYRA 4O4IA 2HWUA 4NJMA 1J4AA 1HMPA 2ZBVA 3OJCA 4NV3A 3WLTA 5CA0B 1VYTA 2XRMA 2ZW9A 3Q12A 4DLYA 5BR4A 1XAIA 1EIZA 1P4SA 3T5DA 1IVSA 3UHPA 2ID8A 4CLRA 1YQWA 4Q7QA 3NBKA 2DXIA 1NAIA 3FNQA 3A4NA 1GNSA 5F12A 1KZ4A 2Q07A 1XTPA 2P2DA 4FKZA 4NOMA 5LWQA 1FRFS 5T8KA 1DXYA 3GYBA 5KBYA 3K0HA 4Y7DA 5TVKA 4G65A 4MVJI 3WWEA 3H16A 2PH5A 3WDLA 2UXCB 1IVNA 2W6MA 5I7SA 1AB6A 1Y8QA 2JS7A 4YRSA 1NQVA 3FFTA 3Q2OA 4BATA 3GFSA 2QTCA 3QJGA 4EWLA 5KI6A 4UUBA 1NRIA 1WLYA 3K0AA 3V7NA 2G5GX 3HWRA 1IBLB 1X7YA 3KQQA 1GP2A 3K05A 4UTZA 4MUMA 4Q00A 1Z4NA 1ZXLA 4MV7A 2GD6A 4ZV4A 4JLSA 5B37A 5DHTA 4J1NA 1L7QA 3U44B 3DKVA 4R3UC 4GIBA 3WV4A 2Q45A 2RC5A 3PJEA 1C5KA 1JP7A 1PE0A 1YRYE 3AVOA 4I4IA 5BPFA 1I6KA 2PD4A 3PFGA 4CKWB 1NA5A 1P1BA 4GE3A 4XVRA 2CC2A 1EZ4A 3N3AC 4TTVA 1YHNA 3SY8A 2R97A 1FY2A 1Q3KA 1XKQA 2GBIA 3GN2A 5IH7A 2ZSAA 4YMTA 4IIUA 1YOVA 2TYSB 2RHMA 1DWPA 4ALJA 4AKEA 1O57A 3L6UA 3IPCA 4FZJA 2E7ZA 4D44A 4WBNA 4JJKA 3HDTA 2ZSUA 4AG3A 4YB8A 1RRFA 3WGUA 4RMJA 1GTRA 1IRIA 4BMOB 1CEEA 2OMKA 1D2HA 1NF9A 4TV9A 4D9GA 1PVDA 1ZMOA 1CY4A 2B35A 2YIDA 1WB4A 3CF4A 3LBNA 4FSDA 3U13A 3BQNB 3K2IA 4ND2A 1NLZA 1NLMA 1Z63A 2D74A 3P1JA 5K3FB 3C87A 5CFQA 2AE1A 3CZQA 2IC5A 1JNXX 3KE9A 5K0BA 2MYPA 3TEJA 2X4LA 2Y67A 5FTNA 3P0RA 1D04A 2EZ4A 1GAEO 2IHJA 3G7UA 3Q40A 1DXHA 4MPTA 4UTOA 4AYWA 4L0DA 4L5CA 3VU9A 2IS6A 4EATA 2VHXA 4KBYA 1T9BA 4CCAA 3RAPR 4ID9A 4ZMBA 5DM70 2JAOA 2XYGA 2ZJFA 3A36A 3WQQA 1H9CA 3BJRA 3PGKA 4RVDA 3ZWPA 1P3JA 4IHJF 3KX2A 1QONA 3PC2A 5FLKA 1ZI8A 4DFDA 4MRPA 2R0QC 2ZZNA 2O5CA 1V11A 1JEYB 5JD5A 3AUAA 6REQA 5K3CA 3OFVA 4CMKA 5SYAA 4JI6B 1Z3IX 4MIKA 3NHUA 1G8YA 2D54A 2GK3A 2XNJA 3GT4A 3SQOA 1ULAA 4U6SA 3RG2A 3IVAA 5BP7A 2PZKA 4D6PA 2EP5A 2ADMA 4PSUA 1EVYA 2AXEA 1Q21A 2ZBPA 3EDRA 2WIDA 4IO1A 5DOZA 1JI0A 2MWMA 4F04A 2PKCA 3E3AA 4PPYA 2YJ6A 3TD6A 3L0IB 5EQTA 3GCGA 4B4VA 1UBLS 4BGIA 4GOLD 4YLGA 2P5UA 3AI1A 1XLUA 1IY1A 1FVHA 3QVVA 1W34A 4Q3CA 3ZDCA 3IERA 3Q98A 2NTYC 1VJRA 4DJFC 4F8EA 3PLNA 2XMBA 4M6WA 4Q9IA 4Q3AA 4DMKA 3JQGA 2SKEA 2JIOA 4ER3A 3Q8MA 1VLVA 1XZDA 3TZQA 4XUDA 3AVTA 1M7GA 1OT5A 2QLBA 1SU8A 4JLNA 1BMFD 1QIGA 2E4VA 3UH0A 1ZGCA 3VNBA 7AT1A 1G21B 4HDSA 5B30A 4HNRA 1BE0A 2GFIA 1U2QA 5AVQA 4E2ZA 1QDUA 2HQBA 1JBEA 4K9KA 2H1WA 2C7GA 3OICA 3VDMA 1CZNA 2VNKA 3IMKA 1JJBA 3T99A 2R6JA 3AOEA 1U31A 4KN8A 5LXTA 1GUZA 5COAA 1SOWA 3SC6A 2XLBA 1A72A 3UWKA 3ANXA 1NW4A 4TMTA 3DZCA 3NFYA 3GOQA 4AO8A 4RHEA 2HXYA 1A7JA 1TUEA 4I50B 4KJXA 4BMPB 1SBIA 3LAWA 4L78A 5KINB 4Z4EA 4OFWA 2XHZA 3AMVA 4OAPA 4WFKA 2HMTA 5DNUA 4DV3B 2ZRCA 1ND5A 4EGQA 5J23A 4M8SA 2QAGC 2CLOB 5ITZA 2WNSA 3EDMA 1ORRA 2HBRA 1MPTA 4KV9A 4M0DA 2Q6KA 1YUMA 3R5SA 4GVXA 2OAP1 1FSFA 2ORIA 1AKYA 3ILYA 3D3JA 4HNAB 3CV3A 3VZRA 3KLNA 2BMWA 4DIEA 4W5WA 3LWZA 4CCWA 1JECA 5D3QA 5DSZA 1L0BA 1KYZA 1WTAA 4I4LA 2Y9PB 4PYMA 2V7UA 1N6IA 4BIIA 2IXAA 3KYBA 1CUDA 3K09C 4EKNB 1YDMA 1KIAA 4C0LA 1NVXQ 1ZD2P 4LZJA 2JBHA 4TV8F 5J2TF 5D7NA 4BV3A 4L9SA 4EG5A 1PL6A 4MS4A 4R9NA 5HKLA 4WACA 3TOSA 1DINA 3NX4A 4LHWA 5IZCA 1SIBE 2C54A 5ALFA 2XQJA 5AJTA 3V48A 5L53A 1XMXA 5BSHA 2CDRA 2XD9A 3KVRA 3IQHX 1INLA 1DAPA 4ID3A 2WV7A 4PO3X 1ZUWA 2D4HA 3MGKA 2XMCA 4E0BA 4KX3A 5JDIA 2DHDA 2FLWA 1BXRB 2W8ZA 2G0NA 2H2AA 4MUKA 2C0QA 3HHEA 2B78A 2W37A 5DV9A 1JVSA 2DPXA 2QE6A 3SC4A 1M1NA 5CVCA 3MTDA 3ZDFA 3AJ9A 3PP8A 3LGAA 3KV3O 5JSYA 3T1NA 1DVRA 2FCAA 1VSUA 3O1IC 2HNBA 4BGEA 4BRUA 1PIWA 4CIBA 3TO5A 2QRMA 4FMCB 1HC7A 4EVSA 1YCFA 4KP7A 1KQGA 5HZGA 2ILTA 3GBVA 3MTJA 3UOGA 3JATB 3QFSA 4YPOA 2RJ3A 1UM9B 4N3AA 3P26A 2GZ3A 3TW8A 4S04A 1M2KA 3RSQA 2GOYA 1LTQA 3OSZA 4YRNA 2IDJA 2ZI7A 2WAYA 2JCVA 4X00A 3NWBA 3NEYA 4NZPA 2PZBA 2Q29A 2YINC 4YI3A 1V2HE 1JEQA 3KR2A 2XCRB 6PFKA 4CQNA 2O7NA 2GNAA 2EKPA 2UZ0A 3WHPA 9LDTA 1G8AA 1NR7A 3W1EA 2PCLA 2ZM6B 1T4CA 1TJ3A 2QZPA 1GHTA 3V7YA 2YC2C 2G1KA 3D6NB 3RANA 1SBQA 1W76A 2VJPA 4BNXA 4PYRA 5BYJA 1P1JA 2AKEA 5J9FA 3AETB 3U49A 4DWWA 1OTHA 1I4DD 1RZUA 2GGSA 2YOGA 3GRVA 4KWHA 1XU9A 2IYWA 4ZN6A 4XJVA 2BMJA 5WRFA 2YNMA 3H1AA 5F2OA 1WQ4A 1RDFA 3U4HA 4LRUA 1P7VA 1Z16A 1K06A 4I4TF 4M22A 5IBPA 4Q39A 3PS9A 2BEUB 4MR9B 5IWCA 4GF5A 3D2AA 4IIXA 4OP2A 3PNBA 4FC6A 4AZ0A 1RJDA 3HP1A 1OI3A 1NC1A 1ECPA 3VYVA 3WL7A 2X2EA 1G4HA 1T6ZA 2OXIA 3ONNA 5THKA 2OCIA 2G5TA 2YXDA 5LIRA 1UC8A 1JL3A 5AKJA 4B7UA 3QYJA 2CZQA 1XZPA 3RSFA 1GQOA 4YBRA 5HFJA 1GU7A 3LD9A 1H0SA 1I4TD 3K0BA 1UMCA 4FHEA 3JWHA 4Z9BA 4DR3B 4KLCA 5BWNA 3B5JA 2IHZA 3TSWA 1QF6A 4X7MA 1TM4E 2MYUA 5T6BA 2O3JA 2F3PA 1QZZA 3I2FA 5B2FA 2HA3A 2JVKA 4JIMA 5LR6A 2FI1A 4O02B 3ONEA 4V0OA 3LPCA 5IJWA 1BA3A 1SELA 3GLGE 2B30A 2EJWA 4MR8B 3WIUA 4KQ9A 3ZCRA 4LNHA 1KDTA 2E4ZA 3WDSA 5HJEA 4N47A 4JV5B 3HXPA 2KYRA 5B4TA 1ZKMA 5CB4F 4M7WA 4QVKA 5FPYA 1JMKC 3HKEB 1IOWA 1QFXA 5F7XA 3F4BA 2RGNC 3F46A 5EQFA 1UIMA 4FYYA 3OT5A 2QLTA 3CINA 4ML3A 3R0XA 4HX5A 2FXIA 1R6XA 5LNK1 4CNQA 4W8HA 4NFYA 3TRJA 2QDKA 4C4PA 5FOQA 4NR0A 5AKLA 1E1NA 2G71A 1JIIA 1U2ZA 3IUEA 4DSAA 2NU6B 5IAEA 5J1TB 1H4QA 3N5KA 2ZUUA 1O4WA 4M1YA 1NU8A 1Y7IA 2HRCA 3IC5A 2Y1KA 3DBRB 3LX6A 3F96A 4DDUA 1COZA 2CYCA 1WUKS 2OM2A 4TYMA 3EQ7A 4B7ZA 5K1ZA 4BN5A 2WDZA 1SQGA 2XYVA 4J7AA 4CKYA 1T34A 1XWWA 1EP9A 3KLOA 2OO7A 5DGDA 4B31A 1ATZA 1T8PA 3N7UA 3STYA 1JYFA 5CLGA 1U1CA 1EFPA 2GYWA 4Q3BA 3S2SA 1TTTA 5EC8A 4C4AA 5C4IA 4PYNA 1VYHA 5CVTA 4BVAA 3P5SA 3CFYA 4WUVA 2NSLA 4IDNA 5ED4A 3V4PB 1K5GA 1II9A 1UFOA 1ZNXA 2FPLA 1NUUA 1U1IA 1H2HA 1B26A 2X0IA 5C8YB 1WXQA 1F1BA 3D59A 4JS0A 4DY6A 4IYRA 1J7JA 1T3HA 3D8RA 1LC3A 2Z4SA 5EGNA 5JD4A 4EG1A 2VOJA 1PK7A 2REOA 3DMTA 3DP9A 5CYFA 3PL1A 4HZIA 4F5WA 3MUFA 4H7IA 4YEDA 4B3SB 1XL1A 1IUNA 1V25A 2JLRA 4WN9A 5FPTA 4CFYA 5A3VA 2BH2A 1XPOA 4RXUA 4UAJA 2XZOA 3SSMA 5LLDA 4DBVO 3R5FA 2OORA 4HQ6A 3JQQA 3HJGA 3VNVA 3HJNA 1NQOA 2DOKA 5B58C 1RWVA 5IC6A 4EHJA 5HW0A 4FFLA 3FKSD 1J2YA 4L4UA 3E9ZA 3QKUA 1SKUA 1B4DA 1T6NA 2I4RA 3PPIA 4HPXB 4KQCA 1L8AA 1OZAA 4O5AA 3ZKWB 1QIMA 4U7HA 1XRNA 1AQ6A 3G2KA 4H16A 2I4NA 4UXHA 4TSKA 3SK0A 4EQ6A 1E94E 4C6HA 4TUYB 3M2PA 1A0OA 4MWTA 4GUDA 5LQKA 3BIJA 1R0YA 4HO1X 4XIFA 3MWDB 4MW9A 1Z26A 4WEOA 4YCSA 2FF5A 2NO4A 1GL6A 3CN7A 3S7TA 3WTBA 4C0SA 4OMUA 3C6YA 3M33A 5J1SB 2X1LA 2NAPA 1Q2XA 1R18A 3FB4A 5F9FA 2A5LA 4HQKA 4AT1A 3F5FA 4RYLA 4B6JA 1IZ0A 4WZ6A 4EVIA 5U9CA 5JS7A 1H65A 4N40A 1R66A 1ZCBA 2WJ3A 2DWQA 4YQEA 3KOZA 4J16A 2OQVA 4D9FA 2O54A 2P1RA 5H70A 1CC1S 1N2CA 1N3BA 4IKOA 2OXRA 2WVAA 4OREX 1YZTA 2UYYA 1GV1A 3SE7A 4CCYA 1LXCA 2H18A 3QLUA 4C07A 3VKGA 4UHCA 3JD1A 5A4DA 2BE9A 2NT4A 4JDUA 4M0FA 5E9AA 1JBQA 5C8VA 2X5XA 2JFPA 4FJ1A 4M8KA 1K0UA 1MC5A 1A4XA 3I09A 5IYZA 4WFJA 3GU3A 4DWOA 4LVOA 2QM8A 3QI2A 2W2LA 4NMXB 2SBTA 4JC8A 4PCUA 4RSMA 2C3PA 3L4KA 4JJZA 2A5GA 1AGRA 1CIPA 3CLUD 5AKIA 3SS9X 4RA9A 2N47A 1J8VA 3C6XA 3E7PA 1FMJA 1UK6A 3FI9A 2L17A 3OJ0A 1S2LA 4XGQA 3UB3A 4CM9D 4DARA 4EABA 4ESOA 3B3JA 3RO7A 3DFIA 3F7MA 1SXJE 3A2LA 4G63A 4EG6A 3IOEA 3CGGA 1II0A 3E15A 3HABA 3PJGA 3FVVA 3MJDA 2XTNA 2QN8A 4IF6A 3GJSA 2QUBA 3W5CA 3LF1A 1W30A 4BP8A 1SUIA 3I23A 3ZW8A 1XE3A 4AN4A 5CW1A 5HM6A 1E7QA 1Z0JA 2COEA 4IILA 1RKXA 3ILVA 3KYDB 3NHBA 3ZQJA 3PQ3A 1HZJA 2ZJ8A 3QXXA 4KXUA 1ZRMA 7ABPA 5LDDC 1UODA 1SZPA 1X38A 2H65A 2DWUA 3DAYA 3HFSA 3NT4A 2ZRAA 5DSXA 4KXYA 2WSSA 2NM0A 1PJCA 1OZGA 4WLUA 5ALZA 1CS4C 5FEUA 1UP6A 1GV0A 3EW9A 3HVUA 3I4FA 4LFBB 3U3RA 5DI9A 1SUDA 1FK8A 1JA0A 1QF7A 1UBJS 3DHEA 1OLSB 1F12A 2NZYA 3B12A 2VPPA 2VYQA 1TD9A 4YJKA 3T4PA 3D5EA 4C78A 1JR3D 4B6PA 4AJEA 1BO6A 1OWPA 2FW9A 2ZTUA 4CLHA 4QQRA 1P1CA 3CSUA 3EXEB 2YY6A 4GWLA 4R0VA 5FWYB 4CMEA 2XX3A 5BN3A 1LKZA 4A0SA 2WVJA 3H1EA 1IXZA 3WAKA 1JU9A 4E15A 3U7QB 3N07A 3M6WA 3UCXA 3K1YA 4X71A 4ZC1A 1SUFA 3OG9A 1JDSA 1UBKS 4D8UA 1UXKA 1ZL0A 1TCAA 4B6FA 1R0KA 3FKQA 5EKXA 2EW1A 2VF5X 2V3CC 3QJ5A 2J5KA 3NHLA 3NRJA 4D4HA 4LX0A 3ECSA 4IFIA 4MUFA 4DCTA 2DKFA 4P1ZA 1WP9A 4IRMA 3QYAA 4WY5A 3S2IA 4AJLA 3RU3A 4BRZA 5BSGA 4IF4A 2GMWA 2WV9A 4IHJB 5KO2A 3DQZA 1C2TA 4IRUB 3QV2A 2D1YA 3D7NA 3FSGA 1M1YE 1I6WA 4FEAA 2BFFB 4HLQB 4RPKA 5D51S 5H3HA 4UDNA 1K6IA 1VPTA 2GZRA 2Y05A 2ZSBA 3OMXA 4IDAA 5HIMA 1G5RA 1G9SA 3GRZA 4RY9A 2J7KA 3COZA 5HQ3A 3CZMA 4Q21A 2EP7A 2AFIA 1TYEB 3EXIB 4UDXX 5HBGA 4QHYA 3LQYA 2I0FA 1SVSA 2BFDB 3MCVA 4ALLA 4JIGA 5A4KA 1DG3A 1JXQA 3IO5A 3SYNA 3DE7X 3IIIA 3S44A 3CX7A 1QS0B 3AB3A 1F3OA 1FP6A 3L9XA 1PI3A 3UJPA 2OHXA 4LZZA 1QP0A 2A1TS 1NUHA 5HCIA 1SCUB 2ZTLA 1VJ0A 3EPHA 1AQYA 2BEJA 2LKCA 3R5XA 5AVKA 1QRRA 4ILKA 3EG9B 3H9QA 3EULA 3LVBA 1H2FA 5AYVA 4DN6A 4E1BA 4MVJG 3GH1A 5FUBA 5COQA 1DGQA 1EGHA 1ZAKA 1CIVA 4BMCA 4QVIA 5ELLA 3WLAA 2H11A 2JH9A 3L77A 4IY1A 1NGSA 2BZGA 5F77A 1X7HA 2ZIZA 1NMSA 1E6WA 3PX7A 3DQPA 5C2JB 4LMPA 1VMDA 2HWYA 4GYYA 1RLTA 2BGLA 2FMUA 4U0KA 3RFTA 1EUZA 2ZVPX 4FHFA 4JC0A 4TTAA 5JBNA 1NM5A 1W5SA 2FEWB 5A4JA 4YJDA 1WKBA 4BMYA 4G97A 3JYPA 4MCHA 3PFWO 4I1UA 1FFHA 1JQKA 2ST1A 3HXTA 1FNCA 1GFWA 4Y6RA 2W6OA 3FOAA 3R9KA 3ZY3A 3SM3A 4Q1BA 4YR9A 3KU1A 3LUCA 3H83A 2ZTSA 3EVAA 3M83A 4M1MA 1MEOA 4LC9A 4X61A 3X1DA 2IS4A 4K1XA 4P34A 3BT7A 1N2XA 3AV0B 4ZCMA 2ZRNA 2HHLA 2FWIA 2C88A 3GI1A 5F21A 2BFEB 2A9FA 2P67A 2XZDA 5J2TB 1R9JA 3ERCA 1MB9A 4Q1VA 3VDQA 3VGPA 2QG9A 4RS3A 3N87A 1Q3TA 2PWAA 1BAPA 3IBGA 5E0KB 4WE3A 3L82B 5L3QB 4GPAA 4UE2A 3RNOA 3JQBC 4GRAA 4B5LA 3G0OA 3GJ5A 3JALB 5H8WA 4G0NA 2C1EA 4FKBA 3PDHA 3TTUA 5LQMA 1NC3A 2O2DA 2P27A 2DPYA 2FVYA 2HFJA 3TI9A 3EH1A 4J0KA 2XWQA 2Q1TA 2Y1CA 3TSOA 2ZQ5A 1H8HD 4QASA 1H5NA 1G5FA 2COUA 3E70C 1F8UA 2UUOA 5HF6A 5I7AA 2XVZA 5AKGA 2B0CA 1FRVA 4XX0A 4RLFA 2ZT5A 4WOKA 1XMSA 5KJFA 1L4HA 3JQ9A 1V3QE 4FDLA 5KVCA 3MZ0A 4TN1A 1L7PA 2XDAA 3RT9A 1QCCA 5K5EA 4OJQA 4EDHA 2PSEA 4YJFB 5AJZA 3WLQA 2C8KA 1KAHA 3TS1A 2UZ3A 4QUBA 1FQKA 1UJBA 1W87A 4FYHA 1JDUA 1YFJA 4IL5A 1OZ0A 4H4DA 2EJVA 3R4VA 3OEWA 4L51A 5F1YA 1GZ3A 1SC4A 2AN4A 3FE2A 4MQFB 4JBLA 1U4OA 1XEWY 3VC2A 1N1EA 4MK4A 4OYLA 1FYFA 4DTCA 1ODJA 2FPSA 2BGWA 1FYDA 4G2TA 5CLQA 2PXAA 4RJKA 1DKLA 2RH8A 2GRJA 3I9V6 1YR7A 4XVQA 1DI0A 3C45A 3E48A 1U7TA 2NQTA 4CEJA 1GZDA 1P1KA 4P3KA 3A14A 2IZ1A 2CHQA 1IK6A 3M81A 4OHPA 2BMDA 3B1JA 3CY6A 5F5LA 1GL7A 2C4VA 3G1UA 3VX4A 1KP3A 3ZQ6A 1JTVA 1TYCA 1O95D 5EG5A 4YRBA 5IUNC 2OXFA 4BBPA 1YCHA 1D8TA 4I4TB 1E4OA 1SVMA 2AF4C 2AQKA 1VJCA 4JYAB 4YRAA 5BSEA 3PEYA 2UUPA 3QHPA 3MC1A 5KDLA 4PR3A 1H69A 3ESAA 3GUVA 1US8A 3CNEA 4KPUA 5E1MA 2ZYDA 1LSJA 4QTXA 2B82A 2FFAA 5AOBA 5EPUA 2O5VA 4G0QA 3OE4A 2ZU0C 2QVZX 4UUPA 2OFWA 2QY6A 1E2DA 2VP9A 4GOMD 1JQAA 3OM1A 4BNUA 1W0JA 4WOPA 3QPUA 4D3XA 5JXGA 1XTKA 3QKRA 4N9QA 1KQOA 4NAHA 3VA7A 4IJ5A 1K5HA 4GOXA 1QHNA 1T8YA 1CZHA 4HYEA 1G16A 1NFRA 5EERA 4ARAA 1FXSA 5KKNB 2O8DA 2H4XA 2VCEA 2VYND 1XDSA 3GHHA 3F6EX 1KA9H 2CXXA 2VDNB 4QXAA 3CVWA 1YF3A 1SVNA 1F20A 1RCTE 1CUHA 5HGJA 3TQTA 5CG1A 3H2IA 1OIVA 5CB4B 1YDEA 1WU7A 1ZFNA 3H5IA 1WBDA 3ILXA 3PGLA 3ENWA 1YZHA 3QFFA 3AZOA 4L75A 3SR4A 3SR3A 3RVQA 4NBLA 3WAJA 5FBVB 1V9LA 2P5SA 4YHHB 1EE1A 3BB4A 1XCLA 3O7MA 4XI9A 5DI3A 2NU7A 3L7OA 1D3AA 1ZLYA 1Q1EA 4Y6OA 3HL0A 4EMTA 2Q3DA 1DS6A 3O2JA 4GKBA 4X1YA 4QC2A 1VDMA 4H59A 1IONA 4FFWA 2PQ0A 3T06B 1C50A 4RY2A 1JHOA 3H1GA 5KQMA 2R1TB 1UT8A 3CNQS 1R4NA 1S2IA 2Q8PA 1QC5A 4JI8B 2VSYA 1FVOA 1N2JA 3Q88A 4E31A 1JF8A 2BGNA 2VJCA 2FY8A 4EP1A 5IJ9A 1LDYA 1EFUA 2V59A 1OB2A 3DR3A 1L8XA 1P0QA 1Q0RA 4J4TA 1T8SA 5JV5A 4K88A 3C24A 1T29A 1WEKA 2JL1A 1VJ1A 4FMBB 4PPFA 2R6CA 1AS3A 1KFJB 1RQNA 2UKDA 2HEIA 4WINA 2YXPX 2DBVO 4WXYB 2QQGA 4R9RA 4M2LA 3KKNA 2IYSA 5CG2A 2LE0A 2AVNA 5SY4A 5LQAA 1LI4A 2RGAA 3H2YA 4I1SA 1TM3E 3ROMA 3K6JA 4QNNA 5JO0A 1C0IA 1J25A 2DUJA 5JSZA 2Z0MA 1DPGA 3AHIA 4R8LA 4WZAA 2AI3A 4J0GA 5AW0A 2I78A 2YFQA 4Q7MB 1PT5A 4ZRNA 5CD9A 4B4OA 1XCPA 1LBIA 4A26A 1G18A 1X87A 4EUKA 5K51A 4C4ZA 4HFRA 4DMFA 3GFOA 1Y4SA 1QO0A 4HDMA 3P0IA 4Z8YA 5H83A 5JCOA 4DA0A 4KE6A 5E9WA 1VPEA 2HU2A 4PXSA 4UZEA 5BR8B 3L0PA 3OFKA 3GUYA 5DGXA 4I5EA 4UPVA 1OMOA 2VP0A 3GFVA 2C7OA 4M3NA 2VQDA 4MKRA 4A10A 4DBLE 1OXVA 5DTRA 4B9AA 1UPXA 1XPRA 2HLHA 1FYVA 3AR8A 3A1CA 3W5VA 2Z5FA 1E92A 4TKVB 4LZNA 1V8BA 1D03A 4R2XA 9LDBA 4DIKA 3PI6A 1AZWA 4UFNA 1A9SA 1Y1PA 1HQCA 3HZZA 3LO5A 1YDWA 2QMZA 4GXQA 5KYVA 1S2GA 2J4DA 1XN4A 2BTQA 2MINA 4GEKA 2IU4A 3WYFA 1NAHA 4Q9HA 4GVLA 1CD5A 1ONSA 1GYQA 3J7TA 4JU8A 5IDVA 3L4BC 2VJMB 2J0UB 3SN6A 2GTPA 4QBFA 3TKYA 3WP1B 2GVZC 3KFLA 3NJ8A 3NQ41 5JALA 2Q7DA 1E63A 3H9BA 3H11B 1JFFB 2JAXA 1EJ0A 3DW1X 2GBLC 1OWNA 1VSTA 2QDXA 1HO3A 1M74A 1WE2A 5I5GA 1GY8A 3ABRB 3H4IA 2BDTA 2IVFA 3L7CA 4OB8A 1VIVA 3SQLA 3TRIA 3PDIA 1KYQA 3MLBA 4MW5A 3OZDA 1XNGA 1Z5OA 2PHZA 4UEQA 1A97A 2EKDA 4V0MA 3CVXA 3WSVA 5GGXA 4RVSA 4Y9RA 1QG6A 5TGZA 4OPMA 1FFYA 3MT7A 1DX9A 4CW7A 5EIFA 2J9XB 2HT1A 5AD1A 1TU3A 2ZWPA 2I7TA 4G1CA 3T3IA 3AW8A 2XDQB 4C20A 1FU4A 1SA0B 1C4WA 1GYRA 1YDGA 2FW8A 3E22A 4KYTA 2BL4A 1JKJA 5G0WA 4D0RA 1FLDA 1E4EB 1N6OA 4OH1A 4C29A 4EB6A 1W2HA 2QX9A 4JC4A 4WNYA 2PL1A 1NW6A 2PLRA 3MQ4A 3ASVA 4NICA 3OI7A 5DCYA 1EK1A 5EXTA 3TTWA 2J3MA 3EGWA 4GLBA 5AWFC 1KH1A 3UBTA 1M8GA 1SXJB 5DIZA 1OU0A 3U26A 3NOXA 2JFBA 1XELA 4RELA 1NBAA 4XD7A 1PGNA 3PIIA 1W5BA 4OF4A 2IY9A 3JYOA 4UVEA 1PWEA 4RJTA 5I7VA 2Q5FA 4N8SA 4R8RA 1SUAA 4XCXA 1YAJA 5I7UA 4PM4A 4W5NA 1R0RE 2GM5A 2IODA 1Y0BA 5DTQA 2VA8A 2PH1A 3WWDA 3H2KA 2CXOA 2Q9BA 3ZBQA 3WJ1A 4FYMA 4OHRA 4M0LA 3ZQUA 2WJ4A 3T1YB 1KEUA 2EOAA 3OQVA 3W2IA 1IAVA 4YAUA 1TE2A 4BO6A 4ZU1X 3T1HB 2O3QA 3VAYA 2EG9A 5BMVF 4PG5A 1UBMS 1VZ2A 3OFJA 2VT2A 4DPMA 4LGVA 4MQLA 2NVUB 2RBGA 5BVHA 3FTCA 1YUBA 2Y4NA 1UJ5A 3E81A 2D59A 4HAVA 2ESRA 2NACA 1FTWA 4LXIA 5CIQA 1T5DX 2CKDA 3KEOA 4GWGA 3A4TA 4JGIA 4NEGA 3KJEA 1E99A 1RRGA 4QO8A 5D1HA 1EWYA 1K7SN 1OSNA 4C3VA 4CPDA 5AUOB 4D0SA 4AZ3B 4H0FA 3GG9A 4MYSA 1C3LA 3QTBA 1QHEA 2YMQA 3NETA 4GSLA 1X7GA 1WSDA 2B5OA 3PKZA 4E11A 2VJQA 5FTKA 4PHHA 1E1CA 1A9OA 3OZSA 4EL5A 5JSUA 3KKKA 4JQZA 1R2QA 3ETHA 1GPAA 3SYTA 3N28A 2C77A 4EW1A 2WM2A 3CZAA 1W0KA 1MKYA 3K0KA 3RS7A 3LYAA 1FUKA 3LY9A 2A0UA 2IDKA 1RPZA 3EVZA 4RSRA 2XB8A 5FORA 2P5YA 1QORA 2MSWA 3L5KA 3QQPA 2QL5A 3H2JA 2VHVA 1UAAA 4LRWA 3LUFA 2XMDA 4TZ0A 4LE0A 1X80B 4I2NA 3DMNA 3NTUA 3QPVA 4NESA 4BB6A 3BRWD 3N2GB 3HXOA 5DCUA 2XBMA 4DIFA 4MVJF 4AF6A 1GNLA 1CVLA 5KTNA 1SO8A 3W3ZB 3S3TA 4GKJB 2FW6A 1NR5A 4FJ2A 4MP6A 1JAXA 1NN1A 5F3RA 4DTIA 2A0WA 3HH8A 2QPLA 5MN4A 3O9MA 1GEEA 3FSGD 4N0PA 3LDAA 2HGZA 4UU8A 1YB1A 1KP2A 3GJ0A 2AUMA 3IQGX 1VL8A 3RFUA 2P2GA 1AN0A 2IGBA 3BH7A 4U2FA 1AV7A 2PPLA 4PSCA 1LDMA 2A9VA 3GQBA 1D1SA 4HH1A 2IFTA 3FZGA 2GVDC 4R2JA 1PU2A 4KMOA 4M60A 2RARA 3D1VA 2QBYB 2JRLA 1V3UA 1F8YA 2J4FA 3PL5A 1DKOA 4FOOA 3L7IA 2RH4A 2X0DA 4IFTA 4F86A 4J6FA 3A9VA 4DQVA 4MUIA 2X8LA 3QEOA 4QNMA 3PCXA 3TZBA 5CA0A 4FBLA 1F3LA 3RS2A 3AUSA 4BRSA 3Q72A 3RSZA 5DLYA 4H7FA 3CZCA 1JQDA 2FSVC 3B51X 3T12A 1X74A 1R0LA 1TMKA 4QJBA 2J4CA 2AD1A 2PUWA 2HSWA 3CXRA 1X1DA 5EMJA 5ALQA 3D6JA 4QDJA 5EIBC 4G4JA 3H1TA 4K9SA 4LJAA 1PAUA 3RWBA 3SYKA 5EJ9A 5JCJD 3BFPA 1WX1A 4AO6A 4AAYA 1YZYA 3UAOA 4CGYA 1OXXK 2WHEA 4KMSA 4I1VA 1EEHA 1EFCA 2GASA 3G0BA 4LVNA 2Z3VA 5MDHA 1AO0A 4QFBA 3NAQA 4ZZ3A 4J4BA 1E32A 1FTYA 1AGYA 2H4HA 3NBYC 5JVDF 5FFFA 4IIEA 4QG7A 4NARA 1HDXA 1QJCA 4MGKR 2VCYA 1NYTA 3IA7A 1KZ1A 3TN7A 1BHSA 1T9AA 2XCIA 4P80A 4Z4FA 4ALKA 3TPZA 1YIOA 3FTDA 5IM5A 5F51A 2POCA 3FPBA 3T94A 2WE8A 4C6RA 3U44A 4W6QA 2RKOA 4L27A 2AZ4A 4XDGA 1NUAA 3Q4GA 1VI5A 2XAUA 4XSHA 1HLGA 1R6TA 4CKWA 3JRXA 3L0SA 4JP3A 1EESA 3BEOA 5KQRA 5B58T 3OZRA 3ZD7A 2DX7A 2BF4A 4XUCA 4A2WA 1JIVA 4P31A 1XQVA 2ZWIA 3BWCA 4YPFA 4Z8XA 2II6A 3I2GA 5MFPA 2EGHA 1KDYA 3LTNC 2HWWA 2M1XA 1K7EB 4Y3UA 1WF6A 4IGIA 5F1OA 1T24A 1MJFA 3G85A