3REGA

Crystal structure of ehrho1 bound to a gtp analog and magnesium
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
171
structure length
171
Chain Sequence
KKALKIVVVGDGAVGKTCLLLAFSKGEIPTAYVPTVFENFSHVMKYKNEEFILHLWDTAGQEEYDRLRPLSYADSDVVLLCFAVNNRTSFDNISTKWEPEIKHYIDTAKTVLVGLKVDLRKDGSDDVTKQEGDDLCQKLGCVAYIEASSVAKIGLNEVFEKSVDCIFSNKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unique structural and nucleotide exchange features of the Rho1 GTPase of Entamoeba histolytica.
pubmed doi rcsb
source organism Entamoeba histolytica
molecule tags Signaling protein
molecule keywords Rho-like small GTPase
total genus 54
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3regA00
1HT2E 4I1SA 4NL4H 5CM8B 3FWYA 3QNUA 1N5JA 4OQLA 5FUWA 3PUZA 4UJ5A 1J7KA 4ZDIA 3NIBA 2LKCA 3SN6A 4KFSA 1IXRC 1KDOA 5H68A 5JSZB 3AUXA 3ZDQA 2ZRDA 5DIFA 4LPKA 1OV4A 1IJFA 1KMQA 3AGQA 2F43A 2NO7A 3DDCA 3NHBA 4JLNA 3DM5A 4Z8XA 2PEYA 2HCBA 4RD3A 3ZJYA 3RYTC 3IO5A 2OE2A 1FPMA 4PPNA 4QXAA 3EPHA 1IN8A 1OYWA 2QBYA 3BXZA 1WA5A 5TMPA 1P5ZB 1FW6A 3NH6A 2A5GA 3EARA 4UNQA 2QA5A 1W0KA 3KJHA 3PEWA 4NHOA 1T3LA 1CR2A 2OFOA 3X1YA 1E4YA 3GJ5A 3KKMA 1LNZA 2VHUA 2B8TA 1SQ5A 4G5GA 2CJWB 3B9QA 5E7IA 1ZD8A 5KTYA 4LV6A 4PO1A 2QRNA 1SHZA 5JJIA 4BLSA 1R7RA 1W7AA 3ND8A 2ODNA 2AL7A 2ZR0A 3T06B 4BFWA 1YE8A 1KNQA 2W83A 3K8YA 1ELOA 2ORVA 3VQTA 4A8JB 4LX0A 2BKUA 1BYUA 1AZSC 3QXJA 4IEEA 1E0JA 1G4UR 1QBKC 2Q3FA 2XXAA 3D3QA 2OAP1 4YQFA 1Q44A 4URZR 4IVPA 1DAKA 2OLJA 1YRBA 4DLVA 2ZREA 1XMIA 4GBMA 4P3YA 5HKKA 1Z6XA 3AP2A 4RKEA 4M1OA 5AJYA 4YONB 2WMOB 4UJ3A 2YHSA 2OLKA 5JS7A 1X8KA 2H57A 4W5JA 1LVGA 3GLGE 3U4QB 2OBNA 1II9A 4DLTA 2ZI3A 1G21E 2V4ZA 3GEIA 3TH5A 1BMFD 4GOXA 1Z06A 4QGAA 1BH2A 1DVRA 2QY9A 3NBXX 4OBEA 2NPIA 3K1JA 4KVGA 2CL7X 1M6NA 5LBIA 1JALA 1NSFA 2A5JA 5IT5A 2CDNA 2FJUA 1S8FA 4LJ8A 2XZPA 4HAWA 1UKZA 3SBDA 1DO0A 3EC2A 3CWQA 4HLQB 2J9RA 2IWRA 2D4HA 3LQRA 2QRZA 1Z3IX 4EDHA 3NEYA 1IXSB 1W47A 5IHPA 2A5FA 1X6VA 2CCJA 3SEAA 4MQBA 2I4IA 1MT0A 4DDWA 4F4JA 1W5SA 3PITA 1XTIA 1E2IA 2H18A 3JVVA 3L8YA 3ADDA 4TMKA 4PZLA 5ANRB 4HB2A 1XTSA 2ZS7A 2WWIA 2JIZA 5C46F 2ZR9A 1XU4A 4S2EA 1I4LD 5JECA 4EAQA 2C78A 3MD0A 2A9KA 2AN9A 3QXXA 2PZEA 4F4CA 3W5IA 4JYCA 3QBVA 4A0HA 3CF6R 4QRHA 4ACBA 4Q1EA 1KNXA 1LS1A 2PX0A 2DCUA 3ZVLA 3KQUA 3PIRA 1N6LA 1P4SA 2H7VA 2C96A 4G5OA 1K5GA 2R6GA 3CM0A 1VG8A 4WIAA 3SFZA 3O8CA 3A6PC 5B58C 3GMTA 3KTAA 4M8NE 4FCVA 4A15A 1MR3F 4KLNA 4B3GA 1BIFA 5C2JB 3K0FA 5E7MA 3THYB 1XJ0A 4DLUA 4LBYA 4IOMA 1E9FA 4AD8A 3NC0C 1XTKA 4C0HA 1FUKA 2RGXA 3H4MA 3RS2A 1U9IC 4MKFA 4WBSA 4TQUS 2BBWA 3EWAA 2OHFA 5FTNA 3BB3A 2PZFA 1M34E 3ZLJA 1ZNXA 4JMPA 1P60A 3EA5A 4GFDA 5IK2D 3VU9B 1GRRA 4IOKA 5EE5B 2ZTSA 1E2PA 4HEJA 3KFXA 3S1AA 4MH0R 3KX2A 4NE2A 1COWA 1NSTA 3D7MA 3GD7A 4ZCMA 3T5GA 2JLRA 4QJ5A 2PT7A 3DKVA 3L0SA 4JVMA 2NZ8A 2QTHA 3B2EA 2H5EA 5G41A 4D25A 1SKYE 2V9PA 3OAAA 4XSGA 1RPZA 2FPMA 1CRQA 2IW3A 3C41J 1NNEA 1MOZA 4LHYA 4B3DA 1OW3B 1BYIA 1VG9B 3SU8A 3LQQA 1RW4A 2GEDA 1OT3A 5KO2A 1DARA 3THWB 5FBWB 4H9GA 3AKEA 4FWIB 4ASUD 5FBVB 1C9KA 3OIVA 4M2LA 2NOAA 5D3QA 3CPHA 2QP9X 4P0TA 4II7A 3QSYA 2C2HA 2GCNA 4PC6A 1CULC 3ZS8A 3GEEA 1S9HA 1KK3A 1HUQA 4B44A 3CPJB 1E0SA 2N1BA 2RGNA 2PJRA 3C16C 4QGGA 4LJAA 2OCAA 4P4TA 2A3RA 5TDHA 1VCNA 2O8CB 4EFLA 1ZM2A 3NC1C 1VMAA 2ZYVX 3GJ7A 3AP3A 1KI6B 4IJMA 2V1XA 2AX4A 3RRMA 1SKYB 3KB1A 1TQ4A 1WB9A 4ZCLA 3EAQA 1ANKA 3GEHA 1NN3A 2OCBA 4URXR 4ERNA 3NVAA 5GADl 3A8TA 1NG9A 3H86A 4P4UA 2QP4A 2AHOA 1GITA 5GJVC 4QL3A 4DZZA 4NDZA 2XX3A 5EP3A 3THWA 2ZJZA 5G40A 4FIDA 5BN4A 2CEAA 1XZPA 2AKYA 2GF0A 2BMFA 3K0CC 4FCWA 2VP0A 4HYYA 4RJLA 3KJGA 3RSLA 4JIMA 2D7CA 1XEXB 2CCKA 4I4LA 4KLZA 2G9NA 1JR6A 3DOFA 1CJVC 4E03A 3J81k 1G8FA 4L16A 1NBMD 3CR7A 3RDPA 1T8UA 4RKFA 1A7JA 3EPLA 3UWOA 2NO6A 1W44A 3U3KA 5AK0A 2WTUA 3T1TA 2AXNA 1EXMA 2WSSA 2VF7A 3AP1A 3IIJA 2YWHA 2J0VA 4TYQA 5IRCD 3SQXA 2F6RA 3WMFA 2ZE8A 1RVDA 3WNDA 4RZ3A 4I81A 4YMUA 2HDNB 4ZV4A 3AM1A 1FMJA 1W2GA 2ATVA 4PANA 3K70D 1XBTA 1DG3A 1GSIA 3CZQA 2R6FA 2F1JA 4TLEA 1XX6A 1J2JA 3T1OA 4EJSC 1VKJA 4B71A 3KJEA 3NKVA 3QF4A 2J5XA 1NJGA 5AUPB 3TAUA 2ZXUA 2J3EA 4U00A 3CX7A 4GMXA 1R5BA 3T35A 1MO3A 1YZUA 2IYXA 2JLQA 1MRSA 1N3BA 2QMOA 4JLMA 5HTKA 4WZAE 2C9OA 2VLIA 3IQXA 2WICA 4KSCA 2EWVA 1XZQA 3CZPA 3REFA 1P6XA 2QROA 2EYUA 2VRWA 4Q4JB 3X1WA 4UNPA 1XXHB 4JYBA 4Q9HA 1NI3A 2GTPA 4IXMA 2ZYUX 3WBJA 4PO8A 5JJLA 2KBFA 4FMDB 3LLMA 4M1TA 2D06A 2D62A 2QTVB 4IDOA 4XVRA 5JEEA 2BC9A 4DLRA 4NPHA 2NTYC 2XTZA 1G8PA 4EJSB 2ZU6A 2GJSA 4RY2A 2KB0A 2BKEA 2UZIR 3SJBA 5FI1B 3JZMA 2FNAA 4URWR 2YYZA 3PV0A 1QHNA 2QQ0A 5L3RA 2OSBA 3CBQA 2DYKA 1ZM4A 4TQ9A 4OQNA 2PMDA 4JKIA 4ZKEA 2H8KA 4D0NA 1T0JB 3I61A 1HH4A 1XTRA 3RC3A 1CP2A 2WWYA 4RD4A 2QNRA 5FL7D 4LCBA 3TBKA 1AA9A 4HDOB 4E5UA 2JJ1D 1NN5A 2KSQA 3CW2A 2VP5A 4Q19A 5C1BA 3C7KA 4MA4A 1TTTA 3LD9A 1Z0FA 3I1FA 1U0HC 2CE7A 3CRMA 2WPDA 4G5RA 1E2JA 1O3YA 3SJZA 2Z4RA 4I1UA 2WKPA 2IA5A 3FPAA 3SOPA 3MGCA 3RAPR 3EPKA 4ZI2A 2HYIC 1LF5A 221PA 2IUTA 3DMNA 4MUBA 3ZZTA 1L2TA 3T12A 4BEBA 2IL1A 3LVQE 5FOXA 1CJUC 1E9SA 1L8QA 1NBMA 2IYZA 2GVDC 3VR1A 3RANA 2HT6A 5FOSA 4DDTA 1II0A 4OJQA 4FD2A 1S9DA 3OEED 1UM8A 4OYHA 1QHGA 2WWGA 4LJ5A 1P62B 2SHKA 1US8B 4EPWA 4HLUA 5AUOB 4A2WA 4ABYA 3P32A 5D3MB 1IJEA 4OI0A 3EXAA 1OXUA 1CJKC 4V0NA 1LY1A 2EW1A 5H70A 5SZIA 4AC9A 3UPUA 3TVDA 2FEOA 5UKDA 4Q4HA 4US1R 2QZ4A 1DAGA 4TMWA 4JZKA 5B57C 1CJTC 2B7CA 4WXPA 1G8GA 1XTJA 3HDTA 3SJCA 2R65A 2ONKA 1KMHA 1KJYA 3MWLA 2W2XA 4R2HA 2J41A 1EX6A 4TMTA 4EKDA 2HJVA 4OHWA 2YV5A 4B3BA 3EIEA 3K70C 3LDAA 3QKTA 4JJKA 2EFDB 1JR3D 4LV5B 3QXHA 5CK5A 4RSGA 3E2IA 1JNYA 5FI0B 5JS8A 1DPFA 1OIXA 4MRRA 2ZJOA 1XNJA 2IF0A 3IO3A 3IPXA 3TUIC 3FHCB 4DDVA 4KITB 4LPSA 4TMZA 2GEUA 5FTKA 3K9LA 2O8BB 1N5IA 2R2AA 3EW9A 4JJZA 4IVQA 1RRFA 1DAHA 3C5CA 4ZCIA 3N70A 5CIWA 4ZDJA 4P33A 4PFSA 3ZS9A 4HZUA 4QHSA 4NYJQ 1G3MA 5LB4A 3AF2A 2WBLC 1FTNA 1E3MA 721PA 4AKIA 4DKXA 1I4DD 2YZ2A 1TMKA 2PL3A 1DAFA 4R7ZA 4YDSA 4Q7JB 4BFXA 3TUZC 1ZP6A 4KODA 4QFMA 1JJVA 2R62A 3OE7A 4BE7B 4A4DA 2ZRGA 5KSOA 4OK5A 4HDCA 4C0LA 5SZKB 5LDDC 1S1MA 2C9YA 2ZRMA 3RRYA 1DBSA 2N42A 2ZEJA 3WP0A 2WPDD 2GA8A 3B1WA 1XXHE 2BWJA 1LB1B 2XNDD 2QGZA 3FGNA 1OHHD 1KI3A 3UMRA 4BWYA 5KNBA 4JBWA 3K0EA 4WW0A 1HURA 4GMDA 2QMHA 5E4FA 3VHXA 2EFCB 4WXRA 5K8UA 4RD2A 4IEIA 1UADA 2R6AA 3IIMA 2VSXA 3N5CA 2P5TB 2W2VA 2IXFA 4XVUA 5BYKA 1U90A 4A36A 2MSEB 4DHEA 5KHOC 4MYHA 1KDRA 1G6HA 4UQOA 3Q85A 3DPUA 1MO4A 3GLHB 3TW8B 3WHLA 2ZETA 2CL0X 3MAAC 1SXJE 3FB4A 4KBFA 1KYIA 1NBME 1UBGA 1X86B 1KGDA 2C8VA 2GCOB 3A58B 2FH5B 3ICQB 1JR3A 1G3QA 1TU4A 1G5RA 1OE0A 2HCJB 3UG6A 5F3WB 3B6EA 1X8LA 2B7BA 3SR0A 2AFIE 3BJIC 1EFHA 1CF4A 3HU1A 1DS6A 4EPRA 3KQLA 2QGNA 1S0UA 2IEZA 3WP1B 2P6RA 5FOWA 3NWJA 4B34A 1VPLA 3LXRA 3Q9LA 4QG7A 4TL9A 4AI6A 1YZNA 1ZM3A 2OCPA 2QE7A 5JCPA 4TYNA 3ASYA 1TUIA 4NYIQ 3ZQJA 3LBIA 1G17A 3RVBA 3PJRA 4LDJA 3D8BA 2JLUA 5HR5A 4UKDA 5KNCA 1S2MA 2KBEA 1XTQA 1F5NA 5KSYA 2NPFA 5FTLA 1J8YF 1K6MA 3KDSE 1US8A 2QMEA 3LH5A 3NBFA 4RD0A 1XP8A 1W1WA 1BKDR 3OFNA 2OFWA 2RB4A 3QOFA 4GI7A 5KDDA 2CE2X 3VR5A 3WRXC 4A1FA 3IGFA 1CKEA 1IAQA 1JEEA 5EXPA 1COWD 3IQWA 3U7GA 5GJWC 3A1WA 3PFIA 1R0ZA 2QBYB 1D2NA 3RS3A 2QPOA 3Q3JB 1XD8A 1SVMA 4BECA 4B73A 1D2EA 1W4BA 3BFXA 2VSOA 2AWNA 2JJ1A 4IOLA 4D6PA 4QBIA 4GPTA 4D4KA 2JLSA 2AD1A 2WZQA 1U2RA 2ZVPX 3CRVA 2OBMA 2PX3A 3AVOA 4JLAA 4A0FA 5CITA 3DO6A 2GF9A 2LKDA 4L9SA 2DHRA 2Q9BA 1WMSA 5CK4A 2OG2A 3PUVA 3H1TA 3ZIAA 4CW7A 1R0XA 3KXLA 4BFYA 2V54A 2VHTA 2B6HA 5DYIA 4ZIRA 3IHLA 4KYIB 3IEUA 1Z6YA 4AG5A 4OJKA 1QHHA 1KI2A 2IYQA 2RKOA 3ND9A 2GK7A 3DL0A 3I5XA 2D2FA 1XEXA 4TTQA 1OKKA 4C7OB 2EVWX 4NYMQ 4DSOA 2NO1A 4BFVA 1JQJC 2XB2A 4JT4A 1PLJA 3IBYA 2WM9B 2XNDA 4EPYA 3W8RA 3K0AB 4LJ9A 2X2EA 3SYNA 4FWTA 3NDBB 2W2TA 5CB8A 3EC1A 1CJMA 3U6KA 2JATA 3CWZA 2ZAOA 2IS2A 3QXSA 1P61B 4MYCA 3SS8A 4XD7A 1U81A 1ZM9A 2ZJAA 3X1DA 5G3ZA 4JSYA 4QM6A 4IKEA 4URYR 1RRGA 4KFRA 2PZGA 1W4RA 2IYSA 4AIIA 1E2HA 2WJIA 3CPEA 4HAVA 5F9HA 2YOHA 4R9UC 4Q21A 2ZSAA 2Z83A 1S3SA 1E32A 3BFVA 5AWFC 2QE7D 2O8EB 5KDLA 4AK9A 1WP9A 1E2GA 2GJAA 4YMTA 2BEJA 3FDIA 1OB2A 5FUVA 3TK1A 1XD2A 1YR8A 4JLPA 4QKQA 4Z54A 2F1RA 3VU9A 1CBUA 2NZJA 4IXNA 2JLWA 2ZI9A 1Z07A 2QAJA 2PBRA 4O2LA 3BH0A 2BOVA 4PPQA 4Q4HB 2J7PD 2HF8A 2CLSA 3AVPA 3F5FA 4TZ0A 5J40A 5CYOA 2OAQ1 2VL7A 4D4LA 2WSSD 4TYYA 2CNWA 2J46A 4HAXA 3QBTA 4W7SA 3RS4A 5JWOA 1KDTA 1X1SA 5J47A 1YR7A 3QEOA 5FOUA 2FSGA 1G291 5IK2A 1P9RA 3HR8A 1G1MA 2FGKA 2BBTA 1OH7A 1UKEA 3B1YA 1EG7A 4BLQA 1N25A 1VG0B 2RGAA 3IHWA 1OIWA 2IBMA 2CVFA 1OSNA 1XCPA 2Q6TA 1VHTA 2AK2A 1TL7C 1IHUA 3LA6A 4U02A 1R8QA 2G83A 4F7WA 1Z0KA 1ZRHA 4AWXA 3GFOA 1D5CA 3FKSA 3THXA 2AXPA 2HT1A 2ZJYA 2OCYC 4YMWA 3C4JA 2EQBA 4JLKA 3QY0A 4DJTA 1TPZA 4CEJB 3QKSB 2YVUA 4MRPA 5DSZA 4XJXA 5JHHB 1TEVA 5EUQB 4CGZA 5HCIA 1H65A 3K0FB 5HE9A 3LY5A 3FFAA 1G8HA 1QZXA 2ZR7A 2C99A 3DMDA 4KFUA 3D31A 1QRAA 2AWOA 5HE8A 1QG4A 1ZU4A 3C5HA 3KTAB 4V0LA 1ZIOA 4AKEA 2O8FB 1X8JA 2IYWA 1W0KD 4TT3A 1IY0A 1FNMA 4MRVA 2GZAA 2ZVQX 3U61B 1XMJA 2IC5A 1KSHA 2YOGA 1FX0A 1E2KA 1ZIPA 3G5UA 1XMVA 3E5HA 4LBZA 3KQKA 3S1AB 1NF3A 1KI7A 3P4YA 2W6ID 3L82B 4N1AA 5GVRA 5FBRB 2RCNA 3LW7A 2A78A 3HPRA 3RS0A 1VYTA 4Q1BA 3NG1A 1E1RD 4LZZA 2ZS9A 4YC7A 4TLBA 2WV9A 3OHMA 4NCKA 1ZUIA 2ZRAA 4P4SA 2RMKA 1T5IA 1RE0A 3I72A 3QIAA 1UBEA 1Z83A 4NKRA 1Z6AA 4XWOA 4TT3D 4C9BA 3GP8A 2F1HA 2IXGA 3LX5A 4LV8B 2R8RA 5K8LA 3KQNA 4C0SA 3FMIA 1WRBA 3A4NA 4LYHA 3U4QA 3K70B 4LYFA 3ZH9B 2VHQA 2ZRBA 2VQSA 3L2OB 1MABA 4B33A 2Z0MA 2YOFA 1E98A 4NU0A 4QC2A 4TSFA 1KSJA 4DC9A 621PA 1PVOA 4NMMA 1N6RA 1FFHA 4Q1CA 5KOYA 4CRWB 1Z6TA 1I4TD 2OT3B 5FOTA 5FH9A 1WBBA 1GOTA 1ZAKA 3QVUA 2ZPTX 1VHLA 3QG5A 1JXOA 3N2EA 2UKDA 2ZQ5A 2VSFA 1CIPA 1W0JD 1GP2A 2ONJA 5JHGB 5LPNA 3CNOA 4H1UA 1F2UB 2X2FA 3HWSA 4PHHA 4BQSA 2ZI4A 1AKEA 1W2HA 5FUXA 1P9WA 2ECKA 2F9LA 4Q7LA 3OIUA 3W5JA 4BRUA 2IT1A 1ETUA 3A4LA 2EWWA 3ZGXA 2GBLA 2JJ2D 5IDVA 1FQJA 3CF0A 4PC2A 4NZYA 4E07A 1E2MA 2ZS8A 3CUEF 2V6JA 4E22A 2OESA 1Z0AA 4PTLA 4M21A 1NLFA 5C18A 2ORIA 4KJZA 2A7QA 5BYJA 1F48A 2F3RA 5BN5A 4NCIA 4CYMA 1A5TA 1E0KA 5J4LA 4LHXA 1OH8A 3PQCA 2C98A 4D26A 5J4YA 1NVVR 4QHYA 2DPXA 4LBWA 3T1QA 4C0QC 5M04A 1DAEA 3ZZ0A 1GWNA 2ZYWX 3AKYA 2P6UA 1OH6A 1T6NA 2C77A 1VIYA 2DR3A 2FF7A 5GJCA 3R8CA 2G0TA 1SULA 2B21A 1R5NA 5CJPA 5EP4A 4CVNA 4FW9A 2XSZA 3LAWA 3UKDA 2PMKA 3OEHA 3RS7A 4C3ZA 1QHXA 1OXSC 4UXIA 5EZ5A 3M4YA 4UNSA 5L3SB 2GXQA 1JR3E 3EZ6A 3B60A 2FPKA 2P3SA 3R7WB 2WJYA 1M1YE 2E87A 2FA9A 1EFRA 2RGGA 4RFSA 5KU1A 4C0BA 1KDPA 1E96A 2ODBA 1ZBDA 4ZDKA 4C0JA 3LV8A 1Q3HA 1BOFA 3AQ4A 1VYUA 3ETLA 5AUNB 4DDUA 4G5QA 1TAGA 2CHQA 4K46A 2NMVA 2W0SA 1FNNA 1KIMA 3IKJA 3OEHD 1HT1E 1E94E 2IYUA 2QENA 2QORA 2REBA 4OK3A 5HKKD 2V55B 2HLDD 4HUQA 4B3FX 3FTQA 2GZDA 4KFTA 5H8WA 3L0OA 1TEXA 4JLVA 4Q9LA 4D82A 5GJBA 3FOZA 3WNBA 1MV5A 4P4SB 3U3RA 1E9AA 2J45A 2J87A 3L43A 3QENA 1XXHA 5CM9C 1NN0A 3NBZC 1Q1ZA 3T1VA 5KDOA 1NY6A 3QVVA 4FMBB 1VDZA 4PSAA 1Z63A 1Z47A 1QG2A 2ZJ5A 2XOKD 2DFLA 2ZE7A 3QI2A 3OIYA 3T34A 5CB6A 3K0CA 1U8ZA 2W00A 3ADKA 3TVTA 1ZC3A 1G5TA 2QM7A 1GNQA 2GKSA 3P27A 1CTQA 1MKYA 3BIFA 5EE9A 2CLDX 2DFNA 3GJ3A 4TYWA 3SHFA 1GRNA 1GNRA 1TF7A 1G9XA 1A82A 3K53A 4NTZA 4PHGA 4BZPA 4QM7A 4PR0A 2XTNA 3KXKA 1SVWA 3SJAA 4NCJA 2ZRHA 4OI1A 5B30A 3P20A 5DGXA 1J99A 3EZFA 5DI3B 3B1ZA 1KI4A 4UXHA 3SQWA 2X19A 1RJ9B 3FHTA 4KI0A 3I3SR 3FMFA 1Z22A 3AF3A 2QEQA 2DB3A 1E2QA 3MJHA 5C4GB 5CYPA 1GAJA 1IONA 5FPTA 3QUSA 2ZSDA 3RHFA 1PJRA 2NGRA 2EFEB 2OXRA 2C04A 4TTPA 4IOJA 5JBQA 5JWRA 4EQ6B 1T9HA 3W3AA 4DLXA 3ICEA 1Z2CA 4OHYA 3I32A 1I2DA 3TE6A 1SGWA 2L0XA 3WY9A 3D6TB 4JLOA 2DWQA 4A2QA 4DLYA 2FU5C 1F2UA 4WZ6A 3EA0A 2V7QD 3U5ZB 2VO1A 3Q8XB 4BASA 1K5DA 3W6OA 1P2UA 1R2QA 2G1JA 2AD5A 3EASA 2QT1A 2BBOA 2HV8A 2R6DA 1RIFA 1FOEB 1OFIA 2QG6A 1LTQA 4UNNA 4DEXA 2XZOA 4Z1MA 3VKWA 4KAXA 3UK6A 1JEDA 5G53C 2FOLA 1GTVA 3QKUA 4Q4LA 2WKQA 3VX3A 2IYRA 2RGNC 2B92A 4B32A 1N0VC 3KB2A 3B1VA 5CDFA 3QQ5A 4PAMA 4O3MA 4NP6A 3AB3A 4KSBA 1NKTA 2A30A 1GVNB 4OI2A 2ZANA 4RZ2A 1A1VA 1NJFA 4HATA 1D6JA 2P67A 4C30A 2FSHA 4ZIRB 4Q4JA 2I3BA 5JI2E 1L4YA 4PC1A 3CIOA 2J0SA 4TL6A 1ZNWA 2ZE6A 2BBSA 2D2EA 1U98A 1ZMXA 2CLCX 2ODWA 1WXQA 2BM0A 3QG1A 5AJXA 4M1KA 4Q9IA 1HV8A 4IDHA 1GG2A 4RFSB 3I73A 4O2RA 5B64A 1AIPA 4G01B 4Q1AA 1E99A 2ZUBA 3K9HA 2VP9A 2AK3A 1AK2A 1N6KA 1UF9A 3P26A 2C95A 3I92A 1I2MA 1E69A 1N0UA 4JVLA 2GK6A 4QJ4A 3BGWA 2WIAA 3OE7D 4TQAA 3W8NA 3DHWC 2ZAMA 3M1IA 1UBFA 3CNLA 3FYHA 3L0IB 1FMLA 4BFSA 3FFBA 1D9ZA 1NVVQ 3SI7A 1W36B 1NVUQ 1E2DA 2OFXA 5AJVB 3BB4A 1TUEA 1DADA 4GOJA 2FE4A 1NIJA 4HAUA 3TKLA 4DIDA 3AVTA 2DY1A 2XOKA 4B6FA 1F6BA 4YXWA 3X1XA 3EX7C 4G3XA 1ZNZA 1AQUA 1Q1QA 1NL3A 3M0EA 3SE0A 4OHVA 4A9AA 3OESA 2CK3A 2BDTA 5E3HA 5DNYB 4LC1A 3AVYA 3Q7PA 1WE2A 5TV2A 1FQKA 1KZ7B 2JAQA 3U6BA 2GAAA 4PAOA 2GILA 1P2VA 4DCTA 2W58A 2RHMA 2QPTA 4MGZR 2FWRA 3DZDA 1E0AA 4V0OA 2YINC 4Q48A 1VCOA 2BVNA 2BV3A 4UXJA 1SKQA 1JB1A 4DUGA 4TSFD 4FI3C 2YC4C 4KV9A 4LJYA 4E09A 4XTRA 3CH5A 2E9SA 3RS5A 1AZTA 1G4AE 5LB2A 1AJEA 1R4AA 2ZRFA 4YMSA 1WBDA 1IY2A 4JS0A 3TR0A 3AF0A 1OIVA 5DLQC 4DT1A 1MO5A 1EX7A 1SXJB 2AR7A 2IWHA 3G82C 3AVVA 4ARZA 2A5YB 3HU3A 5JSZA 1TF5A 2IYVA 5DI3A 1II8B 1NMXA 2F7SA 1R10A 2GZHA 1NMZA 2MSCB 4OI4A 4C7OA 3LRPA 1F2TA 4US0R 2GJ9A 3TSWA 4B2IA 3H84A 4CEJA 4GP7A 2W6IA 4CEHB 3AEZA 4NONA 4GL2A 1YR6A 5KSPA 3K9GA 3WXMA 3LFUA 5DE3A 1A4RA 2FSFA 1JPJA 4PC3A 4DCNA 3GLFA 2WWFA 1XPRA 2FFAA 3U7FB 3B82A 2KJQA 4WVFA 2FV8A 2JJ8A 1BMFA 3O8DA 2IYYA 1YZQA 3MSXA 4MDEA 1ONBA 3V9PA 3TRFA 1OKKD 4DRZA 1M7BA 821PA 3FE2A 5BN3A 3RC8A 4DT1B 1ESNA 1YZLA 3ZVRA 2JEOA 4LJ6A 3SFVA 1Q1BA 1KSFX 5E7JA 1IN5A 4CF7A 1IN7A 1N6NA 4KHZA 2ANBA 3CO5A 2AKAB 3DZ8A 4HLCA 3MWJA 4AG6A 1RFLA 2Q21A 3ONWA 4Q18A 1G41A 3BOSA 5SZJA 4BLPA 1N5KA 2JLXA 3VKGA 2XEXA 5JFGA 1W0JA 3RWOA 4TLAA 1DAIA 4MITA 2JDID 2ZJBA 4F92B 2KWIA 4US2R 1OXTA 4CEIB 3THYA 3FKQA 4HLUC 4DCUA 1NMYA 3TW4A 3K09A 3GLGA 2O8DB 2NG1A 2HF9A 3U2QA 4B3XA 3GLFB 2WOJA 5F9FA 1RRCA 4C0KA 4POAA 2GAOA 1G6OA 2NQ2C 4QBGB 3F3YA 1XPOA 3A4MA 1FP7A 1M2OB 4PC7A 3X2SA 1CR0A 1KJZA 1NLYA 2REXB 3T5DA 4BFZA 3PUYA 3UIEA 3AKCA 1HQCA 4TMXA 4X8MA 2H1LA 1KI9A 2Z4SA 3M6AA 3MRSA 4W5WA 4RZUA 3QF7A 5ELXA 1GM5A 3O47A 3TJZA 3Q5EA 3K0AA 2OBLA 1FUUA 4JBXA 4EPVA 2J1LA 4IDPA 4WA7A 3W9YA 2PCJA 2HEIA 4M22A 4PQRA 1BO6A 4GDFA 2O8BA 1E1RA 1GDDA 1U99A 1JJ7A 1KO5A 2ZROA 3WYGA 3SYKA 5D3MA 3C14C 4HZUB 2VYFA 3VX4A 4CEIA 1RKBA 3WNCA 4BFUA 4R71A 2FFBA 4IRUB 4G1UC 3A36A 4LRWA 4J0QA 1FL9A 4QHTA 2CCGA 5JEDA 1XD9A 2OM2A 4Q7MB 1AQYA 3AV0B 4RCYA 1CLUA 1XPUA 1ODFA 5JLJA 2H92A 1Z0IA 4HAZA 2O52A 1KMHB 2Q0HA 1DG1G 3CLVA 3GQBA 4Q00A 4Z1MD 5SZHB 1PLLA 2GCOA 2PEZA 4Q66C 3PEYA 4NYJR 3RABA 4HAYA 4C2TA 3U60B 1M7HA 1MABB 5A0FA 5GVSA 1EFUA 1LV7A 2FPLA 3TUJC 1GUAA 1EFRD 4M9XA 4ILEA 4NCHA 4OHXA 4EPXA 5CLQA 1P3JA 2ZSFA 4URUR 2QQEA 5AJZA 4PPFA 3WBKA 2IS1A 4B48A 3ZD6A 2JASA 4MGKR 1SVKA 4B2LA 1KJWA 2FMXA 4IFBA 4ESHA 4BLRA 3FHOA 2XAUA 3QJYA 3UANA 3GLFE 4IVRA 1XD2B 2IUSA 2QSZA 4MGIR 3CNNA 4S35A 4V02A 2R9VA 2G0NA 2IK8A 3BH6A 2GESA 2B8WA 1GNPA 3HU2A 5JRZA 1AS0A 1NY5A 2C03A 2WKRA 2GXAA 1S4QA 2A5DA 3WHKA 1XJCA 1YHNA 1UKYA 2BEKA 2VF8A 4DXAA 4TMVA 4HUTA 1TADA 1NP6A 4HB4A 2MMGA 5DH9A 2JA1A 1N0WA 2ZM5A 1M74A 1OH5A 3A1VA 4B6EA 3KFVA 2HYDA 3SHWA 2J7PA 2P5SA 3P4XA 3TSZA 5BXQC 3VFDA 4KYUA 3WMGA 4BPBA 3PG5A 1O87A 4Q5IA 2G6BA 2YWGA 1UEJA 3B5JA 2FFQA 2QAGA 3AH8A 3FMPB 1GKUB 2Q9AA 2P0EA 1KZGB 3F8TA 4LWZA 3THXB 1QHYA 2FZLA 1OYYA 4MKIA 4V0ME 1OB5A 1KO8A 2EFHB 1N2CE 5EQTA 4A2PA 5BQ5A 3MWKA 1KOFA 3W6PA 1FP6A 2QN6A 3EWSA 5FUYA 3UMSA 3ADCA 1G3UA 2JGNA 2YNMA 3NXSA 4A6PA 4DLZA 3ZVMA 5FOVA 1NG1A 2LCFA 4BUJA 1Q22A 5FR2A 4LK2A 4N0EA 1QHHB 4IDQA 4DCVA 3IPYA 1XDBA 421PA 3U44A 1KK2A 3VTKA 1DEKA 2O8FA 3OAAD 3BB1A 2CMKA 3B7GA 3BBPA 1QVAA 1QDEA 4C2UA 1QHSA 8OHMA 2WSMA 5DYGA 2Z5FA 5TY0A 3VAAA 1VYVA 2ZSBA 1J8MF 3BRWD 2F9MA 4AKGA 1SVSA 2HXYA 4ACAA 4BLTA 5HZHA 2ZUCA 1L7VC 1GKIA 2C5LA 2WJGA 1T3SA 1H8ED 4AYXA 3QE0A 5L3QB 3RWMB 2PLRA 4CT4B 1F3OA 4PX9A 1XEWY 2VPPA 2JDIA 5AR1A 4HUQB 5IF9A 4MDFA 2FEMA 1XEFA 1IQPA 2CJWA 2XSZD 4PZZA 2PLFA 3THOA 3VR2A 3ZVNA 1U0LA 1XJQA 5K8IA 4D80A 3PCRB 1J90A 1YZGA 4FINA 1YKSA 1JBKA 3RSOA 1GL7A 4TWZA 2NO0A 3EG5A 1D8TA 1P2SA 5BWMA 1HYQA 5K8TA 4XWAA 5FPKA 3EZ9A 3W3ZB 2IF2A 1XF9A 2O5VA 4M1YA 5FBLB 2Q9CA 4PO9A 1TQDA 4P31A 1EK0A 4GOKA 4DSNA 1W46A 2VTKA 2GVZC 2X77A 2YWFA 4PHTA 5CLLA 4TTRA 1ESMA 4IDNA 4TLDA 3I8XA 3QPVA 1N6HA 2NIPA 3KKQA 4A8JC 3E1SA 3KKPA 3HR7A 4A0GA 3GLIA 4URVR 1PLKA 2DWPA 1KK1A 4TYPA 2CL6X 1ZCBA 3JZAA 4LHVA 3MJRA 1JXMA 4N0DA 3BE4A 4RFVA 5EE0A 2J59A 3TGPA 2R44A 2J0QA 4Q47A 5EP2A 2V8OA 3B8HA 4NH0A 2J0UB 1G5PA 5A5GA 2G77B 1IN4A 1W4CA 3EPJA 1TX4B 2OO7A 1KHTA 3FKSD 2ZJ2A 4V0MA 4YMVA 1XMSA 2V1UA 1XEWX 3GLIE 2WIBA 1OFHA 1KI1A 5FFMA 4ZPXA 1E9DA 4MYUA 2XNSA 4BFTA 2RAPA 2VH5R 3VNUA 2ZU0C 4LBVA 1H8HD 1A2BA 1PV4A 4BRWA 3TSOA 1CU1A 2ZI6A 4KVAA 4V0KA 5DO9A 2EFGA 4LY6A 3QKRB 1IM2A 1P2TA 4M1SA 4WOPA 3V00A 3GLGB 2QP3A 4DB4A 4X8HA 1VIAA 2WAYA 1NN1A 3SZRA 4L8GA 2V7QA 2NO9A 4ZDWA 2X8AA 3SC3A 2KI5A 3NTUA 4I99A 3GPLA 1G7TA 2BHRA 4OKSA 3BFKA 1E1QD 2O0KA 1S3GA 1Z5ZA 4MKGA 4PPGA 4OHZA 1UJ2A 1E79D 2XJ4A 3U7EB 3X1ZA 4ASUA 4PZYA 4M9ZA 1RZ3A 3U7HB 1EWQA 4R98A 2CHVA 1GFIA 4ZKDA 2G3YA 1R8SA 1G64A 5LD2C 3AF1A 5FR1A 4KU4A 2E1RA 3LX8A 2WJVA 1XB2A 2ANCA 2GJ8A 2X1VA 5P21A 5DISB 1E9RA 2CBZA 1YZTA 3BERA 1Z2AA 1RYFA 4MUAA 4TZ6A 2IHBA 4G0NA 1UDXA 3TIFA 3L8ZA 3MCAA 1RRPA 4Z8YA 3CB4A 1AN0A 3H2YA 2WJJA 3TNFA 2VA8A 2REOA 5L3QA 2XB4A 1ZM7A 2GBLC 3PEVA 4AY2A 4AYWA 1JI0A 5JMTA 4FMCF 4JL5A 1IXZA 4L15A 2IXEA 5FL7A 2KE5A 4JLJA 1Z08A 4YDHB 5EE1A 1E9BA 3W90A 2ZI5A 1G8YA 3TQFA 3GJ8A 1KO1A 1E2LA 1S96A 2YC2C 4OK6A 3BK7A 4M53A 4RD6A 5DI9A 4NYIR 5TB5A 1T5LA 4DLSA 1HE1C 4HI0E 4DLWA 4Q03A 4BLOA 3GCGA 1RC8A 1KO4A 4JBYA 1PZNA 3B85A 2MSDB 3RRNA 3A1TA 4GP6A 2DWOA 4HSEA 2DFTA 1UAAA 1HA3A 1N6IA 4UNRA 1Q1EA 3DEFA 2ZI7A 1T0HB 2VHJA 2ATXA 3C15C 2P6NA 1B0UA 2IS6A 2WAXA 2WOOA 2LWIA 4OQFA 5G3YA 3I62A 1UDWA 4ZO4A 2ODEA 2QU8A 4WZBE 3B1XA 2UZ3A 5HCNA 1AKYA 3DKPA 3R8FA 2ZRPA 2QTFA 3UMFA 1Q57A 2DFKB 2HJGA 2K5UA 1AGRA 1JAIA 3CX8A 5KUTA 3MLEA 3OFND 1BS1A 5FTJA 3SBEA 1ZD9A 1SXJA 2XTMA 4EUNA 3K0SA 1Z0DA 3R7WA 2WJHA 3F0TA 2J7KA 2IX3A 2Z6VA 1HTWA 1HE8B 2QM8A 4M1WA 5BW8A 2IYLD 4JVNA 2QPAA 3BH7A 1XCGB 2XJ9A 5J5CA 1OFUX 4GNKA 4CT5A 1NVXQ 1SXJD 1N6OA 1Y63A 2J0UA 2PH1A 4JLBA 3W6NA 2QSYA 2Y8EA 2UVQA 3QKRA 1W36C 3WRYC 2P2LA 3VHLB 5A4JA 3HYRA 1EESA 2C9CA 1ZJ6A 3TR5A 4LSGA 4LGMA 3O8RA 4QOSA 3U3MA 1MO6A 4A0RA 1SHKA 1XCMA 4DVGA 3IEVA 2F3TA 1QVRA 2RGBA 4QBHA 4BZXA 2RGEA 4Q1FA 4D2IA 1CRPA 4QGHA 4Y0VA 1VCIA 4BGDA 1YRAA 1GL6A 3ASZA 3LNCA 3QF4B 4JKYA 3FMOB 3H0KA 2JLYA 4K81B 3PUXA 5FPSA 2XXAB 4BEJA 3IBGA 5F2EA 1G19A 1HEIA 4IFEA 1EWRA 4PQYA 2W6JA 4EFMA 5L3VA 3BWDD 4M9QA 1ZINA 2JLZA 3TMKA 3WMEA 1OXXK 3B13B 3SYLA 2VP2A 1ZU5A 2TMKA 1VCMA 4QGFA 4QNMA 4ESVA 4CEHA 1NKSA 1KKLA 6Q21A 4ITRC 1R0WA 5JCZA 3VNVA 2GEVA 4Q4AA 1H8EA 1MRNA 5JWHA 1P73A 1D9XA 2H16A 1FTSA 3ECCA 1OHHA 3PEUA 4MRNA 4NYMR 1ZC4A 2RH5A 4Y0AA 4MRSA 1RJ9A 1W36D 3WYFA 3HJNA 2BJVA 4R2IA 2ZRKA 4TLCA 1T3HA 4TN1A 4EJSA 1E2FA 4C4PA 2ERXA 2OEPA 2JIZD 3MUFA 4DIEA 1SXJC 3PENA 2GDJA 3DVLA 1G18A 2JCSA 5FPHA 4Q7KA 4EQ6A 1DOAA 2I1QA 5EP1A 1GZSA 5KPDA 2F55A 1LFDB 1CS4C 3TLXA 3BC1A 1E6CA 2ZJ8A 3NDPA 2GRJA 3BORA 3CRW1 4EPTA 4LHZA 3ZD7A 1RYHA 5J4VA 3ZYCA 4BZQA 3K09C 3I8SA 1WDTA 2VBCA 3IUYA 1OFTA 4DWJA 1W4AA 1E79A 4JL8A 1KY3A 4U7DA 3KQHA 2Q3HA 1FZQA 1E1QA 2HXSA 1JQLB 3OF5A 3A37A 2PJZA 4KBGA 1HY3A 1G7SA 4LC0A 5AJWA 1VG1A 1E9CA 4CZ2A 4F38A 3R9XA 1U9IA 3JVUA 2YWEA 4RD1A 4X8LA 3FVQA 2FSIA 3CRQA 3RRZA 4DUGD 1U8AA 3MMPA 4D4MA 2FZ4A 4F93B 1V43A 3R9IA 4P32A 5CIQA 4CDGA 4GSYA 2JJ2A 4I1VA 2BM1A 2ZYTX 2BMJA 3WYAA 4B47A 2QI9C 4ARZB 2RGCA 1WF3A 1KTVA 5FTMA 1C4OA 2QMUA 1X1RA 3R20A 1R0YA 3ZQ6A 3TAHA 3I4LA 4TL7A 4JSTA 1OJLA 3ADBA 3NH9A 3U3OA 3UWKA 1L4UA 1UEIA 2CK3D 3KJIA 3QPUA 2RHDA 3KUCA 4CIDA 1GILA 3KKNA 4PSKA 1MH1A 3LWNA 5FL3A 3EZ2A 1GL9B 3QKSA 1XWIA 3L0PA 1V5WA 2ZUDA 1TQ6A 2IHYA 4IW3B 3AGPA 5TXGA 4RVCA 4EFNA 2EYQA 4YXWD 3NBYC 3U44B 1K8RA 1NIPA 1W5TA 1EGAA 2OZEA 3LW8A 1Z8FA 3OEEA 5CDFE 1Q20A 1DO2A 1SVOA 5EJEA 5KNDA 4DSUA 3PVSA 4KXFB 4QNRA 4LI0A 4B3CA 1IOZA 1KAGA 4XOIA 1N5LA 1YR9A 4C0AC 4DCSA 3VMFA 1UBCA 3UATA 2XGJA 4DB2A 3Q5DA 4X8OA 3T61A 3GJ0A 1FX0B 2I1VB 1M7GA 1VTKA 1ZVQA 2V3CC 4Q9KA 3N2IA 1P9NA 3G0HA 1G7CA 4HB3A 2QAGB 4NBSA 2VHCA 1G3IA 4MGYR 2F43B 4XIGS 1U94A 1U8YA 4A82A 1JAHA 1F60A 1GIAA 2GJKA 2G88A 5FBQB 4Z51A 4LJ7A 1B23P 3P1JA 4QBFA 2VEDA 1DTSA 4B35A 3A1SA 2OUKA 3O8BA 4OL0A 3IDQA 4QJ3A 1SVIA 3OZXA 1DE0A 1A2KC 4YLGA 1IBRA 2QUZA 3V4FA 1OF1A 4PSVA 4I1OA 3GLHA 1IN6A 4W9MC 1N6PA 1IY1A 1HQYE 1SZPA 4GRAA 5HZKA 4Q1DA 2DBYA 5KSZA 5J4HA 4B2PA 2Z43A 4WAUA 2HLDA 5KPJA 2VP4A 4ZI3A 2O8EA 2HUPA 2ORWA 1S1CA 4PQFA 5KYKA 1KK0A 3AVXA 2O0JA 1P7CA 2ZRNA 3PR1A 5EUMA 4XD7D 4Q9JA 1ZD1A 4LYJA 4OQXA 2BCGY 2QAGC 2ZRLA 1EFCA 1LW7A 5DN6A 1NRJB 3UXMA 5F98A 2O8CA 3VR4A 1DELA 1H8HA 2VIIA 1E2EA 5TVKA 4ON9A 2CXXA 1E9EA 1TF2A 3I5YA 3GLHE 3AVWA 4FN5A 1T8TA 4M0LA 4AURA 1Q12A 4DSTA 4H1VA 2OXCA 5J4KA 4KO8A 5DHAA 3V4RA 2GETA 3RLFA 3HYTA 2XITA 1OXVA 3DM9B 3CR8A 1YVDA 5LD2B 4FCTA 5JJKA 2WWXA 2YJTD 4RCZA 2PCLA 1NLZA 3U3JA 1EFTA 1SVLA 3ZIAD 2Q3MA 3W34A 4D81A 5L8VA 3IIKA 3LVRE 5EE3A 4NCNA 1G3RA 2R6CA 4HB0A 1U0JA 5FPYA 3RNLA 3CRRA 2BCJQ 1QF9A 1JPNA 2CNWD 2CVHA 4LYAA 4JT2A 2IS4A 1W48A 121PA 4B74A 5DHFA 2D3WA 3QXCA 2ZRCA 2FGJA 4M4SA 1KAOA 2GCPA 1T91A 3EIHA 4GT1A 1OLOA 3ZZUA 1Y3AA 1YU9A 2FFHA 3GJ4A 3VR6A 1Z0JA 4LUCA 4D0GA 1PUIA 2V6IA 1KI8A 3UG7A 3QPWA 4IHQA 3R9WA 1AGPA 4JL6A 3PXGA 3CX6A 3NHAA 1YQTA 4RZXA 1G20E 4N3NA 5EXSA 3GJXC 2FG5A 4M1MA 2WWHA 3LO5A 3QEJA 4HLDA 5B2ZA 3KL4A 2ZSEA 2VP6A 3CH4B 2GXUA 3CKLA 4PXAA 1II8A 4AYTA 1Z6GA 4Q01A 3SNHA 3BAFA 2GHIA 2W0MA 5CJ2A 1UKVY 1WCV1 3LXXA 1KKMA 4FXPA 2FN4A 1CXZA 4L9WA 1KO7A 1ZCAA 4LOAA 3Q72A 2IUUA 4DEYA 5JZVA 1Q21A 4V03A 4D4JA 2IYTA 3EZ7A 1CEEA 2O8DA 5EZ6B 2WHXA 4LHWA 5L3SA 1ZUHA 2MMCA 4L4UA 5DN6D 4A8JA 1DAMA 3EIQA 1Q0UA 4Q4AB 4FMDF 1R6BX 3AKDA 1VECA 3MWYW 5AUQA 1KI6A 3MFYA 1TNDA 1J70A 1M8PA 3AVUA 4F4IA 2ZE5A 1GRQA 5EXXA 5JRJA 4PHFA 4XVQA 3PUWA 1R5OA 4HZIA 3B9PA 2BJWA 2FX3A 5HPYB 2GNOA 1TU3A 3HP1A 4A92A 3LBHA 3CF2A 2N46A 2RGDA 2W6JD 1GKYA 1XFAA 2FDCA 3SDZA 2BMDA 4K8OA 1E2NA 4GZMA 1T4GA 2P65A 4EIWA 3OIWA 1E4VA 3B78A 4M9SA 2EU8A 2D7DA 2CHGA 1F2TB 1WQ1R 2GXSA 2IEYA 2WVJA 4JVSB 4AKHA 4JLDA 3LLUA 1AS2A 1JECA 2A2ZA 4Q02A 4XTCS 3BS4A 4L5BA 2GWHA 1P75A 2WWWA 3E70C 3IILA 4FMCB 5EXTA 4W5HA 1KSGA 1OPXA 3GFTA 2PT5A 4MYTA 3KKOA 2WMNB 2ZRIA 1YJ5A 3Q7QA 1ZW6A 4U5XA 4XSHA 2ZITA 2ZIAA 2QL6A 1LS6A 4LJ4A 1AS3A 2JLVA 1X3SA 1KY2A 1ZUNB 1Z29A 2BIFA 1D2MA 2D74A 2QT0A 3BD9A 1YZKA 2F1IA 5JI3E 5C4MA 4MKHA 2ERYA 3NEJA 521PA 2OILA 4PAQA 3AF4A 1LF0A 2AFHE 3GJ6A 4B43A 4B75A 4HDQB 2XZLA 3AVQA 4D0LB 1UFQA 5E95A 1Q3TA 2ASEA 3CONA 3KZ1E 3VR3A 4DBLC 1ZNYA 3C8UA 1CR4A 1AM4D 3DOEA 3T15A 4XH9B 2OV2A 3TQCA 1G16A 4A6XA 2H17A 2O0HA 3KXIA 5H1YA 1W49A 4F91B 4O0MA 3REGA 4OQMA 4TL8A 1P72A 3HPQA 3GFPA 1Z28A 3MG9A 2ZRJA 1TQ2A 3K9NA 4KCGA 4GZLA 1G7RA 4G5SA 4B76A 5TARA 1UPTA 2YKGA 4O25A 1XRJA 3A1UA 3AUYA 3GLIB 1QHIA 1ZYUA 1CR1A 3KUDA 1NVWQ 3VKHA 4XWKA 1C1YA 1PUJA 2G1KA 3LBNA 2BMEA
chains in the Genus database with same CATH superfamily
5B1DA 5CM8B 1QGAA 2Z5LA 5KMGA 3EWIA 1AV6A 1JKXA 1KPIA 3U48A 5IFLA 4G0MA 3RS9A 4ALMA 5BQXA 2LKCA 5CXXA 5CW2A 4KFSA 5B1SA 5JNSA 4DY6A 2NV0A 2JBAB 2HU2A 4LPKA 3UJ9A 1IJFA 1FFWA 1H4TA 1V4BA 1OI3A 3GAMA 1DQZA 3DDCA 1D8AA 1T6XA 2ZBRA 3HDVA 1DJPA 1XA3A 1QSGA 4B6SA 3S2UA 1U5AA 3JARA 3RYTC 3ZJYA 2RHHA 5EINA 4RDCA 4E5YA 2AFVA 3WO0A 3EPHA 3JQQA 1PK9A 4BOYA 5KZMB 5TMPA 1OXKB 4D1YA 2P9JA 3NH6A 1YCGA 3VH3A 5BUZA 1Z4QA 1GNSA 3HJHA 3IJEB 1XZBA 5IAGA 5H3LA 3X1YA 4P2GA 3W0LB 4CL8A 3ZDCA 3V1LA 4PLGA 4BRSA 2CDAA 1P7ZA 4DYDA 2VHUA 5KYVA 2B8TA 4HX5A 3KCQA 5TS3A 2RAUA 4N7RA 5CFMA 2FKAA 1GARA 4G5GA 4KX5A 2CJWB 3UFBA 1YI0A 3DVRX 3MB8A 3C3AA 5AIAA 1LA2A 4PEVA 4PO1A 4Y6GB 4YCMA 2EERA 3EF3A 2QRNA 4BLSA 1R7RA 4KFCA 3W8FA 4RKYA 1KJ9A 1M2GA 1M1NB 1O08A 2AL7A 5MN4A 3O2QB 3T06B 4JODA 2ECFA 3K8YA 2ST1A 3O1LA 3P0EA 1MQAA 1ELOA 1JBEA 2ORVA 3VQTA 2CN1A 2FYTA 4EEXA 3ZHCA 1Y1PA 4CIVA 4I55F 4RTNA 4LX0A 3KEOA 2BKUA 1BYUA 1XZEA 4EMUA 2BSXA 1VKHA 3RBXA 3D3QA 1V47A 2OAP1 1Q44A 2X58A 1H2XA 4MICA 1ZD2P 2GPAA 3RFXA 1ODJA 1U63A 3KPVA 3LC0A 3N2LA 3I2FA 2VDWB 1VFNA 1YRBA 3M6IA 1G5FA 2WUGA 4R0VA 4ZAYA 1ZMBA 3NJ8A 4GBMA 4P3YA 4DLVA 4RV4A 5TPWA 4UZFA 5KSWB 2OGWA 2MYPA 4RKEA 2X8JB 5AJYA 1ZGBA 1YDMA 3OX3A 2YHSA 4B6GA 3ZDZB 5T6MA 3L1UA 5ICGA 2PN1A 3K3PA 3FWPA 4G81A 3ZWNA 2FSVC 4TZTA 5EHGA 3WMXA 4DLTA 5K4HA 1T6BY 2XOXA 1LWNA 3MT0A 1Z17A 4UM7A 1BH2A 3CO0S 4N0MA 3ROTA 1DVRA 2ZGVA 2VYNA 3IT1A 4FGJA 3JQ8A 4MR8B 4R8RA 5E9QA 3W8EA 2CL7X 4IXTA 2EX4A 3R3JA 2O7VA 1NSFA 2A5JA 1J2RA 1ODSA 2BI8A 2WHPB 1MEOA 1S8FA 3O95A 1TCAA 1ZFNA 2HLPA 3OM9A 2HA6A 4LJ8A 3W79A 3BREA 3SBDA 3EC2A 2RBKA 3V8PA 4HLQB 2IWRA 3GR6A 2Q8QA 1OC4A 3M4XA 3EDRA 1IZ7A 5AVWA 4MI9A 1Z6PA 2ZUWA 3LQRA 2WFAA 2QRZA 4W6QA 1FP2A 1IXSB 3AY3A 1T2DA 1TT5B 3NKFA 3PLNA 1O4VA 5KAMA 2YHBA 2PSDA 5ER9A 3TPCA 2O20A 1RQ7A 2HWWA 1TA0A 4MQBA 1TJPB 4HRAA 5ER6A 1U7OA 1W5SA 2ID9A 4KRYA 3V1UA 5I9IA 3PC4A 2H18A 1M3SA 3AR8A 2EARA 4S1TA 4RFLA 1PD1A 2AMYA 3CY6A 5F2KA 4G4GA 4PZLA 3MJTA 4ME6A 1J22A 5ANRB 2HN9A 4ZT3A 1GU1A 1XTSA 2D5CA 3EQ9A 4KXXA 4Q3NA 3PPXA 1SBIA 3SX2A 1Y4DE 5C46F 6GPBA 2HJ9A 5I9BA 4B46A 3Q7IA 2C78A 1GTJ1 3MD0A 3S99A 2G63A 1JPVA 3UCEA 2PTGA 1UJ6A 1L5MA 4V0QA 4EVRA 1Y6ZA 5CP8A 1BDBA 4U6QA 1KNXA 1GYQA 1JU9A 2BY4A 1X7WB 2I62A 4ZO6A 4JENA 2HI0A 3GEDA 2DCUA 1LRJA 4Q34A 3CNHA 2UYHA 2H7VA 3LBAA 1NWHA 1QS0B 4H6WA 4WIAA 3R3ZA 1K5GA 1SWWA 2Q4TA 1VG8A 2R6GA 3SFZA 3H6GA 1L4EA 1X87A 1BZYA 4L5JA 4M8NE 1YKFA 4X0EA 1I51A 1M1UA 4FCVA 5A6SA 4A15A 4CLOA 3IB6A 1X7DA 2DKFA 5GIOE 1TYCA 1XGKA 3IKTA 3PWKA 1WOMA 4FR0A 5FHQA 1BIFA 3VZBA 5C2JB 3U4MA 1ND6A 4KQIA 1O94D 3CHYA 3ZBUA 1SCQA 1VZ2A 3G23A 3Q9NA 3THYB 4LBYA 4DR6B 1EQUA 1RYZA 3HKBB 4OGLA 3ILHA 3JS5A 5BR7A 1XLTA 4ZOBA 3MTAA 2P9EA 3VPFA 3GRUA 2RGXA 4INPA 4U2KA 1SUEA 2GEJA 4UHHA 3RS2A 3UQYS 5HM8A 2DLNA 4Y1EA 2F3SA 3EWAA 1IDN1 4U0JA 5JCOA 3JR7A 5FTNA 1M34E 3ZLJA 1ZNXA 3H5IA 1RYBA 2ZYHA 3KT0A 3EA5A 4YCAA 1FNBA 5EE5B 5IKEA 1OR8A 3GH1A 2C84A 4HUJA 4Z3KA 1AKWA 3KFXA 3S1AA 3KX2A 1BXGA 4CKZA 4QPPA 3T5GA 1IFXA 2EZ8A 1BOOA 2RB5A 4WZAA 2XT9A 1ORTA 3DKVA 4GIBA 2QOEA 5ESDA 2QW1A 1M2KA 4AZ0A 4TVBA 4ZAZA 3TLCA 2GDZA 2V9PA 2JJYA 3O84A 3OAAA 1EGHA 4RZSA 4ZHSA 2FTKE 5BURA 3KYCB 4F7DA 2FR0A 4GXTA 4DE5A 3C41J 1QFJA 1XN1A 4WTOA 1SQSA 1SQ6A 4JFRA 4HR7A 4BQPA 1NNEA 4GO1A 4B3DA 5BOSA 3SU8A 1AMNA 3FHJA 1RW4A 3LQQA 1OBHA 2BELA 4ZTBA 3ESXA 1J0BA 1HDEA 2O3JA 4ZHQB 3L7OA 2EJTA 4H9GA 4EY4A 1LI5A 1ZZGA 3DV0B 3ESRA 1RI2A 1XHLA 1AB6A 1A4UA 4TLLB 2JB9A 5FBVB 1OV6A 1HYEA 4O1HA 2VZEA 3SVZA 1ZRMA 1LK0A 5G0TA 1MZPA 1GHTA 3CPHA 5JW6A 1GG9A 1EM8A 1SXGA 2BFMA 2VPTA 3HFRA 4LOHA 4M49A 2XUGA 3JV7A 3QSYA 1NOJA 3W9SA 4ALNA 2GCNA 2Y1OA 1P7WA 4Q3LA 2ZJFA 1H9BA 3ZS8A 2VPIA 1G0NA 1KK3A 3ANXA 4JC0A 1H2EA 3QMMA 2RGNA 3TG2A 4JNCA 2OCAA 4OHFA 1VGQA 1BE0A 2A3RA 4KMOA 2FPXA 4HDNA 5TDHA 1JQKA 1ZM2A 4IIUA 4K40A 3EQ7A 2PVPA 4FGLA 4INAA 5HS6A 3JYNA 2OKGA 2PKQO 1E59A 2V1XA 5K9ZA 4R7GA 5GM2A 3KEMA 1L1RA 1BN7A 1P5JA 3E4DA 4ZCLA 1GG5A 3UXYA 3N2GB 3RC2A 4I2VA 4L7QA 5D00A 4A5OA 4EK9A 1OI7A 5GADl 4P4UA 5JBIA 2QP4A 5GJVC 1F5SA 5A7FA 1OTHA 4DZZA 5HUHA 1IY8A 3THWA 1NKVA 1ZIXA 1YQGA 2ZJZA 1OLUB 3HP4A 4GYJA 1WDMA 4TWIA 5G40A 3UJBA 1RJGA 2GF0A 1XTPA 5JAZA 1NRWA 2BMFA 3K0CC 4U7PB 2FP4B 3PYLA 1EEXB 4HYYA 5IG2A 1K92A 5K0SA 5ENZA 4RJLA 5LBUA 1K66A 3FPKA 2D7CA 4JIMA 4ZZ0A 2CCKA 4I4LA 5JS7A 2PXXA 2GAJA 3VVBA 4Z0TA 4J0KA 3NYRA 1CJVC 4E03A 4ECAA 3D6VA 1M67A 2QVBA 4C4ZA 3OT5A 1N2JA 4D8VA 1DOHA 1QONA 3KZCA 3NORA 4PLCA 1P8JA 2A86A 5AK0A 5CA0F 4Q3EA 2NV2B 3AP1A 4KR6A 3UNXA 1T1RA 3AMVA 2IEGA 2XE6A 2J0VA 4X60A 5KOIA 3I4CA 1WVMA 2ZDQA 3A70A 1O6CA 4LNAA 4UHEA 4P58A 4YMUA 4ZV4A 3IP6A 4I36A 1J24A 3D3KA 3WLSA 1M6VA 2VHWA 3E5MA 4HDRA 3JASB 1PNTA 2CHFA 2ECQA 2OQIA 1XNHA 3OIDA 4M0CA 4CL0A 3K70D 4REOA 1GSIA 1P2FA 1TYEB 4R5MA 2ZKLA 2F1JA 4MVJD 2FSUA 2HA7A 1JXQA 4EJSC 5AVSA 4QU8A 3NKVA 3O5AA 2XNJA 3ZDEA 4PLYA 5AICA 4C0WA 3C6KA 2V7EA 3H2GA 4M1ZA 3TTWA 5AUPB 5HWSA 1MOSA 1YBFA 2AN1A 2P1RA 3K9CA 4TWJA 3CX7A 4PM4A 4C4YA 1R5BA 3C74A 3T35A 1MO3A 2IYXA 1Q7GA 2CUKA 5CYGA 1SN7A 3H9GA 1T36B 2VLIA 2ZYSA 3M9XA 3ZY3A 4KSCA 4PLVA 1WJGA 1XKQA 3ELWA 3OZGA 3TDMA 1M75A 1JFFB 2BM9A 3AW8A 1XVAA 2A8YA 4KIUA 3CEPB 3UK1A 3KLNA 4QQNA 2JHGA 1P6XA 4HTFB 3JALA 4XFJA 3REFA 4CDNA 4E3WA 4UNPA 5D86A 2FEAA 4Q9HA 2GTPA 4PV7A 4IXMA 2ZYUX 4CTJA 1MEEA 1UOQA 3KZOA 2E18A 3VDXA 2BGJA 2KBFA 4LX8A 1EVLA 1K98A 1K88A 3FPFA 5CXSA 1BA2A 2D06A 2Q1TA 4YDRA 4QUJA 3TLYA 5I51A 2BFOA 5JEEA 1PSWA 3JQGA 4DLRA 5AXDA 5E4YA 1ORIA 3K7EA 3UAOA 4YR9A 2Z2ZA 1LC0A 2I6SA 2V3VA 1DAPA 1G8PA 4EJSB 4RY2A 5KKCA 4YPFA 4EJ2A 4J2OA 2AQKA 2V7UA 1O58A 1WCXA 2E1PA 3JZMA 2F64A 4KAFA 1ISGA 4Z4EA 3PV0A 4EW2A 3WWCA 2C42A 2O8CB 2MYTA 2V4MA 1DKMA 4E2XA 5A62A 4IVNA 4JJ6A 3TZCA 2DYKA 3H99A 5JROA 2CYBA 2Z8YM 3FBGA 5G0WA 5E2BA 3AL2A 4JKIA 4ZKEA 4KTVE 4AJEA 4D0NA 2ZB4A 1PS0A 2H59A 3FNQA 2LCQA 4YCLA 2WWYA 4FQ5A 3LCVB 4RD4A 4LY0A 2QNRA 1NC3A 4WNIA 3I6YA 1X3LA 2R47A 1CUSA 2VUTA 4LCBA 2RHGB 4E3ZA 1RPAA 3L8DA 4HDOB 5HJ7A 4L0QA 1FVHA 2BSAA 2Z1MA 4JH0A 4RTPA 1N2IA 3CW2A 4WFKA 3D7SA 4MA4A 3WLAA 1TTTA 3VISA 1TM5E 1MAAA 4OYLA 1PT7A 2JHCA 3DFMA 1U0HC 3HJUA 4NICA 3WB1A 1E2JA 2OMEA 1I9GA 1UXHA 4JWKA 1QO7A 2XCQA 4WKGA 5FNVB 3RAGA 1PV2A 4YJGB 1ST3A 3SJZA 4ZGGA 1GQFA 2WKPA 3CURA 2EXXA 2RK4A 1O9HA 3GA0A 4FYVA 2WVHA 1MH9A 1S6YA 5KOJA 5KYUB 1BVHA 4M37A 4MUBA 1L2TA 1XL0A 2G9RA 2UUAB 4GKVA 1E9SA 1L8QA 4D43A 2V6GA 2GVDC 3NBQA 3RANA 5AW1A 2G8NA 4OJQA 2F4NA 5HMMA 4FD2A 3T6KA 3JWJA 3ZCQA 1QHGA 4Z4CA 1X1AA 1P62B 1CUJA 1T4CB 2SHKA 3FVRA 3GB9A 3KYIB 3WDKA 3WLNA 4DMFA 4DLNA 4NBWA 4NVRA 3P0RA 4IO1A 5FYQA 3GBPA 3S28A 4ABYA 1UIMA 4ARUA 1A69A 5BSGA 1EFAA 1OXUA 1BXRA 1TB4A 2Q3CA 4PAWA 1KVUA 1A7AA 5H70A 1DBVO 4AC9A 4UCXA 3UPUA 4RMIA 2FEOA 2VWQA 2IJGX 3HCAA 1BMDA 1W93A 2JVJA 1U80A 1DAGA 4BMVA 3P9RA 2OO5C 3GVPA 3MMNA 3Q3EA 1G8GA 1XTJA 5H59A 5LMZA 1KMHA 3MWLA 3U4IA 1WMBA 2Y1XA 2J41A 4TMTA 4B3HA 5FEUA 5BSHA 4OHWA 2YV5A 4EO7A 4RLSA 5E1BA 2BHNA 3FTNA 4OVKA 5GGYA 4H7HA 3CEJA 2JAXA 4UBMA 1SC9A 3IQDB 5FI0B 3DCYA 1URPA 5ALQA 4EQZA 5JS8A 1RC1A 2TRSB 3LMKA 3D4BA 3OTQA 4B7XA 4JEHA 1XNJA 3IO3A 4O2BA 1RPNA 3IRUA 4XYEA 2JGAA 2IY9A 3NHPA 5CFQA 1F3LA 3DUFB 3G9QA 1WCIB 5CH8A 2YCBA 3J7TA 1IK6A 3CE6A 4KQEA 3DTVD 5KDOA 3MHTA 3EXFB 5I8WA 3PQDA 4IVQA 5EOVA 1RRFA 4HT3B 1ZD4A 4I4NA 3PT9A 3LL4A 2IH4A 4OOEA 2UXBB 3WG9A 4HZUA 4MUGA 3M89A 4NYJQ 4GAEA 4QOHA 5EYPA 3JCZA 2RI6A 1J25A 5L4NA 1E3MA 2VJNA 2O2SA 3DE2X 3MQ4A 1QTIA 4JR1A 4AVYA 4CG0A 3L40A 4E46A 5KC8A 1ITZA 5CIYA 1L7RA 1SHTX 4ZEOA 1OLSA 2GAIA 2YZ2A 1TMKA 2JGLA 5LDGA 2WIKA 9ABPA 1NMQA 2C4KA 4OLJA 2F67A 4U9UA 5A7GA 1G2OA 4GEKA 5ALOA 1MPXA 4Q7JB 4FFMA 3GQBB 4NXMB 1Q0SA 3GLQA 2PRIA 5KQGA 5EAIA 3TUZC 3ZDBA 4QFMA 2QRMA 2CHUA 3JQFA 4R2XA 3R9XB 5A06A 3CSDA 1DEAA 3QOXA 2ZRGA 5C8VA 3MTJA 1NTRA 1O96A 1VPTA 4OQQA 2ZRMA 1F38A 3LK6A 4QPJC 2AYZA 1AHPA 1GAXA 2OWEA 4MVJI 1MJHA 1EBBA 3P2YA 2FMTA 2W90A 1XIVA 2QTWB 3RYFA 4HNQA 4QTXA 4XSVA 1LB1B 3TLJA 3ZTWA 1KI3A 2LIPA 3WLFA 1N2OA 3K0EA 3SEZA 3CX4A 3PE6A 2CXOA 5I3ZA 3QKIA 2BFAA 3UB4A 4QUEA 1QLJA 5ARBA 1R18A 2C92A 2R6AA 3GJQA 4OJNA 3IIMA 2QQ5A 3N5CA 5AXAA 3DDWA 3UICA 4BFCA 2W2VA 3AM4A 3ZHRA 2O50A 4E5PA 1FYXA 3BFPA 1U90A 1Z7YA 4A36A 2MSEB 5KHOC 2GEFA 5COAA 3TO5A 3G2QA 3K8QA 4RXTA 2ZWPA 3AHIA 4AO8A 5I7VA 5JZSA 1UEXC 3DPUA 1MO4A 4M9UA 4L07A 3EMVA 1L7PA 1MFZA 4OXXA 3LM8A 3A6FA 4YP6A 2Q7OE 5JYEA 1UODA 1UBGA 2P9GA 4Y2XA 1YVEI 3PIDA 3RREA 1KGDA 2C8VA 1ACLA 2GCOB 3HCWA 4U8HA 5BR4A 1CZUA 2A1TR 2C7OA 4KKXB 1JR2A 1KZ9A 2C4HA 1RLMA 1TU4A 4ETWA 4D02A 3W5AA 3SF8B 4EGSA 5CHEA 1PR3A 2NVWA 2XDAA 4YBZA 1K06A 4A73A 5CGZA 4XYMA 2GA9A 1A98A 2O05A 1JWBB 4KUHA 3SR0A 2J31A 4WINA 1J0CA 1UBNA 3G88A 1HF3A 3ICCA 1PIWA 2OGUA 4NAUA 5LQNA 1QGUB 5E38A 3QFCA 5IW8A 2E4WA 3T7KA 4PZPA 3FCYA 3NWJA 1KTIA 3ABSB 5ILOA 5F35A 4AJ9A 4RF5A 3W9BA 3RF6A 1TKRA 4HNHA 4QG7A 3ANSA 1L5KA 1ZD3A 5B7NA 4GICA 4I9HA 1CUDA 1G17A 3HFGA 3KS9A 4LDJA 3SF0A 2XRZA 4EGJA 4G89A 4G86A 2V8BA 3K4PA 2H1RA 2UDPA 3CKYA 2I80A 3QBJA 4HN9A 1BS2A 1NAHA 4IS2A 4R2MA 4MQFB 2NUTA 2JLAA 2D5IA 3FAZA 3CU5A 2P4QA 2XV1A 1XTQA 4BP3A 4D9KA 4DA8A 3OMLA 1K6MA 2VFAA 2WJAA 1T4CA 1CY0A 3BUSA 4UMEA 5CH3A 2QXTA 4BCBA 1HETA 1BKDR 1FP4B 1W1WA 2GUGA 2D1TA 1LTKA 3FFTA 4LXGA 16PKA 3UHJA 1OXMA 2CE2X 2PBLA 4FQ7A 3W7BA 4A1FA 1YCFA 1VPEA 3IGFA 2PS0A 4ND4A 1ZK3A 3Q88A 3FDZB 4M8IA 3L7LA 3WOHA 4BECA 4D4GA 1AT1A 3TOXA 2BDUA 5FA6A 2FDRA 3WJ7A 2XMZA 1L5WA 2ZBFA 3BMOB 1KMMA 3GT3A 2JLSA 3U9LA 2G1PA 2PA3A 2R7NA 2YXPX 4A0FA 1M1XB 2ROQA 2XDWA 3DO6A 3IBSA 3KIPA 4YCDA 1GTL1 2JD2A 3JARB 2QTTA 4RPCA 1HFKA 2D0OB 1XRQA 2OG2A 1VKZA 3VXKA 1R9MA 2H2DA 4YR7A 2B8JA 2B6HA 2YYYA 1DAOA 2BYTA 1QOZA 3L77A 2WTEA 3B2QA 3M3PA 2HCRA 3IEUA 3SHVA 3FSRA 1CT9A 1KI2A 2IYQA 2RKOA 3WK4A 1CFZA 3QFRA 3I5XA 1U4NA 3K32A 1PWEA 4RORA 4TTQA 5LC1A 3KAPA 4WDQA 2R5NA 4NYMQ 2NO1A 2X3FA 5FI5A 4KMMA 4X91A 5LL6P 4QX6A 3BGOS 3GH3A 2QRKA 3V7WA 2WM9B 1FIUA 2C2MA 3W8RA 5ALUA 3STTA 1W25A 4DC0A 3DHEA 1WSWA 4FWTA 3DWEX 3LPMA 3NDBB 4EVIA 5CB8A 3BWEA 5TQ0A 2FCAA 3TRHA 2ZAOA 3GGOA 1H85A 4M60A 3V7YA 4CKBA 3GC6A 1I7PA 2BZ0A 4KRGA 3KEGA 4B1FA 4EB0A 4YT4A 2IS2A 2HA2A 1WB6A 1MTZA 1ZM9A 3ORQA 1K3TA 3TIIA 1V1JA 3DAGA 4QM6A 4LWOA 1AQNA 2CLEB 2P11A 4QOEA 1GUFA 1T9ZA 4KFRA 1LBIA 3COZA 4L5YA 3QK7A 4RMNA 1PBTA 4FFWA 4TKMA 4AIIA 1Z4PX 3NHYA 3OO1A 4B0OA 4F86A 1Z13A 1BMQA 1AO3A 4RLQA 3DLBA 3CLKA 2WJIA 2YOHA 4R9UC 3DYBA 3C98A 4KX3A 4NWIA 4UEQA 3TLMA 4Z53A 1BE1A 2PSEA 4RM3A 3PK0A 2V6BA 2BTQA 1L4MA 1UP7A 2YY6A 2VAWA 3PL5A 1N2EA 4AK9A 5DNUA 2GJAA 4WGGA 1GCAA 4ZANA 5CRIA 3O26A 4RIIA 5JISA 3CISA 3PZBA 4DMGA 2Z6AA 3L7KA 3UPTA 2FX2A 5HFAA 4QKQA 2H52A 2G17A 1NJ8A 1PDOA 3BHJA 3QWAA 4AN1A 4P35A 1NQXA 1L5ZA 4P0PB 4PPQA 1R8JA 3O31A 1KZHA 4Q4HB 1PW7A 2J7PD 1DJOA 2CLSA 1YR1A 3COSA 2G40A 3G0OA 3I2KA 2OAQ1 3KUKA 4R2JA 5CYOA 4PG7A 2PU5A 4D4LA 3O4FA 4BVGA 1FUEA 1KDYA 2J46A 4PR3A 3CN7A 3LNTA 4PWZA 4YFYA 4RGYA 1U0OC 3D3NA 1EFPB 3HL0A 5ALZA 4EI8A 5J47A 1TT5A 1TOAA 3ETGA 2FSGA 3H18A 3MEQA 3NM5A 2AYYA 3R77A 4G67A 5FOUA 1P9RA 1PYOA 3SJ7A 3X43A 5C35A 2BBTA 1H5QA 1JBQA 2RGWA 3FCCA 4FDMA 4EELA 3GRFA 3KQWA 3G85A 4PCLA 1QRUA 1KVTA 1XJWA 1CJSA 3N6XA 4FT2A 4DQXA 5I9NA 3LU1A 5JATA 3EEIA 3D8SA 4XLTA 2Q6TA 1RBMA 1VHTA 2AK2A 1IHUA 3THRA 4NEGA 1MJFA 3E81A 4PZAA 1ZVJA 3HRHA 1Z0KA 3GV0A 3T7RA 5TQ2A 3QELB 3E23A 1W5EA 2ZJYA 4EFKA 5I9LA 4KXUA 4WECA 5E8RA 4ISCA 1RAEA 3OPNA 3A0UA 3OA2A 3EDOA 5HDBB 4DJTA 2HLHA 2X4IA 4OLFA 1QIEA 2KM1A 4QZVA 1ZGZA 1DV2A 2MINB 5DSZA 1ZEMA 3PICA 3U7QB 4XJXA 3T52A 5JHHB 4G8CA 3B3QA 4M9CA 2CBXA 4RK5A 3CLUC 5HE9A 4KXYA 3ZDDA 3CT4A 4X3CA 1QZXA 1YBHA 2WNSA 2ZR7A 4MJ3A 5CFZA 3D31A 1QRAA 1EIZA 4UTNA 1PWYE 3ANLA 3RTBA 1ZU4A 4BKQA 4XQEA 1ZQ1A 3JQEA 1UJ4A 2B9VA 2IYWA 3LQYA 1ZUNA 4ZC1A 1DSSG 4EBBA 5I7OA 1MVLA 2REQB 3F6RA 2JI9A 3NHJA 1P74A 1FNMA 2QY6A 5FPPA 1XMJA 1YB6A 2H1HA 2YOGA 3C3YA 3HVJA 3BMXA 4KRXA 1E2KA 3DXFA 1ZI9A 2VAMA 1ZIPA 3G5UA 3GQVA 4NEQA 3GPBA 4JJ8A 3S1AB 2B4QA 4WD3A 4BN5A 1KI7A 3C8HA 5A5EA 2VXCA 3L82B 4N1AA 1R16A 5K6AC 4UDXX 3BD7A 4KQHA 2XWBF 4DMMA 2A78A 3RS0A 4ROTA 3HKCA 1VYTA 3A28A 3LI2A 1FXWF 1Z7GA 3A6DA 3NG1A 4Q1BA 2ZS9A 1IEXA 4EHDA 2L42A 1Z15A 4LE2A 4MSUA 1ZESA 3OHMA 3L7DA 4DQUA 2WWRA 4X71A 2ZRAA 2RMKA 2I91A 1T5IA 3G2MA 1NSYA 3JAKB 3KLMX 3LVBA 1JT2A 3GNLA 2Q3BA 1Z6AA 2C2GA 3QJ5A 4OHRA 3GRKA 4XWOA 4C9BA 4C76A 1RXSA 4HN2A 2Q3DA 2R8RA 3R1IA 4EGQA 1YJ8A 3AUTA 4K2HA 4C0SA 2WKWA 5K8LA 3FMIA 1RZUA 2ZYRA 1PL0A 1TT7A 1OD6A 2QUBA 1X7XB 3KC2A 3ZV7A 4UU8A 3K70B 1W75A 1EAYA 5D3ZA 1KKUA 1ZLXA 2EW8A 2FMIA 3UMGA 3RG2A 3LX6A 3G2LA 4NS4A 4WFJA 1SELA 5DVZA 5A1TA 3VKVA 1PZMA 1A5AB 5E6UA 1C0KA 4B33A 3IJRA 3Q87B 5JASA 5KQMA 1EUCB 9LDBA 1PVOA 1ISPA 4NMMA 1N6RA 3JQPA 5DNCA 3FX2A 3ZE7A 2MTBA 2BMAA 3F98A 1WBBA 1GOTA 3Q9UA 3IAS1 3QG5A 4M1QA 3N2EA 2UKDA 4H18A 5J23A 1AUXA 5LP6A 1V5FA 1SOUA 3C1UA 4YJDA 2IU0A 4NESA 3CVOA 2ONJA 4EHKA 5LPNA 2XMDA 2XBMA 3FOWA 5T3YA 4GKAA 3T7SA 5K01A 2AOVA 4KACA 1CY1A 1F2UB 3HYLA 4BQSA 3PX2A 3VGJA 4IF6A 1CZKA 1WEKA 1W2HA 2HRZA 3IS3A 2ZXFA 4LIPD 4W82A 5FUXA 2F9LA 4O4HF 4Z9XA 5BY2A 3OIUA 1IUKA 2CLMB 4LJLA 4MW6A 4HRXA 4NDAA 4JI3B 1XZIA 2Q3EA 3CWCA 1M34A 3P2IA 4UPEA 2FR1A 3TTSA 4D5EA 6NULA 2QRLA 1YRQA 2JJ2D 5IDVA 4Y7DA 3FIUA 3PT5A 4R8VA 5AKEA 1ZQ9A 1WXIA 3ABOB 2FJ0A 1V6AA 3TD9A 5HGXA 1TRKA 1CZRA 4OAQA 4L28A 2OESA 1Y8QA 3OU6A 1YK1A 4YCJA 2B1RA 5KNDH 4OTZA 4HADA 4M21A 3RRFA 5KVCA 3AHJA 4M0EA 4Y6RA 2A7QA 3PQ3A 3KR1A 3Q3CA 3QJGA 1W5AA 2F3RA 1RRMA 5HF9A 5BMVB 2FW6A 1ZOSA 4OMCA 2W93A 4FS3A 3PQCA 4BZZA 4YRAA 1RWWA 1L5OA 1CNMA 1GXSB 1Z4IA 5AKJA 4DAEA 4GZ5A 2DPXA 3AM5A 5BNFA 4Q16A 4UCWA 1YGYA 2J9ZB 1BHO1 3I28A 3M2PA 4JGBA 3MILA 3SSNA 4BO4A 4NF2A 4UULA 5L7YA 1DAEA 5DM4A 3AKYA 3OHSX 2P6UA 3MINB 2HIHA 4DADA 3AUKA 3KD2A 3SCZA 1RXYA 5ELLA 5LR6A 1RWXA 3I6IA 4MQ4A 5AKXA 1SULA 2B21A 5EP4A 1LV8A 5EIHA 1T1SA 5GJCA 4BCCA 1AH2A 2X2PA 3HA2A 1NXPA 1C2TA 3L6UA 3G02A 3LAWA 2PMKA 3ONDA 4QUBA 2YRXA 5KEIA 1OXSC 2L17A 3H9EO 3L0CA 1NW3A 3GJYA 5D85A 3ZI7A 4CM4B 4JB3A 2PL5A 3EZ6A 4GRIA 5FLEX 3B60A 3N8HA 3N7UA 1DI0A 2P3SA 4HFMA 1TVKB 1RXVA 3BBLA 3GVHA 4RK4A 2XGSA 2QS9A 2E87A 4C0BA 4HGNA 5E2AA 3TZHA 3P9YA 1ZBDA 1C1DA 3GO4A 2FEPA 1XT6A 2F8LA 2FB9A 3QKWA 1BSVA 4F1KA 3QLEA 1CUFA 2PT6A 4BQQA 1O5OA 3PQ4A 3ETLA 3SKVA 4HNVA 2CF5A 3RJ9A 1S3IA 2HDHA 1IZ9A 1TAGA 3BEDA 4S2UA 1FBNA 4ABTA 2VYVD 2NMVA 3PJFA 1AGYA 1YL5A 2Q62A 3ILVA 4MV3A 4ENWA 2W98A 2HMUA 4OK3A 2QORA 4GW3A 3QW4B 2PZLA 3NTVA 5C1DA 1BCRB 2E21A 3MTBA 3RYHA 4Q9LA 1TEXA 3ZY5A 3NPMA 3FOZA 1MV5A 3I83A 4HGQA 3U3RA 1G8AA 2P2YA 2DM6A 3RTEA 3HJTA 1NN0A 2PX5A 5JQGB 2VWHA 3NBZC 4ZPJA 4BLVA 1Q1ZA 3T1VA 2FDXA 2PSSA 5E1MA 2ZJ5A 4UATA 3EB9A 3LY9A 1KP9A 4QFCA 4Q93A 3RI3A 5BSKA 3W78A 4N8EA 3EGXB 3VR3D 3JRNA 3OI7A 2JGDA 4HVCA 2IPLA 4F5YA 3ADKA 3TVTA 3P27A 3PQ5A 1GNQA 4TWRA 1FSPA 3WLOA 3FUVA 3HCFA 5ILGA 4PNEA 2PDAA 1DC6A 2DFNA 3GJ3A 5A5DA 3U7IA 4TYWA 2AJLI 1GNRA 1PYDA 2RJNA 4PLTA 1G9XA 4JYZA 4NTZA 4PHGA 4BZPA 5I8ZA 4D9CA 5HW0A 3SJAA 4O2BB 3EBLA 2PU7A 3QFHA 4XYBA 5JNLA 2I9KA 1TKBA 3D64A 1NRIA 3WGLA 3QQPA 3V4OA 3VTZA 3SQWA 3PDCA 2NW6A 3PI6A 5D2CA 1JSCA 5FPQA 1Z22A 1PJSA 2QEQA 1JL3A 2DB3A 4G25A 1REQB 1MHTA 2IUFA 2PD6A 4JBHA 4D74A 5EJ9A 2NTVA 5FYDA 1XJ5A 1CVLA 1A9QA 1O89A 2I99A 1I3NA 3AJEA 3OQIB 4QA9A 1Z2OX 2OXRA 9ATCA 2C04A 2C3UA 1HO3A 3VH1A 1WUHS 3W3AA 1Z2CA 2ACKA 3I32A 1SGWA 1IOWA 1UT5A 2L0XA 5IC5A 5CAEA 5JU6A 1TPYA 4MQEA 3KVVA 1A0OA 1F2UA 2FU5C 1FXWA 4WZ6A 1YACA 1IU9A 4HFRA 5GPBA 1D2GA 4F1JA 1Q91A 3NAZA 3W6OA 3V8MA 1P2UA 7AT1A 1ARZA 2HV8A 3U81A 1RIFA 2A7XA 4Z4FA 2ASVA 1J39A 3PIIA 4UBLA 3AHGA 1A9XB 1LTQA 1JDPA 1K1EA 4Z1MA 2QR3A 2Z04A 3FNHA 1GTVA 3CMCO 3TINA 2WKQA 3OZRA 4EI2A 3N7AA 1VMKA 1OX5A 5IP5A 2YS7A 3R44A 3ZXSA 1UR5A 3DEIA 5ITWA 3RFVA 3KB2A 4MHTA 3B1VA 1S7CA 4JYAB 4HGPA 4PAMA 2O07A 1ZKMA 4KSBA 4ZCRA 2UZ0A 1EUYA 3IJPA 2QRHA 4BHTA 4OI2A 4YX9A 3V1TC 1G0OA 2ZANA 4RZ2A 5EZYB 1UAGA 1FEZA 2LCIA 4FC7A 5CCEA 1V16A 4HDMB 4ZOEA 2FSHA 5K3SA 2HGZA 4Q4JA 2I3BA 5JLAA 3QFTA 4MA0A 4TROA 3ZTYA 4P7KA 1EUZA 3H42B 3H1EA 5SY6A 3WIVA 1U11A 3E15A 3JQBC 4KPYA 4W6ZA 3GJRA 3ROMA 3M3HA 2ODWA 1WXQA 2BM0A 3KG2A 4MUYA 4KE9A 1MA3A 2PGOA 3E22A 3W5BA 1L6RA 4IV8A 3IULA 1T26A 1GSOA 2HMYB 3I73A 2G5PA 4OB7A 4TM8A 4G01B 5HQTA 2WJWA 4GRDA 3S1SA 2Z30A 2ZUBA 3LO8A 2O23A 2VP9A 3MF4A 1AK2A 3SD7A 4YYZA 1EIWA 1USGA 5LOVA 4ESEA 1E5QA 3VPDA 1I2MA 4MP3A 3IAEA 5DU2A 3VDMA 4KN6A 4MEAA 4QQKA 1PNRA 2Q5OA 2WIAA 3WBBA 2QXYA 4FNMA 1MNQA 3GD5A 3WGJA 3DP7A 4EJ0A 1QE0A 3B7WA 1E89A 2J3KA 3FYHA 3GA7A 3DCNA 4G5HA 4RJ2A 3FFBA 4YWJA 4ZOQI 1NVVQ 3QLUC 1YRHA 3ZVKA 1E2DA 2OFXA 2XGOA 3TKLA 1ZOLA 4DIDA 3KALA 3C3WA 1TXGA 4DRXB 3EX7C 4G3XA 1O96B 1ZNZA 1AQUA 4BQFA 2B69A 3V2HA 1E7YA 2XCSB 3DDUA 4N12A 4OHVA 1O95D 1GZHB 2C4UA 2VS1A 2BDTA 3HJRA 3A1NA 1HEUA 3Q7PA 1WE2A 3R40A 1X80A 3RSCA 4P1ZA 3I6QA 3ZH2A 1FQKA 3QWBA 5FV7A 1QTRA 2GSDA 2ZBUA 3KT8A 1TW3A 2N9UA 2QTGA 1CUAA 2Z2YA 3GP3A 4MULA 4O5OA 3BMNA 4KNWA 1PFWA 4DCTA 2RHMA 2QPTA 4FYIA 4KIJA 4LI3X 2FWRA 1E0AA 1S01A 2OXTA 4V0OA 3OG9A 3L02A 3ZZNA 4ICIA 3H04A 4TSRA 2P79A 3T9FA 4FFNA 3QVSA 2BV3A 1IBMB 1SKQA 5WRFA 4DUGA 1NDUA 2PXAA 1P9LA 3G8BA 3TS1A 3KJZA 5T57A 5G0SA 3HE3A 4E09A 4PYOA 4R2WA 4M7WA 1R0KA 2BUAA 4ZOCA 3A7EA 1P29A 5JSQA 2WW8A 4M99A 1Y81A 2ZRFA 4MR7B 2FWJA 1K6JA 5H80A 2VJYA 1OIVA 1Z2PX 2OR3A 2PAAA 3F3MA 5CDSA 2BP7B 1J9GA 1SXJB 2P3LA 4J0DA 3MB5A 2BH9A 4ARAA 3Q7SA 3AU8A 2HXGA 3QTTA 3QU7A 4CHTA 1TD9A 2IYVA 2VAPA 3ICPA 2V03A 2WHEA 3EN0A 1FC0A 2E37A 3OWOA 1QDLB 4E12A 3INTA 3SIRA 2MSCB 3W2FA 1RP7A 5B3LA 2TECE 4OI4A 1N33B 3S5UA 2PR7A 1OWMA 4PVDA 1Z16A 3H84A 1KRXA 1JHOA 5BNIA 2YL2A 4CEHB 1F0YA 3OZEA 1XTBA 3AEZA 4NONA 4PYKA 1LJLA 3KQPA 4F21A 3PTAA 2H3HA 4L8YA 5KSPA 4IDAA 1GPDG 5DB4A 3ZWAA 2NWQA 5DE3A 1E64A 2BISA 4I1RA 2EGHA 3UTDA 7MHTA 1LU9A 3O91A 1HOXA 4G63A 5E4JA 4PC3A 3OZVA 2DQ4A 5ECYA 3TFQA 5L7TA 4ADSG 2AFIA 3O93A 4FQ8A 1JSRA 2P62A 3LZDA 4Y8VA 3B82A 5G0VA 3TBHA 3GJZA 4C87A 4