3REGA

Crystal structure of ehrho1 bound to a gtp analog and magnesium
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
171
structure length
171
Chain Sequence
b'KKALKIVVVGDGAVGKTCLLLAFSKGEIPTAYVPTVFENFSHVMKYKNEEFILHLWDTAGQEEYDRLRPLSYADSDVVLLCFAVNNRTSFDNISTKWEPEIKHYIDTAKTVLVGLKVDLRKDGSDDVTKQEGDDLCQKLGCVAYIEASSVAKIGLNEVFEKSVDCIFSNKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rho-like small GTPase
publication title Unique structural and nucleotide exchange features of the Rho1 GTPase of Entamoeba histolytica.
pubmed doi rcsb
source organism Entamoeba histolytica
molecule tags Signaling protein
total genus 54
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3regA00
5CYPA 1ZD9A 3QEOA 3TH5A 3GLIA 2VQSA 3SC3A 5C18A 3ZLJA 4A2WA 4MITA 2ZJ5A 5G40A 1E1RD 2HCBA 3AP2A 1OIVA 2NGRA 1G9XA 5F2EA 5FPYA 5L3QA 4Q7LA 1YKSA 4MKIA 5D3QA 2IC5A 4GBMA 3A1TA 4I1SA 3A1SA 4US0R 3SHFA 4JVNA 2V7QD 2CNWD 2ZYUX 1ZRHA 3TSOA 1E2FA 2QL6A 4YDHB 3AF0A 4DCVA 2O8FA 2PCLA 3QF4B 3DPUA 4KVGA 4NPHA 4B48A 4HLUA 2Z0MA 4OL0A 5H1YA 1IOZA 5HCNA 2ZREA 3U3MA 4I99A 4CGZA 1K8RA 3R9XA 3ZJYA 1OT3A 5DIFA 1VECA 2VEDA 2ZITA 4U7DA 2Q6TA 3HYRA 5DE3A 4DKXA 2ZJAA 3RRNA 2XOKA 5AK0A 4IRUB 2FH5B 2ZRAA 1RZ3A 3LAWA 2J7PA 4JL5A 2GF0A 1F2UB 4HZUB 5EUMA 4DCNA 1M1YE 1UDWA 1JEEA 1J7KA 1JJVA 1KO8A 5BQ5A 4A15A 1R8QA 3EPHA 2HF9A 4H9GA 4RD1A 3U44A 4QJ4A 4C4PA 2GRJA 3ADDA 3IQXA 1RRGA 1CR0A 3W6NA 2FSGA 1Z08A 1CR1A 4OHWA 3NEJA 4BFVA 1W36D 4UNQA 1HTWA 2WIAA 4TL7A 3TUJC 3UATA 5GJVC 1GL7A 4ZI2A 4M21A 4AYTA 2BBOA 3MWJA 3F3YA 2ZJZA 3WY9A 1G7TA 1P4SA 1FFHA 2G0NA 2ZE6A 3EPKA 1E9FA 3AVPA 2O5VA 4D26A 1NMYA 4TYPA 4POAA 1LS6A 2NO9A 3QI2A 1FPMA 2X8AA 4BLQA 3HJNA 2VHTA 2ZUCA 1EWRA 5IF9A 1A1VA 4PHGA 1KI8A 4FCTA 1KK2A 3K70B 3THWA 2CE7A 3KUCA 5FI0B 4D81A 5LB4A 2CLSA 4HZIA 3VU9B 2H16A 1FZQA 2VIIA 1ZC3A 2YINC 3A4MA 1SVLA 2O52A 4M9QA 4LBYA 3ECCA 4DLXA 2CLDX 4LRWA 5CM8B 4PZZA 4A6XA 4LHZA 4YQFA 1B0UA 1UKZA 4MYTA 5AUPB 1F5NA 2OUKA 4UXIA 4CVNA 2E87A 2FPKA 3KKNA 1DELA 4OJQA 4MYCA 5SZHB 3AVYA 1XXHB 3RS7A 2VF8A 5EXSA 1GP2A 4QGFA 1KGDA 3B6EA 4JLBA 3LW7A 4R7ZA 3FHOA 4S35A 2JDID 2ZSFA 4O2LA 1ZNZA 2Q9AA 2XNDA 2K5UA 3REGA 3RS0A 1GKUB 2QY9A 1VIYA 4B73A 1GOTA 2GF9A 4E03A 3K0CC 5DI3B 4UNNA 3OEEA 5B2ZA 5LB2A 5B64A 5K8IA 3BE4A 3KKPA 1KTVA 1MH1A 1W4CA 4M1MA 3ASZA 4TQ9A 3GJXC 1AM4D 2B6HA 1KK1A 3HU2A 4B6FA 1JJ7A 3HU1A 4E09A 1NBMA 2VSFA 2RGGA 4RD3A 1C9KA 4QL3A 2YOGA 1NNEA 1UEJA 1ZD8A 3C5CA 3I4LA 4PC1A 5DNYB 4JL8A 3B8HA 4B2IA 3TGPA 2V1UA 1CIPA 3PEVA 4F92B 1U8AA 3NH6A 5AR1A 3TNFA 3UMRA 4OI0A 1RYHA 4PPFA 1PLLA 3SYKA 2W2TA 4TMVA 1VG8A 4TYWA 3HYTA 1V5WA 5HKKA 4LSGA 4URVR 3T1OA 5HZKA 1UKYA 3BORA 1CJMA 3GLGB 2DWQA 1AJEA 4UXJA 4J0QA 4E07A 4NP6A 2JIZA 4PHFA 1R10A 1PLJA 1KDRA 5CB8A 1SXJA 5JSZA 2H7VA 1TAGA 3EWAA 1WRBA 2JEOA 2F1RA 4RZXA 5EZ6B 1N2CE 1ZD1A 5B58C 5DISB 1E2EA 5KPJA 1N5LA 1NIPA 2HT6A 4ACAA 1RIFA 1R5BA 4PPQA 2NPFA 3PQCA 4JS0A 4DBLC 3PVSA 1QHXA 1SQ5A 3BC1A 4L15A 4B6EA 5KU1A 1GNRA 2RHMA 2LKDA 1YU9A 4DT1A 1W2HA 2ZUBA 3ADCA 1XFAA 1G8PA 1SZPA 2BEJA 1NY5A 4B44A 2ZYWX 3X1ZA 4OHZA 5JFGA 4M1WA 3R9IA 4MRVA 3TVTA 1E69A 1KMHB 1ZM9A 5J4VA 2RGAA 3QF4A 1E99A 2XZPA 2QM7A 3WYGA 1DBSA 1TL7C 2QQEA 3GLIE 3KUDA 2ZETA 5JJLA 1LVGA 4LV5B 1G3QA 2KBFA 4BEBA 3U60B 4NKRA 2RHDA 4OK6A 3G0HA 2DFKB 2BM0A 4TLAA 3T1VA 4L16A 3BS4A 1U98A 3ZIAD 4TN1A 3LVQE 1UADA 4EPWA 4Q4JB 4BPBA 1RC8A 2BOVA 4WAUA 4F4CA 2Z5FA 4JSTA 4B3BA 2Q9BA 4ZKEA 5CLQA 2CXXA 2RKOA 3R20A 4RZUA 4XOIA 3UWKA 4M0LA 3SOPA 3GQBA 3GLHE 5IRCD 2A5JA 1KAGA 3L82B 3PIRA 5GJWC 2MSEB 2GBLA 2QE7D 1RE0A 3MUFA 2DBYA 1VHLA 2CJWB 4WXPA 3GLFE 2HF8A 2GCPA 2RGNC 3LQRA 3RAPR 2WOJA 2ZROA 2IYUA 2VSXA 3TAUA 4Q4HB 3VQTA 2F1JA 3T12A 2BBWA 3OESA 3MFYA 1JECA 3VR4A 2QPTA 1W5TA 4UJ3A 5CDFA 4DCUA 2NO7A 4YDSA 3RS2A 4OKSA 2W6ID 2J0UB 3DO6A 3KXKA 4CEJA 3WYFA 1IBRA 3A37A 2QGZA 2ZS7A 3KX2A 2YWFA 2IYZA 1XD2A 1OJLA 3EIHA 1A82A 1JPJA 1N5IA 1XRJA 4UNRA 3HPRA 4KFUA 4X8MA 4BEJA 4DZZA 4HB0A 4FWTA 2NO1A 3H4MA 1DO2A 2VP5A 4Q66C 4JBWA 4L4UA 4V0LA 2OBMA 1UFQA 1BO6A 3W5JA 1CJUC 4HAYA 1E79A 4DLZA 1X1RA 3P32A 3OIUA 3Q9LA 4B32A 3T06B 3H0KA 3P4XA 3VFDA 1Q12A 2PCJA 2R2AA 1Z0FA 3QEJA 4C0KA 421PA 3THXB 2C78A 2O0HA 1XP8A 3TQCA 2WWGA 1P73A 2EWVA 1KJWA 1W7AA 4FWIB 5GVRA 4M22A 4YMVA 1JEDA 2QSYA 1DG3A 2CBZA 3CF0A 4M1KA 2GA8A 5FL7D 4HLUC 1M2OB 4AY2A 3QE0A 1PUIA 3MWKA 2BHRA 1E9SA 2JGNA 4ZPXA 2ZSAA 1VIAA 2AKAB 1OW3B 4RD4A 5EXTA 1Z0AA 2W6JD 3B78A 1CKEA 3W8NA 3RS5A 2PJZA 1G6HA 1Z3IX 3IGFA 1E1QD 4Q9KA 4FCWA 3FPAA 1OXXK 2BMFA 1M7HA 1JXOA 1BYUA 1RRPA 2GXQA 4NYJR 2F1HA 3BB4A 5KNBA 5JCPA 3W8RA 2AWNA 3FB4A 2BEKA 1NG9A 2R6DA 3CNNA 3ASYA 1X86B 1JB1A 3KXLA 3BBPA 5DLQC 4C0AC 2VF7A 2YV5A 4AKGA 1KO4A 3AVWA 4NE2A 1H8EA 1UBGA 1OKKD 1P9WA 3CKLA 5B57C 1LFDB 2QGNA 4MQBA 4U02A 4XSHA 4DB4A 4L8GA 1AS2A 4BECA 3U6KA 2XTNA 3SNHA 3UPUA 3THOA 2FFBA 1P2SA 2IF2A 1OB2A 1CR2A 2ERYA 2IK8A 1Z8FA 2OXRA 4R9UC 4TT3A 3WRYC 5JEDA 2V6JA 2J46A 2CHVA 3VX3A 1AN0A 2G1JA 3V4RA 1AZSC 4M9ZA 4O2RA 1NBME 2KJQA 4G01B 3PENA 5ANRB 1ZM2A 3NC1C 1XJCA 3IPYA 1H8HD 4AD8A 1D6JA 1NN1A 1KDPA 4PC6A 3UG6A 1FTNA 2V7QA 1W4RA 3WP1B 4F4JA 2CNWA 3CF2A 1TU3A 2NPIA 2IXGA 4KXFB 3NHBA 1E0KA 4IXNA 3VNVA 3G5UA 4QFMA 5FUXA 3CRQA 1OIWA 2I4IA 3Q5EA 2RCNA 4M1YA 3SHWA 1ZM7A 1KSGA 4LJAA 2FGKA 4BLTA 4A0FA 3LD9A 4DDTA 2Q21A 4Q1CA 2HXYA 5KDDA 4KSBA 1X1SA 4TLCA 2J7KA 2WWFA 2FMXA 1W49A 2A5DA 3GFTA 3U4QB 1COWD 2SHKA 3MSXA 4MKGA 5FPTA 3WNCA 1M6NA 3AVVA 1F60A 4Y0AA 3VHXA 1E2QA 1E4YA 2CVHA 4QOSA 3CR8A 2IYXA 2WWYA 4EIWA 3LBIA 1CS4C 2ZRKA 3K9NA 4Q4AB 5BXQC 1MT0A 4ZI3A 3IEVA 4IEEA 4D2IA 1S4QA 1TADA 1TEVA 2XSZA 4OQFA 4QXAA 2XXAB 3HWSA 4TTQA 3AGPA 4DHEA 4IFEA 1IJEA 1YZTA 2IF0A 3B7GA 621PA 1YHNA 1TUIA 1DAMA 4UNSA 1I4DD 2I1QA 5KHOC 2VYFA 4W5JA 1GSIA 1XWIA 4PANA 2CJWA 3EZ2A 4JBYA 5L3QB 4GDFA 4W7SA 4QHTA 3LXRA 2X19A 1FP6A 4KYUA 3MLEA 3SJZA 2QMEA 2A2ZA 4ZCLA 4WBSA 4DSUA 4Z1MD 3ADBA 1Q1EA 3K9GA 5JWHA 3TSWA 3PEWA 4OYHA 2O8FB 4PAMA 3H1TA 5IDVA 2J3EA 2BKUA 2X2EA 1HY3A 5IT5A 3L0OA 4V0OA 1XCPA 4QJ5A 3W6PA 1CU1A 4OQXA 2EW1A 5FOVA 1JAIA 3QKTA 4H1UA 4OHVA 1SXJC 4PC2A 4Q1AA 3AM1A 1QHIA 3LV8A 3EARA 2CLCX 1CLUA 2XJ4A 5L8VA 2IYRA 2C99A 3P27A 3NEYA 2VH5R 2ZVQX 4QBGB 3LY5A 1GTVA 3MD0A 1NIJA 3DOEA 1SVMA 2Q9CA 5G3ZA 1EGAA 2B8TA 2D74A 4EUNA 4B3DA 1TX4B 5CDFE 3VNUA 1OB5A 3RRYA 5M04A 1QHHA 2R9VA 4ITRC 1DO0A 1E6CA 3U44B 4N3NA 4AKEA 3FKSD 5KTYA 1Q20A 3CRRA 3I5YA 4HUQA 1UJ2A 2WICA 5CB6A 2D2EA 3K0AA 1NMXA 2GJSA 1SULA 3EC1A 4DJTA 3ZZ0A 3EW9A 1DARA 1O3YA 3L0IB 5G3YA 2REOA 1N25A 2QP9X 1WMSA 1UBCA 1SGWA 2FF7A 5DHAA 4CEIA 2YJTD 1Q3HA 3OIWA 2ZU0C 3RRZA 1NSFA 3OAAD 4V0NA 3H84A 3HPQA 1W0KA 3IIKA 2WKQA 1IY0A 5KDOA 2R6GA 1XBTA 1Z0DA 3K1JA 2PLFA 3X1DA 4JVMA 2GK6A 4AK9A 3K0FA 4EFLA 3THWB 3KJHA 1JR6A 4MUAA 1XXHE 4TZ6A 1N6HA 1E9AA 5A4JA 4YXWD 4WIAA 2NZ8A 3QY0A 4A9AA 3SBDA 4TTPA 1Z5ZA 4IVPA 3CZQA 4PSKA 4HB2A 3ZD7A 1L4YA 3RYTC 1GRQA 3SFVA 5CITA 2OZEA 1M34E 1MABA 2C96A 3A1UA 4Q9IA 1RYFA 1SHZA 1QHYA 1OYYA 1XEWX 2IYQA 3VMFA 4ACBA 2Z83A 5J5CA 1OFUX 4BFUA 4IKEA 1MRNA 4GNKA 1EK0A 4IOLA 4MDFA 5JS8A 4W5WA 4QRHA 2JLWA 5GADl 3LNCA 1NVUQ 3AQ4A 4P31A 3BOSA 1UDXA 1JR3E 4I81A 1G5TA 1ZIOA 4HB4A 4U00A 1S3SA 2ZI7A 2FV8A 3KB2A 2KI5A 2WM9B 4UNPA 4XD7D 2FFAA 3GEHA 4ON9A 3I61A 2N42A 1XEWY 4AYWA 3K70D 2ZR0A 4DLUA 1RW4A 5DYGA 1US8A 2VHQA 3IPXA 2V4ZA 4IFBA 4V03A 5JJKA 1A7JA 2A7QA 5E95A 4BZPA 2FWRA 4MGZR 2D06A 3VKWA 1S1CA 2I1VB 5KDLA 2P6RA 1GKYA 1WXQA 4QJ3A 2FG5A 3L0PA 3P20A 2W2XA 5L3VA 4MA4A 2YNMA 1AS0A 2XAUA 4O3MA 1G18A 4GPTA 1G1MA 5F98A 3CW2A 3I92A 2RGDA 4OQMA 5CJPA 1EFUA 3UG7A 3EX7C 2VHCA 3B60A 2DB3A 3ZIAA 4C0QC 1SVOA 3BB3A 2ANBA 4EPVA 2PZFA 1E2JA 2FA9A 5EP2A 4QHYA 2VRWA 4JZKA 3U4QA 1IXSB 4FMDF 5FPKA 4ZCIA 1ZNWA 5LDDC 2NG1A 2QP4A 1E2IA 1TQDA 4IOJA 4QM7A 4PAQA 4PTLA 1Q1ZA 2G6BA 1L7VC 1OFIA 2BMEA 4P33A 2QE7A 3TRFA 1S0UA 1S8FA 1OFHA 3JVUA 1SXJB 2WZQA 3NC0C 4LJ5A 3WBKA 5JSZB 2XXAA 1OYWA 3SFZA 3UWOA 2IYVA 1S3GA 3F0TA 5JZVA 2WJVA 1BIFA 4WXRA 1NL3A 4KITB 4NH0A 2ZJ2A 4C3ZA 1R0XA 4P4TA 721PA 5HE9A 5CM9C 1KDTA 2IL1A 3T35A 2LCFA 2HYIC 1RRFA 4DT1B 4ILEA 2H57A 1KOFA 2ZRDA 2OCYC 2GZAA 4IOKA 5FTKA 4HLDA 1IHUA 4URUR 2FU5C 1NRJB 4GT1A 1NKTA 1LTQA 3CX7A 3AF1A 4DWJA 4RKFA 1NY6A 2IHYA 1N6NA 4DCSA 1DADA 3CO5A 2ZE8A 1OHHD 2GJ9A 2JATA 2VBCA 4HAUA 1XF9A 5G53C 1AQYA 1KK3A 3LA6A 2ANCA 2KSQA 2FPMA 1II8A 4I4LA 3DKPA 2BMJA 1LY1A 3VTKA 4C0JA 3U7EB 2C04A 2J1LA 2ZR7A 3CRW1 3RDPA 1BYIA 1MR3F 2OCAA 3V9PA 3QPVA 3CR7A 1R8SA 4NYJQ 1N0UA 4EPXA 4CF7A 2IYLD 1TPZA 2W58A 3KB1A 1HV8A 2PMKA 3Q3JB 1R4AA 3MMPA 5BN5A 3T5DA 3MRSA 1Q22A 5E7IA 4CYMA 2ZI9A 2A5YB 4M1OA 4HATA 3WBJA 2QMOA 2IS2A 4JT4A 1HQYE 4G5SA 4LYAA 3U2QA 3GJ7A 1YZNA 4ASUD 2HXSA 2FSFA 1NF3A 2W6JA 2ZSDA 2J59A 2C8VA 3OFNA 3OZXA 1D9XA 3BIFA 3CPJB 1DEKA 1E1QA 3K9HA 1V43A 1F3OA 4JVLA 1ZAKA 3I73A 1JXMA 4XTCS 1KDOA 1AKEA 1CBUA 1EFCA 1Q3TA 3SR0A 2IS1A 5EE9A 4CEJB 3LX5A 1NVVR 4WA7A 1OH7A 1W48A 3W34A 4URXR 3KZ1E 1XD2B 1XMSA 2V8OA 4ZO4A 2ZAOA 4UQOA 5C4MA 3V4FA 4A82A 3TSZA 1ZNXA 5CIQA 2IT1A 3FHTA 1FNMA 4LOAA 3C7KA 1U8ZA 1CR4A 1W36C 4WW0A 3ZGXA 2OESA 2WIBA 4V0MA 3CB4A 2QU8A 1OKKA 5FPSA 2XX3A 1GG2A 1QVRA 2YYZA 3NXSA 2J45A 3CZPA 3MWYW 4DLYA 2VP2A 1ZUNB 1EESA 3C15C 3EZ7A 1R0WA 2X1VA 3BAFA 4HDCA 4Q9HA 1N6KA 5FOUA 3ICEA 2YOHA 4TQUS 3I72A 3NBZC 4OHYA 2BC9A 3B1ZA 4PZLA 4HLQB 3BFKA 2Q0HA 2FFHA 2BM1A 4LI0A 1XPUA 4UJ5A 3PCRB 1DOAA 4D6PA 1UF9A 1G64A 4NCKA 3KTAA 3Q85A 4ZCMA 3GJ3A 5E4FA 3A4NA 4RFVA 5P21A 2A5GA 3ICQB 1H8HA 3IIMA 2WJJA 3PITA 4RFSA 2VO1A 4CT5A 5K8LA 2PZGA 2W0SA 4RSGA 5JCZA 1IN4A 3OEHD 2OLJA 4C7OA 3FMPB 4PC3A 3E5HA 3W90A 1WBDA 2IS6A 4URWR 1NI3A 2D7DA 2XEXA 4KU4A 5G41A 1EFHA 4FI3C 4TWZA 5DI9A 4DDVA 4LBWA 1VG0B 2RGCA 5FR1A 3S1AA 4HAXA 3U5ZB 1HA3A 2Q3MA 3VAAA 4RKEA 3LLMA 1NN5A 1KSHA 2O8CA 5KSYA 2YOFA 2GAAA 4PQYA 4QM6A 5ELXA 3UANA 1COWA 3OF5A 4CEHA 2JCSA 4MRRA 2FEMA 2ZM5A 2WPDD 3LO5A 2CHGA 2WSMA 1BOFA 3N70A 1E94E 1UM8A 1WF3A 4P3YA 4TMWA 2OT3B 3QF7A 2JJ8A 2AK2A 2REBA 2ZUDA 1GAJA 3DZDA 1ZM4A 2ZRLA 1G8HA 1VCMA 2C9YA 2QAJA 1Z6YA 4LBZA 5FUWA 1FMJA 2ZRHA 2QQ0A 3CUEF 2WHXA 1F2TA 2G77B 2OCPA 4O0MA 3EZFA 2ZRBA 3AKEA 3GJ6A 4LHXA 4C0LA 2ZRGA 2WWIA 4II7A 3SI7A 3VX4A 3H86A 5FBQB 5JI2E 3AGQA 4FCVA 1E9EA 1IY1A 4TL9A 4X8LA 1JAHA 4M2LA 4MRPA 4NHOA 2AKYA 4QGHA 3GEEA 5EXXA 4LHYA 2UZ3A 3FDIA 4DSTA 4Q1FA 3QENA 3AVQA 5KSOA 3TR0A 2ZVPX 3PUXA 4Z1MA 2PMDA 4P4SA 4ZDJA 1U99A 5IK2D 2GETA 2G1KA 3ZQJA 2IXEA 4ZV4A 1KHTA 3EAQA 4US1R 4Q9JA 1Q57A 1XMJA 1AGRA 3BH6A 4TMZA 2ONKA 2NQ2C 2QMUA 4IXMA 2O8DA 1XJ0A 4V02A 2J0SA 4XWOA 1D2EA 4Q21A 2TMKA 1NVXQ 5BW8A 4K81B 4G5OA 5LPNA 3N2EA 1T91A 2NTYC 1RJ9B 3C4JA 4QNRA 4XVUA 5CYOA 2NO6A 2IUSA 2R6CA 4Q47A 1W1WA 1ZYUA 3M1IA 3PR1A 1SVKA 3Q7PA 3VR3A 3ZYCA 2VA8A 3Q7QA 4JMPA 1M7GA 1RFLA 2WJIA 4XH9B 3U61B 5HTKA 4B43A 3LXXA 1TF2A 2FNAA 5TMPA 4Z51A 1G3RA 3DHWC 5AJXA 4QBIA 2OFWA 1U0HC 1W44A 3M4YA 3UXMA 3VR6A 6Q21A 1TEXA 3FKSA 4D4MA 2JA1A 2F9MA 1W36B 4B3FX 1E9CA 2AD5A 3FKQA 1GVNB 2DHRA 3A4LA 3CWQA 1OXSC 4LX0A 5J4KA 2IS4A 3FFAA 5JWOA 1YR7A 2O8BA 1GM5A 2QRNA 3MWLA 1N5JA 3QXHA 3ZS8A 3PEUA 3WMFA 3W9YA 2P6UA 1I4TD 3TLXA 2BBSA 2F43A 3JVVA 5EP4A 5JHGB 2QENA 2P6NA 3OAAA 2UZIR 3SJBA 2QT0A 1GL9B 1AZTA 1KY2A 5H68A 5HR5A 4C30A 5BYKA 2ODBA 1U0LA 2DFNA 4HAWA 4PQRA 3U3OA 5L3RA 1CJKC 3LWNA 4MRNA 4IDOA 4KHZA 1Q0UA 1HUQA 1KI3A 3KXIA 4LV6A 4JLDA 4P4UA 4C0BA 4EFMA 3AF4A 2PH1A 4YXWA 3DL0A 4KFSA 2DPXA 4MGIR 1U2RA 2BCGY 3NHAA 1QRAA 1G21E 1CULC 1KNXA 3MG9A 3BK7A 4Q03A 2JLQA 1EXMA 2V1XA 2QAGA 3CM0A 1GZSA 3KQHA 2QZ4A 2EFEB 1Z0KA 5TARA 2CL7X 3FGNA 1MO4A 1L2TA 2BCJQ 4NYIR 2FX3A 3WMEA 4F93B 2ATXA 1S96A 3CH4B 1IN8A 1QHHB 3IQWA 4JLKA 1I2MA 3AVOA 5C4GB 1WB9A 3QPUA 3QPWA 2JJ2D 4MYUA 3K9LA 2GWHA 4HUQB 4NCHA 2IYWA 1XTQA 3TIFA 1YQTA 3MJRA 4X8HA 3K0AB 4XD7A 3IKJA 5FL3A 1OSNA 1OH8A 4AKIA 1T0HB 1ZBDA 1P6XA 3U7HB 1K6MA 2QEQA 1FQJA 3IBGA 1XX6A 3ADKA 3EZ6A 5KOYA 2RAPA 4CEIB 2ZYVX 1E0SA 1C1YA 4NCNA 1YR6A 3W3ZB 1ZW6A 4PSAA 4KYIB 3A6PC 3WNBA 1XZQA 4RCYA 3WP0A 3EPJA 2J7PD 3DEFA 1IN5A 3UK6A 2CMKA 2FE4A 1VHTA 3SJCA 3P1JA 5FUYA 3SS8A 1U90A 2GXUA 3U6BA 4UKDA 4F38A 3PG5A 4QBHA 3K0FB 1W47A 1WBBA 3NDPA 1CP2A 5JMTA 2ZRNA 4XVQA 2JAQA 4F91B 4C2UA 2ZEJA 2NZJA 1KSJA 4Q01A 4DC9A 1ZVQA 2WKPA 3LBHA 4D80A 4NMMA 1T4GA 1VMAA 2RGXA 2ZAMA 3BB1A 1MABB 4H1VA 5E3HA 5K8TA 4B33A 2ASEA 2BBTA 1XNJA 3HDTA 4CDGA 4GL2A 4HAZA 1GIAA 3L43A 1NP6A 2UKDA 2P3SA 1XTJA 4JYCA 1JBKA 1XPOA 3N2IA 4YMWA 1DAIA 2PT5A 5GVSA 2QUZA 4L9WA 4Q1BA 1HE1C 1SVIA 2ONJA 3MGCA 4HUTA 821PA 2EFGA 5JS7A 5KNDA 4ZIRB 4IHQA 1WDTA 5C1BA 2YWEA 1E1RA 4R2IA 3R7WA 2V6IA 1YJ5A 5TXGA 1CJTC 1G8YA 5DH9A 4Y0VA 5KUTA 2OBNA 4JIMA 2B92A 2VP9A 3FOZA 1BS1A 2R8RA 3B1YA 1US8B 1UKVY 4JLVA 4B47A 2D4HA 1S1MA 1E2PA 1Z06A 3IHLA 2GVZC 3PJRA 5EUQB 4NCJA 2Q3FA 4D4LA 2WJGA 1FX0A 2IEZA 1TUEA 4TYNA 2PLRA 4JLNA 3KKQA 1G8FA 2ZIAA 3DM5A 1P62B 3F5FA 1DAFA 3GMTA 5F9HA 1OHHA 3CRVA 3SU8A 1PVOA 1XCMA 2V9PA 5BYJA 1EFRD 4GSYA 1SXJE 4WVFA 1HT1E 1KI7A 2AL7A 3CF6R 3KKOA 4DLSA 2V54A 3EPLA 2CE2X 4NYMQ 2CVFA 3MJHA 3ZVNA 1RJ9A 1KKMA 1KI2A 2QBYA 3GJ4A 221PA 4NTZA 1G4AE 2KB0A 5BN4A 3D3QA 2GJAA 1QBKC 4LJ7A 2AFHE 1Z47A 3ZZUA 2HT1A 2EFCB 1NVVQ 1G4UR 2BKEA 4TLBA 1SKYE 4YMSA 3SQWA 4AURA 4AIIA 2H1LA 3NVAA 1JQLB 1WQ1R 3O8BA 3TAHA 2A5FA 4A92A 2Z6VA 4A6PA 4TMXA 1U9IA 2GZDA 2YC4C 3BFVA 2ZS8A 2F3RA 4Q5IA 5DHFA 1BMFD 3IILA 2BDTA 2BMDA 4KV9A 4MKFA 3KKMA 4OBEA 4MUBA 1IN6A 3PUZA 2N46A 3PUWA 1XTIA 2JLVA 2CK3D 4F4IA 4NDZA 3EIEA 1X3SA 1W5SA 2QNRA 2NO0A 3B1XA 2VP6A 4PHTA 3HR8A 1LF5A 1G3MA 3I1FA 4PAOA 2EFHB 2WWXA 2O8EB 2AXNA 3SJAA 4LJ6A 1ZU4A 4LGMA 4NONA 3N5CA 3NTUA 2ZJBA 3SDZA 2DFLA 3QBTA 4ZDIA 1E2GA 1CTQA 4YLGA 1DAHA 1HYQA 3U3JA 3U7GA 4GMDA 3B9QA 4V0KA 1OXTA 4OHXA 1F48A 4N0DA 1II8B 2W00A 1PLKA 4PHHA 4MYHA 1J8MF 3D6TB 3CRMA 5L3SA 4Q9LA 1DTSA 3OIYA 1NVWQ 4RCZA 2JJ1D 3C8UA 1M7BA 2W0MA 5K8UA 3VR1A 5CLLA 2C2HA 1VCIA 3LDAA 3C5HA 3QKRA 3PUYA 3SBEA 2YVUA 2AX4A 4Q7MB 4IDPA 3KQNA 2VTKA 4C2TA 2XB2A 4HB3A 5SZKB 2OHFA 1RRCA 1T8UA 2CL6X 3GP8A 5TV2A 1X8KA 1ZIPA 3WNDA 2GEDA 2JDIA 4DDWA 3ZH9B 3OEHA 1ZNYA 1Z22A 2GNOA 2WJYA 2ZI3A 2J5XA 4NZYA 2R65A 4TZ0A 1A4RA 1XD8A 1QHGA 3U7FB 2KBEA 1KI4A 2HLDD 1T9HA 3PFIA 4MH0R 3TE6A 2NIPA 4BFSA 3A36A 4PQFA 4OJKA 3QXXA 3BH7A 5J4LA 1XPRA 1XB2A 5EE5B 2DWPA 4ZDKA 2E1RA 4A0GA 5BN3A 1T5IA 2ZRJA 2IHBA 3O47A 5FBRB 1TTTA 1IAQA 2WPDA 2IX3A 2WMNB 1NLFA 2ZXUA 4ARZA 2YWGA 1RPZA 2QG6A 2QTFA 2B21A 4QBFA 2QTVB 5D3MA 1LF0A 1PJRA 1Z2AA 4YMTA 4DLTA 4FD2A 5KSZA 4PFSA 4MRSA 4DRZA 1D2MA 1EG7A 2FEOA 3O8RA 2EVWX 1OPXA 2C98A 4AG5A 5A0FA 2VPPA 4EJSA 5EE3A 1DAKA 3KFVA 4MGKR 4OK3A 2XTMA 4TLEA 4DIDA 3E70C 4D0NA 3I62A 5TB5A 2G3YA 2EU8A 3KTAB 3C16C 2GDJA 3RHFA 4DLWA 4M53A 1KNQA 4N1AA 4QHSA 5CK4A 4CIDA 3NDBB 4PX9A 4RFSB 2YC2C 1OE0A 3QNUA 4E22A 1FOEB 2OXCA 4ZIRA 1G6OA 3QVUA 4EPRA 3FVQA 4P32A 4C7OB 2C5LA 4FXPA 5IK2A 2DY1A 5FTNA 2LKCA 3AVTA 2ZSEA 2EFDB 1OV4A 3FHCB 1DS6A 1ZJ6A 2QAGC 3L0SA 3IUYA 2OILA 2F6RA 1SVSA 5LBIA 3NG1A 3FTQA 3P26A 4AKHA 1J8YF 2ZRPA 2ZSBA 2GXSA 2PL3A 4BZXA 1ZU5A 3S1AB 2V55B 1S2MA 4IDQA 2ORVA 3W3AA 4NL4H 1W4AA 1DG1G 2C9CA 1KIMA 1KO1A 4FMDB 4M9SA 2O8CB 4DSOA 4PR0A 4TYQA 1R0YA 3EIQA 2FZ4A 2WWWA 4DIEA 3LH5A 3AB3A 4PSVA 4CEHB 2GVDC 1OXUA 3EZ9A 4LHWA 1R2QA 3M0EA 4EQ6A 5AUQA 1KO7A 3B82A 3KQUA 2BVNA 1GWNA 1VYVA 1AGPA 1H65A 4D4JA 1Z0JA 4OI4A 3K70C 3QSYA 1DPFA 3UMSA 4M1TA 3O8CA 1J70A 1N5KA 1YVDA 1JPNA 5FOSA 2HJGA 3KFXA 2WKRA 3BD9A 2FN4A 4NBSA 4HYYA 3TJZA 4BFZA 1F2TB 3CPEA 3QG5A 4FMCB 3QXCA 3LQQA 3EA0A 5TVKA 1U0JA 4PXAA 1L4UA 3VR5A 4EPYA 2GJ8A 2XITA 4GMXA 5CIWA 1IQPA 5FBLB 3VR2A 4FW9A 4I1VA 2PX3A 5J4HA 1E96A 1NG1A 3DVLA 4JLJA 2D3WA 3KQKA 2GCOA 4JT2A 1ODFA 3E1SA 3RLFA 4F7WA 5KPDA 4NCIA 1KMQA 1MOZA 3DZ8A 2HJVA 1JR3D 4KLZA 3TQFA 4B3CA 3ETLA 3BXZA 4BUJA 4DUGD 3T34A 2G83A 1Z6GA 4P4SB 4C9BA 4FMCF 5FOXA 1J2JA 1N3BA 3W6OA 4NYIQ 5H8WA 2DWOA 1SKYB 2AR7A 1GILA 2O0KA 5JRZA 1CEEA 2W6IA 2EWWA 4R98A 4Q1DA 1AQUA 2O8DB 2O0JA 2WTUA 1TQ4A 2O8EA 3I8XA 3LFUA 4O25A 4M1SA 4A0RA 1FW6A 1B23P 2R6AA 4A4DA 3CWZA 4Q00A 2PJRA 3Q5DA 5EP3A 2CHQA 3AP3A 5KYKA 1PV4A 2P65A 3WMGA 1AK2A 2WWHA 2OG2A 4KVAA 1W4BA 1XMVA 2OCBA 4LYFA 4MKHA 4GZMA 5IHPA 4TQAA 2IUUA 3ZZTA 4BFTA 1T3HA 3BGWA 2OEPA 3CX6A 1KY3A 2XB4A 4BRUA 1C4OA 2JJ2A 1JI0A 3GLHA 1VDZA 1E0AA 2ZANA 5EJEA 1BKDR 1KZGB 3VKGA 4HI0E 4GRAA 2IA5A 2PX0A 2WV9A 4HAVA 5FL7A 3GLFA 1UBFA 2O8BB 1XTKA 1KZ7B 5FUVA 3THYA 2A78A 4Q4LA 1Z6TA 2REXB 4D25A 3D31A 1P9RA 1FMLA 3IO5A 3QIAA 4GOKA 2ORIA 3QKSA 4XIGS 1Q21A 1VCOA 3G82C 2I3BA 2F43B 2RGEA 4NYMR 1UPTA 1N6IA 3MCAA 3T5GA 3OIVA 1LS1A 3NBXX 3ZVLA 2FPLA 1JQJC 2FZLA 3FFBA 5DN6D 1HE8B 1E9DA 2XSZD 4B75A 2JLUA 5SZJA 1E9RA 1X6VA 1P3JA 4JVSB 1UBEA 4LWZA 4RD6A 1T8TA 5BWMA 3X1WA 4EKDA 2CL0X 3ZD6A 1U9IC 4LYHA 1TF5A 3NBYC 3IO3A 2OAQ1 2QAGB 1YZUA 2MSCB 3RABA 5FBVB 5HCIA 2DYKA 2JLRA 1KI6A 4WZBE 1XZPA 1KAOA 1XEXA 1P2VA 1T5LA 2D62A 1WE2A 1N0WA 3DOFA 2VLIA 3U3RA 4UXHA 2PEZA 2XZOA 3CIOA 4IOMA 2FSIA 4RY2A 3ND9A 3FMOB 2ZTSA 1EWQA 3WHLA 2Y8EA 3WHKA 4JL6A 1YZQA 2OFOA 2OV2A 2QA5A 1VG9B 5HZHA 3TUZC 3T15A 3B9PA 3C14C 1FUKA 4LC1A 4URZR 4C0HA 3T61A 2ATVA 4Q7KA 1KSFX 2CCGA 2ECKA 2ORWA 3C41J 1ZCAA 4QNMA 3NKVA 3T1TA 1IXRC 1Z29A 1G41A 121PA 3A58B 3BFXA 1X8JA 1FL9A 2F3TA 2JLZA 2QI9C 3QG1A 3IHWA 2C77A 2R44A 1EFRA 4QGGA 2GEVA 1K5DA 1OFTA 1XEFA 2A3RA 2CCKA 4JSYA 1ETUA 1Z0IA 4KSCA 1E32A 3BRWD 1EFTA 521PA 1I4LD 2QTHA 4A8JA 3AKYA 4LY6A 3ZQ6A 2JLXA 3QXSA 3AVXA 5AJWA 4ESVA 1YZKA 2D2FA 3NWJA 4TSFD 5AWFC 3VHLB 2OSBA 2QORA 4E5UA 4BFXA 4GFDA 4KFRA 1KO5A 3LW8A 3ZVMA 3QJYA 3RC8A 1QVAA 2GESA 2DCUA 3CBQA 2BWJA 3IBYA 1W0JD 1XU4A 1UEIA 1YRAA 2H5EA 3PUVA 3QBVA 4DVGA 5EXPA 2IW3A 5FR2A 3OE7D 2ZR9A 3F8TA 5HPYB 3GFPA 4W9MC 4QGAA 1W0KD 4BASA 3RRMA 3R7WB 4ZKDA 1BMFA 1FTSA 3QOFA 4Q02A 5FBWB 2J9RA 4JJZA 4QG7A 2WOOA 4G5RA 3RSLA 3GJ8A 2OAP1 2WAXA 4L5BA 2B7BA 2QROA 2CK3A 2H8KA 3A8TA 4OQNA 5E7MA 4ZDWA 2C95A 1GDDA 2AHOA 4G0NA 3TMKA 3GFOA 5DYIA 1G19A 2FSHA 1QG2A 3LLUA 2YWHA 1FX0B 2WAYA 2ZJOA 4LJYA 4A0HA 3I32A 4M4SA 1E4VA 3I3SR 4IDNA 1GUAA 1P72A 4OK5A 1G8GA 4LPSA 2C03A 4EJSC 4AI6A 5FPHA 1HEIA 1P2UA 2AK3A 3BJIC 2HDNB 2ZE7A 3A1VA 1ZINA 3ND8A 1OXVA 1P60A 2H92A 1JALA 1Z28A 2GILA 1S9DA 1P9NA 4LBVA 2XJ9A 2QBYB 3O8DA 2JJ1A 3L8YA 5EE1A 1II0A 4WZAE 1IXZA 5FH9A 3FYHA 4DEYA 4YC7A 4AC9A 5KNCA 1MO6A 4EAQA 3AVUA 2ODEA 4U5XA 2QPOA 4JJKA 2A9KA 3JZMA 1A5TA 2JLSA 5EE0A 4Q19A 2H17A 2IEYA 2OFXA 5AJYA 1G7RA 1GITA 2E9SA 5GJCA 2C9OA 2WSSD 1R6BX 1TU4A 4LCBA 1QDEA 2LWIA 1PZNA 2HLDA 4XTRA 4B2PA 2NMVA 1E9BA 4TL8A 1XCGB 2PBRA 3EXAA 2R62A 5DSZA 5FOWA 4GP6A 4BZQA 2J87A 1ZP6A 1SVWA 3BERA 4JLOA 3LVRE 4DLVA 4B74A 1R7RA 2FJUA 3UMFA 1XDBA 4B3GA 2IYTA 1EX7A 2IBMA 2OO7A 2ZRMA 2IYYA 3NBFA 1F2UA 4HZUA 4X8OA 1HURA 3X1XA 4CW7A 3GJ5A 3SZRA 1KYIA 2RB4A 3GPLA 3AV0B 2WJHA 5JLJA 1W2GA 1A2KC 2KWIA 4LDJA 3KJGA 2W2VA 5F9FA 1ZC4A 5AUOB 2R6FA 3TR5A 4PO1A 5F3WB 1NLYA 2ZJ8A 1XTSA 3QKUA 2GKSA 2MSDB 4BLRA 1YZGA 5TY0A 4CZ2A 2ZS9A 4YMUA 4XWKA 1G5RA 3RC3A 1GNQA 3CH5A 3K09A 4S2EA 5L3SB 1ELOA 5FFMA 1OLOA 4KFTA 2FGJA 3DMNA 1G7CA 2BIFA 4ABYA 2ZRIA 3QKRB 1MO5A 1YE8A 3AF2A 4P0TA 5B30A 4OQLA 4TYYA 1CRQA 1QG4A 4B2LA 4XWAA 2ZI5A 5JEEA 1M74A 3SYLA 2OLKA 2FOLA 4D0LB 4G5GA 1U94A 2L0XA 3AF3A 4K46A 2V3CC 1T3SA 2RH5A 4GI7A 1R5NA 4C0SA 2RMKA 3EA5A 1NLZA 4V0ME 2ODNA 5C2JB 3B1VA 1XMIA 2Q3HA 4W5HA 2QRZA 3U3KA 5JJIA 1CXZA 3VU9A 5SZIA 2QPAA 4XVRA 1Z2CA 3PXGA 5JRJA 2XOKD 1LW7A 1U81A 3QQ5A 1ZCBA 3UIEA 2MMCA 1YRBA 5JHHB 4MDEA 5H70A 4BLSA 2B7CA 1PUJA 1Q44A 8OHMA 1YR8A 4Q48A 3T1QA 4ARZB 4BFWA 4TMKA 4Z54A 1DAEA 5DO9A 2NOAA 2OE2A 1XXHA 5EZ5A 5D3MB 4Q7JB 1D5CA 2ZU6A 1T6NA 4RZ3A 4JYBA 3EC2A 1UKEA 1FUUA 1MO3A 4US2R 3UKDA 3OFND 1QHSA 2GEUA 1NSTA 1L8QA 2XNSA 5EQTA 1VKJA 4I1UA 1N6LA 2X77A 4EJSB 1E2MA 1E2HA 3Q72A 3AUXA 5UKDA 3B2EA 4PO8A 5FI1B 3J81k 4HDQB 5DI3A 3PV0A 1Y3AA 2PT7A 4HLCA 4BQSA 4LC0A 2G9NA 2D7CA 2IUTA 1XTRA 2P5TB 1X8LA 2HUPA 3LX8A 1DE0A 4GZLA 1HQCA 1G3UA 1CRPA 3IDQA 1JR3A 1ONBA 4RD2A 3ZS9A 1SKQA 1VPLA 1D9ZA 4RJLA 4DUGA 3EG5A 2HV8A 3B5JA 4JKIA 1LV7A 2AWOA 2AN9A 2OBLA 4FMBB 2XTZA 2Z43A 1E2KA 5EP1A 2VHUA 4BLPA 5LD2C 1CF4A 4PC7A 2FDCA 4EFNA 1GRNA 4AG6A 2WMOB 3GEIA 4HSEA 1Z83A 1IONA 3CLVA 2DFTA 4LK2A 1IJFA 1T0JB 1TQ6A 1MRSA 2QM8A 2GXAA 2QT1A 3GLGA 2GAOA 3TW8B 5DGXA 2BV3A 2BJWA 3W5IA 1K5GA 2B8WA 2HCJB 3CX8A 3M6AA 3MAAC 1G7SA 4EQ6B 2A30A 4JKYA 2G0TA 1Q1QA 3L2OB 1AS3A 1I2DA 3E2IA 4JLMA 1P75A 1MV5A 3KL4A 1A2BA 4JLAA 1KK0A 2Z4SA 4PO9A 1U8YA 2ZPTX 1GNPA 1VG1A 2JLYA 2YZ2A 2XNDD 2VL7A 2QSZA 2IYSA 1KKLA 3I8SA 1ZM3A 1R0ZA 2ZI4A 4IJMA 1WA5A 1KI9A 5KO2A 1G17A 1TF7A 2BJVA 4OI1A 5E7JA 1Z07A 4B71A 3REFA 4A2PA 1E2NA 3LBNA 4TLDA 3SN6A 4GOJA 3OEED 3FMFA 5J47A 3KQLA 1ESNA 1KMHA 1OIXA 4HDOB 2AFIE 3FMIA 4QKQA 1UAAA 1G16A 2GCOB 2JASA 1AIPA 2QP3A 3WXMA 5KSPA 3D7MA 2HYDA 4ASUA 4DCTA 2QMHA 1TMKA 3KDSE 3IEUA 4BRWA 2WBLC 1QF9A 2OM2A 3RWOA 4TTRA 2P67A 3L8ZA 3RWMB 4A8JC 1NBMD 4B35A 1CJVC 3BH0A 4D0GA 2P2LA 2ERXA 4YONB 3RANA 5DN6A 3HU3A 2IWHA 3TK1A 1LB1B 4A2QA 1ANKA 4JBXA 3RS3A 4Q4JA 3GD7A 1TQ2A 1G291 3D8BA 3GJ0A 4IVRA 3R8FA 3R8CA 1QHNA 2ZI6A 1N6RA 4DB2A 1YR9A 3V00A 4BFYA 5HKKD 1Q1BA 2FFQA 2J41A 1OH6A 4K8OA 5FTLA 2XGJA 1IY2A 3EASA 3GLIB 3R9WA 1NJGA 1P5ZB 4PPNA 4BLOA 4BE7B 4R71A 2J0VA 3SE0A 2F9LA 2EQBA 2JIZD 1WCV1 3DMDA 3RS4A 1KI1A 2YKGA 3RVBA 1MKYA 1SXJD 4HEJA 3DKVA 3ZDQA 4DSNA 3GCGA 1BH2A 1XD9A 3I5XA 4GP7A 4Q4HA 1GKIA 4KO8A 1OF1A 2GCNA 1GL6A 2GHIA 1F6BA 4KI0A 2IXFA 1ZUIA 2DR3A 4KCGA 3TVDA 1EX6A 3KJIA 4KJZA 4XJXA 4D4KA 2J0QA 3GLHB 4OI2A 2CCJA 1N6PA 4B34A 3SEAA 5J4YA 2J0UA 1M8PA 4LPKA 1J99A 5AJVB 3GLFB 2GK7A 2H18A 3AH8A 1HH4A 4FINA 4M9XA 3WRXC 3THYB 4L9SA 4RZ2A 4WOPA 4LJ4A 4D82A 4Z8XA 4TMTA 2EYQA 1E2DA 1T3LA 1KJZA 3QKSB 2GJKA 4LUCA 4BGDA 1E98A 3H2YA 3AKCA 1DAGA 3FE2A 4ESHA 3K0CA 3LRPA 5AJZA 4MGYR 3QUSA 1P61B 4N0EA 3RSOA 4ERNA 2F7SA 3B13B 3RNLA 4A36A 3HP1A 3EWSA 4URYR 4IEIA 2XZLA 3THXA 3CNOA 3AKDA 1J90A 3CPHA 1G5PA 2CEAA 3B1WA 4CT4B 1IM2A 4M8NE 2VP4A 4RVCA 4TSFA 1VYUA 2G88A 2GZHA 3B85A 4PPGA 4IVQA 5LD2B 2KE5A 1II9A 1N0VC 3K0EA 3ZVRA 3VKHA 3ONWA 1KI6B 5FTJA 2ZE5A 1AA9A 2MMGA 4IW3B 1W0JA 1XEXB 4TL6A 2F55A 2Z4RA 1NJFA 5JI3E 1GFIA 3OE7A 2AD1A 3IIJA 3DDCA 1ESMA 3QVVA 5J40A 5JBQA 2P0EA 5FTMA 1ZUHA 2WVJA 2X2FA 4BWYA 1O87A 4LHVA 3PEYA 3AUYA 3NIBA 4KLNA 5TDHA 2PEYA 2GBLC 4LJ9A 1RVDA 4XSGA 4FN5A 1JNYA 4KBGA 1P2TA 2YHSA 5A5GA 1TNDA 1NKSA 4I1OA 1HT2E 4IDHA 1Z6AA 3P4YA 4KAXA 1VCNA 4A1FA 5FOTA 1Z6XA 3K09C 3Q8XB 2ZRFA 3A1WA 3AP1A 3K53A 1D8TA 3AEZA 1XJQA 1E79D 2ZRCA 4JLPA 2ZJYA 1WP9A 1QZXA 3JZAA 1E3MA 1NN0A 4EPTA 1D2NA 2VHJA 3DM9B 2PZEA 4CRWB 4A8JB 1FP7A 4DEXA 4AYXA 1KJYA 2ODWA 4LYJA 4NU0A 1N6OA 2HEIA 3KJEA 1IN7A 1G3IA 2QN6A 3TKLA 3K0SA 2CDNA 4Z8YA 5JECA 4B3XA 3X2SA 1R5OA 4R2HA 3TBKA 4B76A 3WYAA 4LZZA 5JWRA 4AWXA 5CK5A 2VSOA 1FQKA 1DVRA 3FWYA 3TUIC 4EDHA 2RGBA 1AKYA 4G5QA 3BWDD 1P7CA 4LJ8A 1Y63A 5AUNB 3NH9A 4LV8B 1RKBA 2W83A 4DDUA 3CNLA 1W46A 1NMZA 3GLGE 4G3XA 2WSSA 2EYUA 5HE8A 2AXPA 2RGNA 2ZQ5A 4PZYA 4DLRA 3SQXA 1VTKA 1YZLA 3K8YA 4Q18A 1Z63A 2F1IA 2P5SA 2N1BA 4RD0A 1E2LA 3QXJA 2IWRA 5CJ2A 1LNZA 2VP0A 4QC2A 1GRRA 4KODA 1OH5A 1SHKA 4GOXA 2UVQA 1FNNA 3SYNA 4Q1EA 1NN3A 4DXAA 1H8ED 4KBFA 5C46F 1G20E 4FIDA 3CONA 4Q4AA 1VYTA 2GTPA 4G1UC 2ZYTX 4WZ6A 1E0JA 3TW4A 1S9HA 1ZMXA 3X1YA 3OHMA 3HR7A 5GJBA 4TT3D
chains in the Genus database with same CATH superfamily
3NORA 3OLQA 1OPRA 1A27A 3QEOA 5DCLA 4B3MB 3GLIA 1KC3A 2H2GA 2VQSA 3SC3A 4BX3A 5LA6F 4JNKA 3URKA 2A0WA 1E1RD 1FUYB 1CRWG 1PFGA 2GLTA 4N8EA 4XYMA 3VSBA 2GN9A 3K9BA 2NGRA 4IXTA 1CZRA 3PXDA 1AKMA 1D1TA 1Q92A 2JIPA 5D5PA 4BO0A 1XK7A 3DFUA 4FZJA 4C5BA 5EHZA 1KA9H 5BURA 2EJBA 4JHLA 1LI5A 5D84A 1H5UA 2DH5A 2ZYUX 3TSOA 3ONDA 3LG2A 1P8JA 2G1AA 4LF4B 3I09A 2QRUA 2BFOA 4WK4B 3QF4B 4ZU3A 4F3RA 1YRHA 3UPDA 4NPHA 5FI5A 3CH7A 5LP1A 3AL2A 3F3SA 3I0ZA 1F2VA 4B48A 3H5WA 2BEVA 3A9CA 3KQVA 3QUBA 2HJSA 3R3WA 1EWYA 2HJWA 3KEQA 4KQXA 4OHKA 4UMVA 5IAOA 2WYVA 4OU5A 4MI6A 3U3MA 4CGZA 1K8RA 3CJTA 5E0KB 3R9XA 3ZJYA 4BWGA 1ZN2A 3MQ4A 4ZPJA 4HGPA 3AB7A 2NX2A 1YJAA 4CNQA 4D0RA 1KERA 1FMTA 1K6JA 3RRNA 1KAMA 1GSAA 4CL8A 4ZZ0A 3AEUB 1PJ2A 1G5IA 2OCLA 4CI9A 4ESEA 2ZRAA 1LH0A 3OE1A 1H3FA 2REQB 1FLDA 4RO0A 4QLBA 4JL5A 4L8WB 4BJHB 4DCNA 2QJOA 2QMYA 3TSAA 3WQHA 1R6UA 1J9GA 3EQ8A 1AHPA 3SIPA 4DV6B 5C5CA 4A15A 2HSEA 1R8QA 2E37A 3ILHA 4IRMA 4YQEA 2RHBA 1TKBA 2G8NA 1PT9A 3PZRA 3WA7A 4RD1A 1VZ2A 1EP2B 3PNMA 1RRGA 2X7JA 1CR0A 3W6NA 2FSGA 1CR1A 4OHWA 4BY9E 4PAGA 4UNQA 4YH1A 2E18A 4ZODA 2WIAA 2LPMA 4TL7A 3ENVA 4DARA 4B8YA 5GJVC 5JAIA 3GHHA 1GL7A 3VHRA 4ZI2A 4Q82A 3T7EA 1UMDB 2HPAA 4AUMA 3OCJA 5HM8A 5JQGB 2R1ZA 2F67A 2BBOA 5KTRA 5JTTA 2JS7A 1RS0A 2IYFA 1G7TA 1P4SA 2C7VA 2G9ZA 4C03A 1X9GA 2ZE6A 1ID8A 2VJMA 3AVPA 4FK8A 3DOJA 4RKRA 1R6TA 5DP2A 1NMYA 3T4UA 1TCUA 4RIFA 1KYQA 3DLTA 2NO9A 2Q50A 1O7JA 3GAZA 4OJYA 1EFKA 4C01A 3AEYA 4PTYA 3TD2A 4UPEA 3UK7A 2UUPA 4BLQA 3U1VA 3N0TA 4GI3A 1EUCA 4WCFC 1QC5A 4C4XA 5IF9A 2ZYSA 4YEDA 4ZT7A 1CZUA 3NLLA 4L4ZA 5F7XA 4QU9A 3I2KA 3OZTA 1Z13A 1YOBA 2BGJA 4M86A 1J1ZA 3PYXA 1A8SA 1JQAA 1YRQA 2HWYA 3IVAA 3VU9B 1YS9A 3JD3A 5KX5A 2YINC 3CNHA 3GGPA 3A4MA 2EX1A 1XGKA 4YJKA 3REQB 4LBYA 4RY8A 3HKBB 3LHKA 3JQFC 1VJDA 2YR0A 1B0UA 4YAEA 3RFUA 5F9MA 1FJXA 3UHOA 1EHIA 3IOMA 4BN5A 4I9FA 2DHQA 4ISCA 4DNPA 1DCTA 1JHPA 4A73A 3PNYA 4PE5B 1IEXA 4UD6A 3OE4A 3H87A 5E3JA 1AHIA 1C7RA 4PLZA 3TOXA 1NF9A 3WLJA 3R7SA 2ACEA 1GP2A 4PLWA 3F7NA 4S35A 2CVPA 5KC8A 1F9AA 1NC1A 2ZSFA 2Q9AA 1FP1D 4J0JA 3REGA 3TGWA 3WGIA 4D8UA 3INYA 4FIZA 4H7KA 2CF6A 1VRWA 5TX7A 5KYXB 3AILA 4MJLA 3IKVA 3RIMA 2GF9A 1J6UA 1FNDA 2NXNA 5CDSA 3AY0A 3T7IA 1I9CA 5LB2A 4FZ5A 4AMVA 1GY8A 2JBWA 2Q1TA 5B64A 1H0SA 4N18A 4R41A 1B6TA 4GP9A 1KTVA 1P1BA 2HR1A 1SCNE 1DIHA 1PE0A 4BTLA 1HZJA 4M1MA 2CEKA 2P40A 3GJXC 2Q7XA 4HXGA 4OB6A 1DIOB 1KK1A 3E2PA 1L7NA 2OOSA 2W4QA 3N6VA 1JJ7A 3HU1A 5H81A 1QYVA 1NBMA 2VSFA 4E09A 1DRJA 4QL3A 4FDLA 3U5TA 4G36A 4NBKA 3I4LA 5IZCC 1MNQA 4UREA 3UW1A 1DX9A 3W9BA 5JY1A 1USIA 1CIPA 3PEVA 4II3A 4YRKA 5JD4A 5EMHA 2FYTA 1D2AA 4MR7B 2AMYA 4K9NA 1MC4A 4CFYA 4OI0A 4PPFA 2K6GA 2X41A 4HGYA 3E23A 4TMVA 5BYBA 5HK9A 4L4RA 5EIWA 2VJCA 3ZV6A 5LA6A 3E7DA 3NBMA 4PSDA 4GX5A 4HADA 1CJMA 4IICA 5KS2A 3AXSA 4K9RA 4F6RA 1I4EB 1DXHA 4J0QA 2GCEA 5DW3A 2WYWA 2JAXA 3OY2A 4PHFA 4B3RB 1MNAA 3W78A 1R10A 1PLJA 3P9SA 4G23A 5CB8A 4MX8A 1TAGA 4KQIA 1GV0A 2D54A 1UQTA 2F1RA 4RZXA 2AI3A 2O0MA 2F59A 4UHKA 1L5LA 5DISB 4ZEOA 1NIPA 3B2QA 1P1FA 3JATB 4JC5A 5I9MA 4GECA 3C45A 4PPQA 3TZHA 1Z7WA 5IKMA 4DBLC 3PVSA 1Z36A 5LC1A 1AQJA 2C9BA 2YVKA 1YKFA 2PDAA 2OHJA 5KU1A 2P2NA 1H1TA 1N2GA 3O7MA 1DEOA 2LIPA 2XWBF 2GBFA 2JAHA 4PQGA 1W2HA 1RI3A 2HCRA 5LQCA 3OX1A 1NY5A 2BFCB 5HUHA 1R6AA 5DHTA 4ONEA 2FHSA 4ZAVA 4YI5A 3RT9A 4CU2A 1E69A 2AEEA 4CLRA 3O2QB 4ZGBA 3GCDA 1SQGA 3NDJA 4U2CA 4ZTZB 2H11A 3E9DA 4YDQA 3HCOA 5EIOA 3WK4A 1E99A 1K4MA 5AK5A 2QM7A 3WBBA 1Y6GA 3FNFA 2OSVA 4UE2A 1DBSA 1JQ3A 1FPQA 2QHXA 3O92A 4D02A 1YB6A 3HCBA 3KAKA 2EG9A 5J5VA 2QTTA 1G3QA 2I7DA 2J9GA 3O8LA 3PPVA 4BEBA 4IDDA 3RVNA 1FRFS 4LIPD 3T1VA 4L16A 3BS4A 5CA0A 1XZAA 5KREA 2UU9B 4X92A 2OYRA 1N33B 4EPWA 1RC8A 4WAUA 3FDXA 2WMDA 3KNZA 3OURA 1QOPB 2B2CA 2Q9BA 3PTZA 5IPFA 4YRCA 1J20A 3NMUF 1LPMA 1C14A 2PK3A 3VTZA 4WCFB 4BATA 4M0LA 4URFA 1EPUA 1NR5A 3GQBA 5DXFA 3GLHE 4HN2A 9MHTA 2YMMA 4X1KA 4BNFA 1JZSA 1B8NA 4G1CA 1DBVO 3VR5D 4FFPA 1L7DA 5K51A 2QNIA 3V7WA 3BIWA 1BD3A 1QIHA 3LBYA 5BVGB 2GCPA 3VNVA 2RGNC 3AERB 2EGHA 3B2NA 4OSPA 2WOJA 5DBFA 2W2OA 1DC7A 2BE7A 4LVUA 2ZROA 4XJVA 3RAPR 4KXUA 4ZEXA 4A10A 5CLIA 1DX4A 2QVXX 4Q4HB 2X0KA 4R7TA 5CA1B 4QEDA 2JAUA 2ZCVA 4RELA 4JBIA 1U4NA 4UU0A 4M37A 3VQTA 4XX0B 1U2PA 1JECA 4ZAGA 5TQVA 3RTGA 1ODSA 1T6XA 1Y9DA 5CDFA 2ZCJA 2NO7A 4FEYA 3G6WA 3D0OA 1LZKA 3WHIA 4A03A 3RCBA 4U5QA 1XPJA 2DE0X 2ZS7A 3LX4A 3KX2A 2NADA 2EEZA 4PYIA 3N2LA 2C92A 4DC1A 3EIHA 1IXYA 5FWYA 1LUAA 1A82A 1R18A 4P08A 1U0GA 4KFUA 4MIEA 3F8SA 2IQ5A 5JXGA 1TW3A 2H0AA 1RCUA 4FWTA 1TA9A 1CCWA 1NULA 2BFDB 5AVKA 5JY6A 3OZCA 2VP5A 4BLVA 4YUAA 4W7IA 2B1RA 4HAYA 4PRLA 1X1RA 3P32A 1WEKA 4EHAA 5T4BA 4AW9A 4O2BF 4G25A 4YS6A 5HTOA 5B6JA 2BPOA 2HHJA 2YN2A 4R0NA 2GLXA 1Q12A 3QEJA 3THXB 4MCIA 4BO6A 4RFLA 3E9NA 1NR7A 1WKVA 4JT8A 2WR8A 1JJFA 1XP8A 1KVTA 4GPIB 2FR8A 5ERXA 2WWGA 3IA7A 1XP5A 1NJ1A 3UJNA 4M22A 5CR9A 4HWKA 5GZ6A 4FOSA 5HUJA 1JP7A 5FL7D 1WIWA 2ZTHA 1HLGA 4HLUC 5LQSA 5U4QA 4ZJZA 4AY2A 4ZGWA 3FF4A 4PBRA 4GKKB 3RBZA 1E9SA 4MQ6A 4ZPXA 3JQ9C 4XWWA 5JVDA 1A4UA 1PRYA 1Z2DA 2VPXA 5DVZA 1AUVA 1IYZA 1DQZA 1Z3IX 3IGFA 3SMVA 5K3FB 4IGAA 3R0QA 2ZQZA 2JJYA 3ESXA 2R00C 1KFKB 1PT6A 1W5EA 4TSRA 1V11B 3SR3A 1JXOA 2GXQA 3IRUA 4NYJR 2ZIVB 3LYAA 4UZEA 2HLNA 4ZP1A 3WKEA 2D0PB 5K8CA 3QJ5A 3ABQB 1BKSB 1AHNA 2JIMA 3H05A 4WL0A 4L8VA 4EO7A 2BGKA 5E2AA 4WFJA 2TSYB 1X86B 4LF6B 4L1KA 2ZJ1A 3BBPA 4C0AC 4QRDA 4Y9UA 4YAJA 5ES4B 3CVXA 4BS9A 1M10A 4NULA 3AFGA 5JDIA 3AVWA 4NE2A 4DV4B 3IP9A 4C6TA 4EW6A 1OKKD 4NFSA 4QG3A 3AX6A 3DQZA 3V48A 2AH5A 3CUWA 4MQBA 3RTEA 3GT3A 2VYND 4DB4A 4P22A 3WRVA 2G71A 2VYVA 4KE6A 2AGVA 5BOSB 1TI7A 5CG2A 1W25A 1WXDA 1P2SA 2DBVO 2IF2A 2PGIA 5HZGA 2J9FA 2ERYA 2PJDA 4MWTA 2NW6A 5IAGA 2RE8A 1VOTA 2AC7A 4WD3A 2D1SA 3AV3A 3QPAA 5JEDA 2V6JA 1FK8A 4UDXX 2CHVA 5LOVB 2TMGA 2YV2A 1LBEA 4OA8A 2KMLA 3NHPA 5JG7A 1AN0A 1U0FA 4DMFA 2DR2A 4F0JA 2FPIA 5ANRB 5G0SA 1A9XB 3BAZA 1COZA 1U7TA 4AD8A 1ICIA 3L01A 4BO7A 4MULA 1BXGB 2J4CA 3MCUA 2ZBEA 4YUVA 1XZJA 4XGRA 3RBXA 3SMQA 3TOSA 4CV3A 2JG3A 3CVOA 2ADOA 3KV3O 3QBDA 5AT1A 1ZJZA 1W5AA 4ANFA 3NHBA 1WD5A 1HETA 3DTYA 4EEXA 4X6XA 3RJ5A 5FUXA 4ZQEA 4CKEB 2I2WA 4DJEC 3RU2A 5DHQA 3AFIA 1Q7BA 5JO9A 4J0HA 2FUG6 3HZRA 1ZM7A 1DQRA 4LJAA 1NX9A 1EMDA 1NVMB 2H2WA 3G7NA 5C34B 4BLTA 4BVLA 4DDTA 3VUEA 1GKKA 3P2EA 4Q1CA 5EWLA 5B4TA 4FFDA 5KDDA 4YJGB 4AZVA 4TLCA 4B4KA 5IT4A 3BF8A 2WWFA 4LG1A 5IU6A 1E8NA 4Z86A 3SXJA 2Q7DA 2A5DA 1O9BA 3U4QB 4ZZ3A 1COWD 4MKGA 2ISSD 1M6NA 1X77A 4IDCA 2C2YA 2IYOA 4U7HA 1A0OA 1G98A 4FGSA 5IDWA 1E2QA 1E4YA 3KUUA 5BSRA 1KU6A 2WWYA 4WESA 1CS4C 4Q4AB 3K9NA 1QQAA 1MT0A 4DQVA 4ZI3A 1Z38A 3GDHA 4TQGA 1TADA 4JOBA 3ROTA 2XQKA 1TEVA 1C1XA 2AJDA 4S12A 4OQFA 1UAYA 1UOQA 1JIXA 4CI0B 4J1SA 2E82A 1BHJA 1XDDA 2VWPA 1E5LA 3RM3A 4FKBA 4IFEA 1AO3A 1FZTA 3BE5A 3EVCA 4INPA 1DAMA 1UBTS 3T1NA 3D4NA 3KEFA 2JI4A 3BGIA 1XWIA 2W9XA 5F33A 1LK0A 1KR5A 2CJWA 3NAQA 5JISA 4W7SA 2RH8A 4X1YB 5ECYA 2X19A 3PU6A 2P2ZA 4KYUA 1TYDE 4FYYA 2Z09A 1T3ZA 2BTEA 2CXSA 2OZKA 1AF7A 1D0VA 4G1EB 3E8SA 3K9GA 1CYEA 5JWHA 2A5LA 1H93A 4PAMA 1KYTA 2J6HA 3H1TA 2FSSA 4CLEA 2B6NA 1DKPA 2Y1EA 4CKCA 1U9JA 2J3EA 3A31A 1LNSA 3BJMA 2BKUA 2BEVB 2X2EA 1SIWA 4L6CA 1LLQA 3WB1A 4EHFA 2RD2A 3L0OA 4GR5A 1TKAA 4HOYA 2IPXA 2AXEA 2QTMA 3MEQA 4KRYA 3TFWA 4U00A 3I30X 3R9XB 4DPLA 4OHVA 2Y27A 1BC5A 3QLEA 2R5WA 2BW0A 3U4MA 5ICFA 5BPFA 3AM1A 3NTVA 4MW1A 2XJ4A 4E1AA 2IYRA 5HKBA 3P27A 4R5MA 2VQFB 3NATA 2VH5R 2ZVQX 3GOHA 4FS8A 5CFOA 1T9CA 3KSZO 4KIUA 2PUBA 3DOEA 3FOBA 5JU6A 1ZK1A 4MW4A 2EQAA 1QO9A 3ZEIA 4BP8A 1IDN1 3HADA 1TX4B 2JLCA 4B3DA 4ZZ1A 3VNUA 1B6SA 2BR4A 2Y76A 1BNCA 2R9VA 4RA6A 3I37X 4UEQA 3BCUA 1E6CA 5DU2A 4QXMA 2VPQA 3Q9SA 3CZ9A 4F2HA 3FKSD 5KTYA 5CCBA 2PGOA 5CB6A 4LXQA 3K0AA 1HTBA 5CVUA 3KQQA 3IL2A 5IZ4A 1MVNA 1Z4KA 5C8DA 2I2BA 3HFJA 2WYHA 2BDEA 3ZZ0A 4D8WA 1P4HA 3RADC 1O3YA 4IUYA 1RM5A 1T2NA 4RLQA 4Q05A 2CBXA 5EI5A 1MQSA 4UD2A 3U3DA 2WP8J 3RUCA 1SGWA 4EDFA 1F8YA 4H3KB 4BLWA 2VJMB 3OIWA 2XXBA 5DT9A 5FLYA 1WZCA 3AJRA 3MBOA 4JUDX 1CQJA 1L3IA 1NZJA 1W0KA 3NHSA 1MOPA 3ZBPA 2E4UA 4EYOA 5BT8A 2CHUA 1I5RA 1PYOA 3W8FA 5KDOA 2R6GA 5IJXA 1EUCB 3LCJA 1QC5B 1XBTA 5E1DA 1ZSVA 2NUTA 3W2FA 3D6AA 3X1DA 4JVMA 3UB4A 3RW9A 3OOWA 5FYDA 1A50B 3T0FA 4E4RA 4LY0A 3KJHA 1MQ8B 3CRZA 4MUAA 1DKQA 2ZQYA 3L6OO 1GCOA 2C97A 1M0WA 2RB5A 3KT6A 2CHEA 2EFYA 3LI2A 4JQSA 1T8YA 4WIAA 5SV2A 4YXWD 1JIKA 1F51E 3OT5A 3UA3A 5KX5B 4QASA 1GTSA 1H2YA 1ZHHA 3JYHA 4TTPA 5A05A 3LT0A 2ZUEA 4IVPA 3VJMA 3A9RA 4PSKA 4EJ6A 4IF6A 3RYTC 3S2IA 3OLWA 3ECSA 1R6XA 4CF6A 3NT5A 3VMFA 2IYQA 2Q49A 3HCRA 5LMCA 5B1YA 1LEHA 4X7MA 4GBJA 1SD2A 2YIVX 1BMDA 2VKQA 1MRNA 2Z08A 3QH4A 4IKEA 3SGLA 3TI7A 4FNAA 5JS8A 3RAFC 4W5WA 1J2EA 1F8GA 2O59A 4QU5A 1CUHA 2O9JA 3LNCA 1NVUQ 5E1MA 2FRDA 4P31A 1I2CA 3B48A 2I6TA 3TTWA 2O3QA 4WCDA 5DT2A 4I81A 1G5TA 4RMHA 2PPLA 2XYPA 3EDOA 1Q83A 3FFWA 3IVGA 2KI5A 1DKUA 1P5RA 1Y1SA 2A86A 3IEIA 3N6RA 4XD7D 5E4YA 3DZGA 1T2FA 5LBTA 4ON9A 3OPYI 3VPDA 4EVIA 5HF6A 4A23A 2P4UA 4HPJB 1YAHA 2DF8A 2HK8A 3K70D 1JDUA 1RW4A 5MGBA 4MDHA 2GYWA 1NATA 3IPXA 1AXGA 2B0JA 2V4ZA 3PWTA 2V4MA 2EW2A 3OQPA 4LMAA 4V03A 1FBNA 1Q14A 2A7QA 2C54A 1POXA 4G8CA 4NCBA 4MGZR 2VXCA 4R8MA 2D06A 4KOEC 2FEKA 1Z9BA 5TPZD 4AO7A 3NUZA 1BFKA 1JAYA 2X1LA 4LEIA 1WXQA 3WV4A 3ZEAA 4ZANA 2F4NA 2W2XA 4QJBA 2FR8C 3P9RA 4GPTA 1XF1A 3UG7A 1EFUA 3D6NB 1PHPA 3WHPA 3ZHRA 5HKAA 2HHCA 5HMMA 1NBWB 1SVOA 5F51A 4LE0A 1FY2A 2QOEA 2IOYA 1U5BA 4QHYA 2EATA 1D2RA 2ZT6A 2EZ9A 5FPKA 3LZDA 2XGMA 1I7PA 3PNSA 5LNK6 2B1QA 1G6KA 4MJXA 1TA0A 5LA6B 1HDEA 3WB0A 3EPRA 4FFVA 2NG1A 4PN3A 1TQDA 4IOJA 4QUKA 4F6RB 1OFIA 2HQBA 2BMEA 2PFSA 4O4HA 4P33A 5HJEA 1GQOA 3AHGA 4ZALA 1PJLA 2XNCA 3A2NA 2YS7A 2WZQA 1ABEA 2WNHA 1AUOA 1GPWB 1OY1A 3AIKA 3BCSA 2ZT7A 1NXSA 3Q2KA 3V3TA 3FUUA 1OYWA 4H7JA 3FSGD 3NXKA 4QDXA 1JTEA 1IHYA 1S3GA 3N3AC 3NYIA 4UCWA 2FMKA 1NL3A 5KNDD 2R6ZA 4NH0A 4TVSA 3KTDA 2O4UX 3D8SA 3QLVA 3CUYA 1PK9A 4IL5A 5CM9C 1KDTA 2IL1A 2C5AA 4RENA 5CH3A 2LCFA 2HYIC 4KQWA 3MS2A 4Z7JA 1RRFA 3AFNA 4EG6A 2CFIA 5JDIC 1VGRA 2GN1A 3K2BA 3KT8A 4ZWNA 1V2HE 3NUGA 1WL8A 1AZWA 2CMDA 2R1UA 2W6MA 1KL7A 3QFRA 5J5AA 4JWTA 1GGVA 5FTKA 3GWGA 3IXQA 1LGYA 1M2JA 4L28A 3U9TA 3V80A 3DHNA 4CLRB 1YK0A 4KPFC 1CIVA 1AT1A 1GPMA 1EE9A 3VM6A 1NKTA 2WV7A 3VV3A 1ZK4A 4RKFA 4RJTA 3LQ1A 2I4MA 1VL2A 2P68A 1TT5A 3CO5A 3TWOA 3GNSA 5DIZA 3D5QA 2ZE8A 1R64A 2JATA 3GLSA 1S89A 2YHAA 3IMCA 1E8DA 1RRMA 2F8MA 5JSUA 3RAEC 2PHZA 2ANCA 1H2EA 5CA0B 2WVAA 1R4MA 1BD4A 2B98A 4KZPA 3P7MA 2CUZA 5DGIA 4TRRA 1R12A 4QECA 2PG3A 3U40A 2HZ7A 3M5PA 2J1LA 2ZR7A 1CR6A 1BYIA 1U2ZA 1DC8A 1AURA 2OENG 3B6IA 3IESA 3PC8A 2VUSA 4LVCA 3QEKA 4OKIA 4OP1A 1P33A 2GF2A 2WNIA 1P3DA 1FVOA 3F6YA 3QPVA 1C4KA 3A1FA 4UUOA 3V46A 2IYLD 3L4BA 1P0FA 1OJ7A 3HCEA 3GQBB 3LT1A 4HWSA 4M89A 1HV8A 4YAGA 2PMKA 3Q3JB 3TLKA 4X1KB 1QQBA 3R77A 2ORYA 2R85A 3T5DA 3TEFA 5BQ3A 4NRDA 4QYMA 4DZRA 1ZGBA 5AIAA 3ZI7A 2A5YB 4M1OA 5TGZA 1UINA 1UM9A 1UP6A 4Q9NA 3AHDA 4PVDA 5DX8A 4N3AA 5JSZB 1C9EA 3TZLA 4YCSA 4R68A 3Q0TA 2AQHA 2ZSDA 4PM4A 3OJFA 3AEQB 4LF7B 4ZQFA 1D9XA 3GA7A 3O74A 3CPJB 4F5ZA 1YS4A 2C2BA 2EXXA 2WHYA 4FYHA 2P3QA 3K9HA 1O1YA 1V43A 3MTIA 5EC8A 2M6RA 1Z8HA 1F3OA 1LBHA 2IEIA 1CSEE 1SG0A 4JVLA 2BHLA 1SHJA 4O63O 1JXMA 3DAHA 4QDUA 4XTCS 4ZVTA 1V71A 4RTLA 4WV3A 2AQKA 2I4NA 6REQA 2OCKA 2OB1A 2IS1A 2C5GA 1PYDA 1J8DA 2I76A 3Q98A 4PSCA 4WA7A 3U09A 1C8KA 1MIOA 3P52A 4D3FA 4URXR 2Z95A 4XUGB 1ZG3A 1TQ8A 5EJAA 5FWYB 3G2MA 4A82A 3KOOA 1PGOA 2R3SA 3E22B 1O94D 4A16A 3HO1A 1T9GS 5FQOA 2WIBA 2GSDA 3CB4A 1EQUA 5F1YA 1OKKA 4RPLA 3HDYA 3U4AA 2QTVA 4F8YA 1E5VA 2YYZA 3S99A 4E5KA 3VH1A 2I6QA 2VYNA 4P98A 3H9EO 2FUKA 3GYBA 3MWYW 1NBEA 4HLNA 4XQCA 4CM4A 3VR6H 1VB3A 3C15C 3I9V6 1SY7A 3Q2OA 4OHYA 3EAGA 5B7QA 4DDKA 4ZYUA 1K97A 4HLQB 1JLRA 1I9GA 2I5PO 3EDRA 3QV1A 2FFHA 2BM1A 4W1RA 2O2IA 1PQUA 5B2FA 4ZCMA 1W0CA 5E4FA 4RFVA 1P0IA 2WJJA 4GZ6A 4L07A 4Y98A 2O1SA 1W30A 2I2FA 4MV5A 4DN6A 2PZGA 1YS1X 2H5LA 2J0EA 1N2JA 3E8XA 4QVIA 3OEHD 1N2ZA 3FMPB 5JVDB 1Z5WA 2W37A 4OQEA 4RGVA 4B87A 2RBKA 1NI3A 4DV1B 2XEXA 4F60A 1A04A 4DDVA 8ABPA 3L1KA 3QFCA 3D81A 2I62A 2HDOA 5DI9A 4YN3A 4KX5A 1BEZA 4CPDA 3D1JA 3CVWA 3H9UA 5AKJA 4KJXA 4LYGA 5CVVA 2HA4A 5FR1A 5KTOA 4ZYYA 2CKDA 2QSUA 2XNHA 3LZCA 5G1PA 2XVXA 4GIBA 4RKEA 1FDIA 5AVQA 3FPHA 4LCJA 4Y9RA 3PDWA 2PVSA 1EDBA 1P4RA 2E2WA 5F1OA 3T9EA 3JYOA 5ELXA 1C0LA 1COWA 3KQOA 3MS4A 4N01A 5CTJA 5ALPA 4REQA 5CFRA 1IEVA 2HNKA 2QJWA 2R8YA 3W5BA 4CEHA 2GBPA 3R5KA 3T3EA 1BOFA 1H94A 1JHXA 2PGJA 3N70A 4BBZA 4C6TB 4AY6A 4R0VA 1D1PA 4CFZA 1M6EX 4KE9A 2C2OA 4M36A 2TS1A 1E3SA 3ACBA 3K05A 1FXSA 1C7FA 3DE3X 3KSRA 1ZM4A 1FRVA 2PE5A 3ZGVA 2VNKA 2C9YA 4X7PA 3RTAA 3QPBA 1ZMTA 4LBZA 2Q62A 4TKLA 2C57A 2J9FB 3AU8A 5U1PA 2IBSA 1XWFA 2OBFA 2F3SA 2C42A 4H77A 3L40A 5DYNA 2G77B 3CWCA 3RK4A 3AK4A 3NHZA 3TLCA 3WJ7A 5H82A 2ZRBA 1CEYA 4D3SA 3AKEA 3SEQA 2ZRGA 2IZOA 2WWIA 2VDPB 4UBJA 1QIJA 4BMNA 2FPIB 4HO1X 5KU7A 2JFHA 2W48A 4Y7DA 4YXFA 3FZQA 1T1SA 4QGHA 4CM5A 3G8BA 1FEZA 4BU0A 2EF1A 2V4UA 1XHEA 1UBOS 2HPZA 4LHYA 4MNTA 1O9HA 2UZ3A 2XVYA 3DOIA 1HMYA 3GEDA 3AVQA 3O21A 1XVVA 5JD3A 3HM2A 2P1ZA 4P4SA 4ZDJA 1LTKA 2EQ5A 3OICA 3DMGA 1FFDA 2XTJA 4E94A 1LBSA 1U8TA 5LQKA 1WW8A 1WHSA 1TO1E 1QMGA 2PLNA 2ECPA 1Y8QB 4US1R 1Q57A 2DLNA 1AGRA 1IQUA 3G0BA 3PFNA 4TMZA 1TZ2A 2ES4A 2NQ2C 2ONKA 2B4YA 3HJCA 2FG6C 3L7IA 1DDGA 4KK4A 4V02A 5CVCA 5EWLB 2CFCA 4M60A 3TZQA 3AHFA 1QHEA 2O3JA 3I39X 3PDCA 2QB5A 1YSCA 3HO6A 3LC1O 4G5OA 3N2EA 4HTAA 1CEXA 2NTYC 5LPNA 2CLHB 1RJ9B 1PGPA 2FRDC 2VBGA 3C4JA 1Q7TA 1PJTA 3HBFA 4UHEA 3TL3A 1I33A 5CYOA 1JIVA 3RE1A 3GCXA 2BRUA 4P2GA 1IG3A 3PR1A 3Q7QA 1V5EA 3K32A 1M7GA 4JMPA 4WESB 4XH9B 2LE0A 1FSGA 3LXXA 5TMPA 4Z51A 1C1XB 3DHWC 3H97A 3DPIA 5AW4A 1VL0A 4BNWA 4ZQGA 1U0HC 3IQZA 2AQIA 4CIYA 5ALXA 6Q21A 2CXQA 3RVJA 4H0CA 2RSLA 1TEXA 3BREA 3FKSA 3ONNA 4O8CA 1CY2A 1FDUA 3FPJA 1D4AA 3WWOA 4GKVA 1GVNB 5BSTA 2ZIEA 1P6QA 3A4LA 1OXSC 3CWQA 3Q0EA 3ZV7A 3C6ZA 1K8QA 2Q3DA 5JWOA 1THTA 1Z6QA 3C6QA 3LQFA 4UVEA 2HX1A 1IVNA 2QRNA 4G5YA 3MWLA 1CEQA 3ZS8A 1GNLA 1CUXA 3PEUA 4MQUA 3S68A 5EJ5A 3BULA 3H2SA 2HQSA 2RAFA 3EF0A 1NAIA 4RVNA 2VQDA 4AZTA 1CDDA 2BBSA 4JY7A 5EP4A 2RGRA 1DMRA 3JPYA 4NJEA 3CA8A 5GQSA 2I78A 3WL4A 3W5AA 1KY2A 2PQ2A 3BCHA 4C30A 3PX7A 1ZY2A 2UUAB 2GPYA 1JMKC 2BCEA 4KP7A 4PG7A 3A0UA 1R9NA 1SCBA 2C29D 2VJKA 4PQRA 4C78A 3IBSA 4MRNA 4CKCB 3O95A 1RWKA 3KKKA 2FI1A 4IDOA 1Q0UA 1HUQA 2HU8A 2H0RA 4KHZA 4JI6B 3UMMA 3C3CA 3JQ6A 4JLDA 3OLYA 4LV6A 1C3XA 4X91A 3X1JA 3AF4A 2PH1A 4YXWA 2WF9A 4KFSA 2DPXA 2R79A 2R4UA 3Q3VA 4ZOQI 1N7JA 4OF4A 1TYAE 4CUJA 2VHEA 2BTQA 4AJJA 4EB6A 9GPBA 4WKCA 1PX2A 2QRGA 4HWRA 1OA1A 4QUBA 3K0HA 3TTSA 5HXAA 1CUVA 3A6FA 2QAGA 3OY7A 3I4FA 5JAHA 2XCSB 2QZ4A 2EFEB 4G0YA 2MSNA 2PL9A 4OFXA 3UY4A 2JFQA 1MO4A 2DRIA 1SCJA 3BMOA 1Z34A 1X74A 1JEAA 2BCJQ 2YJ3A 3GIWA 4MR9B 3LDGA 3GRUA 4BVBA 3DL7A 2HCTA 4B82A 5LDHA 1V6CA 3MRVA 1XEAA 1IB6A 2HU7A 3IQWA 4RA6B 4XDHA 3SZLA 3IKMB 4P8RA 4Z4GA 5JXJA 3QPWA 2JJ2D 3EC7A 1OAKA 1A95A 3K9LA 4GL4A 1UBNA 3MT9A 3TIFA 1NQ5A 1YQTA 5AI5A 2AOUA 3KQMA 3K0AB 4FS3A 4XD7A 1B93A 2QI9F 5FL3A 1OSNA 2HWWA 1HMPA 2J9YB 2Z8YA 1P6XA 3U7HB 3CUSA 3F3KA 4CF4A 2ZB4A 1FQJA 2NTNA 2PQ6A 3ELBA 2AFVA 2HK7A 3SJ7A 4AX8A 2RAPA 4HK4A 3RQIA 1GUDA 5LJIA 4QUHA 1N9KA 1E0SA 2F3QA 2POQX 1F6DA 4K6MA 2BGMA 4DIKA 5TPZA 4CNBA 5ICGA 1CQJB 5DM2A 3CU5A 3PC8C 4NFHA 4N6OA 2QX6A 3FDFA 3K5PA 2V7WA 2V59A 3PX3A 3EPJA 1AV6A 3DEFA 3UK6A 3FLMA 3WGGA 4JENA 2NUTB 2FG7C 3L4BC 5FA6A 2OM6A 5K0TA 5KYGA 3P1JA 3SS8A 2GXUA 4Y2HA 3BWYA 3ZU5A 1VLVA 2PS0A 1SUIA 2HU5A 4R69A 1RPJA 3I52A 1PK7A 1WBBA 1UBRS 4I5IA 5DTRA 1NUQA 1KETA 1EP1B 3BBLA 5G0UA 3VDXA 4XVQA 1W8DA 2JAQA 4PIVA 2ZEJA 2VJAA 2HREA 4Q01A 5AI6A 1ZVQA 1CERA 4R1MA 2VSQA 3T7RA 3QU2A 1RACA 3E7WA 1VJ5A 3O0TA 3WLMA 4PZDA 2CYAA 4J2HA 4BNNA 1MENA 4H1VA 4R1NA 1X7YA 3BHNA 4B33A 2XXAA 2FXVA 2R6HA 2BBTA 3HDTA 2XAAA 4Z4HA 4CDGA 1CFZA 1H3NA 1R50A 2XD4A 4LRSB 4X6YA 4YGYA 3PC4A 4RGBA 3R3HA 2OV3A 1JBKA 3QELA 2R7KA 1HNXB 2ROQA 1LBTA 1ZFNA 2QLMA 3FSGA 1DAIA 3OZGA 4REMA 2XHZA 2QUZA 4Q1BA 821PA 4HUTA 1J00A 3BA1A 3NR2A 3NP9A 4AO6A 5KNDA 4ZIRB 3LKDA 1WDTA 2YJNA 2P3OA 4R2IA 3R7WA 4NZ9A 3T0GA 2V6IA 5TXGA 5AMXA 4RWEA 4YYZA 3TXXA 4E51A 3OECA 4D9CA 2CFOA 2WZDA 2OXEA 2V45A 1QR6A 3R1IA 1OD6A 5DM70 1UKVY 1X42A 4B47A 3HWWA 1S1MA 1VI5A 3BPSA 1E2PA 1XALA 1C7JA 3QK7A 5G1OA 3IHLA 2IDZA 4LF8B 1H5QA 2GVNA 4Q93A 2Q3FA 4WNAA 3K30A 3AL3A 4BE9A 3RRJA 1DRKA 1QJCA 4TYNA 1LLCA 3BDAA 3R7BA 4F1JA 2HAEA 1U7HA 1ZQ9A 4GU5A 3P9ZA 1OZGA 3GMTA 1PVOA 1N92A 3GBSA 3OU6A 3SU8A 4R51A 1KE2A 4K1LA 4RHFA 5EIHA 2ADMA 4KPYA 4GSYA 5D5HA 3OUUA 1Y6JA 1HT1E 3KKOA 3A2LA 4FX2A 4WLUA 4CM8A 4DLSA 2V54A 4E5DA 4DCPA 4KIGA 2XYQA 1Y8AA 3CLRD 3ZVNA 5EA2A 1U5BB 5FEUA 2IP2A 1KKMA 2QBYA 3ORQA 1PZXA 2Q5EA 6GPBA 2CC2A 1XL0A 2XV1A 1T1GA 1QBKC 1WBJB 1Y34E 3D3QA 4LJ7A 4QT4A 1UC4B 2AFHE 3DBVO 1Z47A 1IC6A 1WSWA 2W6CX 4TLBA 1NVVQ 2BKEA 3HA2A 2X7XA 4MVJE 2EG5A 1RPTA 4FQ8A 4O4HB 4YMSA 4AIIA 4D3XA 4QOHA 2H1LA 3JWHA 5E9AA 3SQWA 4MYDA 2R25B 3NVAA 3EFBA 3TAHA 3U7RA 2PZKA 2OO5C 1LI4A 4A6PA 4YRRA 4RF5A 3F67A 2FMHA 3UTCA 4LRUA 3A6HA 4WBNA 3DYVA 3FOWA 5IH7A 2PUHA 5HM6A 3ZV3A 1KPHA 1ZN8A 3C3XA 2XMZA 1ZWLA 4PLYA 2BMDA 2Z2IA 4QYWA 1HOXA 2B36A 2MR6A 1IN6A 3PUZA 4MUBA 4NZOA 5I7OA 4NFYA 3PUWA 3RG2A 1EUDA 2WWTA 3BL8A 4DGSA 4F4IA 2PZMA 1HG1A 3IDFA 3M4JA 4MKXA 5IS2A 5T41A 3HB0A 3GJTA 5M34A 4PHTA 4QPJC 4RNCA 1SK9A 4RZIA 1QV6A 4R3NA 4XIYA 3SJUA 4CM6A 4PAOA 3FOEC 2O8EB 4EECA 4F5YA 3SJAA 3UAXA 2Q6VA 2C4UA 4EARA 2CHFA 2DQYA 1O94A 2J33A 1ZU4A 3RTBA 1FLAA 1YBHA 3N5CA 1RQ2A 1TT5B 4QQNA 2DFLA 3QVLA 4ZDIA 1X1EA 1E2GA 1CTQA 1M1XB 1MAAA 1HYQA 3KE9A 1J22A 1ZRMA 2OMEA 1S7CA 4JGIA 2AKEA 2GD0A 2ZG6A 4OHXA 4XA8A 2YN4A 2DU8A 1QRSA 2VH1A 3IAUA 2ENUA 1O6ZA 4C0WA 2X4LA 1PLKA 1R4MB 4MYHA 1QTNA 5K3DA 4S2UA 1MXFA 2FQXA 4RXUA 3ROPA 4XLTA 1VI6A 3CRMA 4EB3A 5L3SA 2JJ1D 1M7BA 1OVMA 3M3PA 5K8UA 3PNOA 3CKMA 3HKCA