3UF0A

Crystal structure of a putative nad(p) dependent gluconate 5-dehydrogenase from beutenbergia cavernae(efi target efi-502044) with bound nadp (low occupancy)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
249
structure length
249
Chain Sequence
GPFSLAGRTAVVTGAGSGIGRAIAHGYARAGAHVLAWGRTDGVKEVADEIADGGGSAEAVVADLADLEGAANVAEELAATRRVDVLVNNAGIIARAPAEEVSLGRWREVLTVNLDAAWVLSRSFGTAMLAHGSGRIVTIASMLSFQGGRNVAAYAASKHAVVGLTRALASEWAGRGVGVNALAPGYVVTANTAALRADDERAAEITARIPAGRWATPEDMVGPAVFLASDAASYVHGQVLAVDGGWLAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Short-chain dehydrogenase/reductase SDR
publication title Crystal structure of a putative NAD(P) dependent gluconate 5-dehydrogenase from Beutenbergia cavernae(EFI target EFI-502044) with bound NADP (low occupancy)
rcsb
source organism Beutenbergia cavernae
total genus 93
structure length 249
sequence length 249
chains with identical sequence B
ec nomenclature ec 1.1.1.125: 2-deoxy-D-gluconate 3-dehydrogenase.
pdb deposition date 2011-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3uf0A00
5L40A 3H9EO 3JQAB 3NV9A 1YJQA 1KOLA 3CXRA 4L76A 5BSHA 1D3AA 1ZO8A 4XQCA 3S2FA 4MVJE 4DLAA 2OUIA 4B3HA 1EUCA 3KVOA 2OP1A 2WDZA 1KEWA 3ZWYA 2ZK7A 3LT2A 1U1IA 2C20A 2H1SA 1NXQA 3I4CA 3I1JA 1PZEA 5G4KB 3U09A 3MCVA 4BIIA 2WD7B 1PJ3A 5DF1A 3WGHA 2YDXA 2Y1CA 5TT1A 3TOZA 3TRIA 2DBZA 4KWIA 4OQZA 5JMWA 2EJWA 3E03A 2NM0A 5T8KC 2RBEA 1E7WA 4YR9A 3QA9A 1GAEO 1PQWA 2X0JA 3HDHA 1LRKA 3FR8A 5U1PA 3ZN2A 4HBGA 1EQUA 1ULSA 4J9UE 1F8FA 3VKUA 4PN3A 2WE7A 1R0SA 1X1TA 1Y8RB 3DBRA 3PFFA 5KJEA 2AQKA 4GAEA 1ZZEA 3I9JA 5CFZA 1WP4A 1Y1PA 3TN7A 3W4IA 4E2WA 4RVUA 4YAGA 4JROA 4J7UA 3IKVA 5TX7A 4IGFA 4PVCA 2YZ7A 4CM8A 3PP8A 1DJNA 2CSUA 1W73A 2NVBA 1Y7TA 4XGIA 1H6DA 2C54A 4MKXA 3ZU2A 4NPCA 1N8KA 3ZWCA 1V0JA 3E9NA 1VSVA 1YL6A 1B3RA 3WYEA 2GCGA 2HSDA 3QVOA 1T4BA 3F6YA 1UXHA 1HE3A 3DAFA 1HTBA 3PGJA 5DBIA 3BYZA 5ADHA 4OAQA 3HHPA 3KUXA 1GUFA 1Y9AA 4PLPA 4IPTA 5TJ9A 3ANNA 1DC5A 1Q2XA 4XGNA 2F1KA 2DFDA 1N1GA 3AOEA 4RVHA 3QWAA 4DIOA 3DOCA 3WGGA 4CR7A 1PGJA 4KOAA 4DQVA 2I6TA 2Z5LA 1JWAB 1WAMA 3FTPA 3OJ0A 3PEFA 1ZSVA 3V1UA 5DNAA 2EKPA 4I5GA 1E1KA 2O4UX 4Z9XA 4EJMA 2JHFA 1RYEA 5BSFA 4BO0A 1XIVA 4WECA 4W9NC 4MKRA 1ZMTA 1A72A 4PZDA 1BXKA 4P4LA 3QSGA 1PZFA 2FHSA 3JD3A 4NK4A 4PLTA 3RUEA 1LU9A 4DVJA 4ZJUA 3NT4A 4GMFA 4J4BA 4PLYA 1N5DA 4ND5A 4NFSA 3NJ8A 1ISHA 5IZCC 5U9CA 2P5UA 1HSOA 2X0IA 1CQIA 1YE3A 3IUSA 4LMPA 1P1HA 2Y05A 1DOHA 5J23A 2HK8A 4ZD6A 3EYWA 3GMSA 1NQ5A 5ICMA 3RFXA 1ZXBA 3DZGA 1SOWA 4E33A 1S7CA 2DAPA 2QG4A 5EINA 5ENDA 2O7QA 1N7HA 2JFGA 3HFGA 3LZ6A 3FNEA 4MVJA 2PY6A 4LCEA 2CDCA 2EG9A 4PG7A 1MP0A 3L4BA 4MVJD 1FMCA 3RU9A 1TEHA 5COBA 2GERA 2E49A 4EI2A 1PJ4A 2NU7A 4XYEA 4QUKA 2DBRA 3PZBA 2DBQA 5DCWA 1J49A 2F00A 5I7FA 5JYEA 1HDZA 4ZN6A 3P2YA 3JQFC 2JCVA 3SLKA 3D4OA 3OA0A 4E31A 2A35A 3GUYA 1NYTA 3GDGA 4K6FA 1K2WA 4CQLB 1I3NA 5H82A 5JSFA 3H5RA 1LRLA 3ZV4A 4M55A 3ZWWA 3VPXA 3OA2A 1AXGA 1K0UA 2BRUA 3UKOA 4JXKA 4M1QA 2VUTA 1V3UA 1I30A 3DFZA 1CF2O 2EV9A 2FPIA 5JC1A 1NX6A 5ILOA 4BNKA 3TF5A 4UVEA 1L1FA 4IM7A 1DRWA 3B6ZA 3ZWOA 2JD2A 1F14A 2FPPA 3N7UA 4I5EA 5FI3A 3W6ZA 4RORA 4J6FA 3OBBA 5IDXA 5GZ1A 2WSBA 3GFBA 5JE8A 3T4XA 5DN9A 5TQVA 1K89A 1AUPA 4YRAA 4XKJA 4AJEA 2E4AA 3RCBA 3WIDA 3GVPA 4OM8A 2DC1A 1LLDA 2PH3A 4FDAA 4OYRA 4Q3BA 4Q9NA 4LW8A 1Q7BA 1YONA 2C5AA 2D4AA 3LT1A 5EL0A 4BO4A 4YT8A 3JQ8B 1GQQA 1M66A 1XLTA 2C59A 3F1LA 1C0KA 4XR9A 4L74A 1G0NA 3O03A 1D1SA 4WNCA 1ZIDA 1U7HA 5T67A 1JAYA 3ITKA 4GVLA 4CUZA 3K73O 3W6UA 1QYDA 3AU8A 4IS2A 1HWYA 4NH4A 2O7SA 2SCUA 4P22A 2V6BA 1YQDA 3BTOA 2YUTA 4J7XA 3S55A 1VJ1A 2PD6A 2X8LA 4MP3A 4XWYA 2DTDA 5A9SB 4JNKA 1AN9A 3D5QA 3K31A 2QRKA 2B0JA 2WEKA 1BXZA 2RHRA 1GADO 4IJVA 5JPIA 3IC5A 2EKLA 3AK4A 4D3SA 2A94A 2JKVA 2VHVA 1GZ6A 1NPDA 5A5EA 3C24A 2FOIA 1KYQA 3DXFA 3ZW8A 4LVCA 2RHCA 4GX5A 1K6XA 1F8GA 4L4SA 2Q46A 5ES3A 3RC9A 1JU9A 2OORA 7ADHA 3BHJA 2B69A 3IP1A 4IZIA 4YJHB 2FPGA 4DIFA 3G1TA 4AJLA 4W99A 2X4GA 3OQ1A 3P19A 4Z0HO 4AVYA 2GZ1A 1IUKA 1UAYA 3NEPX 1TXGA 4CMCA 3PPIA 4AJNA 1DIRA 4R54A 5DT9A 1LSJA 4N18A 1NP3A 4OXNA 3VVBA 2PZMA 1XELA 3TOXA 3MJSA 2LDXA 4BO5A 2FZWA 1VC2A 1V35A 3JQ7A 4RVFA 1X13A 1GPDG 2GZ2A 3O4RA 3E18A 3R0IA 1E7SA 4ZICA 3PK0A 1VL8A 2HAEA 1U9JA 5B37A 4OO3A 2X86A 3KBOA 3KEOA 3V1TC 2HK7A 1PS9A 1M6WA 1IHYA 2E82A 2H9IA 3E5RA 1YL5A 2J5KA 3QWFA 4F46A 1XEAA 4QFCA 4CV2A 1U8XX 4BNNA 4GWGA 4ALKA 4Y98A 4BMVA 2B35A 4A03A 3GEMA 1IULA 5JO0A 1U5CA 4PLHA 3BZUA 4B79A 3COSA 1MG0A 1ZUD1 3FNHA 4Z3DA 4XDYA 3D3EA 3AY6A 3IMFA 4B4WA 5IDWA 3KM0A 3D4NA 4ZGWA 1LLCA 1I10A 1I0ZA 2PD3A 2QX7A 3ZNNA 3OH8A 3Q6IA 3E6AA 4L73A 4FOOA 2JHGA 4R1SA 2I99A 4INAA 4DC0A 4LMRA 4D41A 4BOYA 1PJBA 3QJ5A 1EFKA 1V8BA 1YB1A 2TMDA 2PKRA 3ZZNA 1VI2A 4YAKA 2B4TO 4OKNA 1P1FA 3DZKA 4WCFB 2DKNA 4GKVA 4ALMA 2VUSA 2FSSA 3I52A 4DLLA 5JDCA 3WYBA 3DTTA 1YB4A 3PJDA 1Q0QA 3VHRA 2Y0DA 5G0WA 3HN7A 2BKAA 3EVTA 4UEJA 5I8WA 2ZB3A 2NU8A 1ZCJA 4A10A 2OMEA 3RASA 3AJRA 2XOXA 4YJGA 4I9HA 2C07A 4W4TA 3GRPA 4CM7A 5ENVA 4CV1A 1L7DA 3VH3A 4DL9A 1HLPA 1ZK3A 3GOHA 3NDIA 4AJ1A 4MINA 5L3ZA 1E3IA 1NR7A 4CM8B 5JCJD 3KETA 1YOVA 4OIMA 3GQVA 4QTZA 4XIYA 4OMUA 1ZW1A 3FPCA 2FP4A 3OFSA 4RPJA 4BNGA 5L7YA 4D79A 4GSKA 2Q1SA 1H2BA 1VJ0A 2P4QA 3G1UA 2PKQO 4FFRA 4DIBA 3W4JA 3ORFA 1LNQA 4M87A 2FR8A 2ZB8A 3A14A 2BHLA 3HDQA 3UCEA 4J9VA 2J3KA 2YQ5A 1ENZA 4D45A 3VTZA 1CEQA 3WBFA 1SPXA 1XDWA 4RLHA 1HYHA 5TNXA 3TL3A 3OQ6A 4N5MA 3WXBA 4MPDA 2HQ1A 4IJUA 4CLOA 1XWFA 3WBBA 4CLHA 3AM4A 3FI9A 3HE3A 1CIVA 1J4AA 2C7VA 4Q39A 5JDIC 3KO8A 4RPHA 2CMDA 3AY7A 4YTEA 1XA0A 1I3KA 3LF2A 4G65A 1SAYA 1FXSA 3GZNA 5T64A 2OXIA 1V6AA 3ZNOA 2P9GA 4QEDA 3VZQA 4QT0A 1IHXA 4FW8A 3DHYA 4HNGA 4E21A 3WGQA 1ZVMA 2UUOA 5CDUA 4I8XA 3PWZA 3TZ6A 5JS6A 4WOJA 5A9RA 2DPGA 2NV6A 1LDNA 2HDHA 2HK9A 3KTDA 3OSUA 4BQPA 4NNJA 3N58A 3PQEA 2Z95A 4UULA 2GN4A 3VTFA 3SBOA 3QWHA 3V5NA 1TT7A 5FF9A 3LC7O 3PI7A 4NHEA 4BNIA 2DM6A 4WLFA 1LDYA 3JV7A 2FZEA 4I5FA 1W8DA 3DBLB 3ZNQA 2CD9A 3KV3O 3Q2KA 2NQ8A 4JLWA 4ND3A 1VL0A 4FC6A 2HMTA 2BFPA 1QSGA 1HETA 3DL2A 2B4QA 2BGKA 2O3SA 4BB5A 3EDMA 3I5MA 4G5HA 4MDHA 4WNIA 5HS4A 4R4JA 3ETGA 3EGOA 1BW9B 4OKIA 5GMOA 2NTNA 1E3WA 1E7MA 4CLRA 4WEQA 1SO8A 3NGXA 1XU7A 3OJLA 3TDKA 3WR5A 3IS3A 1EFLA 2VYVA 3QWBA 3CTMA 3BHMA 1HE5A 4FIZA 3WNQA 1MX3A 1LQUA 4YT2A 2OHXA 4HV4A 4D42A 2VWHA 2EW8A 1R0LA 1TLTA 2VYVD 1X15A 5AOVA 2O2SA 4HKTA 1PEDA 3F1KA 1T2CA 4TKLA 2PNFA 2YV3A 5LC1A 1WMAA 1BG6A 5T6BA 2I5PO 5I7SA 3O8QA 1NR1A 3GA0A 5TJHA 3EZYA 1MGOA 1RM5A 2DBVO 2C2XA 4IIUA 4II3A 1NHWA 4TKMA 3ASUA 1GUYA 2CVOA 1N1EA 1QLHA 4KUHA 1ZSYA 1BSVA 2B5VA 3NAQA 3ZWXA 1YRLA 1SCUA 3DMTA 3ON5A 5CDGA 1NFQA 3JQBC 3NTOA 3Q3CA 4BNJA 1ADGA 3SX2A 4ZRMA 5ILGA 1QYVA 4WE3A 4YRBA 2O3JA 4CJXA 2D5AA 1R4MB 3B1KA 1DLJA 5THQA 3B1JA 4TRRA 1C14A 3DWFA 3NDRA 1A7KA 4Y8VA 3GC6A 4NFYA 2VHZA 5L51A 2I3AA 1QXSA 2C29D 4J1QA 1XR3A 2ZYAA 2FWMX 1PTJA 1AE1A 1GPJA 4IZHA 1SEVA 5EMHA 2GN8A 5B4TA 1PJCA 2V6MA 2JAHA 2YV1A 2JL1A 4GX2A 4NBVA 4MOWA 4DPKA 2PZLA 3H2ZA 5AQ1A 4RQTA 3CINA 3TQHA 2YW9A 1IZ9A 2IZZA 4KQWA 2FRDA 4HWKA 1E7RA 3JQDA 3H6KA 1PL7A 5KJCA 3GNQA 4HFMA 5KJ6A 4A26A 1J5PA 2Q4BA 4RLSA 1E3LA 2VQ3A 2YFQA 3M2PA 3PWSA 5TIIA 3TPCA 3KYDA 2BI8A 1GTMA 3V2UA 4UEOA 4KZPA 4DRYA 4O59O 2Q99A 3Q0EA 2WWRA 4K28A 4BNVA 2HRBA 4ND1A 1QRRA 1ZK0A 4E2YA 1QG6A 1R66A 3BTVA 4IY1A 5IN4A 5CHEA 1UXKA 2HMUA 2ZCVA 3GPDG 4U5QA 3RUDA 2IYOA 3HADA 3H8VA 2D5CA 1N92A 4NDNE 2WTBA 3LQFA 3ZU3A 4E6PA 1PZGA 2O3RA 3Q2IA 4PRLA 4BGIA 1LDMA 4MIEA 3VOSA 3PDUA 3QY9A 2OFPA 1WLYA 2X0NA 3LU1A 4JGBA 4YJDA 2FMUA 4BKOA 3B1FA 1AGNA 3MJEA 4FPXA 3DBHA 3OEYA 4ITUA 1GYPA 4YRDA 1CQJA 4C7KA 3WDSA 1GY8A 5DCYA 3EY4A 4GX1A 2C82A 1HXHA 3RFVA 4UUNA 1SEPA 4AJPA 3IOYA 4YJFA 4B7CA 2BFAA 2QYTA 3D64A 4WLVA 5B1YA 5FYDA 5G0VA 4CUKA 4IINA 2J8ZA 4R3NA 4QQRA 1Y8QA 2VHXA 4CV3A 5FWNA 2IE0A 4CV0A 2R00A 3NTRA 3RC2A 3UW3A 3PHJA 3RROA 5T8KA 1S6YA 4FD3A 4IDDA 4FBGA 1OI7A 2ZB4A 4BNHA 4YVFA 4YB8A 4XA8A 1NTOA 2EERA 3KHUA 1UXIA 4DGSA 3JQCA 3SEFA 1PQUA 1T26A 4EEZA 5KKCA 1JKIA 1XCBA 5K9ZA 3K8ZA 3WSWA 4R9RA 4IS3A 3X2EA 1QYXA 2A92A 1A7AA 1ENYA 2PLAA 3AFNA 4BMNA 5A06A 4XD2A 1HEUA 1IPEA 1EBFA 2Y93A 1E1MA 3IAHA 5CG2A 1ZBQA 4UUOA 4BL5A 1EEHA 1ORRA 2I3GA 2B36A 2H63A 3UFXA 2IODA 1K5HA 1BXGB 4Z0TA 3QWIA 2DTEA 2IYPA 3LVFO 3JYNA 3L4SO 4R41A 4ALLA 5A9SA 5CEEA 1Z82A 3ZDFA 1GUZA 1UJMA 4H7PA 1UXGA 4R5MA 4PFJA 2Q1UA 2OBYA 1XG5A 4YQYA 4I9UA 3LLSA 1HF3A 5I7EA 4JP3A 1DIGA 4UREA 3HUDA 3GHYA 5AXCA 1EQ2A 4YT4A 2A4KA 2NNLD 4A2CA 5F1OA 3MTJA 1DRUA 4CR8A 1ONOA 5T57A 2QHXA 1R16A 1MG5A 1ZKMA 3FTNA 3KEQA 1PS8A 1FK8A 4IQ8A 4E5MA 2G76A 4PG5A 1I01A 3ETDA 4TMFA 4P8RA 5CDSA 4PLCA 3OM9A 5HM8A 3AFMA 3I9NA 2VWGA 3IKTA 1ZJYA 4WCFC 3RVDA 3S2IA 1U3UA 2HMVA 4DUPA 2OBNA 3INTA 2PK3A 3RKRA 3WNVA 4KWHA 3JD1A 3L6DA 4QSMA 5IZCA 4IXTA 3W1VA 1DRVA 1DFIA 2NSDA 1FDTA 1LSSA 4UAGA 5DOZA 5TF4A 2W90A 4RPKA 5JC8A 2BF7A 2POQX 3NX4A 1JAXA 2HLPA 1I2ZA 1UP6A 3GZNB 4ZRNA 4W82A 3BMCA 5BNIA 4BHTA 4ILKA 4J2HA 3S2GA 4NU5A 5ER6A 1E1LA 2IXAA 1ZK1A 4JBGA 5T5QA 1Z6ZA 2WJPA 3RI3A 3U62A 3K2BA 4Q3EA 3VH2A 4N5LA 4XYMA 1JTVA 1O95A 3QVWA 4OOFA 3ZWPA 3KYCA 3DZJA 4BNYA 2CF5A 2VZ8A 3IQDB 4IDCA 4BO7A 1PL8A 4EJ6A 4YAIA 8LDHA 1GQYA 1X1EA 3BMOA 3D7LA 1NFFA 4Z0PA 3DDNA 4DLBA 1P0FA 4XR4A 4Z3KA 1WDKA 1TI7A 1M76A 4ZHSA 2PGLA 3GF4A 5JNLA 3JQFA 1B2LA 5JBIA 1P74A 3FHLA 5DP2A 3G17A 3HN2A 3AI2A 4PLFA 2EP7A 2PZKA 3V2GA 3EW7A 3GGGA 1E1NA 1TT5A 1NVGA 2J3JA 4CMIA 4LVUA 1UDCA 3NYWA 4J2OA 1T1SA 4QXMA 3RIHA 2O2YA 3WICA 1SC6A 1UZLA 3HFSA 4A73A 4FCCA 3EUWA 1GDHA 1E92A 4AJ2A 1E77A 1P0CA 1LA2A 3WSVA 3GK3A 1NBOA 3HZZA 3P2OA 1VKNA 3OJFA 3OECA 5C3MA 3ONEA 2PA3A 2WYVA 3RAJA 5KWEA 1NAIA 1PQPA 2TMGA 3ENNA 4CM1A 2BGLA 1WXDA 2PGJA 1ISFA 4C7JA 4GH5A 1KERA 1DHRA 2QYSA 5AYVA 3DONA 1LBEA 3PYLA 2YHIB 4YWJA 1O0SA 3OMLA 3UICA 3FPLA 4GLLA 4Q3NA 3LK7A 4XQ9A 3ZU5A 4YAJA 4BMSA 2H6EA 1CYDA 3OIGA 4O5OA 1W6UA 3O8QB 5JAZA 1DSSG 4FN4A 2RAFA 1EDOA 4BV8A 4TVBA 4ESOA 1GCUA 4BO2A 1DFHA 5DBFA 2IRWA 2I76A 1IL0A 1LXCA 1M67A 3AI1A 2VRCA 4FJ1A 4D44A 1H2HA 4MVJP 1IYZA 2YV2A 2EKQA 3WWZA 2GF2A 3VPHA 1N9GA 3BMQA 2JJYA 2YJZA 1Q0LA 1U5AA 4CM9D 1ENOA 3A06A 1Z7BA 3GDOA 2P9EA 1FDVA 2VRCD 3SLGA 3UHAA 3ZWAA 4BGEA 3L4BC 4ZU3A 4ZQFA 4DYVA 5FFFA 4TWRA 4XEHA 2PFGA 1PSDA 3GEGA 1LRJA 2GNAA 3C7DB 2NU9A 2Q49A 4CMEC 3H3JA 3JQEA 3K2EA 4QO8A 3PLNA 1HKUA 1BTOA 4WGGA 3P5SA 4BO6A 2GR9A 3TJRA 4R1NA 4AJOA 3GZ4A 2GASA 3BAZA 3EHEA 4ZQHA 2AQHA 3DR3A 2OZPA 1I8TA 1NPYA 2XPCA 4A7PA 4R3WA 2RIRA 4CUJA 1MA0A 1O6ZA 1MUUA 2BGMA 3UCFA 2EXXA 4CLEA 1PWZA 1CETA 4CMBA 1XSEA 1J6UA 1T2AA 1UH5A 4MVJM 5F3RA 2QZ9A 2HMSA 2VZ9A 4FGWA 4BNXA 2PZJA 2E37A 2HJSA 1QYWA 2ZYDA 4YYZA 4E13A 2NQTA 3M1AA 4FFPA 4N54A 3U9LA 4CMJA 2JD0A 4BQRA 1PZHA 3KLPX 1Z75A 1DPGA 1M6HA 1VKOA 4IQGA 5A1TA 4LRSB 2JAPA 3AUAA 3MOGA 4GVXA 1G0OA 3RQSA 5IAAA 3JQGA 1F0YA 1GEGA 2NVUA 1KETA 2AEJA 2O50A 4MKZA 1KY4A 4RV9A 4NR0A 2ZYGA 4U0KA 1DDOA 4NBRA 4EEXA 3U4CA 2EJVA 3BTSA 4R1TA 3H7AA 5KJ1A 2W2KB 4FOSA 2X9GA 4BUCA 4R5HA 4O6VA 1E6UA 4Y6RA 1RM3A 3QRWA 4CL3A 2AA3A 1OMOA 1I32A 1C0LA 3TSCA 3WQSB 1KY5A 3ZH2A 5L4NA 4RJTA 4CQMB 1X7HA 2GN6A 3I3OA 1I5RA 5LCXA 4M49A 5IZ4A 2ZTMA 3R6DA 1I3MA 2ZIZA 1VLLA 1ULUA 4BKPA 3TL2A 2QRLA 2VNSA 1C1DB 1SBYA 2X7HA 4O63O 1GCOA 4NMHA 1PJSA 4G81A 3I9MA 1NWHA 3JQ9C 4OSOA 3GH3A 4CM6A 1P1RA 1RJWA 4J1TA 4N7RA 4CLDA 4M8SA 5CDYA 4GSLA 3WTCA 1EK6A 3G49A 5TSDA 4WK6A 2CDAA 5EN4A 3L77A 2JCYA 2BFOA 3WLFA 3QVXA 3FBGA 3HQ4O 3PHGA 3RUCA 3H9GA 3VAZA 2X5KO 3TZQA 3WJ7A 4BNWA 3O38A 2DUUA 3DB2A 5IDQA 3BMNA 2Y1DA 1SB9A 2LDBA 2PV7A 3CH6A 3CSDA 1ZEJA 2WD8A 5BQFA 2ZJ1A 5L7WA 5HBRA 1F06A 4KDFA 1WZEA 5DCUA 3UH1A 1QV7A 4TRMA 3PHIA 1Z74A 4L9RA 4XGKA 2BMAA 2PWZA 2VT3A 1SOVA 2EIHA 1I2BA 2Q3EA 1PJ2A 1PGNA 3FWZA 1ARZA 3CUKA 4BNMA 3KSDO 1ISGA 2DT5A 4RCVA 3PJFA 4FS3A 4K9DA 3RUFA 3TZCA 3L07A 4PLWA 3D0OA 2Q2VA 2DVMA 2RCYA 2CF6A 1Z45A 1RM0A 3JQAA 4ID9A 1U28A 1JVSA 4HFNA 5JMPA 3ZHBA 4B4VA 3OJOA 2JD1A 1C0PA 5F1PA 4BNTA 4XB2A 2Q50A 2VCYA 4OXYA 4E5PA 2XXBA 4QFDA 1YH3A 3GG9A 3ZWMA 5C7IO 5MDHA 3DBRB 3JQAD 5JCJA 1BRMA 1KIFA 3H2SA 2CY0A 2O3TA 5G4KA 3QQPA 5L4SA 2WD7A 3F9IA 1K3TA 1P1JA 4XQEA 1C3VA 1EVYA 2GZ3A 4UVGA 4Y67A 1IY8A 1EDZA 1VM6A 4XDZA 2OOSA 1SMKA 1MFZA 3KSZO 3NKLA 4W7IA 1WW8A 5BT9A 1WNTA 4TRNA 3UN1A 3X2FA 3PJEA 4RL6A 4NFHA 1LDEA 4UUPA 4FFNA 3FR7A 2QW8A 1Y8RA 1QKIA 4A0SA 1PGOA 4R69A 2D59A 3EMKA 4XJSA 5CEFA 2O3QA 4J0FA 3JSAA 1BDMA 3U4DA 1U3TA 3LT0A 4GI2A 1U2GA 3JD4A 1KVSA 5JDCC 2ILTA 3LYLA 4NZ9A 1B15A 3W8DA 2VT2A 4YA6A 3RC7A 3U0BA 3WX0A 2OO5A 1P9LA 4YEDA 3V2HA 1H6AA 1EE2A 5A03A 3RBVA 5G2OA 1LJ8A 2FR1A 2W8ZA 3UAGA 3DFUA 4JK3A 1B14A 3ZI0A 3ONDA 2I65A 1H0KA 3BMCB 3DHEA 3ICPA 1YL7A 2QQ5A 1JKFA 4YXFA 3TFQA 2O23A 3VPSA 3MJVA 4MP8A 3DHNA 3GVCA 3GUCA 3E1KA 2C7GA 3S2EA 5CAEA 3DAPA 5JO9A 3I23A 3U4HA 5KNLA 3HJAA 5G0SA 3F46A 3GDFA 2CFCA 3EAGA 1LUAA 4NIMA 4BO3A 2VOEA 3BMOB 1B16A 4FGSA 3STHA 3SC4A 3FCOA 3PQFA 1LI4A 1DC6A 4B7XA 4TRJA 5JCXA 3GY0A 5EESA 1R12A 3W4KA 3AW9A 1B8UA 2DFVA 3FWNA 2GSDA 4BV9A 4OXKA 4Q3AA 4TQGA 3QW2A 3BTUA 2Q45A 4FFMA 4EZBA 4XJTA 3SJUA 2HRZA 1BWSA 3IIEA 3D3WA 5IF3A 4YCAA 4RVSA 5ICSA 4BKQA 4OQYA 1VJTA 5EQDA 2P91A 1OZAA 3ZV3A 4ZQBA 4J4HA 1ZSNA 3L9WA 1QMGA 3DZFA 4EITA 2DPHA 1YWGO 3VZPA 1O89A 4D46A 3DZBA 3I9OA 4EW6A 2ET6A 2EEZA 3OJEA 1JVBA 4J91A 5A3VA 4F3YA 3I9KA 1WZIA 5HRUA 4FSHA 4BVAA 4OOEA 1A4IA 1D1TA 3WFIA 4BGUA 3Q9NA 4KP7A 4LSWA 4RDIA 3O9ZA 5BSEA 1GL3A 2X23A 1RKXA 2X1HA 2RH8A 1GYQA 1YXMA 4GBJA 4PVDA 5A4DA 5HWSA 2P5YA 1HDXA 1A9ZA 4EDFA 2AG5A 5IN5A 3ENKA 2J5RA 2C5EA 3PHLA 4HNHA 4PLVA 5COAA 4F6CA 1SB8A 1QYCA 3GFGA 1ZK2A 1N9GB 3BMQB 2ZTUA 3WYCA 3ULKA 4R1UA 3W8EA 2HJRA 4NJMA 3MOIA 4CQLA 3MJTA 2NACA 2VTEA 1R4NA 3AUTA 3RD5A 3GAFA 3KZVA 3D5TA 3DMYA 4MVJH 2FN7A 2RH4A 5KOIA 4E5NA 3T4EA 5KTKA 5DDIP 1B3BA 5K6AA 2GDZA 5L95A 3D4PA 2W98A 4GX0A 1RPNA 4WASA 1CJCA 4EGFA 3DOJA 3WJAA 3I83A 3E8XA 4GWKA 3TZKA 1HE2A 5KVQA 4BNUA 1NASA 1XGKA 4K26A 4B7UA 5AVOA 1X7DA 1TA4A 2GYYA 3RUHA 2QIOA 3WGYA 4R9SA 3GR6A 1N2SA 1NNUA 4E5KA 5G4LA 5L45A 3M6IA 1IE3A 2GD1O 2BD0A 4ALIA 5F1KA 3JQ8A 3JYLA 1ADCA 4XYGA 4AJJA 5JY6A 3ANLA 4D3DA 1EK5A 1T2DA 4WLEA 3GVXA 3QVTA 5B4VA 1A5ZA 3U5TA 3H5AA 1E3EA 3LT4A 4JX8A 4DA9A 5A02A 4H3VA 3CKYA 5KVCA 4E0BA 5G0UA 3MEQA 4N5NA 5A5FA 3AY3A 5I8ZA 5JFOA 1LSOA 4I1IA 4W7HA 2WYUA 3JQGB 5IXYA 1UUFA 1B0AA 5KKAA 2IZ1A 2Q4EA 3KSUA 5B4UA 2CDBA 1R6DA 1DJQA 3F5SA 3KLMX 5GZ3A 1EMDA 3ROKA 1U4OA 3IJPA 4WKGA 1YDEA 2NUAA 3CE6A 1HYEA 1MB4A 1WWKA 1X0XA 3EZLA 1Z73A 2VHWA 1CRWG 2AE2A 3H9QA 1BDBA 1F17A 4XYLA 1T4DA 2VRBA 1HDRA 3JQ7B 2CVZA 2FY8A 3GEDA 3PIDA 4FR5A 3GG2A 2VWQA 3ZGYA 3CPSA 3QLJA 1YVEI 1ENPA 1NM5A 1P33A 2PKQP 2AMFA 2DTXA 2EW2A 2WMDA 2XF8A 4P4NA 1YBAA 3VKVA 5JY1A 1EVIA 4BGVA 1SZJG 4PG4A 1HZJA 2ZQYA 1HDOA 5F21A 4D0RA 1LC0A 2B83A 3HDJA 1XKQA 5CEJA 1MFPA 2UYYA 4OL9A 4J3FA 1WDLA 3PJGA 1K6JA 1PWXA 5BNFA 3H9JA 3CMCO 3SXPA 4GGOA 3OEWA 1H6CA 2G17A 2X9VA 1PX0A 4F6LA 5CPFA 2XXJA 4LN1A 4QO7A 2BELA 1OOEA 5TRTA 1NVMB 3C8MA 1X7GA 4NK5A 1E0DA 2EGHA 2AQIA 4FFLA 4BNLA 2J3IA 3F3SA 3GNTA 2ZJ0A 5K0ZA 1E7YA 3ZNPA 4Y9DA 3RUAA 1V9LA 4S3MA 5JAIA 4UUMA 1A4UA 2VTDA 3VZSA 2ZB7A 3FF4A 3RFTA 3QVSA 3A9WA 6LDHA 4EUFA 4BNZA 4J1NA 4WLNA 1EUZA 1ML3A 3GN2A 2Y1EA 3FRJA 3H3FA 4PCVA 1Q1NA 3WMWA 1YS4A 3HDYA 4PIVA 2J5QA 4J1SA 4MJLA 5I9MA 3T7EA 3NT2A 3QE3A 1ONPA 4I5DA 1O94A 2H5LA 2VNAA 1P44A 5ER9A 1TB4A 1DFGA 1HL3A 4KTVE 3FN4A 4FC7A 4OGWA 1U7TA 3KRTA 4MO2A 1RWBA 2HU2A 3K6JA 1NAHA 4MVJI 3PLRA 1MC5A 4K6CA 3FBTA 1KC1A 4D43A 2NVWA 4IDAA 3IJRA 1KS9A 1HRDA 4BO8A 4KMSA 3WQQA 5A9TA 3VVCA 2E48A 1DIAA 4UVIA 5DP1A 3NUGA 4JJGA 4OH1A 4K1LA 2XAAA 4B8ZA 1OBFO 1F12A 4AJKA 4YJGB 3GNSA 1T2EA 2QRJA 4PG8A 4HX5A 4WCFA 3WFJA 4URFA 3MZ0A 4B4UA 4IXWA 3AOGA 4QECA 3VH1A 3OHSX 5JXWA 1BMDA 4U0JA 3WGZA 1YJ8A 5KCZA 2Q1TA 2R00C 1XQ6A 1DB3A 1TVEA 1YOVB 1AHHA 4DC1A 2QZZA 4J7CA 1HLDA 4ZVVA 3H9UA 3L0DA 4C4OA 1P1KA 1YQXA 2P68A 5H83A 1KC3A 3U49A 2I67A 3SJ7A 2DQ4A 4CMHA 5JAMA 3PFWO 4B3JA 5L53A 5AXAA 1O5IA 4JBHA 1E7QA 1HDCA 1PS0A 3QIVA 4W9NA 1YDWA 5JYDA 4DREA 4EUEA 1NQAO 5FI5A 3ZHZA 1E5LA 3JYOA 4PZEA 3UOGA 4ZA2A 3C7AA 4YPOA 1U8FO 2IEBA 1VRWA 2AEMA 4MIYA 4CLOB 3NRCA 2P9CA 1H6BA 2G82A 4KUEA 4UVHA 3OETA 2EWMA 4R51A 2Q1WA 4XIJA 3VPGA 1GZ4A 1JQBA 1MLDA 1WMBA 3GVHA 4HXYA 4IDGA 4Z9YA 1R15A 1VPDA 4RO0A 3UGKA 2AW5A 3NJ4A 4DBVO 2J3HA 1ZJZA 2Y99A 1FDSA 2G1UA 2ZQZA 1LLUA 4JIGA 4WUVA 3AWDA 4F45A 5C5IA 4O1MA 4MVJF 4WLOA 4CM4A 4FB5A 2D2IA 1JW9B 1E3JA 3G79A 2UVDA 2D0IA 4J49A 2JFFA 3PGXA 4IMRA 5GY7A 1UXJA 1HYGA 2UAGA 1QLJA 1CERA 1DBVO 2NLOA 2UUPA 4CL8A 1NQOA 2ZTVA 5IJZA 1I3LA 3L9XA 1CDOA 3CEAA 5A3JA 1GU7A 4PLZA 3RJ9A 3OIDA 1DIBA 5I9NA 3OQBA 4JN6B 2B4RO 2W2LA 3Q9UA 4H16A 2Z1NA 3VZRA 1E6WA 2PR2A 4UVDA 2BFMA 3AOEC 2Q2WA 3ZHYA 5EQFA 2W2LD 3D3WB 5GZ6A 5LDGA 4R16A 4YBZA 4IJKA 1VE9A 1E3WB 2AE1A 1U3VA 3ZHXA 1DXYA 4MP6A 4GLOA 4HFRA 4CLRB 2YHUA 1PL6A 4L4RA 1MXFA 5I7VA 4KDEA 1E3SA 1YBVA 2AXQA 1O8CA 2I66A 3DBLA 3RJ5A 3FD8A 4IJWA 4IIVA 4DXHA 1B7GO 2GRAA 3PYXA 3F4BA 4DPMA 4A27A 5HTOA 1GFSA 3C1TA 3GRKA 4EYEA 1W0CA 4ALNA 3AUUA 2AEFA 2GLXA 3DBVO 3ETEA 3LSYA 2A9FA 1BW9A 1DC4A 4HP8A 4D7AA 4JJFA 4CM5A 4CMEA 2DLDA 3GLQA 1W4ZA 1LLQA 4LGVA 5A05A 4CM9A 1YKFA 3ICCA 1DC3A 5IDYA 1KEVA 1SNYA 4AJIA 4NBTA 3DOOA 5L9AA 2Y0EA 2JFHA 4PLGA 2PD4A 1JDJA 2Y67A 1B8VA 3GGOA 4FJ0A 3ZU4A 4NJMB 3KOUA 1UP7A 1R4NB 1ZEMA 3UCXA 1Y5MA 5BR7A 5EIOA 1E6EA 3B20A 3E82A 3JTMA 4ALJA 1JWBB 3INGA 3WMXA 3ANMA 2GUGA 4WEOA 3AM5A 1MXHA 5DBGA 4MIOA 2EF1A 4L4XA 2WYWA 2YDYA 3I6IA 3ADOA 4RDHA 1WVGA 4DWVA 1U3WA 4RF5A 1KVTA 2X9NA 1EVJA 4P4GA 4JQCA 4JBIA 1ZNQO 1BGVA 1A71A 1EBUA 4WCDA 1DHTA 3VC7A 4RZHA 2BLLA 4IDFA 4AG3A 4BNFA 2NADA 3G3EA 3Q11A 3TWOA 3W8FA 5EERA 1UDBA 3PIIA 1R4MA 5AXDA 5TGDA 4CMKA 4D3FA 4J0EA 1O9BA 1WDMA 4HADA 3LDHA 1UZNA 4XYBA 2YYYA 3FSRA 1PJQA 2ZCUA 1OC4A 1C1XA 1KEPA 1VL6A 3KYBA 3KYDB 2O48X 5THKA 4BB6A 5C7OO 4R68A 4BKRA 4U8GA 2Y1FA 4IUYA 4LCJA 2Y1OA 4U6QA 2DU8A 1Z7EA 4RQUA 3MWDB 4NQZA 1LQTA 3H65A 4TSKA 4RPLA 3KXDA 3ONFA 4EJ0A 5ITVA 5FEUA 3NTQA 5IXSA 3E9QA 1GEEA 3JQ9A 4CR6A 5KJFA 3TZHA 4BO9A 4E12A 3JYPA 1LSUA 2FSVA 3PVZA 4IGEA 4E2ZA 1T1RA 4AFNA 3I9LA 3RBZA 2OL4A 3SVTA 2HKIA 4ND4A 3WGTA 3JYQA 1JLLA 1QP8A 3QP9A 1GV1A 4DMMA 3DBHB 3K30A 1T25A 2IDZA 2HUNA 1LDBA 3C1AA 1IZ0A 4XZ3A 3E5MA 1YBMA 3JCZA 3OICA 2YFHA 4BKUA 1GV0A 4XRGA 1H93A 5KVVA 4YJFB 2Y66A 1IOLA 1G1AA 4U6SA 2NWQA 5F5LA 1DEHA 2PGDA 3M2TA 3A28A 1Y8QB 3ASVA 5KIAA 3QHAA 4PRKA 2X5OA 3F47A 2V6GA 3A1NA 4FFOA 4IDBA 5DULA 4YT5A 1YQGA 2X6TA 2VZ0A 4J16A 1GQ2A 5CDTA 2VOJA 3F4LA 4JJIA 4RVDA 1LEHA 5C37A 2W4QA 2Z1MA 3QV1A 4E3ZA 3GVIA 4G2NA 2JCXA 1DIHA 3I4FA 1UAGA 5U4QA 1R37A 3KB6A 4I08A 9LDBA 1DLIA 1P1IA 3CIFA 3GAZA 4PGFA 2G5CA 3WQRA 2Y0CA 4RGBA 3UF0A 4Z6KA 3DZIA 2O4CA 3GHHA 1GD1O 3L6OO 4GPD1 1XQ1A 3Q1LA 2D8AA 3UUWA 1NFRA 3L6EA 4PZCA 4EBFA 4D0SA 2GPTA 3K5PA 1B8PA 1T24A 3S1LA 2EP5A 1D4FA 2Y68A 3NDJA 3PXXA 2CNBA 4HUJA 5L4LA 1ISIA 4WPGA 5BNTA 3AM3A 2AQ8A 3WGOA 3RC1A 1FDWA 3ST7A 4II2A 3JD2A 3BXXA 1HE4A 1FF9A 3VPFA 2D3TA 2C0CA 4J4TA 1L7EA 5HA5A 1A27A 4Y6PA 4XCVA 2HCTA 2WM3A 1H9BA 1JN0A 2E6UX 5MGBA 1ONNA 1LX6A 1YO6A 4E32A 3LC1O 3OP4A 1BXGA 3DC2A 1EZ4A 1XYGA 1NWCA 3OF2A 3ZCXA 4AL4A 1RYDA 1V3VA 5EJ2A 4DTIA 3OIFA 1QR6A 4ZQEA 5IFLA 2GO1A 3GN1A 5JDIA 4O0LA 4GGPA 5B12A 3R1IA 1Y6JA 2D1YA 1G6KA 1HSZA 3CMMA 1ISJA 5AXBA 3C7CB 3P7MA 1E5QA 3BHIA 4KTTE 1NQTA 4Q3DA 1GYRA 5I9LA 3CZMA 3PQDA 4RF3A 4TVOA 5TS3A 2VWPA 2IZ0A 3DQPA 1HDYA 3EK2A 3IP3A 2B37A 2Q2QA 3RWBA 1H5QA 4KUGA 1ADFA 4I9NA 3PHHA 1D7OA 4Q3CA 1H9AA 4RZIA 5TC4A 1ID1A 2VYNA 5TT0A 1M75A 2G0TA 1A9YA 2ZKLA 3DAGA 4CM4B 3JQ6A 2I9PA 1MV8A 2VYND 3FNFA 1OFGA 3WG9A 1KEUA 1KVRA 3WS7A 3H5NA 3WOHA 3FNGA 1LDGA 1ZFNA 4IBOA 3WIEA 1P31A 3PZRA 3ROMA 4CMAA 1KBZA 3KYCB 1JA9A 1I36A 2V6FA 4XB1A 4E30A 3IDSA 1AXEA 4HY3A 2CUKA 1EUDA 1QV6A 1ZH8A 3AU9A 4P38A 5HS6A 2O3UA 4CM3A 5G0TA 2WE8A 4Y6SA 1HZZA 4IMPA 3V1YA 1K6IA 2X22A 4RF4A 6ADHA 4TZTA 1XU9A 9LDTA 1LC3A 1PGPA 3HWRA 5F5NA 1FJHA 3M1LA 4L75A 3WWYA 5JW6A 1IB6A 4LISA 3WTBA 1DAPA 3I6QA 4CMGA 1TT5B 2UV8A 3VDRA 3PWKA 1PIWA 5A04A 4PG6A 2CVQA 3N74A 4CMIB 4ND2A 1QORA 3HSKA 4E2XA 1JKJA 1PGQA 1R0KA 1OAAA 3S8MA 3PTZA 4XQGA 1RM4A 3HNPA 3IL2A 4X54A 1IPFA 2GGSA 1M2WA 5KVSA 3GPIA 3C85A 1UDAA 2AG8A 1V3TA 5DOVA 5BSGA 1D8AA 3D1LA 2VN8A 2X58A 2P2SA 3BA1A 3AI3A 4OSPA 3DEYX 4J43A 8ADHA 1LTHR 3GMDA 3O26A 1Q7CA 4LK3A 3WGIA 4E4YA 1ADBA 3ABIA 3MJCA 1MC4A 4NG5A 3RUIA 5IG2A 3JQBA 1ZMOA 2Y1GA 4DYDA 4AJ4A 3V8BA 5EPOA 4YAEA 3WLEA 2ZTLA 3HB5X 4BS9A 3U3XA 4M89A 4TROA 4KQXA 2HMWA 4BO1A 1NHGA 1DO8A 1Q0HA 1I2CA 1ZK4A 2B5WA 4MVJG 5LDHA 4DQXA 2IXBA 3H4VA 1NPTO 2BI7A 2P4HX 2YHIA 1NVTA 4RVGA 4NJOA 3NGLA 1HT0A 2X5JO 3NT5A 4H15A 3ROQA 4ONEA 2FR0A 4WOKA 2R2GA 4YACA 3T7CA 2PTGA 2DUWA 1UR5A 2EGGA 4FJ2A 3ZWBA 4IQ0A 4R01A 2CZCA 3HG7A 4FQ8A 2YQ4A 4YDRA 3C3XA 2NTJA 1H94A 3R3SA 2OP0A 4CLXA 1Q7GA 1EVZA 1YB5A 2AHRA 3ZW9A 1KVQA 1U4SA 3ITDA 4NI5A 3DZHA 2YY7A 3HB4X 4HFJA 3TFOA 3EVNA 7MDHA 4W6ZA 1PR9A 1UP4A 2NU6A 2PH5A 4J90A 2V65A 4NU6A 3UVEA 1P45A 3JD0A 3DTYA 1T2FA 3ADPA 3PYMA 5JLAA 1ZXLA 1VSUA 4DMLA 5CP8A 1B26A 5COQA 3MTGA 4NBWA 3ZV6A 3ZWNA 2UDPA 4DQUA 4TZKA 3RKUA 3UXYA 3PRJA 4QX6A 4A5OA 3DMTC 2C2YA 1C1XB 3K9QO 4M86A 4XRRA 3BIOA 3RBXA 1PR3A 1U2DA 4OHUA 2J6IA 2NVUB 3ROPA 5K6AC 1BVRA 1UZMA 1AHIA 1P3DA 4B4OA 3F5QA 2R6JA 4NBUA 3G0OA 3IUPA 4RF2A 1X14A 2NTVA 2OGUA 4GMGA 1PJTA 4LRTB 4Z9FA 3R3JA 1EE9A 3E48A 3ZV5A 3K96A 1GR0A 1KVUA 1BHSA 3LC2O 4AICA 4EUHA 3PDJA 1GZ3A 4YJHA 1Y81A 3ZWVA 3SC6A 3RU7A 1I33A 1I24A 1CWUA 3GGPA 1DAOA 4WJZA 5TLSA 1X0VA 4B8WA 4S1VA 1YGYA 4YQZA 3CZRA 3LLVA 3GT0A 1PU2A 3C1OA 1P77A 4JP2A 4LSMA 4RPGA 5H81A 2W2KA 4GKBA 4E5YA 3B70A 5L7TA 3E9MA 3RSHA 5DZSA 3INRA 3VH4A 4CODB 3U4IA 4B3IA 4XX0A 2IEDA 3K92A 4CQMA 4GQAA 4M54A 4UEKA 4DBZA 1FDUA 4U7WA 3DO5A 4GL4A 4L0QA 1PJLA 2BH9A 1BVUA 4IDEA 2HO5A 4L8VA 4CQMD 1J0XO 1ISMA 1OC2A 1WPQA 1C1DA 5ITWA 3BMNB 2X0RA 1XHLA 2VHYA 1Y5RA 5CPBA 4AJHA 3MJ4A 4WLUA 5C7LO 2ZATA 3AUSA 3WB9A 3EC7A 1N7GA 3LF1A 1C0IA 2VUUA 4CPDA 4DPLA 3TNLA 3A4VA 3VDQA 3MWEB 2GN9A 2V7PA 2EHDA 4ROSA 4OJNA 5JAQA 5CG1A 1Y9EA 4ZQGA 4JCOA 1HDGO
chains in the Genus database with same CATH superfamily
3B7PA 2JGDB 1QQAA 2OFOA 1ZIOA 4JCCA 1GZHB 1MB0A 4HMQA 4IFIA 1ZO8A 4XQCA 2ZUEA 2R87A 1ZH2A 1QK3A 2CZGA 2HZ7A 1DX6A 4LC0A 3D4IA 4KR7A 2QTMA 4CKWA 1OA0A 1U1IA 3NW9A 1JEYB 1C0EA 1NXQA 1X86B 3I4CA 3I01A 3HKBB 3Q8XB 5TE9A 4JI1B 4NTZA 4BVHA 4EFDA 1XMIA 5C51B 4C29A 1HE8B 4X60A 1NVUQ 4CTMA 3OZIA 1C3LA 4KQMA 5CA1B 1J1UA 3TRIA 5TT1A 4KWIA 1ACLA 1RAHA 3WKEA 2YBEA 3D8HA 5A06A 2JLVA 2EZ4A 1TCCA 2NM0A 1T8TA 5T8KC 1NBHA 1KJNA 3L84A 1XZBA 3UPTA 1TVKB 1C7JA 2QN6A 5GM2A 1ZJWA 1GAEO 1PQWA 1T5OA 4TKVA 3I39X 2JGIA 3TRHA 1NBME 5ALNA 4JYBA 1OZFA 1F8FA 3KD3A 4DARA 2WNHA 2JA2A 3LOQA 1KU0A 1R0SA 4Y30A 1Y8RB 4MMZB 5KWIA 2AV6A 4J0GA 1Z34A 4JUIA 1TU3A 2CNWA 4AO6A 3L6BA 5CFZA 1XLUA 4NV0A 4TX1A 1E9DA 4E2WA 2JK1A 4YAGA 4CDGA 1TJPB 1RHQA 4HYQA 1DC8A 3IKVA 4A6DA 4ZYVA 1YRWA 2YZ7A 4CM8A 4K9QA 1DJNA 2WBLC 2JBAB 1Y7TA 3RJ5A 1ZD2P 2B25A 1L4BA 1SXJD 1W87A 2B30A 1N8KA 2YMQA 4L3OA 3ZU2A 1PNVA 3X1XA 5DNCA 3GLTA 4DTCA 3F6YA 1XKLA 3I2GA 4NENA 1N6IA 2HXGA 4ZCRA 4ABTA 5FFNA 5CRIA 1FNDA 3CH5A 2E2WA 3PGJA 4C0WA 1ZGHA 2XCSB 2JH8A 3BYZA 3QXJA 4OAQA 4TM7A 3M3HA 3KUXA 1OILA 1Y9AA 3IPAA 2GTHA 4JEMA 2PTHA 2VKTA 3G9QA 1K66A 5DM60 2OD9A 3HABA 4MUXA 3E05A 3IOBA 3WK8A 1Q2XA 3EARA 4R1PA 5B3JC 3IV7A 2Q8QA 1MR3F 4R31A 4Z99A 3TEMA 1CIPA 3HBAA 3PNQA 2Z6QA 4D5EA 1LW6E 1TMGE 3DTVB 2UZ3A 3QVUA 4U2EA 5KSOA 4U2FA 2XB2A 2XNHA 2XF2A 2I3BA 2I6TA 2YFYA 1WAMA 2V7TA 2OCBA 1F48A 4US1R 1IUNA 5DB4A 3E4DA 1PRYA 3DOFA 3LP6A 2R8PA 2GM9A 3MRSA 1E1KA 1VE5A 3PGVA 3QUQA 4I5GA 10MHA 2O4UX 1BEZA 1XP5A 1EJ0A 4Z9XA 3UOAB 4GOJA 4CU5A 2FLWA 4M76B 4BO0A 3WA6A 1J2JA 4WERA 4WECA 1EM8B 4MYSA 4MKRA 1ZMTA 3QSGA 3AYZB 4GPAA 4ZMSA 1LW7A 1N0IA 4ZJUA 1CY7A 4KDRA 2YWDA 4OUDB 1W581 1VG8A 1Q7RA 2CBXA 3OKFA 4NFSA 4CHTA 2PL5A 1BAPA 5EMKA 2AXNA 2JFUA 2P5UA 5BW8A 3OUTA 1GSHA 1YE3A 5HYVA 2DY1A 7YASA 2PUJA 5D5QA 4PEVA 1K7CA 1YMUA 4ZD6A 5ELLA 3ZX5A 1PK7A 1NQ5A 2HBYA 3CLTD 5FBRB 5ICMA 1XNRB 1PFKA 2ZBGA 3VRHA 5K6TA 1SOWA 1H2EA 1GL9B 4I14A 2QRQA 4ZEOA 5GQSA 5J4YA 1NDQA 1WW2A 3D8UA 3WLSA 2F55A 5DT2A 2IHVA 1DKPA 3HFGA 1RJ9B 1K4KA 4OREX 3D02A 4RA6B 1W5TA 4F9TA 1NF8A 1O2DA 3P52A 4MVCA 1XDSA 3G0IA 1C30A 1Z7GA 3CF4G 3DA8A 3VNBA 4BUJA 4F11A 1E79A 4W5TA 4BFWA 3HCOA 2AR9A 3L4BA 1Y7HA 4G1MB 1HFJA 4RADA 5HG0A 4RSMA 2XXAA 3S1AB 1IB0A 3D0QA 1CQXA 1NOIA 3V1LA 3P4UA 5CVTA 4F4HA 1UBLS 2ZI7A 3ZDAA 5COBA 4ZTZB 2NO4A 1E62A 1PJ4A 2IWHA 3DBIA 2R65A 4JUFA 2PUGA 2DBQA 1BHO1 2G80A 3LKVA 5BQ5A 2WUWE 4A8HA 1H2YA 2A4MA 1KNQA 4YMWA 3QHQA 4KU4A 4E31A 2XB8A 3SZMA 1ZUWA 2Y4OA 3GDGA 3M4YA 4K6FA 4CQLB 5H82A 2BGNA 4Q6BA 1YJAA 4UDXX 1NW5A 4C30A 1PUJA 3ZWWA 3VPXA 3HUFA 1AXGA 1JF8A 4YRNA 4JXKA 2P2CA 3IIKA 4ARIA 1GSOA 2OBLA 3DHVA 3E9ZA 3JZMA 5KYWA 3CPHA 2FWRA 4W8GA 5A0FA 3OO1A 5FA6A 2WW8A 4U7TB 3H8JA 2P79A 1CJMA 3EDQA 1U90A 5KYYB 1ETUA 1A4XA 1NBIA 2K7ZA 2JD2A 2R8YA 3B6ZA 4G41A 4G4IA 3ZTYA 3ROEA 4R1QA 4DM4A 1KYTA 2YNMD 4R2JA 5EE3A 5B58T 1NXOA 2Z6UA 4DY4A 2ZANA 5BV8A 1K89A 4ZZ2A 5TPWB 4N5DA 4D8YA 1GN8A 3I2YX 2WKQA 2E4AA 4AJEA 1T13A 1T5SA 4P7GA 3IQWA 5JI3E 1JZTA 2DC1A 2VPPA 1LLDA 2PH3A 4Q3BA 5DISB 1SRRA 1W5SA 3DXYA 3LT1A 2D4AA 1G8PA 4LW8A 5EL0A 4BO4A 4UOZA 4ZDIA 3U7HB 3K05A 4DOMA 3NOQA 5C1IA 1GQQA 2C59A 4M9UA 3OLQA 1C0KA 3R7LA 3INYA 2JBHA 5EIFA 4JT4A 3O03A 1NE2A 3P9SA 3HBMA 5TARA 4KFRA 1JAYA 2WRZA 3K73O 3AU8A 5JJBA 1POWA 2D1FA 2SCUA 5B7PA 3BTOA 3JAKA 5EKXA 2PD6A 4YJ2B 3HCDA 4LPKA 4XWYA 1AXRA 2DTDA 3DR5A 4FT2A 4KBGA 1TF7A 2VYCA 2ECOA 4KKVA 4KXLA 3ABRB 4MYTA 4X90A 1KI6A 3ZKAA 4E51A 1SIOA 2YWXA 3UMRA 1QTNA 4YMGA 4M1SA 2EKLA 4RULA 3AK4A 4D3SA 1K8RA 3PTLA 4HDKB 2A94A 4EHDA 2JKVA 4XDGA 2GJSA 2P0EA 1FSFA 5DTIA 3JWPA 5A5EA 3OOYA 4ES6A 1TTTA 1EK1A 2OBFA 3ND9A 4UEQA 2XBUA 1W88A 3LTEA 2XY4A 4J94A 1P1CA 5IJXA 1KKUA 3TSZA 1K6XA 2Q46A 4MEBA 3GBPA 4P82A 2DWQA 4ZOLA 4FMDB 7ADHA 3JX9A 1TAGA 5BV0A 3V1KA 4UTXA 3RQIA 3V8RA 2X4GA 3NYRA 3OQ1A 4M7PA 3RJZA 1A76A 1IUKA 4F8YA 1G21E 4MB6A 3IE1A 1BMFA 4CMCA 3AR2A 4AJNA 5DMXA 1Q12A 4XIIA 1NP3A 2XDWA 3FNIA 4JU8A 2V55B 3OM1A 1WBBA 4W1QA 3IEXA 5EJ6A 3TUJC 2HI0A 5JV5A 1QHXA 2LDXA 2VRWA 4PSUA 2GB4A 4RVFA 1X13A 3N76A 5JNRA 2QRGA 1E7SA 2Q5CA 1UJNA 2VF5X 1DWUA 4FLEA 4JLPA 1CZUA 2JHAA 2ISSD 1P91A 3G0GA 4ZXFA 4OO3A 5B37A 4A9AA 3DBOB 5TEWA 1JQ3A 4JY7A 4OKSA 1GLGA 1G1MA 2EZTA 2KLBA 1RRFA 3KBOA 2HK7A 2HLNA 3MIZA 4J0CA 5FTJA 1CQWA 1M6WA 3TW0A 4F60A 1RQ7A 2QLLA 2E82A 2FF5A 2V59A 2D06A 3B9BA 3PEVA 1DZ3A 1SR8A 3LQRA 2JI4A 1P0PA 2HHCA 1GKKA 4Z49A 1ZRNA 5IH3A 4LZLA 3TLCA 2P3OA 1BE0A 3N5KA 2JC3A 4Y98A 2C2OA 3FWPA 5EJMA 1UJCA 3OJXA 1WXWA 2JFYA 5IAGA 4EABA 3C8DA 1U5CA 3K9FC 4PLHA 2BJWA 2XUOA 5CA1F 5CJPA 1TKCA 6ABPA 3OQPA 4B79A 3HYSA 5K8CA 5IF9A 3HEMA 1C9DB 3FTCA 4XDYA 3AY6A 4YALA 5HZHA 1TKAA 3BJEA 3KM0A 3D4NA 3L93A 5IJAA 1PLKA 3I64A 2E3JA 1I10A 1Z08A 5EXEA 3TKLA 1M33A 2PD3A 2QX7A 1Q1BA 1KAGA 2PH7A 4XCQA 4L73A 2QTVA 3E6AA 2UZAA 2JHGA 1C4WA 3JWIA 3LECA 1G6Q1 2FWPA 2I99A 2FEWB 2R68A 4NBKA 1K7SN 2X5XA 4TL7A 3M3DA 5BRAA 3WAGA 2P8JA 1PJBA 2AJLI 4F2DA 1YB1A 4CKWB 4BLOA 2IHTA 3NBAA 5AKXA 3O90A 4GBED 3C6QA 2H00A 2XCOA 4Y6LA 1RYBA 2OV3A 4YP1A 2V5AA 3HP7A 3WV4A 4C7BA 1VPWA 4EGQA 3ND6A 1H9CA 4HWPA 5DI9A 4NH0A 4ALMA 4RK6A 3PX3A 1WUTA 3GU3A 3HDTA 1G8JA 4TLBA 5JDCA 3R7FA 3HYCA 5JNSA 4YMIA 1TTPB 3DTTA 1Z06A 1QPZA 1GNPA 3PJDA 3RJMA 3WL4A 1Q0QA 4DCUA 2XQGA 3VBEA 2FNAA 1MAVA 1XHFA 1HOXA 4HGOA 5ALYA 4IX1A 1N2BA 1YZHA 3AHJA 2I2AA 3NZEA 3D3KA 2IYTA 2CMFA 2PL3A 3U7EB 5HHTA 3WLHA 4XM2A 3U7IA 4A10A 1ZCJA 4LVNA 3W9BA 3T0IA 1M8JA 3M5CA 4DUGA 3DDZX 4IV5A 1JG4A 2Q6TA 2ANCA 4W4TA 4CM7A 5ENVA 1FZTA 2QMYA 2NVOA 1D0SA 1QLWA 3G9ZA 1ZK3A 4RVNA 4L95C 3VH3A 1MN6A 3H99A 3HCNA 5LQSA 2QT1A 1E1YA 2BUAA 2RJNA 4CM8B 3IURA 3Q3VA 1FQKA 4GPTA 1GU1A 3UUEA 3NORA 2Z8YM 1ZW1A 1MH9A 2Y1KA 3UGQA 4ENRA 2WWWA 5L7YA 2Q1SA 4EKDA 3G1UA 2PKQO 2A1TR 4FFRA 1U2RA 3ORFA 4MJXA 3K53A 1LNQA 4PR0A 2FR8A 3AUFA 1NV9A 1G21A 2BHLA 2DFTA 1HC7A 4FNAA 1KO7A 5K3EA 4UQOA 1VPEA 1S89A 2QSJA 2B8EA 1K6EA 1Q16A 4FYMA 4B48A 2SKEA 3MWJA 3WBFA 1AU9A 3EIHA 3SSOA 4KWEA 3URMA 3WWCA 1A50B 4RD1A 4ZOQI 2MIIA 1K27A 2QU7A 2HA0A 4LE2A 4RMHA 1YGPA 4YUVA 4N5MA 2ODWA 4RPCA 3M6MD 5IC5A 5B6IA 1GZ7A 2FPMA 4E7PA 1NSTA 4HVCA 5AW1A 2P6MA 4O2LA 2GEBA 2O1SA 2WKPA 3KOMA 3SZOA 3ZD8A 5ARCA 4CLOA 2I9KA 1N4AA 3CXUA 4MI1A 2F3PA 3FI9A 3TYXA 1A7UA 1W1UA 3OEHA 3W2TA 5F2NA 5JDIC 4G0VA 3DXZA 3RRMA 1W6RA 4C6HA 4YCMA 2PMDA 3CLSD 2CMDA 3AY7A 4WKCA 4YTEA 5AW3A 3DDUA 4EWLA 3LF2A 2C7OA 1IFXA 5T64A 3U40A 1HNWB 1FRZA 3T94A 1NI4A 2P9GA 3T9CA 3BFKA 1NKTA 3LS2A 3VZQA 5CURA 3HWSA 4FW8A 3O1IC 2WTUA 1P29A 3DHYA 4E21A 4HUTA 3IIJA 4H1UA 4Q48A 4G1BA 1WO8A 1T8PA 4BCDA 2J9ZB 2F8SA 2DERA 1U7UA 2N3ZA 2DPGA 2HK9A 1NXWA 2BZGA 4NNJA 1J9GA 3N58A 2Z95A 3OURA 1KEZA 4UULA 5EVJA 2OLKA 3SBOA 4MI9A 2Z3ZA 5DLPA 5AT1A 4YMHA 2XOKA 3WGVA 1Y9ZA 2ST1A 1P4GA 1WZCA 4NHEA 4W1RA 4HNRA 2DM6A 1YHZA 2ZKIA 4DM7A 1PR4A 2B2XA 2YMMA 4I5FA 1KOGA 4G23A 4ND3A 1NNI1 2NQ8A 4HEHA 1QCZA 4WY8A 1XP8A 3ZY5A 1KEKA 1ZOPA 1EX6A 1E5DA 2BFPA 2HMTA 2XKAA 2B92A 1QZ3A 2ZOSA 3BF7A 3G1WA 5BXYA 3PFGA 1E1CA 2MSDB 5L6LB 2QD1A 1M6VB 5ALWA 3ZE7A 2O3SA 4BB5A 1G17A 2ZWIA 4G5HA 2J31A 4DMGA 4IDQA 2FXIA 1L7MA 4D0NA 2JCSA 2ZDQA 4JB0A 1Y8ZA 1WZ2A 4GDMA 5FOWA 2C3UA 3T9AA 4N6OA 1RYFA 1BS2A 1OU4A 3OE1A 3TQQA 4EGSA 3CTMA 1BOOA 1HE5A 2GTIA 3BHMA 2P65A 4H35A 5LYJB 4A0FA 4F9EA 1IQ0A 2ZYRA 5ISMA 1UBMS 2EW8A 1NJ6A 1KK2A 3RH0A 4ZMBA 1TLTA 2VYVD 1X15A 5CNJA 3R7NA 2YY6A 1B1CA 1MAAA 2O2SA 1PEDA 4B3GA 4QRHA 2DHQA 2XI4A 4EQ6A 2NP7A 3S8EA 1WMAA 4HVAA 5T6BA 3O8QA 2XE6A 3EODA 1NJSA 3EZYA 4UQLA 2HBRA 3JR3A 2D00A 3DPIA 4XWTA 4D6PA 1JAHA 1XN1A 3L0OA 5JCZA 3ZJUA 4URUR 4L4ZA 1GNRA 3ASUA 1M2HA 4B2YA 2W48A 3ZDQA 4HDMA 1N1EA 4DCNA 4KUHA 2B5VA 1BSVA 1XD8A 3NAQA 1YR6A 2HJ9A 3ZWXA 2YVQA 4QHTA 4ACBA 4YJ2F 2CJYA 3GD7A 2FWAA 3P9KA 3I62A 3OPYB 5MHTA 4C87A 1KZGB 3L40A 3LHFA 3R20A 1EXMA 2BT4A 2FRXA 4R8KA 1ADGA 4ZCPA 3SX2A 1QYVA 4WE3A 1NVVQ 2JGMA 1YS6A 4X44A 1R4MB 2DULA 1WCXA 4TRRA 4MR9B 3JYHA 4OFZA 4R2LA 3N53A 5L51A 2C4UA 3BOSA 5IAEA 4J1QA 3TIIA 2ZYAA 1VPVA 1PTJA 1TMYA 4FMDF 3ZBQA 4FM9A 3V97A 3VPAA 4IZHA 1SEVA 1DS6A 5D00A 3RAEC 4HPJB 1P2UA 5EJEA 2ZRFA 3JAKB 2YV1A 1GRQA 3CX4A 3Q9LA 4PF1A 2PZLA 4P32A 1MQ8B 5DVZA 1EA5A 1IZ9A 1KI6B 1W5BA 4HWKA 3K9GA 4X84A 3IP6A 1S8FA 4HFMA 4RAQA 4GXRA 1GXSB 4GOLD 4FSXA 4ZCSA 1P3Y1 4Y2PA 3DAYA 3G13A 1RCUA 5A4KA 1IBKB 4AY2A 1WDTA 4A26A 4E08A 3VTAA 3CX8A 2BMVA 2OCXA 1LK0A 1UJ6A 2VQ3A 1YQTA 2YFQA 1RPTA 1DC7A 3PWTA 2XT6A 4W6QA 3E3LA 1FW6A 3WYFA 1UWVA 1P0IA 4RCZA 3TPCA 2QF7A 4NNPA 8MHTA 3LI2A 4QARA 3F7OA 1Z5UA 3KQYA 5LQDA 4KB5A 4LWQA 4DNXA 1JFRA 5AOAA 1HM5A 4AN1A 2XUKA 5JFGA 4UBOA 1VA4A 2F64A 2V0NA 2EFHB 3B6KA 3BL6A 5D3ZA 1QRRA 5A2QA 1W7AA 2QXUA 1Q3TA 1QP4A 3WL7A 5I4KA 3BTVA 4IY1A 5FT9A 2ATVA 5L6MB 2OG2A 5CHEA 1UXKA 2HMUA 4U5QA 3RUDA 2IYOA 1W34A 1JXOA 3WRYA 4NDNE 1AO0A 1X94A 1Z2DA 3IXMA 3LA8A 4N0PA 4KREA 3TUIC 3ZU3A 3C87A 3UATA 2B7LA 4E6PA 2J9FA 3FHOA 2QM7A 4EHBA 4K9RA 2HJHA 1UDRA 3LU1A 4JGBA 4DV2B 3IDAA 4M53A 2XYHA 4A0GA 5HQ3A 3OCZA 2FMUA 3TEJA 1KO8A 1Y37A 4PAOA 4BKOA 3B1FA 1AGNA 4B87A 4I1YA 2KX7A 3V4ZA 1Q17A 4ITUA 4CKEA 3LZDA 2XMDA 4Y0AA 4RQAA 4YRDA 4JBNA 2WTAA 4Z1MA 1QK5A 3EY4A 2OXFA 4KR2A 3PDHA 1SEPA 2BBOA 3HR4A 5EIBC 3UT6A 4AJPA 4DW8A 2A9RA 1RIIA 3H11A 2EKBA 3W6NA 1PT8A 5B1YA 5F2OA 1DKLA 3PRKE 3SXUA 4DDTA 4IP0A 3AJAA 4NX2A 4CV3A 3FHTA 3D1JA 3GCZA 1QE3A 3M0EA 2AT1A 3QJGA 4IOLA 5AH0A 3ZE2B 1FFXA 4N5IX 3UW3A 1VJ5A 1M34E 2FMFA 2BM1A 4MHOA 1CZRA 4RLFA 5T8KA 1DAKA 4FD3A 4EHJA 4IDDA 4F2PA 4FBGA 1WQ1R 5AESA 2JI6A 1M5UA 2ODNA 4YVFA 4YB8A 4IYRA 4QUEA 4U1RA 3KSBC 2QTVB 1UF9A 3EAQA 3IT3A 1OWOA 3KHUA 4U7GA 3U81A 4CL2A 4DLAA 1J0BA 5J1SB 1PQUA 1JKIA 4DLZA 1WOYA 3K8ZA 2CE7A 3WSWA 1Z0AA 3DCNA 3CRNA 4RKEA 2ZSAA 1HQDA 4M1MA 4UHKA 1Z5GA 4MA4A 3M4XA 4D4JA 1V1RA 1JG3A 1J7KA 2V7UA 4BMNA 4G89A 3S70A 1XRJA 2VP2A 2Y93A 4JH0A 4KAJA 1EK0A 1G5HA 3DFFA 3SN6A 2IS6A 1G42A 3AKZA 1NSFA 3TKYA 3E7DA 3NP9A 1K5HA 1BXGB 3DMFA 4Z0TA 4A4DA 5B2FA 3LVFO 3JYNA 3LDAA 1U5BB 4PZZA 3HFRA 1GKYA 4CTOA 4TUYB 2F59A 3OU6A 4ER0A 1FUKA 2O1XA 2OHFA 3NBFA 3IUNA 4EUKA 4LI0A 3IT2A 4H7PA 1I4WA 3TNJA 1Z0KA 2VQ6A 3EH1A 3SHOA 5K09A 1PNRA 3W34A 3SF8A 3DL0A 1FFGA 4KO1S 5B3JA 3THYA 1JFFB 1DIGA 3GHYA 3DHWC 3CZCA 1RSZA 4I1UA 1HR0B 1XZMA 1WM1A 4OLHA 4YT4A 3IXQA 3VR5D 1Z37A 4BJ3A 1JQDA 3PF8A 4ITRC 4P84A 1SU6A 3ZC3A 2OZLA 2QHXA 4XAQA 4GW3A 1MG5A 1ZKMA 3OX4A 3KEQA 2P9ZA 4IHAA 4TLAA 1PZNA 4J3NA 3JASA 3O2QB 5EKUA 3B1XA 3BK7A 3IVRA 5FOUA 4E5MA 3C5CA 5HQTA 4HXEB 3OQMA 4DUYB 4WAUA 1EZZA 1G21B 4A36A 3UO8B 1DE0A 1KU6A 2HOQA 2DWOA 2V6IA 1D6JA 2VDQB 3HC7A 5IVPA 1XAIA 3B2NA 2VEDA 1ZJYA 1O5TA 3S2IA 1U3UA 4FNMA 5E1MA 1XNJA 2ZLBA 2PK3A 4YP0A 3JD1A 3AVOA 3IIIA 5FB3A 1NZFA 3CF2A 3OC0A 2X5NA 1GKIA 6CHYA 3O83A 4BCBA 3L7AA 4G3XA 4N7JA 4QOIA 3SX4A 1J24A 1KSFX 1LSSA 4P2BA 1J25A 4IIYA 1NKSA 2O7RA 1ID8A 1KDVA 3SMQA 4O4HA 1VHDA 2AJDA 1DELA 2VYQA 3T8YA 1L8OA 4NLLA 3BMCA 5BNIA 5ELXA 1QE5A 5F51A 1NI4B 4ILKA 2QL6A 2PN1A 4NU5A 3L4EA 1CPYA 1FRFS 3O4VA 5ER6A 5CBPB 1IJEA 2JJ1A 1DMSA 3OCCA 1Z6ZA 2OHOA 2Y27A 1O08A 1WOMA 5JEEA 3H2IA 1TPYA 3I01M 4Q3EA 2ZE6A 3TD6A 1VB5A 4XYMA 1YU6A 3TR5A 1JTVA 3ROFA 2EG5A 4I4TA 4PG8A 2G1PA 5JECA 3EVFA 2VZ8A 3GJ3A 3IQDB 5ETJA 4RH1A 1R0ZA 3P9QA 3WRXC 4EJ6A 1NUTA 1ZGCA 1RI2A 8LDHA 4OHPA 3BMOA 2WP8J 5B3KA 1U0BB 2IJGX 3D7LA 2PH1A 1M34A 2TRSB 1FIUA 4OCZA 5KOHA 3TXAA 3DDNA 4GOXA 5CXUA 5LYJF 3VHXA 4XR4A 4BQOA 4DLBA 5E9JA 8GPBA 1L4KA 1JI3A 2XE4A 3AXTA 3E7PA 4UHEA 1B2LA 2VSYA 5JBIA 1IUOA 4FE3A 1KAEA 1N3BA 3O9MA 3HN2A 2I2BA 3ELYA 3PNOA 5CFQA 4YYEA 3R3ZA 2PXCA 3GGGA 2FPRA 3L6RA 4CFZA 2FDRA 3U5ZB 1WNFA 1P81A 1E1NA 5A4JA 2V0GA 1G5PA 1OZHA 2XYQA 1QG2A 2Z1DA 2AG1A 2ZYUX 3RIHA 4D0GA 1N5IA 3WICA 2R79A 4TXNA 2ZE8A 4P4UA 4OFXA 2C3MA 3HFSA 5NULA 4A73A 1QHGA 4OB7A 4AQDA 4BBJA 3OZGA 1ST3A 2IDKA 3EUWA 4V24A 5E2IA 3WK7A 5DHPA 3GYGA 5M3BA 1QC5B 2GZMA 3NTXA 3GK3A 3HZZA 5BOVA 3RIXA 2MYNA 1VKNA 4TMKA 5LM3A 3OECA 3ETJA 3I5AA 3ONEA 1YJCA 3PPXA 3AF5A 3IPRA 2IOYA 3V8MA 4CM1A 3KTAA 1T5DX 2HUPA 4P92A 4AN4A 2JEOA 2W6NA 1KIMA 4C7JA 2GAOA 1KERA 1LVHA 2QYSA 4NOJA 5FWXA 1LBEA 3WWDA 5JSYA 5JRJA 3VR3D 4XQ9A 3VI3B 1IAQA 3TE6A 5AI9A 4JOCA 2DY0A 4P83A 1XTJA 4Y7CA 3O8QB 1SUWA 1GCGA 4LJSA 1R8SA 1SXGA 2GETA 1EDOA 1GZDA 4WL0A 2Y6UA 4HZGA 4BV8A 3BXGA 2IWRA 4BO2A 4ESOA 2PLRA 1B23P 5DBFA 1VRVA 3DV0A 1IL0A 3EDYA 3AI1A 4IRMA 4KXWA 4TTVA 1E4YA 4HDMB 4MVJP 1ZXXA 4KNWA 3BJRA 2MSCB 3VPHA 3BMQA 4AP6A 2ICAA 4HJXA 5KYKA 1Q0LA 1S1CA 5LMCA 1U5AA 1Z07A 1YZNA 3ND7A 4C5AA 1R6TA 3IA2A 1RIFA 4LYEA 4HC4A 4IFEA 1FDVA 2QLMA 5D5PA 3UMFA 3SQDA 1D2CA 4KQ9A 4TWRA 4XEHA 1ZCAA 2WVAA 2E18A 3IQFA 4JASB 3OY2A 1VBFA 3O4FA 3ZCQA 5ED4A 1MX5A 1P39A 5TF0A 1ISSA 1OY1A 2CXSA 4QO8A 1NY5A 2CHUA 3PLNA 1HKUA 1BTOA 1UKCA 2FSUA 4BO6A 4D4MA 4UCWA 2P9TA 4DADA 2IBSA 2PL9A 5AW6A 4ZQHA 3VHLB 1U1CA 2XA2A 3OX2A 1I8TA 1Z6QA 4BVLA 1NPYA 4A7PA 1MTOA 2PRJA 1MA0A 3L82B 3TLMA 4Y6OA 1CD5A 1KDTA 4WY2A 1JBEA 3LYUA 3LCUA 1EFUA 1PWZA 5AKKA 3AUKA 1LTQA 4AKEA 2R7AA 5F3RA 5CT6A 2QL9A 4II7A 4UUAA 3U9TA 2CXRA 3V4SA 1KI8A 3G2LA 4CFSA 2ZYDA 3CB4A 1RHMA 1V25A 3D6JA 3M1AA 5DTJA 1N57A 4CMJA 1ZRHA 3GQBA 2AI1A 2XMSA 2JD0A 3HGTA 4MV8A 4QSHA 3RYIA 4BWVA 1NVWQ 1WKBA 4FR2A 4DZTA 5D51S 1Z75A 4MS4A 1RWKA 1N8SA 4KAAA 3EGEA 5FNVA 4ZJZA 3ER9A 2E1PA 2Z8XA 1W48A 3K4PA 4ZVUA 2JAPA 5A1TA 1OFVA 4IVPA 4N8DA 5IAAA 3RQSA 4FN5A 3VQTA 2WF5A 3LQ2A 4K9OA 4HHEA 4TXMA 2Y0BA 5L3QA 4B32A 4N6GA 3P9ZA 3I1IA 1WKCA 1V6CA 4AG6A 3EUEA 3N8DA 1MOQA 1OAKA 3MD0A 4AG5A 4NBRA 1PI3A 2WHPA 3T12A 1YUMA 1N36B 3BTSA 1PF7E 1V7PC 3A25A 4FUTA 4O6VA 1E6UA 4Y6RA 5CJ2A 3CNNA 2W8BB 1YBHA 3UANA 1POXA 3FDZA 4GM4A 1I32A 1VJRA 2JAQA 1KY5A 4PC7A 3ZH2A 5L4NA 2J9FB 4RJTA 2CXNA 1AB5A 2XB4A 4G4SP 4BQEA 2QVCA 3E3OA 2ZUWA 5CX1A 1GL7A 1I5RA 1JSZA 1Z4MA 3EIWA 1QH0A 5AM2A 4A6XA 2BFDA 5IZ4A 2WQZA 1I3MA 3IJ5A 2DPXA 2ZIZA 2X2PA 5H1YA 1ULUA 4XOUA 5D84A 1RHKA 1XO1A 5CTJA 3R7WB 3TL2A 2QRLA 4Q9AA 4EELA 4ZT6A 2YHSA 5EKDA 1F8UA 1XZQA 4H1WA 1EPUA 2ZRLA 2XGMA 1OI2A 4LXTA 3GH3A 4CM6A 1GPH1 2P9FA 3H11B 3Q7TA 1VHWA 2VF7A 5DGCA 5ITSA 5M29A 3GJYA 4L28A 5CX4A 5BN3B 2QUAA 1USGA 2QR2A 2JZNA 2YS6A 3D7MA 4WKPA 3SXUB 4HS4A 1C2TA 4WK6A 4OA5A 3WI7A 4CKYA 5CB8A 4W9MC 3GLGE 1AS3A 2PCLA 3KB2A 4WXPA 3ZDBA 4FQ7A 2BFOA 3WLFA 3WMFA 3HQ4O 4PX9A 4DLSA 3RUCA 1FFXB 2VQEB 3H9GA 1M9NA 3TECE 1IWOA 3FOZA 2W6JD 2HLDD 4AIIA 4JQOA 1WU7A 4XLLA 5CJJA 3IDZA 2J3EA 3DVAA 1AUVA 4TUYF 5FV7A 2E4ZA 1ZEJA 2P67A 5KNCA 4DR1B 4LHEA 5HBRA 3Q8KA 3N0RA 5KI6A 1NJ8A 5DCUA 3TLYA 1IXZA 1P5ZB 3O2NA 5A7GA 4CIBA 5AJUA 1CR6A 1S9DA 2D1QA 1T6NA 2JF0A 1E8NA 3QEJA 3R5FA 4QWMA 4RFSA 1PGNA 2QX8A 1ARZA 3Q7IA 1S2LA 4I5IA 1JLHA 2O8EB 4WZAB 2O8FB 1NC1A 2YJGA 4I0WB 4FS3A 4RCVA 3RUFA 3NV7A 4KL8S 4YMVA 5K0SA 2J41A 3D0OA 2Q2VA 2UYCA 5P21A 2CF6A 5SYNA 1S2NA 3L41A 3LHIA 4ID9A 1U28A 5JMPA 4HFNA 5JS2A 2PO7A 3BN3A 5BPHA 1C0PA 1IIBA 1YQUA 1PT6A 4L3VA 1MEJA 4OGGA 4TN5A 4TSFD 4TT8A 4XB2A 1PVDA 3JW8A 1X8XA 4YQFA 2R1VA 4QFDA 2BBSA 5C7IO 2AKYA 2IT1A 5MDHA 1VCMA 2VF8A 1AQUA 2C1ZA 4HL6A 3FMPB 2XHEA 2O3TA 3U13A 5L4SA 1E9FA 3CLUD 3EF1A 3R3WA 1P1JA 2ZTSA 4ZYXA 4XQEA 1EVYA 4MRSA 1F60A 1FVFA 1U6JA 3Q7QA 5FHRA 4Y67A 4HNUA 3G7UA 1VM6A 3O3OB 2OOSA 3SQXA 1UMCA 2HQOA 3PS9A 1DTSA 3KSZO 3KB1A 4W7IA 1OFUX 1WW8A 5A2GA 3TUZC 3X2FA 3KAKA 2GA8A 4RL6A 2K87A 1J42A 3W3AA 3O21A 4F1KA 4F86A 4PZ9A 2R25B 4UUPA 3GLUA 5LBTA 1FNBA 2PEYA 4FFNA 1E2GA 3GOQA 4HDSB 2W6ZA 4Q3LA 5H4HA 4NULA 1QKIA 3BSYA 1PGOA 3MLBA 5F7ZA 3E1GA 4Q5IA 2PMBA 1QANA 4XJSA 2O3QA 3BULA 3TNYA 5CEFA 3D6TB 5KJCA 1FMFA 4JA2A 3GBVA 4MQBA 5CTAA 4YI5A 5ESDA 3LT0A 3DE0X 1D8TA 1JMVA 2XE8A 4FFDA 3JD4A 3U7QA 3PGMA 3VR4D 4NZ9A 1L6IA 4FYYA 4YA6A 4QGBA 3ZGNA 3ZQ6A 1P9LA 4PQYA 4JJAA 3P9XA 1M2JA 3KJZA 3K09C 4N8SA 4F72A 3NR2A 5AM3A 4O33A 4R6WA 2Z6AA 3WDLA 2B4KA 2FR1A 3FKJA 4KBFA 1YFJA 3DEJA 4MRNA 1QIJA 4RKYA 3B3GA 3U1BA 3ONDA 3PL1A 2OAGA 1H0KA 3BMCB 2OTCA 2AGVA 3KEFA 3K15A 1WBJB 3AEQA 1AT1A 3H2HA 3ICPA 4FT4A 2ZIVB 4FZ5A 1JKFA 2PMFA 3KEMA 4YXFA 3TFQA 5JSUA 1NF9A 3FX2A 3Q40A 3VU9A 1XWWA 3VPSA 2IELA 5CITA 1C8BA 3DHNA 3GVCA 5J2UA 3E1KA 2A9PA 4MV3A 5IW8A 2QOEA 3E5NA 4I4TB 3TINA 1JI0A 3M9LA 3GLGA 1L7OA 3HJAA 1O57A 3ZGLA 3DTVD 1ZMRA 2PR7A 1K0FA 3TE7A 1OYWA 3FMOB 4Z8XA 4WOCA 4DCGA 3NDBB 3JVDA 3BMOB 4L72A 3SC4A 2ATEA 4Q1EA 1M34B 3EWSA 3MILA 1XRNA 4BMZA 1LI4A 5KOHB 4Z8YA 1NJGA 5ALOA 1P2GA 3GP8A 1G20A 2C61A 3DD1A 3VHXB 4UNRA 1B8UA 2GN1A 2DFVA 2GSDA 1X3LA 4OXKA 4Q3AA 4P7FA 2OHVA 2YC2C 3OFKA 4I36A 4TQGA 2O2DA 1NRIA 1RJEA 3BTUA 3G23A 4QJ5A 1N2ZA 4Z51A 3K2IA 1NC3A 1JAIA 5AICA 5E6SA 5FUQA 2RH9B 3UMYA 2EVWX 3LGXA 2I1LA 4F12A 1K3FA 1BWSA 1CS4C 1Z4OA 4R7GA 4ZMRA 2VZLA 1JSXA 2JLAA 3DE1X 4QBGB 3ASZA 5EQDA 2UUCB 2DZDA 1XZEA 2XDQB 5M04A 4ZQBA 3LQ1A 1GSIA 1T8YA 2VK1A 3EASA 2X42A 3E3NA 1F8XA 1AMNA 1G7TA 4YMUA 3L9WA 4KYVA 2OPHA 1RQXA 5J40A 2XQIA 3NYIA 4YXWD 3H17A 3VZPA 1W9HA 1UPCA 2JANA 4D46A 3IV9A 3I9OA 4EW6A 2ET6A 3WNDA 3OJEA 7MHTA 2WJVA 5LQNA 1M5TA 5KVAA 5HRUA 1Y1RA 4FSHA 4P31A 1ORWA 2W2QA 1IZZA 3HBJA 1XK6A 3O8LA 3NHYA 4R81A 3BWDD 3FZEA 3L1VA 4KX3A 2I4NA 4B44A 1DMRA 5FWXB 5JZSA 2WU3A 1XE3A 1D1TA 1FXWF 2CNLA 1PVVA 1JHDA 2M98A 4BGUA 3THWA 2PUBA 1WP9A 1Q0PA 2EIXA 2X23A 1M0SA 2RH8A 1GYQA 4EKEA 5BQXA 1E3TA 4S1WA 3QXXA 3MRTA 3N8HA 1EWTA 3OZCA 1XV5A 1MAUA 2AG5A 2F2TA 2GCOA 2J5RA 1R0RE 2IVFA 3DV0B 5GM1A 4C2UA 1VCOA 5IK2D 2OYSA 4F6CA 2MT9A 1QYCA 5B30A 3GLFE 3GP3A 5I9MA 3BMQB 2ZTUA 3AEYA 3V46A 2AOXA 2HJRA 1CY6A 3MOIA 4DNPA 2KI5A 3KKEA 4TYYA 3KZVA 1ECFA 3K70D 2MSEB 4BN4A 4C6TA 2C03A 5F35A 1H8ED 5JJLA 4UBNA 1MJ5A 3EZXA 5DDIP 4UTPA 1DO2A 4NYIQ 3Q98A 3L1UA 4Z2AA 2R47A 1TJ4A 2AN9A 2FKAA 4XE5A 1KJZA 5L95A 4DV5B 3SE0A 5LQUA 5JQWA 5ALTA 2OCIA 5CM9C 3MPUA 5CA0A 1KZ9A 2XCTB 3IAAA 5IAKA 2QVGA 3TZKA 3O8DA 1BD4A 2CVHA 4MAMA 1TVMA 1FQJA 4KQCA 3B78A 1NASA 5IS2A 3AVQA 2LCFA 5AVOA 1FTGA 2GK4A 1TA4A 2HJGA 2N47A 1LQ2A 4R2WA 4S1PA 2GYYA 3OX3A 5DXFA 3WGYA 1FMLA 5J5VA 5CH8A 2D0DA 2RB4A 4JB8A 5G4LA 1IE3A 4QUAA 4U7DA 3ZDRA 5TQ0A 4ZI2A 3ANLA 1E9EA 1EK5A 1QYRA 2WR8A 3GVXA 4MUAA 3QVTA 3VJMA 3ROTA 1L7XA 1G64A 4JX8A 4E5DA 3GQBB 2FYTA 3LCRA 2UYGA 4HAVA 4XD7D 3VJRA 4I4CA 4EX7A 4H3VA 5EE5B 4F38A 5I4IA 3P2IA 4MS4B 4E0BA 3HN6A 4G1VA 4MLCA 1OI4A 4RUKA 4D97A 1R9JA 2PQMA 3PQ2A 2AK3A 4MGKR 4ZKDA 2CLDX 2J9RA 4M2LA 3VM6A 5FUYA 4H0CA 2GBFA 3FFXA 4I1IA 5DYTA 5C3UA 3C3KA 1NI5A 3IBTA 4E7OA 3ZHSA 2RIPA 1TUIA 5IXYA 1JHRA 1RKVA 3KSUA 4LZOA 1YKGA 3DD5A 4MGHA 3W7AA 1MDFA 3L7KA 4Q4JA 3WLTA 1DCFA 4G0UA 3O3NB 4WD3A 1D2HA 4LDZA 5PNTA 5J4VA 3CE6A 3EEIA 1HYEA 1WWKA 1X0XA 3EZLA 1CRWG 2AE2A 3H9QA 3DEFA 1HDRA 2ZIAA 1T6XA 3JQ7B 4C1BA 1F1BA 2D2EA 1GQSA 2CVZA 1YVRA 3EFEA 3FDZB 3A1WA 4QYIA 3GEDA 5J5CA 1JVNA 3RFUA 2GAFA 5T7BA 2K2WA 3QLJA 1YVEI 1RE0A 3B1WA 1EWVA 1DJMA 2CCGA 2R4TA 2XF8A 5BNZA 1W85B 5IARA 2IHZA 5FBKA 3TX2A 4FHGA 3T54A 2BFDB 3CONA 5JY1A 2C7PA 5H02A 4EVQA 3PC8C 2GXUA 4PG4A 4EYQA 5F21A 3QI2A 3M4NA 2R6AA 1YC5A 2EJBA 3OIYA 2CYCA 1XKQA 2C4WA 3NALA 2D6FA 1VDMA 1XRMA 2YJNA 3AL3A 4EMTA 4OL9A 3Q8WA 3BREA 3SXPA 4FGUA 1JTEA 1K6JA 1PWXA 3H9JA 3OTWA 4LGYA 3EVZA 1NYRA 1UIRA 2F3SA 4GGOA 4MK4A 2X9VA 4RA9B 5CVJA 1CTQA 4F6LA 1XVLA 1W59A 3OQNA 3BGWA 5IJWA 4JDUA 3CVWA 3MTEA 5KMGA 2GXSA 3PDWA 1NVMB 4UOEA 5JNWA 1E0DA 1STOA 3H7IA 3NETA 1Z25A 4RMJA 1I9GA 2QRVA 1E2LA 5K0ZA 1EXDA 2CLCX 2GHTA 1OLXA 1RZRD 3QNWA 3V4FA 1X7YA 1A4UA 1PDWA 3HA3A 3VZSA 4QZVA 2IYYA 3A9WA 2IS4A 4J1NA 3ZOKA 1X8LA 3GN2A 4X66B 1G41A 4KFTA 1AOXA 1Q1NA 2O5RA 5CD9A 5KC9A 1NTRA 4PIVA 2O59A