1F9AA

Crystal structure analysis of nmn adenylyltransferase from methanococcus jannaschii
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
164
structure length
164
Chain Sequence
b'LRGFIIGRFQPFHKGHLEVIKKIAEEVDEIIIGIGSAQKSHTLENPFTAGERILMITQSLKDYDLTYYPIPIKDIEFNSIWVSYVESLTPPFDIVYSGNPLVRVLFEERGYEVKRPEMFNRKEYSGTEIRRRMLNGEKWEHLVPKAVVDVIKEIKGVERLRKLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL PROTEIN MJ0541
publication title Structure of nicotinamide mononucleotide adenylyltransferase: a key enzyme in NAD(+) biosynthesis.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
total genus 52
structure length 164
sequence length 164
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.1: Nicotinamide-nucleotide adenylyltransferase.
pdb deposition date 2000-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1f9aA00
4WSOA 4MAFA 2B7LA 3GMIA 1K92A 2BTEA 1G8GA 2PZ8A 3NBAA 1NUUA 3CLTC 4R2LA 1IVSA 2JANA 3P0JA 3COVA 2A7XA 3IMCA 4L2IA 4MW5A 2QTRA 3MUEA 4DLPA 4JXXA 2D13A 3M5WA 3ZJUA 3CA8A 4MUFA 1IHOA 1PG0A 4KPUA 2PZBA 1JZSA 1WXIA 1JIJA 4MW4A 4MW1A 2A84A 2PFSA 1JEEA 4U7JA 2YWBA 1N1DA 1TEZA 3RK0A 4YP7A 1NUPA 1JGTA 4MVCA 4I6EA 1KQNA 2C5SA 3AL0C 3L93A 3ISJA 3RK1A 3TQOA 1N2OA 3SP1A 1N2HA 2YWCA 4CT0A 3TQIA 4EG1A 3CVVA 1SURA 3FIUA 2XRYA 5KWVA 2HZ7A 3JXEA 4OJMX 5K0SA 3CVXA 4MUGA 1O95C 5KCMA 3D6VA 1K4KA 3N8HA 2QUJA 3FNRA 1N2BA 1EFVB 3IDFA 4GRIA 4KKVA 1GTSA 4A91A 5BNZA 1QU3A 2A1UA 1J1UA 3G5AA 3COWA 1IRXA 2GOYA 5F23A 1NUSA 1VL2A 4ND6A 1COZA 3RBAA 3UK2A 3QTBA 1F7VA 4R0NA 3TNJA 5TS2A 3DLAA 1F9AA 3CLSC 4MWBA 3G59A 4KR9A 3TS1A 1M8KA 3LE8A 1MOPA 3CLUC 1TYDE 4MUEA 4P2BA 3A2KA 1O5TA 2X1MA 3HL4A 3IOCA 1ULHA 2GKSA 3IUBA 4CDMA 3DO8A 2J4DA 1M83A 2A88A 2PXHA 4F4HA 1OWOA 1O97C 1QTQA 5TEVA 1N77A 2YXNA 3PNYA 1WOYA 3IMEA 4HPWA 4MUKA 2VXOA 4PBTA 1EFPB 1F7UA 1HYBA 3H05A 4S1OA 1QJCA 1PFUA 3DV2A 2O5RA 1N2IA 2J5BA 1OBHA 1YUMA 1M8PA 3AFHA 1EE1A 1GN8A 1KH3A 1TQ8A 3X1JA 1NYLA 1Q11A 3FI0A 4HK4A 4ND7A 1QRSA 1R6XA 1GZUA 1F4LA 1R6UA 3U1VA 3MLAA 1QU2A 3A05A 3KT8A 1EXDA 4XSVA 1QRUA 1UFVA 4I6JA 5TGTA 3MXTA 4J75A 2TS1A 1IFXA 1TYCA 1IQRA 2DETA 1N2EA 3FOCA 3IH5A 1WQ4A 2CFOA 1QQTA 1R6TA 1G8FA 2PIDA 1YI8A 2QJFA 4MQ6A 1JIIA 4YP6A 2HMAA 5H16A 1PFYA 3CVUA 5HUJA 4MWDA 1U3CA 1K4MA 4L2IB 4NDAA 1FFYA 5HG0A 4EG8A 4EG5A 5EKDA 4DNXA 1J09A 4MWEA 3E27A 5DEOA 1NURA 4WNYA 1J20A 3FHJA 4EFKA 1JILA 2X3FA 3L92A 1KAMA 4EGAA 2H2AA 1O94C 3HZRA 3N2YA 1U7XA 3UOWA 2ZUFA 1VBKA 1YULA 4NATA 5DASA 2J09A 2A1TR 1ZH6A 1VBMA 2VTBA 4F3RA 1RQGA 1T9GR 4ARIA 2CYAA 1NP7A 3BL5A 1M8JA 4MW2A 2RD2A 2XRZA 3UC5A 2DEUA 3FWKA 3RFFA 3ILVA 2A1UB 3AKZA 1G8HA 1YIDA 3A04A 3FG9A 2PZAA 3ZXSA 4G6ZA 3QTTA 3IOBA 2BYTA 4Q93A 1EUQA 4NAUA 1XNJA 4DDHA 4QREA 1JMVA 4MW7A 4MVXA 3SYTA 3ZJVA 1Q15A 4XFDA 1X8XA 3S3TA 1OWNA 1Q19A 3MMXA 4ZT4A 3SZ3A 3COYA 2NZ2A 5FO0A 1H3FA 3Q10A 1MB9A 1YUNA 4Q16A 1EUYA 3P52A 2Z08A 3SZGA 3X1MA 3D6UA 2QTMA 1VBNA 1JEDA 2OV4A 1O96A 4AQ7A 2I1LA 2V0GA 1WXGA 1DNPA 3KT0A 1N3LA 4K0RA 4DJAA 2WQ7A 1KAQA 4CQNA 3MLBA 1KH1A 3UMVA 2GM3A 3TZEA 1U0BB 1KKUA 1T6XA 2R5WA 2ZUEA 2CT8A 2A1TS 3N05A 1KP2A 1NSYA 2IJGX 1WZ2A 2CYBA 4EG3A 2QJTA 1T9GS 3X1KA 1EFVA 1TYAE 1ZUNA 1S4MA 3IUEA 1JZQA 1WY5A 4MW9A 3PNBA 2CUZA 4JYZA 4MWCA 1XNGA 4U63A 1LW7A 3P0HA 3ZGZA 3G6KA 3PRHA 3LCJA 1OWLA 5DB4A 1K97A 1M8FA 3ND5A 1O0CA 2QUIA 1TYBE 4OUDA 4NZPA 3CLRC 3IVXA 2CV1A 3COZA 1N75A 4MW6A 5TEWA 1J21A 3H9CA 1BS2A 4DDKA 4X0EA 1J1ZA 1QRTA 4MUJA 1H1TA 1WKBA 1YIAA 2E18A 3C8ZA 1JECA 1KH2A 4J76A 5LM3A 2E0IA 3IVCA 1ZH0A 1V8FA 4UZEA 4MVWA 2D54A 4EG6A 3PNVA 4KPUB 2VTBB 1IQ0A 1N78A 2WSIA 4ZT6A 4ZT5A 4EG4A 4UZFA 4JFAA 3K32A 3VU8A 1J70A 3K9WA 4E1AA 1H3EA 1B6TA 4U8HA 4NX2A 4G5FA 3SDBA 1MAUA 4XFJA 1Y42X 5IJXA 4NAHA 4I6GA 4G5YA 4PY2A 2WQ6A 3ELBA 1NZJA 3CLTD 1WXHA 2DR2A 1M8GA 4ZCQA 2CSXA 2G36A 4HJRA 4PBRA 1T6ZA 4ZT7A 4GU5A 1IQUA 1PG2A 3LOQA 1A8HA 2IP1A 2Z09A 3CVWA 4YMIA 1OD6A 4BWVA 1NUTA 4DDMA 2E21A 2EL7A 3CVYA 1GAXA 1MC1A 1OWPA 4HJXA 1WXEA 2E89A 3F3MA 3OP1A 2HGZA 2V0CA 3UY4A 2AZXA 4PBSA 3VRHA 2DXIA 2ZP1A 2JAXA 1KORA 1O96B 5K0TA 1H3NA 3SEZA 4MLPA 4QBTA 3HMQA 4MVYA 4ZCRA 1I6LA 3FETA 1WQ3A 4QRDA 1U3DA 3ZIUA 3QE4A 2Z3VA 5FO1A 3INNA 1N2GA 3Q12A 1T6YA 3I05A 3IOEA 5H7XA 1O95D 3ND6A 3SEQA 5AHWA 2JA2A 1JHDA 3DPIA 1MAWA 3H97A 4EF6A 2H29A 3H9BA 2X0KA 1WXFA 1N2JA 4JXZA 1GLNA 2CV0A 1CT9A 2RE8A 1O0BA 4R2MA 3FDXA 3AG6A 4JZYA 4K03A 4MUHA 2WB2A 3CLSD 1GPMA 3RHSA 1I2DA 3IODA 1XJQA 3CLUD 3KFLA 5HUHA 1G59A 3KT6A 2O8VA 2PG3A 2A4MA 4KR6A 4CDNA 1GTRA 3ZXIA 1LI5A 1ZJWA 1O97D 1JIKA 3NV7A 5LFAA 1MJHA 4OUDB 2A86A 1NI5A 1MB2A 4H3SA 1NUQA 2QJOA 2QUHA 4ZCSA 2DUMA 1WJGA 1OWMA 1PFVA 5J58A 2DPLA 4FZJA 3P0IA 1U7DA 1KQOA 4YBRA 4ZT2A 5DK4A 3CR8A 5IHXA 1EJ2A 1TFUA 1LI7A 2QTNA 4ZCPA 3PXUA 3AIIA 1MRZA 3FH0A 2J07A 2NSYA 5J5AA 4MUIA 1V47A 4TS1A 4MW0A 4DE5A 3A4IA 1D2RA 3FY4A 4RPIA 1FYDA 1I6MA 1VLHA 2CV2A 1X6VA 3ZUGA 1Q77A 1QNFA 3AG5A 1MBZA 3GUZA 3RJZA 3TZLA 3KT3A 1KP3A 2D5BA 3CLRD 1KR2A 4MUNA 1IH8A 3HV0A 5LLTA 1M1ZA 1O6BA 4EG7A 2CYCA 3ND7A 1ILEA 1EFPA 4KR7A 2QUKA 3HFJA 1KQPA 1I6KA 2J08A 2AKEA 3NBKA 4ARCA 4RUKA 4ZT3A 2AG6A 3ZJTA 3Q4GA 2DERA 2DLCX 1OBCA 3IMGA 2EJCA 1P7PA 3H99A 5JBNA 2IELA 3OTWA 3IVGA 1O94D 4YP5A 5FNZA 3VGJA 1XNHA 4ZCTA 4MULA 1PFWA 3HGMA 3GLVA 2X1LA 5J59A 4AS1A 3N9IA 2OQ2A 5KHAA 2YY5A
chains in the Genus database with same CATH superfamily
1GRQA 4J3FA 4WSOA 3D2BA 1ELOA 3HXOA 4M9ZA 2NVBA 2B35A 2HWXA 8ATCA 721PA 5J4HA 3I5MA 2IYXA 3AEZA 3GRCA 3MTGA 2P0EA 3PA6A 1P2DA 1E3LA 4ZQBA 3A4MA 1PHRA 2O2CA 4XYMA 1BJKA 1SJ9A 5FA5A 1HNNA 1VGRA 2KHZA 2Q5EA 3GLTA 1CBUA 3LU1A 1Q1QA 2PJUA 3CS3A 2YKGA 3M5PA 2P0AA 4FYHA 4IO0A 2XQIA 3TXAA 4EI2A 1IZ8A 1AQYA 2C57A 2R7NA 2W5UA 3JTMA 4MGHA 4YA6A 5ECGC 1J0XO 1QVWA 3RK0A 4DJEC 4ZFNA 5CA0F 1YZHA 2K5UA 3GFQA 1PJ2A 2P9JA 4I1YA 4JCOA 4P83A 4UM8B 1CIJA 1VL1A 2GNAA 3G2HA 1I3LA 4WOBA 3TTVA 3OZIA 2WTEA 1Q0RA 2BKUA 2PUVA 3N76A 4DMRA 3EVEA 2Q21A 2NACA 4Z4GA 1HUQA 4AZ0A 3LQKA 4L4UA 5AW7A 4LK2A 5JQGA 1EBBA 4RLFA 2XNJA 3NC1C 2YV1A 3I6IA 3TXXA 1NNUA 1CY0A 2YWRA 1SXHA 1YV9A 3BIFA 3JXEA 2WFLB 3LX4A 1QPGA 1ZMBA 2PFGA 2V97A 3ANSA 4YT4A 3WWEA 2PFKA 4XIGS 2FRDC 5LMCA 2HCFA 3MPUA 2PD3A 3IDFA 4JP8A 3LT0A 3T1QA 2JD0A 3VSCA 1J5EB 3KELA 1J1UA 1VKJA 4ZVMA 1RAHA 1VPTA 1BA2A 1TRKA 2VDRB 3COWA 1IRXA 3DDNA 3ETEA 3IEPA 4PO3X 4AKEA 5D84A 2IVZA 3TL3A 2ZYHA 2FZWA 5TS2A 3TNJA 2FSPA 1ESEA 4MWBA 2G9QA 2QPLA 3D3JA 4MQ5A 4ZQCB 1EJ0A 3DXYA 1NG1A 1RLUA 3C70A 3ORFA 1CC1S 3HCDA 3FPLA 4NH0A 5K3DA 2JZNA 2CDBA 1RXEA 4LA4A 3CYFA 3A6JA 3GQBB 3IUBA 4M38A 5DYGA 2G1KA 2PUWA 4JOCA 4J0GA 5JI2E 1SVLA 5HHTA 4PLWA 1H66A 2J7PD 4INAA 3TSYA 2FW6A 4WXPA 4BGUA 4I50F 3LQFA 3PJEA 4BO7A 4BP1A 4YIHA 3PSAA 2PANA 2HIAA 5EPEA 4AJPA 5L53A 3KKOA 3KQWA 4G26A 4HRXA 3OE4A 4E2FA 1J9EA 3AT1A 2AI1A 2QLFA 3PNYA 1V4VA 3DJYA 1W6RA 5G1NA 4PRLA 2O8CB 3SYNA 3I9OA 4WCFA 4XQ0A 1NVBA 1QG4A 2XQFA 1T2AA 3H05A 4RAOA 1H6BA 3R3YA 2GPWA 4S1OA 4Y2YA 3R7FA 1KNQA 1NDQA 1ZVQA 4OI1A 1W85B 3FTFA 2W6JD 5GGYA 2QV0A 4DRXB 1CE8A 1DCTA 1G4UR 3GRAA 5A5EA 5CG1A 2CFTA 2FAXA 2X1HA 2VNSA 3KXLA 4DJFC 1GN8A 2WRZA 3VH1A 2P6RA 2D5IA 3KKQA 4TSFA 3HN2A 4Y2SA 3T3EA 2XUAA 2P8SA 2I6UA 3VKVA 4NF2A 2HWWA 1R6XA 3QKRA 4B81A 2H85A 1VBFA 4DLKA 1QU2A 2QUBA 2WF6A 1EWKA 4HBZA 1Z5GA 4F9EA 3W78A 2FPOA 7REQB 3FTNA 1P81A 3DXFA 4F97A 5BNFA 1WKVA 2F67A 3TGWA 3D6NB 1CP3A 3DLHA 5F12A 5HF8A 2Z04A 3V8EA 2AIRA 2WD8A 3NOOA 1F6WA 3GP5A 1WBJB 1E2HA 1PZMA 1S7CA 4PXAA 4ZWNA 3T7DA 3UFBA 3KQOA 2X86A 3KZCA 4HMPA 1W5EA 2HPZA 3WLKX 1K4MA 1U94A 3BD9A 3KV3O 4E5UA 3Q87B 5AVZA 2DBQA 5EWMB 1FFYA 1YZ3A 2ZI5A 4MB2A 5CLJA 2WKQA 1SOVA 3OMWA 1FTWA 1YQEA 4PHCA 1GPUA 2C4WA 2CF6A 1V3VA 2WYHA 3I58A 4WN9B 1VCNA 2RKWA 5LLSA 4Q4HB 3DWFA 5AJHA 1T8YA 3NTOA 1GITA 4OMDA 4G1FA 3STUA 1LBQA 1SZPA 1LF5A 5JISA 4ZO9A 1E6EA 1E61A 4ZOLF 4MSUA 1IUOA 5AR1A 3K72B 3S2ZA 1P9OA 4B46A 1XMIA 2ODAA 1XDBA 3NH9A 3A4TA 2V8OA 3LQRA 2A3NA 1J07A 4MWZA 3KP1A 3BL6A 1PD1A 1SQ5A 1Q14A 2LE0A 4NABA 3UK1A 2VYQA 3UJBA 1HBJA 1CUUA 4JAVC 3FGPA 4PAWA 2B1RA 1Y7PA 4Q7MB 2C5LA 5DPMA 5SZKB 2IE0A 4MPDA 1HG1A 2W9XA 3UWKA 3O8OA 2DULA 3V32A 1T9GR 3GARA 3N2GB 1OAAA 4OSOA 3HUTA 2EP7A 2QVGA 1OF1A 3E15A 3PDUA 4CMCA 5CYPA 3GAAA 4U2EA 1T26A 2Z5FA 5LP6F 1G64A 4L3WA 5AVVA 4ILKA 1EWQA 2H00A 5CXQA 3ZHOA 3RFFA 1EWTA 3F3YA 4TTTS 4ZAYA 3ZVMA 3N0VA 1RQ7A 1Z06A 1D2AA 4KPEC 2IIQA 2BZSA 2VTDA 3N0WA 4WMLA 2JI9A 1KYXA 1OUMA 1A7JA 1PUXA 2O7SA 1CNEA 3E3NA 3KZMA 5A0FA 4BGEA 3KSAC 1W88B 4YAGA 5FRDA 3CVJA 1YK1A 4NONA 3KHSA 4YY3B 3EXEB 3IDAA 5HF6A 3L4JA 2YJ4A 3O7WA 1EUQA 4HHEA 5IK2D 5A9SA 1O9GA 2WHYA 4EYSA 3AR4A 3HU5A 1OROA 3REOA 1BROA 1SKMA 4JQYA 1PIWA 1JHRA 3UUFA 1Q6YA 3CKLA 1TYZA 2OHFA 2G1JA 4ZDIA 2F3TA 4GDMA 1L2TA 2GK7A 2XT0A 3IQXA 2HU2A 4RH3A 3BTSA 3GCWA 3ZZ1A 4YV1A 5TNXA 4YT2A 4LVOA 1JIUA 1MB9A 4RDXA 4RVGA 3RS3A 1LFDB 2AYZA 9LDTA 5EZYB 2C2YA 5EUCA 3T4EA 4MYCA 4BVKA 2OBXA 4CN8A 1MG0A 5JHHB 3K0FB 4CUJA 1O94A 4WBXC 4F2WA 3DFIA 2AFVA 4FGZA 1JR6A 2R9VA 3DBIA 3OZTA 1CY6A 1MO3A 3LWBA 2GD6A 3KWMA 3WOVA 2O54A 1PQUA 1U4NA 3KV1A 3WXBA 4NNOA 2FGJA 5C1PA 3U60B 4AKTA 1JU4A 1TTTA 3MOGA 1BCSB 2C88A 1NM5C 4K6OA 4EITA 2WWFA 2YWXA 3TNYA 3UA4A 2AFHA 3GT3A 4TTAA 1UP6A 2P2YA 2Y99A 3MJHA 4Y0AA 1G6HA 3WMRA 821PA 2I3ZA 5KQSA 3W2HA 1T1GA 1JFLA 3GMSA 1DC7A 2KI5A 4BHTA 4Z1OA 4IIUA 1R5OA 4PGHA 4BKUA 5JJCA 1L9KA 3ELUA 4U7GA 3LDGA 3WGGA 1YA6A 3GBSA 3QFHA 3RRZA 3WZMA 1V6AA 5ES4B 3MGKA 4D0GA 2OD7A 4PSVA 3AB7A 4YJFA 2H52A 4ZOQI 5M2QA 1UBLS 2ZRFA 2FRVA 2PGOA 2OWEA 3FPFA 2PJRA 3D4NA 2JFPA 2GZHA 4I7EA 1PGJA 5IZCA 4JP5A 4FQ5A 1QH8B 3AY0A 1IXYA 1HO3A 4MWCA 4JQCA 5ITSA 3SBDA 4H7HA 4PSKA 3L8EA 2KJQA 2N42A 2X7HA 5H1YA 3VHLB 1XKLA 4QPCA 1GU7A 4DIOA 2UU9B 4K6FA 3NKVA 4M1MA 1PGPA 1R9NA 1BYUA 3IIIA 3KO8A 3D4LA 2CBGA 2YV5A 2JEZA 5TEWA 3GCGA 3H9CA 3CZMA 3HABA 4MUJA 4Z9AA 3QXSA 1JDNA 5T6BA 1VB5A 4BMOB 1NMEA 2Q6OA 2R85A 2POCA 5C5CA 5IABA 3WGMA 4Q47A 1A9RA 5B1DA 3B38A 3IP5A 1AD2A 4R1UA 1U31A 4PO8A 1G8MA 1FFXA 3B9PA 3FYHA 1ULBA 3IR7A 4HWTA 2ZPUA 4QFDA 1JJ7A 1HDRA 3FDZB 4FWIB 5HILA 3H1FA 4ZT5A 3MFQA 1WU7A 4N8SA 3LUHA 1QQ5A 2X3UA 3KXPA 1PCXA 3SIWA 4YCCA 1XK6A 5EZSA 5JD3A 1ESDA 1Z26A 4EQZA 1C29B 4UAUA 1BJTA 5TE9A 2R2GA 5AFSA 4BLUA 1XLUA 2PZFA 4QYXA 4O2BB 1WXXA 3VZSA 1EVYA 1G55A 1WCIB 4C3OB 4G5YA 1I2MA 2ODPA 2Y0BA 3EXHC 2GCOB 2J7PA 2OPBA 4RZ2A 4YJ3A 2YJTD 4JUCA 2QN3A 1D03A 2IPNA 4DRYA 2G04A 4FONA 3F4BA 4KIGA 4GKKB 3IBFA 3HB7A 3MJ4A 1UL1X 3A7EA 1DEHA 1O1YA 4X1OA 4E2WA 4JT9A 2J0UA 2XUJA 5B37A 1I5OA 1RLMA 3VR4D 1KZYC 3ZI4A 4A1OA 3JAMA 4FCWA 3CF0A 1PGNA 2JFHA 1S8OA 1GSOA 1VYUA 3HVUA 4FFVA 4GU5A 2RGUA 1IU9A 1WDWB 3VISA 3GAZA 4JJ8A 4AN1A 4QDXA 1J0AA 1T0PA 1U4OA 2DE0X 2GKGA 4NE2A 3TIGA 4PHFA 4CMBA 5C51B 1GR1A 2RH8A 2BFCA 2F00A 1NU8A 3M9LA 4GZ3A 4A8HA 4F4DA 1F8YA 4P0PB 1HZJA 4GBED 5TDHA 1JFFA 2XVXA 5IANA 2AW3A 4RGQA 2DT5A 2APJA 3R3VA 1NY6A 3LPAA 3VRHA 5CFPA 3K1AB 2XB4A 3IAM6 5TMPA 4N54A 3CG0A 4ZTUB 2BCJQ 2GYYA 2HDOA 2R5NA 3EUAA 3SEZA 3QHPA 1GN9A 5K0TA 3WGIA 4FOOA 5KO2A 4FD2A 3HJHA 4IRMA 4RTJA 5SZHB 4IX1A 1MR3F 4FFBA 3NDPA 1AQIA 1JXAA 2VRNA 3QVLA 3R5HA 3B3GA 1U9IC 1ZK1A 3D7RA 4OGWA 3I9V6 3ND6A 5D3MB 2Q6IA 4UOQA 4DIBA 5CVJA 1UMKA 1KAHA 3DPIA 4DR1B 2EV9A 3FOEC 4HGQA 4EF6A 1L5NA 2VEOA 3MB8A 1Z4IA 1ZX1A 1X7ZB 1RXWA 1VPVA 3AMVA 2C7GA 3OTOB 1QX3A 4BMXA 2JCVA 1G20E 4FCTA 3UJCA 1M6HA 2VP4A 4C4AA 3VDNB 2CVFA 2LD4A 1O0BA 5DBHX 2VP0A 2IV3A 2PT5A 4NECA 3P19A 4QYSA 3VVLA 5LQDA 3UAGA 3PC8A 3FDIA 1IY9A 3C3PA 1HV8A 1Z0FA 4ZO7A 4PQYA 1F17A 3A37A 3OQBA 4L0DA 2FLVA 3VX4A 1GNRA 3DD5A 1JDUA 4RGBA 2MDTA 3ILHA 5ELMA 1YFJA 5A3SA 5ULLA 4BN4A 5A9RA 5JAMA 4I1SA 3CG4A 1X0VA 2FXIA 2EFYA 3Q88A 3T5TA 4DV4B 2Y92A 4O0MA 1L1EA 2GEJA 2XCRB 2GO7A 1O97D 1HPLA 2RI0A 1V3UA 3DDWA 4WESB 4BQFA 5C46F 3LVFO 3AGPA 3SIXA 4ZAWA 2FW7A 3C6XA 5EHZA 1KJJA 4Z9YA 3PXBA 4I55F 1WJGA 1SOMA 1NF8A 2BMWA 2K4MA 4F12A 4XJXA 1EFKA 1Y81A 2PWYA 1IG0A 3AF1A 3OE7A 4PU0A 3FRIA 4XD7D 3HU1A 1AZWA 4QE3A 4ZCPA 1IVYA 1WABA 5CVEA 1JWBB 4B80A 3ZGNA 1JQLB 4GE3A 2VP5A 1P6QA 4G36A 4ENRA 4C4SA 4HNTA 4BVEA 4DCVA 5B64A 2VF7A 3GZ4A 3OT1B 2LR0A 4LQ4A 5K4HA 2HF2A 1YZLA 2HHLA 1KJWA 3LBFA 4TMFA 5AI0A 3WIDA 2OL4A 3KSRA 5C4IA 2OYSA 2GEVA 4GI5A 1LJLA 5IVPA 1NW3A 4JI1B 4DV3B 2AX3A 3T9EA 1Z75A 2X8JA 5IK2A 3IXLA 4B3RB 2GPJA 5GTDA 1AHPA 3VBEA 1Z6QA 4Z3OA 1NW9B 2EEPA 3B6EA 3CX7A 2P3QA 2CZQA 3NUGA 1U0OC 3ZHRA 2I8CA 4XCXA 2ZDHA 5DM1A 5KINB 3K4HA 3GH3A 4BO0A 2Q0SA 4Q7KA 4R01A 1E1MA 4LRUA 3QRWA 2V9PA 4I66A 3P5BA 2KM1A 2RHLA 4IXTA 4BJ6A 1UOEA 1NXSA 1F4VA 2Q5LA 4UBNA 5IBCA 4P4TA 1C41A 2FWNA 2LIVA 3ESBA 4OHFA 5HIJA 5CLFA 5I7WA 4F38A 5M04A 1UJ6A 2R4UA 1NVVR 3FMVA 4FGJA 1D1PA 1M66A 3OEHD 4QTTB 3EIOA 4KAFA 3U3RA 4R0VA 5G0VA 3V8QA 1OBCA 4KBGA 1PJBA 2B1QA 1P80A 2B69A 2E4UA 3O9MA 5EJ8A 5ALOA 1MIOA 1WEKA 3D8HA 2F1JA 4HFMA 5E7IA 4DV6B 3IVGA 1HNZB 4Q9HA 1NQTA 4C7MA 2KWIA 4EABA 4OH7A 1E1YA 5AXCA 1GPWB 1NX6A 3AJEA 3AI7A 3PQEA 2XMCA 2J4CA 4KB5A 2BUAA 1RLOA 1Y4SA 4QNMA 4LJRA 4E4YA 3WGOA 3NZEA 4GLJA 2HFKA 1BOOA 3FZQA 4EQ6B 1Q0HA 4WOPA 5ERYA 1CS0A 3AFMA 1ODLA 4UFOA 4WZBA 3JQFC 1H5NA 3L1JA 2WNIA 2LPMA 2G0NA 3KZKA 2CF5A 3RVSA 2CLIB 3LFUA 1KFKB 4MW5A 4UUMA 4KKXB 5IBQA 2FP4B 1CUWA 1AQ6A 1D9XA 4ZOEA 1PR6A 5HKOA 2REBA 5E4JA 4L57A 2Z95A 1C1DB 1XP5A 2NADA 3B6MA 4Y7CA 4CE6A 4CM8B 2O5VA 4JI2B 1EX6A 2NNWB 1KBOA 3AF3A 5DM2A 3ELYA 5DGCA 5BW4A 5HQTA 2Q46A 1FP2A 3EPRA 4MMYB 5F3WB 1XEXB 4NP6A 2QP3A 2QRKA 3LSYA 4ZJZA 4D6YA 5C52B 4CWAA 2G6TA 1HEIA 3CLVA 3QXCA 3V8NA 1FBTA 1K9VF 2X5OA 1GPDG 2O7QA 4KN5A 4UJ3A 4NBVA 3DNMA 1I51A 5LN1A 1L4KA 1ZSYA 2FI1A 3CZCA 3MWEB 4U02A 5A7GA 3ZY2A 4F4JA 3FPKA 1DJLA 4DCOA 1XCLA 1ORRA 2YIMA 4M1ZA 4EKEA 5EE0A 3T3OA 5EXXA 5ALSA 1YRWA 5K0SA 3OBIA 2J6CA 2XMRA 1U3UA 1T1SA 3K3PA 2E5WA 1L4LA 2GM5A 4IILA 5ECWA 5FOWA 4FI3C 3WLEA 5C18A 2BJVA 2YYAA 5K6RA 4URFA 1KDPA 4MA5A 2QLMA 3DP9A 1I2CA 4HWKA 4MR9B 4EA8A 1I2BA 2A1UA 4JT4A 2PQMA 1QYDA 1XTPA 2P67A 4F46A 2B92A 2ZRQA 2GERA 3U3DA 4WL0A 2ZYIA 3RBAA 4DLWA 3CRMA 1PLKA 2ISQA 3ZUPA 1G2QA 2KX7A 3LF2A 3EZXA 2GH1A 5IAKA 3D9QX 3E2PA 4KMMA 4RFSA 2W6CX 2FR8A 2ZYGA 4ARZB 5FPKA 5HIKA 3VR4H 3K8YA 3KVYA 4LQDA 2GI4A 3VR4A 2EWWA 1TYDE 2B4TO 2ZIXB 4IDNA 4RVHA 4MI3A 5AOCA 3W4IA 4EUHA 3T5GA 2D6FA 4R83A 1C1YA 4KFTA 1ZCZA 4YFVA 3ROMA 5LU9A 2IZOA 2C4UA 5F5NA 3N8NA 3SPXA 3RS7A 2A88A 4HUJA 3Q0TA 4F4HA 1ACLA 3FOWA 1M1NB 2D06A 2XGSA 4MQEA 4PFSA 1J7KA 5FB3A 3WBBA 1Y4ZA 1NQ5A 2YXNA 3T3MB 3A1UA 1HNWB 5HS4A 3GXOA 1KY4A 1L5FA 4A27A 1QLWA 1GUDA 4Z99A 1U11A 4HDNB 3F5MA 2INGX 3GJ5A 4NESA 1GPBA 1XVUA 1JA0A 2WT9A 3GJTA 1JKIA 1I7SB 3R7WB 1GNSA 1SZDA 2X7JA 4XA8A 2AZTA 2Q7DA 4Q3EA 1NXPA 1JQDA 3BX1A 2O05A 1CDEA 2XH8A 3BT7A 3TM5A 2WILA 1X94A 1QDLB 5CMLA 3UCEA 5AKKA 3HR8A 3OE5A 5BN5A 4K3VA 4LOAA 4YCSA 2OCAA 3EBLA 1PR9A 2BP7B 3JW8A 1R6UA 3HL0A 3NTXA 1HH4A 1R0BA 5CLIA 1E3TA 1EP9A 2YMQA 4KVGA 3INRA 5J2UB 3VI4B 5FNVB 4JQOA 3Q11A 1S01A 4EVSA 1P1JA 1VPDA 1CHNA 3AK4A 3QJYA 2TS1A 1GVNB 4I6JA 1PZEA 4X8OA 5SY6A 2I67A 4YUYA 4ZDJA 3IVRA 1APBA 2PSHA 3S81A 2FMIA 2LVBA 1E6MA 4HXFB 5KWJA 4CQMD 1BFKA 2FX3A 2QX7A 5BR1A 1GVHA 1KY5A 1NLZA 4L8YA 1J2UA 4O5OA 5JMOA 3MTBA 1F6BA 1Y34E 2HMSA 3IP6A 2AG0A 4OX9B 3QFTA 5IN5A 3QVTA 1NN3A 2C4HA 4L95C 1CUVA 3HB4X 4WXEA 1GNVA 3JQQA 4Y67A 2AOWA 1EUDA 1SCKA 1GG8A 1ST2A 4MKHA 4IEIA 4MJLA 4MYUA 1R0KA 4QBHA 2HMUA 2W00A 3VFDA 1WSDA 1QIFA 1UZNA 1V37A 2E4ZA 4GM0A 4UASA 3WL6A 1D2CA 3PICA 4QO7A 3NV9A 3DNFA 4JOBA 3RYFB 4DT1A 3PJRA 4R3WA 2B34A 2GEBA 3SCZA 3BWYA 3BE4A 3EBOA 1EFTA 1SBNE 2ZK7A 2HK8A 4RK4A 3IHLA 4XDZA 2B2CA 4RTOA 3UOWA 4G37A 2Z8YA 4GSKA 5J2UF 4U7DA 1PVOA 1JIQA 3CTMA 3LQ4A 4XD7A 2GT1A 4G81A 2WOOA 4MWTA 5FADA 5IUJC 1LSOA 1KEKA 1ML4A 1VBMA 5G3ZA 4P7FA 4BFZA 1E4YA 2P9FA 3ZBUA 4LDAA 1FZTA 1FK8A 2Q1UA 4EPWA 2FEMA 1P8JA 3ETJA 5A4DA 4PLHA 4Z86A 3GEPA 3FYUA 4L6CA 4QBIA 3UA3A 5CXXA 3RT9A 3K2EA 3HI4A 4BTEA 3WYFA 4NG4A 1XMJA 1FX0B 2ZE6A 2XEXA 4HI0E 3RIGA 4NE9A 3EMVA 2HQRA 2V6MA 3SHWA 5FBLB 3S1AB 2VDPB 2PZAA 2QHXA 4IWXA 4OU4A 1INLA 1QGOA 1YCGA 2OGUA 2WVHA 4M8KA 4QPDA 4JL8A 4DCMA 1SXQA 2CJWA 2QVYX 3H11A 2O7RA 3HDJA 5K3FB 4QREA 4BQSA 1SBCA 1VLMA 1ZW6A 5ESRA 3WDLA 4PLYA 1XKQA 2NZ8A 4HR7A 1AA9A 1DX9A 3DV0A 4N8EA 2BDEA 4QTUB 4R31A 4B2LA 4OAPA 1FX1A 2C2MA 3MFYA 3CKYA 1YF3A 4E32A 3OEHA 5COAA 1RYDA 2XJ4A 1NDHA 1AV6A 2BLLA 1NC3A 2J30A 4EA6A 1Y7HA 1QDEA 1ND6A 3EGVA 5CHEA 1M7GA 5E7JA 5TXGA 4ZYXA 6REQB 2GVDC 2GF0A 3ILXA 4XWTA 2IV7A 3PDJA 3AIKA 2DUNA 3SZGA 2A5GA 3RTAA 3CWQA 1FDTA 1VMAA 2GZSA 3KG2A 1ZXXA 2MYPA 3I2JA 4NL4H 3BTUA 4PZCA 4PSDA 1QVZA 3VNAA 1I1QB 4FW9A 5FV4A 3V8MA 3EASA 2HRZA 1T3TA 1A77A 2I1LA 4D4KA 2Q9AA 2ATXA 3EUEA 3ICPA 3EFOA 1SU7A 1XCBA 4LS3A 3RUDA 5LD2C 4DIUA 2BMFA 3UANA 1TO6A 2JFZA 4YECA 4BFTA 2C7PA 1P3DA 5FBHA 2YCLA 4NU0A 3ONWA 4KJXA 5WRFA 2P7IA 1YVPA 2BGIA 3DKIA 2CLLB 4JIMA 3WTCA 2I7DA 1D6MA 3FWHA 2Q5CA 3ZE6A 1R15A 1UBOS 2QZJA 4QBFA 3DTNA 3UPDA 3W5SA 4HH4A 3O1JC 1PNQA 4ZGBA 2PUDA 4I9HA 1Z7EA 3UB3A 4M1QA 1OT5A 3DULA 2YZKA 3DCIA 1AO0A 2WIBA 4LWOA 4UQLA 3B1VA 1U8YA 5F21A 2QK4A 4QXAA 3TRKA 4AZSA 2CYBA 4C7OA 5F9FA 1X1SA 1AXRA 3OIYA 4MEBA 5DXJA 3VNBA 1DAOA 2F3SA 3B3AA 4EELA 2NZWA 2FHSA 1QCYA 2D1RA 2L42A 3D8TA 4M9SA 3EGDB 3IYLW 1J2YA 2B9VA 4MI9A 1TEVA 4Q1CA 2AN1A 4Y9SA 4DR6B 4JYZA 1MEEA 4WECA 2B6NA 4DC0A 3M6AA 4DV0B 2QD1A 3QBTA 3LHKA 1O2DA 3HP4A 1X8LA 3R5FA 2F7SA 1DO2A 3RYHA 3U31A 4DMMA 1ISMA 2EJBA 1ZZEA 1ZGBA 1N2CB 3KTDA 2BBWA 3U4IA 4R05A 5FL7A 1SPBS 4QECA 1E3WA 4BMVA 4CM1A 1K7XB 2CDCA 5A5FA 1JSLA 1ZNYA 3UPUA 5AI6A 3UMFA 1WKBA 4I4TA 5J2TB 2G1AA 2B4QA 3G1TA 3T7SA 2PZMA 2FCRA 2Y93A 2DU8A 3H6HA 1W19A 4JHXA 1RFLA 3PEYA 5FOUA 5LQAA 2P2SA 3RAGA 2PRJA 1OVMA 5BN3A 4DBVO 3U61B 3UV7A 5LDGA 3DBRA 1T3SA 4Q5IA 5LMZA 5FUBA 1GA6A 1ISJA 2RH5A 5BT9A 1VHTA 1YGYA 5JDIA 3FYDA 5M3BA 1BE6A 5CFLA 3BTVA 1V41E 4A23A 3K9WA 3BAZA 4NFLA 3BK1A 4JOSA 2DH5A 2PYZA 3IC5A 3IDQA 3MWFA 5BSMA 2VJMB 1H42A 3GIDA 3M3HA 3D5TA 3LX6A 3BORA 4ZTBA 1VE9A 2XWQA 1JFSA 2HFJA 5D1HA 4IQGA 2JHAA 4BNFA 2FY8A 4J0FA 4YJHB 2G17A 3GAMA 2F43A 2PPVA 3LT4A 2RGAA 2VAWA 3BFXA 4Z8YA 4EPYA 2WQ6A 2XOKA 2YHAA 1SWWA 1P1CA 3ELBA 2QA5A 5DCLA 5KSOA 1EEXB 4BFLA 1IN6A 2Q6VA 3HYRA 3R77A 2XUPA 4RZQA 1RYYA 4S0XA 5GVRA 2WYIA 1UP4A 1FRVA 3NYQA 2PZKA 1XZPA 4JLNA 2PR7A 4NOMA 4ZT7A 3RC7A 1U9YA 2VHVA 2C7QA 3OVMA 2AUTA 3L0PA 2O3QA 1WHTA 2A9PA 4X6YA 1MUUA 4DPLA 3EW7A 4DGSA 5FHQA 4F96A 4H7EA 3IXQA 4IXMA 1Y82A 3UZUA 2ZVQX 1LWNA 5C5IA 1T5BA 3I3SR 3QF4B 4HTFA 2A94A 1V1RA 5DOVA 5ADHA 3B2QA 2JK0A 5GZ3A 1NVXQ 2IE8A 2WM8A 1SUWA 2O3UA 5DNYB 1KORA 4YAWA 1SCBA 3I6BA 3D1JA 1H3NA 4FMDB 4OYYA 3SHOA 4FGKA 1PGQA 4ZCRA 6ABPA 1JHMA 2F1OA 4BJHB 3STHA 4CQMA 5LMUB 1RD4A 1V7PC 4PPNA 2QIOA 2YYYA 2PSSA 1JHOA 4MVJI 2C9BA 3SSNA 1EVIA 1N2GA 2AV6A 1L6RA 2OZPA 4RE5A 3SEQA 3SVZA 5LCXA 5T4EA 4HX9A 1UINA 3FLMA 4NPCA 4NYIQ 4EF4A 1FUEA 1U0RA 2NOAA 3HUFA 3PYLA 5T8KC 1ADCA 2YDXA 5IPFA 2C92A 3HJGA 1VL5A 4HNHA 1XRPA 2B0CA 4LIPD 2QI9C 4RJKA 4XARA 5BSEA 3A1WA 2O8BA 3FUWA 2RE8A 4BTLA 1Z83A 2OAP1 3RO7A 1YR8A 4QHTA 3N7AA 3OC6A 3ZK9A 4E3WA 4E88A 3WIOA 3DBOB 5CPBA 4NBKA 2C5HA 3FNBA 5AT1A 2VEDA 4XQEA 3T0IA 1M10A 3GBPA 3UMGA 4F11A 2BFFB 1X7HA 1Z6XA 3ZHUA 4MS1A 1K6JA 4YDHB 4D0NA 3KT6A 1QF6A 2O8VA 5LIRA 5TS3A 1IC6A 2X40A 1KDZA 2L0XA 1QFSA 3EGXA 1NLYA 3I09A 4B3FX 1U1FA 1UFQA 1HDGO 2GUWA 4BV8A 521PA 1HE8B 2DPYA 3B1KA 4O1MA 1ABBA 4FMDF 1F2UB 5DSTA 1B8NA 1OJLA 1NNI1 1EQUA 2C54A 3GYGA 1MW8X 2XMSA 2GD2A 5LZ2A 3CUTA 2DKNA 2AA3A 5KYWB 4ZAVA 5J58A 3P9CA 4X7RA 4FZJA 3WWCA 4QD3A 3KOOA 3OLXA 2UYCA 4M88A 4N7RA 2RAVA 2X4DA 5BW8A 2QTNA 1VA5A 1YDMA 2C5GA 4NJMA 4QJ5A 4P2GA 3CF4A 2XT6A 3ZE9A 1SBTA 5HKKD 4YREA 2IYNA 2VUSA 3AERA 3N6XA 4PC6A 4CEIA 3RVOA 3CH7A 4KIWA 2OHGA 4S1NA 3VNSA 3SI7A 3TQHA 1SXPA 4EFMA 3LCRA 1JG3A 3JVVA 2X76A 2P2CA 3W7VA 1HRDA 1Y48E 3FY4A 2FE4A 1I6MA 4D9EA 1L1FA 1VCOA 5KTRA 3CCBA 4ND3A 4K26A 4MA4A 4CF7A 2FPRA 3LRXA 2HHJA 3I04M 2VHJA 2XMBA 3IE2A 4CMHA 2CDNA 1YQTA 1N34B 4DDTA 3TZLA 4D3XA 3D31A 4LJ5A 4YYZA 3EXAA 1KR2A 3LKZA 4NBNA 5F76A 2GETA 2W37A 3KQLA 1P1RA 3JYQA 1JF8A 2JI8A 3ND7A 1PYOA 1MXFA 2JAUA 1CX9B 1X14A 2MSKA 3NFYA 3H5NA 9MHTA 2Q5JA 4KE9A 4C7XA 4WEOA 2VJAA 1ZH2A 2JHFA 1TA4A 2UVPB 3A4LA 2J08A 3K2IA 4LE0A 3IAHA 5HOEA 4JBLA 4KWTA 3V8VA 1KZ1A 4K6MA 2AC2A 4ARCA 1S3GA 1RCTE 2AG6A 2XXJA 3DM5A 3JYLA 3PUJA 4LSGA 4R7ZA 4UHCA 4JLVA 1XVTA 3OZRA 5UKDA 3WQSB 4D9HA 1Y9ZA 1KPIA 1T3HA 5TPZD 4BBAA 4MVJG 3LCVB 3ORSA 2EP8A 5F7XA 1ZIXA 1POWA 2B6HA 1H2WA 3VXKA 3W34A 2IEAA 1IPFA 3AGQA 1PZGA 3PXXA 4J4TA 4EVRA 2VS1A 3RTCA 2GF9A 2D0PB 1Y7TA 2ZR0A 1CQJA 3E9NA 3FSEA 1B8UA 4JASB 4MHSA 4P98A 1FL9A 2RK6A 1K92A 3W7AA 2RHRA 1G8GA 1EB8A 2PZ8A 2WD7B 1ZZGA 5CVUA 5SICE 1T1RA 3G02A 3VZRA 2NO0A 1KVSA 1NFRA 1QF7A 2FFAA 3L0YA 4GBMA 2AZMA 4L2IA 4M54A 4M46A 4A92A 5LQCA 3H2IA 2JIQA 2YX1A 4D9KA 4RE6A 3CA8A 2DTXA 3VR0A 4BRZA 5EJEA 4PFJA 4U39A 5DNVA 1W94A 4CG2A 1G5IA 1B4DA 1ZRHA 1JIJA 1OLSB 3CCCA 4XIFA 2JIZD 4OHCA 3AI1A 3AR2A 4QAQA 5DGIA 5JMPA 2XSZD 3L7YA 1H0KA 3R6TA 4S1PA 3W05A 1V9SA 1EK5A 4LGYA 4ZDWA 2J3DA 4FFSA 4QQ8A 1JGTA 3B36A 4C9BA 1DT5A 1EVQA 3KC2A 3HJTA 4LX8A 3EG9B 4QGSA 1LLQA 2GPYA 3QKIA 1E2UA 1GARA 3EA0A 2OZEA 3L0ZA 3SEAA 4OKSA 2X4GA 2KPOA 5I9MA 1S02A 4YJ2B 3KEFA 2C8VA 4A8JB 1GU1A 4YP9A 2ZJ0A 5I9IA 4DR7B 4EDHA 5CDTA 2HH9A 4LW8A 1ISPA 3HO6A 1A9QA 5BMVB 5BYAA 3TGPA 3L7JA 4UCXA 3Q5GA 1CZNA 4LYDA 1Z7BA 1F2TA 5ALDA 3ZX5A 3CXUA 4EMSA 5DRTA 3BHIA 3LLUA 1UBSB 3GMTA 4CLDA 2I9KA 1UJNA 3CJTA 2Q0XA 2BBSA 1XQYA 3IQDB 2O4UX 2QTGA 2FOXA 2QUJA 1RWXA 4GUAA 3KWLA 5MF6A 4NENB 3FPJA 1L4UA 4A91A 2HPVA 3B6JA 2I6FA 1R4NB 1RWVA 2GPTA 1JVSA 1NUSA 3KB1A 2PCJA 4ERXA 2VXCA 2ZBRA 5K2MA 4KE8A 1GZSA 2OCYC 3BGVA 1LF0A 3GVXA 5EP1A 5IFLA 4YDRA 2JDID 1E0DA 3EF1A 3MJTA 4TYWA 4Y98A 2HU7A 5HJEA 1GGFA 1PJRA 1I4LD 3T5MA 3UJ7A 1VYTA 3CLUC 3AKDA 4MUEA 1HEUA 2IK8A 3KFVA 4HQ6A 3SJUA 3U1BA 5LMNB 3B70A 4ID3A 1MLDA 1JHZA 3AVQA 4LGMA 1U80A 4YAFA 3SKYA 1IXKA 3TLJA 1RRPA 1U5BA 4MIEA 4J4BA 1UXIA 4YJ2F 1GV0A 1Z0SA 4PYOA 3R5TA 3P2MA 4UREA 4EKNB 3RF6A 2C8LA 3UXYA 2X2PA 3IMEA 4WY8A 2I91A 3ZGOA 1N1GA 4GX5A 3FVWA 4EJFA 3ZU6A 2KS6A 4DKJA 2O8FA 2YW9A 2WFAA 1DJOA 3D54D 4RBNA 3FNHA 1MABB 3H13A 1Z2AA 3HCWA 2VDLB 2P9CA 4PSAA 5HSGA 2RHHA 4GOND 3QOWA 1R6BX 1OBHA 1OHHD 5ENZA 2Z2KA 1ULTA 4W4TA 4RPHA 3A6PC 4P7JA 3E3AA 1Y8RA 5BYBA 3L01A 3X1DA 4E13A 1JDSA 4BNZA 4TV8F 1Q11A 5JHGB 3L4BC 1HFWA 5LA6A 4EY5A 1Z18A 3RC8A 3A1SA 3BIOA 2XYHA 4WLVA 1T36B 4D5GA 4TTRA 3F9RA 4MVJF 2QN1A 2P79A 5CLHA 1MPTA 2CMDA 3DS8A 3DR3A 2COUA 3RUAA 1I1OA 1AO3A 3BA6A 5TGDA 3IAS6 4TLAA 1L6IA 1KZ7B 3RWBA 3IUNA 3ZCXA 4D82A 2BLNA 5AW4A 5JVDA 3MN1A 4BBZA 1XX6A 3L82B 2IXAA 4QUJA 4MQ6A 4QT4A 1J2TA 1H1LA 3AO0B 3F3SA 1E2QA 3PFCA 4PFKA 3VC3A 1WLSA 1JDBC 1PJ8A 5K8TA 2O59A 3KPVA 4LJKA 4EHJA 1ZJZA 5FLYA 3EVBA 4DJJA 3M4YA 4NWIA 4Y2XA 5HG0A 4HNAA 5K8JB 1M2GA 1O03A 2GBIA 5IU6A 1YC2A 3DHVA 4TV9A 2R7LA 3VVBA 4HVCA 3M70A 5ES3A 2XBUA 3NYIA 3Q2KA 4KOAA 1JG6A 3G79A 3II6X 1Z2EA 2QMEA 1J20A 1V3QE 4JJIA 3FHJA 3HRIA 3EEOA 3X1WA 4G63A 3ZGVA 3BXGA 5KVQA 3ED1A 3Q9LA 5DNUA 1VRWA 5FAXA 1I3CA 3HZOA 1WUJS 1ZAKA 1PHPA 3D7MA 4II7A 5T5QA 4M83A 4DG8A 5A6VA 3EPLA 3EGCA 4OUKX 5H81A 5HJ7A 3BN3A 5K0NA 2MMCA 1ZMRA 1E2IA 3LBIA 1DAFA 2N3ZA 3H4TA 2A9RA 4IZOA 2A1TR 4JR0A 4R8LA 4CMEA 2BM8A 5HKKA 2AHOA 4UD2A 2QTBA 4C0SA 3R3JA 2XVYA 1SA0B 3N8DA 1G19A 3N6RA 1OILA 1NY5A 3V5NA 4G01B 4PZPA 2D2EA 3U7RA 1W76A 3IUPA 2NYVA 2QPTA 3KOZA 4H08A 1IIRA 3RGWS 5E6UA 3NFRA 1IYZA 3X1XA 5HVNA 3RS9A 3UAVA 3U7QB 1L8QA 2DEUA 4HDRB 3JQGB 2ZATA 5KC8A 3PE4A 4AULA 1S7GA 1GGNA 1W5FA 3OHPA 1PL8A 3C8HA 4H4CA 1G8HA 1DVRA 5TC4A 4OFWA 1CJMA 1T2DA 4YCBA 1TZMA 3FG9A 3FYSA 1BW9A 4QPZA 4YI5A 4HQNA 4EW1A 4LDZA 1OAKA 4XX0A 4DMLA 2JJYA 2QL7A 1P7CA 2BYTA 5DBOA 1DI0A 2NSHA 4LBYA 2G7MC 1GFSA 1L9XA 1JEQB 3EHDA 4ZVRA 4OM8A 2PQ6A 3FR8A 1XAIA 3I42A 2WWWA 2EDCA 4TVBA 5D5HA 3HEMA 4OI2A 2AOVA 4LKRA 3S3TA 3IALA 3HCBA 1M6WA 1BE1A 1TZ2A 2Y67A 5EYPA 4NXNB 4TWZA 4URYR 3L2OB 4JOQA 2PDAA 1W9MA 4KWHA 4V0SA 1GCAA 5ALIA 2OVBA 5EWJB 5FO0A 2IOHA 4EPXA 1Q7CA 5TPZA 2JD2A 4DSTA 4COKA 3ONDA 5K6AA 4ZJPA 1VIVA 2WHQA 4C06A 5ALNA 2IDZA 2WU8A 4PTZA 4W7IA 1Z6YA 1C9DB 4PG8A 2BFBA 3SQLA 5HRUA 5C8VA 3KKLA 4LXXA 2QTMA 3S0JA 1I4TD 4C76A 3THWB 1ZI6A 1X77A 2IIPA 3MRSA 4A2PA 2G71A 3RIXA 3ROTA 1FIUA 3U7FB 5IAAA 1G16A 3KAJA 4F92B 5H59A 4L8GA 5KNCH 3GUHA 4EZEA 2J6HA 5KNCA 5JCJD 1H93A 5E0KB 1RJDA 1WP4A 4KIJA 4QZVA 2BGRA 3EFBA 1I1NA 5AK5A 3R4CA 1BDIA 5DYIA 1NMSA 1TCBA 2PX4A 1DAGA 3JQ9A 1KSHA 4AYWA 2V9ZA 2JIZA 3IEKA 3FUVA 3OUZA 2WNHA 1KMCA 2XSZA 3KUDA 4G0XA 1K9SA 4FYPA 4BP8A 3R9WA 2G3YA 3WKBA 1FP7A 5ERGB 4PYQA 5EAIA 1S9HA 1NRXA 1OLXA 2D1TA 1ULSA 4ZIRB 3LRPA 4Q0MA 3TW8B 2PRYA 4U63A 2RHBA 1FLAA 2B36A 2VH2A 1AKVA 3EC1A 5BP7A 3ESYA 1OWLA 1A2KC 1FY2A 3VAYA 1IDOA 2QN7A 3JYHA 3S2UA 1ZM9A 3EEBA 3IVXA 3NWEA 2LP4Y 3K1YA 4Q1VA 2ZULA 4RS3A 1M2HA 1N75A 3LHDA 3RTGA 4EVQA 3P4YA 1R0SA 4W9RA 5L7WA 4I1VA 3N7TA 4J16A 1H1TA 4AO8A 1J39A 3HP1A 1DOZA 3T38A 5EMHA 1FYWA 4J0EA 2FW8A 4R6WA 3WDKA 4Z4IA 1KMHA 1YDGA 4UAVA 4QC2A 2DPXA 4UZEA 4MVWA 3VSAA 3PEVA 2C1XA 2Q6KA 1R18A 4FNMA 2C9CA 2FWRA 5DHQA 4MIOA 3SQNA 3H0EA 1H23A 2F1HA 4DIEA 3P9SA 3BMOA 3JQBC 5CFNA 1IB0A 2GBPA 2JDIA 2GZMA 2JAHA 1GNPA 3N2NA 1GT6A 4ZHQF 1AKMA 3FZYA 4FMBB 4GMHA 4NG5A 1FW6A 4P0TA 3Q6IA 3ADBA 1U2PA 2QY6A 2OFPA 4LF9B 4IQ8A 4EJ6A 1WZEA 5FULA 3TPCA 3E2IA 4NAHA 3BS4A 5ICCA 5JRJA 2YZ7A 1NXWA 2O5CA 1ORWA 2W2TA 4CV3A 1XELA 3UVEA 4LWPA 1RPZA 1T1IA 1BH6A 1W44A 3IT3A 1PL7A 2ONKA 4XEHA 3LUKA 1NZJA 3RARA 1ZIYA 2X8BA 3PL1A 3DAYA 3S7TA 5JSZA 2QDKA 3LA6A 2GK6A 2O0KA 1P5RA 1TT7A 2B21A 2JHCA 3KR1A 4FEAA 1RRCA 2J0SA 2R6GA 5C35A 3GP8A 1GGHA 1MEJA 3DEIA 1D2HA 1M2VB 1PP4A 4DA4A 4QOGA 4KN6A 3QA9A 3SX2A 3H1EA 1H4TA 2NNLD 1SG6A 2ODBA 4MRMA 3AEUB 2R11A 1MG5A 1JA1A 1V11B 2WPDD 1OHHA 4KREA 1G21B 3MGCA 3HI6A 3N74A 2J9FB 4G65A 3PX2A 2ASEA 3BJEA 3VR5D 1I36A 1V1MB 5SYNA 4B73A 2P1RA 4DPKA 1OI4A 4NC9A 4BO4A 5A3QA 1TADA 1RPNA 4LHVA 3CSDA 2CVPA 3BWDD 1SG0A 4NARA 4AG5A 2GO1A 3GFRA 5IZCC 5KSWB 4Z4EA 1H9CA 4ANFA 1LQ2A 3HU2A 3T7KA 4Q3AA 1O96B 2IXGA 4CV2A 3ZD6A 1ZJ4A 2H1RA 3JSAA 3QFRA 5C7IO 1ES9A 4QYIB 4I4IA 4JBYA 1Q6ZA 2GZDA 1PX0A 3ABOB 2XB6A 3K7EA 4N39A 4LV6A 2GJ8A 1BVRA 3EGWA 4CKCB 3COPA 1QG6A 3BQMB 3INNA 1TD1A 3L0SA 5A6SA 2BDTA 3I05A 3LOUA 1O95D 1UM9B 3TDKA 4KVFA 5IVDA 4AY2A 1MAWA 1QFXA 2LDBA 4JC4A 3UCXA 2CHUA 2V9CA 1W5TA 3F5SA 4ZC1A 1WHSB 1AC5A 4U2KA 2FJUA 4GMKA 1FRFS 3ZIAD 2VQEB 2NVUA 2JIMA 3GVPA 4ARAA 2ZRMA 4RZ3A 1CR0A 1C1HA 1P7YA 2PLNA 3GF4A 4GSLA 3T7EA 2IYWA 2GLUA 1ZK0A 4PHTA 3V8BA 2PMBA 2E1PA 5EESA 1WULS 1HT2E 1FUYB 3GGGA 3CEPB 4I19A 2ZU6A 2QDXA 2F2TA 3OT4A 4HGYA 1B6SA 1Q91A 4JLOA 1OYWA 2ECQA 3PWZA 3R7NA 4ZKEA 1CTQA 1I5EA 1TUGA 4IJUA 3CNHA 5BSRA 3OKPA 4NLLA 2W2QA 5D3KA 5EUBA 1XALA 3GAFA 1QCCA 4PQEA 3L7BA 3H8SA 1FTSA 2AD1A 3ABZA 5D51S 3AW9A 5AM1A 4A03A 5ETJA 4PRYA 2A9QA 3MNFA 4YJGA 3PHBE 1EFAA 1NE7A 3IGFA 2IUTA 1E9AA 4DLXA 3ZVNA 3NJ4A 1E2MA 4RNCA 4X3OA 1PFVA 5D87A 3WMXA 2C31A 4J91A 1EFCA 3SD7A 2HEGA 3WJ2A 5BNIA 3C3AA 1FDSA 2JCSA 2V7WA 3SVLA 3CTPA 3CR8A 3SQDA 1KI6A 1GA4A 3FUTA 3LC7O 2NV2B 1BXGA 3BC1A 3PPYA 4LRWA 5IBRA 1UKCA 4ITRC 4YYEA 3I1JA 1DARA 2J07A 1N2CE 2G8NA 2JB9A 4TXJA 3WTBA 3PX3A 5I3ZA 4YI3A 3E5HA 1G7RA 1HMPA 4UDYX 3W8DA 1PGOA 3WI7A 1BHO1 1JLLA 3QH4A 4QXMA 1VLHA 5DMHA 5KTKA 5ED4A 3KYIB 1NV9A 1EXNA 2FK7A 4Q7JB 4MP3A 5F77A 4DTCA 4P0QB 4BMCA 3MJVA 2DCMA 3O1IC 1JL3A 4HATA 1RE1A 3KYDB 4CZ2A 3W2FA 3LK6A 4K6GA 3EWNA 4L1KA 4YT8A 4GNRA 3G8CA 3EAFA 3BXHA 4ZYYA 3QPCA 5BW5A 1GZ4A 1U1EA 1V5GA 3EF0A 1RAEA 1XDGA 4DFDA 1BX0A 3ZZTA 1PW5A 2XVZA 4P58A 2P6MA 1VJRA 2ZAYA 1ML3A 1XMSA 3AY6A 3T3HA 3C6KA 1DE0A 2BKXA 4PLZA 4Y0NA 4A1FA 4H3HB 4HGOA 1I5RA 5KVVA 1QUEA 3QEMA 1YZNA 1RI1A 1T4BA 2EF0A 3GPCA 3BJRA 4MV8A 3JQ7A 3EXFA 2GM4A 1MZVA 5FBQB 2H4JA 4NK5A 1GZ7A 2GILA 3OU7A 4KUEA 4MR7A 4OBXA 1YS1X 1EG7A 1P7PA 2UV8A 1DDGA 1ZUWA 3NGXA 3W79A 3AVUA 1URPA 3PC8C 2YJNA 5A0TA 1D8TA 3ZWNA 2XODA 2C2HA 1JHUA 1R8SA 1CV2A 2GJAA 3CUUA 4IHKA 2RHMA 2CFCA 1OVGA 1SC6A 2X6RA 2QX9A 3Q0IA 1EJ6A 3OM0A 4GG1A 1MX5A 1WMEA 3RKSA 2FMHA 3HHEA 3KEGA 3PXAA 3V7FA 3KAQA 3WGLA 1X39A 2IS4A 1N2SA 3ESQA 3SJZA 3GGDA 2OB1A 3DEKA 2O52A 3S70A 3USZA 2IYAA 2MINA 1TQ4A 2OHVA 2HF7A 3B48A 5G53C 3WHIA 3D3NA 2C8JA 2WG2A 1YRLA 1PR2A 2I1VB 2AE2A 3U3XA 1Y89A 3H8WA 2VPXA 3DAOA 2AN9A 4P93A 2WJIA 5I9SA 1JXQA 3V4RA 1UC9A 2DJ5A 2PZJA 3FLBA 2ZAOA 5FTLA 1RRGA 1TZBA 4Q9AA 4LDQA 1Q1BA 5MN4A 2GJ9A 3TCNA 1MC4A 1IHOA 1PG0A 2I22A 2REQB 2X0NA 3ETNA 2XOEA 4LYFA 2HMTA 1QLJA 4PAGA 4BRWA 1JT9A 4WK6A 2IDMA 5F3RA 2GXQA 2ZTUA 1U3FA 3CUVA 3UGKA 4Y1EA 5LBUA 4WOJA 2GEKA 2JG3A 4U7PB 3L7KA 3HCAA 4JFRA 1JE0A 1RE0A 4RJJA 2OV1A 3WRWA 3PT5A 2OECA 3S2GA 1J8FA 4FBMA 3I01A 3OJ0A 4KACA 4PIPA 1G41A 3IR6A 5BR8B 4LOHA 2R8PA 1S2NA 1J8YF 2CMFA 1NE2A 2WZQA 3JVEA 4RY8A 3CEMA 4JVOA 4UOEA 4Q1BA 2PS1A 3OZDA 2P2NA 1PQ4A 5D6NA 3ZWBA 2FWPA 1YMUA 5BVGA 5EERA 3UICA 5KOHB 1CUXA 1C7IA 1IOVA 2ZROA 1MQSA 3AI2A 3SAJA 3D3QA 3DZ8A 3M5CA 3IP3A 3P9PA 4F91B 3JX9A 1E4EB 1L3CA 3N8HA 4DJTA 5HK8A 1L7MA 1T2UA 1V35A 1X1AA 1UMBB 3AEQB 3JZDA 1J33A 3IIJA 4BZQA 1JVBA 2PXAA 3HSKA 1EVKA 1CFZA 5AW5A 2BBOA 1K06A 3RYTC 3ZV5A 2UZIR 2GK4A 2IHVA 1Y5MA 3IBGA 1L4HA 3A6KA 3LVQE 4JDUA 1V7ZA 3OSUA 1PS9A 3U80A 4R4JA 1MOPA 2OG1A 2X58A 1RACA 2V5VA 3QKSA 5IM5A 3R7SA 3K0AA 9LDBA 4YBZA 3GXBA 1W1WA 3I64A 1QH0A 4Q1AA 4N5LA 4D43A 1PV4A 4MHTA 3DO8A 3SXUB 4MCIA 5IRCD 1FFWA 1R74A 1M83A 5LXTA 1TZCA 1Y1LA 1C0EA 2HV8A 4KX5A 1RYBA 4KYTA 3PEUA 1P9WA 1ETHA 2WPDA 5CM8B 2O8DA 1KAEA 2HC9A 2DF8A 4NFYA 4RX1A 2QRPA 1WOYA 3VR5H 4MP6A 1XQ9A 1FC0A 1TD9A 1DQSA 1V8BA 3FCXA 4XM1A 3VR5A 4DZRA 3FHOA 4OQMA 5LUBA 2NMVA 1L1QA 3CWCA 1V2GA 2V58A 1KA9H 4QEKA 4IXDA 1PFUA 3AB8A 1CUZA 2C5EA 3E5NA 3GGPA 2LW7A 1X38A 3JQCA 4EOGA 1LTKA 2VHYA 2FEAA 1L7QA 3EQ7A 3ZKWA 1G20A 5KVCA 1TQHA 1Z2PX 2LKCA 3B7WA 1KEEB 3LLSA 4LV8B 1EE1A 1CKEA 3GDGA 4RY2A 4ZQFA 3K5HA 4ZXFA 3UJ3X 5EJ7A 4D6PA 4PWZA 5B1YA 3AJAA 3FNIA 3KAKA 1QHIA 3MT7A 4JSTA 3F7OA 4G97A 4QOSA 4OBBA 3WSWA 4EAAA 1O95A 3GDFA 4LKOA 2QIPA 2XUOA 5LYJA 3K70C 2QN8A 3RM3A 3EY9A 1K88A 1ZCJA 3BDVA 4XYEA 2IY8A 4NSNA 1UQTA 3MS7A 4U7WA 1KEUA 3RU9A 8GPBA 1TYCA 3T35A 4BVGA 1FXWF 1GL9B 4R7GA 3FSGD 1Q83A 3ZIAA 2IOQA 2DETA 4HB4A 2XCUA 4QPNA 2QTLA 4TT8A 3IAAA 5E6RA 5ECDA 1QSGA 2Q3EA 5FL3A 4ARSA 4CBVA 4EM6A 2PBRA 1W73A 1SBQA 4L8FA 2XCQA 1WZCA 4KPFC 5ALYA 1E9VA 2HI0A 2RGWA 3C7AA 3CGWA 3K0BA 1PFYA 1UP7A 1KI4A 2BFDA 5EJIA 2I65A 1NBOA 1RM5A 2MYTA 4WKGA 4Z49A 1A96A 2HXYA 2JIDA 1IN5A 2FKAA 1H9BA 3GW8A 3D7NA 1TZKA 2H17A 4HNQA 5EKDA 3UWPA 1E8MA 3QLVC 5LU8A 4UEOA 3M34A 4J1SA 1LQUA 5LR6A 1DBWA 1L5YA 4LRSB 4RK0A 4LWQA 4BZWA 3RYIA 5DEOA 5KDLA 3WOHA 4WNYA 4G5XA 1KNXA 3RC9A 4KP7A 3IAEA 3CZRA 4CL2A 4HUQA 1BXZA 4MYSA 5DF1A 5AVOA 2W2KA 5G1OA 1R66A 2AOXA 3DYIA 1ESCA 3N2YA 3WHPA 1ONNA 2HMWA 4CW7A 4U2DA 3B7GA 4LZAA 1WCYA 3CH4B 4W1SA 4LFCB 2VTKA 4TMXA 2O0LA 1PT9A 4BNVA 3OA2A 4TM7A 3H2JA 4MEJA 2XWPA 2GEDA 4OK6A 5FOVA 4LDNA 4ZYZA 2PGAA 3T1OA 2Y3IA 3VKFA 1HE4A 3PQ2A 2VTBA 1SKBA 3WA7A 3OO1A 1A2QA 1L5WA 1NP7A 4TROA 4XB6B 5AW1A 1JHXA 1M8JA 5TQJA 3OZXA 4L7VA 4YRTA 3RS2A 3SM3A 4CM9D 1RHUA 1Q1AA 5GZ1A 1ZINA 1SPXA 3FPEA 3JRNA 2WSSD 2ZUBA 4Q3KA 4Q3LA 2YHUA 3DSRA 4BASA 3ILVA 2WAYA 4A6EA 1D4FA 2WF9A 2BISA 3L1VA 1HFKA 1TTHA 1L8LA 3ASZA 3N1UA 3D1LA 3JWGA 4H15A 3W8RA 4EZIA 3DONA 1JLRA 1ZD4A 2CK3D 4B2PA 3RREA 2H7XA 4OHYA 3LL4A 3WB9A 3A14A 3QTTA 1WB4A 2FTKE 2AN3A 4N49A 1XAJA 4IHJB 2CE2X 4UATA 1MAHA 4RK1A 1FXSA 2ZJ1A 3IV9A 4BVAA 2O3SA 1JMVA 4AZ3A 3T5PA 2CW5A 3G6WA 4U7HA 5FYDA 3SYTA 3EEYA 4F86A 3JATB 4B6RA 2NP6A 3OPXA 4PRKA 2XTNA 3PQDA 2IWHA 1T2NA 2HUPA 2QAIA 4P4LA 4EPRA 5DLEA 1MQ8B 1WB6A 2MT9A 3IEUA 4URVR 1NWCA 3G9XA 4W5JA 4FD3A 3PTZA 4HDSA 3T41A 1QS0B 2WWRA 1T25A 3UOGA 1WW3A 3WNCA 3R20A 1E3SA 2FZCA 3AEXA 2UDPA 4PXYA 1U2ZA 4YAEA 5DNCA 2ZZMA 4BEJA 3U16A 1DS6A 221PA 4DCTA 3WKCA 1NOJA 2DFVA 1OJ7A 5M34A 1OX5A 1KFJB 3QPAA 4M0PA 1XU9A 4KODA 3QNUA 4AYXA 1DC5A 5LQJA 3OOSA 4QU9A 1E1KA 1ZM2A 1NN5A 3E7XA 3TOXA 1WWKA 3BXXA 3IS3A 2I3BA 2RSLA 1UMCB 3OETA 5E2BA 4RVNA 7MHTA 3LKVA 5IVIA 3PG5A 1THTA 1JHQA 3D8UA 1GLVA 1GLGA 2Z2ZA 4M9RA 3A06A 3FPSA 4Y2PA 4FOTA 2XLCA 2XKJE 4JITA 1P0IA 3LWZA 5EWLB 3ZY3A 1FQOA 3AFGA 2QBYA 1KKUA 4K9OA 3R76A 2OEPA 2X1VA 2CC2A 1II8B 3I73A 3PRKE 2P91A 3DUWA 4GL4A 1K7FB 2HIHA 3EVDA 2VAPA 2WUEA 3OQPA 2J59A 2NUAA 1ACMA 3WLMA 3OZWA 1YASA 1RI2A 2X13A 3ZU3A 2FZEA 5A71A 4ECEA 1POXA 1J06A 1WY5A 4KK4A 5K45A 3K20A 1Z6AA 4UHHA 3ZH9B 1W5AA 3FYUC 6YASA 1ZC4A 4R1PA 3FFBA 2CXUA 3AHHA 4G89A 4WLOA 4K9RA 4P1ZA 4XIJA 3MTIA 4NZMA 4BV9A 2WZCA 2OFXA 4DWWA 5THKA 3P9QA 4KPYA 3H2GA 5H70A 3IX7A 2G08A 3NO4A 2HLPA 2QUIA 4M6WA 3S2IA 2FN9A 3VPAA 1FP6A 5DXFA 4KFRA 3UJNA 2QZ4A 2CXNA 1GZHB 2NUBA 3SLGA 3O8CA 1S6YA 3C39A 4UNRA 1J6UA 1VG1A 2VA8A 2C9ZA 1YBAA 4NCIA 1RYMA 3EZ9A 4DLYA 4YHBA 5ALPA 3REQB 4LJAA 3LVBA 4IEEA 1A2OA 3IVCA 3F1LA 4WT7A 3ROZA 1V8FA 1YE5A 2DTDA 2QXYA 3HCEA 4K9LA 3ZI0A 3O4IA 3Q6MA 4NJEB 2PGLA 2VK1A 1XF9A 4B79A 4TRNA 2IGTA 4Z2YA 3TQFA 4CIBA 2GTPA 2BMAA 2FX2A 4RKQA 1GQQA 2ANCA 2VJOA 3M6WA 2JJQA 1R4ZA 3RSOA 1J24A 2ACEA 4IDQA 4E1VA 1QZ3A 5GWXA 1XRQA 2D7JA 2H63A 4C1BA 4Y0VA 5DCUA 4FGUA 1J90A 1XTJA 2FQ1A 1U7WA 5AVWA 1KI7A 5DW3A 1N5LA 1P75A 3M1YA 1FS6A 3MAGA 3TK1A 1RXUA 4F3NA 2QRGA 2PXCA 4ZPJA 2F3RA 1YDWA 2PT7A 4LYEA 4QTXA 4C4OA 1C9YA 3ZJ5A 1UPBA 3PCTA 5E95A 3MQ4A 1V5IA 2JCGA 4HL6A 2GAFA 4XOIA 3CMMA 2JC3A 2ZJ3A 4ZO6A 1X1BA 2AG8A 2B4KA 2CL5A 1WCWA 2I29A 2JBAB 2KBEA 2W8ZA 3DOCA 3MJDA 2NO1A 3O75A 1OZHA 2YDYA 1PVVA 2VHZA 3OOJA 3QVOA 5AKZA 2R8EA 2W2XA 1WD7A 4I81A 5FTJA 2N75A 2Y1WA 4IDEA 2EFDB 3UJHA 3U37A 5JXJA 4IDOA 4B3DA 1CEQA 1NPDA 2E21A 2J4FA 3W77A 4A4DA 4EUKA 3WL3A 4HJXA 2LCQA 3WIVA 2E89A 4BKOA 1R3UA 1I3NA 4WLEA 3TLCA 1K75A 4OD0A 4UKDA 5K20A 3BMNA 3GUUA 4ZMBA 1BWQA 2HO4A 1QOZA 2I4RA 1J5PA 4H27A 4PIVA 4A8TA 1N8NA 4BMYA 1MNQA 4YNBA 3VR1A 1XR3A 1ZGZA 1C7ZA 1TVKA 3FSGA 3C98A 4MVYA 2PUEA 2H06A 2FMUA 1PR3A 3VZDA 4I1PA 2EQ5A 4IXWA 2ZPTX 1ZOSA 4KO3S 3TLEA 4FPXA 3U7JA 1T6BY 5AI4A 1A2BA 7AT1A 4IIVA 3BRCA 2FPUA 4UW9A 3H97A 1IZ9A 3OQJA 4GPZA 2QRHA 2H0QA 4H7PA 4KIUA 3ZD9A 4B1FA 1MOQA 2X0KA 3FM9A 3DNPA 3LLCA 4OHKA 1OBOA 5FPQA 2G06A 3IQHX 1DELA 2GBGA 2JGFA 2YL2A 3ETLA 3N2EA 1G5RA 3NWBA 4R2MA 5F1OA 3ROKA 3U4GA 2H5LA 5ELLA 1ZOLA 2YYZA 4Q37A 2OGTA 5TMDA 1ZK3A 4XVUA 4HLDA 1GPMA 1IEXA 3Q3VA 1GOTA 5H3LA 5CYGA 4P5EA 4KLRA 3RG2A 3IQIX 1K89A 4II2A 5FEMA 4YC7A 1L4MA 1V0JA 4AD8A 1WRBA 1OYVA 1NA5A 2BCGY 3D2LA 2Y76A 4K2HA 4KR6A 2DJIA 4D45A 4QGBA 2ZXUA 3U44B 1YU6A 3OICA 1FYEA 3USCS 5GIOE 3ADCA 4GR9A 5EPOA 1UPFA 3PKIA 3NV7A 4NYIR 2XMZA 3O83A 4KZKA 3STVA 1T8SA 3BXOA 4LF6B 1C0KA 2BVNA 5CH3A 1LV8A 2WFLA 5EJGA 2ZWPA 1W7AA 3T4XA 2QZSA 3OCVA 1RKBA 4LBZA 4WBSA 3YASA 4O3MA 4GX1A 1U7DA 2I2FA 1SVNA 4FYKA 4CM9A 2PKXA 3FX2A 1UDWA 4EKIA 5ITZB 2QYSA 4W1QA 2R1VB 1NQUA 2WSSA 3T12A 2CZGA 2IVFA 2VZEA 3UQZA 4EFKA 2V7EA 3LXRA 4TKVB 3ROEA 3LXMA 1GADO 4FZ3A 1LLUA 5K3BA 3H0KA 1HG0A 4IKOA 1DKQA 1SB9A 2ISCA 3B9QA 1YL7A 2CK3A 2H1SA 2RGGA 4X7BA 5EC8A 3SSAA 3MHPA 2VWGA 3OPVA 3L1IA 3V6LA 4JVMA 1ODKA 1YOVB 3TCXB 4ACBA 2QNIA 4RWEA 2BF7A 2ORYA 4LQCA 4PSCA 3GEIA 3GQBA 1QNFA 1SC4A 1MBZA 3AY7A 4BMZA 2Q4DA 1JALA 3RJZA 4I1IA 4FXOA 4A36A 3PQ7A 3RS8A 2QRNA 2I4MA 1IH8A 4MUNA 1I10A 1YZFA 1MO5A 2VWPA 4HQFA 5DYYA 1YFKA 4L3OA 3X2FA 3ZQUA 5HX7A 2O8CA 1PWHA 1P5HA 2BFAA 2WJGA 4YMHA 2IYUA 1ZP6A 3DT8A 1A7KA 2JAPA 5C3MA 4RHCA 1W85A 1NVKA 3EZFA 3MTEA 4DRXA 3U4HA 4CLOB 2PZGA 4D4MA 3O91A 2ONYA 2GWHA 2Z1MA 4XQCA 3F97A 3PHIA 4BAZA 2YXDA 1RWWA 4OQFA 4RLSA 4WNIA 3U56A 4CODB 2VH5R 4OQ4A 1KI3A 2QTFA 3K8QA 1FTQA 2OVFA 4CT4B 1E60A 4R1MA 1AKEA 1PG5A 3ITKA 3O8NA 5FNZA 4HEA6 4NKRA 4LEIA 1EGAA 1J2EA 1EK1A 1X7GA 2E48A 2QN2A 4QULA 4OLBA 5J59A 1M1YB 2B8WA 7REQA 4Z7OB 3HXMA 1Q0PA 2GB4A 4R41A 4HDOB 4TWBA 4FIZA 4M7PA 1A72A 3C1TA 5CFQA 5HBGA 1FNBA 1G21E 2FJPA 4QJBA 5BN1A 3W6NA 4IDGA 4ZAZA 3NYWA 1U2RA 1KQFA 3VPFA 1CZRA 1UDRA 3EA5A 3HR4A 2NU8B 2W6OA 5LP6A 2OFOA 1D1SA 1Z56C 3AM1A 3DP7A 2IUFA 4IFIA 4D8WA 4ER5A 1N7HA 1PR1A 4H59A 1XK7A 3P2YA 1C5KA 4V2UA 4FHEA 5EWMA 3SC2B 1UWCA 1DC8A 3ZJUA 4O8CA 1IOLA 2O7VA 1FRZA 5JLAA 4W1PA 5H5JA 2W8BB 1L7EA 3MINB 4MRAA 4RMJA 4WN9A 4B8ZA 1FTGA 3EXHB 3HCOA 3QVVA 4Q4HA 3HO8A 2I55A 2PFSA 4GWGA 1S4QA 5EIAA 1L5LA 4DV1B 1S3FA 2FQQA 2IYSA 1JB1A 1IHUA 2BMDA 2I33A 2XQKA 3D2AA 3DQQA 1L7PA 3CX6A 4W6QA 4Y2VA 2QTTA 4RZSA 4C7VA 4MV6A 1TU4A 4MVCA 2J85A 1W1IA 1L7OA 3L40A 2C5SA 3AL0C 4PS0A 1CK4A 1PYDA 4KEAA 1UBRS 1QWOA 2GEUA 3ISJA 1EM8B 3LPNA 4UBIA 2BSAA 4L0CA 3RJTA 3RK1A 3TMYA 3UBTA 1Y0BA 5C8YB 3QKUA 4YRAA 2VJLA 5E2IA 3NEYA 3PIRA 5C0OE 3DF7A 5CDYA 3G2JA 4ZYUA 4NEQA 3NW9A 4NMXB 2FF5A 4JR2A 1JBQA 2XRYA 4DS3A 1RP1A 3RRYA 5JBQA 4AFNA 3QPDA 4I4LA 1H2BA 3GH1A 2ZSUA 3N2GA 4HC4A 3CNNA 4RJIA 1PR4A 4DPMA 2WJAA 2XADA 4IJVA 4HAOA 5CB8A 1EFVB 1YZVA 5E1BA 2Z58A 2K2WA 3L4EA 4C0QC 1E6KA 2Z8XA 4ZQEA 4BIIA 1V26A 2TMDA 2GAAA 2P90A 3R9KA 1BVHA 4X60A 1K7SN 2QRVA 1D2EA 5KOJB 3G85A 1W88A 2ZWAA 3PTLA 4WKOA 4RZXA 3FTDA 4E5KA 3CLSC 3PWKA 3EXEA 3I83A 4L76A 2Q27A 4ALMA 4DOMA 3Q8LA 1HQCA 1UBEA 4N3GA 2JJ1D 2D74A 2FPXA 3QPWA 4G5SA 3LW8A 4RH0A 5CR9A 4N5HX 2SBTA 4IZ6A 1I4WA 4LPKA 4YHHB 1V6SA 5BWLA 2ZYAA 1XEWY 1CETA 3BG5A 4Q1DA 4XM2A 3G2KA 2NAPA 3JARB 4O59O 5JALA 2ZTSA 5IT0A 2Q45A 1RWNA 1ZVJA 3ROFA 2QSJA 4U2BA 2MSLA 3MD9A 4G1CA 1PAUA 2I9PA 1I7NA 4G0NA 5BXYA 1I7PA 4IDDA 2L19A 4PBTA 1EFPB 3I6ZA 5JXHA 3LBAA 3QIVA 5EZYA 3OIDA 1VA4A 5CFRA 3K0FA 2A5DA 5EIBC 3NU1A 1HQYE 1VYVA 2XUGA 3MMZA 3R4VA 4V02A 1VXRA 2OM2A 2WVGA 2FHPA 2GSWA 1U02A 2QMOA 3BFVA 3JAWB 3R3HA 3TLYA 1JNYA 3D7KA 1SB8A 3MYRA 1FSSA 1E9SA 4X5OA 3ZWMA 3K09A 4MZXA 1RHJA 3THRA 1I24A 3E1KA 4N18A 2VNAA 2H4ZA 4O4IF 4D99A 2ZKLA 3SICE 1LVUA 3CZ5A 1BCSA 3IBTA 4PG5A 1JDJA 1EPUA 2ZJZA 1EUCB 3TZQA 1E0SA 4ZGWA 5BWCA 3WWYA 2J8ZA 5IC5A 2ODQA 4K9DA 4N7MA 4BLSA 1UFVA 1G38A 2XZOA 3D3KA 2UUOA 1P91A 5I48A 3V4PB 1EQAA 3CIFA 1KS9A 4P81A 4C21A 4EH1A 5A4MS 2F4NA 4LSMA 4XUCA 5BQXA 1PUJA 4UM5A 3L8MA 4K40A 3AF4A 1G8KA 1DBPA 1E1LA 1ZNZA 2QJFA 3DE1X 3LYAA 4G56A 1JIIA 4URWR 5TF0A 2AFIB 5HTOA 4RYDA 1GDHA 3IHTA 3WHLA 4HLUA 3WMFA 3WY9A 1LRKA 4CKWA 5ICSA 5KQPA 3O8RA 4WINA 4OMUA 3OQHA 4QUBA 5ALLA 1PTKA 1PLLA 4JL6A 1AKUA 1OR8A 3F6PA 1QH8A 3U48A 3G8YA 4EG5A 3LY8A 1G5PA 1ZGGA 4Y1GA 3W5UA 1ACJA 1IB6A 1ZNWA 2BFEA 3DMRA 4OQLA 5GOZA 3OQNA 5IP5A 3O1HB 4N6GA 3W6ZA 1N25A 2EG5A 1Z5WA 2PRSA 4MUXA 4PQGA 1CRWG 2LCIA 3E48A 4TTQA 4UCWA 3AOEA 3Q1KA 1JILA 1LLFA 1LTHR 1T9CA 1XJCA 2JVKA 1JKXA 1U90A 1D0VA 2PKQP 1AS2A 2XWJI 3BHMA 2R48A 4NU5A 3N87A 5HMMA 4PZEA 1YKFA 2H2AA 1XDUA 4OHVA 3PRYA 1HL7A 3KQKA 4ZOBA 3I34X 2XGGA 1AHNA 4XR4A 2IZ5A 3RR2A 3QWAA 4UMFA 4DLBA 2Z6QA 3NRBA 5KMGB 4AECA 4RTKA 4XD2A 4Y2GA 4G5QA 3ANLA 3JZMA 3G2IA 1JS1X 1KZ6A 4QICA 4B44A 3NC4A 3UOAB 3HSSA 3NAZA 1B2RA 5IUNC 2C7RA 5FI1B 3AIOA 2V1UA 5FPPA 2ZS7A 1QP0A 3UMRA 4Y18A 3R5KA 4HB2A 3W9SA 1TA9A 1N36B 1ENYA 1T91A 1KVRA 1T9BA 4PNHA 3THSA 4CNQA 2IA5A 2OCBA 6CHYA 1ISFA 3BKXA 3D0OA 3KCQA 2ZFUA 5E7QA 2C4VA 1N1MA 3KLBA 3IPAA 3KJGA 2GN8A 1NSFA 3ADKA 1T34A 3D4OA 4O2BA 2OR3A 1WCIA 3WYEA 4A2QA 4L4YA 3G0GA 5IDYA 4F5DA 2GCOA 2C4KA 3OEEA 1VSVA 2PUTA 4JI8B 1YOBA 5FWDA 4ZI3A 3A9UA 2E5LB 1XCGB 1US8A 1Y9JA 1JZTA 1W2GA 2IYQA 3BSYA 1GT91 4Q93A 4TSKA 5E9JA 4BB5A 2JCBA 1F2VA 2NT4A 4KQEA 1K2VN 3RIYA 3W7BA 1SFRA 2Q1WA 1CB7A 1LPBB 2WMDA 4A16A 5IDWA 2AG1A 1E7RA 3UH1A 2DUJA 2JATA 2ACKA 1TF2A 2Q0QA 1CS4C 3JQRA 1PBNA 4GZ6A 4HWOA 3ZJVA 4L6IA 1WY7A 1G7TA 3LZDA 1VMIA 1XZEA 2ZR9A 1OA1A 4LNUB 3HBAA 2VUHB 3B5EA 1HQKA 3JSXA 3QP9A 3WMWA 4C0KA 1FTNA 4BEBA 2BSXA 3RV3A 4V1CI 5JZ9A 3PX7A 3HRKA 4JWKA 2ZM6B 1CUAA 1BSVA 1DG3A 1G63A 1T29A 3CF6R 3P5SA 4WKCA 2UYQA 2W2LD 1QHSA 4BFYA 1HDIA 2YWJA 2Z5GA 3I92A 1OFIA 3DYBA 3QMVA 1WBBA 2O8EA 1A9PA 1NJ1A 4ZVUA 3IMFA 1IQPA 3K1AA 4UCQA 5AHRA 3LCCA 3AR5A 4FU0A 1VB3A 2AN5A 3LX5A 2JI4A 3PXGA 3JQDA 4Z9XA 1EDDA 2FX5A 3M1IA 1E9RA 1DKRA 1KAQA 3WAGA 3IBSA 4MGIR 1WZNA 1GAJA 1TPZA 1K8ZB 3KOMA 3A1TA 1NU6A 4MITA 3TQCA 4RF4A 1SAYA 5D3MA 4YXWA 5IZ4A 4P36A 1J9ZA 4D79A 3B3FA 4YP6A 3KR0A 2X0EA 4DAOA 1X7ZA 2GDZA 2ZTLA 3HDYA 1U0JA 1E9EA 4UPDA 4I5IA 1UM8A 1TFRA 1VKNA 2VLIA 2OO7A 2RC6A 4PIMA 1GCGA 1DWUA 1EDEA 1K3UB 2WD9A 4WQMA 2NLOA 2WG0A 4K9PA 4NCHA 1UJ4A 1CR2A 3CM0A 2O2SA 1J2RA 1T0HB 4WZ6A 2DAPA 2LDXA 4TYNA 3VJRA 1BVUA 5KU1A 3ZZMA 4RHEA 3ZQJA 4TN1A 1R0LA 2GLXA 3TUZC 1CF9A 1Z33A 4W9NA 3TECE 4ENPA 1NR1A 1ZO8A 3N2KB 4KR3A 1DG1G 3C15C 4UHBA 4HAYA 3NIDB 4FDTA 4HF7A 4QBKA 4WESA 3PQCA 1NASA 3O82A 2WDZA 4IVPA 4M3NA 2CVQA 4QPPA 1M5UA 2PBZA 3T7TA 3ZLTA 4BNTA 1MXHA 4D02A 1Z0ZA 2C29D 4FDVA 1YRYE 5FXMA 4E7PA 4X0EA 3PENA 4MKGA 4BYMA 1PSZA 3K9QO 4O2AF 3GZTB 4MYDA 2BOVA 1D7OA 4X1YB 4B3TB 4AS3A 3GZJA 1L4YA 3C8ZA 4FI3F 4IDPA 1HFJA 4XXHA 2Y68A 3WIEA 1EVZA 2QMYA 4R16A 5MHTA 1LQTA 2CNLA 4U0JA 1UAYA 1P29A 1E1CB 2B25A 2VPWA 4RA6B 3D5QA 3V3KA 3ZV4A 1N5IA 1U1GA 1XJ5A 2H1OA 3ZY5A 4QJ4A 5NLLA 3OT1A 4AJNA 4BECA 2CBXA 4Q7QA 2ODTX 3PFWO 4EG4A 4GGPA 1KE1A 3EC7A 5CT8A 2H51A 3AF5A 4I4TF 4CYMA 3A2NA 2Q4RA 2HCBA 2OHJA 1EFUA 3A6FA 2R86A 4HVTA 4US0R 3GLGA 3G68A 5DNAA 3VHQA 1RC8A 2JJ1A 1SN7A 3CF4G 3ZWVA 4EYKA 5JFOA 3KZXA 4HH3C 4Q03A 4DY6A 5IJXA 1NL3A 4AKHA 2M2IA 2MYUA 2CKDA 3LG2A 3UAWA 5KTTA 1FUUA 3L7MA 1TAHA 1N8TA 1RFGE 2P5UA 3H1TA 1KYYA 3LSTA 4NS1A 2OXIA 4F21A 4Q4DA 1QAQA 3SS7X 1K5PA 2PPLA 2IQ5A 2PK3A 4BNIA 1QCZA 3BAFA 2ZLBA 3NT2A 3S99A 4DA6A 2CEAA 1OH7A 2XI4A 3D7SA 3OPYB 2OXTA 2BR5A 2RG7A 1KYIA 2P11A 2CWDA 1RJ9B 4DIDA 2JEOA 1EKXA