3REGA

Crystal structure of ehrho1 bound to a gtp analog and magnesium
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
171
structure length
171
Chain Sequence
KKALKIVVVGDGAVGKTCLLLAFSKGEIPTAYVPTVFENFSHVMKYKNEEFILHLWDTAGQEEYDRLRPLSYADSDVVLLCFAVNNRTSFDNISTKWEPEIKHYIDTAKTVLVGLKVDLRKDGSDDVTKQEGDDLCQKLGCVAYIEASSVAKIGLNEVFEKSVDCIFSNKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unique structural and nucleotide exchange features of the Rho1 GTPase of Entamoeba histolytica.
pubmed doi rcsb
source organism Entamoeba histolytica
molecule tags Signaling protein
molecule keywords Rho-like small GTPase
total genus 54
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3regA00
2YWFA 1Q3HA 1LVGA 4IHQA 4NP6A 4JLKA 2Z43A 4HAWA 4TMTA 4OI0A 1JR3D 3R9IA 4JLPA 2FZ4A 4P4TA 2NQ2C 3E1SA 4LJ8A 2ZSDA 4F4JA 4D0LB 5JEDA 3AF3A 3QI2A 2FPLA 3IBYA 3DL0A 4OI1A 4OL0A 1QG4A 2IYTA 3GQBA 1OFHA 4O0MA 4TTPA 2PL3A 4GI7A 1E9CA 2C04A 3SJBA 4FD2A 3QKSB 3QXCA 3RC8A 3BWDD 5ANRB 3OAAA 4OHWA 4XWAA 1YJ5A 1KGDA 3K09A 4M0LA 4KODA 5LBIA 2IYUA 4EFMA 4PAOA 5GVSA 1UKZA 5IT5A 1R0WA 2ZRDA 2C5LA 1L4UA 3H1TA 2CDNA 1VDZA 1KYIA 1KTVA 2WMNB 1YKSA 3BRWD 1VIAA 1R8QA 3R9XA 2WKQA 5FUYA 1Z6TA 2A2ZA 5HE8A 4TYYA 2VP6A 5CB6A 1M7GA 2QAJA 1G5RA 5G53C 2H17A 3U3MA 5KPDA 5SZJA 2K5UA 3Q85A 3A1VA 1F5NA 1P2UA 3RS3A 5KHOC 1P6XA 1VCMA 1ZUHA 2QA5A 1G41A 1T8TA 4LK2A 1I2MA 4N1AA 2NPFA 2ZSFA 5IRCD 1AA9A 2IS6A 3AVVA 1E2EA 4JL6A 1BH2A 5LB2A 2C2HA 2FSIA 4WIAA 4OQLA 3W6PA 1FOEB 1T5LA 2IYRA 3AV0B 2CL6X 2VHUA 2EW1A 3KJEA 3LWNA 5FBRB 5KU1A 4KFTA 2PCJA 3SJZA 2YC2C 1JBKA 2A5YB 1XMVA 1XU4A 2SHKA 4RD6A 2ZI7A 4E07A 1DG1G 5FPKA 2JGNA 4FXPA 1AIPA 2PLFA 4HLDA 3ETLA 1SQ5A 2CVHA 2JCSA 3J81k 2XTZA 4DIEA 4TL6A 5HE9A 3EX7C 2ECKA 2XZOA 3ICEA 2ZAMA 4TYQA 2D7CA 1KOFA 3VKWA 2GXSA 4ITRC 4Q7MB 1RRCA 3B5JA 3ZQ6A 2BBTA 5IDVA 4B3CA 4C4PA 2JASA 2QN6A 4C2UA 2IXEA 1NKTA 3NTUA 2AHOA 2I1QA 2FJUA 1NIJA 1E79D 2DB3A 2DR3A 5BW8A 3KQHA 2J59A 4TSFD 1CRPA 2GXQA 2BDTA 2JLXA 3CRQA 5FTJA 1WMSA 4Q9KA 4C0JA 1II9A 3BFVA 2GCNA 2ZSEA 4DRZA 2F55A 2ZYUX 4HB4A 1GIAA 3O47A 4HUQB 3T06B 2JJ1D 4B2IA 1Z6AA 4KFSA 3UWOA 4QJ3A 1A1VA 1DEKA 1XMJA 2V4ZA 1KSGA 2MMGA 1N5IA 2ZJOA 4URZR 3I61A 4GOJA 1Q1BA 5EXTA 3U6BA 1Z22A 5ELXA 1JEEA 1O3YA 1P9WA 2QRNA 2GEVA 2QE7A 4OQMA 2O0KA 3SN6A 4A2PA 2BV3A 3U44A 1W4BA 2R62A 4G5QA 4LJ9A 3IO5A 3KTAB 2D3WA 1UDWA 4BFTA 4Z8XA 2BEKA 1A7JA 2RHMA 3X1WA 1LTQA 1G20E 4B48A 5D3QA 4CVNA 3GLIE 3P20A 5KSOA 5JI2E 4POAA 5JECA 5FL7A 4PPNA 4QNRA 2BM0A 3CONA 4YMUA 2W0MA 3KFXA 1G6HA 4IJMA 2XTNA 5CLQA 5JJIA 3PCRB 3NBFA 2FA9A 2UKDA 3MCAA 5H68A 1PV4A 3PR1A 5IK2A 4D0NA 3UPUA 3CBQA 3AH8A 1CKEA 4OHVA 3EZ2A 1GKUB 3DZDA 3QEJA 3T12A 3W6OA 1T4GA 5EZ5A 2RKOA 2HLDD 4NYIR 2EVWX 1RJ9A 3FHOA 1U99A 3C16C 1MRSA 1L4YA 4LYAA 2DFNA 1Z0DA 3LQQA 1RFLA 4MRVA 4Z1MA 4IRUB 2Q21A 4TLBA 2BOVA 4BFUA 2P6RA 3UG7A 3REFA 4MYTA 4URUR 2CK3A 4PC6A 5JJLA 4B3GA 1JQLB 2ODBA 4RFVA 1RRFA 4W5JA 4ACAA 1E1QA 4RD1A 3L0PA 4MGKR 5GVRA 1W0JD 1R0YA 2BVNA 4TLAA 1J70A 3CR8A 2QBYA 5DE3A 3GLIB 3WMFA 1IOZA 1V43A 3OEED 4CYMA 3FDIA 1C1YA 2JDIA 1YZQA 3KL4A 1A2BA 1G8PA 2IYQA 3E70C 3GJ5A 3QEOA 4M1MA 1SXJD 4ZO4A 2XB2A 3QXJA 3PUZA 1CLUA 3HU2A 3LVQE 2PEZA 4KLNA 3TVDA 3N5CA 1TMKA 2QMUA 1XTSA 5CDFE 4CRWB 2A78A 1UBEA 5KNCA 2XB4A 4D4MA 1NY5A 5G3YA 4LYHA 3AP2A 1IJFA 3QKSA 2AXNA 3ZH9B 4Q1EA 1ETUA 1E2FA 3ZIAA 1IN8A 1T5IA 2ZJ8A 1CEEA 4MGIR 3SQWA 4ASUA 1KI3A 4NYMQ 4Y0VA 3KQNA 1SXJC 1HT2E 2YWEA 3TIFA 4QOSA 2W2VA 4M22A 1L7VC 4CEJB 2CL7X 3GLIA 4BPBA 4XSHA 4Q9LA 4KYUA 1SHZA 3AUXA 2PJZA 4JS0A 2JJ2A 1XXHB 1S9DA 1KO5A 3DDCA 3IDQA 3WP0A 5F98A 3U3JA 5FI1B 3WY9A 1OHHA 4KU4A 1XD2A 2O0HA 4DLSA 3HR7A 1JR3A 2PCLA 4G1UC 4TL7A 1Z29A 2AXPA 4Q19A 2F1RA 1TNDA 4HAYA 3FKSA 3NH6A 4TN1A 2ANCA 1P72A 3VNVA 4UJ5A 2RMKA 1N6NA 4LZZA 2FDCA 5JHGB 1K6MA 3CX7A 4IW3B 4DCSA 2QSZA 1H8HA 4RVCA 2VTKA 4R71A 3G0HA 3CX6A 4KXFB 1XEXA 2W00A 3P4YA 2XJ4A 4MRNA 3VU9A 3SS8A 2ZXUA 3UMFA 2DWPA 1KI9A 3TQFA 4AD8A 5K8TA 1EK0A 4A8JB 4QBFA 4M8NE 3CX8A 1XMIA 3S1AA 3HPRA 3SHFA 1HUQA 4Q00A 1G9XA 3X1ZA 4URWR 2AFHE 2MMCA 3L0OA 4Q1AA 3T61A 2QRZA 2WM9B 3IPXA 3OF5A 1N6IA 4P31A 4O3MA 2G88A 4QL3A 5FTNA 1CTQA 2ZJ2A 3FVQA 1E6CA 3CPHA 3P4XA 4NH0A 3QBVA 1E2NA 2ZI6A 4PO8A 2OCYC 2R6DA 5KPJA 3EG5A 3KX2A 1KSJA 3AF1A 5EXXA 4OQNA 4CF7A 1GILA 1NI3A 1TEVA 5SZHB 1FX0B 2AR7A 2WIAA 2WPDA 1L8QA 3EPJA 3RYTC 2QGZA 4LJ5A 1WRBA 1H8HD 4BFXA 2IC5A 5AJYA 1ZNXA 2JIZD 3RSOA 3CPJB 2YOGA 4RY2A 4A4DA 3NHBA 2OT3B 4QXAA 4LC1A 3DPUA 1TAGA 2G83A 2P67A 3UXMA 3PV0A 3PVSA 3IKJA 2P2LA 1TQ6A 2B6HA 2WMOB 4KFUA 4EPTA 4UNSA 3X1YA 1XXHA 3KB1A 4B3BA 4XD7D 2GKSA 1IXSB 3QPWA 1QVAA 2AD1A 1X1RA 221PA 4PC2A 2PT7A 1KI8A 2D2FA 4K8OA 4KLZA 1KDRA 5CM9C 3EPKA 3B78A 1Z0FA 1J99A 4GOKA 2ZPTX 1GNQA 3C41J 3L82B 4AIIA 2ZJYA 1CR4A 3OEEA 4M1KA 4PC7A 1KMHB 1GKYA 2W6ID 1Q3TA 1QF9A 2VF8A 3AP1A 3OEHD 3KJIA 2Q0HA 3EPHA 2IF0A 1HQCA 3W90A 3PITA 1A5TA 2Q3MA 4FIDA 1XF9A 4YQFA 1WBBA 3KUDA 3U2QA 4EPWA 4OHZA 2H18A 1LF5A 3NEJA 4KCGA 4R9UC 1E1RA 3JZMA 4DLRA 2IEZA 2V9PA 3D31A 1M74A 5AJVB 2VHQA 3DHWC 2QTHA 4V0OA 3OE7A 5DI3B 2ZRAA 3WP1B 4BLQA 1F2UA 4GSYA 2RH5A 5FBWB 3WNBA 2XXAA 1KDPA 2LKCA 3QIAA 2O8CA 3VFDA 3LBHA 5GJVC 3GJ7A 4BZXA 3EIHA 1G8YA 2O52A 4K81B 2QORA 4V02A 4D82A 1G64A 3TVTA 3KZ1E 3RLFA 1GL6A 4WZ6A 3CB4A 3EW9A 4RFSB 3U44B 3LW7A 3K0SA 4TTRA 4G5OA 4JVSB 4W7SA 4XD7A 2BCGY 4WZBE 5DHAA 5KYKA 3VKHA 1MKYA 2NTYC 3MLEA 1OE0A 5DHFA 1LFDB 1KK2A 1WA5A 2OAQ1 2CCKA 2OEPA 2VP4A 4JLAA 2ERYA 5F9HA 3TSOA 1LY1A 2QAGC 1IY0A 4ZCLA 5J4VA 5JRJA 5AJWA 3KQLA 4GDFA 3NH9A 1DO2A 5L3SA 1DO0A 1FFHA 4CW7A 1RRPA 2NO6A 1E4YA 1EWRA 4UJ3A 2QM7A 4Q4AB 3OEHA 4TZ0A 4MRRA 5D3MB 2Q3FA 1II8A 1TADA 4LWZA 5J4LA 1BKDR 3GJXC 4B32A 3FHTA 5JBQA 1YR8A 2YJTD 2GJ8A 3BERA 2N46A 2O8DB 1FZQA 2ZE8A 1Q12A 3GJ0A 1FTSA 3EARA 3QF4A 3ASZA 4TL9A 1DBSA 1W48A 5G41A 1YZLA 1GSIA 3PEWA 1CULC 1XX6A 1NVVQ 3QXXA 1TU4A 4QGHA 4C0SA 2ZI3A 4M2LA 4OHXA 5BN5A 1Z3IX 3Q9LA 1G7TA 4IOJA 1ZNWA 1UPTA 2QP4A 5IK2D 1SVKA 1E0JA 2C78A 4WA7A 1ZNZA 2ANBA 5J47A 1OB2A 4S35A 2OHFA 3I5XA 1G6OA 1G8FA 2WIBA 3T5GA 2KSQA 3LDAA 3K1JA 4XVRA 1RRGA 3MWJA 4DSTA 1UJ2A 4JLVA 5B2ZA 1ZUNB 4PSVA 4N0EA 3FGNA 4Q7LA 4JLBA 4JSTA 5DNYB 2X77A 3TR5A 4KBGA 2P5SA 1SXJE 4HSEA 3LO5A 2MSDB 1C4OA 1OH8A 1P61B 3W6NA 3AVWA 1HTWA 3BAFA 1E9AA 1IXZA 5FOTA 2ZVQX 3V4FA 2GRJA 5HZHA 2D74A 4BFZA 2QMHA 3LAWA 4GRAA 3WRYC 4D25A 5JSZB 3VR4A 3G5UA 2CJWA 2IF2A 4IVPA 1U9IA 3U7EB 1G16A 1XMSA 2QPOA 1KAOA 2G9NA 4M9XA 2CE2X 1JPNA 3BXZA 1E0SA 3I62A 5DN6D 1NY6A 4DEXA 2BKUA 2GETA 2R6GA 4HAUA 4LJAA 2CVFA 5KTYA 4C0LA 1P7CA 1JAHA 2IA5A 1XDBA 1ZCAA 4JMPA 4R98A 3I92A 4DLVA 3AVPA 2LCFA 1G18A 1WCV1 2VHTA 1E99A 1W0KD 1KI6A 1UDXA 4EJSC 3Q7QA 1KJZA 1IBRA 1YRAA 3H4MA 3GJ6A 1ELOA 1UEIA 3KQUA 4PZYA 2WWIA 1OXUA 4OK5A 2EFCB 4M9ZA 1G8GA 3K0EA 2WJHA 3P32A 4PPFA 5KUTA 5AUPB 1E96A 1Z83A 4NONA 2VQSA 1JB1A 4S2EA 4JKYA 2D7DA 3K9HA 5C4GB 1KK1A 1GWNA 3CF6R 4NTZA 4ZCMA 2V54A 4RD4A 4KV9A 2BMFA 4QHTA 1X8JA 2XITA 2ZYTX 1GOTA 4TYNA 3B1VA 1GTVA 3CM0A 4Q5IA 2LKDA 4OJKA 1KZGB 2IYLD 3W34A 4B44A 1DAKA 3I5YA 3CPEA 1XTQA 3GLGA 2AX4A 4MKHA 4JSYA 4XJXA 4BLPA 3ZIAD 1N5JA 4B2PA 5LD2B 2REOA 4YONB 1G1MA 3A37A 3IIKA 4U7DA 1OFTA 4Z51A 2V55B 3Q5EA 3TK1A 1NP6A 3M6AA 4J0QA 3QOFA 3H86A 2IWRA 1NSTA 1W4CA 1WF3A 4DT1A 2WKPA 1TX4B 3CO5A 2GZDA 3CF0A 4FN5A 5EXPA 1QHIA 2IL1A 2YWGA 1XPRA 3BFXA 3QPUA 2QZ4A 4LBYA 2OE2A 1BMFD 1JPJA 2X2FA 3VX4A 4Q01A 1Z2AA 2VIIA 3BC1A 1W5SA 2FH5B 4YMWA 5EZ6B 4IEIA 3K0CA 2ATVA 3BH7A 3I1FA 3I72A 4M9SA 5FTMA 4GZMA 2CEAA 4RKFA 4ZPXA 2ZJ5A 3QKTA 4HUTA 2D06A 1ZIOA 2MSCB 3RVBA 421PA 3QBTA 1CR0A 1WQ1R 3GFOA 3JVUA 1XEWX 5KDOA 2IEYA 1MRNA 3SNHA 1S0UA 4AYXA 1W36B 4DUGA 1D2EA 3A8TA 1MO3A 4OYHA 3K0AA 1JNYA 3RS2A 3GD7A 4C0AC 3MUFA 2FPKA 3BORA 1N5KA 1VYUA 4LGMA 2QE7D 2BMJA 2WV9A 2ZYWX 2ODNA 4PQFA 2O0JA 5JHHB 1YU9A 5JI3E 4LDJA 3CZPA 4A92A 1YRBA 2WJGA 1GG2A 1KMHA 2FX3A 3IO3A 3QJYA 3QG5A 4Z1MD 1NBMD 3ZVNA 3WRXC 2GXAA 3PUXA 5BN3A 4ZCIA 3TBKA 1EG7A 2A7QA 2PBRA 4YMTA 5H70A 2GAAA 4I81A 2G77B 1VCOA 1JXMA 4BRWA 5E3HA 1QZXA 1XZPA 1Z47A 2V1UA 4JLJA 1SKYE 2GCPA 3P27A 5FBQB 2ZEJA 1KKMA 1MABA 2DYKA 2ZREA 1EFHA 4BRUA 4DBLC 3THWA 2WWGA 4US1R 1CJKC 4DXAA 5H8WA 1ZAKA 5L3VA 3C7KA 1ZYUA 5AK0A 4V0KA 4AKIA 2JIZA 2ONKA 1R0XA 1ZJ6A 3SHWA 4MKFA 5EUQB 2VHCA 4F93B 3MRSA 1KY2A 3ZS8A 4L4UA 3TLXA 5L3SB 1LS1A 2GHIA 1G19A 4LHZA 5TY0A 2Z6VA 5E7MA 1ZD8A 2XXAB 4MKIA 1P62B 2GCOB 4LHVA 3B8HA 2HT6A 3SYNA 2VP2A 3TNFA 4ABYA 2PX3A 4UKDA 2J7KA 1OH5A 4MH0R 2F1HA 4RCZA 4RFSA 5CDFA 4I99A 2EYUA 3CNNA 5SZKB 5CIWA 4CT5A 1E0KA 2X2EA 2R6AA 1YR7A 3TKLA 3B13B 5FOSA 3ZVMA 1NN5A 4C7OB 4PX9A 4GFDA 1XTKA 5FH9A 2FNAA 1R8SA 2REBA 4KSBA 1HY3A 5FPYA 3M4YA 4Q1BA 3U3OA 1D2NA 2AKYA 4B76A 3DM9B 2GAOA 1VKJA 2W83A 4NYJR 2IYWA 1BOFA 2J46A 1CR1A 5G40A 4GPTA 5EP1A 1IM2A 2DPXA 1UF9A 2C98A 4AYWA 4B6FA 1B0UA 1FPMA 3IILA 4Q7JB 3QPVA 4MRSA 4L16A 3EZ9A 2BBOA 1XZQA 4URXR 4URVR 2NPIA 2ZYVX 1GM5A 1NJGA 3W3ZB 2ODEA 1XFAA 1YZKA 2ZSBA 1NMZA 1XD2B 3LA6A 4JLMA 4NYMR 3MFYA 4LBZA 4BQSA 2RGEA 4IOLA 5EUMA 2E87A 3ZD6A 2A9KA 2V7QD 2JLWA 3THOA 4RZUA 5JSZA 4BECA 3HR8A 1N6LA 2KBFA 3WHKA 1HE1C 2RGNA 1UFQA 3PUVA 1DPFA 2YNMA 1JECA 2Q9CA 4EQ6A 1ZM2A 1FNNA 3O8DA 4UQOA 4FI3C 1OPXA 4A6XA 3PUYA 3BE4A 1LV7A 4DVGA 4ESVA 3W5IA 2JJ8A 3L43A 1DAHA 3VR5A 4PHHA 2BBWA 1IN7A 3K8YA 1S2MA 3L8YA 3PG5A 4C3ZA 1W5TA 4W5HA 1U94A 3C5CA 3WYGA 1QHXA 3PFIA 5L3QA 5CYPA 4IDOA 4JYBA 3KJGA 4I1UA 5HCNA 5EE1A 2CLSA 3RNLA 4B71A 4EJSB 1F6BA 3VR3A 3AKYA 5H1YA 1UKYA 4OBEA 1RC8A 1JAIA 2D2EA 3H0KA 2DHRA 5DI9A 2JLUA 2AWOA 1W46A 2AL7A 2GJ9A 4E22A 3CRVA 2YVUA 5LD2C 2HF8A 4TQUS 4Q4JA 1U0LA 1OKKA 2EFGA 2ZRHA 2HXYA 3HJNA 4GP7A 2OCPA 4XH9B 3MSXA 4KITB 4CDGA 4NCKA 3H84A 1FUKA 4PXAA 3TR0A 2FGJA 4GZLA 3FKSD 3TUIC 4IOKA 2DY1A 2ZRCA 1TQ4A 4PANA 4TTQA 4WAUA 3HDTA 4N0DA 3TW4A 4LJYA 2ZVPX 1W7AA 4A9AA 1R10A 5KNDA 1J2JA 1XJ0A 3P26A 1HH4A 1KKLA 4DJTA 4M21A 1X8LA 2JLSA 4IXMA 2GXUA 3FKQA 4PZZA 1KK0A 5CM8B 2VSXA 4XTRA 5P21A 4DDWA 1S1MA 3GEEA 3B1WA 1PLLA 4HZUB 1XEXB 2OLJA 4NL4H 3OIYA 1OKKD 2CL0X 2V6IA 5DYIA 3VAAA 3EIQA 5JZVA 2EWWA 1NRJB 4MGZR 4HLQB 3U61B 4HB0A 2FV8A 2FGKA 2GJSA 3SZRA 3S1AB 1GAJA 1UKVY 3B6EA 4TT3A 4TQAA 4N3NA 3NDBB 2GF0A 1CP2A 4FMDF 2FSHA 1JR3E 4KI0A 1JJVA 4CIDA 5HCIA 2V7QA 3GPLA 2QTVB 3BB1A 3LV8A 3GMTA 121PA 5BXQC 4UNNA 3LXXA 2VP9A 1JEDA 2YOHA 4OQXA 4QHSA 3PUWA 2XJ9A 5GJWC 1GITA 3FTQA 4XIGS 1ONBA 4Z8YA 2MSEB 4F38A 1SXJB 1ZM4A 3DMDA 1W44A 3IBGA 4Q9HA 2QTFA 4D4KA 1J7KA 4Q4JB 2EFDB 2IK8A 4MQBA 1P60A 4DLXA 5IF9A 2OXCA 2O8EB 5DIFA 2XSZA 4V0ME 3GLHA 2ZRGA 1KAGA 4DEYA 4Q1FA 1V5WA 2WKRA 3EIEA 3H2YA 1HV8A 2AN9A 1KDTA 2ZI9A 621PA 3SJCA 1XBTA 4U00A 4BEBA 4PC3A 3PXGA 4DUGD 1MR3F 3A58B 3OIVA 1MABB 2ZU0C 2QEQA 2R2AA 4JIMA 3SI7A 4KJZA 1D2MA 2ERXA 5CLLA 1M2OB 1B23P 2WAYA 1OJLA 4DKXA 1VYTA 2YKGA 3T34A 1I4LD 2RGAA 4US2R 4DLUA 4FMDB 1RYFA 1E69A 2JJ2D 2QENA 4TMZA 4V0MA 2NZ8A 3TJZA 2A3RA 1Q1ZA 3C15C 1PVOA 1G3IA 2XNDD 3MWLA 4AG5A 2Z5FA 4TL8A 2WPDD 3HYRA 3FMOB 5DN6A 2RB4A 4L9SA 4A8JC 2W0SA 2B7CA 4NYIQ 3KKNA 1E2DA 1L2TA 3PEUA 4QJ4A 4DDVA 1P9NA 1AZSC 1EX6A 2AWNA 1JXOA 1FW6A 3CF2A 4H1UA 4XVQA 3UATA 6Q21A 4DSOA 2O8DA 3D8BA 2FF7A 3QKUA 4NHOA 4AYTA 1TEXA 4NCIA 1KIMA 2FZLA 2KB0A 2ZR9A 3A4MA 2VLIA 1NNEA 2J0UA 4ZI3A 1US8B 2ZS9A 3RDPA 1P2TA 5E7IA 3ZVLA 1LB1B 4HB3A 4B3DA 1EWQA 4F4IA 1XPUA 2X8AA 3THXB 1NVWQ 3M1IA 3U7FB 1AQYA 3F3YA 4KBFA 4M1OA 3SC3A 2F9MA 5C18A 4F92B 1CJUC 3KDSE 3D7MA 1ZBDA 1XRJA 1UEJA 2DFKB 1XXHE 4HATA 4L15A 3AUYA 4DLZA 2FFBA 5FR2A 3CH4B 3V9PA 4HYYA 2F3RA 1IAQA 2A5JA 4H1VA 3HWSA 4M53A 1E0AA 4LJ6A 4EQ6B 4QJ5A 3RC3A 3TGPA 2XAUA 1Z07A 4DLTA 1VG1A 2QMEA 3UANA 4ZDWA 1XJCA 3GEHA 2N42A 4E09A 1EX7A 4UXIA 2CJWB 2NO9A 2R9VA 2NOAA 4L8GA 3PIRA 5DSZA 4O25A 3I32A 2BWJA 1QDEA 2P3SA 2W6JA 4NDZA 4CEJA 1ZMXA 2OBNA 2OCBA 1OIWA 3VMFA 4OI4A 4B6EA 2OLKA 2A5DA 2RGGA 3HP1A 3T1VA 1EESA 2IHYA 3AGQA 4KFRA 4QBGB 4OQFA 2FMXA 2WBLC 2JLZA 1N3BA 4K46A 3EASA 2KBEA 4FMCF 5JCPA 5LPNA 1LW7A 3TRFA 1ZRHA 1R4AA 3L0SA 4OJQA 1Z0AA 3ADBA 3TQCA 1JALA 3WMGA 1X3SA 2QM8A 1QHYA 1K5DA 2ZUCA 3LXRA 1U98A 3LBIA 2IS2A 1A4RA 4EPXA 3O8BA 2J1LA 3RS4A 4E5UA 3PEVA 2VYFA 3WYFA 2J87A 1E98A 2C8VA 2WWWA 1O87A 1YE8A 1TTTA 1Z2CA 4A6PA 4YMVA 1N0WA 1Z6GA 4R2HA 4DCVA 4ZKDA 1XCMA 3E5HA 3ADCA 1UADA 4DCTA 1NSFA 3GLFB 1NL3A 4EPYA 4ZV4A 4P4SA 2CK3D 3B9PA 5E95A 4IDHA 4HZIA 4BASA 4ESHA 3QXSA 4JVNA 1W47A 2OO7A 3FE2A 3U5ZB 2B8TA 4U02A 3LFUA 2W58A 5JEEA 2ZUDA 2FWRA 2XNSA 5FR1A 4JBWA 3A1UA 1PUIA 2FEMA 4P3YA 3GLFE 4QBHA 3AM1A 3FOZA 4AKGA 2CNWD 3FFBA 1QHSA 1DS6A 1S9HA 3UKDA 4NU0A 5AWFC 2YOFA 2DBYA 1MV5A 3NEYA 5CIQA 5CJ2A 4DCUA 2ORVA 5JS7A 1E79A 5B30A 3THXA 2JEOA 1E9EA 2QL6A 3AF4A 5FUVA 5F3WB 1GRRA 2W6JD 4M9QA 2A5FA 3SU8A 3IQXA 1YZGA 4WVFA 4B43A 4BFVA 1OYWA 2J45A 5JFGA 2IXFA 1NF3A 1VCIA 3OZXA 2HT1A 3FMIA 2BIFA 2FEOA 4PPQA 4HLUC 3WHLA 2OXRA 4E03A 4A8JA 3K0CC 5FOWA 1D9ZA 1RIFA 2O8FB 3L8ZA 1W4AA 5TXGA 5JWRA 1Z6YA 2UZ3A 5E7JA 2KE5A 2Q6TA 3AVOA 2I3BA 4AKEA 3ECCA 2H7VA 3FMPB 4P33A 1TUEA 2ZE7A 2PJRA 4G3XA 4I1OA 1ZU4A 3BOSA 4MDEA 2IUTA 4UXHA 4ZDKA 3TAUA 3FWYA 4QGGA 3SEAA 5DO9A 2XSZD 3L0IB 3B1YA 1Z28A 2RHDA 2Z4SA 3DM5A 3F5FA 4HAVA 4KYIB 2NO1A 3CLVA 4LHYA 1R7RA 1OF1A 4XWKA 5KDDA 1FX0A 2CHGA 3GLFA 2IS1A 1CU1A 2ASEA 2J3EA 1M7BA 2A30A 3R7WB 3CZQA 1Z08A 5BYKA 3IEVA 1MO6A 2YC4C 3NG1A 1KZ7B 4Q03A 3AQ4A 2RGBA 2ZS7A 2GTPA 3HPQA 5DI3A 1F2UB 5EXSA 3LNCA 5DGXA 1R2QA 3ZGXA 3THYA 1AS3A 1E2HA 2AK3A 2W6IA 3MWKA 2ZETA 3PQCA 2AKAB 1C9KA 1W4RA 4EDHA 1Y3AA 2XNDA 4O2RA 2F6RA 1KO8A 1CR2A 1G3RA 2QGNA 5EE9A 5A5GA 3GLHB 3LRPA 1NLFA 2J7PA 3A36A 1Q1QA 1TF2A 1E9SA 2Z4RA 3RAPR 1FTNA 3SDZA 4B75A 4DCNA 4BFSA 2O8EA 2HCBA 2OV2A 4C30A 3VKGA 3QXHA 3NXSA 1N6KA 3D3QA 3VHLB 3DZ8A 1EFCA 1VG8A 1G21E 4EFLA 3PJRA 1W36D 2RGDA 5DYGA 821PA 4BLSA 1GP2A 5HKKA 2ZJAA 3AKCA 2J0UB 2CBZA 5JWHA 4C7OA 2QSYA 3ZVRA 2CHVA 2Y8EA 1COWA 1KI4A 2J5XA 1DAMA 2F1JA 2CMKA 4Q1CA 4NBSA 2H8KA 3QG1A 2A5GA 2HCJB 1ZM7A 4JLOA 4Q18A 4TWZA 3OIUA 4BFYA 2R65A 4C9BA 3PEYA 3ICQB 4B3FX 5HR5A 5KNBA 1N6PA 4D2IA 2R6FA 1AKYA 4CZ2A 1OB5A 3QQ5A 1Z0IA 1ZW6A 5EP3A 5CITA 1MO5A 3BGWA 4LY6A 4TLCA 2BHRA 4FW9A 3SYLA 3BH6A 3EA0A 2CCJA 5EP2A 2W2TA 3THWB 5IHPA 2UZIR 3LY5A 2C95A 1PZNA 3RS7A 5G3ZA 3DEFA 4G0NA 4PSKA 2IT1A 3Q7PA 4MKGA 2HDNB 4IFBA 1CRQA 4EUNA 1G5TA 1TUIA 4NZYA 2PMKA 4P4UA 2WZQA 2IUUA 3MJHA 1QVRA 3B1XA 1OSNA 1XJQA 2IYXA 1N6OA 2ZQ5A 4MA4A 4MRPA 3HYTA 4CEIA 1CJMA 1Q22A 2QPTA 2R6CA 1QHHB 5CYOA 1EFTA 2IYZA 3SOPA 1G7RA 1R6BX 4DSNA 4ZIRA 1W2HA 2OAP1 3U7HB 1WDTA 1E1QD 3E2IA 2QROA 3LBNA 4KHZA 4DZZA 4HAXA 4DDTA 1XTIA 4C2TA 3LLUA 3ND9A 3CKLA 4DHEA 5J4HA 1HEIA 2DCUA 3QVVA 4D4JA 4UNQA 1U81A 2V3CC 1E2JA 4GBMA 2AFIE 3IGFA 1WXQA 3UMRA 3KQKA 4II7A 2E9SA 2QG6A 1T8UA 1BYIA 4LC0A 2JDID 5FPSA 2RGCA 4EPVA 1M7HA 1E9BA 2NO7A 2QQ0A 5KSZA 1N0UA 5C46F 4WW0A 1Q21A 4Q9IA 1Z63A 2JATA 5KDLA 2ZJBA 1KK3A 3A4LA 5L8VA 3VR2A 1X8KA 2IX3A 2QT0A 3EXAA 3EZFA 4W5WA 3BH0A 1SKQA 4IVRA 3AEZA 1E32A 4RZXA 4F7WA 2D62A 4LCBA 1Z06A 3IHLA 4MYCA 1ZCBA 2NGRA 1T9HA 2P6NA 2B92A 4X8MA 3NVAA 4HDQB 4D6PA 2WWYA 4QG7A 3QSYA 1D5CA 4O2LA 1GUAA 2P5TB 5KSPA 2G0NA 4LUCA 1RKBA 4AWXA 4TZ6A 5HKKD 1OW3B 3I3SR 3RRYA 3IQWA 4ARZA 4G01B 5EJEA 2ZSAA 1AM4D 5DH9A 1W2GA 1Z0JA 2F1IA 2WVJA 1OHHD 3RRNA 1ZC3A 2HEIA 4JYCA 2VO1A 2ZM5A 3N2IA 5JLJA 3VR6A 5JMTA 2Z83A 4Q02A 2VL7A 1KNXA 4L9WA 4FCVA 4JVMA 1XNJA 3KXLA 4G5RA 1M1YE 3WBKA 4GMXA 4D4LA 1DAEA 3SBDA 4Q47A 5FPTA 4U5XA 2QBYB 1FMLA 2XZPA 4AURA 3ADDA 2GNOA 4B73A 1EFUA 2YYZA 4DLYA 1RPZA 4JKIA 3G82C 3Q8XB 1UBFA 4I1VA 1FQKA 3AVTA 4B34A 1R5NA 1U8AA 1X1SA 1UBCA 2X1VA 2ZR0A 4TLDA 4LV8B 2VBCA 4DIDA 4ZI2A 1E4VA 2V8OA 4XTCS 4C0KA 2C03A 2VP5A 5FOVA 2F43A 2ZROA 2GDJA 3DO6A 4JT4A 3F8TA 4WZAE 3L2OB 3GP8A 3EZ6A 3C8UA 3BJIC 1NVVR 1IXRC 4GL2A 3EZ7A 2KJQA 4V0LA 1P75A 5EE0A 3MJRA 3NWJA 3Q72A 4QGFA 1EGAA 4FWIB 1U0JA 1GNRA 4A15A 1DG3A 4CGZA 1XEFA 3K9GA 4X8LA 1KI7A 4LHWA 1YHNA 2RCNA 5GJBA 4PFSA 1KO1A 1U90A 5C4MA 2V6JA 1OFIA 4HZUA 2IBMA 4Q4AA 1AGRA 3CRMA 1ZP6A 5JRZA 2G1KA 4PPGA 3TH5A 3X1XA 1OH6A 2WWHA 5FBVB 1HA3A 3T1OA 1JR6A 2ZRKA 1S1CA 4UXJA 4X8OA 3T35A 2JAQA 3W8NA 2HJGA 1F2TA 3EWAA 1KO7A 2C99A 1ANKA 2GK6A 3X2SA 1FNMA 3WNDA 1E9DA 2WSSA 4LHXA 1IN4A 3FPAA 4B33A 3IIMA 1T3HA 3U6KA 3ZD7A 3BIFA 4OHYA 4PAMA 5B58C 1QRAA 2RGNC 3NBYC 5TARA 4RJLA 3ZS9A 1N5LA 1UBGA 4V0NA 4PQYA 4PSAA 3THYB 1KI2A 4RZ2A 4IEEA 4M1SA 1IN6A 2J0SA 3AVUA 2J7PD 2VA8A 4XSGA 4UNRA 4QBIA 2FFAA 4OK6A 5LDDC 3DKPA 2DWOA 1UM8A 4HDOB 1BO6A 1M34E 3CR7A 2QQEA 3SYKA 3U7GA 2VSOA 2H16A 2N1BA 3OESA 4PZLA 5F9FA 1NN0A 1P4SA 2GJAA 4TMXA 4HLCA 1GFIA 4HAZA 3ZZ0A 2HLDA 4GOXA 4MGYR 4A0GA 2VF7A 4TMWA 3UK6A 2D4HA 3VQTA 1J8MF 3LLMA 3NBZC 4HDCA 1CIPA 1XP8A 3U4QB 1ZD9A 3NC0C 1WE2A 5LB4A 3O8CA 3LX8A 4TSFA 1OIVA 2FFHA 4M1YA 1RE0A 1BIFA 2ZRLA 2XZLA 4QGAA 1G3MA 4BGDA 4D26A 3QUSA 2BJVA 2NZJA 1Z6XA 1N0VC 1Q20A 1QHHA 1SULA 1OXSC 2PX0A 3FB4A 1R5OA 2WHXA 3OE7D 4JLDA 3Q5DA 2OSBA 3FYHA 2WICA 2UVQA 4JLNA 4A2QA 2GA8A 2VRWA 5FOUA 2JLVA 2ZUBA 3B2EA 2H92A 4Q4HB 3FFAA 1EXMA 3RANA 2I1VB 4US0R 5KOYA 3QKRB 3SE0A 1Z8FA 4AG6A 4R7ZA 1KDOA 1RJ9B 1JQJC 3AVXA 4A82A 2ZJZA 4PHFA 1Y63A 1LF0A 1DVRA 3ND8A 1JI0A 5HZKA 1J90A 1TU3A 4NYJQ 4YDSA 2EWVA 1TF5A 3NKVA 3U4QA 3MWYW 2OBLA 4LOAA 4Q9JA 1PUJA 4PR0A 1ZIPA 4JJZA 1BS1A 1BYUA 4BZQA 3T1TA 4M4SA 4PHTA 3R9WA 2C77A 2ZRNA 5EQTA 1ZM3A 1KMQA 1KY3A 1W1WA 4JZKA 5E4FA 1KNQA 2AK2A 1GZSA 4F91B 1K8RA 2JJ1A 3I8SA 5L3RA 4MYUA 1DOAA 4Q4HA 4TMKA 1VPLA 4PQRA 4EJSA 4IXNA 3F0TA 3BFKA 4Q66C 3RWOA 4MDFA 3A6PC 1XCGB 4C0HA 4OI2A 1VG0B 4AKHA 2CNWA 1E2LA 2JLYA 1LS6A 1ZU5A 2F9LA 1RW4A 4OKSA 4BLTA 5J5CA 1HQYE 3GLGE 1NJFA 3B9QA 1G5PA 1TF7A 2OESA 2EQBA 2ZIAA 2ZI5A 1I4DD 2ONJA 4BEJA 3C5HA 3A1SA 1OV4A 3K9NA 3KKOA 3W3AA 4YMSA 4B47A 3I8XA 5FPHA 4GT1A 4IFEA 4HLUA 1E2IA 1IY2A 2QU8A 3W8RA 1SVSA 1W49A 1XD8A 3V00A 3LD9A 3VU9B 3CNOA 4LX0A 4RD3A 1A2KC 3NIBA 3BK7A 4I1SA 4RSGA 3CNLA 5AJXA 1G3QA 3SQXA 5K8IA 3U60B 4M1WA 2FE4A 3SBEA 1I2DA 3EC2A 4TMVA 5L3QB 3OFNA 3T15A 4Y0AA 1GKIA 5D3MA 1G4AE 4D80A 4JL8A 3GEIA 2PZFA 5FFMA 3QVUA 4XVUA 4YLGA 1Q1EA 2BEJA 3P1JA 5TVKA 2ZTSA 2C9OA 2FSGA 1IONA 1U2RA 3CW2A 1SVWA 4TYPA 3UMSA 4TT3D 3QF4B 1KSFX 3K9LA 2WJJA 4EFNA 1XTRA 2ZS8A 1JJ7A 2PEYA 1T0JB 4JT2A 4V03A 2PT5A 2NMVA 2ZRIA 3K70B 3QE0A 3QF7A 5BWMA 1U9IC 1QHNA 2Q3HA 2O5VA 2OZEA 2ZAOA 4DDUA 1K5GA 1GRNA 1F48A 1ZD1A 2EU8A 1F3OA 1NG1A 2IYVA 1OLOA 1S3GA 3A1TA 4P4SB 5A4JA 2IS4A 1X6VA 2X19A 2WWXA 2YV5A 3OAAD 2FOLA 5JCZA 1HURA 1VCNA 2CHQA 3W9YA 1D9XA 2FU5C 2ZRFA 1ESNA 2ZI4A 4G5SA 1IQPA 2BJWA 3CIOA 4HB2A 4EKDA 2NG1A 4A0FA 1TQDA 2BBSA 2B8WA 2OFWA 5AUOB 5BN4A 1T91A 2VEDA 3SFZA 3OFND 2EFEB 2FSFA 4GMDA 4WOPA 4YXWD 2BCJQ 2HUPA 2ODWA 3KUCA 3ZDQA 1G7SA 3KB2A 1E1RD 3R8FA 2QP9X 3ASYA 3GFPA 1A82A 1N6HA 4BZPA 2DWQA 5KSYA 5AR1A 1M6NA 2GEUA 1NMXA 3GJ8A 3EWSA 1OXXK 3LVRE 4NE2A 2WJIA 2ZRBA 5FOXA 5FI0B 4PHGA 5M04A 2GBLA 3DVLA 3RRMA 2BKEA 4ERNA 1ZUIA 4HEJA 2B21A 3AP3A 1DAIA 4TQ9A 3M0EA 1BMFA 3AF0A 4LBWA 1OFUX 2BMEA 5KO2A 2DFLA 2GVDC 2JLRA 1KO4A 3FMFA 1VHLA 2XEXA 3I73A 1KI6B 2O8BB 5BYJA 4ON9A 3BD9A 1S96A 3VR1A 2REXB 5HPYB 4DB2A 4LYFA 2G0TA 1WBDA 3BS4A 1MH1A 4QC2A 4B2LA 3CRRA 3KXKA 2PLRA 3U3KA 1IY1A 3OIWA 1YZUA 4WXPA 1D6JA 1Z0KA 4IDNA 1G291 3OHMA 4BE7B 1OXVA 2QY9A 1R5BA 1DARA 1YR9A 3K70D 2GEDA 2YINC 4DWJA 1OH7A 3RABA 4D0GA 4R2IA 1VMAA 1GNPA 2BM1A 4FWTA 1KI1A 2GJKA 5C1BA 3B7GA 2WSMA 4QHYA 2LWIA 3CRW1 2GILA 3GFTA 3ZZTA 2OBMA 2YZ2A 1F60A 2GESA 2H57A 1OYYA 1SVIA 4LPSA 3B82A 1XTJA 3LQRA 3ZZUA 2I4IA 4HUQA 3T1QA 3WYAA 1H8EA 1NLZA 1Q57A 3HU3A 4CEHB 1E9RA 3RSLA 1G8HA 4B35A 3VNUA 1T3LA 2IW3A 3KFVA 3B1ZA 4KVGA 4AY2A 5K8UA 5JWOA 1SHKA 1FMJA 5GADl 2BC9A 4JVLA 2R44A 4PAQA 4NPHA 4A2WA 1H65A 1II8B 2Q9BA 4FMBB 1KJWA 5C2JB 4QM6A 1VECA 3TUZC 2YHSA 2PZEA 3NC1C 3TSWA 8OHMA 4D81A 4ZIRB 1NG9A 3IUYA 1GRQA 3GJ3A 1DAGA 2CE7A 3TAHA 3AF2A 4C0BA 2QAGB 5FTKA 3A4NA 1CJTC 5AJZA 1GVNB 4LV5B 1DTSA 2OFXA 3R7WA 4LJ7A 4NCHA 3LH5A 2HF9A 4QNMA 4DB4A 1T3SA 4AI6A 1VIYA 3NDPA 1SZPA 1S3SA 2O8BA 2H5EA 2WOJA 4A0HA 2JA1A 2ZRMA 1E3MA 5BQ5A 2VPPA 3V4RA 1MO4A 2J41A 1AK2A 2HJVA 4ILEA 1J8YF 3TMKA 3BBPA 2RAPA 2Z0MA 3O8RA 3SJAA 1CBUA 2OFOA 3IPYA 2GCOA 3UIEA 1VG9B 2IWHA 1NBME 1CF4A 2FG5A 2G1JA 1NVUQ 1YVDA 4PO1A 2ZU6A 4MUAA 1HE8B 4URYR 4ACBA 2HXSA 4Q4LA 4EAQA 3CWZA 4AK9A 4DLWA 2FPMA 3ZQJA 2GBLC 3LX5A 1G7CA 1RZ3A 2E1RA 3KJHA 3GJ4A 5TDHA 4HI0E 1W36C 1ODFA 3TE6A 4BFWA 3K0FB 2TMKA 2V1XA 1RVDA 3MAAC 2FFQA 3R8CA 1QHGA 4EPRA 1E2MA 2XOKA 2QP3A 1XD9A 2WWFA 2WAXA 1W0JA 3QNUA 3MG9A 3RHFA 1U8ZA 3A1WA 2HYIC 1N2CE 4JBXA 4ASUD 1YQTA 1DELA 2NO0A 3B85A 2PMDA 1XCPA 1CS4C 3B60A 4QKQA 2QUZA 4Q7KA 1T0HB 2KWIA 3EAQA 3RS5A 2PH1A 1H8ED 4KSCA 1AN0A 1PLKA 4TLEA 1SKYB 4FCWA 5HTKA 5J40A 5TV2A 1AQUA 1RYHA 521PA 1GL7A 2P65A 2W2XA 1SXJA 1PJRA 5J4YA 2RGXA 1HYQA 3Q3JB 3RWMB 3VHXA 2IXGA 5B64A 1NIPA 5K8LA 1FL9A 1OXTA 4QRHA 4IDPA 1SVLA 1G17A 2IYSA 1N6RA 2ZR7A 3MD0A 4PTLA 3AKDA 1QBKC 3R20A 3W5JA 2XGJA 2OCAA 4CT4B 2F7SA 2IYYA 1E94E 3SFVA 3LW8A 2P6UA 3MMPA 2OILA 3C14C 1I4TD 4Q21A 4WXRA 4CEIB 3GLGB 4TYWA 4PO9A 1TQ2A 1P5ZB 1U0HC 2F3TA 3K70C 2O8FA 2AD5A 2J9RA 1U8YA 1XEWY 1II0A 3IHWA 2WJYA 2VP0A 1CJVC 1Q44A 3N2EA 3RS0A 3JZAA 3KKQA 4ARZB 1NLYA 1IJEA 4KAXA 4A1FA 2KI5A 4IKEA 5FL3A 4YXWA 1KJYA 3EPLA 2HV8A 4DT1B 1NBMA 3NHAA 5JS8A 2G3YA 5CK5A 5GJCA 1MOZA 1IHUA 1WP9A 4RZ3A 4BUJA 2OG2A 5EE3A 3N70A 3BB4A 4NCNA 1P2VA 2O8CB 4C0QC 1TPZA 1P73A 1VHTA 1ZINA 3CUEF 3UG6A 4ZDIA 1AJEA 4B74A 2WJVA 1P3JA 2J0QA 3GCGA 1DAFA 5CB8A 4MITA 2QT1A 1AGPA 1ZC4A 2QMOA 3SR0A 1NVXQ 3AKEA 2NIPA 1X86B 5CJPA 4DC9A 2ORWA 4M1TA 1XB2A 4P32A 4JL5A 1FP6A 1VTKA 2WSSD 3VX3A 3UWKA 4Z54A 1F2TB 4FMCB 3HU1A 3DOFA 3K0AB 3TUJC 1OIXA 3PENA 3AGPA 4H9GA 1YZTA 1PLJA 1EFRA 3KXIA 4LRWA 2WTUA 1ESMA 1GL9B 2ZE5A 2EFHB 2ATXA 2GVZC 2C9YA 2CCGA 4JJKA 1W0KA 3KKPA 1G3UA 1HT1E 2ORIA 1ZVQA 3KKMA 5A0FA 4OK3A 5DISB 4KVAA 5FTLA 3ZJYA 2GF9A 2GZHA 3QY0A 2XOKD 1NN1A 2H1LA 3REGA 1S8FA 1FP7A 1FUUA 1KHTA 2G6BA 3DMNA 3FHCB 3GLHE 1E9FA 1COWD 4MUBA 4I4LA 1Q0UA 4W9MC 4IOMA 1XWIA 3WMEA 1YR6A 4AC9A 5B57C 2R8RA 4LV6A 3ZLJA 3ADKA 4XWOA 1E2KA 1SVOA 1TL7C 1D8TA 2IUSA 4JBYA 3X1DA 1G4UR 3NBXX 1IN5A 4P0TA 1QG2A 4NKRA 1WB9A 3K09C 2L0XA 4DSUA 4BLRA 4CEHA 3RRZA 2OUKA 3QENA 5FUWA 1CXZA 2QI9C 2FN4A 1AS0A 4EIWA 1FQJA 4KO8A 2VH5R 1AS2A 5JJKA 3TW8B 5UKDA 3AB3A 3T5DA 2QPAA 2VHJA 2JLQA 1E2GA 2ZRPA 4QFMA 5FL7D 1DE0A 1MT0A 3TSZA 1UAAA 4ZKEA 5FUXA 2F43B 2GWHA 2GK7A 3ZYCA 1SVMA 1KSHA 4FINA 2C9CA 2DFTA 4F4CA 4NMMA 5AUNB 2CLCX 4A36A 3D6TB 3CWQA 3WNCA 1M8PA 2QNRA 1VYVA 3KTAA 3CH5A 3QKRA 4GP6A 2IHBA 1ZNYA 2J0VA 1R0ZA 1AKEA 3C4JA 4BLOA 1LNZA 1UKEA 5FBLB 5EE5B 1XPOA 4RKEA 1P2SA 4NCJA 1N25A 3EA5A 3EC1A 1NN3A 2OM2A 3K53A 1YZNA 4UNPA 1SGWA 2ZANA 4LPKA 3WBJA 1GDDA 4ZDJA 2Q9AA 4LJ4A 3MGCA 4IDQA 1NMYA 4LBVA 2YWHA 2BMDA 1S4QA 3IEUA 4FCTA 4RD2A 1ZM9A 5TB5A 3VTKA 1OT3A 2EYQA 4PC1A 5J4KA 2CXXA 1E2QA 2VSFA 1AZTA 3JVVA 5TMPA 3I4LA 3DKVA 4RD0A 5SZIA 2CLDX 2WOOA 721PA 2P0EA 3DOEA 5F2EA 2ZE6A 5AUQA 1E2PA 3AVQA 2PZGA 2QAGA 4YC7A 3BB3A 1US8A 2XTMA 4RCYA 4GNKA 2C96A 2ZRJA 3IIJA 2GZAA 4B3XA 3K0FA 4XOIA 3ONWA 4L5BA 5EP4A 3AVYA 2ZITA 4X8HA 4WBSA 1T6NA 1DADA 4BWYA 4MYHA 2XX3A 4G5GA 4IVQA 3U3RA 2HYDA 4QM7A 1NKSA 4LI0A 4LYJA 4LSGA 1P9RA 5DLQC 4A0RA 3WXMA 1Z5ZA 2B7BA 5CK4A 4Q1DA 4YDHB 1EFRD 4Q48A
chains in the Genus database with same CATH superfamily
1T2EA 4K9KA 4JXZA 3OPYB 2OFFA 5JARA 3W06A 2OORA 1DFIA 1FZTA 2W70A 3ITDA 5JCOA 4LMBA 1N2HA 1TT5A 4OQEA 2E18A 2C7QA 2BHNA 3KEQA 3QI2A 3VO9A 3ELBA 3F9IA 3GQBA 4G0UA 1OFHA 4O0MA 1LFAA 4TTPA 1DKMA 2C04A 2E5WA 2FVYA 3SJBA 3TB4A 3QKSB 3QX7A 3QXCA 1I7LA 4LSWA 2QYSA 5F5LA 1OXBB 2I2XB 4QRDA 1UBRS 3LYLA 3TCNA 2G0AA 3UMBA 3W8FA 1ZSNA 3NDIA 3VPXA 3W2EA 3E58A 4M1ZA 3NBQA 3RV3A 4MKRA 3F90A 4PAOA 3LVFO 1UKZA 3ENNA 4BATA 4LZPA 1E3JA 2ZRDA 1L4UA 3C5VA 4DMFA 1M76A 1EK2A 1KTVA 1LBIA 1UPFA 2HQOA 2TYSB 3DKRA 3WIDA 2WHEA 1C9MA 2WKQA 3L4BA 4DIFA 4TYYA 3ZXSA 5KX5F 1F7VA 1G5RA 4MV9A 3TLMA 4DRYA 1KWGA 1UH5A 1VIVA 2GKOA 2EW2A 2XBLA 3AR3A 1BRTA 1ML3A 4MMYB 5K3FA 5KYUB 2Z2IA 3TZQA 1E3IA 4Y9DA 1QYWA 3ZTYA 3RU2A 1ISIA 5KHOC 1P6XA 1ZUHA 2QA5A 4RPLA 4TQGA 1AV6A 2VRCD 2NPFA 5AFSA 3RTEA 2ZSFA 3GYBA 4UMVA 8AT1A 2HWKA 3BKXA 3O8NA 3T0IA 4EG0A 2IS6A 1DL5A 3RIYA 1R66A 3VVBA 3Q8KA 1BH2A 3C70A 3FTFA 3VZQA 4RTPA 1L1EA 4DAOA 1X7YA 1I94B 2PT9A 1EWTA 2SCUB 1FOEB 3TEMA 3AV0B 4AX8A 2XUAA 4IWXA 2ERCA 2VHUA 5DHPA 2H9IA 3FWZA 2PUEA 2X0EA 2IITA 1KJNA 3SJZA 2A5YB 2XUGA 3OWHA 4J1SA 3E1GA 1Y8AA 2ZI7A 1TEHA 1ZG3A 2V9ZA 3JQ7A 4ZVPA 4R16A 2X23A 4ZXPA 4TTAA 1DXQA 3NTXA 1QXSA 3AI3A 2WYOA 2NU6B 3ITEA 3E5MA 3EHEA 1ZK0A 2DJIA 4FXPA 4HPXB 1K2WA 4NULA 1DZIA 2REQB 3RASA 1L5QA 2CVHA 4KXQA 1ZZGA 5AM1A 2EBUA 1ZMRA 5JJBA 2BGUA 3ICEA 4B0OA 2PV0A 3CJQA 5H9VA 4DJAA 5BQXA 1D2AA 4PLVA 2JH8A 1UDRA 1SY7A 5CCEA 4RADA 1E7YA 5ABPA 1LPMA 1YS6A 2DP4E 5JQGB 4E2WA 4KDFA 3JZIA 5ALYA 4UPVA 2GXSA 5AJUA 5JO9A 4BNHA 3WJ1A 1PG5A 2AZTA 2BBTA 2J4DA 2PWPA 3D8RA 5E2IA 4BMCA 3Q2IA 2QN6A 4C2UA 3A6LA 3GVPA 3NTUA 2AHOA 4RMHA 1OBCA 1T5DX 2OAEA 2B99A 1D1QA 5JSHA 2CF5A 2IUFA 1AT1A 1VI5A 4BEVA 2NX2A 3AR9A 1PZXA 2C0CA 1JFRA 1RWMA 2H48A 3VJMA 3T7EA 3D0OA 2JB9A 1LRKA 1CRPA 2C0QA 5BN3B 4J7XA 2Q46A 2G06A 5EI5A 3QTTA 4GL4A 4OHRA 5FTJA 1QFSA 5DDIP 4J07A 3PI6A 4BUZA 1KOGA 1XRLA 2OCDA 4DRZA 1KQFA 4O5OA 4B2YA 4BFLA 5KYYA 1QUEA 3T06B 2JJ1D 3UA3A 1NQWA 1MJFA 3IBTA 3X2EA 3QEAZ 2G76A 4NATA 1DKPA 4I36A 4RX1A 5JU6A 2JGDA 3AEUA 5CEFA 1E4EB 3GP5A 4L07A 4BMSA 3KEGA 4GYWA 2Q27A 1JLMA 1ZBQA 2XMZA 4ZOLA 3I61A 3DLBA 3OQ6A 5EMMA 4O4IF 5EXTA 2CEKA 3ZD8A 2MWMA 3GP3A 3OSZA 1O3YA 3DD1A 3V1UA 1A88A 5LOVB 2DQZA 1QIDA 3FYUB 4G5XA 1KJ9A 5B7QA 5AI9A 4A2PA 2BV3A 1RT9A 5BV8A 4K8RB 3MTAA 2GBGA 1VFPA 2H1FA 4LVCA 3KTAB 3BSFA 3L7AA 4EB0A 2RHCA 3E2MA 1FSGA 4M98A 1NF8A 2B36A 2X3YA 3OT4A 4MUKA 4N6GA 2G8NA 2BEKA 5EZSA 2EF0A 1P17A 3TRIA 1I3NA 2AEMA 3T3HA 1JQKA 1L6IA 2FLVA 4B48A 3C3XA 1C9EA 2JAOA 4HGRA 1VJTA 2GH1A 2Y92A 3K1AB 2PANA 3E7PA 3H2ZA 3PVCA 3P20A 5KI6A 1A9YA 3O8LA 2XVYA 5FTWA 5CG2A 4TUYA 1ZVMA 1P5HA 3ED1A 4KXNA 2K7FA 1USWA 1ISHA 2XTNA 2Y77A 1TIKA 4YVFA 1YD7A 3PCRB 3NBFA 4AN4A 5F2KA 3W7BA 5ITWA 1MC4A 2FHPA 1E5XA 1KMNA 1CKEA 1NUTA 3N8DA 1GKUB 3DZDA 1FJ2A 3OZCA 3MMNA 3QEJA 3ESQA 1T4GA 2CW5A 4M0CA 5AKZA 3UUEA 2HLDD 2EVWX 1TAHA 1RJ9A 1V25A 3PHIA 2CNBA 2UXCB 1A9SA 1W93A 4FC7A 1MRSA 4IILA 5IT9A 1IJKA 1BWPA 1F51E 3WYDA 2Q21A 4ZT2A 2BOVA 1GPBA 4IS2A 1IDOA 1N2IA 3UG7A 4BFUA 4H35A 1EXWA 7AT1A 2CK3A 2O0MA 3K6RA 4NIMA 5EHIA 5K0BA 3BL5A 3WL8A 4C6TA 5LNK1 1KOLA 3IEKA 2QV0A 3RUDA 2QDKA 2C7GA 5TQ0B 2Q3CA 3ILHA 2YQ5A 4RD1A 2PSSA 2X2OA 1RQGA 2DUWA 5GVRA 1IUKA 1O4VA 5JAIA 2D5AA 1HZZC 1K4YA 4WN9A 1WMBA 1QCCA 2G9ZA 1V43A 3AW9A 3TKAA 4CYMA 3UICA 1C1YA 3KL4A 1A2BA 1G8PA 1Y1RA 3GJ5A 3AERB 4EOGA 1YASA 3OJXA 1JDSA 1PJLA 2QL9A 2NU7A 2YNMD 2VJLA 2VSYA 3PUZA 1SKMA 1CERA 1HE2A 3LVQE 3OPXA 4KLNA 3VRHA 5CDGA 2OOSA 3LPLA 3MILA 3ZGNA 2QMUA 1UJNA 2QB5A 4ZT5A 1YRHA 1H05A 2O9JA 2WDZA 5CDFE 2A78A 1GKKA 1UBEA 2JHGA 3IRUA 4N9WA 5KNCA 4NU6A 3HB0A 1KVRA 2VBFA 3CUYA 3QKSA 3ZH9B 3Q0IA 4BQRA 4JC4A 1IN8A 1K6JA 1T5IA 1ESZA 1QZUA 3WSTA 1CEEA 2AG0A 4ASUA 4EGAA 1CWUA 4NZZA 4NYMQ 1V11B 5I5GA 4Q34A 2G4LA 4MKZA 5IMSA 4R9SA 3LGSA 2YWEA 2VLBA 5IJ9B 4QOSA 4DREA 2VUUA 4D9FA 2W2VA 5FNVB 3C3CA 4LRXA 3V2UA 5JY6A 4CEJB 2JFWA 2H1OA 5B2EA 1XNHA 3B70A 4Q9LA 4MZXA 6NULA 4KYUA 2O14A 4RTRA 2XZTA 3BQNB 5B1IA 3IVMA 3O8OB 4YUAA 1IZ0A 1IY8A 4RA9A 3PTLA 3HN6A 3DDCA 4QUIA 4B7XA 5LKAA 4UBJA 2C92A 2VJDA 2Q2WA 5BV0A 1NDUA 1XD2A 4BGVA 2PXAA 4UAVA 1BKSB 2P1ZA 5E6UA 3HS3A 4DLSA 3C2QA 3CWCA 3KQPA 4W5OA 3FNEA 3C6ZA 4DY6A 2YMLA 4WERA 1NLUA 2VJYA 1TNDA 3MYYA 4IDCA 4KRGA 4I5FA 4HAYA 1L7MA 1SURA 2VCYA 4NOKA 3WI7A 4ADSG 2YS6A 1KGSA 4IIJF 3UGKA 1AKWA 3MJVA 3Q1LA 2DE0X 4QGBA 1N6NA 4LZZA 4YJKA 1TZKA 5ALGA 4O33A 4K40A 1H8HA 3NJ4A 1AMOA 1XI2A 4KXFB 1XEXA 3RFUA 4NICA 2XJ4A 5ENZA 4QULA 3SS8A 2ZTLA 2ZXUA 1WB5A 2AB0A 1HYBA 2I3AA 4MA5A 4BZWA 7REQA 3QU5A 2DHEA 1W34A 2DUUA 2XUOA 3L46A 1IZZA 1XRPA 5DLPA 4F4FA 3RUIA 3CX8A 2GFIA 3S1AA 1CC1S 3WAKA 4Y6PA 5CA0F 1HUQA 3JQ8B 4K05A 4Q00A 1KEKA 4QU9A 3AFGA 5KX5A 3B6IA 1TW3A 4B09A 5I9NA 2MMCA 3IUQA 4Q1AA 4P4NA 2QRZA 2WM9B 4ER5A 1Q0LA 4YV0A 1FS6A 3KUUA 3VMMA 3I01A 3LPDA 5G1PA 3TSAA 4B4VA 2C4UA 1X1TA 4DUPA 5BW4A 2FXIA 3P4XA 3PIDA 3I9JA 4KXMA 4NH0A 4PF1A 4C2AA 3QBVA 3D6MA 3NETA 3A2LA 3Q3CA 5JAUA 1E2NA 4LRSB 1LDYA 4X1OA 2QZSA 3ETCA 1BQ3A 2Z30A 4HBZA 4MCHA 3KLNA 3MF4A 3ZGYA 4CF7A 2OYCA 2RD2A 2OO5C 1P1BA 3GJRA 3IQIX 1UC4B 2AR7A 2WPDA 3MGBA 4ZA2A 1ZGJA 3RYTC 1NRXA 1T8YA 1H8HD 1JHMA 2GO1A 2IC5A 1ZH8A 1BE0A 2EHDA 2O3UA 4MWSA 1AF7A 4P08A 4UUBA 4GXRA 1CEQA 4RY2A 3KR0A 1U6KA 4UTNA 1TAGA 1QF6A 2C9BA 3LOQA 3QUTA 4K88A 3ROTA 4QO8A 3TZLA 2ILVA 1ENPA 3UXMA 4AY6A 2P2LA 3WLHA 4LFBB 4KFUA 4U8HA 3ZLVA 3DMGA 3LFHA 5CB0A 5AW8A 4F4HA 1E8DA 3UCFA 1WZIA 3QLUC 1E4OA 3NYQA 2REQA 2MYTA 2QYOA 4ZQEA 2EHJA 4DL9A 1L4FA 2AD1A 1U8FO 4PC2A 3ESDA 3PD7A 1KI8A 4DA8A 2Y1CA 3V97A 4TLMB 4EGFA 3A6FA 3VI3B 3DKKA 4GOKA 4R1LA 4QUHA 3C41J 4AIIA 3IXMA 3OC6A 2PZ8A 1FNBA 5IH7A 3OEEA 1PFWA 3AEKA 1E6LA 1GKYA 1M2KA 4NOJA 2VF8A 4HADA 3OEHD 4OSOA 1QU2A 3KJIA 1AO0A 2IF0A 1J2EA 3BMCA 4CL8A 1W5AA 2PUAA 1JZSA 1R15A 1A5TA 3AEQB 5AKJA 4YQFA 1WBBA 3GLRA 4HC4A 1CT9A 2V6BA 3BMOB 1PFQA 2R97A 4FFNA 3NEJA 5T4FA 4OHZA 2OAGA 2BTEA 4C21A 1I0LA 1A3CA 4K87A 4QYXA 4WA8A 4XD2A 2NNLD 5LIRA 4R9UC 1Q2XA 4G0ZA 4L9AA 4BBJA 2NUBA 1ID1A 4GE3A 2GEBA 1KE2A 1X1CA 2NVBA 3TSCA 2KMLA 4CJXA 3D31A 4GSKA 4P80A 2ZBUA 5C8YA 2CZGA 1THMA 2VHQA 1Y9DA 3MUNA 1DEOA 4FP9A 4LZLA 4KIGA 1J8VA 1ZRSA 2PX8A 3L4BC 2RH5A 1I1OA 1G6KA 1G59A 2BFFA 4LYGA 1C3OB 1JTFA 5MDHA 1TO2E 2LKCA 4EHAA 3TLAA 2NZXA 3ESZA 1STOA 3GPDG 1NURA 5GJVC 4AVYA 3C6KA 1U0SY 4UE3S 1YXMA 4Y1FA 3W2FA 1QP8A 4HDSA 5E7QA 1SOMA 4V02A 4D82A 1G64A 1L4KA 1UFOA 3OURA 4XVCA 4UCXA 1IHXA 2WVAA 2QRHA 5JXJA 1GL6A 4WZ6A 2YVQA 3ORQA 4BO1A 3EW9A 4G2NA 5JV5A 3U44B 5LOVA 4YRGA 3LW7A 3JQAB 4RHYA 3MQ2A 2WFLB 3O4FA 5ER9A 4ZOAA 4KUGA 2BZGA 3U4GA 1JDZA 4W7SA 2VSQA 2R6JA 4XD7A 5F5XA 3USCS 3MTGA 1D1PA 4FX5A 1FJGB 2YUIA 5EYPB 2NTYC 3GG9A 3R23A 5TPZD 5DHFA 1C0KA 1SG0A 3KE8A 2Z08A 4GPBA 3R8XA 1KK2A 1WA5A 1PJ4A 3DHVA 4RORA 1A27A 3PJFA 5DHTA 5FXMA 3H1AA 5A4MS 1MVNA 2CCKA 1Q6ZA 2NZUG 2OEPA 2VP4A 4U4AA 1TZMA 2ERYA 3AHJA 4BKMA 5HQTA 5F9HA 3OU7A 4CPDA 2QAGC 4ZCLA 1PL6A 3KQLA 1BD4A 1WY7A 1BNCA 4NK4A 2AR0A 5TF0A 1FFHA 4ENPA 3HP4A 3QELB 3JQFC 4D98A 3ZEIA 1L8OA 2NQ8A 6REQA 2QJRA 4TPKA 5D3MB 1M2WA 1TADA 1G8MA 1BKDR 3E9QA 1KEZA 2A67A 1Y6FA 3DAOA 5JBQA 3H1GA 3FHTA 3BERA 3G2JA 1VPTA 4WY8A 2EP5A 3GJ0A 1T5HX 2GYWA 1ARZA 3P9IA 3EARA 5CA1F 3ZKWA 1LWOA 4TL9A 1EA5A 1DBSA 5G41A 1GSIA 4CM1A 3PEWA 4OHUA 4EVQA 1CZRA 1XX6A 2OVBA 3AYZB 2OHIA 3BMNA 3QXXA 2VNSA 4ZP1A 1K6XA 1BRMA 2ZDGA 2ZI3A 2R4TA 2C4TA 4JNCA 3Q9LA 4Y1RA 5CTJA 5DM2A 4LE1A 1QX4A 1Q0ZA 3VBCA 3SOZA 1UPTA 1CZHA 2QP4A 4AN1A 3FYTA 1V45E 2XDQA 2O6HA 1W2WB 2PMWB 2HHLA 2OHFA 3BE8A 2GN4A 3BUSA 3GN1A 4WL0A 4Y2GA 2DEUA 1X1BA 4XVRA 4R01A 4DMRA 3KPWA 4DSTA 3CUKA 1MV8A 4ZZIA 5LIPA 1RZRA 1XK7A 1XLTA 2PQ0A 5FRDA 4DNFA 3MT8A 4QEZA 3R4VA 2X77A 2F59A 3TCXB 4MP3A 1SK8A 2HGZA 2P5SA 2SBTA 3T9AA 3IVXA 4H59A 2M6SA 1ZY2A 2GUGA 1DWOA 2PRSA 1DQSA 3AVWA 1HTWA 3HUEA 1E9AA 3KOZA 2ZM6B 5FOTA 3PL1A 3DZBA 4AZ3B 2ZKLA 3JQAD 4GYJA 4PGAA 3LP6A 3UQYS 3LAWA 2HREA 3VJKA 4LXIA 1FP4B 5EZYF 5G1NA 3G85A 4H27A 1UQTA 1XHEA 3UUWA 4IYRA 1KAOA 4M9XA 2BRUA 2FMFA 1RXVA 1HKUA 2SICE 3BXZA 1OI2A 4QOEA 4L3WA 4Y1EA 1HDRA 1QWSA 2I99A 1CF9A 3NAZA 3T54A 5KTYA 4WI1A 3IMEA 1BDBA 5AKIA 3RARA 4CI0B 3WJ7A 4D8VA 3O95A 1D6NA 1FRZA 2IGBA 3KDAA 4EG5A 3GUHA 1N8KA 1P7CA 1JAHA 3PA8A 1SA0B 1BVUA 1FF9A 1R18A 4NEQA 1RHKA 3I92A 1HDZA 5E1MA 2VHTA 1T5BA 4BN0A 1WETA 2AC7A 2X7XA 2QLTA 4OQZA 4EFDA 4WY2A 1ECGA 4EW3A 4K9NA 3Q7QA 2IX9A 1KJZA 1YRAA 3H4MA 4NNJA 4PG4A 3SEFA 3USES 1UEIA 1Z13A 1XWFA 4PG5A 2WWIA 3I3OA 4BUCA 3P32A 3K0EA 4R68A 4H4EA 1G2IA 4OXXA 1HT3A 3T1YB 1QH9A 4EITA 5AUPB 1DWQA 2BH2A 2VQSA 3A7DA 4TN5A 5FWDA 5K8CA 1QOPB 3TTXA 4GR5A 3O94A 4JKYA 3NTOA 3FJOA 3LECA 3HG7A 1GWNA 3KOMA 3SIPA 1DUSA 4NTZA 3WLIA 4ZCMA 3ITNA 1TFUA 4LE2A 3I9OA 3VDMA 4BNVA 4KW7A 4C3OB 4DQVA 1XVAA 3OJ0A 1X8JA 1Z5NA 1NNI1 2XITA 3AIMA 4IZ6A 5HILA 2EKLA 2JVIA 4AICA 3A3YA 2I4TA 4OJKA 1KZGB 4JR0A 1O89A 2G70A 3CPEA 2BPOA 1X9GA 4XJXA 3KZXA 3ZIAD 3HJAA 5LD2B 4FFWA 4YONB 4KZKA 3IQEA 3CX4A 4BE4A 2XT6A 3Q5EA 5CXSA 3M6AA 4U2CA 4E5KA 1MJHA 2VUTA 3H86A 1GKLA 2EF1A 4Y6LA 1W4CA 1WF3A 1ZOSA 2IWRA 5TC4A 1DRKA 4WEOA 5EZQA 3BWBA 5EXPA 1QHIA 4DT1A 3DLIA 2UUPA 5HK9A 1KP2A 2DERA 2B78A 3N2GB 4OEHA 3S3TA 3J81A 1B6SA 1X2EA 1NUUA 2OE2A 5D7BA 4ID9A 2F00A 1JQ3A 1QDUA 3BC1A 4YMWA 2FH5B 4OFBA 3ZE2B 1P5RA 3QVGB 1YVUA 1Y9JA 2NTEA 3BE5A 1Y5IA 4M9SA 4GZMA 1B76A 2CEAA 5FTMA 4ICIA 1NATA 4CMEC 5L45A 1ZD4A 1PW5A 2AJBA 4FNGA 2D06A 2WM2A 4MB2A 1VSUA 3QBTA 5K4GA 1CR0A 1WQ1R 3TPZA 3L7MA 4E4TA 4TKUB 5BV1A 3BFPA 3OEWA 4UQPA 1Z3CA 3OD5A 2OCIA 3TINA 3WDSA 4AYXA 3IHTA 2FAXA 5EJMA 1D2EA 1QANA 3T7TA 5C8YB 1P80A 2VT7A 1OZ0A 4OYHA 4BWVA 1RHRA 3SCZA 2PRYA 5HZMA 3AR4A 3FDXA 1OLUB 3Q5GA 4IO0A 3MUFA 1OQAA 2FPKA 1T4CB 4HWRA 3IP7A 5EKXA 4X7RA 3HRIA 4IDDA 2JIRA 1Z4OA 2E0IA 2XB6A 4HWTA 4LDJA 2EARA 3TD9A 2ADMA 2H5JA 3OZ7A 1P4AA 1C7RA 2VUSA 5IAAA 2UVPB 1GG2A 4HWSA 4KAJA 4LXYA 4E0BA 3VYRB 1I7NA 1NBMD 1RI5A 1C1HA 3TDMA 3TL6A 3S4YA 2AE2A 4AG3A 4ZCIA 3F49S 2BGTA 2GLUA 5H70A 1U2DA 1VCOA 2HM7A 1U0OC 1PQPA 1XZPA 2XYHA 3WQHA 3HE3A 1FDIA 4M0PA 1OILA 2CNKA 3GEGA 2ZEJA 3P27A 3E3NA 5BN4B 2H5IA 1X1AA 3F67A 2CKMA 1B74A 3M82A 4DBLC 3THWA 1P1RA 4NV1A 1CJKC 1Z8NA 4MWBA 4YT5A 1UAYA 2AQIA 4S1OA 5JDCA 4AKIA 1K8XB 1D8AA 2QW8A 1CQIB 3MSCA 4XDYA 3SY8A 1VJDA 3A26A 3BA6A 3DNPA 4N7BA 4G07A 3L05A 2VHCA 4F93B 3MRSA 4L4UA 3TLXA 5L3SB 2WUWE 2JHPA 1KR5A 3U48A 1T36A 4ENRA 2Z6VA 3U3DA 1J25A 1ZD8A 2UVPA 3K4QA 3L3BA 3W9BA 1T2DA 1U0FA 2C9DA 3GHYA 3SIRA 5GIPE 1P62B 4G24A 1XRMA 3OP1A 5T5QA 2EC5A 2HT6A 2RHRA 4LGCA 5BWCA 5BQOA 4UKDA 1OH5A 2G25A 3W3AH 1QKIA 3JWPA 2F1HA 2X5NA 2Y66A 4RFSA 3HADA 4RCZA 4I99A 1Z25A 1EFKA 4XFKA 3CXRA 4NENA 2V7BA 1YR7A 1YAJA 4NFHA 1JLRA 1YRWA 2MR6A 4GKVA 3U62A 5I8ZA 1XTKA 2QLBA 2XLCA 3QWFA 5KKNB 3M4YA 3FXAA 1DAOA 3FCXA 5B4UA 2HDOA 4QYSA 3HU5A 3RSSA 2BR5A 2VF4X 3CLKA 5BMVB 1R9GA 3P2EA 3ELYA 3V1YA 4MB6A 5LMUB 3MWGA 4WCFC 3ROZA 1EVZA 3WB2A 5G40A 2YMQA 5EP1A 1UF9A 1D0SA 2C98A 1VB5A 5C5IA 1W36C 3FOFC 4L2IB 4ETNA 3LLCA 2PUDA 4ESOA 3QPVA 4PFJA 1X38A 3TOZA 5ALXA 1JXQA 1VPDA 1Z2PX 2BBOA 4HNSA 3COJA 4URXR 2VBGA 2NPIA 4G4JA 4YFVA 3JU3A 1IU9A 4DBZA 1GM5A 3NUGA 5A9TA 5F2OA 5B1HA 4H7JA 1XFAA 2ZSBA 2GTHA 1PZEA 2C5GA 4R3WA 4NYMR 3MFYA 4BQSA 2RGEA 2QVBA 3SQMA 1N57A 2RARA 5DCYA 1TT5B 5DNAA 4M7WA 2IEGA 5JY1A 2Q8NA 3RKRA 3FFXA 5CEJA 1XDWA 2KBFA 4CIXA 3DLCA 4HJXA 2WQ7A 3QXGA 4OKIA 1BMTA 4J4BA 2CNDA 2NT3A 3EFOA 2D13A 1JKFA 1XKQA 1SHLA 3JAMA 2I7CA 1DSSG 1L5FA 3FRHA 3M9WA 4N3GA 4A6XA 2RHGB 1BVRA 2IRWA 2NNWB 3PFCA 3T9DA 2V3VA 1NV9A 1LV7A 2YY6A 2X7HA 3W5IA 4KJXA 1DAHA 1BN7A 4Y98A 2XGOA 3PDHA 1IN7A 1GGVA 2FN9A 2I78A 3PG5A 2F4VB 2ID8A 4CNBA 4WNAB 5IJAA 1WTCA 1HG0A 3C5CA 1QHXA 3PFIA 5BOSB 5CYPA 3UB3A 1G21A 1QRSA 4PSDA 3DBIA 5HCNA 1XELA 5IFLA 2R1TA 5K3OA 3EWNA 1J20A 3ROGA 4B6QA 4UREA 4JGBA 2TECE 1SCUA 4QLBA 2JLUA 2AL7A 2GJ9A 2JCBA 4PLFA 3K7EA 1GGFA 3O2NA 1G1AA 3CV3A 4QQNA 4ZMSA 2QTWB 1T9GS 1IATA 1Z2OX 2SCUA 4RL4A 1WZNA 1U0LA 1UJ4A 1OKKA 4Y9RA 3FCEA 4ZPJA 2WZDA 2ZRHA 1O5OA 3HJNA 4XA8A 5BRAA 3EBLA 1W35A 1RTKA 4CDGA 3Q88A 3HLTA 4NCKA 4QPDA 4FFVA 1ZD2P 3OU2A 4FQ8A 5C5CA 1TK9A 1EX1A 3ONEA 1LLUA 4FUTA 3D3NA 3S29A 2ENUA 2DT5A 3OY7A 4JFAA 3WKBA 4QUJA 4LHEA 4Z3KA 2WQ6A 3TIGA 4OU5A 4L02A 2FQWA 3OJLA 2WA1A 2X0FA 1UMCA 3PS9A 3MQ4A 3N3BC 3Q7IA 3TLEA 5FWYB 3PNKA 4QSMA 2HQBA 3HDTA 2GRAA 4N0DA 4X63A 3R2JA 1Q5PA 2ZWVA 3LI2A 5LZ8A 4QT4A 4WKGA 1W7AA 1Q16A 1XJ0A 1QCDA 3K4HA 3IX7A 4WKPA 5DGHA 1YC2A 4IXMA 2GXUA 3FKQA 3L1IA 2VATA 4PZZA 3OY2A 1DQPA 3T1NA 4CIBA 1FX1A 1KK0A 3OJWA 2VSXA 3KWFA 4RM3A 3AT1A 2AOWA 4JQYA 4I3HA 3SR4A 5KS2A 2HBYA 3L5KA 3HCAA 4H7KA 5P21A 1PNRA 4YP9A 3SQNA 4B40A 3ZK8A 2VXCA 3NOQA 3K70C 1RQRA 3PHLA 4HZUB 5BRNA 4XVHA 2IHJA 5JG7A 3OIYA 2HMWA 1IMJA 1CUYA 1XFDA 1YHYA 3DYBA 3JYLA 3O4HA 4CN8A 5JZVA 1AKTA 1JHAA 3I9V1 1V11A 3FOEC 2FV8A 3WWZA 3SZRA 3S1AB 1OZFA 4P7GA 1GAJA 3CFYA 2NM0A 2Q9UA 5DMHA 1FDOA 2AFVA 3TI7A 1UKVY 4TQAA 5E1OA 1IL0A 1UL1X 1RE1A 2QRGA 3B3QA 2MHCA 4B3RB 3CURA 2A7XA 4KI0A 4ROSA 4CIDA 2V7QA 3D5QA 1GCOA 2AF4C 1NI4B 2PWZA 1RWVA 2YOHA 3D0KA 3ZBQA 4OQXA 2NTJA 4QHSA 3ANTA 3T9FA 1EFAA 5K0GA 2Q5LA 2MT9A 5AESA 1ONBA 2PIDA 4O5AA 2IKQA 2Z3ZA 4S2UA 4AZ0A 4QSHA 3ICVA 4ER3A 3DMDA 1ZJJA 1W44A 4Q9HA 4J90A 5HS6A 4D4KA 1FA9A 3A0RB 5JWOA 2KW5A 2BDEA 4Q4JB 5FQOA 5IF9A 2NU9B 3T4UA 4ZO7A 2OHJA 1ZDMA 4V0ME 4KI7A 1C14A 3F2VA 4G89A 5C8YF 4Q1FA 2JK0A 3I5MA 4IXWA 4TWIA 3B3AA 1HV8A 4WBNB 3SJCA 4BEBA 3E6AA 3CSSA 2QIOA 3PXGA 3OZSA 3A58B 1UP7A 3TZBA 3DTVD 3OIVA 1MC1A 1SUEA 4YJHB 3SHTA 3VR3D 3A4IA 4UCQA 5CPFA 1PL0A 2YCBA 5CYFA 3F7MA 4IGAA 3VR4H 1PJZA 1QTIA 4NEHB 4CIYA 2CXSA 4IMRA 3OM1A 3QE9Y 2J3IA 4I1IA 2XDAA 1OJLA 3W5DA 3B6KA 4N82A 4YP1A 2YKGA 5LXTF 3NAGA 2DKFA 1YIDA 1I4LD 3KB6A 1YQWA 2RGAA 3P9PA 3HKBB 4HQNA 4DLUA 4FMDB 1E69A 4G2TA 4TMZA 2NZ8A 2A3RA 4RMNA 1RI1A 4BNGA 2PU5A 2Z5FA 1E7RA 2WPDD 3FMOB 4QX6A 1ST2A 2RB4A 1E4EA 5DN6A 2I65A 4B4KA 5T4BA 1FLDA 2EP8A 4WZAA 4N6OA 3IURA 5IWAB 2R1ZA 3R3UA 3U4IA 4NYIQ 1L2TA 2V03A 4DDVA 2A84A 1P9NA 3MRVA 8ADHA 5F73A 2I7VA 4FPXA 4TRJA 2Z6QA 3GX1A 4FSDA 4YRPA 1TJ3A 1T2AA 2PUHA 4HEQA 3QPDA 2JRLA 2O8DA 1CB7A 3RVNA 3CF4A 3O0TA 4M38A 4MWCA 5AKGA 1TEXA 2FPOA 2C97A 2ZR9A 2VLIA 1F9EA 4ZI3A 3IOCA 5D3KA 4R1QA 3WWDA 2HUNA 3RDPA 1P2TA 1AXEA 1DDGA 3T0GA 1K5PA 5GZ3A 2ECFA 4HTAA 1XPUA 2X8AA 5DBOA 2G40A 3W2HA 3GNTA 3IA2A 4WKNA 4MO9A 1T15A 3F3YA 5C1IA 3A04A 4W5RA 2W6MA 4J49A 2F9MA 5C18A 5AVSA 3CCCA 1OLSB 2C61A 3MT9A 3ZDEA 3UGJA 2LPMA 3D7MA 3T52A 4DQ0A 3PICA 4X6XA 1WXGA 4LCEA 4Y6QA 2DFKB 5FJJA 2ZSUA 3JQAA 3BJEA 1SU8A 3H5TA 2FFBA 3RRXA 1N5DA 2YJ6A 2R96A 4HYYA 1IAQA 1SN7A 2B4AA 1GRVA 1RQLA 3KD2A 3AIOA 4PGFA 4LJ6A 3DTVB 2AFIA 3MFQA 4KQWA 1PIWA 4XQ0A 5CA1A 2R47A 2JHFA 1T6XA 1VG1A 2QMEA 1KY5A 4DLTA 4YYZA 2XIQA 2ZPUA 4R1UA 2PQ2A 3GEHA 2A0XA 2NQTA 1EX7A 4LRUA 4Y2RA 3RVJA 4E2XA 5AM3A 4DNOA 5IPFA 3PIRA 2GPSA 3QM1A 3ABQB 5ADVA 4ZREA 2P3SA 5IAGA 2DETA 3PQ5A 1JQAA 1QGAA 1O08A 2V45A 2W6JA 3AFHA 3LDGA 3M70A 2CMFA 2Q5QA 1ZS9A 4RIIA 1HXHA 4G1VA 4B6EA 1VJ1A 2A5DA 2AC2A 1P0FA 2OLKA 1DEAA 2RGGA 3BKWA 3HYNA 4XW2A 2AZDA 2WBLC 4U7WA 5I7WA 5IUJC 2JLZA 3AL0C 4YJ2B 3U0BA 1HSZA 2PZBA 3KTOA 4FMCF 1CDEA 3W8EA 5IVPA 2KM1A 4J91A 5JYEA 3AW8A 4II2A 4YRAA 3L0SA 1TYCA 1WNFA 2PL9A 4JEUA 1Z0AA 4YAGA 3ZX5A 3VV3A 3TQCA 3KT8A 3FGPA 2ZUCA 1XYVA 3LXRA 1WXFA 3ZWAA 4KR2A 1GTRA 4PHCA 1Z4QA 4RA6A 2IS2A 4FMPA 1JHVA 3ERCA 2J1LA 2GK4A 3GA7A 2AN4A 1E6WA 3OM9A 3OTQA 4CXMA 3NNSA 2J87A 3PUHA 2C8VA 1YE8A 4MW7A 2P9TA 2LCQA 2B3TA 1KAMA 2BTOA 4DAEA 3TSYA 2E3JA 1F8YA 1GADO 1XCMA 1UADA 2Y1GA 4L9RA 3N05A 1NSFA 1YQXA 2QN8A 4KWCA 1CCWA 5B6JA 1NL3A 7REQB 2NYUA 1EM8A 1KQGA 4F8YA 5FADA 4CT0A 3U7HB 1NV8A 1OFGA 3G0GA 4HZIA 4IDHA 2RK4A 1N8SA 1W47A 5LLSA 2FP3A 3O7MA 4DRXB 4RXMA 2B8TA 1XLTC 3X1MA 3BMXA 3DD5A 2ZUDA 2YFYA 5HRCA 1N8TA 2IPXA 4EF4A 2O2GA 4JBWA 5G0VA 1XRRA 3G5AA 5IT0A 1XNRB 1JMKC 5C35A 4N3CA 3U26A 3UJ9A 3D8UA 4MS1B 1XTVA 4BY9E 2Q6KA 4NOLA 4XQGA 4RLHA 1NP7A 3ZHYA 1YAHA 2DBYA 3P2KA 4KIFA 4Y8VA 3BQMB 2XMPA 4MVJM 1QGED 4JEIA 1E79A 1JG4A 3D81A 3GY0A 4I8XA 3SVTA 2JEOA 1JG3A 1W59A 3KKZA 3NHRA 4BJ5A 3W1VA 1VE1A 1RKXA 5FUVA 1T35A 2YWJA 2O7QA 4KH1A 1QHEA 5F3WB 1YR1A 2PS1A 3L77A 3TPCA 4UBIA 2ONYA 1CJBA 2WR8A 1L5HA 5MHTA 2WG1A 2EERA 5L51A 4CKCA 2J45A 4DR5B 3OZXA 4MUHA 5IZCC 3GUVA 1TYAE 1JQBA 3WHLA 2JVKA 4DC1A 3NO4A 3OX1A 3LX4A 3V1KA 2AOUB 4CR8A 3CO0S 2O8FB 2J3QA 3EBPA 4KWHA 1I9CA 4IH1A 1I2CA 5IAJA 2WLSA 3FBGA 2H5LA 4UZSA 2DUMA 5JWRA 5AK3A 4ITUA 5E7JA 3TZCA 5TQVA 1CUJA 3AVOA 1UK7A 4WMLA 3WLNA 4F3KA 3ME5A 4AKEA 1KPIA 2JFBA 2ZYIA 2H7VA 3FJ1A 3PUJA 4GYKA 4IIHA 4CCYA 5K03A 2LNDA 4R2WA 4LGVA 2ZE7A 2XTAA 3NALA 4G3XA 4RSMA 4D92A 3BOSA 3F6YA 3KD3A 5HRAA 2PYZA 5SY4A 5LLDA 1O0CA 4MDEA 5JYDA 5CT4A 3LUPA 1NXSA 3FWYA 4U0JA 4S04A 3F73A 1H3EA 3R6TA 4YB8A 4DDMA 1H3FA 3KUXA 1PW7A 2EG5A 2XSZD 2G5PA 3L0IB 5AW7A 1Z28A 2Z4SA 4WLUA 2XCUA 1JIVA 3D6AA 4TZKA 5LBUA 1R7RA 5KDDA 4JV5B 2GZMA 3GLFA 4DLKA 2IS1A 3O1HB 4DM4A 1CU1A 4AQDA 5JS2A 4CDNA 1VBFA 5BXYA 1M7BA 1JHYA 3CZQA 1Z08A 2EBHX 3CW9A 4N6NA 2NVUB 4YGXB 4EBFA 2TMDA 3ZI7A 3SS7X 1EFVB 1PHRA 1PKXA 1RLOA 3OCXA 4ZOLF 1F8GA 3WGJA 4MLCA 3EEIA 1WV1A 2FF5A 5IWCA 1EK1A 1H0RA 3UYKA 2OLEA 1N8NA 2J9FB 2XNKA 3LNCA 2HFJA 4RTQA 1GUBA 4P3NA 4TMYA 1ZK4A 2QVGA 1A5AB 3R40A 3ZGXA 4J8PA 3CS3A 2IHTA 4P93A 5EJ2A 3THYA 2FP4B 3MWKA 3GLTA 4WK6A 2ZETA 3PQCA 4DIOA 2QLJA 5KREA 2PPVA 4X71A 3PFKA 4UHKA 4R0VA 1DBVO 4O2RA 5IDQA 2VQDA 1KO8A 4TXMA 1CR2A 1M0WA 1R3DA 2O2JA 1R6XA 3GLHB 5A5GA 3EQ2A 2G5CA 1P33A 1P3DA 1Q1QA 3C6MA 1E9SA 3AG6A 3PQ2A 1FTNA 3VYSB 2OV2A 4WBNA 2V74B 3TFQA 1N6KA 2XVZA 3D3QA 3OO1A 3T7IA 3VO2A 4EGJA 1UT5A 3PU6A 4U7TB 4CQNA 2B9EA 3PHHA 4PYKA 4CL3A 5I51A 4M8IA 1KBQA 1W36D 1DFHA 2AYYA 5TMEA 5E9QA 4MHTA 4A10A 2VNIA 1LK7A 1V8OA 2DKNA 4QOFA 2J0UB 4C7OA 2ZATA 4YAJA 2G9RA 4C4YA 4K9LA 2FPSA 1IXKA 4XR9A 1XRQA 5IVKA 2G80A 2F1JA 3EVFA 4L4SA 1NKVA 4TWZA 1JFLA 1W88A 3FTNA 3AUFA 3OIUA 4D4GA 1JZTA 4E5DA 4HEA6 2YW9A 3NQ41 4YACA 2