1F9AA

Crystal structure analysis of nmn adenylyltransferase from methanococcus jannaschii
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
164
structure length
164
Chain Sequence
LRGFIIGRFQPFHKGHLEVIKKIAEEVDEIIIGIGSAQKSHTLENPFTAGERILMITQSLKDYDLTYYPIPIKDIEFNSIWVSYVESLTPPFDIVYSGNPLVRVLFEERGYEVKRPEMFNRKEYSGTEIRRRMLNGEKWEHLVPKAVVDVIKEIKGVERLRKLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of nicotinamide mononucleotide adenylyltransferase: a key enzyme in NAD(+) biosynthesis.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
molecule keywords HYPOTHETICAL PROTEIN MJ0541
total genus 52
structure length 164
sequence length 164
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.1: Nicotinamide-nucleotide adenylyltransferase.
pdb deposition date 2000-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1f9aA00
4MVXA 3ND5A 1F7VA 1EUYA 4XFJA 3PNYA 1U7DA 1WJGA 3ZIUA 3ELBA 1VBNA 3D6UA 1O94D 1UFVA 1WKBA 4ZT4A 3IDFA 5LFAA 1VLHA 3K9WA 2CYBA 4MVWA 4OUDA 2AKEA 1WXHA 1TYAE 1IQUA 1XNGA 3HZRA 2H29A 1J70A 4MUGA 2A86A 4G5YA 1MJHA 4X0EA 2A1TR 4CDMA 1JIKA 2IP1A 4MULA 1JILA 3CLTD 4JYZA 1O0CA 4HK4A 2J09A 3N2YA 3A05A 2CYCA 2QJOA 1GN8A 2DERA 4MUEA 4MUFA 4MW9A 3TNJA 3ZXSA 1PFVA 1LI7A 1MB2A 1VBKA 1FFYA 4ZCRA 3IOEA 3KT8A 1G59A 1F9AA 4AQ7A 3FY4A 1COZA 3ILVA 1PG0A 5AHWA 1EJ2A 2A88A 4I6EA 1KAMA 3QE4A 1I6LA 3KT0A 2WQ7A 1JMVA 1ZH6A 1Q11A 4NAUA 5HUHA 1U3DA 4J76A 1KQPA 4ZT5A 4XFDA 4MUJA 1HYBA 5J59A 2YY5A 5KWVA 2QTNA 5J58A 2D13A 2OQ2A 2E0IA 3HL4A 3Q10A 3Q12A 4Q16A 3MUEA 1TYDE 1JZSA 1JECA 2PG3A 4DE5A 4JFAA 2J08A 1MC1A 3FNRA 4OUDB 3PNBA 1TEZA 1I6KA 1M8PA 2I1LA 3HGMA 4MWBA 5IJXA 1NURA 1WQ3A 2HMAA 3CLUD 3QTBA 1QRSA 3DV2A 1FYDA 3SYTA 3QTTA 3KFLA 5K0TA 2XRYA 3VU8A 3UY4A 1WOYA 2QUKA 4EG8A 1OWNA 1NUTA 2AZXA 1JEEA 4CQNA 3DPIA 3FETA 1DNPA 1JEDA 1BS2A 3FWKA 3KT3A 3ZXIA 3CR8A 3H9BA 1IH8A 3FG9A 1NZJA 3NV7A 1OWMA 5TGTA 1YUMA 1N1DA 3CVWA 1KKUA 3IVXA 3TQOA 2CV0A 4EGAA 1O97D 4KPUB 4ZT2A 3TS1A 4ARCA 1MB9A 1N77A 1G8FA 2DEUA 3GMIA 1GPMA 1QRTA 5J5AA 3CLRD 4XSVA 3UC5A 1IQ0A 2CUZA 2CV1A 4R2MA 1XJQA 1YIAA 1XNHA 4JXZA 1K97A 4KPUA 3P0JA 3VGJA 1T6XA 2RD2A 1G8HA 1JIIA 5EKDA 3Q4GA 1M8JA 1QTQA 3A4IA 2J07A 3FDXA 2X3FA 2O8VA 1J1UA 1H3FA 4NZPA 1IHOA 5LM3A 4EF6A 2PFSA 4ZCQA 1YULA 3H9CA 4MWDA 3MXTA 1NUPA 1OWOA 1WY5A 5FO1A 1YI8A 4HJRA 3AG5A 1PFWA 4G5FA 3X1JA 1WXFA 3IMCA 3G59A 2DR2A 2HGZA 1QNFA 1P7PA 3RFFA 3ND6A 1J21A 1N78A 3PXUA 2ZUEA 4EG5A 2CYAA 1N2HA 3INNA 4KR6A 4EG3A 3AIIA 3ISJA 4GU5A 1NUQA 1J09A 3N9IA 1OWLA 4JZYA 4HJXA 2Z08A 2XRZA 3A04A 1KQOA 2JAXA 4MW5A 1TYCA 1R6XA 3RHSA 3H99A 2IJGX 3ZJVA 4DLPA 1K92A 3ZJTA 4YP5A 1KORA 2PZAA 5H7XA 4PBTA 3FOCA 1NSYA 3HV0A 4YP7A 4EG4A 2E21A 4MAFA 1MAWA 3HFJA 4U8HA 3IUEA 1TYBE 3CLSC 5IHXA 3PRHA 2HZ7A 4ZCTA 1LW7A 3ND7A 3H05A 2GKSA 1GTSA 4ZT3A 1EFPB 2JANA 1N2OA 4NX2A 3IUBA 3KT6A 4TS1A 5KHAA 3CLRC 3FI0A 1WXIA 2VXOA 3X1MA 2VTBB 1I2DA 3NBKA 1IRXA 3CVUA 2CT8A 1KQNA 4DDMA 2PIDA 3COWA 4WNYA 4KKVA 4U63A 3A2KA 1EFPA 1KH1A 4K03A 1T9GR 4QRDA 2NZ2A 5H16A 4MQ6A 1V47A 1KH3A 4KR9A 3SZ3A 3ZJUA 4EFKA 4ZCPA 4DDHA 1VL2A 3LOQA 1T9GS 3CLTC 3OP1A 3IVGA 3IMGA 1OBHA 1H1TA 3CA8A 4S1OA 3IH5A 4I6JA 2X0KA 4ARIA 1PFYA 1ULHA 2OV4A 3CVXA 3LE8A 4CDNA 2C5SA 1CT9A 1K4KA 3HMQA 1MOPA 3I05A 2DUMA 2E89A 2QJFA 2PZBA 2A84A 2G36A 3MLBA 2TS1A 4E1AA 1A8HA 1SURA 3G5AA 1GTRA 4DJAA 3FIUA 1ILEA 3GUZA 2QUJA 5TEWA 3E27A 2YWCA 2VTBA 4R2LA 1O95C 1QU3A 4ZT6A 2J4DA 3UMVA 1NI5A 2R5WA 3SDBA 3AG6A 4NAHA 2Z3VA 1Q19A 1OBCA 1XNJA 4MWEA 3DO8A 1O94C 1ZH0A 1VBMA 1N2GA 4MUNA 1MBZA 2D5BA 1N2JA 3L92A 4YBRA 5DEOA 3F3MA 4MW0A 4OJMX 4YP6A 1U0BB 1M8FA 1ZJWA 4RPIA 2IELA 1F4LA 1M1ZA 5DB4A 4DNXA 2E18A 5TS2A 1EE1A 1R6TA 4PY2A 2CV2A 5DK4A 3IOBA 1I6MA 2EJCA 3PNVA 2X1LA 2DXIA 2B7LA 3N8HA 4MUIA 4EG1A 3G6KA 3K32A 5BNZA 4Q93A 2QTRA 5LLTA 1EFVB 1WQ4A 2EL7A 5DASA 5FO0A 5HG0A 3N05A 4L2IA 1JHDA 1Q15A 4I6GA 1OWPA 2V0GA 1YUNA 4MW4A 3SEZA 1B6TA 2AG6A 5KCMA 1H3EA 3COVA 1O96A 1F7UA 2BYTA 3NBAA 4MW1A 3TQIA 4QREA 1EFVA 2QJTA 3RK1A 4L2IB 2CSXA 4MW7A 3DLAA 1J20A 3C8ZA 2V0CA 4G6ZA 4UZEA 1IVSA 3CVVA 3IOCA 4UZFA 3X1KA 1O96B 1MAUA 4K0RA 4GRIA 4MUHA 1NYLA 2A1TS 4EG6A 1WXEA 4F3RA 1NUUA 3FH0A 2A1UA 3S3TA 1N75A 1LI5A 1X6VA 2D54A 3BL5A 3CLUC 1S4MA 2NSYA 4H3SA 4AS1A 3JXEA 3AKZA 1KP3A 1WXGA 1X8XA 4F4HA 3LCJA 1J1ZA 1YIDA 1U3CA 1N2IA 1M8KA 3RJZA 1O95D 2GOYA 2A4MA 1JGTA 1GLNA 3TZLA 2WQ6A 4NATA 4ND7A 3SP1A 1OD6A 1M83A 3MMXA 4MVYA 4ZCSA 2WSIA 2ZP1A 1GZUA 1KR2A 1O97C 2QTMA 2QUHA 3P0HA 4DDKA 4U7JA 4NDAA 2RE8A 4HPWA 1Y42X 2JA2A 3AL0C 3OTWA 1QRUA 3IMEA 4JXXA 2YXNA 5K0SA 2J5BA 2GM3A 3ZGZA 4BWVA 3M5WA 4R0NA 2WB2A 1NP7A 3SZGA 3CVYA 1KH2A 1MRZA 3AFHA 1EUQA 2A1UB 3COZA 1ZUNA 1IQRA 3IVCA 2DPLA 3IODA 3SEQA 1U7XA 2CFOA 2DETA 4KR7A 1M8GA 3H97A 1EXDA 1O0BA 1K4MA 2QUIA 3VRHA 2PZ8A 2YWBA 4RUKA 1JZQA 4FZJA 4MW2A 1GAXA 4PBSA 1D2RA 1NUSA 3UOWA 5FNZA 4ND6A 1O6BA 1T6ZA 1Q77A 4A91A 1G8GA 1N2EA 4CT0A 1R6UA 4MUKA 1RQGA 3TZEA 2H2AA 1QQTA 4YMIA 1N3LA 1T6YA 4MW6A 1TQ8A 2BTEA 3RK0A 2Z09A 4P2BA 2O5RA 5HUJA 1H3NA 1PG2A 5TEVA 2DLCX 3U1VA 4EG7A 4WSOA 1KAQA 3MLAA 1V8FA 5JBNA 3D6VA 3ZUGA 1QU2A 3UK2A 3COYA 2ZUFA 1N2BA 3GLVA 1WZ2A 3L93A 1TFUA 4MWCA 1QJCA 3P52A 4ZT7A 2A7XA 2PXHA 1PFUA 4J75A 4PBRA 1IFXA 1JIJA 3CLSD 1KP2A 3RBAA 4MVCA 4MLPA 3P0IA 2X1MA 4QBTA 5F23A 3FHJA 1O5TA
chains in the Genus database with same CATH superfamily
2REBA 1RKVA 4F11A 2WNSA 1Y5RA 5AK3A 4LRSB 5EZYB 4HT3B 3PHBE 5IBRA 3V2UA 4G4SP 4AMUA 3BGSA 3HXMA 3OEHD 2RAPA 1Z0FA 2HQ1A 3HRHA 2WWRA 1QQ6A 3ELBA 3KYCA 2IZ7A 2B4AA 2OGZA 3UO8B 2QUZA 3ZWQA 1E1CA 1O94D 3KQVA 4G5OA 3AHFA 3LFHA 3IT1A 4EA7A 2WG1A 2QVZX 3TDKA 3EGDA 3EZXA 5CFZA 2CYBA 1ZUIA 2V6BA 2ON6A 1LY1A 2AK3A 3SBEA 2G5GX 3C7DB 3I9MA 1Z4PX 2ZSJA 3NUQA 1C8LA 2DAPA 3P9KA 5EXPA 4KH1A 4B7XA 1Q0UA 4DR5B 4MJXA 3DMTA 1JB1A 4WOBA 1XZHA 2IP1A 1NMZA 3T7TA 4YHHB 3Q8KA 3ETCA 4ZYLA 3M34A 2JLYA 2MJLA 2OSBA 3CX3A 5EP2A 4EAQA 3GW8A 4QUGA 4CT5A 4Y6GB 1B1AA 1B8OA 5ECDA 3T34A 4F2GA 4FBLA 1OHHD 5HJ5A 4ANFA 2FOLA 1KJIA 4TWIA 1I01A 2B4YA 1VKOA 2OD2A 3W77A 1KMQA 4Z4QA 1DDOA 1MB2A 2AFIB 3HCRA 1NBMA 5H9VA 4DIUA 1FFYA 3NQ41 4OYHA 3SQOA 3ZPXA 4ZCRA 3OVMA 3N2LA 1E3WB 1OW3B 1COZA 1OLSA 4BN0A 3LXMA 4P4SA 5CCXA 1P91A 1V2HE 5LA6A 1T0UA 2VSXA 4FMBB 4ZKEA 1I14A 2GEVA 2IXTA 3BE4A 2VS1A 2IDKA 5IABA 2YJ4A 3VI3B 2OB2A 1N9KA 2EFGA 1T0PA 2F8MA 1YDMA 2IU4A 1RQXA 3H5VA 5E1BA 4RVFA 5A0FA 1LV7A 3R20A 1NUAA 5B58T 1Z6QA 1JBEA 1E3DA 3GDOA 2B30A 3RRYA 1QFSA 4G8CA 3RS9A 1ESDA 1PV1A 1NVUQ 1T5DX 4KC0A 4ZGBA 1UP6A 5J58A 4CZ2A 4FB5A 1GGVA 3NMUF 3OE5A 1MP0A 2FY8A 1ECLA 2TECE 2ZZKA 2QD5A 2CXRA 4BEVA 1OXMA 5JZVA 1S0UA 2ZS7A 1UM8A 3W8FA 3CNOA 4KLZA 3AI7A 4Q4DA 4X64B 4RA9A 5JSZB 4F0JA 1UFKA 3GVHA 3SR3A 2NT3A 5JNSA 1SQSA 1PWZA 3BMNB 4Y1EA 4EA6A 4L02A 4LAFA 4PC2A 4TMZA 3EX7C 1E18A 5JFGA 4MIEA 1QS0B 1IB6A 4MDHA 4MWBA 1HEIA 4ZVOA 2CZCA 3OOEA 2XUAA 2ZSKA 3P9QA 3FYTA 1QIFA 3SFZA 5JSZA 3EQ8A 2X4GA 1UT8A 1E6LA 1T6NA 3KQMA 4O8CA 3BMNA 5DMHA 3STYA 3UAXA 3NGXA 1AOXA 1NM5A 1XTVA 3Q40A 5KHLB 5D3MA 2XXAA 3L04A 3MSCA 3HB1A 1USUA 1N6NA 3THRA 1JA9A 3O83A 4K1XA 5A1TA 3TSYA 1NUHA 4AMBA 1FUIA 3IAUA 3H8WA 4B9AA 1SXJD 4QNRA 5LQAA 3WRYA 3IP7A 2F1OA 3TXYA 1N8KA 2E5WA 1HZZA 1LJLA 2VJMA 5DK6A 3TQOA 1OIWA 3U3ZA 5D3MB 1GUAA 1RD4A 3CXRA 5JSQA 3MZ0A 4Y2SA 3KOXA 5J2UF 4KPUB 2NG1A 3ZHXA 4GECA 1Z6XA 2LDXA 5F64A 1R0RE 2JCVA 3PC8A 4E5NA 1XDZA 3ON5A 1UMCB 5D85A 1XN4A 3C7CB 1VIYA 1GPMA 3NX4A 1EM8A 4QVKA 4OM7A 2CUZA 1HOXA 3NOQA 1G20E 2LW7A 1Y4DE 2QR5A 4KPUA 3WMRA 2AIRA 2Q29A 4UMDA 1KWKA 1FYXA 5KNBA 1G2QA 1RMYA 1SK9A 2HMVA 4H27A 4BZZA 1BMFA 5BV8A 4Z4EA 1OFIA 2N46A 4AX4A 5CDTA 1M8JA 2GRAA 3LLMA 3CH4B 3LCCA 3ZWYA 5T6MA 1MT0A 1ZJZA 3DEHA 5DCWA 3QLTA 2D2XA 4R69A 1IJFA 5BSEA 4D74A 4INJA 3ZBPA 1TECE 4DRZA 1CQIA 4I2NA 1CNMA 2I7CA 1ARZA 5F4BA 2QGZA 4PZCA 5HPYB 3B82A 3IR7A 4HJRA 1D1SA 1EK0A 1EVJA 2IUSA 4XTRA 5F3WB 3V1NA 5EPEA 1KO1A 1S8NA 3DEJA 4CV2A 1XPOA 4AY2A 4WACA 5EMMA 3R9XB 4NYIR 4FSHA 2QRHA 5K0ZA 4ND2A 1YA4A 4E30A 4DPLA 4LXTA 1BMTA 2J3MA 3ND6A 2CMFA 3NWBA 4IOMA 4XB1A 5K0NA 4JVNA 4U6SA 2NXNA 4S24A 4IRXA 1T13A 5HZHA 2GZMA 1ODKA 1ACLA 1R5BA 3SHQA 3PGKA 3A1UA 4F3CA 2OV6A 3G1WA 2YUTA 4B79A 2FUEA 1BWQA 2FSGA 2RK4A 4WBXC 2PMFA 2WWFA 3MS2A 4PYIA 2VRCA 4R7TA 3B7PA 1YONA 1QLJA 4URYR 1AMNA 3A04A 3RASA 2C98A 4Y9RA 3ZWWA 3GY0A 1TYCA 1YI1A 1VHJA 3OCVA 4RQUA 5BMVB 1NXSA 4CV0A 3KEGA 3ZJVA 1XRPA 1IK6A 1UZUA 2Q4EA 3QKTA 1SKQA 2BBWA 1Q0LA 2HLHA 4KXVA 3ANNA 1GHTA 2PZAA 4BQEA 2ZJ3A 3ZGXA 1ZW1A 5C35A 2H08A 121PA 4LHYA 3RKUA 2CHEA 2WY2D 3SNKA 2VT3A 1SBHA 1R3DA 4Z4CA 2VJCA 4IGFA 1GSIA 3M6UA 1U28A 1SC3A 4YCDA 3WLEA 3U7JA 1M2OA 3AFIA 3R41A 5KQGA 5DTMA 5JFTA 1UWLA 1MFPA 3PUKA 4JQYA 4OA5A 4HV4A 4NYJR 5SY4A 1I3OA 1W4CA 2PYDA 3UIEA 3RSFA 2RI0A 2ECQA 1Z12A 3K92A 4OYRA 2HUPA 3G2PA 3HFGA 1F3OA 3EEIA 5K5EA 1F2TB 1C7QA 2QW0X 1IZ9A 2CT8A 2XYGA 1QIIA 1JEYB 5JHHB 4HGZA 1JAHA 4N7RA 4U63A 4A6XA 4CWAA 4YGXB 3B3JA 5IRCD 4YRQA 1EHIA 3W5BA 1DFIA 2AW5A 2QYHA 1PIWA 3W6UA 2GH1A 3MJVA 2XKJE 1JT9A 1U3VA 3LPMA 1A9OA 4ISCA 3FNFA 5CT5A 1NOJA 4IHJF 4KP7A 4RANA 3DSRA 4GC9A 4FZVA 3W6PA 4P54A 2QRZA 3CLTC 2WJ6A 2VZLA 1QBGA 3MUNA 5TGZA 2G67A 3VKUA 5TDHA 1QF7A 3DKVA 3EWAA 4O59O 2NSHA 3SJBA 1LPBB 5BT8A 5J3JA 3LWNA 5HRUA 4E4YA 3IH5A 3V4PB 3IBTA 2BFBA 5FUVA 5HBRA 4W5JA 4ME6A 4FYMA 2W2VA 4RXUA 2B6HA 1Y4ZA 4K26A 4XQ0A 1Y9ZA 3LOUA 4Y3UA 3RIXA 2DLDA 3HY3A 3W04A 4AS3A 4EB3A 1TW2A 3HN6A 5I9TA 1NNSA 2C2GA 3CMCO 4G4IA 2IQ5A 3CW2A 2ACKA 1D2EA 2HO5A 4NMLA 1NJFA 4O4IA 2Q5IA 5G0SA 2IYRA 1HTWA 3O4JA 5U9CA 3WQHA 3EA4A 4XDZA 2QE7D 4LX0A 3K31A 2ECOA 4E1AA 1VFNA 3WL5A 5LZ4A 1ISSA 5ILOA 1ONSA 3PT5A 2ONYA 3S2EA 2FLVA 4RTMA 1PGPA 1OH6A 221PA 4OB7A 2UVDA 1A5BB 3D4PA 4TV9F 4FCCA 3IPRA 4NFHA 1HBJA 3O26A 4BKPA 3IDZA 1P5JA 4DIMA 4WJLA 1PNRA 1H4SA 1VIVA 4FKMA 5JCZA 4N65A 4H1VA 1V8ZA 4TKMA 3C6BA 4KE9A 3SIWA 4AWBA 2X8LA 2I66A 5BORA 4TZ6A 1A5ZA 1DO0A 2YCBA 4ZD6A 5C34B 3GCGA 5E9QA 3L92A 4AY3A 3L84A 1UM9A 2Q4OA 4PLTA 2B34A 3CWCA 3TE7A 3L1VA 1UBMS 1U2EA 1P0IA 4HDRB 4B6PA 4D46A 4CMEC 2GXQA 3JW8A 2GO7A 3EB9A 5JNLA 4KZKA 3BHNA 1OB2A 3I2YX 5CAEA 1PL8A 4B3XA 3GOQA 2NTJA 2JIQA 4LPSA 4UFOA 2C9CA 2BONA 5G0VA 3S1AA 4RCVA 5AM1A 3S2YA 2IHNA 1Q3KA 1AKUA 4M1YA 3WJ1A 5HXAA 4IZ6A 1VPLA 2BGUA 4CM4B 4J4BA 1RM0A 4G26A 2HWKA 4MUIA 3DUWA 4XIGS 2UZ0A 1NDQA 3K9HA 3QI2A 5ALZA 2Z9CA 1UBGA 1DDGA 2Z4TA 4OQYA 2YIDA 3NETA 2WJHA 4K2AA 1CUFA 4QLOA 4YP9A 3V1TC 2VSYA 5IHPA 2FEWB 3I3SR 4GF5A 4MUYA 4RF2A 4EQ6B 2PLAA 4PXAA 4MW4A 3D8RA 1P1FA 1V6SA 2I2BA 1GGMA 2PJDA 2R1UA 3I9KA 3MD0A 3QXXA 1N5RA 4LGYA 3DEIA 2FI1A 4U6QA 3LKBA 4C7JA 1ETUA 4MW1A 4NEGA 2XA9A 3CUEF 3ZUPA 3TQIA 1PUJA 4F3NA 2CJXA 4AD8A 1Z9BA 4GI3A 1TF2A 3RARA 2CSXA 1NPYA 1M2EA 1SIWA 1AGNA 1IWBB 3I28A 1EXMA 2DUWA 2QZZA 2VP4A 4Q9LA 5BN1A 1VRWA 2CZGA 4RD6A 3WJAA 1BKSB 3C85A 3IOCA 5FTJA 3CUYA 2WLTA 4FW8A 3U9LA 3TKAA 3GJXC 1JQLB 4XCXA 3GA0A 3ZQ4A 5CEJA 1OX6A 4LRXA 2ZGVA 1SRQA 1DWPA 1G3RA 2Z3ZA 3THWB 2IEAA 4EG6A 3QZUA 3DE0X 4RTOA 1MKYA 1Z47A 2IXFA 2X2PA 3BN3A 4YA6A 4Z4FA 3LSYA 3W5SA 2XHEA 1P1BA 2Y4NA 3MJHA 2GYWA 2G82A 5KVSA 3OOYA 3UCEA 3MS4A 1HYHA 5E4TA 1REQA 5A6VA 1M2VA 5D1HA 4H3VA 1NE7A 1RW4A 4UQOA 4UM7A 4CFZA 3E8XA 4M9RA 4KXXA 2QA5A 1SRRA 5JE8A 2ZYTX 3EGXB 3FR7A 2G63A 5FV7A 5H4HA 3PQFA 2G77B 3B51X 5HF5A 1GAEO 4G8BA 3PITA 3HABA 3QFCA 3R3XA 4JB0A 2EGHA 1DIHA 1NVKA 2X1VA 2Y92A 1P1JA 1Y3FE 1U3WA 4KQ1A 5ALYA 1QORA 4AJ4A 2PS1A 1VZ2A 1DPGA 1SWWA 1F9EA 1SUFA 2JH3A 4TV9B 1WXQA 2GJAA 4D79A 2FKNA 1FXUA 4DM4A 5KJ1A 1PVDA 5DGCA 3KETA 2X0NA 1ZCFA 4EYGA 1S4QA 4NPCA 4NSNA 2QLNA 4BZQA 3C3JA 3EAFA 3EXEA 3OU2A 5KINB 3HP7A 4MV5A 3ZGVA 1E8DA 5J5VA 4P4LA 2MR5A 3LS2A 1SVNA 3W5HA 4XVCA 1KJQA 1W5AA 3FSJX 2CXXA 1QG2A 3D7LA 3FCEA 4EJ2A 1NR7A 1WMSA 2YXNA 5HYVA 2J5XA 1LBQA 1ADCA 2PKXA 4QU8A 1PEYA 3PGXA 5HMLA 1H5NA 4U2EA 4BNDB 2UZ1B 1JSZA 1RAIA 2GBIA 5AVTA 1A1VA 1YUBA 2J9ZB 4H7PA 5TR9A 1RKXA 4NU6A 3QOFA 5I8ZA 3VPFA 3RIHA 1I32A 2G1JA 2OHXA 4M1ZA 4R68A 3U4GA 1P4RA 4FILA 4QO7A 4BVBA 1UXJA 1Z7EA 1SUIA 4GUDA 3DMNA 3OY2A 1X3SA 4C0WA 2BN4A 3OPYA 1D0SA 3P9XA 1XA3A 3BD8A 3T7AA 2WHEA 1L5YA 1C8BA 5ARDA 1IHXA 2FEMA 2JGIA 4ZVQA 3VXKA 4CL8A 4A36A 2IC5A 1LK0A 5I3ZA 3FTPA 3PIRA 5DXAA 3AI2A 5KNCA 1NJ2A 4A8PA 1RM4A 1TT7A 2K7ZA 4KLNA 3NYIA 2Q0SA 3CEHA 5JNRA 1ZIYA 4UUOA 3MGKA 3CEJA 3LQKA 3VHXA 3LXRA 2ADMA 5IC5A 3NYWA 1PZEA 1XRQA 3C1OA 1OIVA 3TZEA 4G3XA 4OBBA 1KOLA 1AKYA 2WZBA 4LIPD 3G17A 1QFYA 3AI1A 3KKQA 3AB3A 2JK1A 2ECKA 3M70A 3PHIA 4FFBB 1W6RA 4C2UA 1XLTA 1WM1A 4BHTA 2ZIXB 2R96A 3INTA 3NDJA 4IWYA 4PQEA 1LRJA 1VFPA 4N6NA 1K4YA 5HIMA 4TTVA 4ARAA 1UH5A 1CUHA 1QZ3A 1V3UA 3P94A 1J9ZA 3Q85A 4LCEA 5BVHA 4FFSA 3RBVA 4E2XA 3K70B 1QU2A 1G7CA 2XTAA 4TYWA 4G8DA 1JHQA 2ZT5A 5L3QB 3VR4D 2BI8A 4D0NA 1N2BA 3GEIA 5D5PA 3MMSA 4HPJB 1KMHA 2SKEA 2ZYUX 5DCYA 3UATA 1FTNA 4RVUA 4UVGA 1FTSA 4BCCA 3VR6A 1II0A 2OO3A 1IZZA 2XKBA 3F47A 4M60A 4E5DA 2YWXA 1CULC 2BHLA 1U7UA 3JX9A 3K0CA 5BVHB 3E5MA 5CFMA 3SYLA 3IKJA 3MGAA 1ZIXA 3CIOA 4UHBA 1HOTA 1ZMXA 1JIJA 1UJ6A 2ONKA 3EF3A 5KMGB 1APBA 1NF8A 4QUKA 3G7NA 3O3OB 3RPEA 3P9ZA 1KMHB 5B1YA 5CFPA 2C4UA 3KD3A 1TM5E 2WJAA 3PUYA 4HAIA 2FUG6 4JUBA 5IKMA 1HYQA 3H2YA 1WPQA 2OV2A 1DQPA 1HLGA 3ASYA 1LD3A 3K0AB 4Q00A 5E1DA 5E6UB 2BEWB 3V46A 3AYZB 3GFVA 2NO1A 5TXGA 3VOBA 2PZMA 2XAUA 3TRKA 4A0SA 5DLYA 1FXSA 4DIDA 1LBIA 5AW5A 2PKWA 1G6Q1 1R50A 3QK7A 2EQAA 3EVEA 1ULSA 4CQMD 4Y1GA 5BMOA 3FGPA 3ROKA 5I9NA 2G07A 1DQYA 3K9WA 2OHJA 5ALHA 2L19A 1U1GA 2PA0A 2VJNA 1NPTO 3HCBA 3OCZA 3N2KB 2YVUA 5LBUA 3GWZA 4HLDA 4O4JF 3HLTA 2V5UA 4TTIA 3TXAA 4GL2A 2Y66A 2PUAA 2OENG 2X9VA 2QD2A 1U0EA 4LDZA 3WGLA 4V1CB 1F20A 1NLMA 3O94A 1D6MA 2VJPA 4CODB 2B1IA 4EO4A 4QUJA 2JIRA 3WZLA 2MR6A 3TZHA 1H6DA 2HA3A 3LW8A 5EFOA 1TEXA 2GEDA 1KVTA 2YYSA 2DWOA 4IEIA 4MUFA 5E9WA 1E79A 3ZXXA 4FJ0A 3RSSA 3V1MA 1TEHA 2GD2A 3GJQA 4WADA 3CO5A 2RCNA 2ZBDA 3I2JA 5JAHA 1BE6A 1FUUA 2NP7A 2EEZA 1QK5A 1ZJ4A 5IT5A 1L7XA 2RG7A 3QHQA 1QUEA 3ZHOA 4E1VA 2H18A 3HVIA 1UK6A 4MV7A 1Z4MA 3SF8A 1P0QA 3VPSA 1G0OA 1WL8A 4M88A 3IHTA 1MO3A 1LFAA 4BVAA 4L5IA 4KO2S 5J59A 4C6RA 2I33A 4L0CA 2AR9A 1VLJA 1IQPA 1YDWA 3EEYA 4GOND 3BIWA 3HDGA 4RDHA 3QP9A 5AMXA 1ZHHA 4QDUA 1ZRNA 4WK0B 4N6OA 1Y34E 1QH0A 4OHUA 2G8NA 2OESA 3KJFA 1Q0HA 3KUCA 3FNEA 2V3VA 5HE9A 4A0QA 2REOA 4YRDA 1P72A 4P4TA 4V2UA 3MUEA 2DBQA 2VN8A 5FFMA 5K6RA 3BK1A 1E6EA 3LKZA 4DUZB 1FJXA 2BM0A 1ML3A 4LY3A 2XVXA 3PPXA 1M2JA 1PJBA 3CV3A 1FJ2A 1L4NA 3CNHA 3HWWA 4O0LA 5DHAA 2QTAA 4BNVA 1E2GA 4AN1A 2PRIA 3KZKA 1QRSA 3THSA 1P7CA 4LVOA 1FSGA 3BTSA 5HWSA 1RWXA 5T4HA 4BMSA 3QWIA 3ZCRA 2KMLA 4B83A 3QFFA 3ONEA 1T2AA 4HAVA 3DVQX 3N70A 4GMHA 3KYDA 3ZVNA 3ISTA 3U7HB 3B89A 5NLLA 3I3OA 3KJZA 3UMYA 5KQSA 3E0QA 5CIWA 1Z0IA 1PE0A 1DG3A 2VUTA 2VNAA 4JGBA 2JZOA 3L06A 2KPOA 3D8TA 4M1SA 4ZHQB 3SXJA 4IDFA 1XFDA 1NZJA 2WYHA 3DYVA 3HN2A 1RVDA 2X3YA 3TSZA 1TMOA 5CDSA 2RGGA 3Q6MA 3IIMA 4HPXB 2WSSA 3AYXB 4ENRA 5ISMA 1O97D 4PX5A 2NUTB 1YRQA 1T8WA 3EZ2A 4FP9A 4MA0A 5D7NA 3ZDZB 1I2AA 3CZQA 2ONJA 1Z07A 3MTIA 1JPNA 1E1RD 3DWGA 3HYRA 3QX7A 1ZHFA 2DFKB 4QXOA 5HP4A 1FUYB 3TG2A 2AXNA 3GMIA 3G0OA 4TM7A 3DLTA 4QX6A 4XSVA 3ELYA 2L69A 2QMYA 4OQDA 3VTZA 2AFHB 3GEMA 1P4JA 2I29A 4H08A 2QN9A 1E5TA 4I50F 4JYBA 4Y18A 4NYMR 4F72A 5BY2A 1ADBA 7YASA 2JVJA 4RHCA 4F1JA 4X62B 5EJMA 2BDTA 2J87A 2ZYIA 1M0EA 1J2YA 3K2QA 3LQYA 5C8DA 1A71A 2BELA 1WHTA 3H3FA 4UTVA 3PNMA 4KXYA 1P4AA 4JQCA 3FTDA 3LBNA 1DE0A 1IHOA 3N2NA 2CFTA 3DMTC 4HGPA 3EFHA 3TMKA 1PR9A 2R68A 3DCNA 3NRBA 5DI3B 4JSYA 5IARA 3NV9A 3FBGA 4IIDA 3SXUB 3WYAA 2YR0A 4CPDA 4YV1A 3TG8A 1VE5A 1Y80A 2I71A 4ND5A 5AKXA 2BDUA 2FZGA 1JALA 2CXUA 1Z37A 5AOVA 5K3BA 3PG5A 3GRKA 3O7WA 3QF7A 3SSAA 1LZKA 3G1UA 5IJ0A 3ADCA 3EZFA 1NFQA 5K3FA 1ORVA 5BW6B 2HDNB 2RMKA 3REQB 4G0QA 2W6ZA 5C5DA 2EP8A 3T1VA 2ZM5A 4OH7A 4PZZA 1FDWA 1NXTA 3B20A 2XT6A 4ZVNA 3RSCA 8MHTA 1J21A 3BJRA 3PXUA 3ZV4A 2XUIA 5HA5A 5D3QA 3KR2A 5BQFA 3IV9A 4FZRA 1V4VA 3N53A 2OO5C 2CNDA 3AEXA 1T4DA 4RK4A 1Z22A 1CR6A 3GLTA 4WOPA 3PQEA 2O8BA 1FQKA 3N5CA 2OO5A 3H75A 4EKYA 2H5IA 1RI4A 3EZLA 4TXNA 4B82A 2ZT7A 4GZ6A 1BTOA 1U8TA 2IL1A 4QATA 2BZSA 1CLEA 3WZMA 2W2MA 1V5EA 5CX1A 4CLHA 3L8FA 1I3LA 2WV9A 3EVGA 3IDOA 4TUYB 3K8YA 1JDZA 3DEAA 3SSMA 4HNRA 4P82A 2YWRA 5T57A 3WHLA 1DKLA 2AXQA 2EERA 2HSGA 1ZPDA 3K30A 4W1QA 1MEJA 4RY0A 4CV1A 2X41A 3X1ZA 2FP4B 3O9VA 3ETGA 1LWNA 2V9PA 3S2IA 1C9NA 5LQJA 3P0EA 4EUEA 4L08A 1FP1D 3UICA 3JSAA 5JYCA 4JI8B 2V7TA 5MFZA 4PHCA 4E14A 5JW6A 2I4MA 3U3MA 3D8UA 2WFMA 4TTRA 3JD4A 1C4OA 1TQ2A 3QI7A 1SBZA 3GT4A 5FBRB 1BXRA 4M0CA 1FDRA 1QYDA 4BO3A 3SQXA 2E6KA 4N5LA 1XQVA 3AHHA 4KW7A 4L7QA 5C3UA 1EMDA 2BHRA 3EXFB 2YHIA 5BUCA 4K03A 4S35A 4YT4A 4HXFB 3H1TA 4YJ2F 4CU2A 5TRTA 2ZYVX 3R0XA 3DMDA 4TLLB 5HKLA 1VLZA 2QL6A 3FW1A 3PL1A 4YQFA 1V7QA 6ADHA 5AQ1A 3AY6A 2IYSA 1K6IA 1V8DA 1VYTA 5JAMA 3KL4A 4AMYA 2GEBA 4FYYA 4QHYA 2VHQA 5THQA 3EVNA 4FFDA 1P3DA 4OQQA 4ARIA 2IYNA 2ID9A 4XIIA 3PNPA 2QZSA 4FYIA 5LB2A 2FRVA 4ENPA 2NYVA 4CDNA 2BF4A 1USIA 1E66A 2O50A 1ZESA 4S0XA 1YBHA 1GUBA 2HQBA 3GLHA 2IY8A 3HSKA 3NBUA 4Z54A 1H66A 3QXSA 4LI0A 1WA5A 4DLVA 3HKCA 4OSOA 5LQSA 2XXBA 1H1DA 1U0SY 1URPA 3T6KA 3TYXA 3O84A 5EIBC 3W5UA 4JIGA 1DEXA 3RU7A 3NVAA 5KTSA 3WGKA 5GTDA 5AUNB 1N3BA 3G5AA 1TVKB 3UH1A 4NENA 2P35A 2ZBFA 4WCFB 1JAYA 1CZNA 3DBLA 1SQFA 4L57A 2YVKA 4UJ5A 1TO2E 2DYKA 2AG0A 1T3GA 1GG5A 1T2DA 3EC1A 2YWCA 1K7YA 3LWDA 3MJCA 4KZPA 3K1YA 1V3QE 1V8OA 2V96A 4JOCA 4HNSA 2OHGA 4EFNA 1U8ZA 3G2LA 1YKFA 4CR6A 4MWEA 1G5RA 4KE8A 3KUUA 4WKNA 1U02A 1N34B 2GPNA 3HJTA 1CXZA 3DBLB 4CG0A 2D2VA 2VF4X 4B3TB 1QKJA 4A0HA 2HCJB 5AI8A 1YZ3A 1MA3A 3WHKA 4IGIA 3LMKA 2P75A 2JIDA 3PS9A 1HMPA 2ODWA 1M3SA 4D3YA 2Q2OA 1X1EA 5CLJA 3MWFA 3RJMA 3G9QA 1GTG1 2QLFA 5BT9A 3F67A 1YFLA 1PZHA 1EE1A 3OHSX 1E0JA 3BE5A 1P74A 2VRNA 1P2SA 4BFLA 1AG9A 3IBFA 5C18A 4ZYWA 4N6GA 4AKSA 4NBNA 3A1TA 1JYEA 2EBWA 3IAFA 3F73A 4NCHA 2ZCJA 2JD1A 4UDXX 5KC8A 3GU3A 3T7EA 6NULA 4LTNA 3ZGNA 3E3NA 4E4TA 7GPBA 2H4FA 1XOIA 1JJIA 4K9DA 1ABEA 1ICIA 3OPMA 8OHMA 3AOEC 5J23A 4HUQA 1GPYA 2ZJFA 2PVPA 2VHWA 2GNOA 4TL7A 2YXDA 4Z99A 2F2TA 1YCGA 1YL6A 1YUNA 3WWYA 3ZQJA 3FD8A 4Y6QA 4EYSA 2YIMA 1IZ8A 1YJ5A 2H5EA 2UYQA 4JNKA 5TGDA 4D8VA 1VGQA 2QU8A 4O2BF 4I3GA 1EFVA 1Z83A 3RFCA 3WSTA 1LLFA 4Y7CA 2JIOA 3GIWA 3QEJA 1W85A 2QN3A 3HPRA 2CMGA 2X76A 5ANRB 3NHRA 3O95A 4LEIA 1HGXA 5EVCA 1OT3A 3FMGA 2HFJA 1ZD1A 3AJ9A 4D5EA 2FZCA 2BRUC 5L7WA 1NQOA 4XM0A 2JI6A 3OQHA 3ZWAA 1BAPA 1C3VA 2A30A 1MIOB 1OXXK 1YBMA 2ANBA 1U2RA 1W85B 4MX8A 1UIRA 4Y9DA 3TR6A 5COBA 4QODA 3SC3A 5I7EA 4C78A 4O0MA 1V7PC 1PRYA 3NIWA 4BB6A 1T5BA 2I5PO 3VVMA 2QDKA 5F98A 2OBYA 1UZLA 4XM1A 2NSYA 4DNOA 2WT4A 3C5EA 3JXEA 4ROSA 4TSKA 4YEDA 1KP3A 1WXGA 3JYHA 1J1ZA 2B8WA 3VAAA 1JJAA 1WCIA 1ZLYA 4I99A 2NSLA 2VHVA 4O2AA 4DTCA 4WA8A 2WJYA 3I0MA 4HAUA 1GWNA 1DINA 1W25A 2DH5A 2DHRA 2V7UA 2GOYA 4CM4A 3S99A 3UGTA 4F4JA 5ITZB 1NOKA 4JVMA 4ND7A 2G7MC 2OBMA 3PXDA 2YH2A 1FZQA 3P8ZA 5I7OA 5KWIA 4AJ9A 4NZ9A 4JN6B 3NHUA 1FOEB 3JASB 5K0EA 3GLHE 5AXDA 3VU9B 1H8EA 3PFNA 1XL1A 4JMLA 3CRMA 1HNXB 5T4FA 5TQ2B 4AF6A 4YV7A 4NDAA 3AL2A 1N4AA 4AIIA 5EHNA 4QUHA 5AI0A 1KEEB 4YCSA 1MJ5A 1P2VA 1Z0DA 5C7YA 1IOVA 1FPMA 3WLSA 4KYVA 2Z58A 1U0LA 3ZY6A 1AUPA 2G8LA 4V0QA 4I9HA 4O4IF 2W48A 3GARA 2Y1OA 1OI4A 4XYLA 1ZHOA 3E0XA 1YB5A 3R09A 1FVOA 4LYAA 3WQQA 5JQWA 1E2KA 4GX0A 3JVVA 1UK9A 3E2PA 4KLCA 1TCUA 1Z4OA 4OIFA 1JTVA 5IJWA 1RRGA 3AETB 1KH2A 1TPYA 3OTGA 4FYVA 4KOEC 1Q74A 5CPFA 1EUQA 2J9FA 3AZOA 3NOVA 2BD0A 3PGLA 4Q7MB 1X19A 3AFMA 3CX7A 4AP5A 1BJTA 4KVAA 3HZHA 3QYPA 5KNDA 1IN7A 2AA3A 3ZDBA 5T7BA 3EMKA 2WJVA 1BCSA 2O8NA 1CR2A 1DEAA 3AWIA 1XWIA 3F5SA 1ZZEA 4V2IA 3CKYA 4QU9A 4CHGA 3ZV3A 4WTOA 1RPTA 4QE3A 4F1WA 4IDAA 1JMKC 2HLNA 4NZOA 3QH4A 4MW2A 4QTTB 1U7HA 2OHHA 3C15C 4PTLA 4N3BA 3BL6A 2X2FA 3LPAA 3O2JA 4F2DA 1DG1G 1X7XB 1J0CA 1FSFA 1Z88A 2PLFA 2MCFA 4PINA 3ZTTA 3PD7A 2X86A 4R71A 2LUOA 1P29A 3GD5A 1IHDA 3M1IA 3D3WB 4KWTA 3U3KA 2EL9A 2XOKD 1PR5A 4LGCA 1ESMA 4DUYB 2EP7A 1T6YA 4OQ4A 2AZTA 1TMKA 1A88A 1TQ8A 5BXYA 4D56A 1BRMA 4DCOA 2ADOA 2O05A 5F4ZA 3MB8A 4ZAGA 4B3SB 3EXG2 5IX8A 2PD6A 3O8QA 2O2HA 4OHRA 1YF3A 1TMGE 3COYA 4IXMA 1EGVB 2BGIA 3OLZA 1A8SA 2OZLA 2Q4BA 3D6NB 1Y7IA 3L0ZA 2YJ6A 2JARA 2Y1DA 3NS7A 1K88A 1WSDA 2DCUA 3AUJB 4P31A 5EPOA 3H4MA 4BMPB 3SX2A 5CFRA 2J5KA 5CB4F 3BILA 1GZHB 3QOYA 1L4KA 4K40A 5A3QA 1M1YE 1R6AA 1MABA 3OZEA 3U39A 3C4QA 4KHPB 3RYHB 3U37A 5FBWB 5CG2A 1WZEA 1YSCA 2CLMB 4CVNA 3SNHA 2ET6A 2PUTA 4KRFA 3VDRA 3DDSA 3GUHA 3LBYA 2E2WA 2FRXA 4JLDA 2RDMA 4C14A 1I0ZA 4G0MA 4XEHA 2AEJA 3BC1A 4OPMA 5FP0A 3MWEB 1AK1A 3CPJB 3FNQA 2UYCA 4OTZA 2PNFA 2HT1A 2XR1A 3FSGD 3PNYA 1S2GA 1XRLA 2IUFA 2WU1A 3BDIA 3C4JA 4PGHA 3HZZA 4P7FA 3L7AA 4C08A 3BGVA 1UFVA 1BDBA 1WKBA 3ANTA 3KEOA 4OGWA 4QAJA 5B3AA 2W00A 4DLYA 2CLLB 2RGYA 3MTBA 5LKAA 1UKBA 1U65A 2QJRA 2VYND 3FGOA 4KX3A 1NLYA 4PICA 2AKEA 2I91A 5HDQA 4C21A 1ZL0A 1SY7A 3AW8A 1UBSB 4QDKA 4FDMA 4LYJA 4TYNA 1A0OA 3BF7A 1LF5A 4ITUA 5TF4A 3P32A 1A9YA 1V48A 1JIKA 2NV0A 3RVSA 1KF0A 1ZXLA 3OI7A 3HEAA 5TC4A 1N5MA 2ZPAA 4ZGWA 2JCBA 2XGMA 3AKYA 3I04A 4HDAA 5JAIA 1RPJA 3H9JA 2Q3EA 3FUWA 5HKKD 3VSEA 4JU8A 4MV8A 1BROA 2PWZA 3OESA 1L5WA 2BPOA 3JALA 5SZJA 5B1HA 5E2IA 1RLTA 2R6JA 3ZCSA 1KERA 1PFVA 2Q28A 4G1FA 2PJZA 1Y7LA 4PLVA 4CMKA 2CD9A 5BV1A 1C50A 3QX8A 3PFWO 3PK0A 2I6QA 4PVDA 4DQUA 5ALIA 4CKZA 5AHWA 3RC9A 1NNUA 3SKYA 4HWGA 1PS0A 4CTOA 3KKOA 1MQ8B 2WHXA 1I6LA 3I6IA 1O1YA 1W0CA 2ZBUA 1A69A 1C7JA 1FB5A 1GG2A 2FCAA 4CKEA 1P0MA 3I1JA 4HYQA 5JS7A 1SVKA 2R11A 1LLQA 3E03A 3SBDA 5DM1A 4YJ3B 2HDOA 3RO7A 1RBZA 4KCGA 1QPBA 3EY4A 1IVYA 2HWYA 3HU1A 3JAKB 1AQ6A 1PDOA 1WTAA 4S1NA 1X92A 2H0AA 3G5LA 3IO5A 3OQ1A 4IHQA 7ABPA 3WXBA 3EZYA 4G0OA 2CXNA 4PN3A 2PGJA 1DOAA 1QUFA 3WNZA 3BKXA 3EGVA 4MIYA 4D5GA 1FU4A 2NT4A 2PX5A 4IF6A 1Q92A 2O1EA 4BPBA 1BJKA 2ORVA 2ROQA 2XE8A 1DRKA 5DTEA 2ZR0A 2WM2A 3CRQA 1ZOLA 3N2KA 3IFSA 3PNBA 4OMFG 4QEZA 2XGOA 4BQSA 3ZJ4A 1U9IC 2V54A 4I2VA 4AF8A 2RH4A 2DZDA 4DZZA 1ZOIA 1NP6A 3UAZA 2E5LB 1W7AA 1U2PA 1PTKA 1SC4A 4MYUA 4F92B 1UWKA 1LC3A 2YVQA 4BBZA 5A9RA 1ZITA 1E1NA 4FK8A 4RIIA 3ZJYA 2HW8A 4F3YA 4GQBA 1VHDA 2WG0A 5T8KA 3HA7A 2GXSA 3SIPA 3DPIA 3QPAA 2X7HA 2WWYA 1N4DA 2GD6A 1BGVA 2R60A 3AUTA 1X7WB 2BL4A 4KMSA 3ZH9B 4B3DA 2Y1KA 1I1NA 4EO9A 2EG9A 3E22B 3GH3A 1NQTA 2IH4A 1YDHA 2X0JA 4UD2A 3T95A 3A4LA 1QYXA 2AVDA 2QY9A 4LQDA 3SF8B 3K9FC 4YDSA 2OFXA 1M6VA 2QLMA 4R5HA 1QLWA 3I5YA 1PT8A 3C3EA 3LPDA 4MRSA 2Q5HA 1IULA 1W1WA 4HR7A 4TZTA 1Y4UA 2PBFA 3E22A 1E2MA 1LLDA 1LXCA 3TKYA 3ZHZA 3DHYA 3LP5A 3WFZA 5JY6A 1E61A 2W6QA 5CXXA 1IQ0A 1U9IA 2VCHA 4R2MA 9ABPA 1ONOA 1G8SA 2FSPA 1B0AA 2YZMA 3WYDA 2WWGA 1QH9A 1TJ3A 2DT8A 3HJNA 1HWYA 1Q1BA 5I9MA 5B7QA 2NU7B 3FGZA 2JIZA 1IPHA 3A1NA 2H1FA 3SOZA 4BJ3A 2KI5A 3EZ7A 1KOFA 4W7HA 4HB0A 4PSCA 2WTNA 5EMKA 3RW9A 4AZ0A 3C8UA 5HR5A 3UWMA 1BD4A 3I45A 3THXA 2NPOA 2PWPA 4HD8A 2XSZA 2OG1A 3KJEA 4NJOA 2X4IA 5AHKA 4UTNA 2AUMA 2MYUA 4LHVA 1QKKA 1WZ2A 4LJ7A 4LV8B 5FO1A 5FTKA 1P7YA 4AZ0B 5FWXB 2PXXA 3IEPA 3LC2O 1M6WA 4UNPA 1DKPA 2IRWA 1X77A 2W6JD 3GJZA 3P27A 4N5HX 2PCLA 1JKJA 2P4HX 1YK1A 3KV1A 3HKBB 1QNFA 3GEPA 2DF8A 1PD1A 3T41A 1JFRA 4D42A 5H0IA 3W2HA 3PDJA 4JXJA 1C0EA 2APJA 1N78A 1K5HA 2HY7A 3EQ2A 2IH2A 5DYWA 2HEIA 2C42A 5M7EA 1TX4B 3R3HA 4B34A 2ZIWB 1N2CE 4G24A 1F6DA 1NUQA 4RV4A 3RHTA 4GZ5A 3QHAA 4YMTA 4OB6A 4XGQA 4G0VA 4NEQA 2Q5CA 3VMFA 4R2HA 1LTKA 4ZRMA 3C3BA 1QGYA 3ZNOA 3L7OA 3AJ8A 3R44A 5KYNA 4FWBA 1MU0A 1YQWA 2G7ZA 3DJYA 3IUNA 1ZVJA 4XYMA 2D0DA 2AFHA 2IEBA 2QRPA 1TOAA 3MINB 5FV4A 4XQ9A 3CZMA 4UM8B 1RRMA 3PJDA 1KBZA 3UWSA 2OMEA 1QWSA 3LUPA 3M83A 3VPHA 4B8WA 2R8OA 4UE6A 3UMMA 2B9EA 5D84A 4DJDC 4I5GA 4IHKA 4L5AA 4OAPA 4ZO8A 3O1HB 3WTCA 4DBZA 1UJNA 2B25A 2HN9A 2JJMA 4GI5A 3ZE8A 2HSZA 4K9KA 3G6WA 1AUXA 1KA9H 4WGFA 4CF4A 4QTYA 2OYRA 5TIIA 1DBIA 3ZHUA 1AUVA 1J8VA 4MWZA 1PQPA 2AC7A 3HXPA 4HLCA 2Q41A 1QSGA 3DUFA 4HN2A 2J3IA 4DR7B 2O3SA 4YV2A 3KT6A 3NH6A 4NU0A 3ZX4A 4EY6A 5IKPA 1WU7A 5DGXA 1TZBA 1B41A 5EQJB 4UPEA 1K63A 2ACWA 3GG2A 1HLDA 4JR2A 4R1TA 5CMLA 1J7KA 2FWJA 2YV2A 2PTGA 1VG1A 3G5TA 3QWBA 5EFZA 3EGIA 5HRAA 1JAXA 3LQ1A 3E4CA 3WYGA 1OKKA 3TCKA 2GN8A 3LV8A 3KQQA 1DRUA 1GSOA 2C82A 1WX1A 1P8AA 2I76A 2JGFA 3CLHA 1WP9A 3NFYA 2IOQA 1CTQA 3PFFA 4JODA 5GJVC 5H16A 3ZWCA 4BVGA 4YUWA 2K87A 4PHFA 3SZ3A 1M73E 1SVSA 1XZGA 3PUHA 4G84A 4F84A 3RU2A 4EKEA 4E21A 2GYUA 4QG7A 1WW2A 4ZJZA 1EX6A 2VWHA 2YNMC 3NJRA 5AKKA 3NWEA 5EKSA 3GLUA 1KMCA 1SIUA 3OZVA 5FEMA 1GRRA 4XAQA 1CZOA 1US8B 2B5OA 2QS9A 4S1WA 5CDFE 2IE0A 5B30A 2MOKA 3CA8A 2P0YA 4PC3A 5CVUA 3HM2A 1R8YA 1A76A 4R5MA 3PX7A 1HDRA 4TKVA 2ZE5A 2YZNA 4FPXA 2VF7A 4Q3KA 1WDMA 3NYRA 1ESNA 3UB3A 4JY7A 3KXPA 5IF9A 2PFGA 3WAGA 3S40A 3AEYA 1K4KA 1J23A 1DIRA 5EE3A 5AHRA 1EFLA 2ZDGA 4BNJA 3TOZA 1LTHR 1L5KA 5HF6A 3QNUA 4OHMA 1AB6A 4WK2B 5A62A 4B35A 1L5HA 2FKAA 2A9OA 4LSGA 1QR2A 1SBTA 2O7NA 3JYLA 4JC8A 2XV1A 4NEHB 4PG6A 4NPAA 4EUKA 4L5CA 4B47A 5JXJA 3KYJB 5KTTA 3GK3A 4QJBA 4XJXA 3EIQA 1B42A 4BO7A 5LQUA 3WB1A 3EDQA 1YS4A 2VTBA 4XLZA 1U2GA 2C77A 4RZHA 3F7NA 1TA4A 4KITB 4HKTA 5ER6A 4YUVA 2X1HA 3CH5A 2CNWA 4WWHA 3CCFA 3FOAA 3LL7A 3OFSA 1VYUA 3SDBA 2WR8A 4KRXA 4RIGA 5BN4A 4PWZA 5A1JA 4JI6B 3HXOA 3I32A 5BQ3A 2OLJA 3R3SA 1DJLA 3DYIA 4R8KA 3FMFA 1PR2A 2JJ1D 4F46A 3BMOA 3O3MB 4UVDA 3QYAA 1KQFA 1QOZA 1R37A 3T5AA 1A82A 4NHEA 4LXUA 2ENWA 1YQ9A 2OWEA 3FFBA 1PT5A 2G83A 1LV8A 2QTGA 2WWHA 3K6KA 4G5SA 2E18A 4WASA 4YRFA 4ZAFA 4YAOA 4UVIA 2BSQA 2XUQA 3TPCA 1UBKS 1Y1QA 2JGLA 4HXGA 3GZNA 3QU2A 4HDOB 4KXLA 3BTUA 4A10A 2D8AA 3Q98A 5AOCA 3RS8A 3X1DA 1HSZA 1SCKA 5I47A 1EFDN 2H2GA 2GB4A 3A10A 4JLMA 2IBMA 4BUJA 4C1BA 3DL4A 4EW6A 5LP6B 1ZZGA 2JF0A 3F3SA 3G6KA 5EI5A 3V1LA 5JU6A 2NPFA 1VKZA 2GDZA 1DELA 4G5HA 1FFEA 3A14A 4QUEA 2CHQA 4G67A 2SNIE 1IRIA 2GARA 2WUEA 3NCHA 3R7DA 2JH8A 3OTHA 4JL6A 3DO6A 5EL0A 5JJKA 2ZATA 1SMKA 1ND6A 2WQZA 4JLSA 4Q1FA 2QRMA 2NZYA 5LQKA 2O2YA 4IZOA 5CVTA 2P2NA 3M3PA 3TB4A 1JH9A 2BGJA 4U5QA 5K8IA 1Z3IX 4EA9A 4QREA 1PWEA 4EKDA 3RK1A 1W75A 3VO1A 3KPWA 3LCRA 4L8YA 2V6FA 4QULA 5ALEA 3VR0A 3W4IA 5LJLA 1H6BA 1ZN8A 3AR3A 1ZM4A 2HMWA 1IJBA 3TFQA 1QBKC 4FE7A 4JUCA 4UZFA 4HFMA 2JFZA 1MB0A 3CUKA 1XO1A 1KDZA 3IJEB 3LA6A 3OOWA 1N1GA 1DLJA 2BHSA 4G9GA 4NBSA 1NU8A 3D54D 5CYGA 4RPJA 1RLOA 5IM4A 4B8YA 3VC1A 3LUGA 4DTIA 1TDJA 4YLEA 2O3RA 2G0NA 3BL5A 3URKA 2PUWA 1DTWA 1MV8A 3ACBA 4X60A 1ZJ6A 4YAEA 3S27A 1BEZA 3IQEA 3FBTA 2H4XA 2GBGA 4K86A 1H4VB 1ZMOA 2C61A 4B45A 4YJ2A 1XPUA 1J0XO 2ZREA 3LUFA 1YDFA 2H48A 4JZKA 1J8FA 2QTFA 5DLEA 3VU0A 2VP2A 1GTZA 4NKRA 1M8KA 4AJKA 4M1KA 3RJZA 1ZG3A 2BI7A 3F71A 4NOJA 3DXZA 4KVZA 4TMKA 4ALLA 4F3TA 1W48A 1Y1RA 5HTOA 2CE2X 3SP1A 1E3LA 3F6RA 2WAMA 2BFFB 3IKVA 2PX6A 4JWKA 4XGIA 4UHEA 1Z7WA 3H9UA 4N40A 4Y1RA 5H82A 4MQFB 4C6TB 4DDKA 1I94B 2EJTA 3NTRA 2E4WA 1AV7A 4DC1A 2GEJA 2XW6A 5KQLA 2J0QA 1LS1A 2JCYA 2SECE 4JBIA 1DZIA 1L5ZA 2RIPA 4IDQA 2Z2KA 4Y0NA 4RPCA 2BFCA 2ST1A 4Z9XA 4YRKA 3FPGA 1BDHA 4EYQA 1QRUA 1T2CA 1VLMA 4D9CA 2VDUE 4E6EA 1UEIA 1AN0A 3HHEA 3RH0A 3U9TA 4MQFA 4C6TA 1JDJA 3BAFA 1SU6A 4R0NA 4XD2A 4MVJA 5DX8A 5IPFA 2H1OA 5J1SB 1V4BA 3DOEA 3UYLA 2H4YA 4EIWA 4J0JA 5IH3A 3O73A 1GQYA 5CBKA 1GZSA 4N7JA 4DT1A 3COZA 3CG4A 2DPLA 3DVAA 1GPLA 4UBMA 2ENUA 4P5EA 4QL3A 3TXXA 2Q27A 3NBYC 3MT7A 1DIAA 2XT9A 3DL7A 3HYSA 3CRNA 2Q0XA 2LXNA 1Y9AA 2X7XA 3ZWVA 1K0UA 3GP5A 1EXDA 3RC7A 3VRHA 4F4UA 2FRDC 2PKCA 4XCQA 5CGZA 1JFVA 4HGNA 5CJ2A 3FSEA 1KKLA 5I9IA 1NR5A 1CB0A 1R18A 3JARA 1XMJA 2REQB 4K6GA 1JWLA 3ICQB 5HIAA 4ND6A 3F6BX 1K6MA 4CNBA 2EC5A 1ZN9A 1Z06A 3O8NA 1QANA 4I46A 1U0FA 3LPLA 3JSXA 2BBOA 2OP0A 3VKGA 1DCKA 5BYBA 4EJSC 3LF2A 4XGNA 3JASA 1Y4AE 2NGRA 1EFRD 3GB9A 3WLMA 3AUSA 3KJHA 3A31A 3OFND 4HQLA 1J0BA 5JNWA 1TO6A 1U5BA 4H7DA 1DQSA 1ODFA 1PJ8A 3CE9A 4HEQA 5A4KA 2L2QA 4DUGA 2GO1A 3B2EA 3INRA 1O58A 4P2BA 1IN5A 4LSWA 4QQRA 2XDQA 4QAQA 2ODBA 3S68A 4OGGA 3BREA 3CG0A 3U1VA 1RQ7A 1UK8A 4ZQEA 5DN6D 3EYWA 4AJNA 3CPHA 1M1NB 4Q4HB 2P6MA 3VR5A 1IG0A 3DE6X 3UTDA 2XIQA 4Q9IA 3ZBTA 3SVLA 2C2YA 2WYUA 3RROA 1IHYA 2O2CA 3SF0A 2NTYC 1F06A 1RP7A 4IDOA 3T9EA 2WFZA 3N7UA 1DKOA 4PAMA 2F9FA 1T8PA 4C3ZA 3DD1A 4TLEA 5DN9A 1O7JA 2ATEA 2XCQA 3H18A 1JR6A 1WABA 3H65A 4WRRA 2G1AA 1UK7A 2HA2A 3GFQA 3C16C 3CUUA 4F5WA 2H1HA 2LD4A 1GRCA 5KKCA 2WABA 4QM7A 3DR3A 1FFXB 3V2GA 1ODJA 2D7CA 4MVCA 4OP2A 3KPYA 2EVWX 3DTTA 2FG6C 5CUQA 4X8HA 4LHXA 4BCDA 4BXOB 4HNVA 2W5UA 3PC2A 1Y4SA 3OECA 3KP1A 3BB1A 3K0HA 1D0VA 1CY2A 3S7TA 1OSNA 3BXHA 1NWHA 3CBQA 3K8QA 5LMNB 1EUYA 1ZI8A 2VO1A 5JI2E 4DC0A 2CXSA 3HXKA 3K0CC 3B36A 4FGWA 2DFDA 4UW9A 3WA7A 1MHPA 3F90A 4J2HA 4ML3A 2DB3A 1NXXA 2E4XA 2A9JA 4IJMA 1FP4B 2ZRNA 3P0RA 1EDEA 5BSGA 3TK1A 2P77A 3D3WA 4URHA 3H84A 1KZ6A 3NRCA 2BP7B 5EWLB 5ALPA 2RHDA 4ND3A 1ZI9A 2EU8A 1W4LA 1YT5A 2H29A 3O8LA 4M9XA 3FVVA 1KJWA 2CVFA 2A86A 4UTZA 4BGVA 1MJHA 3L5OA 3KAQA 2J5RA 5CNIA 3INYA 4XR4A 1EVIA 1L7BA 3DLCA 3IALA 4HK4A 4LYYA 1JP7A 2ZBPA 3TD6A 3A05A 1MO4A 2CKDA 5LM3A 1NYRA 1VLLA 2BKEA 2QJOA 4ND8B 1BSVA 3GJ0A 1H69A 4EY4A 3LC7O 4FFMA 2RHGB 1X1BA 5A7FA 2V7XA 4HSGA 2AFVA 4ZQGA 1J90A 1NRWA 3EVDA 2F48A 3PF8A 5ARBA 3HU3A 5JWRA 5EYPB 1P1RA 3ICEA 1YBAA 5JECA 3MOGA 1OPRA 2SHKA 3VH4A 3W6OA 2GYVA 1PFQA 3I53A 5C4IA 3DJFA 3Q15C 4KPGA 4INOA 2IYTA 2KWIA 2XMDA 4IVRA 4TT3A 2KLHA 1BC5A 1WSAA 4B09A 1WSBA 3LWZA 1EGAA 1T5IA 3HVHA 4GD3Q 3CFYA 1FF9A 2GK4A 5DDIP 3TLGA 4GH5A 4J94A 4KRYA 4B1FA 1E1DA 2MWMA 3HO8A 1GIAA 4H6PA 4JB3A 5AK0A 1GPAA 2Z95A 4KIUA 3D7RA 4YYEA 5J2TB 4J03A 3SM3A 4G0XA 2MSWA 2P7IA 3U7QB 4CQMB 3KOOA 3HL4A 3L1IA 3DEYX 3HEBA 3C6YA 4EKGA 5C8YB 1ZD5A 5CITA 3HUUA 4WK4B 3FFAA 1YU6A 1GKLA 2H57A 2HQRA 5J2TA 1R2QA 4BC0A 3VX4A 1EX9A 4J0KA 5FPTA 2ZRHA 4JELA 4U5XA 1K27A 1UPBA 2CFSA 3N28A 4OUDB 1U4SA 3FA2A 5DO9A 4D9KA 4EF5A 1I7DA 1NURA 4EFMA 2WKRA 2O8CB 4RF3A 2AT1A 1HC7A 1CQWA 1FYDA 1XTBA 1YR7A 2V7WA 2WHRA 4QEKA 2UU9B 4LJKA 2CJWA 3BA1A 3B6JA 4OUKX 2ZCUA 3ZLJA 4EJFA 1IBSA 1GU7A 3HKDA 1P2UA 3W4JA 3DD5A 1OFVA 3RUHA 1GKKA 4ZTUB 5EWMA 2UXBB 2WPDA 5AKHA 4UEWA 1VJRA 1JLKA 3A6LA 3AEKB 4B2PA 3ESRA 4O2RA 2YZKA 5BSMA 1BCRB 2CLFB 4FSDA 3E9YA 3QLUC 4I4TB 1J8YF 5ALSA 3NVMB 3WDLA 5CIQA 3U7GA 4MVJM 2Q21A 3GNQA 5I8WA 4FGJA 4AK9A 1KRWA 3CW9A 4ZI5A 2D7DA 3BZBA 2HHHB 3DAPA 3MVEA 3PHHA 5LBIA 1QAMA 3D5QA 3OFNA 1TTPB 5E4FA 3ZV6A 1Y1SA 1JIXA 3BK7A 4BFYA 1EX1A 3DULA 2QUBA 2REXB 1SD1A 2DKOA 4L9AA 3MTJA 3ZKAA 2FX3A 1C9DB 1U0OC 3I2IA 2FF5A 4KMMA 3WK5A 1YIAA 1KY2A 2FMHA 5L40A 4BKQA 1KJNA 3WK4A 1T24A 4NWIA 5LSAA 4YBZA 5HK8A 4ZZ3A 4FZ5A 3AC0A 4HVTA 4A6PA 1GJRA 1MVNA 2JFWA 1TQHA 3D4IA 3ZU5A 1LDNA 2Z2IA 3NOOA 3IEVA 1QTQA 3IQZA 5BSTA 5A3VA 2J07A 3B70A 4BLSA 3PEEA 4DCSA 4B6OA 1N32B 3LXXA 4RVOA 3ZNNA 4C22A 2B92A 1PBTA 3H0KA 2PFSA 5HCUA 3VZQA 1TCAA 1K3FA 3A9SA 1J7JA 1RJDA 4U3JB 1MB3A 2J0EA 3L7CA 4FHCA 3U5TA 3PWSA 3QVTA 2BSXA 3LVRE 4IFIA 4RL6A 2X5XA 3C5CA 1YS9A 3DNFA 4JUDX 4PC6A 4Q1CA 4Q4LA 2K7FA 5BN3A 1IY1A 2WU4A 3WNVA 4JT9A 5EOVA 1RFGE 4P3PA 3X1JA 5JS2A 5JD5A 1CQZA 1R0KA 1CE8A 1WXFA 4PIVA 3ULKA 2F8SA 1CS4C 3TGPA 3MGGA 2BTQB 2LRHA 3LIIA 1S8OA 2BC9A 4I81A 2V97A 1S2OA 5AIAA 1F8UA 4YRSA 3PC7A 1DAPA 5FF9A 1CFJA 1HV8A 1LX6A 4NR0A 4NBKA 4OP1A 4RORA 3ZDAA 4UVEA 1II8A 3H4IA 3AIIA 5B3JA 4G4GA 4A0FA 1E3QA 4CKYA 4XVUA 2Z08A 1IUPA 2ALJA 3MD9A 1XR3A 1H5UA 1KZ1A 1LDGA 2CDAA 4GPBA 4MW5A 4E5KA 3CEAA 3CZ5A 5JHGB 1G8YA 5ICSA 2IOYA 5AKGA 5IVPA 5KPDA 4EATA 4W5QA 3PJFA 1FSPA 3HLKA 1NF3A 2LP4Y 2IEGA 3RIYA 1EM6A 1U6KA 4FLEA 1NW8A 1ODLA 1SIBE 5DSXA 5I9BA 1PTJC 2MYNA 2VZ0A 3SR4A 3MERA 3WGGA 5BN5A 3OJEA 2QUAA 3W79A 4CQLA 5AVXA 1ZGAA 3I9FA 1F6WA 1RQNA 3H6GA 2QX9A 4MP3A 1IHUA 1PQUA 1BX0A 1IE3A 1WKVA 1ZK3A 3I30X 3IUEA 2XMPA 5MHTA 2HJHA 2QSUA 2HHAA 4LRWA 3AF1A 4R1OA 1GKIA 1RP1A 1GUYA 2NWQA 1TJ4A 1QFXA 2IHTA 1TW3A 2QROA 4HDMB 2PV0A 3IPXA 4WY8A 4DG5A 1N2OA 4AJEA 4ARBA 5B3LA 5CGQB 2C7PA 1M72A 3LLVA 1A77A 3M5PA 5JCJD 1OFGA 3NBKA 1A7AA 2X8BA 3ZEIA 4C4TA 1ICEA 5KDDA 4E3ZA 1E2FA 5BRJA 2V55B 4RZUA 3HR4A 1E94E 3FE2A 3FCCA 4X63A 2BGNA 1JDTA 3D5EA 3SQWA 4B6RA 3EYAA 4W7IA 2X9GA 1BDJA 2ONZA 4C04A 3I5UA 4C89A 4P35A 1QPZA 2PRKA 3EXIB 1E9DA 3QKUA 2HK7A 4EI8A 4H4EA 3FBWA 3EIEA 1CERA 4RAQA 3TTXA 1BVHA 5B3KA 1CUBA 3QXGA 4DDHA 2HBRA 1SVOA 4ZI3A 3NBZC 1AUOA 1X1RA 2YXBA 5U1PA 5K45A 3CZPA 3VPGA 2Q3BA 1YDEA 5BWNA 3B85A 5DBEX 2QV0A 4D3ZA 2XKKA 1JFSA 3RGGA 4CIWA 3NTOA 2NACA 3RQSA 4RGVA 5JAPA 4ABYA 5JY1A 4IOLA 1ZS9A 2IOHA 2VI5A 4E0BA 2I2DA 1RYNA 3DKKA 3EIFA 1BS9A 2IIPA 3P71T 4FMDB 1Q1AA 4GSYA 4RSMA 5F78A 4ENTA 5C1PA 1U9YA 4YMVA 3AU8A 5BYAA 3FZYA 4HNUA 2WVGA 4YRAA 5I7RA 3A2NA 3H8JA 5IYZA 4IIFA 2E89A 5H4GA 2CL5A 2XADA 3X2SA 4PYJA 1KMNA 2OHFA 4DVGA 2IHVA 1NBME 4MMYB 2VDQB 4PWYA 5TMDA 4JX9A 1NX6A 4ZREA 1MDBA 4NCAA 2MMGA 5L8VA 3FDJA 3WI7A 1Q84A 4DB2A 3HVRA 5DNWA 3L6RA 4Q9JA 3H9GA 1MX5A 1O95C 3R3YA 4X1IB 4ZT6A 3E7XA 3O31A 4P36A 4DSTA 2R00A 4M6WA 2CNNA 4UULA 5M29A 1R9JA 3NFRA 1EFKA 4AP6A 4DWOA 1B15A 1NRXA 2CBZA 3B52X 3I01M 4KAFA 2D3TA 5KTNA 3IAEA 1SQGA 1XNQB 2ZQYA 4P32A 4M38A 3HA3A 3VR4H 1RZRA 1LFDB 2R1TB 4HVCA 1M8FA 4X1IA 4C4OA 2HMYB 3ADPA 3C43A 1U94A 4TT8A 4EX7A 1WF6A 2NVOA 3IP5A 5K8UA 3I04M 1KYZA 3AERA 5IT4A 2ZIFA 1CUCA 1P2GA 3LY7A 2YX1A 1U63A 2YN2A 1V25A 4ER5A 4EGQA 4C7XA 3OEWA 1E96A 4TZKA 4RK6A 3TD9A 4RFSA 4W5WA 3A1WA 4B6FA 4CLOB 4Q48A 1W59A 1SN7A 2JLUA 1E2UA 2UV8A 4OM8A 4Y2TA 1R0SA 4IXDA 3KOUA 4YJGB 2DJ5A 5AO9A 2FH5B 5AH0A 4IICA 1F2VA 3OCYA 5FO0A 3W06A 1GXSA 2ZAGA 2YBEA 1CEXA 2DR3A 1Q15A 4I55F 1QIJA 4E09A 5REQA 2EFYA 1B7GO 1XZPA 1GSHA 4HG2A 4OHXA 1C9YA 1PN3A 5EXXA 3RTBA 2L82A 3FJOA 3ZBQA 1QFJA 4ENWA 2WZCA 4LKOA 1BVUA 3ZS9A 1SCNE 1VSQA 2P3OA 3COSA 1JHPA 1GNRA 1UC9A 2QJTA 3E2IA 1IDOA 1IN8A 3GVCA 3LT2A 4HUTA 3OD1A 1X7ZB 3DLAA 1Y6RA 2IBTA 3IRVA 1DARA 4YP0A 4QIHA 4RQAA 3VV2A 4AG3A 1BU5A 3OSUA 5EWJA 4GQAA 3SE7A 1VL8A 4DCGA 2Z2XA 5EJ8A 2YJZA 4I50B 4TS4A 1QTNA 3M33A 2UZAA 3O9ZA 4I1UA 2IX9A 1NYLA 2JD0A 2XCUA 3BMOB 3HACA 4DV4B 1X1DA 4QPZA 4AKTA 3C5VA 4CMIA 1COWD 4HNTA 1I3NA 4TL6A 4BBPA 4AMVA 1V5IA 3WLIA 4J7CA 5E9JA 4BNUA 1VP9A 4H3SA 5HRCA 1Z33A 5KU1A 3AHCA 1O5IA 5TVGA 5LWQA 5FOVA 2CWWA 2WD9A 4MVJH 3PXAA 4MCAA 2FF7A 4EB6A 1KRHA 3PQ6A 4DMRA 2GZRA 2R7AA 3SQNA 1JGTA 1H2WA 3MMNA 2QBYA 1XD9A 1L4LA 2XUKA 4R9SA 5DX0A 3P20A 3S28A 3MMXA 4FONA 5DJ5A 5GAJA 4LQCA 3R75A 1NN5A 3RG8A 3FMOB 3R9WA 4B6GA 2FPPA 3S2FA 1QMPA 1L4UA 3IP9A 1D4ZA 1GPJA 3F7MA 3KFVA 3HYCA 3S29A 4BFTA 5AXBA 1KAOA 1KDVA 3T5DA 3WB2A 2IZZA 2QBYB 3ZX5A 4IILA 4GICA 4X1KB 2O7QA 3L6UA 5T8KC 1YOBA 3K9QO 1G63A 2VIIA 2YJ3A 2ZSBA 1L3CA 1GL3A 3E7FA 2VYVD 5C1IA 3SGLA 1WXWA 3WA6A 3AL0C 4XTCS 4IO1A 4CN9A 4EL0A 1XRMA 1YOVB 3IMEA 1HDIA 4RF4A 3L3BA 4UDYX 4IHAA 3VUEA 3WK8A 4ARZA 4D4KA 3EE6A 1Q17A 2P9CA 5DIZA 4BX2A 2MSNA 1K5PA 1RTTA 1SNYA 5AFSA 4UNRA 1C9JA 1XU9A 1ILWA 3QJYA 1SKYE 5IF3A 3CB2A 4LYGA 1HDZA 2RAUA 2FWAA 3T0GA 3IGFA 4JI0B 1LVGA 4MQLA 1EVZA 1GZ3A 1E8NA 1OA1A 1Q2XA 2NZJA 1TQ4A 3IVCA 1MAAA 4C7MA 1DTWB 3BOSA 1IXSB 4ZMBA 1OLOA 1S3GA 4BVKA 5F5LA 1NQXA 1S5PA 4Q7QA 3EVBA 3LDAA 4FDAA 5H80A 1D07A 1JHYA 1CJSA 3FKSA 4FYPA 4LG1A 4CTJA 1T8SA 3IT0A 5IM4F 1RPZA 5J2UB 2WTEA 1OAOA 2GX6A 3A36A 2FAXA 1SHZA 3PI6A 1M9NA 2XQFA 3PFCA 2A3RA 2JLSA 1NBEA 3NM4A 3I5AA 3PXXA 2VAXA 1ZNYA 4LQ4A 4A0GA 1IBMB 1QCZA 1VECA 2F59A 3K0KA 2LVBA 3IBCA 2GAFA 3ANMA 3HJGA 2ZSDA 2HNAA 4M0KA 3OF5A 5IK2A 2PD3A 1JFLA 4E13A 5AKZA 2HH9A 5JI3E 4EGSA 4J2TA 1QO0D 4Q03A 1UL1X 3IUQA 5TEVA 1Q0ZA 1LPAB 3H11A 1XJ0A 1K8XB 3SC2B 3SFVA 3WKCA 5ADHA 1TUEA 1OA0A 3TCNA 4FEAA 3D6VA 2RHLA 2CNOA 4UPVA 1FRZA 1CR4A 3D2CA 4PRZA 4DQVA 2OBLA 1N92A 1YFKA 3GLVA 2ZPUA 3KKPA 2RHJA 4CG3A 1HH4A 3ELDA 3NT4A 1Z36A 5FA5A 4N0PA 3OJFA 3QVMA 1O9HA 3M1LA 1TB4A 4RYLA 3VC3A 3ENVA 5HKBA 4HZUB 4CN8A 3KNZA 2W2PA 4IRMA 3WG9A 4XX0A 1JDSA 4BKMA 3L18A 4RMHA 3CLSD 1TTHA 1ZEMA 4MV6A 2D1YA 4OEHA 3RBAA 2JCSA 2VAVA 1LRKA 1KAGA 4UEKA 4K9MA 2Y6VA 1QQAA 4HRAA 2CDRA 1B1CA 3OLVA 4UHKA 4A5OA 1IM5A 3GNLA 4FMPA 2OFFA 4O2LA 1T2EA 2COUA 3GHYA 4KACA 2CXTA 1L7RA 2O9JA 1UC8A 3AF3A 1VE1A 4J0CA 4DDTA 4J3NA 1MZVA 1WJGA 5CVJA 4DJEC 2FPUA 3P2JA 2Q3FA 4QRHA 1OGIA 4KODA 5SICE 4JJEA 3OIYA 3N5KA 2QSYA 3JWHA 2XGSA 3LFUA 4LOIA 1IIRA 1FS6A 3LU1A 5D86A 2CFIA 4LNUA 2ZJZA 4LWPA 3CGWA 1P1KA 5CVDA 4DLLA 5LQRA 4D4GA 1L4GA 3K5HA 4WCFC 1P9RA 3E9RA 3N0WA 3TNYA 3M9WA 1Y0BA 3HZRA 4ER6A 2GXAA 5F9FA 1Z4JA 1DKNA 4PAWA 1ZISA 4MYHA 3EC7A 3MJSA 5EAIA 2JVKA 5EP3A 2F1HA 1XRJA 3EF1A 5ALRA 1QYWA 3WL3A 2WC1A 1Y7TA 2O1XA 2LZ0A 4Q47A 1VGRA 3T06B 5K4HA 2X5OA 4A6DA 4GM1A 1YKSA 3UHJA 4PG7A 4O29A 3TNJA 3KLMX 1AS3A 1YR2A 1E2HA 1VBKA 3S6JA 1QHHB 4B3RB 1E2BA 4J1TA 1A7KA 2B69A 1TLFA 3CLVA 1FQJA 1KPGA 4A8JA 1L5NA 1G59A 1GPH1 2C0PA 3C3YA 4M21A 3U7RA 3VQTA 1PG0A 4G86A 4HQ0A 3R7WA 3QKWA 1AXRA 2AC2A 2WQ7A 3L6CA 4R83A 4GPEA 3U1BA 3BAZA 1BQ4A 3FUVA 2NZUG 3WOVA 1FXWA 3MQ4A 2H1CA 2MMCA 4QTUB 5CYOA 4LYHA 3W2GA 3D6AA 1N5KA 3LUCA 3O1IC 3GGGA 4QNMA 5AVVA 4I9FA 4E1BA 3EQ6A 4LHWA 4MR7A 3PT9A 2R4TA 1OB5A 1DIOB 4LXHA 3DXFA 2HLPA 2I7TA 2ZRPA 5IJZA 2FEOA 3PCRB 2M6LA 2C1XA 2CLIB 1IZ0A 4N54A 1MJGA 1JZSA 1L4HA 4MRNA 4ZVUA 1WCWA 3LSTA 3J7TA 1H6CA 4AJPA 4W9NA 2O3JA 2CNLA 3BJZA 5E4JA 4RM3A 4X8OA 5K3EA 5AW6A 3NCTA 2P27A 1NQAO 5JMTA 1S9HA 1Q20A 1UBNA 2C57A 4D4MA 1YRLA 1CUWA 3IJ5A 5DU2A 1I3CA 4BKUA 6REQB 4QUAA 2IPAB 1EXVA 2GN6A 2XNDA 3VPCA 3R4VA 4FQ8A 1N6OA 1UAGA 3R24A 2I2CA 4MRMB 4BIIA 5HS4A 3FOWA 1I7QB 3FX2A 1DAMA 3NHYA 4EH1A 1O6GA 2AZXA 1SFRA 5KKAA 1JDNA 3ZV5A 5UKDA 4EOGA 1ND5A 2B2XA 1P9NA 3MLEA 4BQOA 4LQLA 3GRFA 2X14A 4V3BA 3FG9A 1GQSA 2N3ZA 2CL7X 4LXYA 1DO8A 4F06A 1U0HC 2G1PA 1KRXA 1L5LA 1X9IA 4MUXA 5A03A 2GS9A 1DCMA 4MS4A 3OT4A 4B44A 5K20A 3AUFA 3USZA 1TF7A 3DZDA 4LY6A 4WXHA 4YIKA 3PWKA 2EKLA 3JATB 4L6CA 1KDRA 4P0QB 1ZH2A 4UDNA 3VR5D 1CHNA 1QZTA 4FFPA 2DEUA 1GYQA 3ZHYA 3W1WA 3GIDA 4JT4A 1JPJA 3FDFA 3TB6A 1I2BA 4DF3A 3G2IA 2V4UA 3ONNA 3V8QA 3EUWA 3NRJA 3PFGA 2B0JA 2JATA 1DWUA 4CUKA 1OLUA 4N1AA 4RX1A 2BFEA 4KX5A 1MC5A 2HQOA 4RFLA 5D8DA 1G5IA 3IDAA 2TMDA 2GHTA 2IYVA 4PR3A 5K6AA 3VU3A 3ASZA 2JFNA 2W8BB 1GGKA 2HM7A 2FRDA 3AVOA 4CMJA 4TZ0A 1UDCA 4UASA 1OXBB 2JI7A 2O2DA 2PMBA 1W30A 2R44A 2Q2WA 1KYWA 2XCOA 3ST7A 4YCNA 2B61A 4MWDA 4L3WA 4BB0A 1J56A 2VYNA 2GJ8A 4FGSA 3HJCA 4U39A 4V03A 5JNUA 2PQMA 1YRBA 4FS3A 2WD7A 8AT1A 3BWBA 3SKXA 4E12A 3KZCA 3VNVA 2YJ5A 3P9SA 2YN0A 4OOFA 5IH7A 2R5NA 2YTZA 5SZIA 1NFFA 1KI3A 2D0PB 4GBJA 1YNOA 5D51S 1P7PA 1KPIA 1P73A 2QXUA 2X0DA 5FLXA 4W4TA 2XEDA 3OE7D 4XQGA 4JCOA 3RANA 1M34A 2G40A 1FCJA 3I58A 4J4HA 5AKYA 2ZUEA 4C06A 1GUZA 2WYIA 1GUDA 1V5WA 2RB4A 3ID6C 1ORTA 2BWJA 3INNA 4HXYA 3UG6A 4YUAA 4PGAA 1TRKA 2X8JA 3KIPA 1ANKA 1C7IA 1PT7A 2VYCA 3EHDA 5EA2A 1VC2A 2XIJA 2ZJ4A 1NC3A 4WDRA 4F9TA 2ADFA 1RYHA 1K8RA 5ALGA 4X8LA 3TWOA 3WFJA 5I9LA 3LUAA 5MDHA 2XRZA 1H8ED 3FWNA 2ZI9A 3BH6A 5E95A 3FPEA 4FXOA 4P4UA 3LUKA 4EPYA 4G1UC 1XK6A 2H4WA 2VPTA 4OX9B 2VP6A 3VR6D 2C04A 3EFBA 4JUFA 1KORA 5CR9A 1HNWB 2BKUA 4RJ2A 3ORFA 2KSQA 4FC7A 4D3SA 4MARA 3CX8A 4GOXA 4EG4A 5B4VA 5GIPE 1U6IA 1X13A 4CW7A 2FCRA 1D8AA 5DE3A 4ODIA 1JSCA 1XMPA 5HM8A 1CZLA 1CP2A 3C1TA 1WEHA 5KOJA 4P08A 4WY5A 2YYYA 3LBFA 3PJRA 1HKUA 4CMBA 4U0KA 2QMZA 2H63A 4U3JA 3ER8A 4ZGGA 1I4OA 3ICPA 2AWOA 3HB9A 1GTSA 3IXMA 4EA8A 4Z0NA 4YJHA 3EXAA 4LZPA 1GCIA 4UMVA 3MM4A 3AVPA 1C7ZA 1JG2A 3B1WA 3B6ZA 4JA0A 5E38A 3E6AA 1UMKA 1TUBA 2C3YA 3OBBA 4A16A 1D2MA 4BFVA 2PANA 2ZJ7A 4OQLA 1KSGA 1KQNA 2WMDA 4BZWA 1R6BX 5C31A 3GVXA 4LZWA 4ZOLF 5KKNB 4OY3A 3U56A 3WIOA 3AVQA 3GYGA 3TEMA 1YBFA 4PHTA 4YJHB 4E15A 4YV0A 3CRVA 2PSEA 1Z2OX 1KEWA 3BWCA 3N58A 2J5QA 1E3SA 3CW8X 3EZ6A 5JWOA 4EB8A 4BFZA 1IZYA 5KJCA 1D03A 3CT4A 1A8UA 4R2KA 4AY5A 3T5MA 1SZJG 2IF0A 5LNK1 4J07A 2DFNA 5ALVA 1W6UA 1WRBA 2H1IA 2WUGA 1JBQA 3LBIA 3LOQA 4KBGA 3FOBA 3WAJA 5AXCA 2F6RA 2PVSA 3NANA 1H1TA 3W0LB 2EFDB 4RMNA 3AVXA 1F8FA 4LF5B 3BORA 2HV8A 1DTSA 1PX2A 5ABPA 2OSVA 1EVYA 2Z1MA 4BEWA 1T4MA 4I4TF 1ENYA 3CVXA 1NV8A 5JDIA 2ZTMA 3PXGA 3S0JA 1B2LA 2XQGA 2ZU0C 3DV0B 4IX9A 3TQQA 1OBFO 1IXYA 1KYXA 4Z1OA 1HUQA 3GYBA 4D45A 3MWGA 4B8ZA 4OXQA 3I64A 1QO7A 1VP3A 2FPMA 3CF2A 1LLCA 2ORYA 3F4LA 1RPNA 4DLUA 2WHYA 1J24A 4FFNA 2E3JA 4X24A 4YO7A 5DPMA 3LTEA 1RI5A 4YC7A 3L4SO 5AVUA 3H2GA 2QT1A 3DDCA 4OHKA 5IDVA 1A8HA 3U4DA 4CIDA 3DV0A 3M7IA 3EIXA 1JFFA 4I5EA 5FXMA 4CM5A 4DG8A 4W9MC 3IAM1 1EFAA 3KQTA 3FIUA 3PUXA 4XXHA 4GE0A 4RPHA 1U8YA 1Y9DA 4R51A 3CSDA 1L5RA 5K8VA 5DLPA 3TGLA 3K72B 1R0CA 4PX9A 2JAWA 3CVJA 2OV1A 4Z9YA 1KZ9A 2J48A 2R7MA 3M1AA 1KTVA 1XZFA 1WUKS 4DXHA 3DO8A 1O94C 1Z7BA 4IV5A 5FDFA 4JJKA 2RARA 1N2GA 2DSNA 2PBRA 3OZ7A 4L22A 1XTRA 4ZZ1A 1RQRA 2QG6A 3FUUA 4NARA 4CL3A 2XOEA 1YDGA 1I5RA 3KQNA 2VJOA 4HDQB 1JFTA 5JEEA 4DMLA 1R0BA 1JXOA 2IELA 4N82A 1NVTA 3HDTA 3O82A 1VGVA 3R3WA 4GZMA 1CC1S 1LUAA 4MPPA 2IYYA 5TS2A 3TE6A 1R6TA 2D1QA 1KO5A 2BCGY 2QIOA 3D8BA 4Q1EA 2NTNA 2O48X 5DNEA 3TRHA 4Z7OB 5C1BA 1U5CA 2A5DA 3R2JA 2ZAOA 4J16A 5HIJA 3UV3A 2PQ0A 2E87A 3EDCA 2F9MA 5JAQA 3VDXA 2QYTA 2AV6A 5KTKA 5MGNA 1VL1A 1MRSA 5JFOA 5H02A 3RWMB 3GLIB 3PNVA 4QFDA 3HVJA 3K09C 3C48A 1VHTA 2ZE6A 4LNAA 4WCVA 5IWCA 4BUZA 3A9CA 5JBQA 2Q3DA 2RKBA 3K71B 4M0PA 3UNXA 4K05A 1RCFA 2H3EA 3JQGB 5G4LA 4DR4B 1ZR4A 3QELB 2V5AA 2GWRA 3T3DA 2LE0A 1Z8NA 3KTFA 4FLFA 4W1RA 4M36A 4A2PA 5IYZB 1G4HA 5FHQA 3FF1A 3AUXA 3GLIA 5DGHA 3OZBA 3A4NA 2A5FA 6LDHA 3GGPA 2OFOA 2BOVA 3LBAA 4NLLA 3WKEA 4ZICA 1GL9B 1DAFA 3C1UA 4PF1A 1M5UA 2Y05A 2XAAA 1R4MA 5E7JA 3AI3A 5I48A 4IUBS 1QP0A 4FMCB 2VNIA 5D3ZA 3H4VA 2CXOA 2OD9A 2IYAA 3BRWA 3AY7A 4GX2A 4I8XA 4MW7A 1N9GB 5DXJA 1CZUA 1JHAA 4GOOD 3WWOA