3REGA

Crystal structure of ehrho1 bound to a gtp analog and magnesium
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
171
structure length
171
Chain Sequence
KKALKIVVVGDGAVGKTCLLLAFSKGEIPTAYVPTVFENFSHVMKYKNEEFILHLWDTAGQEEYDRLRPLSYADSDVVLLCFAVNNRTSFDNISTKWEPEIKHYIDTAKTVLVGLKVDLRKDGSDDVTKQEGDDLCQKLGCVAYIEASSVAKIGLNEVFEKSVDCIFSNKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Rho-like small GTPase
publication title Unique structural and nucleotide exchange features of the Rho1 GTPase of Entamoeba histolytica.
pubmed doi rcsb
source organism Entamoeba histolytica
total genus 54
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3regA00
1LNZA 4LYAA 4Q9IA 4O2RA 2IHYA 4O0MA 2AWNA 2ZQ5A 3CX8A 4MRSA 2WBLC 4GOKA 4ZCIA 4E07A 4ZIRA 2JIZA 1V43A 2WWYA 4XJXA 1NMYA 4A0FA 4LGMA 1KHTA 4M1KA 2JLRA 5CDFE 1NIJA 3TNFA 2FSGA 2EQBA 3PVSA 1JPJA 1OPXA 1Z0DA 4Z8YA 4BFTA 4C0HA 1T6NA 4QBIA 3UATA 3L2OB 1BOFA 4IOJA 4TZ0A 4EPYA 1JXMA 2J0SA 4URWR 3U4QA 4FXPA 5C4GB 3GLIA 2GDJA 1XMIA 4B33A 3EX7C 2ZITA 5EXXA 4IDQA 2J0UB 4YQFA 3PG5A 4DSNA 1Z22A 2IUUA 3Q5EA 4IVQA 3MWKA 4Q1DA 2WWFA 3TQFA 3AGPA 4EJSB 2FDCA 2CHVA 2IYRA 3BFXA 1UAAA 1T5IA 5L3QA 1SXJE 3ZVNA 3N2EA 4CVNA 1VHTA 1OE0A 3I1FA 621PA 4P0TA 4US1R 4UXHA 2QMHA 1Q3TA 1T8TA 1RJ9A 2O52A 1YR6A 1A7JA 4JBWA 3CNOA 4MITA 4H1VA 2QTHA 3L0IB 5BWMA 5C46F 1KSHA 2PJZA 4PO9A 3L0SA 5JEDA 1X3SA 2FGJA 2G88A 3KL4A 2FZLA 221PA 4MRRA 3QY0A 3W34A 2CJWB 1U98A 3I73A 4DLZA 3RAPR 3TW8B 2RGNC 1CU1A 1DBSA 1IN8A 4C9BA 5KNCA 5HTKA 1IN4A 3DKPA 1ZMXA 5LB4A 2V55B 4PC6A 3KQKA 2CHGA 4QXAA 4QBHA 1UDWA 1T5LA 1R0XA 2VTKA 3IEUA 4ZCMA 1KTVA 1TPZA 2ZRJA 3B1VA 1JJVA 3LVRE 3NXSA 3T1OA 4FI3C 4FW9A 3F5FA 2NMVA 2ORVA 4DEXA 5KSZA 1US8A 3TUZC 1JR6A 4LYHA 2PL3A 2A5DA 4V0ME 5P21A 3TW4A 421PA 4D4LA 5GADl 2GCOB 1KY2A 1QF9A 1YZKA 2J41A 4C0AC 5FR1A 2O5VA 1ZM9A 5JECA 1EG7A 2Z6VA 5JI3E 1DO2A 1ZNYA 3DPUA 1XD8A 4A8JC 3QPUA 1S9HA 3HYRA 2EU8A 3WHLA 2GESA 2FSIA 2GXSA 2P65A 4BLRA 3ADCA 5E4FA 3QVUA 1XJQA 2QUZA 3CWQA 1A2BA 4P32A 4Z1MD 3K70B 2HCJB 2R9VA 4B76A 2QI9C 1E2PA 4CT5A 2QORA 1S4QA 1CRPA 5EXSA 1ESNA 2QAGA 2JAQA 2V54A 2DR3A 2H7VA 3B7GA 4MGKR 4PR0A 4Q1FA 4XVRA 3A58B 2WWXA 1Z6XA 3G0HA 1Q20A 4QHTA 4KO8A 2GF0A 1OKKD 1I2MA 4XSHA 5BN4A 2BCGY 1W2HA 3U60B 1NSFA 1P7CA 1VCNA 1ESMA 2GKSA 2C78A 2QE7A 4RFVA 1X1SA 1W0KD 4A82A 2QQ0A 4TN1A 1EFHA 5FPYA 4XWOA 3A1UA 1Z83A 3QQ5A 3GFTA 3CB4A 2ZRPA 3W90A 2QBYB 1CJMA 3H84A 2FOLA 2X77A 4BLPA 4P4SB 1TL7C 2A5FA 1GG2A 2R6DA 4ZIRB 2VP2A 4B35A 4C0BA 2FZ4A 5JFGA 5AWFC 1NLZA 4I1UA 3KJHA 1NN5A 4B44A 1G16A 2WJGA 1SVMA 4PSVA 4XVQA 4XTCS 5FBLB 4F91B 4AWXA 1L2TA 3GFOA 3VQTA 3QPWA 4KJZA 3SU8A 3FPAA 3U4QB 1KMQA 3GLIB 2N1BA 2XITA 3F0TA 3CM0A 4HDQB 1H8EA 4NH0A 4V02A 1OYYA 3R20A 4M21A 4NCJA 2QBYA 3VNVA 3X2SA 4DEYA 1G4UR 2I3BA 4V0LA 1HE1C 2WJJA 3TRFA 5L3QB 2WV9A 1N6OA 1WE2A 3U5ZB 1Z63A 5B58C 1E2IA 4B3FX 3IIMA 3NDPA 5CIWA 3LAWA 1NIPA 3WMEA 1VCIA 2CL6X 4XTRA 3DEFA 5KU1A 2VP5A 1RJ9B 2J1LA 3DOFA 3GEIA 4Q4JA 3ICEA 2GA8A 1DELA 3E5HA 3T1QA 5F9FA 1CS4C 2ONJA 3MG9A 3E70C 5DIFA 4F4IA 1JAHA 4L15A 4ON9A 1OFUX 4DB4A 3PUVA 4BFVA 4N3NA 2WOJA 2PT7A 3CLVA 4B32A 4DDUA 2ZUCA 3WYAA 3OAAA 3JZAA 3IPXA 2IYYA 4C2UA 2DFTA 1GL9B 3AF4A 3AF0A 5GJWC 3KDSE 3SNHA 3O8RA 2GF9A 2RKOA 4FD2A 3P32A 2L0XA 3GFPA 2VHQA 4AC9A 5DE3A 4M1MA 1AQUA 1GZSA 1Q3HA 2WJYA 3QEOA 1KSGA 3AGQA 4NYMR 3RSLA 1MV5A 4B48A 4BQSA 4OHYA 1FOEB 5HR5A 1MH1A 2F9MA 4HAXA 3CF0A 3ZGXA 1E0KA 2ZJBA 1W0JD 2QP3A 5L3VA 2PLFA 4HZUA 5LD2B 5HE8A 1KJYA 3PJRA 3PUWA 2XGJA 2Q9AA 1W0KA 4NBSA 4KFUA 2AKYA 3IBGA 3A1TA 4PPGA 3W3AA 5IRCD 1OH7A 1CR2A 3B13B 1VMAA 1F48A 4O3MA 2F1RA 1KK3A 1OIVA 3L8YA 2C8VA 1E79D 2FG5A 5J5CA 1HT1E 4FMCF 2YWFA 4JLDA 2J5XA 3AVQA 4PZYA 5KDOA 2AL7A 4B74A 4JSTA 2NQ2C 3AKCA 2BWJA 1IY1A 1JR3A 5G3YA 2IEYA 3GLGA 1VDZA 1F60A 2QAGB 2GILA 1SVOA 3UANA 3B2EA 1F5NA 2BOVA 3LRPA 1OFHA 2C96A 2NO0A 3HU2A 3LLUA 4HLDA 2OXCA 1QHSA 5A0FA 2IWHA 3FOZA 2GEUA 3OFNA 2J59A 1ZUNB 3HPRA 1ZIOA 4RD0A 2HV8A 3SHWA 4I4LA 2WJHA 2QM8A 4P31A 2OEPA 4EJSC 1ZNWA 2ZU6A 1E1RD 3EG5A 3RRYA 3LQRA 2ODWA 2PX0A 1HY3A 5TDHA 3QIAA 1OH8A 4P4TA 3KXKA 1EFRD 4OQXA 2VF7A 3S1AA 3V4FA 1G64A 1U90A 1E6CA 2CL0X 1EFCA 2GBLC 1U0JA 3CBQA 3OIWA 1GOTA 3O8DA 4HLUA 2QN6A 4EIWA 1DAMA 2IWRA 1VKJA 2XJ4A 1Y3AA 2REBA 1XJCA 3RS5A 3EPKA 2JLQA 3K8YA 1E2LA 2X2FA 4BLSA 3GP8A 4BFUA 4NONA 4YMTA 2F1JA 4D2IA 4P3YA 4TL7A 2IYWA 5G53C 2VL7A 2ZRNA 3IKJA 4C0LA 1N3BA 2JJ2A 3FFBA 3NBFA 1Q12A 1TU3A 2ATVA 4QNMA 4HYYA 3IIJA 3O8BA 3ZVRA 4TL8A 5B64A 1RZ3A 2VPPA 5EE0A 1C4OA 5C18A 5J4VA 2VHJA 1NLYA 1Z5ZA 1W49A 1SHKA 3FHOA 2R62A 4L9WA 5LPNA 2ZSDA 1G6HA 3MMPA 4QOSA 4MKFA 4Q4JB 1OJLA 1W0JA 5SZKB 1P9NA 4P33A 1NBMD 3B5JA 4D6PA 1ZIPA 4WOPA 4NHOA 4IFBA 3UIEA 1ZM2A 2IXFA 3K0EA 4A0GA 4EPRA 3C41J 3WBKA 2R6CA 1EFTA 2V1XA 1HYQA 4D26A 3EA0A 3RRMA 3UPUA 2FFHA 3UG7A 4EPXA 2GETA 2SHKA 2H17A 2DWQA 3K9HA 4JYCA 4OJKA 4NL4H 4O25A 1ZINA 4NKRA 2NO7A 2ZI3A 3Q5DA 3ZZTA 3TJZA 5J4YA 2W6IA 2IXEA 5K8UA 4KSCA 1N0WA 4CT4B 2QRNA 4FIDA 3SYKA 1P75A 3K70C 5DYIA 2V1UA 2YOFA 3M6AA 4D80A 3I61A 2F3RA 3AF2A 2B7CA 4FINA 4L16A 1E9BA 1G8PA 3LX5A 4I99A 4DCNA 1CP2A 1DADA 3KKNA 4PHTA 1CJKC 2Q0HA 5EE3A 2IYXA 4HZUB 4B3DA 1ZYUA 1QVRA 2LKDA 1OHHA 1KSJA 4HB4A 1IXRC 2GXAA 1G5PA 1RRGA 2V6IA 4BWYA 1CRQA 1KK0A 2BCJQ 1A2KC 1YU9A 4NYJQ 3SJZA 1FFHA 2X1VA 1XTRA 2IF0A 2QA5A 3MSXA 1HH4A 3WHKA 1M8PA 1ZNXA 5IT5A 4QM6A 3NVAA 2DHRA 4H1UA 1KNXA 4LHXA 4JMPA 1FNNA 2G1JA 3GLGB 1AIPA 1E4YA 1AM4D 2CLDX 4QNRA 4DCUA 3FVQA 2ATXA 1MO5A 2HXSA 3NWJA 4JBXA 3E1SA 1G1MA 5JI2E 1MO3A 4DZZA 3OEEA 5FBQB 3U44A 3RNLA 3PITA 1OT3A 2G83A 5D3MB 1G3MA 5F98A 4B43A 2AR7A 3HDTA 4KHZA 4M4SA 5FR2A 4GOJA 4RKFA 4RKEA 4MRNA 3TKLA 1FL9A 1WA5A 3CH5A 3FWYA 3HP1A 4PPQA 5JMTA 4DUGD 1AS2A 5CLQA 2VLIA 4KVAA 2UZIR 3GLHE 2G9NA 4Q4HA 2RB4A 3ETLA 1QVAA 4XH9B 4QGAA 3T15A 3EXAA 1TQ6A 2BMEA 2OZEA 1FTNA 3S1AB 1TNDA 4AKHA 2Q6TA 1Q44A 2B92A 2QP9X 5KPDA 2J7PA 4R9UC 3F8TA 3KXIA 1HA3A 3B1YA 5CYOA 3T1TA 1XNJA 1X1RA 2ORWA 4OI4A 4DIDA 3A6PC 5KHOC 4Q7LA 1E69A 2DFKB 3AV0B 1VYVA 4G5SA 1TU4A 1SULA 2ERXA 4W5WA 4TQAA 5C2JB 1E9EA 2WSSD 4DCVA 1W2GA 1OH5A 2XXAA 2G3YA 5HZHA 4FMCB 5L8VA 4ZKDA 1G4AE 1KZGB 4R71A 4L8GA 1IONA 2DCUA 3BXZA 5FOVA 4GZLA 2QZ4A 3I92A 5EP2A 1KOFA 2F1HA 1ANKA 2QT0A 2ZAMA 3EA5A 3K0AA 4WVFA 5ANRB 4IJMA 2A5JA 1ZU5A 1S3SA 1BYIA 1Z6YA 3FDIA 2EFGA 2Q21A 2ZAOA 4CGZA 4LBVA 4DB2A 3IO5A 1CR1A 4QBGB 4BRUA 1TF2A 5CJPA 5M04A 4DLWA 4ZDWA 4D4JA 4LC0A 3X1DA 1JQJC 4QL3A 4ACBA 4XVUA 1U81A 3K70D 2IS2A 4FCTA 4KXFB 1AKEA 1X8KA 4TQ9A 2H57A 3B60A 1R4AA 1KSFX 4LRWA 4ZKEA 4LJ7A 2JLXA 3DZDA 3BRWD 3L0OA 1FZQA 3ZH9B 3PEYA 4JT4A 2AN9A 2FA9A 3TUIC 1AKYA 3OEHA 1E2KA 3CPHA 2JLYA 3UKDA 3SFZA 3CPJB 3WNCA 2V9PA 1GILA 4IRUB 4DCSA 4TMXA 2AXNA 3ASZA 1IY2A 2PLRA 4LJ8A 5AR1A 4A1FA 1SVLA 3LFUA 2VSXA 1L4YA 1P9WA 4PANA 2MMGA 2CDNA 4ASUD 3EAQA 2REXB 1OF1A 1GWNA 3AH8A 4IVRA 1KO4A 3RVBA 2P2LA 4JKIA 1WMSA 4NYIQ 4PQFA 5SZIA 3MD0A 3HU1A 4PAQA 1XF9A 4NYIR 1LF5A 4AYTA 5DISB 2DPXA 1DPFA 1NSTA 3A37A 5JWOA 2JIZD 2YHSA 2ZRCA 4K81B 2CEAA 1E96A 2BBSA 2DYKA 3RS3A 1SVKA 1WP9A 4MYUA 4W9MC 4B6FA 1NLFA 3FMIA 5TMPA 2JLZA 4GRAA 2BVNA 1E9FA 4JLKA 4CW7A 1NKTA 2D7DA 4NP6A 4DUGA 3TUJC 4PO8A 4D81A 1PUJA 4LUCA 4PQYA 3WP0A 4DSTA 4C0SA 1YR9A 2RGBA 2RGCA 5FUYA 3U2QA 1R8QA 2YZ2A 4GFDA 1M7BA 2ANCA 3RS7A 4CEHB 3X1WA 2EFEB 2RGAA 4IHQA 2R8RA 4MGZR 5EP4A 1KK1A 2IS1A 1A4RA 1S8FA 4BRWA 1E1QD 1VG9B 2OG2A 3DHWC 3SBEA 1ZM4A 3PQCA 2I1VB 1N6KA 4DLTA 3K9GA 4QKQA 5C4MA 5JJKA 2O8CA 4V0NA 3AP1A 2RGEA 3H4MA 3KKPA 2C2HA 1NVVR 3IBYA 1K8RA 3CKLA 3RABA 1IN5A 1YZGA 2RHDA 1W44A 4DCTA 2YKGA 3Q72A 3Q3JB 1YJ5A 1JALA 2QL6A 1ELOA 4BFWA 2QAJA 4Q4HB 1JEDA 2GVDC 4LZZA 1C1YA 3IO3A 4A92A 2RGXA 4E22A 3TAUA 3LD9A 1DTSA 1ZD1A 3WRXC 4UNPA 1RVDA 1MO4A 4GI7A 4MA4A 4BASA 1G8FA 3T06B 4BLTA 1HQYE 1RC8A 1ZC3A 3B1XA 5TVKA 2IS4A 3ZS8A 3LLMA 4MDEA 3P27A 1GAJA 1G19A 4LBYA 5HKKA 3U6BA 2CBZA 3GMTA 2QSZA 5CLLA 1FQJA 4FCWA 3MWJA 1Z6GA 1XCPA 3BORA 4DLSA 3QKSA 3QPVA 2GNOA 1XCGB 4JLAA 3TIFA 1P60A 3AUYA 2FH5B 1EWRA 1W48A 1II9A 1E0AA 4DLXA 4KYIB 2AKAB 4LBZA 3K0AB 3EC1A 1W47A 1N25A 1D9ZA 3BD9A 3VX4A 2HJVA 1KKLA 2VP6A 2NO9A 1I2DA 1E9DA 3Q7QA 4UXIA 2PCLA 2ZYTX 1ZM7A 2AK2A 4P4SA 1I4TD 5AJYA 2FU5C 2A5YB 4Q9KA 1G3RA 4V0OA 2WWHA 5CB8A 1JJ7A 3IUYA 2GEVA 1GUAA 2HYIC 1ZCAA 3PFIA 1CJVC 3B85A 5BN5A 2XSZA 2IL1A 1AN0A 5CB6A 2V7QA 3DVLA 4ZDIA 2FWRA 5FOXA 1I4LD 1ONBA 1XP8A 2VRWA 2O8BA 2WAYA 1KAOA 2QE7D 4IDPA 4OI1A 5J4HA 1ZUIA 2KBFA 2W83A 4TLCA 2QPAA 4IKEA 3D7MA 3TE6A 4F4JA 3UXMA 1E1QA 3IGFA 2BC9A 4K8OA 4JL5A 1D2MA 1ZCBA 2GZHA 1T0HB 1OFTA 2YWGA 1CULC 4HUTA 2OBMA 3QE0A 4MKIA 3M0EA 2G77B 5FUXA 1OXTA 2F1IA 3TVTA 4D0GA 2Z83A 2A3RA 5H8WA 3QSYA 3P20A 3I8XA 2EFDB 1N2CE 4XWAA 2CVFA 4NE2A 2LKCA 4IOLA 1ZP6A 1YZUA 3NHBA 3FMPB 4RD6A 3VKWA 1YE8A 4RD4A 2HYDA 4OQNA 4A2PA 1H8ED 1G7CA 4HAZA 3TSZA 2B7BA 3Q8XB 1QZXA 1TQDA 4IDHA 5FI1B 2XNDA 4HLUC 2A7QA 2J0VA 3CZQA 1Q21A 2FSFA 4BLOA 1NMZA 1Z3IX 2PMDA 5UKDA 4KI0A 3EC2A 1AS0A 2JA1A 3D6TB 3REFA 2NG1A 3SEAA 1SGWA 3NTUA 3CH4B 2O8CB 2QM7A 2CE2X 2OCAA 2WZQA 3R9WA 2D74A 3B82A 3OIUA 1AQYA 3A1VA 4UQOA 2CHQA 3BJIC 3DL0A 3SYLA 3ZZUA 4UJ5A 4TWZA 4NCNA 3NH9A 4MYHA 4AYXA 1T0JB 3CRMA 1FMLA 3MJRA 721PA 3Q7PA 3H86A 1LFDB 1S1CA 1R5NA 1T91A 2A9KA 3LV8A 3OAAD 4YONB 5BYJA 1KDPA 4D82A 3PEWA 1G3QA 3PEUA 3QG1A 3GEEA 1IY0A 3F3YA 1YVDA 2ZJ5A 1HQCA 4JL8A 2IC5A 3K9NA 3QKTA 4M22A 3EW9A 1G6OA 2GXQA 2CCGA 4M1OA 1TADA 3AP3A 1SKQA 1JBKA 1BYUA 1GIAA 2ZSEA 2MSDB 3UMFA 5AJVB 2HEIA 4G1UC 2XOKA 2GAAA 5SZJA 3QKSB 1IN7A 3VU9A 3IPYA 2UKDA 2ZRIA 1D9XA 4P4UA 1GNQA 1EX7A 4KLNA 3CR7A 3M1IA 3BFVA 1WB9A 2ZE6A 4PSAA 2BJVA 1ZAKA 4UNSA 2BBTA 3I62A 3K0SA 1XTSA 1E2MA 4K46A 1IHUA 1KI2A 3KUCA 4C30A 1RKBA 1ZW6A 4PAOA 4M9SA 5FH9A 2ZUDA 1GRNA 1M1YE 2VBCA 1G7SA 1GTVA 3IIKA 2YC2C 1VCMA 3QF7A 2QTFA 4GNKA 3ZVLA 4DIEA 4OL0A 4Q19A 5GVRA 3FYHA 4POAA 3TK1A 4MH0R 3PV0A 1P61B 2ZJZA 4PC3A 2P3SA 1S0UA 3AVOA 1JR3D 1RW4A 4I81A 5FTMA 3NDBB 3UK6A 4U7DA 2BIFA 3KUDA 1UDXA 5DN6A 4IXMA 4TTPA 4AKIA 1AA9A 4LC1A 1Z08A 4TYNA 2Z5FA 4CEJB 1M7GA 4B71A 3LBHA 5KDLA 4I1SA 3GLIE 4M8NE 1COWA 1HTWA 3LA6A 4W7SA 1NVUQ 5EUMA 2O8BB 4KCGA 3BBPA 3OFND 4BZXA 3JVVA 5GJBA 5FOWA 2A5GA 3A4NA 3SR0A 2FSHA 1VG0B 1JAIA 1U0LA 1X6VA 2ZE5A 3AKYA 4QGHA 4CIDA 5EJEA 2BMJA 4JYBA 3I5YA 3AVVA 4Q00A 4BLQA 2ZS9A 4LOAA 1XMJA 4DSUA 1NJGA 3VMFA 4DDWA 1Z47A 2C9CA 3AF1A 3I3SR 1KI4A 3T5GA 2EWVA 1LF0A 4D4KA 1XRJA 2VH5R 1ZUHA 3SYNA 3MWLA 4Q47A 3OF5A 3DM9B 4HB3A 3VR2A 3G5UA 3ZLJA 3NC0C 4TSFA 3U7GA 1HE8B 1VHLA 1BO6A 3ND9A 5IDVA 5KOYA 1D5CA 1FX0B 4ZDJA 3LXXA 2GJKA 4DT1A 4JBYA 2QENA 5EXTA 3VTKA 2XZPA 4KBGA 3R8CA 3QVVA 2J0QA 1EFUA 2AHOA 2ZRKA 2I4IA 2ODEA 4Y0AA 3RHFA 1FP6A 4JT2A 1GRRA 1P2TA 1U99A 1W4AA 3RS2A 3QF4A 3Q9LA 2JJ2D 1N6HA 4JVLA 2CMKA 1A5TA 3KB1A 1M7HA 1YRBA 4RCZA 1JXOA 3WBJA 1KI1A 5CITA 1U9IA 4LV6A 1EESA 2OFXA 3DOEA 2HF8A 3GJXC 3VX3A 4QHYA 4AK9A 2PH1A 4DSOA 3LBNA 4Q4AA 4CEIA 4RZ2A 4EKDA 2ZJYA 521PA 1Z0KA 5EZ5A 4LI0A 3THXA 2V3CC 1JQLB 4A2QA 1A82A 1IOZA 1J8YF 4OK5A 4OHWA 3ZJYA 2DWPA 4AD8A 1XPOA 2O0HA 3EPHA 1J2JA 3TVDA 1XMSA 2IBMA 3MJHA 3PIRA 3R9XA 4XD7A 2QMUA 2NGRA 4Q4LA 1II0A 4X8HA 1LW7A 3LDAA 1WXQA 1S2MA 4MRVA 3RDPA 1FPMA 4CZ2A 4WAUA 2W6ID 3AQ4A 4ZO4A 4A2WA 2ZJOA 1WQ1R 5GJCA 3RWMB 2A78A 2OUKA 5EUQB 1Q22A 2ZI9A 1FNMA 4MKHA 1E0SA 1Z6TA 4OYHA 5FUWA 3DM5A 4LJAA 3KQUA 5H70A 3IQWA 1B0UA 1G7RA 1KZ7B 2IYUA 5FPTA 3UWKA 3VU9B 4U00A 1LS1A 4KBFA 1E2FA 1SZPA 4ILEA 3SHFA 2HT1A 1CEEA 1XFAA 1SVWA 5D3MA 2EYQA 1OHHD 4Q9JA 3MAAC 2E87A 2QGNA 5IHPA 5JRJA 3HU3A 1VPLA 1TQ2A 2W0MA 1UF9A 1ZBDA 4URZR 2NZJA 3A8TA 4XOIA 1Z0IA 3MUFA 3GCGA 1DARA 1GNPA 2F9LA 2JLUA 4OK3A 2JEOA 5FTJA 3ZD6A 4FN5A 4CDGA 2W58A 5CK5A 3FKSA 1ODFA 3L8ZA 2PMKA 2WKPA 4FMDF 2WTUA 1G3IA 1UM8A 1NP6A 2QT1A 4DRZA 2DY1A 4F92B 4UNRA 1LV7A 1XZPA 4AG5A 3KKQA 2DWOA 5LDDC 5FOTA 1CLUA 2A30A 3EWAA 4Q1BA 4URYR 5KTYA 2PEZA 3OEED 3U6KA 4BFXA 1QBKC 2RGNA 3AVUA 3W9YA 4QGFA 2KWIA 1NVWQ 1YRAA 2P0EA 2PZGA 4WXRA 3VKHA 1PZNA 4IXNA 2AD5A 4WA7A 5DHFA 2GVZC 2PCJA 2ZJAA 5CM9C 1ZJ6A 2C04A 1J7KA 1S1MA 1W5SA 4MYCA 3DDCA 4A0RA 3R8FA 3X1ZA 1E2GA 2CNWA 1W4CA 3T5DA 3AVYA 2D62A 4PC1A 4YXWA 5KO2A 4BUJA 3GD7A 2GXUA 2EYUA 2J7PD 2IA5A 4WZ6A 4BEBA 2VO1A 1NMXA 1G5RA 1WF3A 4IDNA 3AKDA 1YR8A 4JJKA 4DT1B 3RYTC 5AUNB 2G6BA 2D06A 3PUXA 4AKGA 2QGZA 4C0KA 1MRSA 5DGXA 1UBEA 1VECA 2BEKA 2BDTA 2NO1A 2ZRAA 3QF4B 3TBKA 1VG1A 2QPTA 3HR7A 3CWZA 4JJZA 2HT6A 4GBMA 5JBQA 2Q9CA 2OLJA 2QPOA 3LXRA 2P5SA 3CRVA 1N6IA 5DI9A 5FBRB 2B6HA 1O87A 1J70A 3LBIA 1UKVY 1WBBA 1YZTA 2VA8A 2VHUA 2JLWA 4Q4AB 3TAHA 4CEIB 4EFLA 4A36A 1KMHA 3ZYCA 2UZ3A 1CJTC 3EPJA 1R2QA 4AIIA 3THXB 2W2XA 3QXHA 4MRPA 1MKYA 4AG6A 3JVUA 4B6EA 1C9KA 3FMFA 1TEXA 3AEZA 3AF3A 4DLYA 2O8DA 1DG1G 2IYLD 3HPQA 2WJVA 1NG1A 2ZI6A 5EP3A 5E7IA 2G0TA 3RLFA 2XEXA 4B73A 3OEHD 4DLVA 1R5OA 2QG6A 2HLDA 2V6JA 4N0DA 4PFSA 2GCPA 4JIMA 3U7EB 1U0HC 4MQBA 4NYJR 2OFOA 3KJEA 3VR6A 4EAQA 1NY6A 3U61B 2E9SA 4CEHA 4A9AA 2VHCA 3FE2A 2IT1A 5HE9A 3V9PA 1JR3E 2CLCX 2J46A 3CRW1 1NVXQ 2ONKA 3GLGE 1BH2A 3HYTA 4R2HA 4I1OA 1LVGA 5JWRA 1Q1ZA 2OILA 1E2QA 4URVR 5JSZA 2F43B 1P72A 4KVGA 1KNQA 1X86B 3D31A 3ADKA 4TLEA 2WKQA 1Q1QA 3R7WB 4LDJA 4MDFA 4B3BA 4ZPXA 1QHYA 3O8CA 5G3ZA 4XWKA 1OV4A 1KO5A 4Q5IA 2ZI7A 4B2IA 1P2VA 3U3OA 5L3SA 5A4JA 4LHWA 1G21E 2F6RA 4JKYA 4NU0A 4TYPA 3LY5A 1XXHA 4BE7B 3WYGA 1BMFA 2YC4C 4Q1EA 4GDFA 1P2UA 1N6PA 2ZR0A 1IAQA 5E3HA 3ZQJA 2IYTA 5FPKA 4PZZA 1KI6A 5F9HA 2H16A 3EIQA 3EZ6A 1QHNA 4NPHA 3SJAA 4Q48A 5FTLA 1OYWA 4DLRA 3K0CA 2QMOA 2KJQA 2ZSAA 4EQ6A 1F2UA 2N46A 2OT3B 4NCKA 4B2PA 3CZPA 3PUYA 3P26A 1XMVA 4G5QA 4TLBA 2WM9B 3KJGA 4M53A 2GJ8A 4ZI2A 2ZS7A 4EFMA 4Z51A 2IX3A 1P5ZB 1MR3F 3KZ1E 1IBRA 2IF2A 2MMCA 1GKYA 4OHXA 1GM5A 4HEJA 4RZ3A 1PUIA 1GDDA 2YINC 1L4UA 1TTTA 1D2EA 4A15A 2BM1A 5DI3A 4UXJA 1H8HA 4FMBB 4GSYA 4OKSA 3C8UA 1XDBA 4HAVA 4Q7JB 2F7SA 5LD2C 3FTQA 1EGAA 4QFMA 2CVHA 5HKKD 3CONA 1KGDA 4C4PA 1RE0A 1P6XA 4KAXA 4Q03A 1IXSB 3QXCA 5B2ZA 3BB3A 5FI0B 3BERA 4TMVA 5J47A 4LX0A 2OCYC 3ECCA 4X8MA 5HCNA 1E99A 3BFKA 2ZE8A 1D2NA 1IXZA 2D2EA 5JJLA 4QM7A 4PO1A 2QY9A 5EZ6B 1W4BA 4Q66C 1XD2A 1TUIA 4TYQA 1DAFA 3NEYA 5CDFA 5K8IA 2EVWX 2AD1A 2QNRA 1UKZA 3C16C 4DJTA 2KSQA 2ZJ8A 4OHZA 2QAGC 1K5GA 2V4ZA 4FMDB 4XIGS 5IK2A 3RANA 1KMHB 5AJXA 2WJIA 2D3WA 2X8AA 3C5HA 5CK4A 1OIWA 2QMEA 2C77A 2C99A 2JJ8A 1R8SA 1ZNZA 3AP2A 4NDZA 3X1YA 4ABYA 1VCOA 3VHXA 1KDOA 2NZ8A 4BGDA 4I1VA 2O8DB 1OLOA 1SXJA 4R98A 1G20E 1SKYB 1AS3A 3NH6A 3KQLA 1R0ZA 2OXRA 4LPKA 4DDTA 2XSZD 4JLMA 3GJ3A 2V7QD 5AK0A 2NOAA 4HI0E 5HCIA 4Q1CA 2IUTA 5FOSA 2ZUBA 4BPBA 2OLKA 2WVJA 3MCAA 4QGGA 5FL3A 2YV5A 2RCNA 1OB2A 4B2LA 3EZ2A 3L82B 2C9YA 4MGIR 3SS8A 3U3JA 4ESVA 1FW6A 4TTRA 4KV9A 3WNDA 2FPMA 4IEIA 4Q1AA 4HAYA 1UKEA 3FHCB 4OJQA 3EASA 4LCBA 2CE7A 3SE0A 2FFBA 1RPZA 5JSZB 4LWZA 3GPLA 1MOZA 2WIBA 5JCZA 3A1WA 4UKDA 3SQWA 2ZU0C 4OI0A 4D25A 2VF8A 3K9LA 3CX6A 1QHHA 3WRYC 1NY5A 5CM8B 4PAMA 5CJ2A 1XD9A 2PEYA 4HZIA 1ZVQA 3ADDA 1R5BA 2BV3A 1OSNA 2REOA 5L3SB 1CIPA 1W36B 1TAGA 1NKSA 1XXHB 4B3CA 5K8LA 4KODA 2VP4A 3NBXX 2F55A 3DKVA 4V0MA 2CK3A 4QJ3A 2R65A 1E2DA 4LK2A 5H1YA 2R6FA 4AI6A 3U3MA 1P4SA 2ZYWX 3BK7A 1KI6B 2FFQA 4Z8XA 1GKUB 2XNDD 1JEEA 4GP6A 4LJ6A 2ZR9A 2Z0MA 2HDNB 3B1ZA 4EQ6B 1F2UB 4GZMA 2KB0A 1NN3A 2A2ZA 2WICA 4LBWA 2BEJA 1JB1A 1P9RA 1XPUA 5JCPA 5JJIA 5DO9A 2EWWA 1G8HA 1S9DA 2FEMA 1DG3A 3Q85A 1P62B 2VP9A 2BHRA 1BKDR 1HEIA 5FPSA 2JCSA 2AWOA 1M74A 5F3WB 4M9XA 1NG9A 1T3HA 3LH5A 3CUEF 3OESA 1UFQA 3ZIAA 1N6LA 4ACAA 1CBUA 5K8TA 2W00A 2OCPA 1LB1B 1KDRA 5DI3B 4Q01A 2GJAA 1RYHA 4JVNA 2ZETA 4M0LA 2YOHA 2Z4SA 4AYWA 4MUAA 4PHGA 1XEWY 1BS1A 4B3XA 4V0KA 2YWHA 2XOKD 2DFLA 3A4LA 4EPTA 4HB0A 1DOAA 3U7HB 4M2LA 1U2RA 3KXLA 4CEJA 2W6JA 3QXXA 1KYIA 4G3XA 5FTNA 1XD2B 2VHTA 4LV5B 1G8GA 4TL9A 2ZI4A 2CL7X 1P3JA 1HURA 1R10A 1X8LA 3AUXA 3AVXA 4LJYA 2NPFA 3NIBA 2D4HA 2VSOA 2IYZA 1L8QA 2WPDA 2PX3A 1UBCA 1MRNA 4UNQA 1L7VC 5JLJA 2JDIA 3CF6R 1EXMA 2Q9BA 1IQPA 4PPNA 2XX3A 4YMVA 1GVNB 4NTZA 1XTQA 2ASEA 4JLBA 2I1QA 1HV8A 4JS0A 4KFRA 4DXAA 1KJWA 4C0QC 1GKIA 4JZKA 3RC8A 1SXJB 3OHMA 3T35A 3ZDQA 3BH6A 1XBTA 1N5LA 1FX0A 2ZRHA 2N42A 4C7OA 1DO0A 5DN6D 2FNAA 4TT3A 4BZQA 3HR8A 1WBDA 4BFZA 2P5TB 1U94A 2FMXA 1DVRA 2RHMA 1T3LA 1TEVA 3LVQE 1TX4B 3NBYC 3W5JA 1COWD 3KKOA 2LWIA 3BH7A 2CXXA 1GRQA 3NKVA 3CX7A 1LY1A 4LJ5A 1KO8A 5FPHA 1S96A 3K0FA 3A1SA 1OB5A 3LW8A 4YLGA 3QKRA 2GK7A 3OE7A 2ZE7A 4DKXA 2PZEA 4IOKA 5DHAA 3REGA 3VAAA 4Z54A 4GMDA 4IOMA 2IEZA 1DE0A 5HZKA 4DC9A 4Q7MB 2XTMA 2EFHB 1W7AA 4JLNA 3GLFA 3X1XA 3ZQ6A 4PC7A 2CCKA 1P2SA 5HPYB 1QHHB 4D0NA 2X19A 3GJ8A 4TSFD 3ZD7A 3TSWA 3PENA 2QTVB 1KI7A 1AGPA 1TF5A 3LQQA 4LYJA 4U5XA 3WY9A 3CPEA 5KNDA 1AGRA 2BMFA 4WXPA 1ZU4A 4RCYA 3SFVA 2HJGA 1E9RA 4RY2A 2ZS8A 2JATA 4AURA 2H8KA 3RRZA 1R0YA 2QSYA 2V8OA 2EW1A 2W0SA 3NBZC 3SDZA 1TMKA 3V00A 3NHAA 2JJ1A 1ZD9A 2OV2A 2ODBA 4QC2A 5DLQC 4IW3B 5FL7A 3IHWA 2J3EA 1B23P 4DDVA 2BJWA 3P1JA 1OIXA 2YNMA 3SJCA 2PJRA 4WZAE 1D8TA 2FX3A 4KITB 4BECA 1N5KA 4CYMA 2IHBA 3KFXA 3W6PA 3T61A 4HATA 1QHIA 4TLDA 4L9SA 1Z07A 3VR5A 2GJSA 1E2NA 2ANBA 3IDQA 3ONWA 1LS6A 1NN0A 1SQ5A 5JZVA 2H18A 1PVOA 2WOOA 4A4DA 1SVIA 4LJ9A 1R6BX 3ADBA 5J40A 1YZLA 4OBEA 3W6NA 5AUPB 5KPJA 4XD7D 4QG7A 2J45A 3MFYA 1KI3A 5FUVA 3DO6A 3AB3A 3PEVA 4DBLC 1T3SA 5KDDA 1YZNA 3FGNA 2MSCB 1XWIA 3EPLA 4X8OA 1Y63A 2CCJA 1JECA 4NMMA 2IUSA 1VG8A 3B8HA 3W8NA 1DEKA 2NTYC 1Z2AA 4TL6A 5TXGA 2C9OA 3TMKA 2D2FA 2AXPA 3BS4A 2H5EA 2ERYA 4JLJA 5ELXA 3BIFA 1KO1A 1Q0UA 1RIFA 2ZTSA 3UMRA 3HWSA 4GOXA 1G17A 3I8SA 3SZRA 1WDTA 4M9QA 5JHGB 1UPTA 3B9QA 3C15C 4PTLA 1OXVA 1MABA 5LB2A 2VEDA 2O8FA 4YDSA 1OXXK 2GTPA 2P6RA 3WMGA 4IDOA 1U8AA 4M1YA 1E32A 4OI2A 4D0LB 2WMNB 2OE2A 4PZLA 5BQ5A 2D7CA 4G01B 5AJWA 5E7JA 1OFIA 3V4RA 3BAFA 4BFSA 2H92A 3VFDA 3KQHA 3LWNA 4CF7A 2YOGA 1G7TA 2QQEA 2R2AA 4PSKA 4KFTA 1J99A 4W5HA 1NRJB 4N1AA 1PLLA 2Q3MA 3FKSD 5LBIA 2ZXUA 5G41A 3G82C 3OIYA 4M1WA 5EXPA 3JZMA 1XX6A 2AK3A 4G5OA 1CR4A 3W6OA 1A1VA 5JS7A 2GAOA 2WWGA 3P4XA 1IJEA 3CF2A 4C7OB 1E2EA 1KI8A 5EE9A 1N6NA 2GCNA 4KSBA 4ARZA 4A6XA 1ZC4A 4JVMA 3TGPA 1AK2A 2DFNA 3WMFA 3VKGA 2ZROA 2BBOA 1W36C 3KKMA 1U8ZA 4M1SA 2GZAA 3IHLA 4YC7A 2WKRA 2RMKA 821PA 4OQLA 4Q21A 3K0FB 3QEJA 3WYFA 4GP7A 5BN3A 4PHFA 1ZRHA 3BB4A 3EARA 3QKRB 4MYTA 4TMZA 1RYFA 4EDHA 4RD2A 2E1RA 4IVPA 3UG6A 1M6NA 2IS6A 3QNUA 1GSIA 3K0CC 4KU4A 2CNWD 3U3RA 3GLFB 4QJ5A 4YXWD 3CIOA 1UJ2A 2ORIA 3H0KA 4PX9A 5KSOA 1Z0JA 4DVGA 3GLFE 2G1KA 4Z1MA 3SN6A 1Z8FA 3CO5A 4OK6A 1E9SA 2J7KA 4XSGA 2R6AA 4BFYA 3RRNA 3K09A 4JLVA 4LHYA 3I5XA 3VHLB 1I4DD 1FMJA 4NYMQ 2FFAA 1G291 4Q02A 1KAGA 4II7A 1X8JA 2W2TA 1O3YA 1US8B 4RJLA 3GJ6A 3CW2A 5J4LA 5TB5A 1OKKA 4D4MA 3NEJA 2OFWA 3CR8A 2B21A 4JL6A 2ZREA 1II8A 3KQNA 5DYGA 3PCRB 4OQFA 1EX6A 3BGWA 2XZOA 3K53A 2OO7A 4E5UA 3NG1A 2C5LA 3BE4A 3CRRA 4TMKA 2ZI5A 2B8TA 2F43A 1NJFA 1SHZA 1DS6A 3U3KA 1V5WA 5B57C 1OXUA 3AVWA 2QP4A 4L5BA 3K1JA 5E95A 3R7WA 3PR1A 3FB4A 1QG4A 4LV8B 1GFIA 4TMTA 2AFIE 5JWHA 1XCMA 3TH5A 3VR1A 5GVSA 3CRQA 2C95A 2OBNA 3W5IA 1E4VA 1J90A 4LPSA 2J87A 2ZANA 5EP1A 2WIAA 3AVTA 2HLDD 5B30A 2ZRBA 3KFVA 4TLAA 1QRAA 3I32A 3A4MA 1FUUA 5GJVC 3SI7A 2GEDA 2O8EA 5KSPA 4CRWB 3GEHA 3E2IA 4E03A 4ITRC 4WW0A 3SBDA 3SC3A 1SXJC 1F3OA 2FN4A 1Q1BA 3GLHA 1JPNA 4LY6A 4HB2A 5KSYA 3T34A 4TYWA 4LHZA 3BWDD 2O8FB 3TQCA 1MABB 4WBSA 3BH0A 4PPFA 3TSOA 3GJ5A 1G8YA 2LCFA 1N0VC 2XZLA 1W1WA 4ESHA 2R6GA 2BKEA 2FEOA 1QDEA 3BB1A 4US0R 4MGYR 5KYKA 4B75A 2ZR7A 3N70A 3EZFA 4W5JA 1Z6AA 2NIPA 1W36D 1E2HA 4R2IA 2GK6A 1RRPA 1BMFD 2PZFA 1N0UA 3EZ9A 3RS4A 4UJ3A 4F7WA 4H9GA 5DNYB 1OW3B 4LJ4A 3EIEA 1DAEA 4M9ZA 4ERNA 5BW8A 4Q9HA 3TLXA 2OCBA 3D8BA 2QEQA 2XB4A 3PUZA 2B8WA 3PXGA 1GP2A 2WMOB 4A8JA 1XEWX 3P4YA 3FHTA 4ARZB 5BYKA 2BMDA 3WXMA 2G0NA 1WRBA 5JRZA 2YWEA 1NNEA 5FBWB 4EPWA 2ZSFA 3AM1A 1AJEA 1OXSC 2RGGA 3EWSA 3UMSA 1NF3A 4DHEA 4RFSA 3GQBA 4RD3A 4F4CA 4IFEA 2KI5A 4RSGA 1FQKA 1P73A 1KI9A 1F2TA 2BKUA 5E7MA 2O0JA 1XPRA 2XAUA 5H68A 3THOA 1DAHA 3N5CA 4S35A 4KFSA 4B3GA 2Z43A 1YHNA 3A36A 4M1TA 4TTQA 2C03A 1E79A 4LYFA 2FGKA 2ZJ2A 2F3TA 4NCHA 5BXQC 3QOFA 2GWHA 1H8HD 2XJ9A 1IM2A 3NC1C 2ZRDA 3ASYA 2PBRA 4HDOB 1CJUC 1CXZA 3AKEA 2ZEJA 4QJ4A 2XTNA 2Z4RA 5EE1A 1E9AA 3IQXA 1UEIA 5C1BA 1G41A 3C4JA 5D3QA 4F93B 3U7FB 4A6PA 2BBWA 2ZYUX 1AZSC 2QU8A 4GT1A 2XTZA 1CTQA 3C5CA 2XNSA 1II8B 1ZD8A 2GHIA 3L0PA 3QI2A 3UWOA 4HLQB 6Q21A 3AVPA 2CLSA 3KJIA 3GJ4A 3TR5A 4GMXA 3W8RA 2OM2A 1S3GA 2GJ9A 4DLUA 5G40A 1E0JA 5IK2D 1XTIA 1E1RA 1FTSA 4B34A 2HXYA 2ZRFA 1XB2A 1KDTA 2YYZA 1H65A 3QXSA 1VTKA 4QHSA 4TMWA 1EFRA 1Z29A 4PHHA 4BZPA 1PJRA 8OHMA 3VNUA 2ZIAA 4JLPA 3ND8A 121PA 4GL2A 1W4RA 4RVCA 1M2OB 5DSZA 3ZVMA 3HJNA 5CYPA 1SXJD 2OAP1 2ZPTX 4B47A 2Q3FA 1XTJA 3QJYA 1DAKA 3CNNA 2R44A 3N2IA 4DWJA 2WHXA 4ZCLA 2QRZA 3IEVA 1D6JA 1UBGA 4G5RA 4JVSB 3KTAA 3R9IA 3OZXA 2O8EB 2C98A 2JGNA 3THYA 4U02A 3DZ8A 1Q1EA 3QG5A 3C14C 4HAUA 4JSYA 1E98A 5DH9A 3WNBA 1Z06A 5JEEA 2ECKA 1KY3A 1GL7A 2FPLA 2P6NA 1J8MF 1GITA 5J4KA 2ZRMA 2EFCB 3GLHB 4URXR 2VP0A 2OESA 1FP7A 3IILA 1VIYA 1MT0A 1XU4A 1G5TA 2FF7A 4G0NA 5KUTA 2KBEA 3H2YA 1G3UA 1KK2A 3RC3A 4AKEA 2QROA 1NBMA 3DMNA 5L3RA 4A0HA 1SVSA 2VYFA 5CIQA 1PLKA 1UKYA 4ZDKA 3B78A 4R7ZA 3FMOB 2MSEB 2Q3HA 3C7KA 2RAPA 1VYUA 1AZTA 1MO6A 3QUSA 3LNCA 1YR7A 2UVQA 3LW7A 4FCVA 2CK3D 1E3MA 3B9PA 3SOPA 1M34E 1KJZA 2X2EA 1GNRA 1Z28A 4IEEA 2OBLA 1DAIA 1NL3A 3QBTA 4HUQA 3CNLA 3O47A 4TZ6A 4A8JB 3BOSA 1TQ4A 1PV4A 4PC2A 4RD1A 1QHGA 2FPKA 3THWA 1XEXA 4C2TA 2GRJA 3GJ0A 4RFSB 2JASA 1E94E 2JLSA 1GL6A 2VIIA 1VYTA 4NCIA 3KB2A 1F2TB 1Q57A 1G9XA 1XEFA 4OQMA 4G5GA 1T4GA 5TV2A 3TR0A 1E2JA 1XZQA 1YKSA 1G18A 5AJZA 1IJFA 2K5UA 3ZIAD 5IF9A 3FKQA 4TQUS 5FOUA 5JHHB 1F6BA 3KX2A 4TYYA 1CF4A 1RRFA 2J9RA 1PLJA 2J0UA 2Y8EA 4BEJA 3DMDA 3J81k 5KNBA 4L4UA 2WWWA 4EJSA 2IW3A 1VIAA 4FWIB 3L43A 1ZM3A 4HSEA 3VR4A 3LO5A 1SKYE 1N5IA 5FTKA 1UBFA 5F2EA 4EUNA 1JI0A 3SQXA 1QHXA 2W6JD 3B1WA 3MGCA 4UNNA 1TUEA 1NI3A 2ZVQX 2HF9A 1DAGA 4HAWA 3MLEA 4HLCA 3QXJA 1KO7A 3B6EA 2GBLA 4HDCA 1KIMA 4Q7KA 1HT2E 4WIAA 4YMWA 2WPDD 3T12A 4F38A 2OAQ1 4NZYA 2WWIA 1N5JA 1BIFA 5AUOB 4ZI3A 4ZV4A 2JDID 1EWQA 3D3QA 1R7RA 1QG2A 3I72A 4PQRA 2AX4A 3RSOA 1E9CA 1JNYA 4URUR 5EE5B 3ZZ0A 1YZQA 2CJWA 1RRCA 1NN1A 4EPVA 3ICQB 5AUQA 1N6RA 5JS8A 2TMKA 3H1TA 2P6UA 2H1LA 1U8YA 4C3ZA 1Z0AA 3BC1A 3QKUA 4FWTA 4S2EA 3QBVA 1K6MA 4TT3D 2ZYVX 4N0EA 2HCBA 4EFNA 2FJUA 1XJ0A 1LTQA 3MWYW 4GPTA 4LHVA 1XXHE 2ZRGA 2WSSA 3RS0A 1EK0A 3KTAB 3ZS9A 3WP1B 1T9HA 1RFLA 4RZUA 3U44B 1CR0A 4C0JA 3THYB 4V03A 1R0WA 4E09A 2DB3A 1NVVQ 1TF7A 1UEJA 4MUBA 2YVUA 2O0KA 2DBYA 2GCOA 4Q18A 5EQTA 2VSFA 4QBFA 1ETUA 4KYUA 2IXGA 2OHFA 3OE7D 4O2LA 3T1VA 4Y0VA 5FFMA 1K5DA 2FV8A 4OHVA 2AFHE 2XB2A 3W3ZB 1HUQA 4WZBE 1KKMA 2FE4A 2IK8A 4YMUA 4LSGA 4QRHA 3GJ7A 2NPIA 1W5TA 1YQTA 2ZRLA 2PT5A 2W2VA 1Z2CA 2OSBA 1Z0FA 2ODNA 3RWOA 4J0QA 1FUKA 2JLVA 3LX8A 4MKGA 2BM0A 1NBME 1U9IC 1WCV1 3I4LA 3QENA 4KLZA 5SZHB 3OIVA 2IYQA 2ZSBA 4PXAA 2RH5A 2RGDA 3EZ7A 5FBVB 1IN6A 2IYSA 4JLOA 4YDHB 5A5GA 2XXAB 3EIHA 2JJ1D 1OH6A 4Q9LA 4X8LA 1W46A 5FL7D 2YJTD 3M4YA 2NO6A 2KE5A 5TARA 4HUQB 4YMSA 2ZVPX 3VR3A 4ASUA 1CKEA 2IYVA 3K09C 2HUPA 4US2R 1XTKA 2P67A 2ZM5A 4RZXA 3THWB 5TY0A 3MRSA 1XEXB 1UADA 1T8UA 3SJBA 3FFAA 2VQSA 2WAXA 4AY2A 2WSMA 2GZDA
chains in the Genus database with same CATH superfamily
1LNZA 4LYAA 1U02A 4Q9IA 2XV1A 3GFVA 3IC5A 3V32A 4O0MA 1GSHA 4E07A 2Y2VA 4ZIRA 4GR9A 1XRRA 2DHEA 4JBHA 1MAUA 3LT5A 4XJXA 1RRKA 4BNZA 3M5CA 1LPBB 5B1SA 1M5RA 4Z8YA 5LC1A 2GPWA 4C0HA 4KAAA 4M9RA 4ZVNA 3UATA 3TLCA 4Z7JA 1FJXA 3AI2A 1BOFA 4GUDA 4TZ0A 1GUBA 1JXMA 4YY3B 1E1CA 1WB4A 3U4QA 1V25A 4FXPA 5C4GB 2JFBA 2XYRA 2ZLBA 3O9MA 5ALKA 3O2NA 4B33A 4QIHA 4E7OA 3GLIA 1E2BA 1Y4ZA 4WCFB 4DSNA 3M1AA 1T5HX 3AY7A 3I05A 2NU8B 4DWOA 1E6WA 2GNAA 2AVDA 2OHGA 4G26A 2Q1YA 2X8JA 2HRZA 3AGPA 4YMIA 3TQFA 5K9ZA 5KWIA 2FDCA 4X1KB 4BVHA 1CDZA 1T5IA 2BF4A 1MF7A 2GRAA 3F2IA 4KLAA 1E7SA 1LNSA 5BQ3A 3E9EA 1EFVA 1Z4PX 1NVAA 2YDXA 3I1FA 4Q6WA 621PA 1U2GA 5DEOA 3DOIA 2Q6IA 3AEQA 2I55A 2QMHA 1A96A 1MOPA 1Q3TA 2EQAA 2PLWA 1M0TA 1LC3A 1T8TA 1YMUA 4C7MA 1RJ9A 2O52A 3I58A 4O4IA 1YR6A 3CVVA 4JBWA 2XPCA 4BO2A 4HJRA 4MITA 4Z2AA 5BV2P 2CFOA 4H1VA 5DVZA 4BBPA 1BEEA 4C06A 3OZUA 1J9ZA 4LJSA 1DLIA 3RC9A 1O8CA 2WB4A 3GLUA 2PJZA 3DXFA 3L0SA 2F4NA 2G88A 1HNXB 1BXRB 3INYA 3OPYI 3UWPA 1DT5A 4LXXA 4MRRA 3D1VA 3PXBA 4DUYB 5DF1A 4M1ZA 1M0SA 2Y1EA 4JHLA 4BV2A 1EKXA 1AZWA 2JGIA 4KGDA 1NU6A 3OCCA 1IN8A 5KNCA 4M54A 4L0DA 1YZFA 4B1FA 3QEKA 3SX4A 4ZYZA 3SC6A 2H63A 4ZQGA 2EG5A 1YVEI 3Q88A 4WFIA 2WFLA 4OA8A 3AC0A 2ZUSA 3IEUA 5A04A 2ZRJA 3AR6A 3AWDA 3LVRE 4C08A 7YASA 5FUQA 1U8XX 3WGHA 1EE9A 3AFOA 4FI3C 4FW9A 1ECLA 4DEXA 4E12A 3TUZC 1US8A 2NQTA 2ZTVA 3O2JA 4I50A 4LXUA 3O31A 4G1EB 4V0ME 1EFLA 3VYVA 5P21A 4WDQA 2H08A 3H9QA 4L9AA 5ALSA 4D4LA 1I13A 2IITA 4JH0A 2P2NA 3B48A 3R3XA 2OA0A 1PFUA 2O5VA 3TN7A 5JECA 5JHHB 1BA2A 3C3YA 4E1BA 1Q5PA 3HSYA 1JDJA 3DMYA 1DO2A 1EZ4A 1GYRA 3DE5X 4HDKB 1GTSA 3L1IA 3VOAA 2WF9A 1EM8A 5DNVA 2O57A 3JW8A 4NV1A 1O57A 4H7EA 2BCEA 3OQPA 4Q05A 4P34A 4RJKA 3QI7A 4EG6A 2YHIB 4BN4A 3PPVA 5J3JA 4IEFB 2X6TA 1ZOLA 1YNSA 2XUAA 2HJRA 3QVUA 5BSTA 1EUZA 3QFHA 4Z1MD 5LXTA 1QO7A 2GDZA 4NXNB 4B76A 4F4UA 2QI9C 1E2PA 3JV7A 1F4PA 1JG2A 3K35A 4GGPA 3VI3B 4ZZIA 3WKBA 5CFPA 8ATCA 3BL8A 3FPKA 1ZOSA 2BPOA 1K63A 3OURA 1PUXA 2P5UA 1UK6A 2JAQA 2QAGA 4KWCA 1SVUA 4MO9A 4MGKR 4PR0A 1PGOA 2QL7A 2Q3LA 3ZCTA 2Q2QA 5FDFA 3G0HA 2ZVDA 1M6VB 2GF0A 1A88A 3UAYA 4C01A 3DP7A 1FQOA 1W2HA 1VCNA 2KX7A 3ZOZA 5FADA 3ZTWA 2C78A 5LA6A 4QQFA 4DG5A 1XAJA 5DHQA 4A82A 1Z17A 4DQUA 2DR2A 3O8QA 1Q0SA 5GGXA 3UT5B 1SOAA 4UEQA 1WPQA 3T5AA 1ENZA 2ZRPA 2OBYA 1T4CB 5EJ4A 4W6ZA 1TAUA 5BUSA 2QBYB 3H84A 4IF6A 5B53A 2FOLA 2X77A 1DC6A 1SC6A 2Q3BA 3MCWA 4MQLA 5AW6A 4CKCA 2VAWA 4RH1A 2JH9A 4CF4A 5I9MA 3LY7A 4B3HA 4ZC8A 2FZ4A 5EL0A 4OXXA 5BR4A 2OPHA 1P7PA 1Y9EA 2GZMA 2VT7A 1NLZA 2BLLA 3CZRA 1L8XA 5AWFC 2EW2A 3GGDA 1X2BA 1RWMA 4B44A 5AI9A 3BTSA 4NJMA 4XVQA 2I7VA 4F91B 5FBLB 1HNZB 3PGXA 3BXGA 1XZIA 3BPSA 2VJBA 1JPUA 4PGHA 1FDIA 3SU8A 2VXOA 3AUSA 2B3DA 3B3JA 5B4VA 1J22A 3LOUA 2PM8A 3EDCA 4G65A 2N1BA 5L7TA 3F0TA 2FOXA 4OYYA 3FOAA 1P0CA 1G4HA 2I6TA 4LXYA 3PRKE 1USWA 4HDQB 2HK8A 5FNVA 4V02A 1Z88A 1E5DA 4NCJA 5L3ZA 1E3WB 4PYJA 2K2WA 3I76A 2I3BA 5L3QB 1H6BA 3ZGZA 1UJNA 1N6OA 1WE2A 2YWRA 4FR5A 3WO0A 2LIVA 4YPVA 2EXXA 5JARA 3AL3A 3U5ZB 4CV1A 1NV8A 1P33A 3IIMA 5EHIA 5EMJA 5CIWA 8AT1A 1CDDA 3R3SA 1Z5OA 4J7CA 4UCXA 2PUAA 1KVRA 2WC1A 3O83A 1EVIA 1KOLA 3L6BA 4B6RA 2CL6X 4FX5A 1THZA 4JUCA 3Q7IA 2XQFA 5ALIA 3SQOA 3UFXB 4ARCA 2ET6A 1DBVO 1X87A 2VJCA 2ZWPA 4MR8A 1MB0A 5I7VA 3JAWA 3NV7A 3EMVA 4QDZA 3WSWA 5E1DA 3T8YA 1QFZA 3T1QA 3PXXA 1CS4C 3LS2A 2VJKA 2ONJA 5J2TB 3E70C 3EIOA 4EVIA 2IW1A 1JAHA 1A95A 4L15A 3TL2A 4DB4A 3F1KA 3PUVA 4BFVA 4N3NA 3GPIA 4QQ8A 2PT7A 2BR4A 2WVAA 4B32A 1U6JA 4AY5A 1LJUA 3WYAA 3TM4A 2OQRA 4UOZA 3FD8A 1MIOA 3RFTA 5EA2A 3LF1A 5E4YA 1CSEE 3E0XA 4FFWA 3S0JA 1MEJA 5EQDA 1Y5MA 3AF4A 5K6AC 4TV8F 1YZ3A 4FW8A 3V55A 2NUTB 5AKIA 2AUMA 2ZCVA 4Y2JA 4AZ3B 4FD2A 1KP9A 2C20A 5LP6A 1Q7CA 3TJRA 2IV3A 3QEOA 3B6IA 4NYMR 4EA6A 3RUPA 3A4IA 3E1GA 5E2AA 3DWIA 4HAXA 1E1DA 3CF0A 4FGZA 5BOSB 1PT9A 4B7AA 2ZJBA 1XU7A 2ZTHA 3HE3A 3KKKA 1R9JA 4HVAA 3OLZA 1T0UA 4TUYF 1H2FA 4MAAA 1XKQA 1VE1A 3PE4A 2O2DA 2JIQA 2WIGA 3AG6A 4GO1A 4JOBA 4MI9A 5CT5A 2XGJA 3RK0A 4MOWA 1JTEA 4II2A 5IRCD 4PPGA 3IBGA 3ICOA 3W3AA 3PNBA 3FDZB 2LBPA 3HN6A 4JU9A 5KREA 1WB5A 1KK3A 3L8YA 2AGVA 3SCZA 4C7VA 2C8VA 1E79D 5J5CA 5AVUA 1HT1E 1PG5A 2NXJA 4FMCF 2O2GA 4I5FA 4UBLA 4O4LA 5ECDA 5LZ4A 4PZYA 3NUQA 3MB8A 5BQXA 4FOOA 3PEFA 2BWJA 1IY1A 2W22A 4FSHA 4C87A 5F4ZA 3RC1A 3UV3A 1NMSA 4QUGA 4CWAA 1N1GA 5LIPA 2UU9B 2CXSA 1F5NA 3N0XA 2IIPA 2ODAA 3V4OA 3LRPA 4LFBB 2YX1A 3F46A 4G41A 3HU2A 2R1TB 4H3HB 1U1IA 4KAFA 5BO5A 2FDRA 1QGZA 3OI7A 3GVXA 1QHSA 3H6HA 1BHJA 1SQGA 3OFNA 2Z3VA 1ZUNB 3HPRA 4H08A 5CDHA 4DLPA 1SHJA 3HBFA 1DFGA 3P97A 3I2IA 3IT2A 4PYRA 3CZ9A 4XM2A 4K26A 2OEPA 1NMQA 1TKAA 2WUGA 3EG5A 1BVRA 5B3LA 3S2UA 4P0QB 1IZ7A 2ODWA 3LFHA 2O4UX 2PX0A 4YV7A 5TDHA 3QIAA 4I4CA 3F3MA 2ZUEA 1KARA 4LRQA 2IOFA 3F8SA 3D3JA 2R6ZA 4GXTA 3H19A 4XR9A 3TO5A 1E6CA 1A69A 5CB4B 2WJPA 2BEUB 3I9NA 4CJXA 1EFCA 3INTA 5KKCA 2NUBA 3CBQA 2JZCA 5EEHA 1CY1A 3O8DA 3TTWA 1H1TA 1AUQA 4AX8A 5FT9A 3RUDA 4DPLA 1DAMA 3V2UA 4EIWA 4X3PA 5A5EA 2XJ4A 3A9TA 3IVRA 1XJCA 3IV7A 3EPKA 1W94A 3OETA 4EHFA 2JLQA 1IM5A 1NVTA 3GCZA 1TZJA 3O8LA 3WS7A 2F1JA 1QOZA 2OD9A 2PXHA 2UAGA 3EF1A 3CEAA 3NWBA 4FVTA 4GOMD 4RJJA 1RACA 2VL7A 5JNVA 2CJFA 2QRLA 3G5TA 3GH1A 2JA2A 3W0LB 5LQDA 4DV4B 2IKQA 4HYQA 5EWLA 3ZU4A 1GCAA 4BFLA 1TU3A 4EF5A 2ATVA 4F5YA 9MHTA 4RGYA 3SG0A 3TLJA 3IIJA 3SVZA 3I2FA 4ND1A 4HAOA 1R6UA 2C42A 4WOBA 3ODGA 4C0WA 4YWHA 3BBLA 3KXDA 4QXOA 4V0QA 2EOAA 4E5YA 1R12A 4UBJA 1C3XA 2ZWOA 2LCQA 5KNLA 2G06A 1ZK3A 3WKDA 4N6NA 4K9PA 2GA9A 4IDFA 4P33A 5F21A 3B5JA 4D6PA 2WT8A 1ZIPA 3NRJA 1BOOA 1WXDA 2O7RA 2IXFA 3K0EA 1NAHA 4K3UA 3RTDA 4A0GA 3C41J 4MQ5A 5G0TA 2R6CA 4ZO9A 1EFTA 1Z5WA 3IFSA 2FYTA 3OBBA 4HNQA 2FUEA 3U17A 4D8XA 1CNMA 2OORC 4DHWA 5BV7A 1UMDA 3UG7A 5FRDA 2GETA 4RV9A 3UENA 2SHKA 2QTZA 1XRLA 1QC5B 3Q3GE 4TROA 3K9HA 1O2DA 4JYCA 4WASA 4O25A 5G1PA 1TM1E 5HRUA 1C2YA 4EA8A 3ZZTA 3TJZA 1SG0A 5J4YA 5K4HA 3NHUA 1NPYA 1WDKA 1CUJA 3C0KA 3KXPA 5K8UA 4NCIA 1N0WA 5HRAA 2QRNA 2Y4NA 4FIDA 1P75A 3K70C 5C1DA 1Q0LA 2HTFA 3EWIA 4R1PA 3ABZA 1QH0A 5DSTA 2IPLA 4IILA 2B7CA 4GLJA 4L16A 4RKWA 2HMSA 4PN3A 1G8PA 4HKTA 2MCFA 3LX5A 4TRRA 1E3TA 2VEOA 3A2MA 5DBIA 2FTKE 1BWSA 3L7BA 5K0NA 1AZLA 3KT8A 5IJAA 5A4FS 3N2YA 2IYXA 2PIDA 3FROA 4B3DA 2CBGA 1FJ2A 1QVRA 4MW6A 3OZAA 4TM7A 1IXRC 1IULA 3RNOA 2YJZA 1KXJA 2IDJA 3ZU2A 4PQGA 4BQPA 1I80A 3N8GA 1I32A 3EEIA 3LLSA 1KRHA 2V6IA 5CH5A 5E2IA 5E6SB 1CRQA 1FP2A 2UVPB 1CVIA 2HQBA 2XQIA 3OOWA 5AI5A 3ZBQA 1X7XB 1MH9A 4NYJQ 5CNMA 3KM0A 1T9BA 1D2GA 4WDRA 1XTRA 1M83A 3GGCA 3JQRA 3TNYA 3MSXA 3OPVA 3E9ZA 3P71T 1Z18A 3F6EX 3U7QB 1M8PA 5E6RA 4BVFA 3NVAA 3GT0A 4H1UA 1O6FA 4JMPA 2G1JA 1AIPA 2AFVA 2C2ZA 2W2LD 4G5FA 1LBTA 4QARA 4ETWA 5M7EA 1K3FA 2VF4X 1M76A 1QUFA 1XTVA 2HXSA 3O0DA 2IY8A 4KRYA 5A7FA 4OBXA 5F2NA 5ALOA 1G1MA 5A7GA 5ADUS 2B20A 2B69A 1MO3A 3U19A 4X1YB 1S3IA 4FEEA 4RA9B 3PITA 4P80A 3IPAA 1G3MA 5F98A 2C07A 1Y6QA 3V2IA 4DR2B 3UW1A 3EDYA 1T2VA 4M4SA 1USUA 3CHYA 4GOJA 1JMYA 1RCFA 3A6JA 4EL0A 4ZAFA 5DGHA 5ARBA 4CNQA 1IHOA 4PPQA 1E18A 2KW5A 2XGSA 3AQIA 3MWEA 1QVZA 4L02A 4QAJA 4KVAA 5THQA 3D3NA 3GLHE 1DCTA 1A4IA 3ETLA 4MQUA 1M72A 3E23A 3EXAA 1TQ6A 1IH8A 2N0SA 2OC4A 1TNDA 1DJOA 3HI6A 2Q6TA 4UU7A 2IZ1A 3DBHA 3FTPA 3WSVA 1NWCA 5LU9A 2P9QA 4BBZA 2QSUA 3L6DA 2GD6A 3N7TA 2QD3A 4HXFB 2IDZA 1NQ5A 2XUHA 2Z58A 1DUSA 3QUCA 4M83A 1GNSA 3EGXB 3H1PA 4ZT2A 3T1TA 5LZ8A 3A6PC 4Q7LA 3AV0B 3VXKA 4LS3A 4MR7B 4ZT6A 3WLIA 3SEQA 2J3MA 5KQSA 4TQAA 5DZSA 1UPCA 3S2FA 1L7MA 2XXAA 3TZCA 5K0CA 4DMFA 1RQGA 2HSWA 3QPAA 1ORRA 1NW9B 2X4DA 4RWZA 1OI3A 1S8NA 4L8GA 4GOOD 4PIMA 1ANKA 1MGOA 2QT0A 3KWFA 4WVFA 3ESRA 4Y9DA 1FZTA 2C84A 3BRCA 3W4KA 3M5DA 2EDCA 3FDIA 1Z6YA 4PU0A 3C5WP 2VJAA 3JZIA 1CP3A 1J2UA 1GSAA 1K8QA 2PZBA 3A6EA 2HNAA 3TTVA 4D98A 2R5FA 2ZCJA 4CGZA 4DB2A 2R1VB 2BKAA 1S8AA 1QVWA 4QBGB 3AZOA 1YSCA 3BWXA 5LYJB 3HCWA 1LBQA 1OAKA 1TF2A 5KS2A 1UT8A 1WHTA 4LHSA 3TOXA 3AG5A 4ZDWA 4ACBA 1E3SA 3TL6A 3MTQA 1M2FA 3K70D 4BNLA 3QHPA 3LWBA 3MXTA 4TQ9A 4BZZA 5DCLA 3B60A 1H3FA 3GGPA 4LRWA 1ES9A 4MPJA 4IQ0A 5JCOA 2X7HA 1QH1B 2PK3A 3EFOB 1R6XA 2AB0A 3DKIA 4INZA 2QN1A 4X85A 1BVUA 5JMOA 1MP0A 1F1JA 5JOQA 3PEYA 2AN9A 2FA9A 3QKIA 3TUIC 3RYFA 2F8MA 1THGA 2E5FA 2HBQA 2R5WA 3ITEA 4KO3S 5EXEA 4BXOA 1WNTA 3I6QA 3BTVA 2G9RA 2OPBA 2DT8A 3SFZA 3UKDA 2Y93A 3ZHOA 1UDBA 4IRUB 2AXNA 4HJXA 3WK5A 3HL0A 1IY2A 4LNAA 5JVDB 2IP4A 5CCDA 3ZWQA 3ZWWA 5A5DA 5T4BA 1VMDA 1YA8A 2FR8A 2CL5A 3DHVA 4HY3A 3FWZA 4NQRA 1QS0A 4PANA 2MMGA 3VPXA 1T9GS 3B1FA 3E8MA 1L8LA 4IMPA 3KWLA 3RVDA 3RIYA 4J7XA 4Q3LA 1J0XO 1M8KA 2ONYA 4IP0A 3RVBA 4EG4A 3N07A 4NYIQ 3CN7A 4Q34A 5AIBA 5SZIA 2HMWA 3MD0A 4FTWA 4PLZA 1YUNA 4CM8B 2I4NA 2AMJA 2CW5A 1JFSA 1I2BA 2DPXA 1DPFA 5D1HA 5IC6A 3TLKA 3WQRA 2DYKA 2AMFA 3TF5A 2WVGA 1FUIA 1NQXA 3OZWA 4MYUA 2QX7A 4Q1VA 4B83A 2YXEA 1PP4A 3FMIA 3RTCA 1IBLB 5KQRA 1M1NA 1E9FA 2BVNA 4ECAA 4UUBA 1VJGA 5KWSA 3HCPA 4WFQA 2NN3C 1XKLA 4UMEA 4DSTA 3SQMA 1UFKA 3U2QA 3PRYA 4K9LA 5BT9A 2WSLA 5MDHA 1C9JA 4KP7A 2MR5A 3NCHA 1M7BA 2HB6A 1CDOA 4C03A 4CEHB 4G9EA 3X1WA 2EFEB 3P7MA 1G8JA 4UUNA 4C89A 4BJ5A 3JQFA 4GPBA 2IS1A 4CKWA 1ZRNA 1S8FA 4IUBS 1HO3A 1NVGA 1XROA 4PCLA 3SHQA 1K6EA 1V5IA 2GPNA 3COPA 2TYSB 2ZYAA 1T2EA 2AUNA 4MQEB 3FRIA 3SBEA 4G0WA 5JNUA 4CMGA 2ECOA 4TGLA 3I28A 4NOMA 4XW2A 5IHXA 1J0AA 2V7BA 1JR2A 1H4SA 2TMGA 1NVVR 3IBYA 5JCXA 1ZGGA 3UHJA 4LQDA 2GD0A 1HYEA 3COVA 1QQ6A 5K3DA 3E4CA 7REQB 2YKGA 1LNQA 4KN8A 3WFIA 2YWDA 5HBGA 3LM8A 3ET5A 4LZZA 3TIIA 1EP1B 3IO3A 1DJNA 2RGXA 1C3VA 4IICA 1DTSA 3SX2A 4GX2A 5C3MA 1AE1A 4MA4A 4YN3A 3T06B 1HQYE 2G09A 2J9YB 4RA6B 2IS4A 3R4VA 3ZS8A 3P94A 4MICA 5AKJA 1RYBA 1TT7A 3VSDA 4LBYA 3CINA 4WH0A 2VRCA 1SU8A 2QSZA 3MD9A 3PCTA 2PRJA 1U63A 1Z6GA 3OM1A 2QGFA 2WSIA 1XSEA 1GGHA 2H4ZA 3HJBA 1EK2A 1ML3A 1R64A 1XCGB 2GNOA 2VOJA 3DJFA 1P60A 1E6MA 1EWRA 3D7KA 1EH5A 4MUNA 5F77A 4DLXA 1U5BA 1E0AA 3F47A 5ALXA 4KYIB 2JAWA 3ZXIA 4M7RA 4YFVA 1RAAA 3PHLA 4LBZA 3K0AB 5F51A 1X15A 1BS9A 1MU0A 1W47A 2FW0A 3FUWA 3S2IA 4C78A 1QQAA 3STYA 2YBEA 1U4OA 2HJVA 2A0FA 5LDHA 1Y5RA 2AEJA 2B34A 2HMUA 2NO9A 3RH0A 1VJ1A 1E9DA 3LPMA 3K05A 2P2GA 2PCLA 1ZM7A 2EBUA 2P27A 1I4TD 4O63O 3WWYA 4CKEB 3TTYA 2WYIA 1ZI8A 3DULA 3KVNA 1Y1TA 2GCGA 3HGQA 3W5DA 3DCIA 4CIAA 2IEIA 4OV6B 1CCWA 3G23A 4QGSA 3CJTA 3G2KA 1I7LA 3Q7TA 4PLFA 5CB8A 2GEVA 2ZJ3A 1GUAA 1OBCA 4JY7A 1HDRA 1X7WB 4YDRA 3KR2A 3B85A 4S3MA 3D5TA 4B31A 1V4BA 2XSZA 3FYUC 4MI6A 3VA7A 2NX2A 2Q27A 3OZVA 1T9AA 3DVLA 3RRBA 1H0SA 4ETMA 5JT1A 1IM8A 1V16B 1G5IA 3IBFA 4QOIA 1ULTA 2C2MA 1UIMA 2O8BA 2Z09A 2WAYA 2C1ZA 2QE7D 4OREX 4ER6A 3R77A 3ID6C 4PHCA 4EUSA 5J4HA 3Q0EA 1YQ9A 3LGSA 1KY4A 1QGUB 2OO5A 2W83A 2ZYRA 3PFGA 2FW1A 3KVRA 3R23A 1T0IA 4TLCA 3NYWA 3NWPA 2PA3A 2NZVG 4IKEA 3TE6A 3UNXA 2DFVA 1HE3A 3UXMA 1OU4A 1F4VA 3STTA 1CRWG 2FCAA 3KB8A 3PNOA 2R85A 2GZHA 1PYGA 4XIYA 1T0HB 1PE0A 2BFNA 1FU4A 1B8NA 4L95C 5FLEX 1E61A 5BY2A 2IY7A 2Y27A 2YWGA 1CULC 2O06A 3BMQA 3BJMA 2AEFA 4IHJB 1UOOA 3T7SA 5GP1A 3HKCB 5AK6A 2I4RA 3M0EA 4MKIA 5THKA 3RSFA 3ZQUA 2F1IA 4X95A 5H8WA 4EI9A 3IQZA 4AAYA 4WECA 1QIEA 3DOUA 4IOLA 5A3SA 2G7ZA 3F6SA 4MI3A 3WOVA 4DLKA 1JSXA 4WLEA 4M0FA 1G7CA 2BHTA 4GWGA 3TSZA 1SCNE 3A2NA 1TA9A 1TQDA 2BF7A 2OUIA 4QVGA 3K5PA 3VDQA 1R16A 3EGOA 1ZG3A 3LDGA 3P9RA 4HLUC 2VZ8A 5T4EA 2J0VA 3T7IA 2VJLA 1KP3A 2VWGA 2W2PA 3PB3A 5KEIA 4BLOA 1NMZA 1RQXA 1Z3IX 3G89A 3M49A 3O74A 2I99A 4Z0TA 3U48A 3REFA 1N2IA 2NG1A 2R8XA 3SEAA 3DTYA 4F72A 1NW3A 1SGWA 1PZMA 3IAS6 3NTUA 1O0SA 3PNVA 3PNQA 2WAAA 4G4GA 2QDKA 3V9AA 3R9WA 4ZVRA 3OIUA 1NBEA 1AQYA 2R5NA 3A1VA 3OLQA 2GM9A 5A3VA 4BNUA 4DMHA 2CHQA 3DL0A 4JMLA 4IKOA 2JAOA 4TWZA 2WWRA 4BV8A 4L5JA 1V1RA 2PS3A 4BKPA 1C4WA 1JDNA 3D6UA 721PA 2C2GA 3C6XA 3Q7PA 1N9KA 3H86A 4O08A 1EFKA 1LFDB 4DS3A 2QRMA 3N74A 1S1CA 4YLEA 2CJXA 2HK9A 1R5NA 2HEGA 3LV8A 4YONB 4D82A 2R6R1 5B7GA 3PEWA 3JR3A 3PEUA 5DN9A 4C04A 3UO8B 3V1KA 1QANA 2I65A 2HIHA 2E4ZA 2RKBA 4QQNA 3QKTA 4Q4CA 4L9RA 2EJBA 2GS9A 4M9UA 4MRMA 3EMBA 4D8YA 4WZAB 1JSRA 2YIMA 3PNKA 1OZHA 1BYUA 3TCNA 1NDHA 3O75A 2GGSA 1YKGA 2OD7A 2WFMA 3NTRA 4G1FA 1X80A 3VU9A 4YYEA 2O2JA 3IPYA 5BSVA 2QW1A 2UKDA 3EBOA 4MB0A 4HK4A 1MB2A 2ZRIA 2LIPA 3ORRA 4TVKA 1GNQA 1EX7A 2FF5A 2JZNA 1T5OA 3GLQA 2MWMA 3JQ9A 4FBGA 4KLNA 3CR7A 2GO7A 3ECAA 2Q9UA 3BFVA 2EKQA 2PGLA 3FCSB 1Z5UA 5BWNA 8LDHA 3SYRA 1WB9A 2AFIA 1AF7A 1J20A 2V5UA 1ZAKA 1WCXA 2O3RA 3R0IA 3FETA 4UNSA 4KOEC 3OZIA 2CB9A 4L6IA 4K46A 4M0CA 3KZXA 4C30A 4C4OA 1ZW6A 2QDXA 1Z45A 2ZUDA 1R6AA 3UHFA 1OWLA 2FPGA 3IIKA 2BHNA 2VZEA 5IMSA 5ALJA 4GNKA 3OLXA 4E33A 2VWPA 1Q7RA 4LRYA 5GGYA 3FX2A 4YQYA 5C53B 4POAA 4KQ1A 4UBOA 3PV0A 1P61B 1LPMA 1WKCA 1UZAA 2E5WA 4LDNA 3SK0A 3T3EA 4C7JA 2J8ZA 2JAXA 4I81A 3H5LA 4WY2A 3UCXA 3U9TA 4YRBA 1TJ4A 3AI3A 4HEA6 4F5WA 4F12A 3EN0A 1FTQA 3PBKA 4QOHA 4TTPA 1KZ1A 3A04A 3WIEA 1A77A 1C3EA 1YCHA 2WZCA 3WL5A 4AKIA 4HADA 1X0VA 3OTOB 1M6HA 1VL5A 1Z08A 4H7DA 1P18A 1PVDA 3G0OA 5KDLA 4M8NE 1HTWA 4N7MA 4YUYA 2MYTA 3PNSA 2I7XA 2ZSUA 1UMBA 3AOEC 3ZE1B 1HQKA 3OM8A 1PS0A 2XDQB 2PKXA 4HWOA 5CFLA 5B3KA 4GKKB 3SR0A 4QGHA 1JAIA 1QQ7A 1X6VA 3MRVA 1OROA 3AK4A 3FCUB 2QZ9A 4JYBA 1QTNA 3ILHA 3TZEA 3EGEA 3L18A 5DP1A 3ZZ1A 4DLBA 3A1NA 4LOAA 4R41A 1RAHA 1UC4B 3AF1A 2C9CA 3LP6A 5KZMB 2VDOB 2GT1A 3FHJA 1KI4A 4UZFA 4RJ2A 3SYNA 3MWLA 3UJBA 1PTJA 1QKJA 4P3XA 3VR2A 2P2YA 2P40A 1EVQA 1IFXA 2C00A 1CQPA 1ZOIA 2BHSA 3FRJA 3UGTA 5KMGB 2FJ0A 1D5CA 1VB5A 4ZDJA 3LXXA 5AVXA 4DT1A 5EXTA 1ACLA 4EHBA 3QRWA 1FMFA 3V8MA 4JUBA 1CLEA 4DPMA 1EFUA 2J0QA 5IAJA 1DV2A 2I4IA 3GJYA 3H5TA 5JDCC 4JT2A 1NYLA 5HJ2A 1P2TA 1U99A 5U4QA 5EMLA 3RS2A 3QF4A 3Q9LA 3P52A 5I7EA 1N6HA 4RVDA 1W8IA 3IYLW 4BX2A 3SX0A 1R0LA 1NX9A 3EA4A 1A5TA 3GLSA 5JR3A 4R0VA 4RCZA 1D1PA 3WBJA 5AKLA 3WGOA 4LV6A 1PG0A 9ATCA 3IPLA 1BFDA 1H5UA 5DLPA 1MZPA 4MINA 4K8RB 3GJXC 4IYRA 3VX3A 2VJNA 5BVGB 2BKVA 3V7YA 1LBIA 3LBNA 4RZ2A 2GB4A 1WXIA 3ZXXA 3LXMA 1YCFA 1RWVA 1ZY2A 1JQLB 4AIRA 2F3QA 3NYRA 1BX0A 3VO1A 4OK5A 2ADFA 2HX1A 4AD8A 1XPOA 1MZVA 3TZQA 4DYHA 5K2MA 1PFYA 1C1XB 3R3YA 4NU6A 3EPHA 1MORA 4YH1A 2YYAA 3GNQA 4GPIB 2PGIA 2JD2A 4IFIA 4Y2VA 2PA0A 1QGAA 3UFBA 3R9XA 4F3YA 1GN9A 1NI4A 1TUBB 2V7EA 2W8ZA 4YK7A 1WWKA 5IXSA 4P36A 2NUAA 2ACEA 1A7AA 4L8LA 4DAEA 5DYTA 2X0EA 2XMQA 4JK3A 4NENA 4MRVA 2VK8A 1JMKC 2E82A 3DFIA 2NZXA 5TGDA 2IH5A 1ZJ5A 5KNDH 2PMEA 1TM3E 3NC4A 1Y7IA 1GZVA 1PK9A 1DO8A 2HPAA 2LUOA 3E81A 3KTOA 4XKJA 1D1QA 6ADHA 1BD3A 5ICCA 2OUKA 4IIJF 1T24A 5EUQB 3I6BA 2ZI9A 3KHSA 1FNMA 4MKHA 3S2GA 2E85A 3CZAA 4ZREA 5FUWA 3ZCXA 3GAAA 3BCUA 3QFRA 1LRLA 1TO1E 1B0UA 2DGDA 4QULA 5FPTA 1VQ1A 2BFAA 4NV0A 1XZEA 3FTDA 4MVJP 1CFZA 1JKJA 2NTEA 1SZPA 3EF3A 3NM5A 4PPYA 1D8AA 1QGDA 1RXCA 1GPJA 1K27A 2R4TA 2W98A 3L5KA 4FFBA 13PKA 1OHHD 4KXLA 2F67A 2C9BA 4QSHA 4ZVLA 4ZCPA 5JJCA 4ND7A 3MAAC 2E87A 2E49A 4OIMA 5G4KB 3TEJA 3HNPA 5JRJA 1XMOB 1ODLA 2VNIA 3IMKA 3TLGA 1PFQA 1G21A 2F00A 3V1LA 4L76A 3A8TA 3ANSA 3AO0B 5IYZF 5C35A 3D3WB 4R1TA 3GCGA 1GNPA 3U62A 1CY8A 1KPGA 2YTZA 4OK3A 2JEOA 3N39C 1OU0A 3GPBA 4Y6GB 5FTJA 3WJ1A 4KV7A 3RK1A 3RKSA 4CDGA 3FNGA 2W58A 5EZYA 5K5EA 4HUJA 2O7SA 4FE4A 1W4ZA 3L8ZA 3EVBA 4H7PA 4PZUA 2QPLA 4YO8A 3KO8A 1R50A 4FMDF 2QT1A 1NP6A 2BH9A 2E18A 3AFMA 3PPXA 4L3VA 4YLYA 5AVZA 3T5CA 4F92B 1F7VA 1Q14A 4GS5A 4MVYA 3USES 4D3FA 3OCXA 3OIGA 1U0RA 1GPAA 3KPWA 4GKJB 16PKA 5TJ9A 4AT1A 2H1RA 4URYR 5HSGA 4MHOA 4W1QA 2AC2A 1NE2A 4E15A 5I4CA 4Y30A 5SY9A 3HKDA 4ZV7A 3W9YA 4DDKA 1YRAA 3J80A 3G2LA 4QTZA 5C4IA 2HHJA 1QJCA 1UXOA 3BREA 3E03A 4IXNA 4JC0A 5JQGA 2DBQA 2O2YA 1VKZA 2GVZC 2DRIA 1EUDA 3QW2A 4J0HA 1EE2A 1T8YA 3D7NA 4FYJA 5NLLA 5DT2A 1I0LA 5IKMA 1S1MA 3I9MA 1MCZA 3MCZA 3TNLA 3ZBTA 3PZRA 3R8FA 5HF9A 3DEIA 1W4CA 3UMYA 2PVSA 3T5DA 2D62A 3L1JA 4PC1A 2A0KA 2RHGB 3U0VA 2VDMB 3D3KA 3Q9SA 5KO2A 1VE3A 2J7PD 3C7AA 4WRRA 5DT9A 3VVLA 1RQRA 4DCCA 3U37A 1TLTA 3ZQ4A 3UK7A 1GPWB 1RQ7A 1NT4A 4IDNA 3IB6A 1B16A 2C0QA 4L5AA 4J1TC 3RYTC 2FUKA 4C6SA 3RT7A 1Z13A 1EFDN 4AKGA 4OBWA 5BR8B 4C0KA 2PUHA 4LGVA 3VHRA 4J1QA 4XCXA 4BWGA 2VPIA 3O38A 1N9GB 1UBEA 1D07A 2BEKA 2NO1A 2VSNA 2ZRAA 3EVGA 3OT1B 4WT7A 1AXRA 4Z3DA 3Q3HA 3TBKA 2QPTA 4BNFA 4A8PA 3CWZA 5JBQA 3OX4A 2Q9CA 4B4OA 2ZKIA 3EY9A 4UQPA 4XWGA 4NBUA 4OPMA 4JI2B 1N6IA 4KMSA 3OWOA 1K3TA 2D0OB 3BCRA 1O7JA 1FB5A 1GQRA 3C8MA 5PGMA 1YZTA 2VA8A 2VHUA 4EGJA 2A9VA 3V34A 4HT3B 2LV8A 2PANA 3IEIA 4A36A 3DEHA 2BFBA 2QX4A 3BUSA 4FT2A 5G0WA 4F06A 1R2QA 4AIIA 1K4YA 2OGUA 2XMZA 4MRPA 4UVEA 4ZYTA 2HW8A 2NLOA 5C1IA 3QZUA 1YZYA 1DTWA 2Q5IA 1B26A 1GDHA 1E2UA 1UOQA 3FMFA 4PWZA 1WSDA 3F8WA 1BVYF 1VE5A 3DSRA 5J43A 1MV8A 2IYLD 1I7NA 1Y6ZA 1ZN9A 2WJVA 3FPHA 5I5GA 2VH2A 3NTOA 5CXQA 1SCQA 5ED0A 3F6RA 4DLVA 4ROTA 1LV8A 1R5OA 2WDZA 2HNBA 2DH5A 3E7FA 4KPYA 1XYVA 1GUDA 1UINA 4N0DA 5E9AA 5CX1B 1OR8A 3Q4GA 3U7EB 3E8SA 5IG2A 3WAGA 1S2OA 4EAQA 1NY6A 1QYVA 3KTFA 2I29A 3NHSA 1I3OA 1NBAA 4DV0B 4A9AA 2QYSA 4IMIB 5JNTA 2I3GA 3FE2A 4EUHA 3GRAA 2HHAA 2XVAA 2CLCX 3CRW1 3KSMA 3LYUA 4ZMSA 2ONKA 3HBAA 3LDFA 2FUG6 3ABIA 1YGPA 3GLGE 5KTOA 1SC3A 1SCJA 1YWGO 2X0JA 4B85A 4EH1A 4H6XA 2OILA 1MO2A 2Y9MB 5JSZA 2OFPA 2D0IA 2HZ7A 1FDRA 2EJUA 3M2PA 3QTLA 3F49S 4UHEA 4TLEA 4IL5A 4KRGA 3CF4G 1L7PA 3LUPA 4B3BA 5KYTA 4JXXA 5G3ZA 3PHBE 4ME6A 1NOIA 2H8GA 1KO5A 5ILOA 3WB0A 2Z9DA 4LWPA 5AJHA 1G21E 4NABA 3OQJA 2F6RA 4TYPA 3AJEA 4ZEXA 4BE7B 1NXSA 5HW0A 3AETB 3R7NA 4KH0A 4AJLA 3NHPA 2FOIA 3MUOA 2GAFA 2YC4C 4JJEA 4MA0A 1P2UA 4GDFA 2X6QA 4ZXFA 2ZVJA 4GSKA 2ZUTA 4E5DA 10MHA 1P1HA 1WHSB 1IE3A 1IK6A 3KZMA 1G2OA 1ZGHA 1Q91A 3OE5A 5C1OA 3NEPX 4PZZA 5FPKA 1UUFA 2RJOA 4ENSA 1AMUA 4V0NA 2BGGA 4EG0A 2GYUA 6YASA 1PQWA 5FTLA 1YFZA 2RFLA 4DLRA 3FOWA 4NOJA 2QTMA 3RT9A 2P2CA 1F2UA 2PSDA 4B6QA 1RXYA 4YRAA 5AIAA 1YL6A 2FPOA 2XMCA 1KFBB 4HRVA 2IDMA 1X7YA 2HLPA 3CZPA 3P26A 1J0EA 4G5QA 3HKBB 1F51E 4TLBA 1VRVA 3S70A 1D04A 2HLHA 5IN5A 2X8LA 1UP7A 4OB7A 3G9QA 3EQ8A 1N34B 4ZI2A 2QQGA 3C24A 1KH1A 4EFMA 4Z51A 3DS8A 4A26A 1XLTA 4O8CA 1RAEA 4GQIA 1XOIA 2FEPA 3JVIA 3RYHB 2IF2A 4OOEA