1F9AA

Crystal structure analysis of nmn adenylyltransferase from methanococcus jannaschii
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
164
structure length
164
Chain Sequence
LRGFIIGRFQPFHKGHLEVIKKIAEEVDEIIIGIGSAQKSHTLENPFTAGERILMITQSLKDYDLTYYPIPIKDIEFNSIWVSYVESLTPPFDIVYSGNPLVRVLFEERGYEVKRPEMFNRKEYSGTEIRRRMLNGEKWEHLVPKAVVDVIKEIKGVERLRKLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL PROTEIN MJ0541
publication title Structure of nicotinamide mononucleotide adenylyltransferase: a key enzyme in NAD(+) biosynthesis.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
total genus 52
structure length 164
sequence length 164
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.1: Nicotinamide-nucleotide adenylyltransferase.
pdb deposition date 2000-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1f9aA00
1M8KA 3RK1A 2J07A 2DERA 1J09A 1NYLA 3DV2A 4MVCA 1PFVA 3TQOA 1J21A 4ZCTA 1NZJA 4E1AA 3U1VA 3AFHA 4F4HA 5HG0A 3IDFA 5TEWA 3GUZA 3KT3A 4ZT7A 4DDMA 1JZSA 1QU2A 2RD2A 1O0BA 3CR8A 1PFUA 4NX2A 2Z3VA 3TS1A 5KHAA 5TGTA 3A4IA 1J70A 4PBRA 5BNZA 3CVXA 1JECA 5AHWA 5KCMA 3AG6A 4ARIA 1J1UA 1OWMA 4NZPA 3IUBA 2WSIA 1WY5A 1Q11A 4MULA 1KP3A 1TYCA 3ZXSA 2QJOA 1HYBA 3KT8A 1K4MA 1EFPA 3I05A 1OD6A 4YP7A 1H3NA 1NUPA 3CVVA 3IOCA 3N8HA 1M8PA 2A1UB 3UK2A 1G8FA 1KH2A 3MMXA 1WQ3A 1WQ4A 3DLAA 1KORA 1MRZA 4JXXA 1Q77A 5DEOA 2CV2A 1IQ0A 1J1ZA 4KPUB 1IQRA 3AIIA 4YMIA 4ZCPA 5F23A 2X3FA 1QRTA 1BS2A 4EF6A 3G5AA 4PBTA 1QTQA 4DNXA 1OBHA 2CSXA 1M8FA 4MVYA 3Q10A 1JGTA 1V8FA 4MW6A 1EUQA 3X1KA 1N2IA 3H05A 2VTBB 5IJXA 1TEZA 5LM3A 1WZ2A 4EG6A 4UZEA 1MJHA 4EG8A 5JBNA 2PZAA 4DDHA 1X6VA 4XFDA 1EE1A 1O97C 3D6UA 1LI7A 4BWVA 2IJGX 5KWVA 1EFVA 3SYTA 1CT9A 3AG5A 1FFYA 3SP1A 2YWCA 1KQOA 3L93A 1OWNA 4MUFA 2J08A 1WXFA 4EG3A 2CV1A 1MAUA 2VXOA 1G8GA 1M8GA 4L2IA 4CDNA 2DR2A 4KR7A 3NBKA 2D13A 3L92A 2BYTA 4JXZA 2DETA 3CLTD 4WSOA 2CYAA 2PG3A 4MWDA 3RJZA 3N9IA 1UFVA 2IP1A 5FO0A 4HJXA 2QUHA 5LLTA 4MW4A 3CLRC 3IVXA 1MB9A 4I6EA 2V0CA 3ISJA 1YIAA 1VBKA 2O5RA 4DLPA 3F3MA 1TYDE 3G59A 3FH0A 3K32A 1JIIA 3ZXIA 2QUIA 4MW5A 4EGAA 1EXDA 2PXHA 1KAMA 1VBNA 2A84A 3A04A 3MXTA 4MQ6A 3ZJTA 4QREA 1O95D 2H2AA 3IVCA 3SEQA 3SZGA 1RQGA 4H3SA 3GLVA 3AKZA 1N1DA 4KKVA 1WJGA 1PFYA 1G59A 4YP6A 1JILA 3HL4A 4U7JA 4DDKA 5DK4A 1U3CA 1PG2A 4MVXA 1N2GA 3CLUD 4EG7A 1O6BA 2J09A 5DB4A 1WXIA 1YUNA 4MUEA 1ULHA 2CYBA 4K03A 3UY4A 3LOQA 1K97A 2YY5A 2ZUFA 4AS1A 3IODA 1TFUA 1Q19A 2QJTA 3FY4A 1R6UA 2GOYA 3QTBA 3HFJA 1EFPB 4RUKA 1WXGA 2GM3A 2NZ2A 1OWPA 4MW2A 4Q16A 4DE5A 2OV4A 1OWLA 3P0JA 3BL5A 1N2EA 2E0IA 4MUIA 2X0KA 4J76A 1O96A 4HPWA 2AKEA 1JZQA 1PFWA 3HZRA 2WB2A 3QE4A 3CVWA 4KR9A 4F3RA 1X8XA 1QU3A 3H9BA 3LCJA 3IMGA 2CFOA 2PZ8A 3RBAA 1KQPA 1MAWA 1TYAE 4Q93A 3TZEA 1O94C 2QTRA 4XFJA 3C8ZA 3CVUA 4ZT2A 5LFAA 1IFXA 3A2KA 1IH8A 4GU5A 4HK4A 3E27A 3S3TA 1QRSA 1Q15A 4OUDA 1WXHA 4ND6A 2D54A 1EUYA 3FI0A 1GTSA 2HZ7A 1R6XA 2D5BA 2AG6A 3TQIA 3MLBA 3KT6A 5HUHA 3P52A 1T6YA 3RFFA 1F4LA 3SZ3A 3ND5A 3IUEA 3TZLA 4ND7A 4JZYA 1JIKA 4PBSA 4JFAA 1EFVB 1I2DA 2A1TR 3QTTA 4MLPA 4HJRA 4MUNA 2RE8A 5FNZA 3INNA 4MAFA 3IOEA 4U63A 1GAXA 4G6ZA 5IHXA 1TQ8A 1M1ZA 4G5YA 1T6XA 1N75A 3VGJA 3ZIUA 4L2IB 4EFKA 3IMCA 3FHJA 1KH3A 3G6KA 2CYCA 4J75A 2CUZA 1YIDA 4KPUA 2H29A 5DASA 4NAHA 1YULA 4QBTA 1VLHA 3CLTC 4MW7A 1M83A 3NBAA 4DJAA 2QTMA 4MW1A 1N2HA 1A8HA 4NDAA 5H7XA 1T9GR 3VU8A 1XJQA 4CDMA 1NURA 4FZJA 3M5WA 1WOYA 3LE8A 3UOWA 1QQTA 1NP7A 2ZP1A 3PNVA 2JA2A 3K9WA 2A86A 2WQ7A 4K0RA 1M8JA 2GKSA 3CLSD 1OWOA 1OBCA 2BTEA 2WQ6A 2PFSA 1KH1A 4MUKA 2E18A 2IELA 3FWKA 1O95C 4S1OA 3SDBA 1DNPA 1GZUA 2A1TS 3P0IA 3KFLA 1SURA 3PNYA 2TS1A 2XRYA 1XNJA 2JAXA 1O5TA 3AL0C 2PZBA 3CLUC 2OQ2A 1J20A 1QJCA 1KP2A 1I6MA 2EL7A 4MWBA 5FO1A 5K0SA 1IRXA 3A05A 4YBRA 4ZT6A 1JIJA 3ILVA 3ELBA 1N2JA 3ZGZA 1U3DA 1XNHA 2XRZA 4OJMX 1GTRA 1JMVA 3FNRA 4NAUA 2DEUA 1Y42X 4U8HA 1P7PA 2V0GA 3IMEA 4MWCA 5J58A 2JANA 5J5AA 1IVSA 1H1TA 3PNBA 4WNYA 1U0BB 2E89A 1T9GS 3OTWA 2A88A 1G8HA 4CT0A 1QRUA 2CV0A 4AQ7A 1N78A 1ZJWA 3X1JA 3DO8A 5EKDA 1V47A 1MC1A 4R2MA 5J59A 3Q12A 1PG0A 1JHDA 1I6LA 4UZFA 3SEZA 2A4MA 1S4MA 4OUDB 4P2BA 1TYBE 4MUJA 4TS1A 1JEDA 1U7XA 2Z08A 3CVYA 1COZA 1K4KA 3ZUGA 3ZJVA 2HGZA 2DLCX 3MLAA 2R5WA 4ZCQA 4JYZA 2J5BA 2QUJA 4ARCA 4EG1A 3Q4GA 1EJ2A 3IVGA 2AZXA 4ZCRA 1N2BA 1WXEA 3UMVA 3FIUA 4ZT3A 2CT8A 2DXIA 1VBMA 1N77A 1D2RA 4ZT5A 1ZH0A 4EG5A 4EG4A 3MUEA 1O94D 3OP1A 3COYA 1FYDA 4PY2A 2I1LA 2YXNA 3PXUA 2X1MA 3COZA 3ND6A 4MW0A 3COWA 4MVWA 2A1UA 4I6JA 1O0CA 3HGMA 3COVA 1F9AA 1KAQA 3KT0A 3FOCA 3P0HA 4A91A 1GLNA 1N2OA 1B6TA 1IHOA 1YUMA 3N05A 4I6GA 3FDXA 1KKUA 4YP5A 1ZH6A 5H16A 3PRHA 3NV7A 3JXEA 4MW9A 2ZUEA 3FG9A 5HUJA 4ZCSA 1T6ZA 5TS2A 2E21A 4QRDA 4G5FA 1H3EA 2C5SA 3CLSC 2VTBA 2QUKA 4MUHA 1U7DA 4NATA 1XNGA 2A7XA 5K0TA 3ZJUA 2YWBA 1O97D 2DPLA 3GMIA 3HMQA 4R0NA 1H3FA 3D6VA 3DPIA 1GPMA 2O8VA 3UC5A 2QTNA 2J4DA 4ZT4A 2HMAA 1LI5A 2NSYA 2DUMA 3H97A 3VRHA 4MWEA 4RPIA 3RHSA 3TNJA 1QNFA 1MOPA 1NUSA 2PIDA 3CA8A 4KR6A 2X1LA 2EJCA 1WKBA 1NI5A 4MUGA 1MBZA 1N3LA 1YI8A 1NUUA 3ND7A 3H9CA 4GRIA 1KR2A 3X1MA 1IQUA 1NSYA 2Z09A 4XSVA 4X0EA 2G36A 1JEEA 1VL2A 1LW7A 3HV0A 1ILEA 3IOBA 1F7VA 1F7UA 3IH5A 1O96B 1I6KA 4CQNA 3RK0A 3N2YA 1KQNA 1GN8A 3CLRD 3FETA 4R2LA 5TEVA 1ZUNA 1R6TA 3H99A 1K92A 2B7LA 1NUQA 2QJFA 1NUTA 1MB2A
chains in the Genus database with same CATH superfamily
3FTEA 1CS0B 2B21A 4LUCA 4BMZA 3ZWKA 2G5CA 1RI2A 2JVIA 3CINA 4L57A 5F2OA 5ALXA 4ZD6A 5HDBB 5HJEA 5KQRA 1JLKA 5BYAA 3A1EA 3OOEA 2UYCA 4GZ6A 3AVWA 4IJKA 3UHJA 3F3YA 1XLTC 2V97A 1BE1A 5ADUS 3VR1A 4YDQA 4Q7JB 4ZIRA 2ZBQA 3OCUA 3A28A 4GIBA 3EZ2A 4PV7A 4G1UC 1U80A 2ZU0C 3GJ0A 1MNAA 1NT2A 1I9GA 2JFXA 1R8SA 4WE3A 1FRQA 5K0LA 5I5EA 3U56A 3TAHA 1B6RA 2ZUSA 1WUYA 4YK7A 1LC0A 1T2CA 2BKVA 3MJFA 4PCLA 3A4IA 4DCNA 3KR1A 3L9XA 1Z63A 5CFRA 3B1WA 3CVXA 1ZCFA 4A0RA 1J1UA 1JQ5A 4RD6A 3LS2A 1UZNA 5B5SA 1ZQ9A 2OG2A 1BOOA 3H11B 2XUKA 3I01M 3IPCA 1PZFA 2I8AA 4IXWA 4L75A 2XDAA 4M8KA 3VO1A 3R6WA 1KP9A 5CVVA 3OMLA 2LCQA 3STTA 3UVEA 5IG2A 1RXEA 2QB5A 1WL8A 3N2KA 3L1JA 4UCFA 1ZD9A 4KITB 1E5TA 3GBVA 1ETHA 3IOCA 2QAGB 1Z5GA 3KJGA 2XA1A 3OZEA 3PWTA 1V3QE 4I4TA 1UPTA 1C5KA 1L7RA 1G9TA 3ZD9A 5C2JB 2ACKA 3LL4A 3PD0A 4DG9A 4QDKA 3E4CA 3NNNA 4LTMA 4LF4B 3OPMA 1V25A 4DNXA 4QPNA 3DMHA 5F9HA 2IU0A 2DHDA 1B00A 1X0VA 2PX8A 3ZR4B 1K3TA 5JXHA 1TT5A 3WK9A 2JCBA 3FUTA 3TIXB 4E4YA 2CZQA 6CHYA 2FMTA 1TAUA 2C29D 2DAPA 4URFA 1D7AA 4WXHA 5FTJA 2G9ZA 1IEQA 2CNBA 3N28A 2VTBB 4R1LA 2WD9A 2XCOA 1T1IA 3KDAA 3ILHA 4ESOA 1TEZA 1XFAA 3LAWA 4RXMA 5GIOE 5LM3A 4RDCA 2PR2A 2CJFA 1G55A 1Z18A 2ZAYA 4H4CA 2C4UA 3UW1A 1U6IA 4F5DA 3TOSA 1UBHS 4LK2A 4RS3A 4C7MA 4DA0A 3L1IA 1GSHA 5KVQA 3ZCRA 4DDHA 2RH4A 4ZJUA 5IWCA 4E2WA 1MW9X 1TO6A 3QTLA 4TV9A 3TRDA 3SHFA 1SUCA 3KXDA 1USWA 5HK8A 5C80A 2BGKA 2CWDA 4KFSA 1Z9BA 2GDZA 4HTFB 3RU9A 2PBLA 3RB8A 5D85A 3FSGD 4YACA 3CB4A 1JTVA 4FHEA 3OEED 1TVCA 1H8HD 2QTLA 1J22A 3OO0A 3PJGA 3QLUA 3SC3A 3G0DA 2OR3A 4UJ3A 4EEKA 5T67A 1OAOC 1PJAA 4I8IA 3V1TC 5DRYA 3ZWBA 1FE8A 1GNSA 3ZI7A 5LYYA 1R5BA 2F8SA 3EXEA 1M6HA 2EWMA 4M3NA 5INTA 5F9FA 2IEZA 4J7AA 5U4XA 5KVCA 4G0NA 2IPAB 2LCIA 4M88A 2XADA 2PV7A 4O63O 4D74A 3G88A 4UE6A 1D1TA 4JMLA 1Q6YA 1OSNA 3GEBA 1W93A 3EB9A 3GI1A 3PSAA 4X61A 4ASUA 4PC7A 1KRWA 1YZUA 5EEGA 5FPSA 3ZK7A 4B7AA 4HJXA 2Y76A 2NYRA 2XMDA 2VNSA 4ENUA 1K7SN 5FT9A 4GDMA 4HEA1 1QGUA 2H6EA 1DJMA 2ZJ0A 3WY9A 2Z2XA 4WBNB 4FSXA 3IB6A 3CZQA 3SS9X 2FP4A 1MB9A 1UJ2A 2QX8A 3EGCA 2W2VA 4L9SA 4U9UA 4Y1RA 5DMXA 3ISJA 3JAKB 2QVXX 3OLZA 2R66A 1ZEMA 2YYYA 4H0CA 4KPYA 1KPIA 2ZWIA 4H6PA 3THYA 1HQYE 4WFJA 4GYWA 1I51A 2H4XA 3LQQA 3HKEB 4ZI2A 1HO3A 2PH7A 3HCWA 3V97A 3EXHC 1VMAA 2OTCA 3F67A 3P9SA 3V55A 4TXLA 1K3FA 5E2BA 3L40A 1UZMA 2CW5A 1ICIA 5CBPB 5HCIA 1OW3B 3EC1A 4V0RA 5IT5A 5JZ9A 4OP1A 4YJ3A 1Z6QA 1UPAA 4IG4A 4DSAA 2GPAA 1O6BA 2NV2B 2ZR8A 3V8MA 1PCXA 3Q0TA 4ND3A 5DB4A 1RQ2A 2F1JA 2NZYA 3H0EA 3HWSA 1T13A 2Q27A 3I1JA 2QEQA 3I39X 1A72A 1LX6A 2G1AA 1N8TA 2BM1A 1UT5A 2VHVA 3LOQA 4RZIA 1XRQA 5F73A 2K7ZA 3O8DA 2FW8A 2IC5A 2RK4A 5FUXA 4FIZA 3PQEA 3R7WA 4NQRA 4R9SA 5KX5B 3KAJA 5C53B 3BTVA 4FFBB 1T9AA 4D45A 4DW8A 1S7GA 3AHEA 5IJ9B 5BQ3A 3BGVA 4MW2A 4Q16A 4UMFA 4CLXA 4DE5A 3JQGB 2JRCA 1ONSA 1VGRA 1RXWA 2Z5FA 1QBGA 2QTVB 1N6HA 4JJZA 2H85A 3SQLA 2QR3A 2YWFA 3C4QA 5IS2A 1KOFA 3KJZA 2I87A 3DVAB 3QA3E 2WB2A 1JV2B 2LWIA 3WZ2A 3Q9NA 1GEEA 1LPBB 3TEMA 4YRMA 4F85A 3ETHA 3CVWA 4ZXPA 3EGXB 1UMBB 4EY3A 1UXOA 1R0YA 1LGYA 2W2LD 3IR6A 3RBAA 1FVFA 4UTNA 1YC2A 2C57A 1U0OC 2CFCA 1MAWA 2GZ3A 1JDUA 1Q2XA 2QZ9A 1CBUA 3LUDA 1HYGA 1UWCA 4RADA 2QTRA 3MWGA 4GKBA 4EITA 4I9GA 4QDZA 1H6BA 3GVXA 4WINA 2NSJA 2Y3IA 2MR5A 4LOIA 5EOVA 5C5IA 3MW8A 4ATNA 1J5EB 2O7NA 1TJ3A 3CF6R 1BCSA 2FZLA 3VV2A 4GGOA 5AK3A 1Q95A 3I4LA 5ESRA 2BCGY 2QTCA 3FF4A 3NTVA 1R6XA 5JHGB 4MUMA 3HK2A 5HS6A 1EK6A 1ZP6A 2JAQA 3TZHA 4IILA 5ESXA 3V7NA 4R5MA 2PUDA 4TM7A 2EP5A 4WV3A 3PX2A 2WJHA 4NU8X 3ZE6A 1QGZA 2YN2A 4ND7A 4IWYA 3BAZA 2O5EA 2Y0PA 1BKSB 4EA9A 5DWDA 3T95A 3BK2A 4HV4A 1LC3A 4JP3A 2RE8A 1INLA 1VG0B 1DQZA 4E21A 4FW8A 5IXJA 1CQWA 3FSRA 2DBVO 2LBPA 3K5PA 3QI2A 1Q84A 2EJBA 2BGRA 2IFTA 3WNZA 4HXGA 3WL7A 4Q82A 3BEDA 3G02A 4N3GA 3VGJA 4Q9JA 3TG2A 2VHCA 4WNAA 2ETVA 4DA7A 1JSCA 1HNXB 3WBKA 3SZOA 5G3ZA 1NYQA 2UUCB 3QKIA 2OZPA 3U0VA 2CLFB 1EZ1A 1ZXXA 2WINI 3FOWA 2EC5A 2H1IA 3G82C 3JYOA 3SIRA 2FUG6 2W0SA 1ZUD1 4XQGA 1YZLA 3WHPA 1KAGA 4HAIA 1XROA 2EXXA 4C0BA 1BS1A 3GLKA 1HORA 3F6EX 2N75A 3K2BA 3OX4A 4HLUA 2H2WA 4EG0A 3FYUB 3VM6A 4NDAA 1BD4A 1OFTA 2C9OA 1M2VB 2A1IA 2WVJA 3CUVA 3WLJA 4CDMA 5B1SA 1HEYA 3R76A 1ZXBA 1SXJC 3Q7EA 5FI3A 5T8KA 5ULLA 3CNEA 3UAOA 1WOYA 5JYDA 4IV8A 2HY7A 2FFHA 1P1CA 3RREA 2F55A 4PCVA 5BNIA 2WHXA 3EEFA 4KPGA 4EHIA 3ITNA 1ZCZA 3T3DA 1A8QA 2C2KA 3JZFA 5DGCA 2VJDA 4R1PA 5JMPA 3PRKE 4OA5A 1HXHA 1OWOA 3G5MA 4AZSA 5FTMA 4Q1VA 4KOAA 3T34A 5DO9A 2RGWA 2VJBA 1Q3KA 5JAOA 3QWIA 1CJBA 3JQ6A 3WLIA 4UFPA 4FOSA 2CVHA 1V39A 3MWEA 4UBJA 4YT5A 1HNZB 1NQXA 3F2VA 3QFHA 5EE1A 4RHYA 1VL6A 4LY9A 2GHIA 4YAEA 3CLVA 1G9SA 4JLOA 1FVXA 3HABA 5K03A 1GCIA 1V9LA 2HA4A 3C5VA 1RT9A 2OYSA 1XVTA 2W5UA 5JSFA 3MF4A 4FFMA 1M3SA 1NP3A 1RWXA 1Y4UA 4MLCA 4F1WA 5GADl 5CNKA 4QNRA 3M6VA 4E4RA 3UJNA 1XEAA 5DI9A 3T9CA 3UANA 4M8LA 3PVCA 1KJYA 2FR8C 3KJFA 1PLLA 1HG1A 1KPGA 5ISMA 2PGJA 3KEOA 1FFDA 4M0EA 4D0SA 2GPJA 4ARSA 5AK5A 5I3CA 4UBMA 1VCNA 5AOCA 4BWFB 4CUKA 4I4IA 1Q0PA 4U2CA 1UBTS 4BNHA 2DEUA 4O4IB 5FTNA 4X7PA 5DM2A 2FGJA 3UJ9A 5E9WA 3I8OA 2F2TA 2WFMA 4RZ3A 1T9GS 1VJCA 4HYQA 4TLAA 5ICMA 1MPTA 3CX7A 4DA8A 1PD1A 5LUAA 1E4EB 4QGGA 2O06A 3E3LA 5K99A 2VBCA 4D3ZA 4KXVA 4BO0A 1NW4A 3EH2A 2XGSA 1V47A 3DMFA 4ME6A 4DEYA 1KEVA 1M2HA 3HWRA 3TOZA 3MWDA 3QE0A 2OCLA 4D82A 3TR5A 5TVGA 1TYBE 2VVTA 3I3OA 3G68A 2TSYB 4DLNA 2JI9A 2V3WA 3FGNA 3SN6A 2VAMA 4IFIA 2VHXA 1Y1TA 1QR2A 5SYMA 1XZKA 3NAZA 4NYIR 4BQPA 4F6RA 3EIHA 1ZU5A 2JKVA 4QIHA 1THGA 7AT1A 1FLAA 2DLCX 2XA9A 1C3LA 4N5NA 2AD1A 4B7XA 2WJVA 1U1FA 2DG2A 3PVSA 4BN0A 1PJBA 5KSOA 2BFAA 1IY9A 3IR5A 4NCXA 3B53X 4RELA 3Q4GA 2A3NA 2WC1A 2DCUA 1XK6A 4WLNA 5G0UA 1XZFA 2G07A 2AQ8A 3JARA 2PT5A 4IKEA 1LDYA 1XZIA 1OR8A 4UBKA 5K09A 3U60B 4DV1B 2H7YA 1WTCA 3P0FA 2JGRA 1XRJA 1P1FA 3HYNA 3MWYW 4JR0A 4N0QA 3QQPA 4ZT3A 5HXAA 4NXMB 1YU9A 4RVFA 4ZAGA 4B8WA 5LBUA 1QORA 4D3XA 2RI0A 3AI7A 3LP5A 1DGQA 3L6OO 1Q57A 5ITWA 5GTDA 3RSCA 2YWJA 4LTDA 2CXTA 2HF9A 4ZC1A 1E6EA 1FTGA 1SVSA 3K9CA 3OBBA 3REQB 1S0UA 4HN4B 1DIAA 3GFRA 4OQQA 3ECCA 2ZCVA 2FPLA 4I19A 4JIGA 2GLUA 4IFBA 5JCJD 4XRRA 2PSFA 3GRYA 4LXQA 4B2PA 5DN6A 4U6QA 1P9RA 2W2KB 3TTSA 3HNPA 2DJ5A 2JVKA 1AIPA 2RGNC 4M46A 1ZRNA 3PUZA 4Q3AA 4RCZA 4RQBA 1DX9A 5H68A 3OE7D 1DQSA 4XR4A 3I0ZA 4XAQA 5ALDA 1PYDA 4PLTA 5FUVA 1YB1A 3N86A 4BO9A 4NDNE 1HFJA 5IAGA 1IZ9A 4QSMA 4RTNA 1HDOA 1RCFA 3TCKA 4YRBA 4UM7A 4BCDA 5J63A 4YV2A 1ZH8A 1Y5RA 3FMOB 5FOXA 1EUCA 5EFZA 2NT4A 4C0WA 2V7EA 2JW5A 1ZJYA 3UHPA 5BP7A 2C7BA 2C5FA 4EK9A 1Y80A 1CQIB 2V6BA 4RPJA 4PSKA 3ZBPA 4TRJA 1YDGA 1FBNA 3U5TA 5ECWA 3BSYA 2O7VA 4KL8S 4AS3A 1QE3A 1TZMA 1VCMA 3QENA 4DIUA 4EUFA 1AGNA 5I7HA 5BNTA 3D4PA 4JLWA 4ZQEA 5FUMA 1PZEA 1M73E 2WU0A 5F7ZA 4MSUA 3V7WA 1LBSA 2XECA 2H2DA 3P2YA 4HVTA 4QJBA 2HK9A 3THOA 3CZ4A 4B3CA 4HAYA 3OKPA 4PFJA 4EFLA 4DLTA 4OMFG 4E5DA 5LJIA 1JQ3A 2ZWPA 1LSJA 4MH0R 3EAGA 1V5FA 3AKEA 4MMXB 1CERA 5HKKD 4MWGA 1V96A 4QSHA 4TLEA 2CDAA 4P80A 5BQPA 3RHTA 1DLIA 3JCZA 3BF7A 1L1EA 2RKBA 2VOJA 3ZLBA 3GGCA 1RXYA 1AKEA 3R5KA 2EBHX 4FDAA 4JUCA 5B53A 1BGWA 3W5JA 5K6TA 3H8JA 3LHDA 4OH1A 3ANYB 1TMKA 3SKVA 1YFJA 1FNDA 4CV1A 5LCXA 1JEEA 3PC3A 1UOEA 2QYTA 5DZSA 3I0MA 5DIFA 5LYJF 1PFQA 2R5NA 3EYWA 5G3YA 4KWHA 4CI9A 5LDHA 5KYGA 2X8AA 3DD1A 5K8CA 4CQNA 2AL7A 1M66A 2IT1A 5K3BA 2O8BA 1GTMA 2FMKA 4YCJA 4C4TA 4F92B 4L9RA 1XZHA 4QYTA 4OI2A 2DMRA 2BGGA 2P2LA 3A9TA 1J07A 2O2HA 1WHSB 2AOUA 4PZDA 2H00A 4FR0A 4BNYA 4BQQA 1ADCA 3AVOA 3M82A 3QU2A 2ZKLA 5IM4F 6AT1A 4DLZA 2OB2A 4AG5A 4NXNB 2O0HA 1KYWA 1T3TA 1V41E 2AUTA 3D31A 3EWIA 3JYNA 4GLFA 4GT1A 5ARCA 1P44A 3E61A 3RQSA 2O4UX 4HT3B 1D2CA 1TADA 4LJLA 3VISA 3KLMX 2XGGA 4F2GA 4IL5A 3G2JA 2CD7A 3GFSA 4RX1A 1A04A 3KT3A 1D4AA 2XZPA 3GT3A 3UT0A 5DYWA 4EFMA 5JBQA 3EXHA 4DLVA 4FWBA 4R7GA 4JU8A 1UH5A 1E7WA 3AY7A 3DG9A 4IHQA 3JZMA 2XKKA 4EBBA 2V9ZA 2GGSA 3VC2A 1S6YA 1DV1A 3BVPA 4ZEMA 5JPCA 2QVGA 1RP1A 4AP6A 4CL2A 1II8A 4JITA 3IDOA 3GK3A 1EM8B 1Y3CE 1P19A 3EW9A 3AG6A 1PTKA 5KDLA 2QS9A 4JEIA 3AZPA 1CUIA 3F1KA 4F2WA 3NUGA 4BNLA 2ETXA 5FBZA 1BFUA 5CYPA 1BRTA 1PUJA 4WKGA 2EV9A 3G6WA 4NCKA 1J9GA 2PLRA 3ROXA 1OD6A 2FZEA 2ZYSA 1FDVA 3E05A 1N5KA 4LHEA 4P3XA 2IEGA 2X6TA 1JR2A 3OQ6A 3N8HA 1WEKA 1AKQA 2BFDB 3IKMB 3K1AB 1H1DA 3CUEF 5JTUA 5U9CA 1YKFA 3MXOA 5L4LA 1QJ4A 5KKAA 3B2EA 3UBMA 3LM8A 1F51E 2ZVDA 1D5CA 3LQ4A 2F9LA 3TSAA 2IDKA 5K45A 1XCLA 3QHPA 4ECEA 4WKCA 1UXHA 2PWZA 4BFXA 5EJ9A 2CEKA 3WK5A 1KU6A 1RHRA 3DONA 3NKVA 1QH8A 3LCMA 1PSWA 4FDVA 4REQB 2HQOA 2D2VA 3M0EA 1HYHA 2SKDA 2XWQA 4J1NA 4G5XA 3F9RA 1DL5A 1HL3A 3H3JA 2R1TB 4IQ8A 3DHVA 4NICA 4NU5A 5AMXA 1TQ4A 5HKAA 1R4NA 5IXYA 5K8TA 1GDTA 3LBAA 1HFWA 1WPGA 4UHKA 4WZBA 1HPLA 5JRZA 3RPEA 2H92A 5KVVA 4PSAA 3SJBA 3AUTA 4A6EA 2W9XA 2A30A 2C77A 3H42B 4LV5B 3STYA 2WJJA 4U4AA 5IAAA 3I62A 4Q4JB 4OK6A 3M9LA 2NADA 2X5XA 1R0WA 1E9DA 1O97C 3MOGA 4Q1FA 4PG8A 5A0TA 3OCVA 3P9IA 5F76A 3GLQA 3HFSA 3LA8A 4H31A 1ZS9A 4HO1X 4EKEA 3Q7IA 2C1ZA 4FDLA 5B3JC 5GP1A 4BNVA 1Z0ZA 2L0XA 3AG5A 2X77A 3IBTA 5CPFA 3VKFA 3IURA 2RHOA 5F5XA 4OX9Y 1X9HA 2VUTA 3D3NA 3BCSA 4QEKA 1RYYA 5EIEA 3MRTA 2JEYA 2H06A 2HPHA 2BH2A 4EIWA 2ZJ6A 4CV2A 1DBQA 1DRUA 1KAHA 3AL2A 4RVDA 2HA3A 1JDJA 1UQTA 1LVUA 3W8DA 2CV1A 4PQRA 1GP2A 1G8GA 5EZYF 2I33A 2JCSA 1M8GA 4G4GA 4YJDA 4KR7A 4R1QA 1G4UR 1XL1A 3EGVA 3WL5A 2QMUA 3WLRA 3VZPA 4FEAA 3H17A 5B7GA 4JJ8A 4PXAA 2Y1EA 2EERA 4PYMA 3MQFA 1JHZA 1SA0A 4F4JA 5L6LB 2LD4A 2RGEA 1SEPA 1TEHA 3BJZA 4HATA 4A1FA 2VXYA 5EMMA 4BMCA 3IEPA 3VH3A 3IVAA 1ODSA 2FF5A 1KDOA 2GPNA 3AKDA 3PJEA 4U1RA 1HOXA 1D2GA 5F12A 3S2FA 4C22A 3RIEA 3PPWA 4EHKA 4EOGA 4DJJA 1GA4A 1XKTA 3CIOA 1Q44A 3L0ZA 3N0WA 4CIXA 3WI7A 3PPYA 2CJWA 3VJLA 1QPGA 4XVHA 2OV1A 2YS7A 3DS8A 2OD7A 3A6GA 3CH7A 1NQOA 4I1PA 3EN0A 1AHIA 1B0ZA 2X5OA 3E5NA 1JIIA 3Q5EA 2HHHB 1SXJA 2VQEB 2UZ1A 1GFWA 2YZ7A 4PYQA 3V8VA 2EW2A 3AUKA 3UK1A 4E15A 4E6PA 3GDWA 5C51B 1GNRA 5FBKA 4OFZA 1EP1B 5E2IA 4QL3A 1FTQA 1C30A 2E4UA 3IV6A 3LUHA 1NDUA 4E5YA 3LNCA 3KD2A 4QXRA 1U3CA 3EARA 3A4MA 3O6VA 4K6HA 4AJIA 5DEIA 2JAWA 1SC9A 5K0CA 4DUGD 4FPXA 3OJXA 3P9YA 3UHFA 1J2YA 2BE9A 5DM4A 2NU8B 3OPYB 3RANA 1WXIA 1X42A 4MVJM 1Q3TA 3WTCA 4R8SA 4PYRA 3H8WA 4PZCA 1MB0A 4AQDA 3F1LA 4W5RA 5ED0A 1DG1G 1N5RA 4L8FA 1Q2UA 2WWXA 4WFQA 2GXSA 2CLOB 2QJTA 5FEUA 1K86A 3OAAA 3QH4A 5CEFA 5HM8A 2GHTA 1RJWA 4EVIA 3HEMA 3C1OA 4Y7DA 4YRAA 5ENVA 3ZDDA 1Z06A 4JLVA 4Y2XA 1N2EA 1QRRA 2X0KA 4YY3B 3MA0A 5GJCA 1QYRA 3TLYA 1IN7A 1PFWA 4XA8A 2V74B 3ZHSA 5BSTA 4JLKA 1ADGA 1WZIA 1EB8A 4FB5A 1XYGA 4V2IA 1YVDA 3AVTA 1JDBC 4KGZA 2ECQA 2PGOA 1ST3A 1MX5A 4CTOA 5E95A 4NG5A 1ZLYA 1V45E 3R20A 1R2QA 1Y6JA 1DX6A 2AMYA 3D02A 3UMJA 9LDBA 3OH8A 3W0LB 4BN4A 3L6CA 4K46A 5I7FA 2WTAA 1Q3HA 2G0AA 4GPTA 4IHJB 4XFJA 1ZCAA 5JJIA 2E4WA 4CMHA 1M7HA 4A2WA 2IH2A 1QFYA 3GFVA 3VNVA 3QEMB 3WB1A 4WCFA 3SLKA 2YMPA 1LB1B 4UXHA 3EVDA 4DBVO 3NS7A 3WOHA 1QO0A 5EZQA 4L22A 5CDFE 1VC2A 5KNLA 1ZRSA 2FWJA 4FOLA 4F3YA 4Q4DA 2V4MA 1AD2A 4Z9YA 4AC9A 4LF6B 3ZG6A 4JJIA 4MR9A 4GR4A 1GVNB 3H9GA 3C6XA 1RQPA 4RK0A 4F8JA 1BXRB 5C8XA 1ATZA 3PL5A 2RBKA 3NEPX 4KMRA 4R98A 5DWVA 3NIFB 3SZ3A 4CYMA 1UADA 5FD8A 2XNHA 1JIKA 3QW4B 3IO3A 4AS2A 1Y1LA 1UFKA 2NPIA 4MV7A 2GCOA 2WOOA 3NMUF 3QUQA 1YGYA 4A73A 4DY6A 4Y6SA 4GYKA 2R6R1 3FMGA 1HUQA 2IBSA 1GAXA 2GF0A 1ECPA 4G5RA 4JYPA 1TZJA 5HQ3A 4OHYA 1UWVA 5DBHX 4EHDA 3DL4A 3P5BA 3OQ1A 2GA8A 1RBZA 3RKSA 3EPPA 4EF5A 5I7WA 2X19A 5JAUA 1C1XB 4LGVA 1VSUA 3TSCA 3F4BA 1EA5A 1TC1A 2IYUA 3EVBA 4J75A 4MP8A 3G9TA 4OXKA 1CUEA 3OPNA 1EFAA 4X24A 2F8TA 2GZSA 2OO7A 4HQNA 2WM8A 3G5UA 5G0TA 2BEKA 3ZOKA 2SNIE 1TVEA 2IK8A 2I4LA 3HCCA 2OKCA 3JQRA 4UQOA 2EDCA 5DP2A 3SHQA 4YJFA 5EJAA 3H0KA 4R6XA 2O2XA 3RV4A 2Z6UA 1ZM7A 2QM8A 2XDYA 4MW1A 3FPBA 4WESA 3NT5A 1IZ0A 4MR8B 4D79A 4GMDA 4I9UA 4K0KB 4LNUA 4FZJA 3EDRA 1SD1A 4NABA 3CPHA 4OHXA 2OWDA 2WJYA 5FUWA 2RGNA 2CXXA 3VH2A 2ZFUA 2PUFA 4LAFA 2ZSAA 1M9NA 4D9HA 3T3IA 1QIFA 3K9WA 1V9SA 4JEHA 3GIDA 3MERA 1W36D 3UT5B 5BSVA 1JHOA 3HUDA 4CKYA 3IHWA 5DNWA 3FWKA 1T43A 2QV0A 2TMGA 3LYAA 3NDRA 3PFWO 1WS6A 4Z99A 2ONJA 3TWOA 4BZWA 4UPEA 1T4DA 5DBEX 2XMZA 5IN5A 1FFSA 5BR7A 2ZIZA 4XCVA 4EGJA 1GUBA 2Z0MA 3PU6A 1CJKC 4N0EA 2A0YA 2PD6A 1NLMA 3IAEA 1GAWA 1RXCA 5IEJA 1C1DA 5AI0A 5BV8A 2WTXA 2OQ2A 4BVHA 3ZDFA 3PEWA 4PAGA 4CN9A 5ALKA 5AJWA 3WMWA 4QD3A 1FX1A 4RK1A 4Q15A 1E8DA 2E6KA 3SQNA 4ETMA 2H1VA 2XVYA 1NI3A 1U3UA 3EMKA 1L5RA 1EH5A 2ZRFA 3IJRA 3EZ9A 4OSPA 1EFHA 4NPCA 4ZVTA 1XWFA 2XSZD 4QUIA 3ZY4A 5COAA 3P4XA 1DAEA 1HL7A 3CZ9A 5B6JA 1TX4B 3DM5A 3KKEA 3ODPA 1L7BA 2OQVA 2CK3A 1K3UB 5D84A 3EVZA 3KQKA 2G9NA 1OZ0A 4MB6A 4DM3A 4GBGA 2WOJA 4EABA 4KQHA 4AWBA 1THTA 5CHYA 5KDOA 4WFIA 3VVCA 4D8YA 1LEHA 5HP4A 2JI8A 3BSWA 5GAJA 3DR3A 3K6SB 3PI7A 5JT1A 1G8PA 1G8SA 3W5CA 1PT6A 2Q5OA 1M2FA 2Q6LA 2RGYA 3LL7A 1MFZA 4LSWA 2PWYA 2QOEA 4Y3UA 1SCUA 3QKTA 3QVOA 2P4EA 4J90A 1MUUA 1KYYA 1M2GA 1NJSA 2BRUA 2ORIA 2IIQA 2QX7A 4P0QB 1T2EA 2CMGA 2ZREA 3C4VA 4D9EA 1MQ8B 2AOWA 4P2BA 1K8ZB 1LLCA 1BMFD 1YFZA 2C59A 4KUEA 1OHHA 2OBLA 1JEDA 1R0RE 3FJOA 4M86A 2Y6VA 3MAGA 3ONFA 4RSHA 4DCJA 4ZVLA 1A96A 1Z36A 3KTDA 4HQKA 4XB1A 2PBZA 1CR6A 4ND8B 4PX2A 4RM2A 3ZUGA 4BV9A 4YRQA 1TF7A 1ZAYA 4TZTA 1DCMA 2OXIA 2C9CA 1ZONA 2ZWAA 2P0YA 3TDKA 5IZCC 1F2DA 4QTZA 5KMGB 5T41A 3KSUA 1TTHA 2VZLA 3CG0A 2CJYA 4DQDA 3VU0A 1GAJA 4X20B 5DSXA 4MMYB 4K9NA 3TRJA 2Z30A 3TZBA 2OBMA 4MRNA 3Q85A 4E12A 4AZ3B 3C43A 5GZ3A 1PHPA 1PYOA 4NAVA 4BKRA 2HQSA 1VBFA 1XU7A 3ZE1B 5CW2A 3U9SA 4F4FA 1GG2A 3U37A 1WB9A 2RAFA 1QWOA 2V45A 2WAAA 1BQ3A 1YOVB 2XUGA 3OFNA 4NVRA 4RY9A 3TDMA 3AH8A 3BE4A 3I8XA 4M98A 5D1HA 2O8EA 1VLVA 2ODAA 3FUWA 5HBGA 4GSYA 4V0MA 4M1WA 3AMVA 4XDHA 3BQNB 3FLAA 2HYDA 1Y6ZA 3PUWA 2C04A 1RVV1 2V7TA 1YS6A 2WIBA 1GTZA 3H2SA 2GF2A 3M1YA 3T5MA 1LV8A 3I6ZA 2GJKA 2YMQA 4NS4A 3WLTA 3REGA 3UMGA 4IH9A 3ZWOA 1T4BA 3COVA 5DX0A 1T2FA 3HSYA 4HDMB 3SF8A 1GEGA 2COUA 1V1MB 2RK6A 4JN6B 3P9QA 4DCUA 1G8JA 2ZSUA 2RHJA 3N05A 1TUBB 3OECA 4GLLA 1CX9B 1Y8ZA 1E92A 2VBIA 4BLWA 1Z82A 2OBFA 1JKIA 1F6WA 3QPCA 2OUIA 4GXNA 3BGIA 2JFZA 4G97A 4IXMA 3MOIA 3K0CC 4E22A 1SKAA 3WJ2A 5A5GA 3NX4A 3SX4A 3AVYA 2C00A 2BP7B 4IMPA 4EJ2A 3VYSB 4KIJA 2RK3A 1XHFA 2BFNA 4DV6B 4J3JA 4JKIA 1JF8A 2ZGVA 1I7DA 4ID9A 2C5SA 1Z4IA 3ZD6A 5H8WA 1YD7A 2X4GA 3KPWA 3OZSA 2P2GA 4D3SA 5A9SB 1JB1A 4QYIB 4KACA 5KWSA 4OHVA 2FSUA 4U7PB 2LXNA 4N1AA 5TR9A 5L4NA 5LDDC 3H2JA 3NOXA 3DPIA 2HNKA 2FNAA 1UFRA 2GD0A 1JSZA 5MN5A 1Y4DE 4R01A 1DBIA 4MJ3A 4OHOA 3JRXA 3UMMA 1XDSA 5A6SA 4OP2A 4UAJA 3GRRA 3JALB 4I5EA 4WPGA 4ZAZA 1IXRC 5DTMA 1QZZA 1G5IA 5AK6A 2BBTA 4A03A 2XXAB 2C98A 5ALHA 3MWLA 3FUVA 5B3JA 4MUBA 3AM1A 2YQZA 1W52X 3WHLA 3BWEA 1RVDA 1HNNA 1HF3A 1OKKD 1SOAA 2G36A 2VDNB 4BAGA 4C76A 5JVDB 5HHTA 1YS7A 4OYLA 3ST7A 4PF1A 3DE6X 2DUJA 4G9EA 1XA0A 2Z43A 1GQQA 1OIXA 3MGCA 3N6RA 4JHXA 4GX5A 1Q0TA 1FUEA 1PUXA 4X1IA 2Q6VA 3F96A 2GUWA 5A62A 2FUNB 5CD1A 1GN8A 4NH0A 4MPTA 3T9BA 3TX2A 1M76A 4EARA 1GFIA 3BFPA 3PCXA 2FQQA 2CHFA 3JX9A 3PHHA 1BD3A 2IXEA 2ZCUA 4JQCA 4QJ4A 4V2UA 1PL0A 2AFHA 3BTOA 4JBGA 4RA9B 1P7YA 2V5AA 5B3AA 2I3ZA 3CY6A 5G2OA 1P7ZA 1WW2A 2OKGA 4ZMSA 2J07A 1UPCA 1SBCA 5CNMA 3BDVA 3VPHA 3WXMA 4A6DA 4DCSA 1J21A 2C95A 1JTFA 4GI1A 3WIUA 1MH9A 5EMHA 5DFAA 4LRTB 5HG0A 5EPEA 1A98A 4C88A 5FTLA 4JH0A 3CPSA 3IP8A 4BWGA 1YB4A 3PQ8A 3SDZA 1ACLA 3CRRA 3HP7A 4DG8A 2QZ4A 4MJ7A 3WYDA 1YGPA 3ADDA 2RH5A 5I5GA 1A2OA 4S3MA 2PGAA 2PJUA 5FLXA 1IXYA 1N9GA 2QI9C 3HHEA 1QRAA 4J16C 2GYVA 1LFDB 1Z4PX 1JR3E 1F14A 4EQ6B 1LU9A 2VSOA 1BHO1 1B15A 5FPTA 2HA0A 3M6IA 2IY8A 5JVDF 4K6FA 3O4FA 3PD1A 3U49A 1I2CA 1XL0A 4EYGA 6ADHA 3Q7RA 1AV6A 5SYAA 2BDTA 1NUPA 2G08A 1E7RA 1PKXA 1PGNA 2ANCA 1F9EA 3A1UA 3TQHA 1M8PA 3VR3A 2GRJA 5JD6A 1MHTA 4GPZA 3B1XA 3FVVA 4OGFA 1PI3A 2SCUB 4ZOEA 1UJ4A 4MIOA 1AGPA 1I7LA 2DWCA 1GG9A 4AO8A 4IGEA 4PAOA 5I9MA 3UHAA 2J59A 3MLEA 3RG8A 4EA6A 1GV0A 2P7HA 1XDUA 1LNSA 2ATEA 2D74A 3A6DA 4IVRA 1NWCA 3GJ3A 3MIIA 2CSXA 1YHZA 4E5UA 3E03A 4UPDA 4DCOA 4ZCMA 5I3ZA 5K0ZA 2R7NA 1UBOS 4CLRA 4MW6A 4RF5A 4OJYA 2XYQA 4IHAA 2FUG1 1W1IA 3E7PA 4JI1B 2BBOA 3MIZA 3ZWAA 4DXHA 4EUHA 4EHJA 4MP6A 4QARA 5T4EA 1EAMA 1YK0A 1QIGA 4NJEB 1ODIA 2H31A 4KN5A 5CAEB 2V7QA 1BDMA 1D5WA 1P8AA 4MI6A 4QQRA 4LZZA 4C01A 5BW4A 4FNGA 2KE5A 2V7BA 4D9CA 4TTSA 1NKSA 2C8LA 2OSVA 2WJAA 1GUFA 4MI1A 2MSNA 5D01A 3BMNB 1NVVR 4MVJF 2G9UA 3TFOA 1B1AA 3HWWA 3TW4A 5CX1A 5HDQA 2O3RA 2C9DA 2VCHA 1SCKA 5CB0A 5IBQA 5IKMA 3O82A 1OC2A 2C31A 3K1YA 4IJUA 3ZVMA 2VSQA 3KO8A 3M6LA 5LMUB 2OCGA 1GPH1 4CM3A 3TGPA 4RTJA 2HMSA 3A4YA 3WIVA 3TGWA 2QRVA 3PCTA 3KB1A 3GP5A 1EGVB 4CMCA 1BRMA 1PEKE 4IVQA 1II9A 4ASUD 5I8WA 3OD5A 1Q0UA 3B38A 3N8NA 2AV6A 1JVBA 3PICA 3A32A 4EO4A 1IXSB 2VWQA 3DAGA 1VA4A 2I7DA 3MNFA 4LC9A 2R8BA 4ZQHA 4C6HA 4KAJA 2GXUA 1PYGA 1KNQA 4Q7KA 2QBYB 1HQDA 3R7AA 3R9IA 1GUYA 3GLFE 3W8EA 5C5EA 4EFDA 2DERA 1E3TA 3OPQA 1LQTA 1PS0A 1CF9A 2JZCA 4XX0A 4LY6A 4DA6A 5FWYA 3L4BC 4CV0A 1AE1A 3NCHA 1YVRA 2WWIA 1JMKC 4QVGA 4P3YA 3L8DA 3EQ6A 3R24A 5FBWB 1YZGA 1KSHA 1MG0A 2BUBA 4EZEA 1MAVA 3QYPA 3ROEA 3GARA 5L3QB 4I6EA 2P9QA 4NV0A 4UJ5A 1G64A 2FZWA 4YCDA 4BLRA 5DCUA 1A4RA 2EZ4A 4YIHA 1FXSA 2ERXA 4GQBA 1J0XO 2PXAA 4K9LA 4LQCA 3QLVA 1SVOA 2C0CA 3FH0A 2CNDA 3NORA 4MRSA 4RHUA 4BFVA 4RHTA 1PR0A 2F43B 2ZXEA 5ENZA 1P2VA 1VA5A 4TN5A 2CXPA 4C4SA 4W5HA 3SK0A 1XMQB 2WE7A 1J99A 3DR5A 5IVIA 1CJVC 1UBFA 4O25A 4YT2A 1RQGA 3EF3A 1UIMA 1Z0AA 3BH6A 3C3MA 3GLVA 1ZKMA 4KKVA 2EX4A 3AZOA 1QHGA 4WY2A 5KAPA 3S8YA 1JR6A 2DQYA 1Y6FA 1Y3FE 4GOND 3SIPA 5CVUA 1D4FA 1FZQA 3W3AA 1LDEA 3AEUA 1L5YA 1VDMA 1TAQA 3T7EA 5IJZA 2WWFA 3CLUD 1NW3A 2N3ZA 5ECGC 1IBSA 3DA8A 3W05A 3HA7A 1SC3A 2Q1YA 3Q9UA 2PTHA 4ILEA 2YC4C 4PGMA 4J6FA 2FH5B 1EBBA 2XVMA 3NGLA 1P2BA 1I14A 1KSFX 2Z3WA 3QYJA 4NMWA 4NRDA 1HYEA 3RJTA 2CKMA 1R0XA 4K81B 3ADOA 4M1EA 3LQRA 1Y48E 1EFPB 2H7XA 1WU8A 3PXEA 5HGXA 1ODCA 2ISQA 4JQOA 2NZ2A 4IOKA 5BSWA 2HYIC 3OPVA 3MOSA 1K7EB 2XB8A 3MTQA 5H5JA 3TVYA 1ODFA 4KXXA 3IL2A 2X4IA 4J76A 1IPEA 3F5MA 4LHWA 4ZVUA 5GQSA 5I7AA 5TMPA 3FKJA 5AVVA 1CZRA 1CUAA 1UXJA 2P5YA 3RU3A 3T52A 1Z4JA 2J5RA 3PNMA 1I30A 2WSYB 5KYNA 3QLTA 1M74A 2EJUA 1RC8A 1NTOA 4NYMR 5J2TA 1O6ZA 1Z6XA 2NW6A 1JYFA 3IT0A 3EZNA 3WXBA 2ONYA 1E6LA 2R2AA 1GRVA 1X1BA 1GHTA 3EZLA 2WJPA 1CVRA 4BN5A 5TARA 5IC6A 3W4KA 2OYCA 5EXTA 1N2CB 3HLKA 2WLTA 2H07A 1IEWA 1BGVA 3KYCB 1KJWA 1NFFA 3IKVA 3KIPA 2YDXA 1P4JA 1WXHA 2HQRA 3B9BA 1WCIA 1LZLA 1E59A 1BA3A 3BJRA 3KHTA 3P9NA 3IFSA 4CCYA 1E1CA 1EUYA 3K6JA 1SGWA 3W7AA 2PPLA 1I5OA 2AG6A 1DEHA 3FKSA 2ZDHA 3ZBTA 1E69A 5F4BA 2QJRA 5FAKA 4CVNA 1H6AA 3T41A 1HY3A 4A9AA 4KU4A 3Q9LA 3SR3A 4B71A 2B8NA 2VSYA 2YUTA 4EYOA 3TZLA 1KVRA 4U6NA 3Q3EA 5SY6A 2WM9B 3LDGA 3C3YA 2O2YA 2Z2IA 3HHPA 1HRDA 1EWRA 2YOFA 4XJXA 1D4OA 1JP7A 2O1XA 4GEKA 3PWSA 1XDDA 3M4YA 4AG3A 4U7TB 2PQ2A 4C29A 3ONWA 1XIVA 4YS6A 4M9ZA 2NQ2C 1NJ6A 1DJNA 1E2FA 5HE8A 5BNWA 3AI1A 2G8LA 3JAWA 1QQBA 5JI2E 1NF3A 3HKCA 3BL6A 1KH3A 3GPCA 4IDPA 4KQKA 3UWPA 4G81A 3D3WB 5EXEA 5LMCA 2PJDA 4YMUA 4Z4IA 3DLCA 2COKA 2G6BA 1DAGA 3GAAA 4OMUA 2FLWA 5IF9A 2GAJA 4TYPA 3LI2A 4G1CA 3PEFA 3FNBA 5A4IS 1S1MA 2YQ5A 4MW7A 4EJSB 2OL4A 1M83A 1QVAA 3PIIA 5I4CA 2RBGA 4BZPA 3DJYA 3ILSA 4GEGA 3M9WA 3OJCA 1F20A 4NOMA 2B2CA 5HKOA 2B83A 1JPJA 3HO1A 1NURA 4CTNA 1K06A 4V1CB 4S0XA 1KPHA 1J2TA 4GX1A 7YASA 1XEWY 2IW3A 2Q0XA 4L4XA 1Y6QA 5GPBA 1ECBA 5LD2C 1E3WA 1W96A 3REFA 3H18A 1NBOA 1TA9A 3BCRA 1Y9ZA 3K3PA 2XAAA 4QICA 4UKDA 5DV9A 4CMGA 1KVTA 1HDXA 4Q00A 1E2BA 4ZDIA 3FB4A 2H2IA 4B3SB 1Z2NX 2ZRIA 1OA1A 2FOIA 2GZMA 2HCFA 3FW1A 3MGKA 4ZOLF 2SKCA 3CLSD 5LB4A 3WK7A 3ZE0B 1YVPA 2BFFA 3EEQA 3CE6A 5EZSA 5EIWA 4OHBA 3H65A 4FYMA 3SYLA 2O05A 1FDOA 4NK5A 1PS9A 2PIAA 2J9XB 3H2KA 2GR9A 2HSZA 1WLSA 3QF4A 4L4SA 4ZVOA 3PGA1 3FWZA 3ZKWA 4NFHA 4DDTA 3JR7A 1JEYA 2NU9B 4NOLA 3V4RA 4MS3A 1Z25A 3GD5A 3CF4G 1SKYB 2IZOA 4O2AF 2D1RA 3C85A 1G21E 2B82A 1I6MA 2NO4A 2WKSA 4KH1A 5BUQA 2YJ4A 3BB1A 2PEYA 3EEIA 3LHFA 3TXXA 5BY2A 3ENNA 1WCV1 2ZRBA 2A14A 2DGDA 3I2JA 2C4VA 4YA6A 2RGBA 1N2JA 3KZVA 4BVBA 3RF6A 4ZYXA 2JJQA 3EZFA 3JATB 3BD7A 5LQRA 1V6CA 3QFRA 3R3UA 2Q29A 5EG5A 1EK1A 4X6UA 1Y42X 3O95A 2NYVA 4YJ2F 1HK7A 3JWIA 2ZRNA 3PENA 1R5JA 5CK5A 2F1KA 3KKMA 1LF5A 2X9VA 3KHSA 4BB6A 1BHSA 1FPMA 2WY2D 1KI6B 3ORQA 5ALIA 1IL0A 4ILKA 2VYND 1SQ0A 5EJGA 4Z0HO 4RY8A 4KW7A 1TCVA 4RLFA 4UXJA 2PQ0A 2WP8J 3LTEA 3ZZMA 4AYXA 1QX4A 4GPEA 3I9V6 4HGNA 2OV2A 4KAXA 5EP2A 4ZYTA 3FYCA 4FCVA 1YACA 3EA5A 1A9ZA 3PWZA 1SVUA 4F4IA 4NLLA 1E2LA 3ZWVA 5DHTA 3K15A 3BZWA 1N9ZA 2F1OA 3FFTA 2IU4A 2YIDA 3H1BA 4IVNA 4R1MA 3WKAA 2X86A 4B34A 1AUOA 1GWNA 4D97A 2ZEJA 4MUJA 5E7MA 1JALA 3I34X 3L7DA 5F1OA 1G42A 1U9CA 3EMVA 4EO7A 5G1PA 2WPNA 4URZR 3V42A 2IVFA 3I12A 1NVFA 1DBPA 3TUJC 3DZFA 3ZS9A 4CEJB 3RVOA 1MGPA 1LDMA 1XX6A 3RD5A 2R9VA 9ATCA 5KKNB 2AC7A 2JLSA 1J97A 1U90A 4KYUA 4UTOA 1QQ6A 3QUAA 4YASA 3VAAA 3F6SA 4XVRA 4TZKA 3U39A 2CLMB 1SQGA 1VPEA 1KO5A 3CSUA 5K1ZA 1SJ9A 1Z12A 3WNVA 1Z68A 3TUZC 1CUZA 3CGWA 1W2GA 2C42A 5A06A 1EK2A 1RQ7A 3IQHX 2PRJA 1M7BA 1G3MA 3E5RA 5ENDA 3SNHA 2AJCA 3ZE8A 1Y6GA 2AZXA 4EPWA 1EPUA 4QAQA 3WJ7A 3QRWA 3AI2A 1GKLA 1ZVMA 4MIKA 1ABFA 5D6OA 4WNIA 1U0JA 4EPYA 1Z4NA 2WHRA 3JQ8B 3L6BA 5DI3A 4QNMA 4UTXA 3TLCA 5EXXA 4EAAA 2HKIA 4ZYYA 1K63A 3RC8A 1E2KA 3UF0A 4KCGA 3TMAA 3CC8A 4MVJP 5TQ2B 3O8QB 1QS0B 5BO5A 1QIHA 5AR1A 3IXLA 4RSMA 4V0SA 3PC4A 3LCUA 2OXFA 1B41A 2EZ8A 3WRWA 1L4YA 2GB4A 4WECA 1G98A 3QSGA 3CXUA 4A8JB 2HLDA 5U1PA 1XZBA 4UQLA 2GPTA 2UUAB 1E5QA 2YZKA 3IERA 3VI4B 4B5KA 1E58A 3F6YA 1VJ1A 2IHZA 4M60A 4LQLA 3U3KA 2I78A 1P1JA 3LGSA 4GOJA 2W7TA 1X1DA 3EZ7A 5LU9A 1KFCB 3FDZA 3T61A 3D4IA 3NBYC 4WOJA 4PHCA 4UEOA 4Y2UA 4E11A 2FWMX 3S1LA 1UK9A 4RY0A 1OT5A 1YIOA 1UZLA 4IVPA 3LO8A 4M1OA 4UCQA 2E21A 4ZV7A 4ALIA 5DGIA 1BYIA 1GRQA 2HQ1A 2V55B 1YVEI 1KERA 1PNOA 4O2LA 3WG9A 1ZH4A 1XRPA 1BVYF 4G0MA 1OI3A 2QRQA 4G89A 1W36B 1GPKA 5GONA 4UEKA 2CXNA 4X63A 4F9GA 4DV4B 2YWBA 5KNBA 3GHHA 2JIQA 1JL3A 4IIJB 3ER8A 2W70A 3R23A 1ISGA 2R97A 1M6VB 3H6KA 4F2HA 2PH5A 4D5GA 1KZ1A 4US0R 2B4KA 3T3HA 4E5NA 1J8FA 1JI0A 2C3PA 5AW6A 3WMFA 1XZPA 1NUSA 1P2GA 4FYXA 4HNGA 2I7XA 2Q50A 1ABBA 1CF4A 4DSOA 1SWVA 2CNKA 5ALLA 1PRYA 3QQ5A 3EVTA 4I1OA 5DCWA 2PX3A 1S89A 1OBOA 4H77A 2Q9CA 1RMQA 4PS0A 4EDFA 3MBIA 2IUTA 1IQPA 3WLMA 1ZN9A 3NHPA 2NUPA 3SNKA 3BMOB 3ELUA 4KUGA 1SO8A 1V8DA 3AC0A 3ES9A 4MYUA 1EG2A 3F8SA 4BRWA 4OV6B 5LZ7A 4ZVRA 1KI2A 2BM9A 2ZJAA 5D3KA 1NRIA 4HGPA 2M1XA 3S28A 2VHYA 2BMWA 2WG1A 3IH5A 2FN7A 3QU4A 1T5SA 2ARKA 2JNWA 4AVYA 2HW8A 3R4CA 4G36A 3RK0A 1H0HA 1Y0BA 3E3OA 2Q7OE 1WDLA 2A3RA 3RM3A 1V16B 3BKWA 2QZJA 4ABYA 1DS6A 4ML3A 2AMLA 2FSGA 4FVTA 2X9NA 3FNGA 1P1RA 3HXKA 4PQFA 3RC2A 3ETCA 1FS5A 2CN1A 2Q62A 3DTYA 2HAEA 4M1TA 2YNMC 4H6VA 4L3OA 4A1OA 1WUTA 2X2FA 1YBHA 3M4ZA 4RIHA 1AF4A 4BP9A 2R96A 5J4KA 3JASB 1DJOA 5JJLA 1NYLA 1ZK3A 1ZD4A 2GX6A 3BT7A 4ZOBA 1K9VF 1SUFA 2BMEA 4U39A 2EZ9A 4ZOAA 1OBVA 1C4XA 2BLLA 2OAP1 2IP2A 4M0MA 1WKVA 2G09A 3RIMA 4QZVA 2QP9X 4FYKA 5HMMA 5CYGA 1EBFA 3Q3VA 1NR5A 1UK7A 3BOSA 3JWHA 3K0AB 5EWMB 5H80A 4TMXA 4BE9A 4PTZA 2B1RA 5IKEA 5CTAA 4O29A 2V1XA 4MKZA 2PH1A 3UB2A 4H35A 1JZTA 4O1MA 3HNOA 3K1JA 5TGTA 2HPAA 3SJCA 5JUWA 4AXXA 5JDCA 1E2DA 2JFBA 3IAUA 1J70A 4W1SA 4EYSA 1E62A 1JECA 1CF2O 1XMVA 5CP8A 4QATA 4YNBA 4BMVA 4OX9B 1MF7A 4HUQB 1VMKA 2BGNA 2WQZA 5BSUA 4YUVA 3WJ1A 1DC8A 3ZDBA 4D42A 1QHXA 1JLLA 1R4MA 2WYHA 3L6RA 4IW3B 2Q07A 1AGXA 1NY5A 2P4UA 2W6QA 2WFLB 1AS0A 4X84A 2F48A 3LT2A 4B17A 1R8YA 1PL7A 1M1UA 3H83A 1QCCA 1D1PA 1ZNXA 1SCDA 4KJXA 3ZDCA 1OB5A 1M5UA 3JQCA 3RRZA 4JBHA 1WQ4A 3D6JA 3Q2OA 4Q0MA 1WSWA 1AKTA 1KMQA 3MSCA 1J1ZA 4I1IA 4KPUB 3U3JA 5HVNA 5JO0A 2OBXA 4QQ8A 3ESXA 1EFKA 1K8RA 1ZC3A 3ZZTA 3AEZA 4JGBA 4G09A 4JS0A 2CMKA 4DL9A 3TN7A 4MVYA 2XWJI 1M1NB 3UGQA 1HDCA 5IF3A 1HURA 2WI8A 2ZE6A 5F2KA 1YI1A 1U5BB 1RRKA 3QE3A 4ZFNA 3M70A 2C94A 2RHBA 5ER6A 3W5UA 5DULA 4D6PA 4OBBA 5JHHB 1NHGA 1M1YE 1ZSNA 5K51A 4A7PA 3F4LA 3KSRA 2H52A 1EGAA 1GYPA 3KB8A 3GJ8A 4UZEA 3JQ7A 5A71A 2P1DA 1NUHA 2D4AA 4HX5A 1SULA 2Z8ZA 1XQ6A 2OORC 2GPSA 3C3DA 5REQA 1KBZA 1C7QA 1XRRA 2ZVQX 1RXIA 2R7LA 3D8UA 3TTXA 1AUXA 1K6IA 3WMGA 4DR2B 2I4TA 2QIPA 4HNAB 4ZYWA 5B4UA 1XD2A 3GLUA 2A6PA 2Y1OA 2YZGA 1H05A 1W75A 2KX7A 4M1KA 1CLEA 1KBOA 1X8KA 2P9BA 5FV7A 1IY8A 1SUWA 3CPJB 1U65A 3FAKA 1U8YA 2IS1A 4URVR 4B3TB 4ZJPA 3EJ6A 1JQLB 1VXRA 2CEAA 3SZUA 5K3SA 3UV7A 1ORDA 1M2EA 2JBWA 1JSLA 4IO0A 1N36B 4IJVA 2H8GA 2PUHA 3BMQA 1PE0A 2ZU6A 3K0BA 3RRNA 5JFOA 4TMYA 1A8UA 3GDFA 1KAOA 4RL4A 3I23A 3V1MA 3AVVA 3L92A 2BYTA 2FDXA 4FYYA 4TMFA 3I5AA 1X1TA 3CH5A 3CX3A 2VYVD 4HLDA 2CYAA 3RABA 5HKBA 2XB9A 1P74A 4IG9A 3C5EA 3VKWA 4AY5A 2ZM6B 3GPLA 1SC1A 2QL7A 3GX1A 4AJ2A 1L4KA 5AI5A 1Z0FA 1NZFA 5B1HA 1SXJD 4LDJA 4OMDA 2EGUA 4Q6WA 4MRMB 2WZBA 3A1WA 3LIPA 4YJKA 1S5PA 1G5TA 4HLCA 2BJWA 4XWWA 3G2PA 5IUKC 4NFLA 2BSQA 5IKPA 2IYFA 1G5RA 4MW5A 5JS1A 5T3YA 4XKJA 5IAEA 3NHFA 5JFTA 2IYWA 1WULS 2R48A 3NNDA 1MABA 4OO3A 2I2CA 1E64A 3IVCA 4X71A 5J1TB 3ETDA 4C0HA 5BV1A 7GPBA 2F7SA 3TAXA 2I8LA 4HDSA 2JC3A 2ZUWA 4U7JA 3T3EA 1KKMA 2I1QA 3R3HA 2WU1A 4G24A 4CMIA 2HJRA 4S1PA 5EP3A 4IXDA 2FFJA 4L0QA 3E9QA 1FTYA 1U8UA 1VYHA 1BXGA 2QY9A 3O2SB 4QQFA 4K9SA 4E46A 1TCBA 3UQZA 4U7DA 4OBWA 4RKWA 3DPUA 4NZMA 3DQPA 1O8BA 1Y9AA 1RBYA 1F6BA 4W5JA 1NJGA 1YB6A 1G2IA 3SZLA 1NLUA 2B8TA 3QMVA 4YT4A 1VJ5A 3N2KB 1L3CA 1K75A 1QRDA 3LUFA 5I4IA 4N6NA 1W7AA 3O0DA 1T9KA 3TVTA 5JS2A 5CA1F 5JXIA 1US8B 1RYHA 1ABEA 3AERA 4G1BA 3IUMA 2BC9A 4A2PA 2VDUE 1QE0A 1KWGA 3CF4A 2IYPA 1T5IA 1PQUA 2ZI7A 4OVKA 4MB0A 1AS2A 4TT8A 4A4DA 4F3RA 4RETA 3NDBB 4DC1A 1P7CA 2VWPA 2XV1A 1ZG3A 4MPRA 1G5HA 3RYFA 3RS3A 1GPNA 1QO0D 5IDWA 5JIBA 3KOZA 4Z6KA 4LF9B 4CKZA 1DAIA 2PS0A 1GGEA 1RXUA 2J45A 2VDMB 4YAFA 4CKBA 2ZM5A 4UM9D 4JJ4A 4N5LA 4HP8A 2I2AA 1ES9A 2RIRA 4RWZA 5E3JA 1E1DA 3TTYA 2MTBA 5CIYA 1M5TA 4XGIA 5FQOA 4ND6A 3BYZA 4P86A 1MP0A 2HO4A 4Q9NA 1Q91A 1GTSA 5BSGA 4DA9A 4EKIA 3LZDA 2DFTA 1GNVA 5E1MA 3TJZA 5K01A 3DM9B 1EB9A 1NQAO 1TF2A 3AUUA 3EEOA 1AZTA 2ZSJA 3AIMA 3NVDA 2QRLA 5AIAA 5FF9A 3QVVA 3W5HA 4XTCS 4TV9B 4BASA 1U2SA 3SEAA 4BYGA 1QYIA 3MCZA 3PTZA 5I45A 1EVJA 3E7DA 3NHUA 3SKYA 2CNLA 3PQCA 3A1NA 4G37A 4CM8B 4DNFA 4DYDA 3OJLA 1QZTA 1K68A 2MJLA 2ZSBA 3H11A 1GO2A 2WRZA 3IVRA 2NZVG 4DZRA 4QGSA 4IS3A 1NHWA 1VJGA 2BDUA 3GPIA 1E2HA 1JE0A 1EWVA 1UXGA 2ZRCA 4X54A 3ZHTA 4RVCA 1P4SA 5GZ1A 4Y2QA 4P58A 1LA2A 2QAGA 3EXEB 1P3JA 2IZZA 3RC7A 2J0QA 1G6HA 5K0BA 4AY6A 3DYVA 4MPPA 1WSAA 4G07A 1KY4A 2GNOA 1BXKA 4CRWB 4JEMA 2PLWA 4M0DA 1EP2B 4JT4A 3EZ6A 3NHYA 3AIKA 5IHPA 4A0HA 2RFLA 2CFTA 1QCYA 2HV9A 1QOQB 2VT7A 3RUDA 1TLLA 5DNAA 1Z16A 1Q7CA 2J0UA 4FFSA 1RLIA 4WN3A 3RVBA 1QGUB 1NW9B 1Z17A 2H4ZA 1I7PA 3B5JA 3X2SA 3I2HA 2BFPA 3E70C 4GP9A 3CZ5A 4OLFA 2GJ9A 3C6ZA 3M6XA 4Q4LA 4RFVA 3VOSA 4GI2A 2J9YB 1SQ5A 4UUNA 1USVA 1QYWA 4MGEA 4UE2A 3W7BA 5EJ5A 1PNRA 3P71T 2AWNA 3TNLA 1ULSA 4C4RA 4U2BA 2RC5A 3CX6A 1BKDR 3KKOA 4FFLA 3TNYA 5EQTA 4R1TA 3CW9A 4MX8A 2WQ7A 4K0RA 3O8OA 4QPDA 5J2UB 3R40A 4DHEA 3IUPA 1QCDA 2PFSA 2O8CA 3AGPA 1WIWA 2YMMA 4OPMA 2IELA 5TF0A 4FN5A 4BO2A 1O95C 4D4JA 1Y5IA 2L42A 1FMLA 5FBHA 1GZUA 3C1TA 3C87A 4DAOA 4EP1A 3GA0A 1XMJA 5CLLA 1N6LA 3GGOA 3CKMA 1ML3A 3TQQA 1SQ6A 1XZLA 1GNPA 2RHDA 4URYR 3R75A 5KEIA 1Z0JA 1C3EA 2HEIA 1JHUA 2ZUVA 2XT6A 3F7MA 4HX2A 1B8NA 2COEA 2CK3D 1IC6A 4RF3A 4LZJA 7REQA 2H18A 2GESA 1HFKA 2WUFA 4U2EA 4LF8B 4YWJA 4Z4EA 2R1VA 3FPAA 3H8VA 2AT1A 4G8JA 1L5QA 3UUGA 4OYHA 3P19A 4B9EA 4O2BB 1XBTA 4IJMA 3FMPB 2PGDA 2GD1O 1OXUA 1FYEA 1YVUA 3P8ZA 4MI9A 3ZGZA 4E70A 3CKLA 1C2TA 1TIPA 1LLQA 4V02A 4AKSA 2NU7A 3DE7X 2ID7A 1UC8A 4JUIA 4C0QC 2A8YA 1O4VA 1PZXA 4HB0A 2FLKA 2X6RA 1AS3A 3IMEA 3KTFA 3VSEA 4ALKA 1QO9A 1TQ2A 3EG5A 4BGUA 4QDJA 4X00A 3QM1A 3IP6A 3HBLA 1O5IA 3A2LA 2FB9A 3GJSA 4DT1A 1TECE 2V3VA 4WMLA 5JEDA 2A88A 1QRUA 1JDPA 1N1MA 3RS0A 4BGEA 1TCUA 3PFCA 4D4HA 3PHIA 3MGGA 4RWEA 1D1QA 1OHHD 5EMLA 2YV5A 3VU1A 3WGQA 4KIUA 4MYCA 1DAKA 2BTQA 1PDVA 3NOQA 4AJKA 4CF3A 4OHZA 1YHYA 2X0JA 5J2UF 3S4YA 2IHJA 1Q1QA 4DGSA 5HOEA 4ZPXA 1RLJA 3B5EA 4JROA 2AK2A 3O1IC 1XXHB 3L79A 5CBPA 4JVLA 5K8JB 1DQPA 1WM1A 3B9RA 3HXOA 3O1JC 5C8YA 5KUTA 2XKAA 3LX4A 4K6GA 5KOIA 3LUKA 4YCBA 2HGZA 1QHHB 2PQ6A 1MO6A 2W2TA 1BDBA 2QM7A 5TF4A 4DIOA 4KR2A 3OIDA 2D1QA 3C2QA 1NF2A 1W19A 3OFND 2HIGA 2Y1CA 4O3FA 2XY4A 3E15A 3L7IA 4C0XA 2ZTVA 2QE6A 1EGMB 2GASA 4LISA 4FFBA 1XU9A 3HCOA 4O2BF 4CMAA 4DCTA 4NZOA 3WWDA 2WAOA 3EPKA 1K8QA 1NG9A 1O7JA 5IJ9A 4AKGA 5AVRA 3C74A 5DNCA 2W48A 2Z4RA 3L4EA 3JQGA 3LZ6A 1ISFA 1TC2A 3UMVA 2Q28A 1C9YA 1RLOA 2QTVA 4BLPA 4NE9A 4Q1BA 4DMKA 3INGA 3RW9A 3L6DA 3ASZA 3DVAA 2ZETA 3MMPA 4PC3A 2GAAA 3H84A 2A33A 3EGXA 1E20A 1GT91 3EY9A 3GEIA 3S2SA 4TROA 3TOCA 4CWAA 2VPWA 2XVXA 1TZBA 4A8PA 4DABA 9LDTA 4R7ZA 1KYVA 3I09A 1JAHA 1L0BA 2GERA 4OAQA 1NXVA 3PQ2A 4M0FA 3AQ4A 2HT6A 5B58T 5D87A 2JGDA 2A1UA 1IN8A 5E9AA 4R8KA 3RSZA 1ZK4A 4A91A 5I7VA 3FOCA 3P0HA 3OJWA 1NVKA 4TVKA 3QELA 4CTJA 2OCBA 1GQSA 2XBLA 1JFFA 3A3NA 3PXDA 1J0DA 4JVSB 5ARDA 5KSWB 4QT4A 4L8GA 4FE4A 1IJEA 3RJ9A 2XUZA 5ABPA 5T7BA 4GOLD 5JAIA 1VG9B 3K4PA 1TVKA 1J8DA 1EJ6A 2VAXA 1S01A 3SMVA 621PA 1SKBA 1ZIOA 4X3CA 1DU4A 2QQEA 1H69A 2DC1A 4AJEA 1G8MA 2IKSA 1N0HA 3S8MA 4E5MA 3M5DA 4B87A 2OXRA 4OREX 3HU3A 4WERA 1O77A 1FFBA 4EEZA 4GP7A 3CCCA 3LV8A 3QBTA 1SXHA 1DWOA 4LZNA 5DLDA 3GEEA 4HLQB 5EXDA 3TQSA 1G2QA 4PQGA 3WGJA 1XKXA 4HWOA 1NI4B 2UZ3A 3NOOA 2G1UA 1Z8NA 1U9YA 1NPYA 3B1VA 3UOAB 1O97D 2IHUA 3HMQA 3MTDA 3WQRA 4B6OA 1VPWA 2I91A 2WF9A 4KO3S 3C3AA 2ZBUA 5AKYA 3FPSA 2P90A 2JLQA 2HHJA 2OXTA 4JB0A 4DIKA 5KVSA 1T1EA 3RRFA 4B3DA 3QJYA 2ZKIA 1PSZA 1IAVA 2BI7A 2E2WA 2O8NA 4M8SA 1LI4A 4HGYA 1KS2A 5H82A 3TNJA 3UPUA 1WG8A 1Z08A 2NZJA 1B8UA 3Q8LA 4RCVA 2YVUA 3HR8A 3Q3JB 4U3JB 3HI4A 2FEMA 5HSGA 4RKFA 1W6UA 1XZAA 3DZIA 2FWAA 5G02A 1C3XA 4D9MA 1BDHA 1ADBA 2DQKA 4H1UA 1C29B 3A9SA 1P1HA 2JGKA 3FYUA 3G8YA 2YXDA 3AWIA 1GU1A 3BXHA 1M2VA 5EY5B 3W2HA 4CQMA 1ISJA 2XNDA 3O31A 3UFBA 3WSVA 2FWIA 3K8ZA 1EFRA 1ISHA 2P68A 2UVQA 2VN8A 4LZOA 2BI4A 3BS4A 4R2LA 4JI3B 3LTNC 4OQMA 3QX8A 1A8SA 4P54A 5G0SA 2I2XB 1R37A 1DKQA 3MWDB 5AVZA 3AETB 1C3OA 2AC4A 1XTQA 1X7XB 4K9DA 10MHA 4JEUA 3R3WA 3V7YA 1YRYE 4RZSA 1B16A 5A3JA 4EMTA 1EKXA 1YDHA 2IUFA 2Q0HA 2QRKA 1KVSA 3DFMA 3VDXA 3QVUA 1KSGA 4YROA 5CFOA 3N6VA 4LDAA 2V6FA 1KXJA 5CB4F 3T7DA 1G1MA 3SBEA 4UVEA 1T1SA 1YRQA 1OXVA 4NCJA 2Q5HA 2PZLA 2Z9DA 3TQOA 4IINA 4I7EA 3D81A 1WLYA 3HR4A 1NZJA 5C4MA 3ZQJA 1JAYA 1AGYA 2XBMA 4KRYA 1TM3E 1ELOA 2PUCA 4JIMA 4R68A 3R6GA 1Q1ZA 1CJSA 5J3JA 5CB8A 2CBXA 4HB4A 4LA4A 3VDRA 3CSDA 4BKMA 1QU2A 1O1YA 3LC2O 3GJ7A 4FUTA 3WFZA 2PO5A 2VDWB 1FLDA 3BJMA 2JAHA 1T24A 2JAPA 2EFEB 3DEKA 3RKRA 1BX3A 4CU5A 3THXB 1UPUA 4JDPA 3MJ4A 3Q0EA 5ICSA 3VR3D 3U80A 3LX5A 2V4ZA 2WSIA 3H75A 5KYUB 4B3RB 3LW7A 4YPOA 1JFVA 3NYQA 2VDOB 4K6MA 2BM0A 3A27A 1BOFA 2OO5C 1A4IA 1IY1A 1XA4A 4CV3A 5BR8B 2QN7A 5E4JA 4JLBA 2R25B 3ELDA 2CL7X 5LB2A 4B3JA 1SU7A 1PK8A 3HYRA 4KZKA 1EXVA 3GRAA 5IVDA 1NXQA 1U2DA 3Q87B 2OHFA 4ROSA 5AXBA 5DLYA 1AMNA 4E94A 4QDUA 5ALVA 1QQAA 5EL0A 4FB4A 1KJQA 2OG1A 2QTWB 4QX6A 1FMCA 2RCYA 4C30A 5T3UA 2IITA 2X2EA 2VNAA 3X3HA 2YKGA 3JD4A 3E0XA 3OEYA 2Z2JA 4IOJA 4RHCA 2WICA 1MRNA 3K1TA 1GVHA 2V7QD 1OROA 1ESDA 5ECYA 1JGTA 1E0SA 1OGIA 1ORIA 2DP4E 3O94A 4HOYA 4PPFA 4B8ZA 5KJ6A 2P2ZA 5I48A 3PJRA 1MJ5A 1SH7A 1U1DA 1KZ7B 1E2QA 3O7MA 3FFAA 4C4XA 4FP9A 2QNIA 5DSZA 3U61B 1K5GA 4NBKA 1OGYA 3GJYA 3KVVA 5KYKA 1CY7A 5E8RA 2JIMA 1FYXA 1W9HA 1W4RA 4WVFA 2SHKA 3NGXA 1F8GA 2G70A 4JAVC 1G6OA 3RARA 1Z6ZA 4NP6A 3UK0A 4JYAB 1RZUA 4R54A 1E89A 2V58A 5F64A 2PEZA 2TECE 3M3PA 4G63A 2IHBA 2CBGA 4X1YA 2RHRA 3AR8A 3LP8A 4H18A 1BJKA 3EFOA 2CB9A 2O7RA 2B92A 3TL6A 3I01A 4O1HA 1O6FA 1TL7C 1ZIXA 4RM3A 2I4IA 5F21A 5JMTA 3LLSA 4YYEA 3H2YA 3U3XA 3ZZUA 2IV7A 1LTKA 4RMJA 1DRVA 2Q3MA 2D1SA 4KFCA 1Q7GA 4KZPA 3V8RA 1QUFA 5M2QA 2VNKA 1N78A 5AVTA 4AJ4A 4JUFA 4LDQA 2WF6A 1K89A 3KPYA 4FFVA 5AW9A 3ZKAA 3BL8A 4DEVA 2XHEA 2BSXA 2D13A 4BTVA 4PRKA 4RD2A 5GZ6A 3KTAA 5BORA 5LYJA 4GWLA 9MHTA 1J00A 4LX0A 3SC2B 1WW8A 2CL5A 1P18A 2XWPA 3PUXA 1K2WA 4C78A 5CVTA 2O8BB 1FRFS 3FR7A 1ML4A 1ZD5A 1BCRA 1ZK2A 2BIFA 1W1UA 2NQ8A 3GJTA 2VJCA 2KB0A 4OFXA 3T5GA 1P8JA 4OQYA 2CGEA 3WKCA 4N7JA 2AOUB 1Z45A 2XZTA 4N6OA 3Q1LA 2JFUA 3HUUA 1DJPA 1XTRA 2D2EA 2WP0A 1S2OA 4CLEA 1W1WA 5IM4A 1CNMA 4M1SA 4UOQA 4OQ4A 5B2ZA 3K32A 4M2LA 2G83A 1P29A 3KCNA 3W3AD 1CQIA 3DLBA 3A10A 3LWNA 5JNTA 1D2HA 1WQ1R 2II6A 4ITVA 3FHLA 2GVZC 3ZJTA 2XTJA 2ZLBA 1XZJA 4YV7A 1GNLA 1M2JA 1JPVA 3I9V1 4OXQA 3MJEA 3EXHB 2B36A 4TTAA 1GR1A 4Q9LA 2P6UA 1R8JA 1SOMA 2VRWA 2EX0A 3SJZA 2Q3BA 3M6MD 4OQEA 4UVHA 2JIDA 4IIFA 4C7KA 1O95A 1ULZA 1Q1BA 2F3RA 4NECA 2V7PA 2IBMA 2I29A 2OCPA 2WIJA 4B2LA 1NPDA 1NXTA 2DFKB 2QTZA 1RM4A 4HRVA 1VSBA 4BTLA 2B9EA 1ZY2A 1PJSA 2IBTA 2H2FA 1J9ZA 1FXUA 1UKCA 5JDIC 2DFVA 1HSZA 1ZYUA 4J0KA 2QYHA 1NBMA 2ZYIA 3B5IA 3KL2A 2ZT7A 3PKJA 2H1OA 3MTBA 1YUBA 2PMCA 1A9OA 2X42A 1ISPA 3CO0S 4C14A 1RQRA 5JCOC 4L78A 3ORSA 4NYJQ 3RT9A 2JLZA 4WDRA 5GIPE 4W5NA 4A15A 1J8MF 5AT1A 5IANA 1XCJA 1WY7A 8ATCA 2Y27A 1RCTE 2ODNA 1ZK1A 4B6PA 3P45A 3SQOA 1RWNA 4KXLA 1GGFA 3GRZA 3F8TA 5CA0F 4GL4A 4NV3A 4HDOB 5G4KB 4CM5A 1PLKA 1U1GA 1YAHA 3LCJA 3DEHA 2E82A 3K5HA 3SJ7A 3MGAA 1LSOA 4QQKA 1WHSA 4PQYA 1CZHA 1K9SA 3LPCA 1OASA 1OE0A 5TIIA 1QH8B 4D02A 4KUHA 2ZI4A 1NJFA 3HVHA 1XR3A 1F8XA 1YQ9A 2DTDA 1KOLA 4JP1A 3KHUA 1U5AA 3RASA 2JHPA 1PR6A 3PQDA 3RTDA 3OCWA 2IHKA 2QPTA 2NTYC 5F3RA 3FKSD 4D4MA 4BLQA 4RIGA 2Q6IA 1C4OA 1CRPA 4GPIB 1XFDA 4AYWA 2WWWA 3IQEA 3UTCA 4KRGA 4L51A 3LQYA 4WZBB 4L0DA 5C7IO 4HS4A 2RHCA 2J9RA 4EI2A 2OSBA 4MYHA 3JU3A 1SVMA 3S2IA 3LFTA 4H7EA 4EPRA 5ALQA 1G3IA 1SRRA 4HMQA 1MNQA 5DGXA 2UVDA 1QHSA 3T7IA 2KW5A 5JE8A 1EM8A 2TYSB 4JVOA 4PS1A 5JSUA 4RNDB 3ZU3A 1RS0A 4QBGB 4HVLA 2F4VB 1BEUB 3HJBA 1V3VA 2IYXA 4W9NA 1U9IA 2PNFA 1SKQA 4G41A 3T5BA 3GAFA 1RHQA 1VPVA 2R84A 1QVVA 1WE2A 2R7AA 1JBKA 4FNMA 4NONA 4ZCLA 4G5YA 5SZJA 2FI1A 3MUNA 2BFDA 3LDHA 3K1AA 1DELA 2PX6A 4RIEA 3PDHA 1BN7A 4RK7A 5EZYA 1ENOA 1LW6E 3KBOA 1OXTA 1KEZA 3B7WA 2ZWMA 5TE9A 2DPXA 2XIJA 2CYCA 1VKJA 1T0BA 5LQSA 4MDEA 2AUNA 3EDOA 1SA0B 3D59A 1KJJA 3M33A 2IS6A 4CL0A 3BIFA 2D8AA 3KWLA 5MF6A 1VHWA 5E6RB 4CMEA 4GBMA 1ZJ4A 1B4DA 4HGQA 1NJ2A 4RJJA 2JEZA 1AMUA 2NACA 2FN4A 1CJTC 3NBAA 4Q4CA 1HLPA 3GFOA 4KBYA 5KOJA 1AG9A 4REQA 1YZKA 3O8CA 2YFKA 3IR7A 5H7XA 1NLZA 4KBFA 5BQ5A 5EWJA 1P3Y1 1RM0A 2IZ0A 3EQ2A 3K9LA 4DILA 1MZPA 1Z56C 2X0FA 1FZTA 2R1TA 1E1KA 1Q6ZA 2PBFA 3DP7A 2WWRA 1SXJB 2JFPA 2PX5A 4PYNA 3RHZA 1ISMA 1CUXA 1QOZA 2REXB 4L73A 4Z3DA 3LYLA 2OO3A 3ZW9A 4PRZA 4Q3OA 3RDPA 4FYIA 5LPNA 4UNIA 4QPJC 2NU6A 3EOBI 1AK1A 4HQOA 4OOFA 4RQUA 3I72A 2W6ZA 3PCRB 3OJ0A 3QVTA 4C5BA 2LRHA 3HN2A 4LYJA 4Q3DA 1B43A 4Q4JA 4YDRA 2KYRA 3TXYA 5I47A 5BUSA 1FDTA 3UA3A 1LCIA 2W90A 4J0EA 2TS1A 5JLAA 2JKYA 3PKIA 1YB2A 3EXFA 4S05A 1RHJA 3CJQA 1LPMA 1ZGHA 2ODTX 3A11A 3U1BA 2ZYWX 1Y3DE 2ZIEA 3O2QB 2J3QA 3BMXA 3UFXB 3ORHA 4MQLA 4P82A 1SHKA 3DV9A 4OJTA 3NC1C 4P7BA 3UGKA 4C43A 3I1FA 2G63A 3KZCA 4UHBA 2ACWA 3DCIA 2AZMA 2HQBA 4OHUA 4TN1A 3ELBA 2ST1A 4DREA 4YUWA 4ZYLA 2Z83A 2BTEA 2XRZA 1P0IA 4OJMX 4I5DA 2YW9A 2QK4A 2Q46A 2RHMA 4GR9A 4BRUA 3VNUA 1BW9B 5DTEA 2VHUA 4HEJA 2GCNA 4F46A 4EKNB 5CBKA 1G20E 3OZDA 4AF8A 1UDWA 3PNBA 1ESMA 4PANA 3JVEA 3VTFA 4TYYA 4WUTA 3JYHA 4S1WA 1CDDA 7ABPA 8AT1A 4DPKA 3PPIA 1QIIA 4PG5A 3V8QA 3ZQ6A 1EXMA 1NXOA 2R8PA 5AM2A 3WMRA 3U19A 3HM9A 4MVJG 1QGYA 3PFIA 4E30A 1MV5A 3G9ZA 3EXIA 2IZ5A 4GOOD 1I5RA 1UDXA 2KBFA 1W4LA 1I6LA 2QMZA 1JEJA 1ZN8A 2HF8A 3QKWA 4RH0A 3TJMA 4GPD1 4IFEA 3WDLA 3A1DA 1HI9A 5L6MB 1M0EA 1R64A 2MWMA 4FMBB 4TS1A 2GZHA 4UM9B 3RAFC 1S1CA 2CCGA 5TVKA 3W5BA 2AN4A 2WUWE 2YIMA 3E7WA 2GLTA 1SHTX 1EFCA 2QN1A 2NU8A 5T4HA 1YSCA 1JN0A 3GEPA 2QJWA 1F17A 3OPYA 4JHLA 5AHRA 1FNNA 2R65A 1EUDB 2R5WA 2GSWA 4GO1A 5J9FA 3AFNA 1BQ4A 3OIFA 4KP7A 3TBHA 1A88A 4ZAVA 5CITA 1Z26A 1IY0A 1L5SA 2BPOA 2H1CA 3F5SA 3R7DA 4LYDA 4C08A 1X3SA 4YR7A 4J07A 2ILVA 2PMDA 3EIQA 3H7IA 4MCHA 4JI8B 1Z4OA 1U4OA 5HQ3B 3ABRB 4ZRDA 1KK1A 1PLJA 5C8VA 1VL8A 3SE7A 4C05A 3SFTA 1NFRA 5A4DA 3GA5A 3PGXA 4JODA 5CR9A 1V26A 4CT4B 5BSHA 4RD4A 3ZWMA