1F9AA

Crystal structure analysis of nmn adenylyltransferase from methanococcus jannaschii
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
164
structure length
164
Chain Sequence
LRGFIIGRFQPFHKGHLEVIKKIAEEVDEIIIGIGSAQKSHTLENPFTAGERILMITQSLKDYDLTYYPIPIKDIEFNSIWVSYVESLTPPFDIVYSGNPLVRVLFEERGYEVKRPEMFNRKEYSGTEIRRRMLNGEKWEHLVPKAVVDVIKEIKGVERLRKLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords HYPOTHETICAL PROTEIN MJ0541
publication title Structure of nicotinamide mononucleotide adenylyltransferase: a key enzyme in NAD(+) biosynthesis.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
total genus 52
structure length 164
sequence length 164
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.1: Nicotinamide-nucleotide adenylyltransferase.
pdb deposition date 2000-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1f9aA00
1H1TA 1P7PA 1JEDA 4EGAA 3ND6A 2CV1A 3UY4A 1KQPA 3JXEA 3UOWA 3DO8A 3AG5A 1ULHA 2PXHA 4EG4A 1QQTA 3KT6A 3SZGA 2E21A 3G6KA 3IVXA 1O0CA 4J75A 3ND5A 3HMQA 3LCJA 1F9AA 3F3MA 4ZT6A 1YUNA 3U1VA 3GMIA 1IQ0A 1PG2A 3ND7A 1KH1A 4MULA 1G8GA 2ZUFA 1OWOA 3COVA 2X1LA 3LE8A 4UZFA 1I6MA 3PRHA 2JAXA 1FFYA 1N78A 4DE5A 5LLTA 5LFAA 4GU5A 2DUMA 2R5WA 2J4DA 1NUQA 2A1UB 3SEQA 5KWVA 2GKSA 2VTBB 4S1OA 1JIIA 3IMCA 3PNVA 1PFUA 1U7XA 2GM3A 2WB2A 3AFHA 3FNRA 4J76A 3CLSC 4OUDB 4EG1A 3L93A 1EUYA 2DXIA 3P0JA 2X1MA 4MVXA 4JXXA 1COZA 1YUMA 4XFDA 1JIKA 1K92A 2CV2A 2C5SA 2WSIA 2A84A 3RFFA 1QNFA 1XNGA 4YMIA 3L92A 2YY5A 1WJGA 4QBTA 3OTWA 2DERA 4MWDA 1N2IA 1K4KA 3NBKA 4KKVA 5EKDA 3CR8A 2B7LA 4I6GA 3TNJA 1WQ3A 3ZGZA 4MUNA 2GOYA 1LI5A 3FG9A 4CDNA 2O8VA 3AL0C 1KP3A 2QJOA 3Q10A 1IQUA 3P0IA 2HGZA 4ZT2A 4MWCA 2Z3VA 3CVYA 3A05A 4ZCSA 3TZEA 3FI0A 2HMAA 4KPUA 4CQNA 1O5TA 1QRSA 2X3FA 3X1JA 4AQ7A 1N3LA 3Q12A 3CVWA 1R6TA 5DB4A 1NP7A 3H05A 4P2BA 1QU2A 4ZCPA 2NZ2A 3IOBA 3NBAA 3HV0A 3MMXA 3TQOA 5K0TA 1U7DA 3Q4GA 4EF6A 4K03A 1H3FA 1WKBA 1M8KA 5F23A 4E1AA 2PIDA 3IUBA 3FIUA 4MUGA 5TGTA 2E0IA 4A91A 5LM3A 1UFVA 5JBNA 3CLSD 2XRYA 3RK0A 1F4LA 3FHJA 1JZSA 1TYAE 1LI7A 3A2KA 4PY2A 2CSXA 1OBCA 3M5WA 1O96A 1T9GS 3VU8A 1WXEA 4MW9A 2V0GA 4WNYA 3BL5A 1V8FA 3N8HA 4MW2A 3CLUC 3P0HA 4I6EA 4EG6A 2CFOA 1T6YA 5DEOA 1IHOA 1M8GA 4ND7A 3FDXA 3QTTA 1QU3A 4KR7A 1G59A 3ZXIA 1R6UA 1J21A 3N05A 3SZ3A 1X6VA 4YP7A 1M83A 2ZP1A 3IMGA 1H3NA 1YULA 4PBRA 4EG5A 3FWKA 4DLPA 5KCMA 1YI8A 4YP5A 1JMVA 3CVUA 1KAQA 1KR2A 1TFUA 3KFLA 1YIAA 1I2DA 2CUZA 1O95C 3FH0A 2AKEA 1QJCA 3OP1A 4MUIA 4ND6A 2RD2A 1T6XA 2VXOA 4EG3A 2CV0A 3A4IA 4RUKA 4MW7A 5TEVA 1NUTA 4NAUA 3COZA 2QUJA 4JYZA 1MOPA 1H3EA 4ZT3A 4L2IB 1QTQA 1QRTA 2J5BA 4G5FA 3VGJA 1KQOA 3IVCA 4AS1A 1YIDA 1J1UA 4H3SA 4QRDA 1OWLA 4XSVA 4R0NA 1EFVA 4MUFA 3ZIUA 1S4MA 1WXIA 3CLUD 5AHWA 1HYBA 1KKUA 1N2HA 2OV4A 2QJTA 5J59A 3PNYA 1GN8A 2QUHA 4U63A 2QTMA 2BYTA 2DETA 3S3TA 5K0SA 3ILVA 3KT8A 4MUKA 1U3CA 1Y42X 1M8JA 3DPIA 1Q19A 2X0KA 4Q93A 2DR2A 4U7JA 1GAXA 4OUDA 4MQ6A 2CYBA 4Q16A 3RK1A 3P52A 1GTRA 4G6ZA 1Q11A 1EFPA 2XRZA 1MBZA 4PBTA 1VBMA 1O95D 1TYDE 2A88A 1VL2A 3VRHA 3TZLA 3AIIA 4DDKA 2DLCX 4ZCTA 1JILA 1I6KA 1N2EA 4KPUB 4MVYA 1IVSA 3D6VA 4HJRA 4ZT7A 1MJHA 2PZAA 4TS1A 3IOEA 1OWPA 2IJGX 3HL4A 1NUSA 3RBAA 2A4MA 2CYAA 2RE8A 4G5YA 4EG8A 4BWVA 3ZJTA 2H2AA 3UC5A 3G5AA 5TS2A 1MC1A 1N2GA 3H9BA 4NAHA 4JXZA 2H29A 2PG3A 1KAMA 2J09A 4MWEA 1MB2A 1NURA 1N1DA 4NX2A 2WQ6A 1XNHA 1VBNA 3DV2A 1X8XA 1EJ2A 1WXFA 4NZPA 4KR9A 1IQRA 2OQ2A 3ZUGA 1F7UA 1EUQA 2YWCA 1KP2A 1MRZA 3N2YA 2JA2A 3IMEA 5J58A 3ZJUA 1NUUA 1O94C 1RQGA 5FO1A 2QTRA 2A86A 3ISJA 2IP1A 3CVXA 4MVWA 1O6BA 3I05A 1J20A 4MVCA 1Q77A 4MUJA 4DNXA 3MLBA 3K32A 1O97C 1J09A 1TYCA 2A1TS 3TS1A 1TYBE 3UMVA 4F3RA 2IELA 1N2OA 1SURA 2TS1A 1WQ4A 4MW0A 1ILEA 3LOQA 1TQ8A 3QE4A 4ARIA 2DPLA 1N75A 4R2MA 3TQIA 1PFYA 5HUJA 1G8HA 1B6TA 1R6XA 1U3DA 4DJAA 3SEZA 3X1MA 1WXHA 4I6JA 1KORA 3FETA 2CT8A 2QUKA 5IJXA 1JZQA 3X1KA 2EL7A 1FYDA 1VLHA 1WY5A 3H9CA 2QTNA 1DNPA 3KT3A 4WSOA 4ZCRA 1JEEA 3K9WA 2D5BA 3AG6A 1N2JA 2Z08A 4RPIA 5HG0A 3HGMA 1A8HA 3AKZA 3CLRC 3E27A 3G59A 4JFAA 4K0RA 1JECA 2J07A 1XNJA 5IHXA 3QTBA 2A7XA 2EJCA 4HK4A 1V47A 3NV7A 3C8ZA 1OWNA 2E18A 1IRXA 4MW1A 4XFJA 1EFVB 1O94D 2JANA 1N2BA 2G36A 1GLNA 1PFWA 5H16A 1IFXA 5DASA 3RHSA 2V0CA 1NUPA 3INNA 4L2IA 1J70A 2A1UA 1IH8A 1O97D 1JGTA 1M1ZA 3SDBA 4U8HA 4FZJA 2VTBA 1WOYA 3IODA 1K97A 4ARCA 3CA8A 3RJZA 1GTSA 2QUIA 3FOCA 4MW4A 3IDFA 4CDMA 2O5RA 1T9GR 2AG6A 2WQ7A 1PFVA 2ZUEA 3N9IA 3HZRA 1WZ2A 1EFPB 1ZUNA 2D13A 2BTEA 4CT0A 4ZT4A 3ZXSA 3IVGA 3IH5A 2PFSA 1NZJA 3COWA 3SP1A 1KQNA 4OJMX 4MWBA 3CVVA 1M8FA 1GPMA 4EFKA 1PG0A 1OWMA 5DK4A 1NYLA 1Q15A 4MW5A 2A1TR 5TEWA 3CLRD 4X0EA 3CLTC 3MXTA 3PXUA 4DDMA 1TEZA 1ZH0A 1F7VA 4NATA 1ZJWA 3PNBA 1QRUA 4ZT5A 5BNZA 3IUEA 3UK2A 2PZ8A 1MAUA 3GLVA 1NI5A 3ZJVA 1OBHA 3H97A 4YBRA 5FO0A 1BS2A 3SYTA 3MUEA 1OD6A 2J08A 4KR6A 2YXNA 2AZXA 2I1LA 1T6ZA 1N77A 3DLAA 3ELBA 1MB9A 1O0BA 5H7XA 4ZCQA 3D6UA 3IOCA 1LW7A 5J5AA 1O96B 2D54A 3HFJA 3GUZA 3FY4A 4HJXA 4MUEA 4EG7A 4MW6A 1WXGA 2Z09A 1J1ZA 4UZEA 4DDHA 4MAFA 2HZ7A 1JIJA 3H99A 1ZH6A 1I6LA 1XJQA 4HPWA 4PBSA 1KH2A 2YWBA 1EXDA 3KT0A 1D2RA 2PZBA 1MAWA 1G8FA 2QJFA 4YP6A 2NSYA 4JZYA 1NSYA 4QREA 1GZUA 4NDAA 5KHAA 1U0BB 3A04A 5HUHA 3COYA 1KH3A 4MLPA 1EE1A 2DEUA 2CYCA 1M8PA 5FNZA 4R2LA 1VBKA 4F4HA 1K4MA 3CLTD 4MUHA 3MLAA 2E89A 4GRIA 1CT9A 1JHDA
chains in the Genus database with same CATH superfamily
1V8DA 1DKQA 3B51X 1P7PA 4RLFA 5F73A 1YA4A 4EW6A 2PRIA 2RGDA 3LQ2A 5G41A 3R6TA 5AVVA 4WCFC 1KFEB 3EZNA 221PA 3OH8A 4E7OA 3AKDA 1RPZA 1KMCA 2GCOB 2VNHA 3OCVA 1EVEA 3GVXA 5A06A 3WK5A 4EY5A 5JDCC 1R0BA 1QHHA 1LTHR 1GAQA 2Y77A 1VL0A 1N5OX 4GQAA 1G55A 1RRGA 1L8OA 1UM8A 3CX7A 2RAPA 2WYWA 4KLZA 3RHTA 4UBMA 1ZO8A 1O0CA 2YVUA 5JCZA 4PLZA 3DOJA 3HMQA 4DCOA 3BMNA 3EDOA 3JQ7A 3U1VA 1F5NA 1THTA 4K8RB 3FYCA 3U7QB 5B6PA 2F1RA 2GFIA 2QQFA 2IVZA 5KWSA 5K8VA 1KK1A 1JKXA 1JTEA 2DQSA 3DBLA 2RAFA 2K4MA 3W6ZA 4DS3A 3GP3A 1ZD9A 2AQIA 1RU3A 2AWOA 1PUIA 2HBYA 5B7QA 3DDZX 2RIPA 3GIWA 4LCJA 1NF8A 2OCBA 3RU7A 1EH5A 3JS5A 1GVNB 3HO1A 2QRHA 1A96A 4FCCA 1WNFA 2WWFA 1ORIA 4E5SA 1P7VA 2WZQA 5PGMA 4RKWA 1R4NA 2D0DA 2IV3A 1V26A 2GPWA 2VHTA 1UJBA 3D02A 5EJ9A 4P5EA 4HQKA 2WWIA 1Y80A 2J31A 1DCMA 3P94A 5JJLA 4ZK6A 4K9LA 1AHIA 4LJ9A 4YAIA 1ISGA 1QGDA 3P96A 1JIKA 5F9HA 2XE7A 1VTKA 3GDOA 4GMFA 2O59A 2HI0A 1SUDA 1KPHA 1RYNA 4TV8B 3U49A 4AB1A 2G4CA 3B1KA 1XHEA 1UJNA 2W2XA 2VP9A 3F8WA 4IEIA 3ICOA 4H59A 5EP4A 4P0QB 4QBTA 4F21A 4G1UC 3NYQA 4COKA 4O4HF 3K8QA 3HXLA 4DBVO 1NY5A 1D7OA 2NO1A 1ORDA 4U2CA 1KJ9A 2AYZA 4NZYA 5EINA 2L17A 5FUMA 2B9EA 2VYQA 1CIPA 4MYDA 4ADSG 3RSOA 2CMHA 4HWGA 2Z4SA 3AJ8A 5LCXA 4YV0A 1RPTA 4CQJA 5EJ8A 1J23A 2L82A 4OJKA 4IIXA 2Q6OA 5DI3A 3NDBB 1R64A 3AUXA 1C9DB 1W1UA 3T3PB 1A1VA 2GBLC 2A5DA 1G7SA 2BFWA 3IULA 1GO2A 4F2DA 1OTHA 1ZK1A 5IPFA 4UFNA 5MN5A 2DTDA 2GD0A 5FTWA 1YJBA 3GAZA 4CNQA 1H1DA 3FPCA 3T52A 3SVLA 4E94A 5KX5A 3I01M 3T61A 1DT3A 2JGAA 1BROA 2CWDA 2ZSIA 1A04A 1R9JA 1VRWA 3HBMA 4LC0A 4R3NA 3USES 1NHWA 4G36A 3B6ZA 2CBGA 1M8KA 4I50F 4FHFA 3STWA 4IILA 1T26A 3FYUA 4QHTA 4YDRA 2H0RA 4A91A 4DC0A 4JUAA 2PXXA 2G40A 1T0UA 3K1AA 4H60A 4GOKA 3ROXA 3SU8A 3TLMA 3VR0A 3I8XA 3KYDB 3WMGA 4W5RA 3UG7A 4TKVA 2CMGA 2O3UA 3HZHA 1P9RA 3BWMA 4JT8A 4C87A 4BKUA 2PLFA 1MOQA 5ALYA 1OZ0A 1RQ7A 2AOTA 1Y82A 2CXTA 2VPPA 3GT3A 3JARA 1U8FO 3LCVB 4LKOA 4UXJA 5B12A 4EK9A 2V0GA 1V2HE 4QUHA 4F96A 3K09A 5FA5A 4OLBA 3OFKA 3GWZA 4HAIA 3RC1A 8MHTA 1F9EA 4US1R 4YGYA 4I6EA 4EG6A 3SS7X 1PSZA 1Z22A 1IM2A 2EFYA 4N76A 3QE2A 3ONVA 1GQQA 2NMVA 1EA5A 2I3GA 4RTRA 5HQ3B 1UIMA 3CT4A 4FKZA 1SO8A 4MV9A 1G8JA 4ZDWA 2O8EB 1E63A 3KKQA 5C8VA 3VDNB 1Y7IA 4ZYTA 1I8TA 1R6UA 2H7XA 2P9ZA 2B8JA 3KEGA 3LQYA 1L5FA 1SUSA 3IQZA 5AKHA 1T8UA 3N05A 2XITA 3PFKA 3MUOA 4LOHA 4PZZA 3RVLA 1EDDA 3ACBA 4KO8A 3Q2OA 4CCWA 5CA1A 5JLJA 3QELA 5H9VA 4LN1A 3VR6H 4EG5A 5F98A 3H2KA 2W6ZA 1LY1A 2FW6A 3BTSA 1TVKB 2A9PA 4MQLA 4P7BA 5EFZA 4B1FA 2XSZA 4HZIA 5IJAA 3UUEA 4D3SA 1CW2B 1P19A 1LQUA 4GZ6A 2XBUA 1SXJC 5K0JA 2QKYA 1VIYA 3LMKA 3WNVA 3BE8A 1SRRA 2VQ6A 4AP5A 2G06A 3CZ4A 4AP9A 3OJXA 1BU8A 1E1RA 3DZIA 4JLNA 4RFVA 3VKHA 1LVGA 4PAOA 3EEQA 3QNUA 1M73E 5ETJA 3DEAA 4MDYA 5BQ5A 1MJFA 3QW2A 4QWMA 5CDUA 4DWJA 4A03A 1RWVA 1HTWA 1W0JA 5BW4A 1WCYA 3M6UA 3WB1A 3C3JA 4WDQA 4DLKA 5HRAA 5ITWA 5DTMA 2YMPA 1OVMA 3CY6A 3GY0A 3TLGB 2QDXA 4J0JA 3WX0A 4K6GA 4KXFB 4ZHQF 2NPIA 4CN9A 1K89A 3LT2A 5K45A 4XQ9A 1C3XA 2RGUA 5GV7A 5IKEA 4A8JB 1H6DA 2QVGA 2ACWA 2HQSA 3NTVA 3V1LA 3GFPA 3D2BA 3ICEA 1G20E 3AKCA 4MGKR 4MV3A 2X9GA 4MKHA 5AHWA 4I8IA 1XMIA 4F84A 1U63A 3IHKA 5CNIA 5AUQA 3KLBA 2BELA 1FBNA 4TSKA 4H7IA 1CFJA 5KYVA 4DMMA 3AYXB 2ZIGA 3OZSA 4QOGA 4F12A 2YS7A 3R0JA 4ZV7A 1NIJA 2IZ6A 2R86A 4QOFA 1K75A 2QIOA 1K7SN 2PO5A 4IEEA 1UOPA 5DHQA 2BJWA 4EECA 1P61B 1XE3A 1A9SA 4Q1CA 3A37A 2AEMA 4MUKA 3JAMA 2OEPA 3G9TA 3L6BA 5JI3E 3WB9A 2V3CC 4HN9A 2XECA 4PAMA 4MXDA 2H0QA 4M0LA 4TLLB 3PITA 2PKXA 3RBZA 5GOTA 3GVPA 4R83A 5LD2C 1VHDA 1T0IA 1JXMA 3WFZA 1B8PA 3EIXA 2RG7A 2IXFA 2WG2A 4BNKA 3QWIA 1EFPA 4WBXC 3SJAA 1NYTA 4UHCA 1DIAA 1B0UA 1MOSA 3GEHA 5CVUA 2F7SA 1HE4A 3SZOA 3QLEA 4JZKA 4LYAA 5AFSA 4IIHA 3QVOA 3LL7A 1G60A 4WMLA 4RJIA 5K0NA 3WL8A 4DDKA 5DLPA 2FFJA 1L1FA 2VYCA 2WF5A 3VNSA 4DAEA 5JV5A 3KFXA 5COBA 2ZVJA 2B35A 3WK7A 3I1YA 4EKYA 3OOWA 2GAOA 4AX4A 1E4EB 1N6KA 4ESEA 2BWJA 1P4GA 2Q2QA 2XDWA 2IW1A 2ASVA 1KMIY 1WW2A 2ZIFA 5K1ZA 2FJPA 1CX9B 1Y9JA 4IZOA 4MKFA 4RCZA 4Y2TA 2O2DA 3BQMB 5H3HA 3PX7A 1JKJB 2NXNA 1N7HA 4GP7A 1UR5A 4QXAA 5LZ5A 1RYFA 3N3BC 5CLHA 4Z4FA 1TK2A 1R66A 2AQ8A 1E5XA 3FGNA 1QC5A 5DDIP 4MZXA 4BNTA 4PC2A 4C2UA 1SC9A 4M9XA 3ZCTA 2G83A 3JWGA 1SEPA 4QJIA 5F64A 4I55A 3SXJA 3AR4A 2C7OA 4FMDB 3P71T 2FR0A 1M2NA 3I62A 1PW5A 3L46A 5TS3A 3MAGA 1J2UA 2XMDA 1JBEA 3M34A 1F6DA 4UU0A 1F1JA 4X41A 4KLRA 1V8PA 2QD4A 4FNGA 4CTNA 5IVHA 2VHWA 1W1WA 1NW4A 1HBJA 3GDGA 3LHFA 4I8DA 5FAKA 2H1VA 4YV7A 3GLHB 5U1PA 5B4TA 2BLNA 1RDFA 1K7XB 1OFUX 2R84A 2PX0A 2E1PA 3BM5A 4WJKB 4E4YA 1U2QA 5A0TA 3KTOA 4BAUA 4IWYA 1G5IA 4R1PA 4BCCA 2BGMA 3ZJUA 1L8QA 3P20A 3D8BA 4Q82A 4X1KB 3O1JC 2O4CA 4LE0A 5EJEA 4BL5A 1BD3A 1YVPA 2NP7A 3LC1O 3LBIA 2W6CX 1LPAB 2YJZA 2ZTUA 1LSUA 3WGHA 3N8NA 5K01A 3DVAB 5YASA 5BQFA 4A9AA 4CE6A 4C7KA 4W5JA 3D0KA 3PXAA 3A06A 4BECA 5DKFA 1XD2B 1VB5A 1SN7A 1RLTA 2RHWA 3UICA 4MW0A 3WWOA 4II7A 3U7GA 4Y2VA 4EYSA 1HKHA 4AZWA 1V8BA 4IVPA 2XPCA 1NG9A 3IBYA 4Q1VA 3DKIA 5DCLA 5BPFA 4I4TF 2OECA 4AN0A 4NK5A 3R0XA 2HQ1A 3RSQA 1RJDA 4PSCA 3HVIA 5JMTA 1PQPA 1K0FA 4JC4A 2F8MA 4HQOA 4NIMA 2GZMA 3BFVA 4GX5A 4UM5A 4CMEC 3KPUA 2LNDA 2D7JA 4YROA 5TGDA 2F2TA 1L7PA 1XO1A 4JU8A 3ZVRA 5BRAA 5C1BA 2QW8A 4NYJR 1FZTA 1DNPA 2GAIA 2A30A 1M10A 1CQXA 2GCOA 4W1RA 4WSOA 2YBEA 4BJ1A 1AY0A 2XUAA 3D1VA 4L7VA 3KDPA 3BERA 1CUZA 1M2FA 1F38A 1FZQA 3A7DA 4NABA 5BSKA 1OA0A 5AI6A 3IAM1 1Q44A 4W7HA 1E32A 2CK3D 1BN7A 3EWAA 3CUWA 1SKQA 5FTLA 2Q1XA 1VRCA 4YP0A 3GC6A 4IXMA 4BAZA 2EJCA 4R9NA 3WXBA 2BT4A 3GZTB 2JD1A 4MPPA 1RS0A 4B3TB 3D5EA 3MWJA 2WVJA 1N5KA 4FGWA 3FDFA 2PSHA 1KYWA 3AEZA 3CZQA 4ZI2A 3AGQA 4DUYB 2BBWA 3UGQA 1B26A 2OXTA 2I3DA 1XL0A 3CCCA 3V1MA 2CVOA 5BQ3A 2PUWA 4MP3A 5I9LA 3TD9A 2V6BA 2V45A 1CEEA 4N8SA 5FQNA 3L1VA 3OX2A 4C05A 1U80A 3INGA 3ESQA 4NCAA 3L41A 3RS0A 4C3ZA 4CPDA 5HK8A 2C1XA 5I5EA 4EVRA 2FG6C 3AEQB 4ENQA 4ARSA 1ND6A 1JI3A 1OU4A 1PJ2A 3AY0A 3SHFA 4MW4A 4NBRA 3OECA 4DIFA 1ID8A 4Y9TA 1JEAA 2XUQA 4MVJM 1XAHA 1XCJA 2PH1A 4WL0A 4UNPA 1E3TA 1Z6TA 4MRNA 2OD9A 4EA6A 2H48A 3QEMB 3U3MA 1VPVA 4MRMB 1TKRA 4CT0A 1O9GA 1DIHA 2GF9A 1Q7CA 2H85A 3OQIB 2OLKA 4QDKA 4TV8A 4IKEA 5EQDA 3UHAA 3ZEAA 3BX1A 1J8VA 5CEJA 4MWBA 5LMNB 4BWGA 3MT0A 3SYLA 3T9CA 1F5SA 1ESDA 4DNQA 4EFKA 2DKNA 4X1IB 3TKLA 3GGCA 1JHOA 4E5VA 2H2WA 4XGQA 6GPBA 4PLWA 3E5HA 1NR5A 3HDGA 4ND2A 3NASA 3TB6A 5CLIA 1S2OA 2GWHA 1NQAO 4XWTA 3F5MA 1EGAA 3WGTA 1W85A 1SUPA 4LMBA 4MQ4A 1K5DA 4D7AA 1V1MB 2QF7A 3GA7A 1HDRA 1JV2B 2XOKD 3B9BA 4GE3A 5A6SB 3DDCA 4DDUA 5C80A 2XCRB 2VBFA 1PSDA 5IJWA 5AR1A 2ERYA 5IULC 3F9RA 3E0QA 3P2EA 3ZOKA 3ZJVA 2FWBA 3WL6A 3L18A 1J6UA 1JIUA 4K87A 3S8YA 1BEZA 3VZCA 1OD6A 4ZKEA 3ROQA 4YRRA 5BWLA 1QV7A 2O2CA 1PVDA 3ELBA 3JR3A 5IN5A 5BUZA 2YICA 3PGLA 2R8OA 3O75A 4DM3A 2ATIA 2OORA 4YP9A 4DG9A 3FSJX 2BJVA 4XYBA 3WOVA 4AG6A 1MA0A 1TYEB 3HDQA 3SZUA 3WGMA 1X13A 1N5MA 5DYGA 2ET6A 5BN1A 4PZ9A 4DMCA 3AESA 4MAMA 4X93A 3DNPA 4KQIA 1JJBA 1FP6A 1BO6A 1EX7A 5H68A 1WQ1R 1J56A 1E7RA 3KYDA 3NWOA 4PBSA 4WXYB 1JH8A 2ZSAA 1EK6A 3OJEA 3L8EA 1PNVA 2O05A 3DT6A 4GQIA 5LYJA 1GL6A 4F4IA 1EFRA 2REBA 1G8FA 4GG1A 4ALJA 2ORED 4ZYYA 3SWWA 1MB0A 2ESRA 1X2EA 2RCYA 1Y4UA 1VB3A 1AKNA 1QVZA 2KBFA 3GFTA 3HN2A 4KDRA 4ZVSA 1IY8A 1CWUA 3TUJC 1U5AA 4W5NA 2QE7A 5KTYA 1BWRA 3H9UA 2JLZA 2G5GX 1KOLA 2IGBA 3PENA 1CIJA 2PT6A 1W36B 2O8EA 3OQ6A 1YRBA 2BFPA 2HK8A 2I0FA 1IULA 2ZB2A 1C5KA 2D59A 1VBKA 3E35A 4Y0VA 4ECAA 1UAAA 5AW1A 2W43A 4IO1A 3AL3A 2CNKA 3W3AA 4YEDA 3CUUA 3JQRA 1PK8A 3EXFB 2Q41A 3JQCA 4WOBA 4C4AA 5LQUA 5AXBA 1SC1A 1IBLB 2Y1XA 4KDFA 1G0OA 2VJMB 2XUPA 3R2JA 4J4TA 1JEDA 1NKTA 1Q57A 4MAAA 1TVKA 3UY4A 5IKPA 4X94A 1L5OA 3L4BC 5KNBH 4OU4A 4LYYA 5EEHA 1F2VA 1Z5PA 1Z4MA 1ZKMA 2NU6B 1YZVA 2CEAA 2QQGA 2ZULA 1OCEA 3MT7A 1LC0A 3WLEA 5T6BA 2LBPA 5B5SA 3DVRX 3TB4A 4P32A 2UZ4A 4IQ0A 1T3TA 2V9ZA 4G41A 3RGGA 5JS1A 1MZVA 1U1FA 3WRXC 4IUBS 1KIAA 3PQCA 4WLVA 4TWIA 2Q2WA 5A2GA 4BCBA 4F97A 1JKFA 4NCHA 4DVJA 1KH1A 1Z2NX 4WLUA 1SUIA 5DX1A 2BL4A 1X2BA 3PZBA 5AJYA 2FCRA 4UZFA 4K9SA 3PRHA 3EA4A 4KV9A 1IRIA 1L4MA 1BHO1 1THGA 4P81A 4Q4DA 4BLWA 5LNK1 4L02A 3TLGA 3ZVNA 2DHRA 1I1HA 3G9UA 4NG4A 5ARDA 5JARA 3RT7A 1IUOA 5FWYB 1TAGA 2C99A 1NVMB 4B2IA 4YMGA 5JQWA 4XJTA 3TRDA 2GFQA 1YE8A 5AVWA 3RRZA 5KJ6A 4XD2A 2DPYA 4A8JA 2I4LA 2CXPA 1NT4A 4JNCA 3TZCA 1LQ2A 2AJCA 1T0JB 4XVCA 3L4EA 4O6VA 4BMPB 2CNOA 2A8YA 3W7AA 16PKA 1F48A 1ISIA 1I9CA 4YIKA 3RUFA 1EDEA 4NQRA 721PA 3AFHA 4BFTA 1X7XB 2BP7B 4DCSA 3VNAA 1AA6A 4C3OB 3HVUA 1OAAA 1DWUA 3A32A 4RV5A 1CVIA 2VPXA 3QYPA 3TUIC 1LV8A 4R54A 5DHAA 3U56A 3MMSA 4RDXA 2P9QA 2R6ZA 3FNBA 1Q1NA 3O4JA 4LOAA 2AJ8A 1XNGA 4BBPA 2NZWA 4X7MA 2YMMA 5E6UB 4PFJA 1WJGA 4DANA 1OKKD 3AI3A 3Q72A 4RJKA 1V4BA 3CF0A 3BD7A 5JHGB 5FEUA 3TR0A 1UZUA 1WQ3A 3E4CA 1LJ8A 2YJ6A 3HXKA 4E11A 3E53A 4RM2A 1TJ4A 3SG0A 1N4AA 2ZW9A 1GNLA 1YB1A 3GPDG 4BYMA 3DOOA 3RFVA 1L5KA 3NVMB 1ZK3A 1DG1G 1X77A 4QSHA 4BATA 3ENNA 3KQQA 1E3LA 1MVLA 1AKWA 2ONKA 1DELA 4M54A 3PRKE 3B36A 1O5TA 1C0IA 1XZ8A 5ILGA 4U5QA 1C4OA 1T8PA 3PJDA 2C3MA 5FPTA 4CF5A 4G9GA 3W8DA 2M6SA 4YCMA 4JA2A 2JIBA 5NLLA 1GYPA 4GLBA 2UYYA 3WO0A 3DHYA 1JKJA 2NZ2A 2UVPB 2WWRA 3DLIA 3IOBA 2F00A 4MIEA 2M6LA 1YZHA 3LDHA 4O8CA 2DWOA 5A71A 1D1QA 4N5HX 4ZQFA 5JIBA 2E6KA 2PZLA 4MCHA 3L1HA 3S8MA 1H3FA 2FUCA 3G68A 1XN4A 5EIBD 4N3CA 2Q5OA 3TMKA 3LBYA 2HSEA 1QYDA 3EOZA 4HQ0A 4BMYA 1BDBA 2O52A 4LPSA 3BORA 1G8PA 4LGYA 3HWWA 1ZI8A 1LC3A 3PYMA 2JFGA 2Y1GA 4FSXA 5JBNA 1FRVA 4ER3A 1JZSA 1WMBA 5G1PA 1RFGE 1Z6AA 2QMZA 2YWRA 3S0JA 4US2R 4HFMA 3GLHA 5AH0A 3W3ZB 2IQIA 3PT5A 5LXTF 4EEKA 4HV4A 4KBFA 4XYLA 2DJIA 1RXUA 3VAAA 4I08A 5KVAA 1NN3A 5HKBA 4XWWA 2OG2A 4PXAA 4TYQA 1UDBA 2NIPA 3ROEA 1VI6A 1ESMA 3D3JA 3O8BA 1GUFA 1E1CB 4X1KA 3T5DA 4B33A 5E95A 1PGJA 5JD3A 2GR9A 4H4DA 3UUWA 4IO0A 4OHOA 3N6RA 4KR7A 5CYGA 4TVBA 3E05A 1C7FA 2JDIA 5EUQB 3NC4A 1E7WA 5TVGA 3KHKA 5DNAA 3DVAA 2YRFA 3E9NA 4CMBA 3RRJA 4W8OA 4RLQA 2H31A 3HE3A 3CJRA 3RSLA 5IAOA 1MAVA 1XD2A 3VYTB 2MSDB 2EJVA 1KF0A 3BRCA 2C2BA 1XMVA 3OLCX 1ZMBA 5DTIA 3NWBA 3D8SA 3H9JA 3W04A 5BWMA 3LECA 3GJ5A 4EHJA 1EFUA 4TKZA 3CVUA 4ZC8A 1AQYA 4DIEA 1KYZA 2DF8A 2GBIA 3ECSA 4IFIA 4IYJA 3IEPA 4ZMBA 1VI5A 1SCJA 5AESA 3D3WB 3LPMA 3SDZA 3EDQA 2XV1A 4R7TA 5KYTA 4XQGA 4DR2B 1Z56C 1TZBA 3DMHA 1CJMA 2VF4X 1JSZA 3ZZ1A 1EFAA 2O7SA 1OI3A 1AK1A 1OHHA 2IZ1A 2XVMA 1SOUA 3R3JA 1M0SA 3QU7A 1SIBE 2JHPA 1NPDA 3CPJB 3ZWDA 1E3MA 2FUEA 1SU4A 1Y7TA 4Y9DA 5B1YA 4XX1A 1QAOA 2DKFA 2PNJA 2YHBA 1AGYA 4L6AA 1B3BA 1M6EX 1PZNA 3NKLA 4Q3LA 2ZYAA 5C35A 1GFIA 4KWHA 1N4DA 1K9SA 1IOVA 1SA0A 1O9BA 2G7ZA 3FZYA 3TOZA 4AW9A 3PUWA 2JKVA 4Z9XA 3DZJA 3E5RA 3FI9A 4HX2A 4G8JA 4J43A 1TQDA 5DOVA 4E7PA 1NN5A 2XNKA 3DC2A 4H3SA 5TJ9A 3FPEA 3GX1A 4XSVA 1F51E 1J1UA 3CWZA 2HTEA 5HQJA 3WSVA 1GADO 5HCUA 2AKAB 2C0QA 4DA6A 4M46A 5FUVA 5A4MS 3HB1A 4JAVC 2VTVA 4HF7A 2HUNA 5F2EA 4DWOA 2FPUA 1QS0B 4M9UA 1P5HA 2D0OB 2COKA 2I62A 4RHFA 2VQDA 3LA8A 4FBLA 5BORA 3DD5A 1E6WA 1W93A 4JP3A 3RVRA 3A6HA 3HYNA 4PRZA 3RG8A 2BR5A 4A0GA 4EL0A 3L4JA 1JX6A 2QRLA 3T7TA 3LFTA 4RFSB 3I58A 3AEQA 4KIWA 1JFTA 4MQBA 4MRSA 3KXPA 1PL8A 4NRDA 1UPFA 3B2QA 4CMAA 4XEUA 1C0KA 1JPVA 2D3WA 3AP2A 5FR1A 3DZ8A 3JVDA 3RKSA 1VIDA 1SIWA 2IS1A 1L7BA 3SDSA 3QEMA 2B82A 3HFSA 1ZCBA 2JJ8A 1T5OA 1L5VA 3FPFA 3IERA 3HJUA 1CIVA 2BLLA 2JBAB 4MRMA 5KNCH 2XRZA 1QIHA 1U0EA 2IFTA 2AT1A 2HWWA 2Z6VA 2IPLA 3KVVA 3OQIA 4H4EA 1A5SB 4GI7A 1BHSA 1N92A 3VRHA 4L27A 3NYRA 4UNQA 2WE7A 2OV3A 4LXHA 4X1IA 1P6QA 4L0DA 5F4BA 4MDEA 1U8XX 1W2HA 2AUTA 1MFZA 2ZIAA 4FJ2A 4JCCA 2AJDA 4NPCA 1RMQA 4GYKA 3CH7A 3OCCA 2IJGX 2I2FA 4IIVA 3WKDA 4XCXA 1A5BB 1UC8A 1UL1X 3DG9A 1JWAB 3MJHA 2FZEA 1V1MA 4BNWA 3S68A 5A6SA 1GU1A 3A3YA 4QBFA 3AB7A 1N2GA 1ZNXA 1JG6A 4QGBA 4BMVA 4ND5A 2OOKA 1J5PA 1RAEA 5JS8A 2FCAA 3HKBB 2IXAA 3SR4A 3VZBA 4G0YA 3T7KA 4GPIB 1JJ7A 1Z2CA 4YCLA 1N1DA 4E5YA 4R40A 1GDTA 1VYVA 1X19A 2AMFA 3A4NA 1MEEA 2IH2A 3KEMA 1FC0A 3RJ9A 4KVGA 2AQHA 3MQFA 1V48A 4WOPA 2HBRA 3G2OA 3KHSA 1H2FA 3ABSB 4MKGA 1Q74A 2WIDA 2OFWA 1XMXA 1OR8A 2ECFA 3EFHA 3MVEA 1Y1TA 4FEYA 4TS9A 4ZXPA 1QGAA 2Q7DA 3GQBB 5J58A 3FCCA 1UXGA 3QK7A 1SQSA 2IP1A 2QZ4A 4QVKA 1E9RA 3B8EA 1O6BA 1OXVA 2HNKA 3IA2A 1HZZC 2ATCA 1P2SA 3E7XA 1XXHE 1XYVA 3LLUA 3TIGA 3L0YA 4D92A 1T5IA 1J09A 3QXXA 1B2LA 1TYCA 1XBTA 4CQMD 3HWRA 4JXJA 1IM5A 4WNAB 7YASA 4PQGA 2B0JA 1KYQA 1N2OA 2EFDB 1ZZGA 1E9SA 2FEAA 4Y1EA 3A1TA 2ZR8A 3JVUA 2ABWA 2TS1A 3WS7A 1JJFA 3GJYA 1OAOA 3LGAA 3TCNA 1IATA 2EQAA 3QP9A 4Y2JA 3AEKB 521PA 1C1HA 1FNCA 5CJPA 1KYXA 1R6XA 3HJFA 1CJCA 3LTNC 1JA9A 1LBSA 1YR2A 3NIDB 5ILQA 3ANXA 3EXFA 4WT7A 3DM5A 3Q9UA 4D42A 1ZM7A 2YJ4A 3WY9A 2VJMA 3HDVA 4DYHA 1AXRA 1EJ0A 1S9DA 3QOFA 1P1IA 1U3GA 2WF7A 5I48A 2ZVDA 1DJOA 1L1RA 1NP3A 1P0PA 3DZBA 5JXHA 3EMKA 3H9CA 4G86A 2NU6A 2NZUG 1QE3A 2VF2A 1IJEA 2SKEA 3VX4A 4DEXA 1YR9A 1M5UA 1QQAA 3LOUA 1A8HA 1EXVA 3ADDA 3KL4A 1BSVA 3EGEA 3AKYA 4LHXA 1RHKA 3EMBA 1Y34E 4IDOA 2GSWA 4RMJA 3VR2D 1V43A 5BN3B 2XCIA 4FUTA 2JLAA 4TMWA 2KYRA 2IHJA 3OFNA 3LRTA 1Q20A 3HCNA 4KWCA 3U44A 3WTCA 2POQX 1YBAA 3FKSA 4NNOA 4QWWA 2R66A 1NAIA 3BIOA 1NBMD 2CFIA 1FMJA 4KHZA 1IXRC 3SF0A 4DXHA 3BDAA 3FKQA 3FPSA 3KOUA 4JJKA 1KOGA 4L74A 2G36A 2Q0QA 3RWMB 2XAUA 2UYHA 2BC9A 1CB0A 1II9A 1A82A 1WL8A 2G9RA 3GGJA 4KDEA 5FWYA 3L5KA 1NNSA 4LNHA 5FB3A 3NUGA 4H7HA 4L85A 3SDBA 2Z58A 1NJ8A 1RI2A 4RHYA 4JBLA 4GLJA 3QLJA 5JD4A 2VSFA 4Q19A 4MR9B 3RV4A 5BN4B 2E2WA 4AFNA 4D0LB 4ARCA 1SBHA 2I65A 4F93B 1GTSA 1YI1A 2OG1A 1QHSA 2BP7A 2QD2A 3I92A 4TLDA 4UDOA 2NVUB 3UJPA 1T1GA 2AG6A 1BH2A 1I1NA 3SNHA 3GAAA 3R1IA 4FONA 2RK4A 2ZUEA 4IDNA 4C7MA 3I9LA 3AVYA 1YKSA 1ZMXA 3NG1A 4P3OA 5GZ6A 2Z4RA 4BNJA 5FPKA 1K0UA 4RF2A 4RF4A 1E6CA 3VQTA 3BE4A 3NTQA 3O8QB 4ZT4A 3RVOA 3ULKA 1TJYA 1K3UB 4Z3DA 3WLQA 1IWPB 3FNGA 2LZ0A 3OJWA 3BH7A 5E6UA 3TM4A 3UK6A 3HADA 5A9SB 1ZKDA 3U3DA 4L4XA 4NYMQ 1SOVA 2PGIA 4GR5A 1PJQA 4XWOA 1E7SA 4TL9A 4ZV4A 4P08A 1T0HB 5DK4A 4Z0PA 3CNQS 2NGRA 2P4EA 3A26A 2Q5QA 1NYLA 2VK2A 2B8EA 4MKRA 1QG0A 2DWPA 2ZYTX 4J1NA 3VR5A 3FN4A 3ABRB 1QYWA 2GHTA 2XEDA 3TM5A 3I6ZA 2C0PA 3NDIA 4L8LA 2ORIA 1O94A 1DEAA 2E9SA 1KHHA 3THWA 1NG1A 4UM9D 4GYWA 2ZYVX 1WEKA 1FE8A 2CE2X 3PNBA 4RKQA 1WG8A 3T94A 4DG5A 5JZOA 4US0R 4WK2B 3TPCA 5J43A 3QV1A 4EO4A 4AKSA 5DM1A 2QOEA 3C7DB 5CHYA 1QHEA 1UBLS 3H8SA 5TPWB 3UXHA 1UPAA 3ZU4A 5I4CA 5HP4A 2XIJA 4IDCA 2UVPA 4B4VA 1T6ZA 2N1BA 4IXWA 4MPJA 1B0ZA 1VZ2A 4BNUA 2VPZA 2ZT6A 2C9ZA 4U1RA 4YUWA 1RADA 5J5AA 5CIYA 4YTEA 4DPMA 1R8QA 3QU4A 5F51A 2OV2A 4PC3A 4AXBA 3GGDA 4CMKA 3WP1B 5LKAA 1KJJA 1ACLA 2WTEA 2NO7A 3MELA 3JZIA 3HCFA 2EGUA 4MAFA 4UZEA 5ALIA 3EWSA 5T8KA 3WFJA 4XCVA 2DAPA 3DS8A 3WL7A 1I5OA 4PZYA 7AT1A 5IARA 4DMKA 1L7EA 4XVUA 1HDGO 1T24A 3N2GB 4CKEB 1ZM9A 1MX9A 2FSIA 3AP1A 3DR5A 2HNBA 1E2IA 2F1OA 3EPRA 3I72A 4EHIA 5IS2A 4ACAA 1U2DC 4NPAA 5EFOA 6REQB 1NTOA 3P9SA 4OFBA 1KETA 2BTQB 4JZYA 4C6RA 4B3SB 3NGMA 4P58A 3HYTA 4Q3CA 3DL7A 2O14A 3RABA 1E1CA 2Y68A 1O8BA 4ENRA 1XAIA 4PC6A 4URVR 5IFLA 4I1PA 2UKDA 1V2GA 4M98A 4HUQB 1CR4A 1DOZA 4JELA 4Z0HO 2CNBA 5FNZA 4AMBA 2BGLA 1TJPB 2H54A 4KOAA 2HZBA 2HRRA 1C3OB 3UMSA 2G07A 4LQCA 3BXPA 2CD9A 2UZIR 3INTA 1GNVA 2TYSB 1ZJ4A 2PRYA 4QXOA 4HSEA 1NQUA 1IMOA 4J29A 3FYTA 2D8MA 3ND6A 1A8QA 4EEXA 3VPBA 9LDTA 3UANA 5B58C 4PC1A 4NBWA 1A2QA 3C8HA 4YXWA 3U1TA 1TL7C 5EAIA 3PQ6A 2ZJ7A 4J3FA 3DKKA 2HEGA 3WVNA 5TPZD 1LTKA 3JPWA 3O3CA 4O4JB 3D3WA 4ENTA 1Y6RA 3A9WA 1UAGA 5DGXA 5LP6A 4KTTE 4DV0B 1Y6GA 5F33A 2IEIA 4C0LA 3Q9LA 3F74A 2CNLA 1QCDA 3HCPA 5JAPA 3GW8A 5BURA 1IQ0A 4F6CA 1XCOA 2RHLA 1AZSC 4AG5A 2E4XA 1QFJA 2JH3A 1ODFA 2UYOA 3BHMA 1MH9A 5A5EA 3GARA 3BWCA 3K6JA 3NHMA 3U7JA 4G84A 3OD5A 4PIVA 2A0YA 1NU6A 4B6RA 4HX5A 2PWPA 1MENA 2OCYC 1DHTA 4Q05A 1WPGA 2G17A 3ZE0B 3U7QA 4MHSA 1ZU5A 1MXHA 1FJGB 3BKXA 4KYUA 5DGIA 1YHZA 3OX1A 2V98A 3P4UA 3T3OA 1T4BA 1Z4NA 2C3OA 3JCZA 2X4IA 4Q9HA 4IHKA 4RHCA 3LT0A 3ZU5A 3GLGB 3QBDA 4FCTA 5KEIA 2PRZA 1X0XA 2WJWA 4Q6WA 5SICE 3ZWBA 4QGHA 4JBXA 2XE8A 1T8RA 4S1PA 4JJ4A 1H5QA 4YJ3F 4YJ2A 2NAFA 1QAQA 1FDUA 3RDPA 2WIFA 3RSHA 3FB4A 4XFDA 2W2OA 3GRAA 1XVVA 1RNLA 3O3MB 4EGQA 4I9FA 4RFSA 1ESZA 1QM5A 4Q9LA 3N2NA 2CZCA 3OPYI 1KFBB 1GZHB 1RHRA 1D6MA 5EIXA 4N5LA 5HFJA 1YGYA 3TTWA 4FW9A 1CQIB 3VI3B 3GXBA 4YP1A 1RBZA 2EGGA 4K5QA 4Q47A 3CR8A 3MJVA 3WK4A 3DCYA 2PJUA 3X2FA 3R0ZA 5JJCA 3ZGZA 2BCJQ 1GZVA 1LI5A 3F3YA 3H86A 4BKOA 3HI6A 4H17A 3GCGA 5IAAA 1HF3A 2P9TA 5AOAA 3R4CA 3OO1A 5EE9A 4BVHA 3C45A 1RJ9B 5KC9A 3OU7A 4ZANA 2HGZA 1D7AA 3KZ1E 3ZXUB 3TQRA 3T9DA 2GD2A 1N34B 3EZ7A 2A5FA 2QT1A 4AJEA 2YMLA 2N9UA 2OCXA 4PHFA 1T1JA 3F6PA 2FMTA 3B9RA 1ZVMA 1X1CA 2WIGA 2GDZA 1LUAA 4MR8B 4EFLA 1K7FB 2P6MA 1VCMA 2AZMA 4G2TA 3TI7A 4HNTA 4MV6A 1RACA 1U7TA 4IF4A 3QVGB 1IK4A 3RARA 3SJZA 3NDRA 5K0TA 2XT9A 3Q4GA 3LQ4A 1W9MA 3JVVA 1G16A 3QOWA 3Q1KA 2PU5A 2ZXUA 1WW8A 2DPXA 2HIAA 1K68A 2GYYA 1IK6A 1GPDG 1I01A 2JLSA 3HKBA 1X3SA 4D1YA 1CV2A 4COOA 1P4HA 1YHYA 2FPMA 2FRDC 3AHIA 4NCXA 4QELA 4Z8YA 4QDOA 3WAJA 1NMQA 4KE9A 2W4IA 4YMVA 2PRKA 1WB5A 5HKLA 1QFXA 3VM6A 4H6XA 4HG2A 2C7GA 1YRLA 2GZHA 3ELUA 1QG6A 2G72A 8OHMA 1BQ3A 1VE1A 1LI7A 2IEDA 2NO5A 3ET5A 2IOHA 1TF5A 5BR1A 4RVDA 3RC7A 2GERA 2GRUA 2EZTA 3D4IA 3C7AA 3JVEA 1I2AA 1NULA 1ZD1A 3DTVB 2E48A 4XEHA 5C34B 3TIFA 3ZWOA 5EIEA 2A0KA 1UMCB 2VZ9A 4EENA 4RMIA 2YWXA 3KK0A 4WERA 3PCRB 2ZB4A 2H63A 4M0PA 4WPGA 2WSSD 4E30A 1C1YA 4L9WA 1C4WA 1IBKB 4DJDC 2IXBA 1UINA 1OBVA 1VFNA 2IYRA 3KPYA 4MTCA 2M6RA 5DHTA 3T15A 5AVYA 4JL8A 4RD1A 4EB8A 3L49A 1FSGA 4WNAA 1E6MA 1I9GA 2IYVA 3WLHA 5EIWA 3X44A 4YP7A 1V0JA 3BT7A 1H3NA 2XGMA 3KQVA 3KD3A 4TV8F 4TQGA 5PNTA 5KC8A 3LG2A 1KJWA 4OGKA 3V8PA 3VTFA 2XVAA 4TN5A 4QAJA 4UM8B 3LO5A 4ZWNA 3MXOA 4RE6A 4CU5A 1L4EA 3AEKA 4P93A 3S7TA 3ZK8A 1JMVA 1D07A 2FR8A 1K3TA 4JD5A 1JIXA 3JQBC 4ZC1A 3EPHA 2YFQA 2WOJA 3IPAA 2FKNA 2OCAA 1T3LA 3TR5A 2P91A 1JFLA 1RAIA 2FUG1 2J6BA 4LJ4A 4HPXB 1ZHFA 3FH0A 4C2BA 4MVJE 5EZYB 3KZCA 1G5HA 1GHTA 3GJRA 2HJRA 2NYVA 3DE5X 4R1TA 4EF4A 4EG3A 3A4IA 1TXGA 1GRVA 4RUKA 6YASA 3CLHA 4JKIA 3RSFA 4UFPA 3USZA 3FNQA 1Z5VA 4XUGB 3OWOA 3ZLVA 2AD5A 2VDKB 3OEYA 2LCQA 3ESZA 1Z39A 1V4VA 2CLFB 4FDVA 2SBTA 2QJWA 3D6FA 1YZUA 4LSGA 5BN3A 5B4VA 3G7NA 3BILA 3HNPA 2Y1WA 3OEEA 3K0SA 3WKCA 1H2AS 4QZVA 1PV1A 1XWWA 3FSRA 3T1NA 1RZ3A 3T3NA 1NVVR 4O4LB 4GIBA 4G9BA 3FWNA 2BH2A 1W46A 4BGUA 4K9OA 4BDTA 1R5JA 3CLUD 3AWDA 5K99A 3OY7A 3EXG2 5WRFA 1PEAA 3OZRA 2R7NA 4JB8A 3VBEA 4ZQIA 1P6XA 3K70B 4ISCA 5JYEA 1BW9B 4MLDA 1DDGA 2FJUA 1KEUA 2M1ZA 3KQSA 2A5YB 3PNMA 4G0MA 4BMCA 2DETA 1R6DA 1ZUD1 4G07A 2WU1A 3PR1A 3D6MA 4UEQA 3KXDA 2VAXA 1HG0A 3OZGA 1VSUA 1WSAA 2YFYA 4MR9A 5BN4A 3QYJA 3IS3A 1PFQA 3ZTYA 1PLKA 3BA1A 1JN0A 5FDFA 2AG8A 2EYQA 3WQSB 1COWA 4KFSA 1LZKA 1S2LA 1DPFA 2BZ1A 1G9TA 1UK9A 2Q5JA 2ZRPA 3EBLA 3OZBA 5EJGA 4YWHA 2FZWA 2R8BA 2W11A 4FU0A 3ZGNA 1IQPA 5FQOA 5JSHA 3GEGA 1DBRA 5KJ1A 1MPXA 5DNDA 3M8KA 3O8QA 3SN6A 4L0CA 1CY2A 3RIYA 1E94E 1ZNYA 5D85A 3CKLA 5E7MA 621PA 5JXWA 3MTBA 5TT0A 2Y05A 3ZCRA 1KMNA 3BRSA 2J4CA 3G49A 2YDYA 4K2HA 5A9SA 5BWOA 1EFCA 1LLQA 5JXGA 4KIFA 3HJHA 3H3JA 4ENVA 4OBEA 4KPUB 2NPFA 4GHWA 1RYBA 2BW0A 3OF2A 4BP3A 5JAMA 5KPJA 4BE4A 3CG4A 3OLWA 1WBJB 2EP8A 1JG4A 2GCEA 4TS1A 3FVQA 1PJZA 4MVJF 4BV8A 4AUMA 5AVRA 3KQNA 2I7XA 2A4MA 4YQEA 2ORYA 4FNMA 2CYAA 3ZTTA 1R16A 3TINA 4DDVA 1P0QA 2JGRA 1FLNA 4EG8A 1NQVA 1NM5A 4G89A 3QKWA 1UAYA 4FN5A 3GLFB 4AN4A 4RIFA 5CJJA 1Q17A 1BWQA 3TQSA 4OMUA 1LK7A 2BFEB 3TD2A 1SKUA 4PNZA 4AK9A 3AR2A 3FB1A 1CYEA 2QMQA 1YRWA 5TPWA 3ZR4B 5CFZA 5EHXA 3NT4A 3WYDA 3QOYA 3VMMA 1AA9A 2JI9A 5THKA 4Q18A 3OM9A 2AFVA 1TQ6A 4OI1A 3IESA 4FD2A 5IMSA 3VH2A 5LZ2A 3D8HA 3C8DA 4U5XA 2ZQZA 1P73A 1EXMA 4Y6OA 2QHXA 3ZUGA 4YMHA 5KPDA 1FXWF 5AKLA 4BNMA 4YAWA 3LAWA 4Z53A 4MVJD 2GBCA 3VC3A 3P0FA 3RGWS 1MNQA 4YT5A 3NIWA 2JA2A 4DIBA 1SK9A 4QTTB 3H17A 2I6FA 4Y9SA 2QTRA 2WUFA 2PE5A 3X1YA 2Z5LA 2ZUVA 3SXUA 3NKVA 4CKEA 3W5CA 1GNRA 3HPQA 4MVCA 2ZUCA 3MGCA 1BJTA 1EQ2A 4O08A 3OQOA 1O97C 3GLRA 5H1YA 2H06A 3JAWB 2BTQA 4ZOBA 4LXIA 1ZONA 4NE7A 4TLEA 4EJMA 4R8VA 3T5AA 1F8GA 2E4WA 2HJWA 2ZRNA 1WETA 4RPJA 2NO9A 4E5MA 4EI8A 4B74A 1WVMA 2PH5A 1P9NA 4LXUA 4KEAA 2B20A 5CD1A 3LD9A 3TNLA 4O4IB 5CIQA 3GEBA 5GM2A 4KQJA 1C3OA 5JS2A 2JC3A 4FILA 2ZE5A 1Y3CE 2YUTA 2EFGA 2Y0CA 4QPPA 1P1CA 3P1JA 4RESA 1J8MF 3BDIA 3FETA 4I6JA 4RAQA 4D6PA 5B1EA 3RT9A 2XKBA 3G89A 4LZWA 4O1IA 3PKZA 1U04A 2EL7A 2ILTA 3I0ZA 1EZ1A 4XYGA 4GGMX 1MDFA 3L9XA 4KXMA 3L8YA 4W9MC 1NXSA 3GLKA 3L82B 2IEBA 3E15A 3MJSA 2BEWB 4YLGA 4ZQBA 2Q0HA 1BE8A 2Z08A 4D4KA 4FYPA 5LBTA 1RHJA 4O4JA 3OM1A 2UYQA 4QUGA 4KFRA 2BSQA 4RL6A 4ARBA 1W88B 3WGGA 4CMHA 4IW3B 3HYSA 1PBNA 2YV5A 1BYIA 3LL4A 1CY4A 4LHWA 1YFLA 4RVOA 2G9VA 3PQ8A 3G2KA 1TEHA 3TZHA 3IYLW 2WAAA 2K7ZA 1JS1X 4C06A 2R79A 3UH0A 2YW2A 5SV2A 3PE6A 1ENZA 2QN6A 4CR7A 2VA9A 3GRCA 3HC7A 4LXYA 4M99A 4RPGA 5LUBA 4LISA 2JIQA 2P6OA 4DCMA 2BGWA 2MR5A 3RVBA 3O3OB 2XT6A 3GRUA 4MMXB 5B64A 1U0GA 4UOQA 3P97A 4W1SA 1YVUA 1XEAA 4QGAA 2JIPA 3GP5A 4BO3A 3NT2A 4EKGA 1R0YA 3FVRA 3H9GA 4DA9A 2NAPA 2QL6A 1HEIA 2BE7A 3HA7A 1Z6YA 1QFZA 4MI6A 4IWNA 1HR0B 2QUIA 4P4TA 1WPRA 3VKUA 4X20A 1IZZA 3GLGA 1R9NA 1VHTA 4GPEA 4WEQA 4JC8A 3ZN2A 1HYGA 2I6QA 2A9VA 3HKDA 3PR2B 4NQZA 4L1KA 1YJCA 4TVKA 4WGFA 2WQ7A 5HEKA 4DXDA 4ENUA 1PNRA 1Z5UA 2BJHA 3NBFA 4OHYA 1DIBA 4REQB 5DHPA 3RIEA 3WRYC 1VMEA 2IEYA 3HCRA 3WGQA 4JC0A 1A9XB 4RHTA 1MO3A 4PC7A 5D6OA 2IZ5A 5A3QA 1N6RA 4PCAA 3OE7D 3FHTA 2ZYSA 1ZAKA 1WVGA 1WDTA 3AF5A 4QU9A 3H1AA 1GL9B 4LQ4A 3ZWVA 4DMRA 1U0LA 4MHTA 2XMRA 4WZBE 3EZYA 5C3MA 4FNOA 3E18A 4QBKA 2YOFA 2EEZA 2WD9A 4B79A 2Q3FA 2A1TR 2EL9A 1LNSA 3ZBPA 4F04A 2AOVA 3O1HB 1B8VA 1WX1A 3NOXA 1OAKA 1RJ9A 4F45A 2VP3A 5J2UB 2IX3A 5I5GA 2A4KA 2Q7OE 3G8YA 3BYZA 2CLMB 3O7WA 4V3CA 3L7MA 4ZARA 3UATA 4C5CA 2Z04A 3EJWA 3OZTA 3QMPA 4MYCA 4UW9A 4OHBA 2JDID 1V3QE 2HIMA 2W71A 4JOQA 4LVUA 2PMDA 3UJHA 3PZRA 1Y5NA 4MR8A 5I9NA 3SLKA 2RHDA 3B1FA 5AYVA 3FWYA 1D4OA 2JI6A 2NVWA 2X0RA 2WYIA 3QVGA 4JOCA 3VPFA 1WP4A 1N3YA 2N42A 1SVNA 3ZCXA 1WU7A 1GWNA 4OQXA 3C7CB 2WR8A 4B0OA 5CAEA 1PJRA 1EGQA 3EMVA 4U2FA 3IV6A 1JVSA 1SFRA 1WD5A 3AJ9A 2J3MA 3O0TA 1CDOA 1FJ2A 2AR7A 2FWPA 2J8ZA 4A6DA 4JLOA 3LQFA 1ZN8A 2IX9A 2XZOA 2JZNA 4UUQA 2ASEA 1FDRA 1I80A 1HE5A 5JRDS 4DV6B 4OL9A 2PR7A 3OIUA 2PZBA 3QGMA 3AY6A 2HSWA 1PQWA 2X7JA 3W79A 5IT5A 2D00A 4DLXA 3LVQE 3V6MA 4AKIA 2P75A 3LT4A 3C41J 3DTVA 3MINB 4KQEA 4MGYR 2HN9A 5D00A 1H1LA 3BXXA 3A04A 2WMNB 4JLWA 5CB4A 5HVNA 2IXEA 1KKLA 1UKVY 4IDBA 4RGBA 1E2GA 4QFCA 2DEUA 4QYTA 4TMTA 5DGCA 1QOPB 1TX4B 4JQSA 2YV3A 1H05A 1J49A 2R4QA 3LOPA 1P3JA 4Y1RB 1UC5B 3H5NA 4IINA 2X86A 1YDGA 3VU9B 4ZVTA 4H1WA 1TK9A 1GGNA 1RKUA 1NA5A 1PTJC 1KBOA 1WXXA 2A58A 1NBOA 2I5PO 1QGED 2O4UX 4GWKA 5HJ2A 1L4LA 2IODA 3SEFA 4JI2B 2GTIA 2DMRA 4GAEA 5FL7A 5ICSA 5KYNA 3D3EA 4XUDA 4G1MB 1GRNA 1U1EA 2X22A 3MFYA 4DLAA 2C58A 3H2BA 3ZZUA 4Z9YA 4WOCA 2V74B 2XA2A 3MTAA 1E60A 2B83A 2N3ZA 3E1GA 3K09C 3MGAA 3NHZA 1PG5A 1QQTA 4OOFA 1U94A 1WRBA 4QVIA 2TMDA 5JXIA 5EZYA 3LSYA 1A50B 2HF7A 2VLIA 1P44A 1C0PA 4ZIRB 3P9QA 1QG2A 4GYJA 3DKVA 2QLTA 3UJDA 4MULA 3ECCA 4HEA6 4FQ5A 4NS1A 3IRVA 3IHWA 5MGNA 3A70A 2HA6A 2GO7A 1E9FA 3LDUA 3Q3VA 2WINI 1GITA 3GPIA 4RD2A 2R5WA 5HFNA 2CE7A 2CL6X 4DKJA 4R4JA 1RP7A 3KPJA 3AUUA 4O4LA 5TB5A 2O8BB 1M7BA 2CLLB 4ZVMA 3WG9A 2MMGA 2ZJYA 3V1TC 1JIIA 3SQDA 3ZDEA 3UCXA 2G6BA 3DFIA 4FT2A 3ZV6A 3F7OA 3Q8WA 4GEKA 5EQJB 1KVTA 1A27A 1Y8QB 4B3FX 3PIDA 4EG1A 1UWKA 1BW9A 5CUQA 1W44A 2P67A 2ZJ8A 3QI7A 1BFDA 4R2XA 4CLRB 3K30A 4DEYA 2ZYGA 1KEWA 4U9IS 4EZEA 1JE1A 2HQBA 2HF8A 3EZGA 4BQEA 3GB9A 1G5TA 3DEFA 2HRZA 3LO8A 5IK2A 1BDJA 1QGZA 5F52A 4B3HA 3L92A 3HN7A 3IKLA 1GUYA 1QCYA 1XTPA 2YQ4A 4CCYA 2ZRIA 1MC8A 4DV7B 1T8TA 3H6KA 4Q66C 4E5DA 1UFKA 1MJGM 3UBTA 1PI3A 4KGVA 3STUA 1XXLA 2EHDA 4OXNA 1F3LA 4TGLA 2VPQA 3VNVA 4L72A 5T3YA 3G2NA 3O8LA 3R3VA 1P1BA 3SX4A 3U5TA 4FKMA 2J9ZB 4NBNA 2O0MA 3CRMA 1UBRS 4KWIA 1LRKA 4F4JA 2HV8A 1Q0TA 1FDIA 4KPUA 1QRSA 1PNQA 2HXSA 4RETA 4Y6RA 2EWWA 1N3LA 3HM2A 3HU5A 4R8RA 4OFZA 1MIOB 1NP7A 1Q1ZA 3V48A 2QYTA 5LOVA 2W37A 3OU6A 5IC6A 3I04A 4Z7NB 1NWCA 2K2WA 3AO0B 4BO5A 1QIDA 3ENWA 5BNTA 5J4KA 4PZDA 3EVAA 2VYND 5C7LO 3O4HA 2XRMA 1W36D 2GPTA 4IGKA 2BFEA 2O1XA 1O58A 1Z3CA 2CWWA 3EFOB 1HE2A 3HCCA 4X00A 3NHSA 2PIDA 4CHTA 2LUOA 2XYVA 5BR8B 5JNLA 1TC2A 3RR2A 2CC2A 5AVKA 4QT0A 1XFDA 2DHQA 3DH0A 1SQGA 2WVGA 4V38A 4Y8VA 1V11A 4P2GA 3DKPA 3W3AH 2CLKB 5AP9A 4KRFA 3KALA 1GTMA 4M0EA 1FUYB 3PUHA 4JIGA 1NFFA 3OO0A 3SBXA 2XR1A 4KQHA 5CDFE 2B4TO 4IIFA 3D1LA 1CDEA 1CUBA 2HHAA 1D09A 4MW9A 4PSVA 1ZCZA 4RS3A 4TM8A 3TSWA 3HSSA 3ZWMA 4NF2A 1Q7GA 2AHOA 4HGZA 3A36A 3DDHA 3PNSA 4FZ5A 4BFXA 3RG2A 4R9UC 5D86A 1P81A 1A7AA 2Q4EA 5ALMA 4CDRA 4HVCA 5DWQA 4YWJA 1M8GA 2WRZA 1X1BA 5BMOA 3EVGA 2AUNA 2YZGA 1XQWA 2QZJA 2Q8NA 2CL5A 4R8LA 1UFOA 5DXJA 4FGJA 3FKSD 4JMLA 3LUFA 4YREA 4CKYA 4F0JA 3AW9A 1BA3A 5ALGA 5EIHA 5EXPA 4RSRA 3PGJA 3PXCX 3N8DA 1M1YE 4P92A 1C4XA 2ZP1A 4QNNA 4HLQB 1TPYA 1YULA 4U7WA 3T3DA 3TRKA 1SG9A 1FP4A 1UXIA 1PS0A 3LBHA 2H6EA 3PEEA 1OGJA 4LJ6A 1Z17A 3VZRA 4DLPA 3PR3A 4P80A 1LNQA 3THYB 2ZM5A 3UW1A 3SQNA 1W4AA 4E4RA 1A4RA 4O4IA 2G5CA 4UARA 3F4LA 1NRIA 3WJ1A 4R84A 4CR8A 2ZUUA 4FE3A 4PCUA 2WUVA 4TRMA 3UFXA 1BRMA 4B75A 3TGPA 4ZO7A 5KNDD 5ENDA 3TGWA 1IL0A 1QJCA 5C5EA 1BVHA 3OIFA 4TM7A 4B80A 2WAMA 2OBYA 2WHQA 2BHNA 1DZIA 2ZB3A 4GDMA 5JVDB 1CS0B 4ZRNA 1T5TA 4L7QA 3SHOA 2HYIC 3EXG1 5CBKA 2BEWA 1ML3A 1QE5A 2FWRA 2PMWB 3ICCA 5D84A 4DA0A 3M6LA 2RK6A 3V7FA 2G63A 1E5QA 1I4OA 2BGJA 3L8CA 1NJGA 1IZ7A 3GBVA 2B2XA 2MHCA 4HZUB 1W88A 3DF7A 3OQNA 2G0NA 2VDJA 3DL0A 3NP7A 1QTQA 1QUEA 3KRTA 5HM8A 1C1DA 4Q21A 3UK7A 3UW3A 3E58A 3IVCA 4IZIA 4WH0A 3T99A 3VA7A 3MCVA 5IJ0B 3IVMA 1SY7A 5LWHA 4YAOA 2PKQO 3PLNA 2AHRA 2Y2UA 1RWMA 3LFUA 4WK0B 4A3SA 3CGWA 2DBVO 2DFPA 1JF8A 1Y6FA 3KVOA 1FYXA 1PJ4A 1VPEA 1NVEA 2H08A 1RCFA 4IOMA 5DI9A 4RHEA 3QWAA 4BV9A 1KI6B 3OPXA 4Y1GA 5K0SA 2XIQA 3DMYA 3RNLA 2P77A 3DZCA 5L3RA 2OENG 1SCQA 2B4QA 3V2GA 2RGNA 1UC9A 1GPKA 2GYVA 3EH2A 4GZLA 1P1HA 4N65A 3FF4A 4TLMB 4ZAWA 3D0QA 3CZAA 1UPUA 3AIOA 1KBZA 4JUIA 2WYOA 4B0PA 3KWFA 4ZFNA 2JGJA 2B1GA 2YINC 1OXBB 1KEZA 2GZSA 2HA3A 1IHYA 4UUOA 5DLEA 2W2NA 2O8NA 4OUDA 1OBFO 3ZV4A 1IJBA 1U2PA 3GD5A 1TCVA 1C8LA 1PT5A 1T2DA 1JBQA 1M74A 3C5EA 4REQA 4TTQA 4CL0A 4DW8A 3R76A 1GTRA 2GHIA 4IG9A 5L8VA 4UMFA 2KLBA 5DYTA 5C1PA 2Q49A 2GHQA 2ZAYA 1FDSA 1WB4A 3IR5A 5AHXA 1Z08A 1VL2A 3GNTA 1YJXA 1B15A 4GWGA 4YPOA 4WBNF 1CHDA 4N4AA 3Q8KA 1DARA 2PANA 4F5EA 3SC3A 2OP0A 4B40A 1EU1A 2CMDA 4YCBA 4XRGA 5CXSA 4M89A 3RVPA 4DOMA 1VM6A 4O2BB 4ZCTA 4J4BA 1AGPA 4HNUA 1RM3A 3ASVA 4RKRA 3G02A 3ZCSA 4IFBA 4TT3A 4TYPA 1NFRA 2J7PD 4YT8A 3R8XA 4HWSA 3OA0A 4S0XA 1M3SA 2CLIB 3GRPA 4L8WB 2I6UA 3W0LB 3BH6A 4EFNA 1ST2A 1HWYA 3O6VA 5HIAA 1H2HA 4P38A 1NNEA 3UC5A 1G9SA 3ZJTA 3AFMA 5G0TA 1SPBS 2ENUA 5DLDA 5KI6A 1MUUA 3SK0A 4JP5A 2OZVA 3EQ2A 1JPUA 3K92A 3KKPA 4JEIA 1NT2A 2DM6A 4C78A 4EVQA 4XIJA 4DUGA 1JA1A 1OPRA 4I36A 5CB0A 1BTOA 1XWFA 1BOFA 2XUFA 2FH5B 3DJFA 4NX2A 2GXAA 3SBDA 2JJ2A 2P62A 5JJ5A 1ZVKA 4Q3OA 5EZ5A 5BW8A 2OXCA 5KYYA 3UJBA 3M9LA 2WJJA 3KZNA 1EJ2A 1NBHA 1WXFA 4QFMA 1WDLA 3CW2A 3C24A 3EUFA 4JP8A 5IYZB 4QYMA 2HT6A 5FF9A 1SCDA 2HX1A 3AINA 3DE2X 1G4HA 4O2RA 2C92A 4LOKA 4YXWD 5CFLA 4KR2A 1O6ZA 2FN4A 4MO2A 3RVMA 3CHYA 1YZTA 3DJYA 2XX3A 3QYAA 4FYMA 4J9VA 3JQFA 2AB0A 4FK8A 4WKNA 1FVHA 5C52B 2W0MA 3B78A 4N48A 4ERXA 2J32A 3GLTA 4IJMA 3NHLA 5CLFA 3FR7A 2FEWB 4OYYA 4PRLA 4J0QA 4OIMA 2WIJA 4ZVKA 1GFWA 4CKCA 1XVAA 2FZ4A 4E6EA 3CMCO 3GDHA 5AIAA 4TTIA 2H07A 1TYBE 3MCZA 3EB9A 3A31A 5AKIA 4ZDKA 1ECBA 1LEHA 4QUKA 4AI6A 1OJ7A 1WD7A 3CEJA 3A1FA 1E6EA 1KIFA 1YVRA 1Z18A 3FVTA 3EPKA 1EBUA 2PJRA 2OORC 2R44A 1ATIA 1DQZA 2H5LA 4YJFB 4I46A 2I6XA 3GF4A 1NLFA 1ZOLA 3E9QA 3EIUA 3C6YA 3OLQA 4MSUA 4QQRA 3TW6A 4YRPA 3N2KB 4DJFC 4EPRA 4Y1RA 2IBSA 2OT3B 1A76A 3NBQA 4W7SA 1C3LA 3LIIA 4X7RA 2CT8A 5IJXA 4E2YA 2H4FA 4TL8A 1NVAA 4D6XA 1LDBA 4L75A 2EZ9A 4YB8A 3VNBA 4ZYXA 3MPOA 4BPBA 3CRW1 3JPYA 2PQ0A 3QF7A 5EXSA 2AEFA 1H4QA 4XB1A 4UHDA 3FYSA 1DBIA 1YK0A 4ZOLB 2EW1A 5DFAA 1VA5A 3AG6A 3GUHA 3FZGA 2DU8A 1CUGA 1MO4A 1N5LA 3AKZA 2DHEA 1XRNA 2WM8A 3BK7A 5CMLA 4M22A 3G5UA 1P8AA 1R18A 4D0GA 5J1TB 3EPJA 5KU7A 4WLNA 3LPAA 1WCIB 2VHCA 2FDCA 3NTUA 4ZIRA 1EVIA 3KUXA 3N76A 1XRQA 3NT5A 2ZBEA 1CUYA 3GT4A 3Q5EA 1AGRA 3NBZC 4FMPA 3ZCUA 1P7WA 1DAPA 2P2SA 2OAQ1 4EI2A 3W2GA 4QA9A 1P17A 4PX2A 4Q15A 2X41A 5COAA 4X85A 4MICA 4PG6A 1U9ZA 1JFVA 1N2BA 1XZGA 4BVJA 4RKEA 1A8SA 1XRMA 5ALPA 1JTFA 1MN6A 3A0UA 5BSGA 3PV0A 2P5TB 2ZLBA 2GSDA 4AY6A 4N0PA 2V0CA 1SCKA 2DCMA 3GJ0A 2ZDQA 1QP0A 4IH9A 4H18A 3CNOA 1X8LA 5HCIA 2O8BA 3RS9A 4FZJA 3V3KA 2UXBB 4N03A 3CZ5A 1PYGA 4DR6B 3V4SA 4JR0A 3ZQKA 3HFRA 2BKXA 2OP1A 3I6BA 3C15C 2WVAA 4JYPA 1G63A 4ESHA 1ZX1A 1Y8QA 4CNBA 4UHFA 1RI3A 1K5HA 2O5RA 3BL8A 2A7QA 4FUQA 3ZKWB 1YQUA 1EP3B 4N7BA 4EVIA 4IIDA 1JEOA 4GKVA 4IOLA 4CLRA 4PSDA 2VG8A 4HDRA 3BBPA 2JI4A 1ZDMA 2BD0A 1HPLA 1XDWA 2GLTA 3FUUA 5I3ZA 1Y6QA 5DTJA 1JJVA 1GLGA 1PS8A 3JAKB 3K16A 1EWVA 3GEDA 4NECA 5FV7A 4AMGA 1D0IA 1LXCA 1PJ8A 1UKZA 3LUPA 2RH5A 1SC6A 1F17A 1KO4A 3Q15C 4M7RA 4ODIA 4RWZA 3V7UA 8LDHA 3MNFA 3BJEA 5CVJA 4A8JC 1UM9B 5C5IA 4HATA 4FHZA 4DDWA 1QTRA 4DLZA 3HLTA 1ZD5A 3F2IA 4WXEA 4FSDA 3K0FB 1UXKA 5DX0A 4D9MA 4IDGA 3LLSA 2OGWA 3PXUA 4LGMA 4N6NA 5A4IS 2FHPA 3PPVA 4N82A 1BOOA 3BD8A 3NVDA 1R37A 3QVLA 5TE9A 3VC2A 3UPTA 4MQUA 3G88A 4B83A 2C1EA 1EKXA 3L7AA 4UU1A 3H2ZA 4YRJA 4OAQA 3SI7A 1KI8A 2YXLA 4B3CA 1NLMA 4CV3A 4J2TA 3J80A 3R3SA 2ZE7A 2PMKA 4QDXA 4QULA 1MIOA 3MD9A 3KOZA 2I78A 4OF4A 4W1PA 2J08A 3W5AA 2JKYA 1K98A 3D7NA 4Y6QA 4NP6A 1M2VB 2W4QA 2YIMA 3O90A 4YRSA 1B41A 1KJZA 4HYTA 3USCS 5T64A 4QOEA 1SZDA 4MCJA 5AKGA 1FTNA 4K81B 5LQAA 1H8HD 4M88A 1R7RA 1O96B 1XF1A 5C4IA 1U1GA 1PHRA 2CVHA 3KC2A 4CKWA 3EFOA 5JXJA 3MRTA 2XTZA 3OLXA 1QIEA 4U4AA 2ISQA 3TTVA 2C59A 2ATVA 1G21E 1X38A 1Z25A 1KO5A 3F6CA 1LQTA 5EZ6B 3SHQA 4BX0A 3OZCA 3GXOA 3FVWA 2O54A 3O95A 1JIQA 3PJEA 4KQCA 1UJ4A 1MB4A 1NPYA 5TARA 1RKBA 3KG2A 4FX2A 1K7CA 4LC9A 3NRJA 2X40A 5TRTA 4M0FA 4KPYA 3PFNA 4K6KA 1PDOA 1MP0A 4DHWA 2W58A 4RYLA 3L7OA 1ILWA 1PRYA 3DNFA 4QBGB 4YX9A 3IR6A 1RXYA 2H2FA 5K05A 1P1RA 1C81A 3NYWA 4Q7LA 1L3BA 4OH1A 4IGAA 2G9NA 1GPLA 4QTXA 2V7EA 3OBIA 4DYDA 1C0EA 1U3WA 3ZGVA 3I6MA 7MDHA 1NGSA 4TT8A 3SBOA 1NRXA 3DFZA 4J16C 3M82A 3WV4A 4ZEMA 2NYAA 1MJ5A 1OASA 3KPVA 4F8YA 3BJIC 3OEED 4CM5A 4XFKA 3NGLA 2QR3A 1L9XA 1UOEA 3L7CA 2WKWA 4LJKA 2A33A 3SPXA 2PVSA 1TNDA 4KPGA 2ZI7A 2RFLA 3H7IA 1YB2A 1K86A 2AFRA 4KR3A 2C00A 2GYUA 2JJQA 3FCEA 4A0RA 3DO5A 2DQYA 1R88A 1OU0A 5JRZA 4MA4A 2CEKA 4NY1A 1KU0A 3THYA 3IIIA 1GG8A 3OF5A 2E4ZA 3P2MA 5CLGA 2CHEA 3JVIA 2X1HA 3CVOA 5SZKB 1KAGA 3OCYA 4K9NA 2GM4A 2F9LA 1T0BA 4LHEA 2NG1A 3JYNA 3AEUA 2NT4A 2H52A 4FGZA 2CCKA 4UHJA 3FBWA 1DPGA 3X1ZA 3IVXA 1I1QB 4RZHA 3RRBA 3ND5A 4LQLA 4I9NA 5J40A 2A9RA 4MRPA 2A0FA 1VSTA 3FMPB 5G1OA 1CS0A 3W1VA 4ENWA 4EI9A 4II2A 5JVDA 3H5AA 1IVNA 1N0HA 2EX1A 5KOJA 2BM1A 2GAAA 2A59A 4OK6A 5LQRA 4QBHA 4F86A 2P27A 3S44A 1DQRA 3HCBA 2BSXA 4C29A 2C98A 4OFWA 2P0YA 5JMPA 3VR4A 4LRWA 2VF7A 1QANA 3DDOA 4N5NA 4RK4A 3SAJA 3TIXB 3LW8A 5A4KA 3F5QA 5HK9A 2A1UB 5GIPE 4H0CA 1CY1A 1QHIA 1V35A 5DN6A 2P8SA 2I1QA 4GMGA 1CF2O 2C04A 4ZEVA 2W2KA 5F35A 4ZEWA 4B35A 1AIPA 1TC1A 5EXXA 3VR5H 1HYHA 3WLSA 3FNRA 4MIYA 3G2HA 2BGGA 3M4JA 1S89A 3F1LA 3LYHA 3L93A 2DXIA 2QBYB 4ZMSA 3RUEA 1IWBB 3ZJYA 4EPVA 3PDWA 1FTWA 2EWVA 2C5SA 4RY9A 1PL6A 3WAGA 5ERYA 1AKEA 1RTTA 2X6QA 5SZHB 2BR3A 3PHBE 4NMWA 1WCV1 5K6RA 4IKPA 1NQWA 2HPAA 1PVVA 2IUYA 3IBCA 2V6IA 3OTWA 2BMAA 4YN3A 3ISTA 3T4EA 3SF8B 2H2HA 5HOQA 3ONNA 2OE2A 3TNJA 4M9RA 2ROQA 3AGPA 4MV7A 3I53A 4DIMA 3U19A 2WM3A 2QL9A 5EWJB 4C6TA 3TSYA 2HNAA 4J1QA 4LE2A 5HIMA 4NU5A 3A9RA 3VYVA 3HCAA 4MWCA 1JU3A 1P72A 1P6UA 4MYHA 1TGVA 3CQ9A 2G1AA 2QTLA 3IE0A 4CKZA 3GT0A 1JDBB 2DPGA 3GELA 2VPIA 4HTFB 1RYYA 4EA7A 2IC5A 4BGEA 2QL7A 4U7GA 1AG9A 4FOOA 3A6GA 1V37A 1Z88A 3AK4A 4LK2A 5EMJA 3VJKA 2JFZA 2WA1A 4F38A 4EHBA 1FP1D 1I3OA 1U8EA 2BGIA 4GP6A 5C81A 3JTMA 3FZEA 3OKPA 4GYYA 3S8EA 2IYTA 1Q22A 3PFBA 2HD4A 1RBYA 2XNDA 3QUSA 4C20A 2Z2KA 5B2FA 4WLEA 4YT2A 3EQ9A 3RBVA 4TMFA 3REOA 5F2KA 1KNXA 2YZMA 2XNCA 1RQLA 2WU8A 3IPRA 4MGZR 3VHRA 7ABPA 4RTJA 3K35A 1L7DA 3ESDA 1Z6XA 5K0BA 3OCWA 3FWPA 1VZ3A 3WLFA 5A4JA 2W6QA 3OJ0A 2CJFA 2ETXA 4NEGA 4RL4A 3DL2A 3UYLA 2HSZA 5IYZA 2D1YA 5H8WA 1X7WB 1M66A 2RB4A 1KVRA 1SVIA 2H65A 4C04A 4CTJA 4AY3A 1TT7A 1OBCA 3CW9A 3FNHA 1LFDB 4ALMA 4ASUA 3U4AA 1S8AA 4BU1A 2VRCA 5FI3A 4ZYLA 3JQ9A 4F3KA 4GWLA 4HOYA 3O1LA 1HURA 1W6RA 4QQKA 4GVXA 3B6EA 5DEIA 2X9QA 3N0TA 2J3IA 3TZ6A 2JIRA 4ZJYA 1IHOA 5L7TA 2C42A 4M9CA 1U6JA 1K2VN 4G24A 2AE1A 3RV3A 3RROA 1FX0B 1YQGA 2YBDA 4M1EA 8GPBA 4HLUA 1NVBA 2Q9UA 3K2QA 2C94A 2AE2A 1W52X 3IR7A 4J90A 4MEJA 4MS1B 4PU0A 3K8YA 4RENA 2FSHA 5E9WA 1IPFA 2B3TA 2HRCA 2X5NA 2J9GA 5FYDA 3U81A 2GKOA 1QHNA 2GESA 4XDGA 2CHFA 1ZAYA 6ABPA 2C4MA 3B8HA 2GI4A 1J8QA 3ETNA 2YIVX 2BHTA 1LGYA 2O6LA 2PPLA 1UZMA 2RGAA 1PZGA 4RZUA 1WDKA 4YJFA 5KCMA 1FNBA 3RS3A 3AV0B 3AUJB 4HNSA 4TUYB 1C41A 2Q6KA 1TM3E 3C39A 4YRCA 5IN4A 2ZETA 4IIEA 1C8VB 1J90A 4RH3A 3PFHA 3TZKA 3UA4A 1AQ6A 1S4QA 4PN3A 2NQTA 3EBPA 3T9AA 1NXTA 4CJXA 3VPSA 1KVUA 3U4IA 3DV0B 3V9PA 2QMYA 2QN9A 2ZU0C 3L6CA 5JSFA 3EASA 4NENB 1Q0PA 3PK0A 5KSWB 2Q5CA 2Y92A 4HWOA 4ZOLA 2W6IA 4PLPA 4YAGA 2QQ0A 1LH0A 3UM9A 2ZTMA 3KD2A 2GK3A 3N58A 5LA6B 5IXJA 2CXRA 2WG1A 3EPPA 4ZO4A 5EHQA 5LUAA 5E4YA 4DB4A 4NBTA 3T6KA 1MGOA 2KQUA 4B6JA 5AM2A 2BUCA 1LCIA 2DTEA 1PWHA 1NFQA 1WCIA 1EJ6A 2JK0A 4Q3AA 2VUHB 1KTIA 5LZ4A 1J9GA 3LYLA 3ILSA 4OQZA 4XLTA 1LVUA 1USWA 2W6JA 5JMOA 3HTXA 4NFSA 2XZDA 3HBJA 3KQMA 1ZK4A 2ZCVA 3BAZA 3DAHA 4FMCB 1VCIA 2OQRA 2OV4A 4RQTA 4LF8B 2RAUA 3NOQA 3QE0A 4HGPA 3C74A 5TQ2B 1JEJA 1Q95A 1Z62A 3A2LA 1CY0A 3S28A 2GLXA 1T5LA 2JIMA 3DEZA 4ZV9A 3T5MA 5G0UA 3K7EA 1Y42X 3C2QA 1SNYA 1T2AA 4KBYA 5JR3A 3NU1A 3V46A 2QSYA 2X0KA 2C5AA 4B3RB 1PD1A 3R77A 3ZKWA 3AJDA 1R0KA 3E2MA 5D6NA 3RK1A 2VBGA 2FSUA 5I7VA 1J06A 1H65A 1K3FA 3C1AA 1IBMB 2Z9CA 2QRUA 2Z8YA 3DEIA 4R9SA 4XSGA 3S5UA 4ZCIA 2ZYRA 3K0AB 1VBMA 1KSJA 1TYDE 2J5QA 5G1NA 3ZLUA 4A23A 5LIPA 4XWKA 2B1QA 2PZFA 3DVQX 3VZQA 3BUSA 3CVJA 3W6UA 3ZDQA 2R8YA 1ZN2A 4AKHA 1SK8A 3EIQA 1XU7A 3OOHA 1UM9A 1VL1A 5BSHA 1XI2A 2PAAA 2R8PA 1ZXLA 3LK6A 3QKIA 1ZR4A 4D26A 3K0FA 4G1EB 1SUBA 1TVEA 5KAMA 3DFMA 1Y7PA 4X24A 4G5YA 4Y7DA 1ONPA 2ONCA 4N5MA 2VEOA 2O06A 1G7RA 3GUUA 5I9MA 2I03A 4XM2A 5CX1A 4Q0MA 1OFGA 1T3ZA 1FF9A 4CWAA 2H29A 4GX0A 3QKTA 1JQKA 5FI1B 2BF7A 2E4UA 1CERA 1X9IA 4M8KA 1I24A 4AUNA 2PUEA 2AH5A 2H1IA 1M2VA 4HRXA 1XNHA 3CKYA 4MGHA 1VBNA 1MORA 2FPPB 2VDPB 4XLZA 3KKOA 1ONSA 4B7AA 4B6GA 1T0PA 1NQ5A 2QV0A 3MJ4A 1Z4IA 4NL4H 3B13B 1ZEJA 2WV7A 1H0SA 2F1IA 5K3EA 2O19A 1TM2A 3D8TA 1O94C 1WUKS 1JLHA 4YCAA 2QI9C 3IP8A 4XPZA 3V4PB 4X97A 2Y93A 4UBJA 1T9KA 1X7ZB 1YNSA 1WZIA 2JFHA 4PRKA 3DAGA 3C6QA 821PA 4TTSA 4EJ0A 1IHPA 2Z0MA 1L1EA 2G1UA 2WTXA 4G8DA 3NLLA 3F7TA 1QP8A 1SGWA 2QROA 3M1IA 2AI1A 1I0ZA 1M2WA 1NUAA 1QIMA 2Y8EA 1NVKA 3W6NA 4CUKA 5DM60 4Y2GA 3N8GA 5HKKD 3NORA 1VHWA 3IA7A 1UEJA 2OPHA 3PIRA 4O4HB 3UMFA 3R5FA 4F85A 2QTBA 4CUZA 1D3AA 2AFIE 3OI7A 4GXQA 3VVLA 3WLMA 3BE5A 4M1OA 4F7DA 3K15A 5HUJA 3AUAA 5A3SA 2QYHA 3H5RA 1QFYA 2YC2C 1U8ZA 1NJ2A 2P9JA 1QUFA 5L6MB 2YKGA 3MHTA 5EQFA 2IYFA 3S7ZA 3FFBA 2CMKA 4ZPXA 1LPMA 1XP8A 4B76A 2GJ8A 2H5EA 3SSNA 2FF7A 5I7HA 3T3EA 1L6RA 2QLLA 4PZAA 3RD5A 3ZHXA 3T34A 3I2IA 5HJEA 3H04A 3IE1A 1RWBA 2VWPA 2VUTA 2FPIB 3IQGX 4RAOA 2VQEB 4HAUA 5TGZA 3AIMA 1R3DA 1PZFA 3Q7RA 3R6LA 2PUJA 4U00A 4C0KA 2K7FA 4E5KA 3QMVA 1JB1A 4K0RA 3WYCA 2IUUA 1SOAA 3B1VA 1J39A 3CUYA 2Q5EA 1NW9B 2HMTA 2QN3A 1THMA 5I8ZA 4BLOA 4WCVA 3QX8A 4RSMA 1NXPA 2GCGA 5JTTA 2AF3C 2D8AA 3C8ZA 5HNKA 4XFJA 5KSPA 4CMIB 1WLSA 1XX6A 4Z2YA 3NC1C 2Z98A 1J8YF 2OFFA 3VZDA 5DX8A 4MO9A 2W90A 4W5QA 2R6DA 3K9GA 1GLNA 1KPGA 1N8TA 4PANA 2WE8A 5DHSA 2EZUA 3IKJA 4LFCB 2PLWA 1DRJA 1V8OA 4X6UA 1JHPA 3QHAA 4HB2A 1HEYA 3E82A 4EF5A 2A1UA 4Z3KA 4YHHB 4A27A 3LPLA 2YCLA 2ODBA 2NU9B 1OZFA 4OSPA 4R3UC 3SC2B 4EEZA 4ZJZA 5BYKA 1ND5A 2J3QA 1U65A 3HL0A 3T4PA 5AW9A