3REGA

Crystal structure of ehrho1 bound to a gtp analog and magnesium
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
171
structure length
171
Chain Sequence
KKALKIVVVGDGAVGKTCLLLAFSKGEIPTAYVPTVFENFSHVMKYKNEEFILHLWDTAGQEEYDRLRPLSYADSDVVLLCFAVNNRTSFDNISTKWEPEIKHYIDTAKTVLVGLKVDLRKDGSDDVTKQEGDDLCQKLGCVAYIEASSVAKIGLNEVFEKSVDCIFSNKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rho-like small GTPase
publication title Unique structural and nucleotide exchange features of the Rho1 GTPase of Entamoeba histolytica.
pubmed doi rcsb
source organism Entamoeba histolytica
molecule tags Signaling protein
total genus 54
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3regA00
4XD7D 3RC3A 3U44A 1HY3A 1N6OA 2WKQA 5TY0A 4LJ4A 1GFIA 1T3SA 4FINA 4AG6A 2O8CA 3FE2A 2ERXA 1NKSA 3BXZA 3GLGE 4KI0A 4OQFA 3FMFA 3KKNA 3RC8A 4LYAA 1N2CE 1ZM9A 4O25A 1VCOA 4E09A 4H1VA 4KODA 3IDQA 2XB2A 1QVAA 3EA5A 3VKHA 4Q9IA 4M4SA 2F9LA 4X8LA 2QMEA 2QP9X 1TQ6A 1T5IA 3AQ4A 4NCJA 3BBPA 1XD2B 3AVYA 3OHMA 5FL3A 2NQ2C 2ZYVX 3H86A 3SYNA 1F2UB 3RSLA 4DEYA 1TUIA 3CLVA 3DVLA 3ZS9A 4ERNA 1BS1A 1RZ3A 2EWVA 1YZNA 2O8FA 4JLJA 2ODWA 5KDLA 4BZXA 2J0SA 3PG5A 1NKTA 3PCRB 1BIFA 4A1FA 4B6EA 1KI7A 4Q1BA 3A1WA 1SVMA 2ZUDA 2VP6A 4Y0AA 2P6RA 2ASEA 3VU9B 5KDDA 1YE8A 2Q3MA 1P4SA 1F48A 4URYR 4LJ7A 1FQKA 1SVWA 4NONA 2RGAA 2EFHB 1KO1A 1T9HA 2QEQA 2ZEJA 4DDVA 3QSYA 4RVCA 1R0WA 2FDCA 4WBSA 3L2OB 4PANA 4L5BA 1MABA 1XEWX 2QP4A 2RB4A 3OESA 1Z6AA 4OHWA 1SXJC 3ZD6A 4HAYA 2O8EA 3OFND 3B60A 5H68A 4BE7B 2HXYA 3IEVA 1FOEB 1FW6A 3WMFA 4NYMQ 3U2QA 2ATVA 4H1UA 3K70C 4NYMR 2DY1A 3QE0A 4LJ9A 1G7TA 5BQ5A 1XTJA 3I8XA 2EFGA 1NBMA 2HT6A 1NMZA 1RPZA 5CITA 4JT4A 2RGEA 3MAAC 2B7BA 5EXPA 2FX3A 3FHTA 2QAGA 2TMKA 3TVDA 1TMKA 4GOXA 3RDPA 3T34A 1GKYA 3ZYCA 1LS1A 2ZSFA 4ARZB 3ND9A 3SC3A 1DOAA 2F1HA 3D31A 1COWD 2ZI4A 3U3OA 5L3QB 5F2EA 3G0HA 3O8CA 1E9FA 2V54A 1SVKA 1RE0A 5D3MA 1OH7A 2DYKA 1Z29A 4IOKA 4QGHA 1HE8B 3RRMA 1GNQA 1G7CA 4CW7A 2CL0X 2OV2A 5HZKA 3AVXA 2OILA 3GJ0A 1E3MA 2HV8A 4Q9JA 4JIMA 4UNPA 1RKBA 2XZLA 3QOFA 1GZSA 3DEFA 1EFRA 4GDFA 3QEOA 4N3NA 2ZI3A 1D9XA 2WAXA 2DFNA 2PX0A 1WP9A 2JJ1D 2W0MA 4HUQB 4LC0A 2QP3A 5KO2A 1W36B 1FMJA 3Q8XB 1IXRC 2KBFA 3BH6A 4KLZA 4ZO4A 2FSFA 5ANRB 1G5TA 5L3SA 3HU3A 3I92A 4KYIB 5JCPA 3NEJA 3PEVA 2XXAA 1VHTA 4W7SA 4FWIB 2EFEB 2R6CA 3AP3A 5KTYA 2WM9B 4OKSA 2N42A 4IDQA 3KKQA 4BLPA 1ZUNB 3DPUA 4CVNA 4ZIRB 221PA 1Q1ZA 3U61B 2B21A 3GJ8A 3KTAB 3GCGA 4JLNA 2OAQ1 4MRRA 1XB2A 4QG7A 2WPDA 1GNPA 2KB0A 3RS4A 1PUIA 2GF9A 5J4KA 2ZRIA 3A1SA 2RMKA 4WVFA 4PR0A 1X86B 2ZQ5A 3GLHA 4IDHA 4D81A 5LB2A 4M1KA 4D6PA 1QHHA 2ZPTX 3QXCA 2V7QA 4IDNA 4AKEA 4XWOA 4PO1A 1AGPA 4XSGA 4Q1EA 5FPHA 1BMFD 3MUFA 1QF9A 4RFSA 3RAPR 1U9IA 1AA9A 1Z0JA 2XX3A 3H4MA 1RYFA 1IN5A 1OB5A 3T06B 3P32A 4IDPA 1ZCBA 3FHOA 4OQXA 4TLDA 4WIAA 1JB1A 2Q9BA 3EX7C 1J90A 1AZSC 1N6NA 3CONA 3EIQA 4UXJA 1JECA 2I3BA 3W6PA 1XMSA 3NH6A 3CF2A 2Q0HA 4DJTA 1NLYA 1RVDA 1KK0A 4WAUA 4G0NA 1KK2A 1ESNA 1E0JA 4AD8A 3IILA 2YWEA 4V0OA 1UBEA 1Q1BA 4B32A 4Q4HA 5FTLA 5G53C 2ZRFA 1FZQA 1Z0AA 5G3YA 2IS1A 4TL6A 3BK7A 4CIDA 1G8YA 2WWHA 2PT7A 2W6IA 3KUCA 2AK3A 3LX8A 5EE9A 5EE1A 1CIPA 1I2MA 2RGDA 4FMDB 3TQFA 4TYYA 1ZMXA 4C7OA 2V1XA 2ANCA 1EFUA 2BKEA 2OEPA 2XOKD 3CPHA 4A2QA 1KI9A 5KUTA 3PIRA 1YZTA 4QKQA 1W4CA 4RKEA 2I4IA 3TJZA 1P61B 3NG1A 4PFSA 1LTQA 3IQXA 3TUZC 4OJKA 1ZNYA 3ZQ6A 1FPMA 1VPLA 2QZ4A 4WXPA 1CJVC 2G0TA 1GP2A 2G1JA 2JLQA 4GOJA 4YQFA 1NIJA 1XD9A 4PSVA 5CYPA 4BRUA 2R65A 2QQEA 5FPKA 1KY3A 1SZPA 4NCNA 1OXVA 4MRNA 4ARZA 5CK4A 3UWKA 4ZI2A 3NXSA 1N6KA 3K0SA 1KNXA 3U7GA 1BH2A 2ZAOA 4OL0A 1UFQA 1IN4A 1ZM3A 2DPXA 4M1OA 2REBA 3PITA 5DYGA 3AP1A 1JQJC 5LBIA 5DHFA 4GP7A 2VF7A 4HAWA 4MYCA 4V0MA 5JHGB 5EUMA 2V3CC 2VP2A 3SJBA 3TE6A 3CX8A 5CIWA 4LYFA 4B3DA 5KNBA 3PEYA 4LV6A 5M04A 1U0JA 1K5GA 2V4ZA 5K8TA 2FOLA 3IIMA 3Q7QA 2WJVA 1YU9A 3UMFA 3NBFA 4D0LB 1VYVA 3FOZA 3UPUA 2GZDA 2O0JA 1GG2A 4Q9KA 2GEUA 5G41A 1LVGA 5L3VA 4TSFA 4TYPA 1E98A 4HZUB 3GJ3A 4BFTA 1T3LA 4H9GA 1D2NA 3AB3A 4O2RA 4DT1A 2ORIA 2PX3A 3F8TA 3P4XA 3AF4A 1X1RA 3HR8A 2IK8A 1CJMA 3L8ZA 1P72A 4NKRA 2RH5A 1PUJA 4Z1MD 3A8TA 4P32A 3MGCA 2ZETA 4NH0A 2AN9A 4LBVA 2VLIA 4ILEA 4US2R 3LW7A 5DN6A 1KI8A 2EQBA 1KGDA 2XZOA 1Z3IX 1FTSA 4C0KA 1DAMA 3THWB 2C2HA 1I4TD 1D6JA 4R9UC 3GLFA 2OFWA 4A36A 3MJHA 3WHLA 4W5WA 2QY9A 1OB2A 1JBKA 1TF7A 3PUXA 4M0LA 4M9ZA 4NU0A 5IHPA 1KO5A 3BFXA 5CYOA 5EXSA 1XF9A 3UATA 4MGZR 3C41J 1C1YA 2GXAA 2JLUA 5E7MA 2JJ2A 4BFYA 1OXXK 1W4AA 2QI9C 1ETUA 2BHRA 2MSEB 3QKSB 4Q01A 4KITB 4ZKEA 4OHVA 4ZCLA 2YINC 1R0YA 3U3JA 2Z43A 4Q4JA 2PZEA 1L8QA 1LB1B 3GEEA 3P26A 1E2LA 4TTRA 4U02A 2OLKA 1KJWA 1TF2A 2OLJA 4I1OA 2VHQA 4O2LA 4KHZA 5DSZA 1KI4A 2VSOA 1SKYE 2D7DA 4NHOA 4IRUB 1U90A 2IYWA 3R7WB 2ZJZA 1F2TB 2WSSD 4IOJA 4A2PA 2ZU0C 3AVVA 1J70A 4CYMA 3NBXX 2DR3A 2IHYA 3LBIA 4LV8B 4LRWA 2WWXA 1KKMA 3VR3A 4LJ5A 2YWGA 2Z6VA 1ZM2A 3SE0A 1P2UA 4PO9A 1A82A 3NBZC 5TVKA 3VTKA 4IXMA 5HR5A 4AKGA 4Q7LA 4XD7A 4JLPA 4OHYA 2H8KA 2CE7A 2GJKA 4TYNA 2JGNA 5JLJA 2BJVA 2EVWX 1XXHB 3B1WA 2ZJ5A 1CR1A 4DLSA 2HDNB 1AS2A 3RS2A 1XTIA 3ND8A 2X77A 2GCNA 3DMNA 3CRQA 3L43A 3E1SA 1FFHA 1E99A 1MT0A 1P2TA 1VIYA 2GVZC 4EAQA 2Q21A 2QL6A 1ZW6A 3EA0A 3NTUA 3EZ7A 4LPSA 5JS8A 1T0HB 1Z63A 4DLYA 1E9AA 1CEEA 1DE0A 4RJLA 1KSHA 4DHEA 5EQTA 4EIWA 2VF8A 3WMGA 1Z0DA 1R5OA 4D0NA 4DB4A 3TLXA 1ZM7A 1E4YA 4FMDF 1S3GA 1JEDA 4PC3A 1G3IA 3H1TA 4YONB 3GFOA 2FGKA 5E95A 4A2WA 2HF8A 4PQFA 4A9AA 4LZZA 4ESHA 1Z8FA 1JJ7A 4RZ2A 2BVNA 2QQ0A 3GJ7A 5JEEA 1SXJB 4LHWA 4V0NA 1IN7A 3Q72A 2AK2A 4D25A 3VHXA 2XITA 4JYBA 5K8UA 3HPQA 3V4RA 3AKCA 3BFKA 2XEXA 1TQDA 3K70B 3CBQA 1KK3A 2J7KA 4PHHA 4QJ5A 1IXZA 4LDJA 5BN4A 4P3YA 3KJIA 4NYJR 4K46A 2ZRDA 5J5CA 3W3ZB 3PUWA 1D2MA 4TMKA 1TL7C 1MO4A 2YVUA 2C9CA 2O8DA 4HDCA 2NGRA 1JPNA 2XNSA 2PH1A 3BRWD 3R9IA 3I61A 2AL7A 1Z0FA 1GSIA 4YMWA 1RYHA 1TU3A 4UKDA 4PHTA 4UQOA 1J2JA 4GMXA 2VYFA 3FVQA 2KWIA 1GUAA 3LVRE 1GILA 2Z4RA 1NY6A 3VR2A 3C7KA 3QUSA 1ANKA 5FOTA 5BN3A 1DBSA 1Z22A 5FUVA 2YOHA 1COWA 1XMVA 3CIOA 2IYYA 1MV5A 3O8RA 3GD7A 1E9DA 1X1SA 5GVSA 2DFTA 1M34E 1E0AA 4JLDA 5AK0A 4CEJB 3SDZA 1RRPA 5JI3E 2ONJA 3QXSA 1W5TA 1L7VC 2BMFA 3NC0C 5C46F 3S1AB 2FZ4A 2ZRBA 2R6GA 5EJEA 2Z4SA 1U94A 2X2FA 3PR1A 2X19A 4X8HA 3SQWA 4I1SA 1R0XA 3U44B 1VCMA 1ZNZA 2WKRA 3A37A 2O8CB 1QDEA 5FOXA 1NN5A 1W2HA 4IOLA 3R9XA 1JR3A 3SJAA 2FE4A 1NSTA 4B6FA 2GWHA 2JLRA 2GJ8A 3VR5A 3PFIA 2D2FA 5LDDC 3SBDA 2OM2A 4X8MA 3QKSA 3MG9A 4POAA 4RZUA 2DWPA 1HT2E 1KDRA 2WICA 2WHXA 4DSUA 4E07A 3KXLA 1NMXA 3QVVA 3W8NA 5SZKB 5HE8A 4BQSA 4B74A 1AJEA 1XTSA 1N6PA 3UK6A 2JEOA 2ZJBA 2B8WA 1OFUX 1JQLB 3IO3A 2GTPA 2YOGA 3QBVA 2O8FB 4FI3C 4NBSA 1Z2AA 5AUOB 2ODEA 2ZRAA 3VNUA 1RFLA 1ZAKA 1Z0KA 2VO1A 1EX7A 2IEYA 1Z08A 2PMKA 4DDWA 4NPHA 4V0KA 3PV0A 3P20A 2BIFA 2BMJA 5L3RA 3BE4A 3HU1A 5HCIA 1GTVA 3LNCA 2QM7A 4LJ8A 5JSZA 3LVQE 4NTZA 2J7PD 2A5FA 1K5DA 4Q66C 2H7VA 3IIJA 1FP7A 1XXHA 4B43A 2ZYTX 1SVSA 3B13B 1MABB 3HYRA 4N0EA 4Q19A 3EPLA 4F38A 3O8BA 1S9DA 2O8EB 1EGAA 3TW8B 1ZVQA 2X2EA 1G17A 2H92A 2ONKA 1R6BX 4A0RA 1YHNA 4Q1CA 4DLRA 5H8WA 2RHMA 4IEIA 3K09A 2YZ2A 1ZD1A 1XX6A 2WMOB 2QT0A 5LPNA 4D4MA 3C14C 2WOJA 2WJJA 4UXHA 5E4FA 1GL6A 2W0SA 4DLXA 4FN5A 2ZYWX 3GJ5A 4ESVA 1YZUA 1N6LA 3V00A 2O0KA 4K8OA 1U2RA 3QKTA 4QBFA 1AKEA 1N6RA 1X8JA 4MGIR 5FI1B 1H65A 2C95A 2D06A 4PC6A 3SS8A 3HU2A 1FUKA 4S2EA 3RNLA 1E79D 3DDCA 1YZQA 2CHVA 5B64A 2YOFA 2ZI6A 3A4LA 1P9RA 4K81B 5D3MB 2GCPA 2CNWD 2J1LA 1QHSA 2IWHA 2VH5R 1G64A 4HATA 2QGNA 4TLBA 4DDUA 3KFVA 1EFHA 3AF3A 4Q47A 2WMNB 3ZVLA 3VKGA 3OEED 2XOKA 4F7WA 3ICEA 1XBTA 3WY9A 1AQYA 2R62A 2XAUA 5FBRB 5KYKA 1YR9A 1KHTA 4KBFA 1G5PA 4WXRA 2HCJB 4G5OA 4NCIA 5CLQA 4Q1AA 4JVNA 1KI6B 3LD9A 3TNFA 5L3SB 3N2IA 2QROA 2XXAB 3ZZ0A 2XSZA 4TMXA 2PT5A 4XTRA 2D74A 1LF0A 5KSOA 1F5NA 1E1QD 4ABYA 5GJVC 1G8GA 3BB3A 3BH7A 1KAGA 2MMGA 4LBYA 4PPGA 1YRBA 1W46A 2QAJA 1RW4A 2ORVA 1VHLA 3LX5A 5AUNB 2ZYUX 1JXMA 2ERYA 2YWFA 2WWWA 2R6FA 1CRPA 1FMLA 4IEEA 1R7RA 3TR0A 3OAAD 1GM5A 1EWRA 3GLIE 2CL7X 4QC2A 3GLHB 5EE5B 3FFBA 4HB2A 2ZS9A 1SVOA 5FPYA 4KFTA 2GHIA 1QHHB 5P21A 3A6PC 1NNEA 2W83A 2PBRA 2BMEA 4RCZA 3H2YA 2C96A 4TTPA 4FCTA 1H8ED 2FFBA 3CZQA 2FV8A 3I4LA 3KXIA 1KK1A 4RFSB 1J99A 5F9HA 1L4UA 3Q9LA 4IFEA 5G3ZA 3W5JA 3SYLA 1NP6A 3TW4A 4NCKA 4FD2A 4MGYR 2AKAB 1NVVQ 4HB0A 1ZNWA 5FOSA 1NVVR 1E2IA 2J0UA 3BFVA 1MO6A 2EU8A 1DPFA 4NCHA 3FHCB 4JJKA 5IT5A 1TF5A 2YWHA 3E2IA 5FR2A 5FBVB 1EFCA 4X8OA 2IC5A 4G1UC 3TBKA 2GEDA 3C5CA 4FIDA 1KDOA 1KI1A 2PCLA 3B1VA 3W6NA 1XD8A 1OXTA 1UBGA 1XPUA 2ZITA 3K09C 4TMTA 2ZE5A 4ZKDA 1US8A 3M4YA 5DE3A 4E03A 1GITA 3PUYA 2AXNA 2WZQA 3P4YA 3QXJA 4DCSA 2H17A 2VIIA 3AEZA 2W2TA 4D26A 1GVNB 4Q4HB 1LNZA 3KXKA 1W49A 4AKIA 1E2NA 1EXMA 1YZKA 3TVTA 2IYQA 3ZIAD 4EFLA 5AJWA 4HDOB 3HPRA 2C99A 2W2VA 2BBOA 2IS6A 2VP4A 3FGNA 5D3QA 3TAHA 3F3YA 4C7OB 4JVSB 4D82A 3MMPA 1ZIOA 1WA5A 2ZE6A 4B3GA 2IBMA 3HP1A 4EQ6A 2QM8A 3CRMA 1MRSA 3GFPA 3JZMA 3WBKA 1Z2CA 2LKDA 2CHGA 1AZTA 3LQQA 1KIMA 2NIPA 3B78A 2ZUCA 1HYQA 1ODFA 2WSSA 1DTSA 1OIWA 3ZDQA 4WOPA 4XH9B 4QHYA 3UMRA 3RVBA 1NF3A 2FWRA 3DOEA 4F4IA 1FNMA 1OV4A 2VSFA 4U00A 1A2KC 3JZAA 4B3CA 1QZXA 1R5NA 3KB2A 1N0VC 2GJ9A 3DKVA 1JI0A 1II8A 1E2QA 2YYZA 3DOFA 4EPVA 1JJVA 2FSIA 2C04A 2A5GA 2C9OA 2DWOA 2EW1A 3KB1A 4IOMA 1N5IA 2CJWA 1DADA 1E2GA 4R71A 4BRWA 1S9HA 2V8OA 1U8YA 5HCNA 3TUIC 3LBHA 3TUJC 4GT1A 4ZCMA 4WW0A 2WKPA 4JKIA 5FTJA 1AQUA 2XTZA 1DARA 2FFQA 1E69A 3GMTA 2WOOA 4RY2A 4BLOA 4TZ0A 5CLLA 3ZVRA 2YKGA 1WE2A 4URUR 4B33A 4CZ2A 2R9VA 1ZYUA 3AF1A 2GKSA 4I1UA 1G7RA 2HYDA 2R8RA 4Q7JB 3NC1C 2NOAA 3EXAA 4PQRA 1OH5A 1MOZA 4C0LA 2GZAA 2QRNA 2YHSA 5A5GA 2QTHA 3PXGA 1KI6A 5FBWB 5A0FA 2IUUA 5HZHA 5HE9A 5JWHA 1TQ2A 4DT1B 4L16A 2WV9A 1WB9A 3NEYA 3F5FA 5AR1A 3ZZTA 4OHXA 3SQXA 1S1MA 1RIFA 3AH8A 4M1WA 4B47A 3I73A 1E2EA 2H18A 3QPVA 1N0UA 4DLTA 4EDHA 4BASA 2PZGA 5FL7D 2JAQA 121PA 3CF0A 2ZROA 4AKHA 4MUAA 3AKEA 5TDHA 4LHYA 3A58B 2BBTA 4BLRA 4GSYA 2ZRPA 2QTVB 2ZRLA 1XZQA 1UDXA 1E94E 3KQHA 1UAAA 2P6NA 2HCBA 3GLFB 1P5ZB 2FF7A 1WF3A 1ZBDA 3VHLB 5CDFE 2JLYA 4LBZA 3CZPA 4CEHA 2D62A 2BBSA 4DRZA 5F3WB 1PLKA 2V55B 1PZNA 3UANA 3LFUA 1LF5A 2BKUA 4BPBA 2FPKA 2IYLD 4GOKA 1EX6A 1I2DA 3IHLA 3IPYA 4LI0A 5E3HA 2HJVA 2WWIA 3B1YA 5CIQA 4KU4A 1GKUB 4DLZA 2VPPA 2ZI5A 3B1ZA 3WNBA 2J0QA 2MMCA 5TB5A 2H57A 1CULC 1ZNXA 4GNKA 2C5LA 1R4AA 1ONBA 4W5JA 4XJXA 4Q4JB 1U0HC 2IXEA 5EXXA 2QPAA 1UKZA 2JIZD 4OJQA 4BZQA 1U99A 3A1VA 3QVUA 4YXWD 4LK2A 2QNRA 1G19A 2VSXA 1KYIA 2ZR7A 2RGBA 3KDSE 4F4CA 1M2OB 5TMPA 3SEAA 1VCIA 2A7QA 3OE7D 5CM9C 2A5JA 4B3FX 3KQKA 2LWIA 2FPLA 5K8IA 4TWZA 1A1VA 1UKEA 2FMXA 4IKEA 1XZPA 4NP6A 2VRWA 1XMJA 5KDOA 2MSCB 4HZIA 3B5JA 3FDIA 3WRYC 1TEVA 3B2EA 4JLOA 3I3SR 3THXA 3CRVA 4LJYA 4PC2A 1TTTA 1VG1A 4D2IA 1CR2A 2RAPA 3W90A 1G9XA 5AJXA 3ZQJA 3ADDA 2RCNA 4MRSA 4XVRA 2G0NA 2ZI7A 4FMCB 3X1WA 4BGDA 3ADBA 2ZRGA 4MYTA 4ACBA 5KSZA 4B73A 4HEJA 4LWZA 3HJNA 4RD3A 3F0TA 2J5XA 1G3MA 1TQ4A 1KMHB 2BEJA 3IUYA 4FWTA 2FEMA 1U98A 1Q0UA 4MKFA 5A4JA 5DIFA 3BB4A 2RGXA 1VKJA 2BCGY 4EPXA 2ZSDA 5CM8B 3DZDA 2KSQA 3TGPA 3K0AA 1NY5A 2GCOA 4Q1FA 1G5RA 3UXMA 3ZJYA 1SHKA 3WBJA 4N0DA 1KAOA 2AHOA 3N2EA 3X1ZA 2FPMA 2J7PA 2QMHA 2A5YB 1YQTA 3IPXA 2Z83A 3FTQA 2PJZA 1RRGA 5EZ5A 1IOZA 3RS7A 4MITA 3PVSA 1Y63A 1YR8A 2SHKA 3MLEA 1A4RA 4TT3D 4DCVA 2J59A 1TX4B 2JLZA 2ZVQX 3AGQA 2V9PA 1CU1A 1G3QA 5B2ZA 4DCUA 4B48A 3CWZA 3DKPA 1IAQA 2OZEA 3W6OA 3T12A 1X6VA 3U6KA 4HB4A 4QGAA 3LLMA 3QF7A 2IYTA 2O8DB 4EFNA 4KYUA 3REFA 5SZJA 4MKGA 4B76A 3O8DA 4Q9LA 5DH9A 3AVQA 2JCSA 4LOAA 1LFDB 3RLFA 4A15A 2FJUA 3B9QA 3QEJA 2XNDA 4LJAA 3H84A 4R2HA 1OFIA 2UVQA 3CO5A 2P5TB 3D6TB 3FYHA 2P2LA 3MD0A 2IW3A 8OHMA 2GEVA 4TMWA 3GJ4A 3SFVA 5CB6A 1P2VA 1G291 5HTKA 1F6BA 2WWFA 1E79A 2W2XA 1DAHA 1GRQA 2KI5A 2QGZA 3IHWA 1Q57A 4V0LA 5C4MA 4FW9A 3KX2A 4B35A 1QHXA 1XFAA 2CNWA 1T3HA 1OH8A 5GVRA 1XTRA 4JKYA 1KMQA 1OT3A 3VQTA 4AYWA 4C2TA 4C0BA 2H16A 1II0A 4QNRA 2BOVA 4HSEA 4JLMA 3KUDA 1Z83A 4NZYA 2OESA 4BLQA 3LA6A 3NWJA 3OEEA 4MUBA 4L9WA 4DIDA 1JALA 1E2PA 3KKMA 2WVJA 3LBNA 1W7AA 1VYUA 1YRAA 1W0KD 2F43A 3IEUA 1P60A 4OI4A 4P0TA 4QBHA 5E7IA 2F1JA 1E9BA 4RFVA 4WZAE 4XVQA 5FOWA 2BM1A 1E1QA 3M0EA 2G9NA 4QJ3A 1HUQA 1XEWY 1E2FA 1OE0A 3FMPB 4U5XA 2YC4C 1E9CA 2JDID 1DAEA 4KO8A 2F6RA 3U4QA 2NPIA 1J7KA 3KKPA 4LBWA 1ZUIA 1KO4A 4TL9A 2Z5FA 2XJ4A 5EZ6B 3OAAA 2BBWA 2G77B 4B3BA 4LCBA 4KSBA 2OHFA 5JSZB 1IJFA 2HUPA 5FTKA 5BXQC 1OF1A 2AXPA 4KCGA 4AG5A 3LLUA 3TMKA 3MWYW 1G16A 2YC2C 4LJ6A 2ZS7A 3SYKA 4DEXA 1PJRA 1W1WA 1KNQA 3OIWA 1H8EA 4ASUD 2O5VA 2WJHA 3G5UA 3U5ZB 4I1VA 5EP2A 4PX9A 3AP2A 4HB3A 4ZV4A 3DM5A 3U60B 5KSPA 1N3BA 3GEIA 4A0HA 3EC1A 5FPSA 3D3QA 1ZC4A 3RANA 1H8HD 5IDVA 4LY6A 5JCZA 1Z6GA 3KQUA 1FX0A 1KMHA 3CX7A 3GP8A 1NSFA 2X8AA 4QOSA 3FWYA 3A1UA 5EE0A 1S2MA 1Y3AA 3T1TA 3GPLA 1IHUA 5DI3A 4G5SA 2BMDA 1L4YA 1YR6A 2FSHA 3ETLA 4FMCF 3K1JA 3V9PA 3EASA 2QU8A 1Z6XA 4QBIA 1U0LA 3Q5EA 1E96A 5TV2A 621PA 4BFZA 4C0SA 2CDNA 5JWRA 2FEOA 1BO6A 2IEZA 2OAP1 1JR3E 1WCV1 3KQNA 4AI6A 4MGKR 3AVOA 4PZZA 2P6UA 3BERA 2KE5A 2D3WA 3NIBA 1IXSB 3R20A 2FU5C 1WDTA 2IUTA 2WIBA 3AKYA 3U6BA 3ZIAA 4I4LA 3DL0A 4TTQA 421PA 3TAUA 5F9FA 4NYJQ 5KNCA 4M22A 2Q6TA 3OFNA 4TMVA 4DUGD 3CWQA 2Y8EA 2VA8A 2WJIA 1AKYA 5DISB 1KTVA 1SGWA 3QQ5A 3CW2A 5HKKD 5J40A 2ZI9A 4FMBB 2VL7A 1NN1A 2GBLA 3BGWA 3EWAA 3EZ2A 5H70A 3I5XA 4XVUA 3ADCA 3K9LA 4C4PA 3SFZA 1DO0A 4G5QA 4LGMA 1LY1A 2IS2A 4RD1A 1XXHE 2XZPA 4RZXA 2AD1A 5JJIA 3U7HB 3VR6A 3DM9B 1HH4A 3QPUA 4JL6A 2PZFA 1NG1A 4IVRA 4DWJA 2F1RA 1BYIA 2V6JA 3TKLA 4AYTA 2ORWA 4L9SA 3BJIC 5AWFC 4JT2A 4MA4A 4JZKA 3U3MA 1Z06A 1CJUC 5SZIA 1R5BA 1GL9B 4C0HA 5BN5A 4LSGA 4MDFA 3CF6R 4PPFA 1VG0B 2CMKA 4HI0E 2CK3D 3NBYC 3EPHA 2VP5A 1AS3A 1KSGA 1P7CA 1VYTA 3SOPA 5FH9A 2O8BB 4TQUS 4IVQA 1PV4A 2HEIA 2JJ1A 2AX4A 1E0SA 5JJKA 1QBKC 5J4LA 4PSKA 3X1DA 5IK2D 2G6BA 1E32A 3GJ6A 1P6XA 5J4VA 2OXRA 4PPNA 2O52A 5FBQB 1SXJE 4ACAA 4EPWA 2B92A 2QENA 4TLCA 1M7BA 1NLZA 2ODBA 4GMDA 1T8TA 2GXUA 1E6CA 2BV3A 2J0UB 4DDTA 3V4FA 2P65A 1G3UA 3MCAA 1D8TA 1GRNA 1NG9A 1XEXA 5FL7A 4CT4B 1BOFA 1EK0A 3TIFA 2CHQA 3A36A 2EWWA 1YZGA 4JSTA 2CL6X 4P4UA 4N1AA 3EZFA 3RS3A 4DKXA 2PLFA 4UNRA 1N5JA 3DMDA 1AIPA 4AC9A 1Z47A 1JAIA 1US8B 1AK2A 3SBEA 2CCGA 2G88A 1WMSA 2NZ8A 521PA 3KJHA 3TSOA 1NL3A 2R2AA 1ELOA 1OXUA 2V6IA 4MYUA 4LX0A 1II9A 1SKQA 3CNNA 1DG3A 1BMFA 1GNRA 1Q1QA 1RJ9A 2F9MA 3I1FA 3OIVA 4B34A 4HLDA 2D2EA 2IHBA 3KL4A 4AURA 3HR7A 2A3RA 1ZD8A 2JASA 4PZYA 1KY2A 2IF2A 2J9RA 4XTCS 3KJGA 3QKRA 3GJXC 3THOA 2YJTD 1CRQA 1CS4C 2JIZA 4EQ6B 4J0QA 1ZIPA 1V5WA 3AV0B 1MO3A 5F98A 1CF4A 1QHYA 4Q03A 4KFSA 3LXRA 1GAJA 2A5DA 4PHFA 2W6JD 2B8TA 1S8FA 3RS0A 4JLBA 4Q21A 3B9PA 2ZJAA 3NHAA 2GK7A 1E9RA 3OE7A 4PAQA 1IONA 1G20E 3CH5A 1P73A 3AUXA 2A2ZA 4Q18A 3X1YA 4YMUA 2GBLC 3TRFA 3WYAA 1II8B 4TQAA 1AGRA 1FUUA 1W36D 5BWMA 1A5TA 2IYZA 2IYRA 3T61A 1OYYA 3A4MA 4B2LA 1UJ2A 2CJWB 2RGNC 2G83A 1T0JB 4W5HA 3VX4A 3GLGB 4Q9HA 1WBBA 2ZU6A 3GEHA 1XP8A 2WTUA 2IYVA 1YZLA 4CF7A 4CRWB 2R6AA 1XDBA 4JVMA 3THYA 2DFLA 4A82A 1IN8A 4WZ6A 2Q3HA 4QJ4A 2J41A 4F4JA 4TL7A 3T15A 2FH5B 1NN0A 4Q7MB 2L0XA 4V02A 1RC8A 3P27A 4OI0A 4MYHA 3BB1A 3T1QA 2GVDC 3WRXC 5GJBA 4BFVA 4TL8A 4D0GA 4RD0A 5TARA 5JFGA 1ZM4A 1VIAA 3LRPA 3EARA 4HAZA 4LC1A 1QHGA 5C4GB 1FL9A 4DLWA 4QBGB 4F93B 1KDTA 3B7GA 2GXQA 4DXAA 2IXGA 3PUZA 3R8FA 2E9SA 1I4LD 1S4QA 1ZINA 1AS0A 3DZ8A 4ZPXA 3CPEA 1KDPA 4NL4H 4D80A 1NVUQ 3IKJA 5JI2E 2ZJOA 3BOSA 4IDOA 1XTQA 4PSAA 2OBLA 4A4DA 4D4LA 1OXSC 3IGFA 1KI2A 1N5LA 3BD9A 3BH0A 1V43A 2DHRA 4EUNA 4U7DA 1IM2A 3PQCA 3EW9A 4OQMA 1QRAA 3KJEA 4DLUA 4W9MC 2F7SA 4A8JA 2XB4A 4CEHB 4NMMA 3I32A 1E2MA 1NBME 2QBYA 4C3ZA 2O8BA 2ZRKA 4F91B 3N70A 1JNYA 4B75A 3TK1A 2PEYA 721PA 4CT5A 1XJCA 3Q5DA 4HLUA 4JLAA 4DIEA 1KSJA 3NDPA 4BLTA 1G18A 5JZVA 4MRPA 4R2IA 4OI1A 5J4YA 4URVR 3UKDA 4Z1MA 4QM6A 2VEDA 4Q4LA 2W00A 3OEHD 3HDTA 2N1BA 4DB2A 4YDHB 5JRZA 5JEDA 2OCAA 3EZ6A 4UJ3A 2OG2A 3O47A 3QNUA 4QHTA 2JLWA 1KZGB 2LCFA 2QORA 2WSMA 4A92A 4GPTA 3AVUA 4G01B 5DO9A 4BUJA 2FA9A 4RCYA 5FTMA 2AFHE 3U7FB 2BCJQ 2RHDA 3UWOA 4DZZA 2OCBA 4OQLA 2NPFA 4RZ3A 1GWNA 2CBZA 2D4HA 2AD5A 1ZCAA 3LW8A 2P3SA 1MKYA 4QM7A 2ODNA 2P0EA 4QHSA 5TXGA 1PLJA 3MWJA 1YVDA 2HLDD 3EPJA 2ZRCA 1FTNA 3THXB 5JHHB 4ON9A 4I81A 2VHTA 2ZSBA 4GFDA 4CEIA 2QG6A 4OHZA 1B0UA 1NVXQ 3QY0A 1CLUA 1W0KA 1CP2A 1W0JD 2JLSA 2I1QA 2N46A 2P5SA 3OF5A 4BEBA 4YDSA 1RRCA 2P67A 3UIEA 2EFDB 4Q4AA 1PVOA 2OCPA 3TSWA 2ZAMA 1Z28A 2JDIA 4KLNA 4EJSA 3GLHE 1DAIA 4KBGA 3FKSD 2YV5A 4JL8A 4NYIQ 3RHFA 4NYIR 1E1RD 3SR0A 3E70C 3K0AB 1HQCA 4LHZA 2GCOB 1R0ZA 3GLIA 1G21E 2CLCX 1U8ZA 1VG8A 4C0AC 3OZXA 3C8UA 4B2PA 4EPRA 2AWNA 1OFTA 1SQ5A 1DEKA 4OBEA 4PZLA 1HEIA 3AF0A 3GLGA 4ZI3A 1LV7A 3D8BA 3WXMA 1X8LA 3AKDA 2GZHA 1SVLA 4A0FA 4ASUA 4DSNA 2QSYA 1ZU5A 3EIEA 3EIHA 5DLQC 5G40A 4GZLA 2VHCA 4JBWA 2GXSA 1E0KA 2J3EA 1TU4A 3AVPA 2FG5A 1H8HA 3CUEF 4GI7A 2ZJ8A 3K0FA 1UKYA 1NN3A 4TYQA 4M9QA 4O0MA 4EPTA 5C2JB 1OHHD 2ZR0A 2ZIAA 3QF4A 1OW3B 3MJRA 3NH9A 4UNSA 5LD2C 1Z6TA 2ZS8A 2I1VB 4A8JC 5JS7A 2JA1A 3JVUA 2C9YA 2GAOA 1DAGA 3K0EA 2H1LA 5DYIA 1LS6A 4URXR 2GILA 5EP1A 3TQCA 5KPDA 2WAYA 4M1TA 4DLVA 2YNMA 4AIIA 1Z5ZA 4S35A 2JLXA 4R98A 1VCNA 1JR3D 4LYJA 4HLUC 4II7A 2H5EA 3RS5A 2CCJA 5KOYA 2PLRA 2ZANA 3SN6A 1P75A 1Q1EA 2IYUA 3P1JA 4M1SA 6Q21A 1N5KA 4AK9A 5FUXA 3QENA 2WIAA 3RWOA 1Q3TA 4OK3A 3WYFA 1UEJA 1IQPA 1UF9A 4KFRA 4DUGA 5K8LA 5JECA 5KNDA 1N6IA 3FB4A 2OXCA 3QXHA 4M53A 3VAAA 1IJEA 3W34A 1UPTA 2XJ9A 3K9GA 2JATA 3LQRA 3PEUA 3LY5A 4MH0R 1OKKD 5HKKA 5IRCD 4C2UA 2V1UA 5JRJA 2NO7A 1GIAA 1P9NA 2VHUA 1BKDR 1IN6A 2F43B 1OSNA 4URWR 1CBUA 4MKHA 1IY2A 4QFMA 3CRW1 4QGFA 2CLSA 1XJ0A 4OK6A 4TLAA 4V0ME 5DNYB 3L8YA 3IBYA 4HYYA 2HJGA 4PAOA 1GL7A 1ESMA 3QXXA 3SJZA 1WXQA 1VG9B 2F1IA 2QE7D 2F3RA 3U4QB 2GESA 2O0HA 2DB3A 2IF0A 2FSGA 1XD2A 3ZD7A 3G82C 5AJYA 1C9KA 1CTQA 1TPZA 1F2UA 2MSDB 5KU1A 1XPRA 1IY1A 2W58A 4QRHA 4EJSC 3IBGA 3B8HA 2CK3A 2A78A 1HTWA 2PCJA 3EAQA 3WP0A 2NMVA 3NKVA 3L0IB 5ELXA 3PJRA 4AY2A 3SHWA 2G3YA 3M6AA 3GQBA 1R10A 3K9HA 3I8SA 3NVAA 3AM1A 1J8YF 1W44A 2OT3B 4M1MA 1TAGA 4RD2A 4CDGA 1I4DD 3FFAA 1Q44A 3BS4A 1SHZA 4M21A 4Q02A 5SZHB 3L82B 4YMVA 3VU9A 3CH4B 3I62A 5IK2A 5HPYB 3U3RA 1XCPA 1SXJD 1EFTA 3CPJB 4P4SB 2QMOA 1LW7A 3GFTA 5FPTA 4IXNA 2VHJA 3B1XA 5BYJA 1Z6YA 1NJFA 5DHAA 2Q9CA 4OYHA 1J8MF 2LKCA 1FX0B 1Q3HA 3MRSA 4JMPA 2QAGC 4IFBA 3K70D 1M74A 2PEZA 1JXOA 2CVHA 4GP6A 5EUQB 3GLFE 4TYWA 1KZ7B 5DI3B 3DHWC 3PENA 3B82A 1JAHA 4KV9A 2PL3A 4PTLA 4PC7A 4BFSA 2J0VA 2QT1A 3C5HA 4IVPA 1XNJA 5C18A 1U8AA 1XU4A 4US0R 3R8CA 4DVGA 1G7SA 4DCTA 4EKDA 1D9ZA 2WWYA 5CDFA 3SJCA 2WJGA 1E2JA 1WQ1R 2IWRA 1GKIA 4TQ9A 2E87A 4QL3A 2EFCB 5IF9A 4GBMA 3QG5A 4C30A 1OPXA 2WJYA 5GJCA 2CVFA 3EC2A 3WHKA 1JPJA 3VMFA 1MRNA 1KOFA 4HAUA 2XSZD 1ZRHA 3BWDD 2IL1A 2IT1A 1S0UA 5AJVB 1WRBA 2ATXA 2K5UA 5L3QA 1UDWA 1DO2A 1G1MA 4JLVA 1HQYE 2DFKB 3KKOA 2OUKA 2JJ8A 5FUWA 4AYXA 5B57C 3AUYA 3CR7A 2CXXA 3LH5A 4ZDJA 1SKYB 4GRAA 2IS4A 3WP1B 2DWQA 2W6JA 1Q20A 3UMSA 2RKOA 1ZD9A 3OIUA 4HLQB 4PPQA 2IA5A 4JL5A 1HV8A 2OO7A 2ZE7A 3W3AA 4TLEA 2GA8A 3T35A 3RRYA 1RRFA 2BM0A 3ASZA 1ZP6A 1JEEA 1NIPA 3TSZA 5FFMA 4HUQA 5KHOC 2REXB 3LDAA 4RKFA 4BLSA 4C0JA 5GJWC 3SU8A 3X2SA 1N25A 5EE3A 5AJZA 4QGGA 4FXPA 1JR6A 2GDJA 2UZ3A 3RYTC 4UJ5A 5AUQA 4DSTA 5KSYA 4Y0VA 1DAFA 1CR0A 1TNDA 3AF2A 3HWSA 4ZIRA 1EESA 2OFOA 5BYKA 2R6DA 5B30A 1U9IC 2A30A 2UKDA 2WBLC 3KTAA 4PAMA 1Z0IA 2BEKA 1Q22A 4YLGA 1T4GA 2GF0A 3T1VA 1UADA 3ZLJA 1G6OA 1N6HA 1EG7A 2OSBA 4EFMA 4DC9A 1OLOA 2OE2A 2HXSA 3REGA 1GDDA 1BYUA 5JMTA 2QPOA 1YJ5A 3ZGXA 3Q85A 4YMTA 2RGCA 4LHVA 1P9WA 3KZ1E 5UKDA 3K8YA 5CJ2A 1DG1G 5CK5A 3D7MA 1NI3A 3LV8A 1KI3A 1W5SA 1C4OA 4FCWA 1XEXB 4KVGA 4ZCIA 1T5LA 1NJGA 1XEFA 4LHXA 3CX6A 4ITRC 2HYIC 1OYWA 3MWLA 4XIGS 1E2HA 1R8SA 3C15C 4ZDWA 3JVVA 3ZH9B 2J46A 1MO5A 3ASYA 4R7ZA 3MFYA 3UG7A 4DCNA 3ECCA 4WZBE 2ZE8A 4UXIA 4LUCA 1KJZA 2C77A 2UZIR 5KPJA 1HA3A 1NBMD 1P62B 2FFAA 4HDQB 1OJLA 4MRVA 4G5RA 1K8RA 1CXZA 5EP4A 1CJTC 4JYCA 3EZ9A 2ZRHA 1RJ9B 1HT1E 4A0GA 4B44A 2Z0MA 2Q9AA 2FZLA 1DVRA 3C16C 4P4SA 3WYGA 1M8PA 1T8UA 2PJRA 2IX3A 3K9NA 3QBTA 2ZM5A 1G41A 1G8PA 3QKRB 5FOUA 1UBFA 4ZDIA 3IIKA 2KJQA 2FNAA 3K0CA 3U3KA 1E2KA 3BIFA 2JLVA 1G3RA 4P33A 3ZVMA 2ZJ2A 3EG5A 3OEHA 4XWAA 2OBNA 2ZUBA 2F3TA 4OK5A 1KSFX 2IYSA 3CKLA 4JS0A 2Q3FA 4PC1A 3SZRA 3T5GA 2GRJA 3RWMB 2QA5A 2PMDA 3WNCA 3X1XA 1FQJA 1R8QA 1A2BA 1XRJA 2ZRMA 1EFRD 1YKSA 3FMOB 4JVLA 3SI7A 821PA 1B23P 3LXXA 3OIYA 2QPTA 4QNMA 4M9XA 3ICQB 1NLFA 2ZSEA 4LV5B 2KBEA 1S3SA 2C98A 4Z51A 1NMYA 2NO0A 4IW3B 1W4RA 4AWXA 3RSOA 4PHGA 1N0WA 3FMIA 1ZUHA 5DGXA 1TUEA 2HLDA 4XSHA 1NRJB 5FUYA 2ZTSA 1W36C 1U81A 3THYB 3KQLA 1UKVY 1XMIA 2GJAA 1W0JA 3TR5A 2IYXA 1XJQA 3IO5A 1XWIA 4KSCA 4G5GA 2WPDD 4C9BA 4RSGA 1VTKA 2CCKA 2VQSA 1QHIA 4YMSA 5L8VA 3QI2A 2XTMA 4I99A 4KJZA 1VMAA 3I72A 4GL2A 1QVRA 4DSOA 4XWKA 1AM4D 5JJLA 2NO6A 4P4TA 3FKSA 4ZDKA 1E4VA 1G6HA 2RGNA 1DAKA 3QKUA 5J4HA 1E1RA 2V7QD 2HT1A 2HF9A 3WMEA 3MWKA 4YC7A 1K6MA 3L0PA 3W9YA 2AWOA 4EPYA 1KKLA 4HZUA 4Q48A 2J87A 4BFUA 2OFXA 1E2DA 3RRZA 4HAVA 3Q7PA 4JLKA 4M1YA 4KVAA 4Q1DA 1M1YE 5DI9A 3SHFA 2FGJA 2ZREA 1UEIA 4P31A 2VP0A 2QMUA 2QRZA 2ZRJA 4IJMA 5LD2B 1GRRA 4A8JB 3CR8A 4LPKA 3AVTA 3AVWA 1KJYA 3BC1A 1WBDA 4OQNA 3U7EB 1MH1A 2QBYB 1ZJ6A 3VR4A 5H1YA 3WNDA 4PQYA 5CJPA 3CM0A 1D5CA 2IXFA 1F3OA 5LB4A 3THWA 1OHHA 4UNQA 3A4NA 1QG4A 1A7JA 3CRRA 2AFIE 3LWNA 4MDEA 3ZS8A 4D4KA 4URZR 2AR7A 5EP3A 1QG2A 4G3XA 4M9SA 1XCGB 4QXAA 1OIXA 3VNVA 4NE2A 4V03A 2DBYA 2WWGA 3B85A 3AGPA 1VECA 1G4AE 1P2SA 1CJKC 2W6ID 5CB8A 2ZRNA 4JSYA 2XTNA 2IUSA 4LYHA 2RGGA 1Z07A 1FNNA 3K0CC 2C78A 4M2LA 1OFHA 3FPAA 3N5CA 4BZPA 4IHQA 5GADl 1YR7A 4L15A 3NDBB 1SVIA 3ADKA 2VTKA 3QJYA 3R7WA 1ZU4A 3RRNA 1F2TA 2NTYC 2GK6A 3QIAA 4PO8A 1ZC3A 4RD6A 4HAXA 5FI0B 4L8GA 4GZMA 1OKKA 1IBRA 1IY0A 2NZJA 1R2QA 4L4UA 2ZJYA 4NDZA 3ZVNA 4CEIB 2ZSAA 1X3SA 1HE1C 2FFHA 2BJWA 2VP9A 4UNNA 1TADA 3ZZUA 1F60A 2QUZA 4HLCA 3B6EA 5C1BA 4US1R 1M7HA 3E5HA 5FBLB 4Q4AB 4MQBA 5FTNA 3UG6A 4YXWA 1XTKA 1KO8A 3CB4A 3PUVA 2ECKA 2X1VA 1O3YA 3L0SA 1NVWQ 1QHNA 4EJSB 1T6NA 2QE7A 4O3MA 3A1TA 1XCMA 1OH6A 1Q12A 5FOVA 5BW8A 2QN6A 5B58C 4B3XA 3SNHA 3C4JA 2DCUA 1E9SA 3L0OA 3I5YA 1VDZA 2BDTA 4DBLC 2ZXUA 4JJZA 5E7JA 5EXTA 5AUPB 3GLIB 3BAFA 1GOTA 2C03A 1XPOA 1S96A 4E22A 4BEJA 4TSFD 2B7CA 3DO6A 4TN1A 2J45A 1SULA 2NG1A 3PEWA 3RABA 3LAWA 2B6HA 1S1CA 5FR1A 4C0QC 1PLLA 1CKEA 4JBYA 2XNDD 3HYTA 4Z8YA 3MSXA 3VFDA 2ANBA 2CLDX 2GETA 3NHBA 2QAGB 5JBQA 4B2IA 1FP6A 1O87A 3BORA 4TZ6A 1G8HA 4Z8XA 1SXJA 3H0KA 1D2EA 1HURA 2EYQA 5DN6D 1G8FA 1P3JA 2EYUA 4CGZA 2QTFA 2A9KA 3TH5A 2F55A 3K0FB 2ZVPX 2NO1A 3KFXA 1DS6A 3QF4B 1W2GA 3QPWA 4PXAA 1X8KA 3K53A 2GJSA 1Q21A 2FN4A 2NO9A 2AKYA 2R44A 3VR1A 4M8NE 3EWSA 2CEAA 4BECA 2D7CA 3R9WA 3LO5A 1W4BA 4HUTA 3W5IA 3CNOA 4E5UA 3J81k 4WA7A 2G1KA 3W8RA 2E1RA 3ONWA 4KFUA 2ZR9A 4RD4A 2OBMA 4BFWA 2JJ2D 2REOA 3CNLA 4KAXA 1EWQA 3FKQA 1AN0A 3T5DA 4D4JA 1M7GA 2GNOA 2BWJA 2BC9A 1E9EA 4KXFB 4B71A 3VKWA 1G4UR 4JBXA 1T91A 4TT3A 3T1OA 1OIVA 3IQWA 3EPKA 1DELA 4MKIA 1KO7A 5JWOA 3QG1A 3M1IA 4TMZA 4Z54A 4Q7KA 1UBCA 2QSZA 4A6PA 2OCYC 3Q3JB 4OI2A 1TEXA 2GAAA 4A6XA 2CE2X 2XGJA 4F92B 4CEJA 4Q00A 3S1AA 4BFXA 1W47A 3VX3A 2C8VA 5J47A 1MR3F 4BWYA 2VBCA 4XOIA 4FCVA 1CR4A 1L2TA 1M6NA 4Q5IA 1UM8A 1W48A
chains in the Genus database with same CATH superfamily
1G20A 2IBSA 4KX3A 4NV0A 4EG6A 4E51A 1T9ZA 2XUAA 3FZQA 1N6OA 4LJ4A 1T3SA 4AG6A 2V59A 5DNEA 2WRZA 1HKUA 3GMIA 4IGAA 4BYMA 3USES 1WLYA 3AHGA 1XVUA 4HMOA 2V7UA 3D81A 3KKNA 2RC6A 5ALSA 1N2CE 2X2OA 1KETA 3MWDA 4WLVA 5BWLA 5LYJA 1T6BY 3DDSA 2XB2A 1FFWA 2LUOA 2R11A 4OM7A 4Q9IA 4M4SA 1B6RA 3JASB 3MF4A 4X8LA 4FWBA 2QLNA 5HOEA 1KJ8A 1P1JA 3EULA 1XD2B 2E4YA 2NVBA 3I42A 3LY7A 3SX0A 3DMTC 4B1FA 4DR7B 4G4JA 4P22A 1Z7BA 2HSEA 3H86A 1WSDA 4CKCB 2JLAA 4L78A 1NBHA 3RSLA 1OR8A 3PFBA 2OKCA 4G0QA 4A3SA 1QCDA 1ZCJA 3GFBA 3WKEA 1BS1A 1PS9A 5DN9A 4EA8A 1YZNA 1HYHA 3MTBA 4JLJA 3SLGA 5LYJF 4BZXA 2J0SA 1QK4A 3PG5A 3PCRB 5I51A 3LPCA 1H9CA 4A1FA 2QMYA 5J63A 1PWYE 2O2DA 4GGOA 4KDEA 1T0UA 2ZUDA 2P5YA 4OVKA 4WBNA 5ADVA 5ALXA 5F7OA 2E21A 2XRMA 3HDGA 3PHGA 2VT6A 5H9VA 1E20A 2OA0A 2WF7A 2I5PO 4CXMA 1P9LA 1WDKA 4LJ7A 4NBKA 4M8IA 1HG1A 1KO1A 3PTZA 1RS0A 2NV2B 3FNQA 1T9HA 3G2KA 4F4HA 3OTWA 5DGHA 1KE1A 3WKCA 2WEKA 2RBKA 3FDJA 2P78A 3L2OB 3WFZA 4DJDC 1WQ3A 3C6ZA 5SY6A 4BNWA 4Z99A 5DCWA 1XEWX 2V5VA 2V7GA 3MTQA 5KJ6A 3OESA 1GEEA 4OHWA 1QQ7A 1SXJC 4R31A 5H3CA 5DTQA 4C06A 2O8EA 3KYBA 4L4XA 2YHIA 3B60A 2ID9A 1QE3A 2PQ2A 3CLSC 3TW8A 3ZWDA 4ZTZB 2HXYA 3FCUB 3V42A 1PL8A 2TECE 4W1RA 2LR0A 4DG9A 1FW6A 3VSDA 1H9AA 4ARCA 2AN3A 4CMGA 2XA9A 3F6EX 3GAAA 1L1FA 2OO5C 1JA0A 4W9RA 2Q3EA 5BQ5A 4N47A 4NZNA 3DEAA 1NBMA 2PMEA 1MPTA 2PGDA 2G9RA 3QLVC 4NICA 3W78A 2GUGA 3NAQA 5B7GA 1TIPA 1FNDA 3AJAA 1FYDA 4FDVA 2QAGA 3TVDA 3VR2D 3ZYCA 3ZWBA 1RQPA 2HHJA 2ZSFA 4HNGA 3UV6A 3W5VA 3EFHA 4UHBA 5IDWA 3CGWA 1ZN8A 5CJJA 4BP3A 4KR9A 4ZAFA 1COWD 2ZI4A 4PCVA 4UU8A 2Z5LA 5F2EA 1PEYA 2H4HA 3OE4A 3U3OA 3DE7X 5TSDA 5JRDS 4KR3A 2GAFA 2CFIA 4PX2A 4ZP1A 2PO5A 5FX2A 1D4FA 3O8CA 3PIIA 4LOKA 2V54A 2WJZB 3IQHX 1AX9A 3EXEA 4RGVA 2YWXA 1SVKA 5K45A 4XA8A 4E5VA 2H2GA 2CHFA 2DYKA 4IFIA 3V3KA 3ZX4A 1LTKA 1N8NA 5TPWA 3QHPA 3MPOA 1OJ7A 3U3ZA 3RRMA 1GZVA 3DE1X 4GOMD 1GNQA 1G7CA 3MS2A 4N5MA 3TCKA 2CL0X 1XLVA 2ST1A 1Q7TA 2WR8A 4CMHA 1W29A 1A69A 2ZQYA 3L7JA 2OILA 4JBHA 4D1YA 1R74A 2A1IA 3ZJ4A 1QAOA 3T54A 4E46A 1EFRA 5BW5A 3QEOA 1Y9DA 3ETEA 1UZUA 2RFLA 3WGTA 5C37A 1R64A 4IO1A 3J7AC 3GW8A 2PX0A 3N87A 1ORDA 1WP9A 4BTEA 2AIRA 2QP3A 3KTFA 2YICA 2FMFA 2HKIA 2KBFA 3N8IA 4G4SO 2FSFA 4EO9A 1G5TA 1GPBA 4NEHB 4X24A 5AW5A 3I92A 5AXCA 2B99A 4KYIB 3HGQA 4TMFA 3FPBA 4BJ6A 2V7PA 5JCPA 2QTNA 2R6CA 3HCFA 2Q3LA 3AP3A 5KTYA 2WM9B 1CD5A 1VSUA 2EZ9A 5JPIA 1GPH1 2D5IA 4ZIRB 2J5BA 2RHTA 4QSHA 4CVNA 3ZJTA 1F1JA 1GA1A 2FOIA 2VG8A 5J1TB 4BQEA 4Y6LA 3W2EA 1BA2A 3GCGA 4JBLA 2AR0A 2PUHA 3NDRA 1AGXA 4MRRA 1J2TA 3DOIA 2WPDA 4B6SA 1GNPA 4JUCA 4BN5A 4DYDA 2CBXA 2N3ZA 3ES9A 1PUIA 3LUPA 4Y30A 1N1EA 2I1WA 1A71A 3G1UA 1Y1TA 4MA0A 4KIJA 3H18A 4X6XA 3BT7A 1G8MA 4D0RA 1PFYA 2PGJA 4EVQA 1T6XA 1JLKA 1ZBQA 4F9TA 4F84A 3QXCA 1RRMA 4LC9A 5ENZA 2VK8A 2V7QA 3FMGA 2V96A 3SEQA 4BNDB 4PO1A 5FWYB 4UTPA 1M67A 2Q6IA 1RMTA 1TCAA 2AQIA 4PHCA 4DE5A 1QLJA 4Q1EA 3O2NA 3MUFA 1QF9A 1T0PA 3C1UA 4MB6A 2Y1FA 2WFLA 5KTNA 1AA9A 4URHA 1GG8A 2JFUA 3P9CA 2YMMA 3ENZA 1RXIA 3FPCA 4FDAA 3V4ZA 1ZCBA 1SWVA 4OQXA 1F9AA 5FWXA 4QGBA 2I7CA 2Q9BA 3ZN2A 1A27A 2JGKA 5BV8A 2RG7A 3K4HA 4ER3A 2Y2UA 4Q9DA 1QRSA 3CONA 4UXJA 2BFOA 2EXXA 1MA0A 5FJJA 4HPXB 2I3BA 2ZTLA 4EI2A 4EYKA 4O4JA 2Q0HA 1R88A 2NUPB 4BBAA 4DJTA 3WK5A 7REQB 4YJ2A 3HY6A 1F5SA 5BW6B 1GGNA 4YRBA 2VJNA 1IE3A 1ULUA 4F5WA 3I53A 3ZCRA 4QYXA 3SSOA 2Q1TA 4REMA 1ESNA 2GN9A 2A9VA 3ORRA 1F3LA 2R6ZA 4FJ2A 5TMDA 3CSUA 5IH7A 2R8YA 2BEUA 4Z4EA 2W2LD 1QXSA 3M33A 3U7JA 4O4JF 4V0OA 1Q1BA 1YFJA 4Q4HA 1T8SA 5FTLA 4ZVOA 5KTKA 1FZQA 2P41A 4HGZA 3RHSA 3QUBA 5FLXA 2FEAA 5YASA 2IS1A 3LSTA 2QJRA 1AN9A 3N53A 4W7HA 1PK7A 4ZVRA 3EQ6A 1G2PA 4X63A 5EE9A 3TQFA 2RGDA 1E63A 2RIPA 2ANCA 1WNTA 2OEPA 2AZ4A 3CPHA 1KBOA 5ICGA 4YRNA 3QFRA 2I4IA 2H85A 3BXHA 1DXOA 1EVLA 1P61B 3AM3A 4IYRA 3TUZC 3IQXA 4CTOA 4MLCA 1QFXA 5LLDA 3A14A 1SCQA 4DA0A 4QG3A 2W42A 2OVFA 4WXPA 4B7XA 1E6EA 1RJGA 2G0TA 2JLQA 1XD9A 2H5IA 4HYEA 4CMJA 5DGDA 2ZSJA 5A5FA 2FF5A 2QQEA 3GC6A 1E58A 2M6SA 3OWHA 3P94A 1JLRA 2HPVA 2QJOA 2WF9A 2XAAA 4PNZA 4FFWA 1SCUA 4ZI2A 3VISA 4JT9A 4ML3A 1X80A 5AW3A 2FEKA 3K0SA 2VCHA 2BDEA 4XUGB 4EG7A 2G63A 2EWMA 2J3HA 3A3PA 2ZAOA 1UFQA 1F4VA 1H0SA 2ZCJA 3KD2A 2AI3A 2WHRA 3N3AC 2J3IA 3O4IA 3MLAA 3PITA 3AP1A 1X2EA 1JQJC 3GA5A 5DHFA 1N3IA 3KS9A 4MYCA 5EWJB 5KTSA 2VP2A 1YRHA 3SJBA 1YFZA 1JG3A 5CIWA 4MWTA 5JNLA 3CW8X 4LV6A 2OHIA 3M8KA 3NASA 5C3UA 3UY4A 4AX8A 2P2DA 4K88A 4YT4A 3EVCA 1CEYA 1KWKA 4N0MA 1UC8A 1QIDA 1F8YA 1U1EA 3Q7QA 4MV8A 4MR7A 3EIFA 3QM1A 3I39X 3UPUA 2GZDA 3RBXA 2FMTA 1GG2A 2Q49A 4LTDA 4H9GA 1J20A 4YX9A 2XTJA 4J91A 4BWGA 2CZGA 3M3DA 4O2RA 4DT1A 4KR0A 4FFLA 3F8TA 4LWOA 3EYAA 3KU1A 3CPSA 3BGOS 3NHSA 3L8ZA 3BMOA 3CUUA 4NKRA 4Z1MD 3A8TA 3T0IA 3HDJA 5EEGA 3WAJA 2IP1A 1ACMA 1VIDA 3TN7A 4AT1A 3EMDA 1NA5A 2DQZA 3PR3A 4RF2A 1O03A 2F3QA 5I8ZA 1AQLA 1R0CA 3TX2A 2HK8A 2PV7A 3T5BA 3L92A 4OLJA 1C9MA 3OPVA 2VYQA 5FAXA 3SQMA 1Z3IX 3L05A 1R0SA 3JSXA 4RHEA 5GZ6A 5KWVA 1F0KA 3HHEA 3A1DA 4I2NA 4CW7A 2VT7A 3HB5X 3JD3A 1JIUA 3PFFA 3QPBA 5ARDA 1PFKA 4KXNA 3A6DA 4MUHA 3R0VA 1KO5A 3RAJA 5GM2A 3ZVKA 4E0BA 4KN8A 1OVMA 3GEDA 1MZVA 3C41J 1C1YA 4MGZR 3OA0A 3UATA 2WY2D 2EV9A 3W9UA 4H1WA 3MXTA 3B9RA 1SVUA 2FN8A 2VDLB 3P9KA 2PVCA 2ISQA 4U5QA 4BFYA 4HCJA 4ICIA 3SC6A 2MSEB 4IIJA 4LXYA 4Q01A 3G7SA 4B79A 1YQXA 1ZLXA 3P9RA 2AQ8A 3PYMA 4OHVA 3JAKA 1Q0SA 3GUYA 4MCAA 4OAOA 4ZCLA 3I64A 7ADHA 4JI2B 2Z43A 1XAHA 3M89A 1E2LA 5AVQA 3VJKA 1TF2A 4PPYA 4NAHA 2VHQA 3WMRA 4O2LA 3L1IA 5IVKA 4HN2A 1X1BA 4KHZA 4PLTA 3OHSX 4IRUB 2IYWA 5K5EA 2GN2A 4INJA 1LSSA 1RXYA 3FWPA 3R7WB 4IUBS 5A4FS 5AVRA 3TZ6A 1F2TB 1M2OA 4IIJF 4S1OA 1SKBA 3UJDA 4BN4A 3L9WA 4CYMA 4X84A 2YN0A 3GXBA 1JHQA 4LV8B 3LBIA 4LHSA 1L5NA 3WWEA 2WWXA 4W1SA 1ZMRA 5BQPA 3VR3A 5GV8A 4TXLA 2Z6VA 3R6TA 1ZM2A 1A9XB 1GT6A 1QV7A 5TVKA 1A82A 3BD8A 5EMMA 2YXEA 4HNRA 5BVGA 5HHTA 3G2IA 4XD7A 1ULSA 3B51X 1QIKA 5I7SA 4TYNA 4B84A 2I4TA 2JGNA 2A57A 4IIGA 4DA9A 3Q8LA 4EB0A 1FC0A 5HKAA 1FFSA 5JY1A 1JHOA 2P7HA 2X0FA 3C0KA 3IAAA 1CR1A 4MARA 5DSXA 4F7DA 3RYHA 2HDNB 5DNUA 4G5HA 2C0QA 1KFBB 3L43A 2P6PA 1MT0A 1V11B 1VIYA 2GVZC 1R9MA 2QL6A 4FNAA 1ZW6A 4EAQA 5EGNA 2CDAA 3QY9A 3EZ7A 1T0HB 2QPLA 4K26A 1E9AA 1YR2A 4DHEA 5JAZA 2I87A 4WMLA 3W9SA 2VF8A 4U0KA 2F3PA 1XQVA 4GKKB 1YBVA 4MVJM 1X2BA 4I7EA 1JHDA 3C8DA 5AKIA 2JZNA 3AZOA 3HB4X 3H05A 1JEDA 1E77A 3L9XA 4LS3A 4PC3A 1G3IA 2W43A 2Z8YA 3BXOA 3N8NA 4FI3F 4UUNA 5B4TA 5K8JB 1HX7A 2EP5A 4ZVVA 3ABSB 3OM0A 3DL7A 1PQPA 3C97A 3O94A 4PQFA 4A2WA 2IUFA 5C8DA 3ZJUA 4CMAA 5K6RA 2N75A 4B6OA 5JD6A 1A8HA 4EGQA 2VATA 4WXHA 2GM3A 2QQ0A 1OX4A 3F1LA 3MIZA 3EIOA 4K9DA 4YP5A 4UCQA 5CDSA 4LHWA 2YYSA 2JHAA 2B4RO 3WDSA 4X1IB 4EEKA 3VHXA 1W73A 1ZOPA 2UZ1A 1NVEA 2QRVB 2RH4A 4KQXA 5K8UA 3AKCA 4DIMA 3OX1A 5E9QA 4E1VA 1ULTA 4UOZA 2CXUA 3R0QA 1FFXA 3K70B 2XY4A 1OXKB 5B58T 1OD6A 1FQOA 2J6CA 1KBQA 3E84A 4PHHA 1IXZA 2QD5A 3K71B 1DEXA 2OBFA 1XLWA 3AJ8A 5K2MA 5BN4A 1T2VA 1W19A 3KJIA 4RVHA 5CEFA 2ZRDA 4MQLA 3W3ZB 3PUWA 1JWBB 1Q0HA 5IKOA 4YCAA 1K0FA 1B41A 2A67A 2W2KA 2Z3WA 3W1WA 5EIXA 2K7FA 2XRYA 2V7WA 3HSSA 4YJGB 2OSVA 1DT3A 1YL7A 2WAMA 4WPGA 1ZESA 5AHKA 3VKFA 5IVHA 2AL7A 2FWNA 3AB7A 3G1WA 4EX7A 5JO0A 4F21A 3RVKA 1TU3A 4MVXA 4UKDA 3FIJA 2YL2A 1HOTA 4O4IA 1JLMA 3RKSA 1J2JA 3EXFB 2ZTHA 1AQ6A 1TRKA 4J0GA 4BATA 3E3LA 4BQQA 2AW3A 2KWIA 3LVRE 3DF7A 1C30B 1HDRA 4EMUA 1I13A 2Y68A 3NATA 5B4VA 5KC9A 1WXWA 4D3XA 3QUSA 1UEXC 4H31A 1XAJA 5BN3A 1Z22A 2RAFA 1RXWA 2YOHA 2PTGA 2Z57A 4OUDB 3DT9A 4OB6A 1AO3A 1XZEA 1RWBA 2RH9B 4MR9A 3O8RA 5BSKA 2ZTUA 3GBPA 1MX5A 3DW3X 3GD7A 4Q3DA 5M2QA 5GONA 1E9DA 1X1SA 1JIQA 3E3MA 3IV7A 1M6EX 3O0TA 3RC7A 2D0PB 2VSNA 1Y81A 2Q6LA 1VJ1A 3E53A 4ZCTA 1YZ3A 3S1AB 5ELLA 4UMDA 2XH8A 2R6GA 1ZH6A 2JK1A 5CYFA 3T3IA 2PRZA 5DM60 4FIZA 1TGYA 3GV0A 1IZYA 1NJSA 2AA3A 2X19A 3DOUA 4I1SA 3VNQA 1R0XA 2X15A 4DQ0A 2Z6UA 5CVUA 2WHEA 4IQFA 1H6AA 4HDMA 1Y9ZA 3EEFA 4R84A 3VDXA 2P9QA 4IOLA 2IZOA 1VB5A 3IOEA 1Y6RA 2NZUG 5GONF 3DOCA 3SHOA 1NSTA 1Y7IA 2GWHA 5CIYA 4ZOBA 2D2FA 3OPYB 4X8MA 2ZWMA 2HIAA 3V8RA 4B82A 3HKEB 4DSUA 3ADOA 1NMXA 1LPSA 3QVVA 2RB5A 5FA6A 3UJNA 4DR6B 3UHAA 5EHIA 4PSDA 3H2SA 2A9FA 1SK9A 3QLUA 2BTQA 1AK1A 2PX2A 4LRTB 4JA0A 5IVDA 4EO7A 1PEAA 2JEOA 4BNMA 5GPBA 3DMHA 3H7IA 2ZAYA 2YOGA 3QBVA 3D7SA 4LKOA 4RESA 4FI3C 1I14A 2Z09A 1Q91A 1YFLA 4BO9A 1TLLA 1ZAKA 2IY9A 3CY6A 4RIFA 1EP9A 4UAVA 1Z08A 4DDWA 1OROA 3I04A 4YWHA 5CW2A 2GPJA 1M2VA 2WUFA 5A7FA 1LK0A 4NOMA 1TCCA 5I8PA 1Y3FE 3LNCA 2QM7A 4HVAA 3RU3A 2P2SA 5BMOA 5A2QA 5JSZA 2DCMA 2OPBA 1KS9A 2JG3A 4L6CA 1MP0A 1XXHA 3LPAA 2HL6A 1ZSNA 1ADGA 2ZYTX 3H65A 5T8KA 3P2EA 1SVSA 4B8WA 4HWPA 4A8TA 4B8YA 3B13B 2AJBA 1JDTA 3RW9A 2OQ2A 3HYRA 1IOWA 5BSTA 4QUDA 3O8BA 5HZMA 2CUNA 4TZTA 3E2PA 3IUJA 1IZ0A 7ABPA 2PX6A 4DLAA 1JE1A 1JKMA 2Q50A 4UHCA 3TM4A 4DREA 5H8WA 3KOUA 1UJNA 2RGYA 4G67A 2PJUA 3S2ZA 3FPHA 3K09A 4U7GA 4DC1A 2I6GA 1QCCA 1KTIA 5AMXA 3OTHA 1SZDA 4NZMA 3L7OA 3FX2A 5A3QA 4WCFB 1IK6A 1SUWA 4ZRMA 4IS3A 4BX8A 3DZIA 4FGKA 1D4ZA 3I5UA 2W0SA 4XAQA 3GP3A 5JPCA 1ZJ5A 3FNHA 1YZUA 3GVHA 2O0KA 3HUUA 3E58A 3ILVA 3QKTA 2AFIA 1N6RA 4LCJA 4EJ0A 5FI1B 4BJ5A 1BD4A 1Z5VA 4I1RA 1Q6ZA 1S4MA 3HU2A 3ZCQA 1JTFA 5TVGA 3RNLA 1E79D 3BPSA 3DDCA 2ZJ0A 1ICEA 3PX2A 2CHVA 5TC4A 1Z37A 2BZ0A 4ATNA 2C1EA 2WT4A 3O75A 5HF9A 2ZI6A 3OA2A 5LM3A 4HPJB 1KFCB 5KZMB 2QRHA 3A4LA 4FNOA 4R3NA 1GZDA 2RONA 4K81B 2GCPA 3KD3A 1CJBA 4MTCA 2QRQA 2VH5R 3DB1A 1G38A 3ZDDA 1O5OA 1KERA 1WAMA 3BGSA 2QGNA 3V7NA 3EGDA 5CEJA 3TEFA 1M73E 3KFVA 1RLMA 3AF3A 3ZVLA 1LLFA 2AFHB 3RASA 3VKGA 3F49S 2XOKA 4XLTA 3N7UA 5AK6A 2HDOA 4FGZA 4ZI7A 1U4OA 3ICEA 1KC1A 5DCYA 4C04A 1YR9A 3CTPA 1UP6A 1JV2B 4Z4HA 5KAMA 1U28A 1YSCA 2HCJB 3HSYA 1F38A 2WYWA 3MB5A 3MOGA 2GF2A 5CT5A 3H2HA 5A3VA 1JFFA 3GZTB 1HWYA 1C7QA 1KVQA 2WILA 4ZREA 3RVSA 5L3SB 2EC5A 4NFYA 2XXAB 1B8PA 5CXQA 2DJIA 3ZZ0A 2C4UA 2XSZA 1NBWB 4H7DA 3K0BA 4TMXA 3RUAA 2PT5A 4XTRA 2D74A 4LFCB 3HDQA 1E7SA 1LF0A 2JB9A 4DIFA 4EG1A 4ZI7F 3TCXB 1G8GA 1JX6A 1YRBA 1WMAA 2QRUA 1G42A 2ZJ3A 1W0CA 3REQB 1VHLA 2O6HA 3D9QX 3LX5A 4U2FA 2YWCA 5GIOE 2ERYA 3VPGA 3T9AA 1CRPA 5DRYA 2X5OA 1WPRA 1WOMA 3QLUC 4FE3A 1N5MA 4IEEA 4OCZA 4OQPA 5TR9A 3TCNA 3TR0A 2YZGA 3OAAD 3Q5GA 1JTVA 1YUNA 3JQFA 1QZUA 1WD5A 1GA6A 4QC2A 3MW8A 5EE5B 3FFBA 2XF2A 4WESA 5P21A 1G0OA 1ZDMA 1QHHB 3FMVA 4RS3A 4G0ZA 2LGJA 3TW6A 2XYPA 1EUCB 3U0VA 1NNEA 2BRUA 5I9LA 4TTPA 2BMEA 3BQMB 1QQBA 2FEPA 5IAJA 2ZZKA 1G21B 3Q7RA 3BF8A 3N07A 5LQMA 2C2YA 1Y37A 4FFDA 1L4UA 2JJMA 3KDPA 4RTOA 5F5LA 2P69A 1H2BA 1L5SA 2BF4A 3OJXA 3QVWA 1NP6A 1V1RB 3AWDA 5G3ZA 3SKVA 2HV9A 3KNZA 4MGYR 3OUZA 1NTOA 2XZDA 2GEKA 4EJFA 2G8NA 2WHQA 4ZGGA 3ABRB 2BLNA 4LFBB 5T8KC 4TROA 1X7YB 2ONZA 4IPTA 3BFVA 3Q9UA 4YH1A 1PWXA 3ORQA 1R27A 2H7XA 1T2DA 4H6PA 4WOJA 1UQTA 3QU9A 3F47A 4GE0A 1NP7A 4JV5B 1PP4A 3JQ8A 4X8OA 3W4KA 3TBKA 3F7MA 3GFSA 4FIDA 3W6NA 3B1VA 1Y34E 1Y89A 1NBEA 2GK3A 4OGKA 2ZITA 3G6WA 3LDUA 1Y8CA 4OU4A 3K09C 3TGLA 2ZE5A 4IS2A 1NMEA 4GGPA 1MQAA 3ZWMA 1GITA 4E03A 4ZKDA 3KV1A 4FEGA 2PUGA 1HXHA 8ATCA 1POXA 4EITA 2H17A 1RYEA 2VIIA 2EJCA 4I8XA 3R3ZA 5IEJA 3NTOA 2W2TA 1YB6A 1W49A 4MCHA 4XX0A 4AKIA 1YZKA 2JIRA 4HDSB 1RXCA 2Y92A 2R60A 4YP7A 3TVTA 3UOWA 3ZIAD 4H18A 4FZVA 4OJYA 1FJHA 3L7CA 5AJWA 1A50B 3B9BA 4DV2B 3DFUA 4LNHA 3DCNA 4NMHA 4BAZA 2IS6A 1PNOA 5ARBA 2VDWA 4MO9A 3K16A 4JVSB 4D82A 1DGQA 1ZIOA 3T5TA 1HE3A 2R7MA 3HV0A 3NPMA 4F06A 2ZE6A 4FB5A 3O2JA 1AOXA 2QTTA 3B5EA 3HP1A 3WLFA 3CRMA 1MRSA 2QNIA 3JZMA 2MSKA 3OJOA 4LQ4A 2OAGA 1Z2CA 5CH8A 3I9JA 1AZTA 5DIZA 5CDTA 1R1DA 2VTDA 5FEMA 2W6ZA 2H1HA 3ZHCA 1H4TA 2ZUCA 3B78A 1EJ0A 3RGWS 4DRXA 4NXNB 2MTBA 1N5OX 5AW4A 2Y3IA 3ZDQA 4WOPA 2IH5A 1RE1A 1NAHA 3NHMA 1AH2A 4TRRA 1NF3A 3W4IA 3WTBA 1OBFO 1A2KC 3JZAA 3NT2A 2NX2A 5U1PA 1N0VC 2ZXEA 1RC0A 3FNFA 3LGSA 4R2LA 1II8A 1SKUA 2HHCA 3DOFA 2FSIA 1ONOA 2IE8A 1DWUA 1NM5A 4IICA 1OWLA 1NR1A 4CUKA 4ZQCB 4DMGA 4IOMA 2WWYA 2BGRA 3DR3A 3KB1A 2CJWA 2WE8A 3VPDA 2NYUA 3LQ1A 3RU2A 1L8AA 2OXEA 4JELA 4GUDA 1P0PA 1YI1A 3N8HA 1QPGA 5J2UB 2A33A 1S9HA 2PPLA 2V8OA 4BRWA 1KZHA 3TUJC 4GRIA 1FDOA 2YCBA 4NZOA 1N2CA 1DTWA 4HN9A 1JUDA 5DHTA 4MQ6A 2AX3A 4ZAWA 2ERCA 3WBFA 3L6DA 2YKGA 1TJ3A 1NQAO 3SX4A 5AVZA 5JBIA 3VI4B 1ZYUA 2X2PA 3FTCA 4I1UA 1ESDA 1G7RA 2HYDA 3DDWA 2R8RA 3L4SO 5IAEA 3R3XA 2CVZA 3FROA 4PQRA 2FZGA 5ICFA 4E11A 1MOZA 5TF0A 4C0LA 3V55A 3JQFC 5G02A 4DW8A 5C80A 2B6NA 1CZRA 1FUYB 3HWRA 3IUMA 3SKXA 1I4OA 2ZTVA 2R5NA 5A0FA 5ALZA 3T3MB 4MUIA 3OBIA 5HE9A 5JWHA 3VNAA 1YFKA 1WB9A 3IP3A 3KC2A 1LBHA 2TMGA 5AR1A 4BVJA 2PG3A 3G0OA 2J07A 4F9GA 1S1MA 1QLWA 3EC7A 1FP2A 3OQIA 1E2EA 3A1CA 3GJRA 3LE8A 1A98A 5H16A 3ZBUA 4AMZA 1B8VA 4DLTA 4EDHA 1YCFA 2B34A 3BRSA 3DVAB 1BN7A 1DMSA 3CVYA 2WINI 3AKEA 3LS2A 2K2QB 5TDHA 4LHYA 4KGXA 4YRQA 2ZRPA 4PLGA 3OIGA 1JJAA 2DUMA 4KIUA 4UZSA 4MS1A 3DOJA 4UFPA 3WWYA 4BS9A 4ALKA 1J23A 1YCDA 1B15A 2I34A 2IQIA 5TLSA 3GLFB 5EYPB 3WADA 1TEZA 1T1IA 2PQ6A 1USVA 1WF3A 3UWMA 1E64A 3VHLB 2JLYA 4KMSA 2D62A 2HC9A 5K3FB 1ZZGA 1VE6A 1KARA 2XMQA 2E49A 1PW5A 2VJLA 2Q8PA 2O7RA 3IJEB 4RIEA 4CHGA 1LF5A 4JC0A 1J2RA 1XJ5A 2FPKA 2IYLD 3NCTA 4GOKA 4ZARA 1KPGA 1EX6A 5KMGB 2CZCA 4I6JA 4QATA 3U1TA 4Q3AA 1MVOA 2WWIA 2WF8A 3CT4A 3D3JA 3KP1A 3FB1A 1GTZA 2CXTA 2FW7A 5JT1A 3JV7A 5FIUA 1QH8A 1P2BA 3B1ZA 4WE3A 1LRLA 2C20A 2MMCA 1QV6A 3UNXA 3W4JA 4L2IA 5COBA 5E0KB 3K2EA 4GOOD 1ONBA 1QOPB 4FSXA 4W5JA 1KFKB 1U0HC 2IXEA 3E05A 3ZK8A 4JB0A 2QPAA 1UKZA 1UC4B 3ER6A 5AKXA 4HUJA 4KZPA 3H9JA 2C2WA 2PJDA 3QVUA 3ZY5A 2QNRA 4UBKA 1J21A 3SVTA 4ZQGA 4QQNA 3FOBA 1NOIA 3FM9A 4YT2A 3L7BA 2H7CA 4M98A 2W7TA 3G8DA 1EKXA 4NX2A 4INZA 4AL4A 2PUAA 1KMNA 1HLDA 1UKEA 4GKBA 3RM3A 4IKEA 5SV2A 1DAOA 3IH5A 4G1BA 1VL2A 3I23A 1NF2A 3PL1A 3BA1A 1RFGE 3KQTA 3COVA 5L7TA 5KDOA 4ODIA 1JF8A 4CLDA 2OV4A 5F1KA 4HZIA 3VC2A 3FDIA 1G98A 1RD4A 1GZ7A 1YRYE 2W22A 5ABPA 3UCEA 3CRVA 3DXFA 2AVNA 4MO2A 1QVZA 1SHJA 1O96B 1X87A 2Z9BA 3SFTA 1CR2A 3MUNA 2RAPA 2WD7B 2W5UA 2YXBA 3W90A 1G9XA 3A04A 3O74A 4FFNA 4MRSA 1TCUA 1JI3A 2ZI7A 3JY6A 4FJ1A 4M8LA 3WB2A 2XWQA 5CXXA 3X1WA 3JQGB 1F20A 1XTUA 2PL9A 5CB4B 4X66B 1GPDG 2BFWA 3HCPA 4HEJA 2VPXA 4W9NA 4R7GA 1N2EA 1Y5NA 4EBFA 4G1EB 1AC5A 4G0YA 4PVCA 4RD3A 2Q5QA 2Q5JA 3VV3A 3F0TA 1TZKA 2PD6A 3IUYA 1KMHB 3DDUA 1Q0UA 5DIFA 3ZWVA 4ZQIA 4JJ6A 1ZRSA 2C97A 1VKJA 2YZMA 1IWOA 4CIYA 4CFZA 4R5MA 4EPXA 2ZSDA 3DZDA 1HDCA 2VDVE 2KSQA 1KP3A 2Q2NA 3TGPA 1NY5A 2IDMA 3DKRA 4GKAA 5FA8A 4E31A 3V8NA 3KL2A 2NV0A 4LVUA 1KAOA 4P34A 1XQXA 4RMGA 3AIIA 1AGYA 7AT1A 1G5HA 1MW9X 1QRDA 4M60A 1H2YA 1X9HA 3FUVA 2RI1A 1YNOA 2W71A 1VE1A 1VPEA 1Y63A 3PTLA 4NECA 5EQFA 4ER7A 4DRYA 5HP4A 3NRBA 5SY4A 4Y98A 1PYGA 2IIPA 4TT3D 4FSHA 4L85A 2J59A 1TX4B 3U3XA 3VDRA 2ZVQX 4JU9A 2N9UA 3AGQA 2NQ8A 2ZYGA 2V9PA 2ZSUA 1RZRD 1V2GA 1YOVB 2HUNA 3T4PA 3M34A 1SUEA 4XYMA 3UCXA 4B48A 3W2GA 2V7XA 4RCVA 4CIAA 2EDCA 4JX8A 1Q0TA 2FP4B 2O2CA 2FQYA 2BMWA 1YHYA 2JGRA 2UYQA 2O3QA 1JEOA 2O8DB 4YEDA 3F73A 3L41A 3OQ1A 3REFA 2BN4A 4B76A 5IJ9A 5U9CA 1IQ0A 4ER5A 4U2DA 4LOAA 2HA7A 3RLFA 1E1KA 2X86A 4I50B 2W4IA 5F2OA 3IAXA 3SDSA 1FRQA 3W7BA 1GTRA 2XNDA 3H84A 4YMGA 1OFIA 4LRXA 4W6QA 3SKYA 2B1GA 5K0CA 2A0UA 3U13A 1Y6ZA 4QTXA 1FFCA 1SJ9A 1Y7HA 2GEVA 4TMWA 3SFVA 2I03A 3BXEA 1BX1A 2PX8A 3VTZA 3X43A 1NVBA 3EQZA 2I29A 2X13A 2H4FA 1PNQA 2OD9A 3N7AA 4AUMA 2I1LA 3NBMA 1F6BA 5JATA 3N2KA 5A4DA 3IPRA 4WL0A 3SMVA 2OV3A 3RUCA 4JSRA 3OM8A 1AUVA 4V0LA 5C4MA 2FR8A 4XKJA 3K1AB 1B6TA 1QHXA 2FSVA 1O0SA 2ZPUA 4Z3DA 3D3KA 3HEBA 4ZRDA 1NV8A 3LQFA 2CNWA 3OMXA 2VRCA 1T4CB 1JQAA 4CCWA 1KMQA 3FWHA 4XM2A 1LV8A 1XN1A 2I0FA 3G13A 4C2TA 2BOVA 3FLMA 4G65A 3KUDA 1Z83A 2OP1A 1ID8A 1BC5A 1XQ6A 2E7ZA 4GM0A 1QSGA 3D7LA 2QDKA 3NBQA 4L9WA 3T9CA 3FZYA 3R9XB 3R6DA 1E2PA 3R3JA 3ZWWA 4E6EA 3K9QO 4KAAA 4NV3A 3DWFA 1ZMTA 5F33A 1YRAA 1UBOS 2F43A 4PG7A 2QRLA 3T6KA 3R5JA 4P0TA 4DSAA 2PMFA 5KNCD 1UXHA 5E7IA 1BWQA 4RORA 3BYZA 5EJ2A 3KPJA 4GVPA 3MJVA 3QE3A 1E9BA 1O5TA 1MPXA 3NS7A 4WI1A 4XEUA 4XVQA 3UWSA 2IGTA 3DQPA 4HTAA 5K51A 2G9NA 4DBLE 4AJHA 2H9IA 3IR6A 4RDIA 1GPKA 2I6UA 1FRFS 1L7AA 1NW5A 3L7NA 4U5XA 3NUGA 4C20A 1V5GA 2XBMA 4MRMA 4N9WA 4BNLA 4KO8A 5KOJB 1I94B 4KE6A 3D59A 3KZXA 2HK9A 1MCZA 2NPIA 1J7KA 2VPTA 2H51A 2BHSA 4LBWA 5MFPA 2PGIA 1GGVA 3DPIA 4UBNA 4W9NC 4BY9E 3PJEA 3Q1KA 2XJ4A 1RXSA 2Q4EA 4HYTA 4YRLA 4IIDA 1ZVMA 1GYQA 1IJFA 2AYXA 1M8GA 2CWDA 2JI7A 4UEJA 5FTKA 2ILVA 2KLHA 5C0OE 3V4PB 3ZGOA 4AG5A 1G16A 2YC2C 4LJ6A 5HKKD 2Q7XA 2ZS7A 4AJNA 3HBJA 1W1WA 1KNQA 1Z4QA 1PFGA 2OP0A 4IGFA 3EODA 4I1YA 4I1VA 3GH1A 3H2IA 4G24A 3AEUA 4M0DA 3G49A 3AP2A 4MYRA 3IALA 3ICPA 4PX9A 4ZV4A 1QQAA 4AJKA 5EN4A 3FFTA 3GEIA 4A0HA 2D2VA 5BO5A 4RHCA 4E4RA 5HS4A 3B3AA 3H7AA 5AKZA 1GXSA 2VZLA 3PQ3A 1K7FB 1E92A 1ZK0A 4DPMA 5CAEB 1H8HD 5IDVA 2Q7OE 4JQCA 5GAJA 5KX5B 2BT4A 4NAUA 3AU8A 4HSGA 5KJCA 1V8FA 3W5DA 3GP8A 3JYQA 1NSFA 2GBGA 4QOSA 3DE0X 3U80A 1STOA 2CMHA 2P4EA 1BQ3A 2P3OA 3C85A 3O3CA 1ISFA 1BQ4A 1PSZA 3O1LA 4G2NA 2FSHA 3O3MB 4AS3A 4DAEA 2ZR8A 3VSAA 2BGJA 2V97A 2F3SA 4QBIA 621PA 2YNMD 2GZ3A 1E96A 1LU9A 1OLXA 3H5OA 1EGMB 1NU8A 3NKLA 1YB5A 1JR3E 3EXHB 2BHLA 3NWOA 4YI5A 4PZZA 2X5KO 4CF3A 4E1BA 4YRKA 4V1CB 5IWCA 4DR2B 3L5KA 4DV1B 1L8XA 2F1OA 2KE5A 2HLHA 1SN7A 3NIBA 1PIWA 3C74A 4GZ3A 1WHTA 3X2FA 3FA2A 1OXMA 3ANNA 2ROQA 5GGYA 2GLXA 4CG3A 3U6BA 2VNJA 3DFKA 4KV7A 4M7RA 1H66A 3S1SA 4TTQA 5D8DA 3TAUA 3EF1A 5K4HA 1NRXA 2XCUA 3D4OA 4NYJQ 4CUZA 5KNCA 1SXQA 3EDYA 4TMVA 5AH0A 2A59A 2HBQA 4ZK2A 5KNDD 1E7YA 3DL2A 4KE7A 4LTNA 4MV9A 4DHWA 1KEWA 2FR8C 3GI1A 2FSVC 1KTVA 5IW8A 1SGWA 2JLCA 2Q3CA 3HYCA 4MW2A 5TT1A 1KVSA 5IXSA 3B5IA 1R18A 5IEBA 4BB5A 1DKNA 4KO3S 3MN1A 4YMIA 3LI2A 4WXEA 1W87A 5DBOA 4QGSA 3I5XA 5F12A 5DLDA 1SUFA 4XVUA 5C3MA 3HYLA 1GJRA 5EKTA 4BMPB 5IHXA 3U62A 1NUPA 3DUFB 3RVLA 4MB0A 3UMVA 3TAXA 3SFZA 1DO0A 1DSSG 3OCYA 1LY1A 5I9NA 2NTJA 3I0MA 4N0PA 2OB1A 5HF8A 2IS2A 3GROA 4XYLA 1E3WA 3FOWA 2SKCA 5JNVA 5DB4A 4RZXA 4Y2SA 5JJIA 3IB3A 3LZ6A 1VOTA 1ZJZA 3BULA 2QG9A 1U0FA 3L1VA 4H7IA 2O2EA 4L9AA 1QANA