1DG9A

Crystal structure of bovine low molecular weight ptpase complexed with hepes
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
157
structure length
157
Chain Sequence
AEQVTKSVLFVCLGNICRSPIAEAVFRKLVTDQNISDNWVIDSGAVSDWNVGRSPDPRAVSCLRNHGINTAHKARQVTKEDFVTFDYILCMDESNLRDLNRKSNQVKNCRAKIELLGSYDPQKQLIIEDPYYGNDADFETVYQQCVRCCRAFLEKVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of bovine low molecular weight phosphotyrosyl phosphatase complexed with the transition state analog vanadate.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
molecule keywords TYROSINE PHOSPHATASE
total genus 64
structure length 157
sequence length 157
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 1999-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1dg9A00
4MS4B 1PEYA 2L19A 3C6QA 3C97A 3DGEC 4EUKA 4MS4A 1WETA 2YHAA 2N9UA 4G0YA 2E4UA 3H5TA 5KQPA 1E2BA 4WWHA 1JH9A 3H5WA 5IUNC 2HQOA 4KRFA 1IIBA 1ZH2A 1YK0A 4RXTA 1W9HA 3OLWA 4MR7B 1NXOA 2QVGA 1EWVA 3GYBA 4W5OA 5TPWB 4MLCA 3T38A 1Z26A 1BVHA 5TPZA 3N8IA 4N47A 2FEKA 5JNUA 3LUAA 1RZRA 3SNKA 4G0MA 5TQ2B 2FEWB 3QLUC 1GCAA 3IPAA 1NXXA 3KS9A 2OQRA 3RVSA 1JDNA 1DBQA 1Y1LA 3NHMA 4JASB 4KPYA 4HNQA 3CG4A 3LUJA 2FQXA 4CBVA 2V0NA 3JTEA 2H3HA 3TMYA 4G86A 1DCFA 4E7OA 3VNBA 3CU5A 1E6MA 2A9RA 3LFTA 4NQRA 3K9CA 4Z9AA 4Z4CA 4XASA 2JB9A 2QW1A 2MYTA 4KMRA 2PJUA 3MA0A 4UHJA 1AB6A 3UK0A 1BDIA 3OQOA 1U2QA 2R47A 3IP9A 3GL9A 3ILYA 5JNRA 1EFAA 3M9XA 3QEKA 1U0SY 2R4QA 1D1PA 3ROTA 3TD9A 1ZHHA 3O75A 4F12A 2JRLA 3JVIA 5CNJA 2H0AA 1LJUA 4YS6A 5FWXA 2BGGA 1RNLA 3BILA 1NXSA 3O1HB 3RVOA 5KI6A 5IULC 4MQEB 4Z0NA 2PUBA 3Q15C 2WMYA 2WJAA 3HUUA 1PNRA 1DBPA 4PE5B 4XFKA 2NT4A 9ABPA 2R25B 4W5RA 1JFSA 2QR3A 3MIZA 3RQIA 2WY2D 4G0ZA 4M88A 2JVKA 4Q7EA 2FW0A 2MSWA 3L49A 2PMCA 2Q5CA 5HSGA 3RVNA 3JS5A 4G0XA 1DCKA 2PUCA 3FFXA 4W5TA 1U04A 4MAAA 2VYCA 2PL9A 3N6VA 3F6PA 4KQ9A 3OO0A 3I09A 3A0UA 5DGCA 4JOQA 3P9YA 1DJMA 3EAFA 4JP1A 4LX8A 2F8SA 5EWLA 2PUAA 3SG0A 3OLZA 3LUKA 5FWYB 3M6MD 3H5OA 1T34A 3O2SB 3EQZA 2YHBA 1BDHA 2GBPA 3KLNA 4WXEA 3DBIA 4PEVA 2RDMA 3CZCA 3GWGA 4KREA 3LOPA 3CTPA 3F73A 5IUJC 2JBAB 3T8YA 4UHKA 4RKQA 1JDPA 2RJNA 4QICA 3GV0A 3ROFA 4YRZA 1M5TA 1QKKA 3Q7SA 2HQBA 4RSMA 3HEBA 1NATA 3KSMA 4MRMA 2VUHB 3JVDA 3GBPA 2CWDA 1DRJA 1L5YA 2WRZA 4KK3A 6CHYA 3HO1A 3QLVC 1DBWA 2CHFA 1D5WA 4RK0A 2ID7A 4S05A 3HXMA 2PE5A 1ABFA 3OQMA 5T7BA 2PAFA 4RWEA 5PNTA 3OQNA 1M2EA 4DQDA 3MF4A 3HDVA 1JHZA 4D74A 5HM6A 1ZVVA 3H1FA 5BQ3A 2J48A 1GLGA 1MVOA 2WB4A 3RVLA 4RXUA 5KQGA 1QNLA 2LPMA 2E4WA 3HS3A 1A2OA 4LE0A 3RVMA 2NZUG 1USIA 4Q6WA 1DP4A 1DRKA 4LE2A 5D2CA 3UUGA 1XHFA 1YK1A 1ZH4A 4L4UA 1C4WA 1FQWA 1Z12A 1ZN2A 1ISSA 3SAJA 4MS1A 3RVQA 2PLNA 1YVUA 3JY6A 4GPAA 5C5EA 3EULA 8ABPA 3Q7TA 4EVSA 5IEJA 2P4UA 1W25A 4TMYA 3NNSA 4OATA 1PUXA 3CG0A 4XAQA 5TQ2A 4YO7A 4TLLB 4RK6A 2PUGA 4F06A 1KMIY 2I6FA 4P1ZA 2NUBA 1XWWA 2MYPA 3HUTA 1Z25A 3MM4A 1MB3A 4S04A 3H6HA 4RK5A 4OLBA 5DTEA 4D6YA 3NHZA 2JBAA 3EODA 3LUCA 1ZGZA 5TQJA 4IF4A 3H6GA 3I45A 3VNAA 2PUDA 1F51E 4IMIB 4QYMA 4KK4A 4NCAA 4OG2A 4PZ0A 3SY8A 2GI4A 5KWSA 1YS7A 4NCBA 1S8NA 4MPTA 4RS3A 5EWLB 3RVRA 2FN9A 3CFYA 4ETNA 3GA5A 4WUTA 3D02A 4MLDA 4YGXB 3GT7A 5FBHA 1FFWA 3TX6A 3A0RB 4MS3A 3IP7A 1TJYA 2E4YA 5B3JA 1EAYA 3IPCA 3URMA 2JK1A 4N03A 4QPJC 2PUEA 1ZESA 3C3KA 4MRMB 3HK2A 3OLYA 3RVKA 2L2QA 1LBIA 4Q6BA 2MYUA 4RK4A 1KRWA 3CHYA 2MSKA 2WWVD 3E61A 5JNSA 3Q41A 4L85A 2IPMA 1Z17A 5CNIA 4EYGA 2GWRA 5IC5A 2KYRA 3O1JC 5B3JC 1KGSA 3W9SA 3BREA 1HEYA 3HZHA 2ID9A 2FTKE 2F8TA 1Z18A 4YWHA 2FEPA 3IDOA 3EGCA 3FFTA 4LE1A 4EYKA 3G1WA 4N41A 5HKOA 1P6QA 3DLHA 2A9OA 4Z4FA 3MQ4A 2HSGA 5DCLA 2P9HA 4Z9BA 1RXIA 2FMFA 3KJXA 3DGFC 1U8TA 2E4VA 1NXTA 3H5VA 5DLEA 1FSPA 2FKAA 4RDCA 5IX8A 1DC7A 5T3YA 1NTRA 1Z16A 4OLAA 4RZSA 4G0PA 1D2AA 4MR7A 3GBVA 3KYJB 1EHCA 2L17A 2PUFA 2HQRA 3G85A 1BAPA 1E6KA 1QMPA 3O74A 4IRXA 2QSJA 4F8JA 2MYNA 1JLKA 1QO0A 4TN5A 4FE7A 5HQJA 1Z15A 2X7XA 5ED4A 4H3KB 1ZY2A 3O1IC 1A04A 3UKJA 1SXGA 2MSLA 4IILA 2AYXA 3FFWA 1TLFA 4XARA 5EWJB 3Q7RA 3KCNA 2FVYA 5KC9A 3LMKA 4YV7A 5FWXB 1YMUA 4ETIA 4N0PA 4YLEA 4KFCA 2ZAYA 3O2JA 4D6XA 5KC8A 3E3MA 1RZRD 4KVFA 1QPZA 1A0OA 1FFGA 1P2FA 1YS6A 1OXBB 3H5IA 1JWLA 4WXMA 3S99A 1DG9A 4MGEA 4Z4IA 1ABEA 4DADA 4O5AA 1Z2EA 1RPJA 2RJOA 2A9PA 7ABPA 2XDYA 1VKRA 1MB0A 3LUFA 3RVJA 3HVRA 1M5UA 3TO5A 5KQMA 3C3WA 3N0XA 3CNBA 3MYYA 1RXEA 2WJWA 4XXHA 3N0RA 5CNKA 4G0OA 1U2PA 5TPZD 2VK2A 1CYEA 3O2QB 4JB0A 4MQEA 3N0WA 3OO1A 1NXPA 4EGSA 2TMYA 4OTZA 4MYRA 4WZZA 4G97A 3M9WA 3OM1A 3F6CA 2QVCA 1JBEA 3HJFA 3LUGA 4RXMA 4ZJPA 3BBLA 3LTEA 5IEBA 1VRVA 2AYZA 2B1JA 1K66A 2FXIA 3F7NA 1QQAA 4HYEA 2E4XA 3I42A 4MR9B 1EWTA 5GOTA 4N76A 5IBQA 4JAVC 3CS3A 1NXWA 4YP9A 3LUDA 1KRXA 4DN6A 2FMHA 2GKGA 4H3HB 3QLTA 1LBHA 2FQWA 1LJLA 3CZ5A 3N75A 3CLKA 3KKEA 3HSYA 1QP4A 1B00A 5JNVA 3EDCA 5DKFA 4F3TA 1Z13A 5TQ0B 2IPLA 4MQFA 1K68A 4LRQA 1YIOA 5JNTA 5TQ0A 1CEYA 1UDRA 5KQLA 5EWJA 2FMIA 4RY9A 3T6KA 1PEAA 3KYIB 4KV7A 1PNTA 2IDMA 1FFSA 1TMYA 2JVIA 4Y9TA 4Z4GA 3RH0A 4O1HA 2FMKA 1XHEA 1DC8A 1DCMA 4FE4A 2LUOA 2LBPA 5BR1A 5JS1A 4LZLA 2B4AA 3DZDA 4B09A 4KQCA 1JFTA 3FGZA 3QX8A 4EY3A 5C5CA 2PKXA 2PL1A 3BRQA 3JPYA 3C3MA 1MIHA 4MQFB 5CNMA 1DZ3A 1JYEA 6ABPA 2HJ9A 4EYOA 1P8AA 2QU7A 4N0QA 1L5ZA 4RK7A 1BA2A 3HDGA 1NXVA 3I5AA 3QX9A 4Z4EA 1QQBA 1ZITA 3L6UA 2QXYA 2FQYA 1CHNA 2JVJA 4NICA 4RU1A 3GRCA 3IP5A 1NY5A 1USGA 1QP0A 3N53A 4OBBA 3OMXA 2L18A 1PHRA 2GX6A 4O1IA 4TLMB 1J56A 1USKA 1YMVA 3QEMB 3TB6A 1JX6A 2VUIB 3SQNA 5BRJA 3QEMA 5BRAA 1R8JA 2OENG 1SD5A 2FN8A 5EWMB 4ML3A 3LKBA 2ZWMA 5E3JA 1BDJA 3HV2A 5EWMA 4LDAA 1ZAYA 2LP4Y 4JB2A 4MR8B 1SXHA 2A9QA 3FDFA 2CHEA 3HCWA 4W5NA 1GUDA 1MAVA 5JNWA 1P6UA 1SRRA 1ZGGA 3NBMA 4G0QA 1GUBA 1JYFA 1ZDMA 4Z99A 5TPWA 1TM2A 1GCGA 3HM9A 4W5QA 3H75A 2DRIA 5F64A 2IPNA 5CHYA 3NNNA 4EVRA 4EVQA 2LIVA 3OM0A 2QV0A 3ILHA 2M1ZA 2IPAB 4ZPJA 3NNDA 5FWYA 4MR9A 4EYQA 4ZMRA 2HPHA 4PYRA 4IGAA 4JA2A 3RVPA 3DLBA 3BRSA 4RY8A 4PICA 2FSPA 3FMVA 4HNSA 1M2FA 3IP6A 5GQSA 4RY0A 4E7PA 1JFVA 1JL3A 4WT7A 3SM9A 3A3KA 1Z2DA 1C0EA 4Z4HA 1OXKB 4YR7A 4ETMA 4LDZA 4F11A 3CRNA 4H60A 3H5LA 1QO0D 3H1EA 2O20A 1VPWA 2R48A 3OLVA 4RKRA 1YTUA 2IOYA 3MMNA 2M98A 3H1GA 1LK0A 3KHTA 1F4VA 4ZYLA 3LUHA 2IKSA 3EJWA 2E4ZA 3Q9SA 1JF8A 3EQ2A 4GNRA 1D1QA 3KG2A 3KLOA 3OLXA 3K4HA 3O21A 5TE9A 5IUKC 4P98A 1D4ZA 5JS2A 4ZMSA 1APBA 3R0JA 2JCGA 3QLUA 3QLVA 3KTOA 2W42A 4NV3A 1ISRA 2RGYA 4RK1A 4FB4A 1AB5A 3QELA 1I3CA 1VLZA 1QP7A 3JPWA 2IYNA 2FLKA 1H9CA 2QZJA 4YCSA 3A10A 4XLTA 1SXIA 2NZVG 4MR8A 5I4CA 3CKMA 5ABPA 1EWKA 2NT3A 3T95A 1E6LA 3QK7A 2CD7A 4MS3B 4RV5A 1TVMA 4QYWA 3B2NA 1URPA 3LKVA 4MS1B 3OMWA 5FBKA 3D8UA 4KNYA 4IMJB 4KZKA 2FLWA 4HNRA 3QELB
chains in the Genus database with same CATH superfamily
1XV5A 3DNFA 4U2DA 2XCRB 2ZCJA 3QITA 4URWR 3GPDG 1WVMA 3BFXA 3OZDA 5SZKB 4GWGA 2G4CA 1T0JB 3ZLJA 1N2HA 2XOXA 2YWEA 5CK5A 2DFLA 2E4UA 1A9QA 4RVDA 1OWNA 1GPJA 4HQ6A 5IFLA 4Z0HO 1G7TA 1XVVA 3BGWA 3HP7A 4PTZA 4DSAA 1LC0A 5L3RA 4BXOB 4LZZA 4RCZA 1CIJA 1OZGA 3P2MA 5AJXA 3QENA 2SECE 4XIFA 4R54A 4RJIA 5K3BA 1G8PA 1Z26A 3A4LA 4US2R 1U2DA 5L3QA 1UOPA 3LLVA 5JNUA 4UAJA 2RGRA 2JKZA 1JJAA 3QPWA 3HDTA 2WYUA 1LXCA 4RF4A 3R6TA 3R77A 4H6WA 1P44A 3R20A 1WPRA 2GK6A 1X7YA 3HWSA 3DKVA 4DR7B 1H4VB 5ICGA 3D6NB 4MX8A 1GL9B 3GDHA 1PHPA 3TMYA 1JDVA 2NU7A 3K6RA 4BN0A 4Q4DA 5EPUA 3AOEA 4JLMA 4HDNA 1P62B 3NDRA 4KO3S 5F7OA 2AKYA 2QRKA 3HB1A 2PZMA 2VP0A 5AM0A 5JZMA 3PWZA 1OLSB 2B92A 3E9DA 4MK4A 1QHGA 4DYHA 3IHWA 2OLKA 3CMCO 4HGZA 1ULZA 4QUBA 1SC6A 1RWWA 1V37A 2BJVA 4HDCA 2G77B 2Z5GA 4GE3A 1USVA 3SEAA 1IOLA 4BNWA 3UOGA 4NP6A 2IXDA 4QQ8A 5DIZA 3GLGE 1THTA 1U99A 3U44B 3TL3A 4O33A 4AM8A 2Q3LA 4K3UA 5BWOA 3QH4A 3N2IA 3B7WA 2GT1A 3MGAA 3IAUA 1H2YA 1GGHA 1T6NA 4ACAA 1DKUA 4ISBA 1TZBA 1SUAA 3LX6A 1IXYA 5AM1A 1ECLA 2EJTA 2ZB2A 4JLPA 2X0EA 3VJKA 3VTZA 3ENQA 1T9AA 4KXMA 3WR5A 2A9JA 4HNAB 4UDYX 4YJHB 5CAEB 4OSOA 1UK7A 1IDOA 3U4CA 3X2SA 4AD8A 1T0IA 3ZWBA 1TM4E 5FCDA 2G1KA 3IUYA 5IJXA 5J40A 2ZSJA 1RJ9B 2GKOA 3MIZA 4L74A 2PMFA 3WNQA 1G8HA 3N2YA 3HCAA 2QHXA 3SNHA 4TVSA 4H7DA 4GHWA 1GRVA 1CZOA 3CIOA 4M88A 3W1WA 2B7LA 2Q2QA 1ENPA 1MJGM 1YHNA 3IP1A 3JYNA 1KY5A 3O92A 3OTWA 4W82A 1FNMA 4AJ1A 4BRSA 3I4CA 1YI1A 2GHQA 2OK8A 4RLHA 3NU1A 4D81A 2D7DA 1Q57A 4EVSA 1DO2A 4G0XA 3RTDA 1U80A 3ANYB 4R9SA 1JRLA 4ECEA 2O5RA 1A69A 4RA6A 1VJRA 4YR9A 1FNNA 4N3CA 4EUFA 2NZ8A 2OESA 1L0BA 1D2RA 4I4NA 1HUQA 3T3GA 1Q1BA 3TLJA 4DNFA 5B3KA 1DJMA 1PEDA 3F49S 4IFEA 1BQ4A 1J06A 4OB7A 4Q0MA 4NCIA 4US0R 1J5XA 2HA4A 1OB2A 3QFHA 1FYFA 4ZT2A 1ECJA 4LXIA 3O1LA 2DWPA 4E5PA 3ROZA 4IGIA 1ZQ1A 2QN3A 1K7FB 2PKCA 1RTTA 4TMVA 4DR3B 3T15A 2VXOA 1QH9A 1X7GA 3LO8A 4UHKA 4P32A 3T8YA 2LZ0A 3NHYA 1QX4A 2ZK7A 5KSOA 4EB0A 1T4MA 3KJGA 2ZUUA 1B41A 1MO3A 4QICA 5LZ8A 1Y37A 3WLNA 1Y4DE 5CFRA 4AK9A 2RGWA 4OJQA 3QVJA 3G2HA 3AVUA 1NBWB 4XEUA 4PANA 3QVKA 4Q93A 1PK8A 2O7RA 3FVRA 2Y9PB 3GRAA 3MS7A 3DAFA 4XWYA 5DLQC 4BBAA 2C5SA 2XECA 4TV9F 4DMLA 4UEKA 5HF9A 1Q5PA 2ZBEA 4GMDA 1Y8AA 4X92A 2X8JA 2P90A 3W5UA 2YTZA 3MWFA 1T8RA 3FTCA 1AKEA 1SVLA 3OQMA 3T1TA 1IH8A 1N2SA 1R3UA 2ZRGA 2IHUA 3B3FA 5E9QA 4EPXA 3PE6A 4DDUA 4ER7A 4JI7B 4JCCA 5A0VA 1NW9B 2GPSA 5ALFA 3IDFA 2I4IA 1QGZA 1VL8A 3FBWA 4PO1A 3T9DA 1ES9A 1UKBA 1UMDB 1VZ3A 1VGQA 3PICA 4LXYA 1MVOA 2P3QA 1G8FA 1NJGA 4OGWA 4AJKA 4D9BA 4BFXA 3BWEA 5IJZA 1JEEA 1USIA 4RWZA 2DCMA 1E9FA 1AO3A 1EWRA 1RTKA 1YQWA 2YXNA 3NKVA 4Y2PA 3GY0A 2JIRA 5IN5A 3CUKA 4XSGA 5BUSA 2VCYA 3TNDA 1HNZB 3QTTA 4NPHA 2Y2UA 3H4VA 4H4CA 4KLAA 2HA5A 4EDFA 5BNWA 2EL7A 4URYR 3WXBA 1D4OA 2DECA 3I53A 4LQDA 1UP7A 2BMAA 4IFTA 3D2AA 4BO1A 4TTTS 3GW8A 1DEOA 3ND6A 1II8B 3R8XA 1XDWA 1R9MA 1FPMA 1XGKA 2ZXEA 2RG1A 2C2YA 4FOSA 1YZVA 5DGTA 3IKLA 1YKFA 2DBVO 5AOCA 3ZDCA 2GNOA 3OIVA 2PRZA 4UU7A 1J2TA 3MM4A 5A4JA 2IEZA 3UT5A 2BSXA 4BX8A 4LJSA 2P2LA 1KY2A 4AMGA 1V8DA 3PDJA 2AFHE 1QIHA 2ZLBA 1KSFX 2FHPA 1YDEA 4MB0A 5TQJA 5JXHA 2JFPA 2XEDA 1NGSA 4LC0A 3ZZTA 1H0HA 4TZTA 4P81A 3CJQA 4IMIB 4IVQA 3NQ41 4US1R 2WWGA 2PPVA 5T5QA 4E32A 2IYFA 2OKCA 3GFTA 1A4RA 1BW9A 1Y3FE 2PLFA 1YC2A 2ZULA 6GPBA 4LXQA 1SBIA 2JIZD 3TLGA 4RVOA 3DOIA 5F77A 3REFA 5IAAA 5K2OA 1Z4NA 3C48A 2PUVA 4IEIA 2VHWA 5DTIA 5FORA 1Q1QA 1NVFA 1M2NA 4P83A 4BE9A 3OOWA 1U28C 3U3MA 1F6BA 4YONB 3OEHA 4HDMB 1JR3A 1M6EX 4QO7A 1ZGAA 3IP7A 1NF2A 1NP6A 1Q2XA 1KZGB 2WE8A 3OICA 1EFUA 2WAOA 4QPJC 3TW4A 3IEIA 1G3QA 3KVVA 3QE3A 4KYUA 4NR0A 3UXMA 1OSNA 2WM9B 3RIGA 1GVNB 3AF0A 2X5OA 3ZKWA 4I81A 3W79A 4WEQA 2VBGA 3A1SA 3OLYA 1SQ5A 1KJYA 2F8MA 4RD0A 1O5OA 4YI5A 1F2DA 5TEWA 4AMYA 1NQTA 3FNFA 3GAZA 1N36B 1I01A 2EIHA 3FM9A 3MMXA 3P19A 1A98A 2GFHA 1KOGA 1FRFS 4GOMD 2WWVD 1XVTA 4AG3A 1GFIA 2PEYA 4OQXA 2P9CA 2V9PA 3A4NA 2IPMA 1KWKA 2Q3JA 2ATEA 2WFMA 1TEVA 4YUZA 5JYDA 1PTJC 1YCGA 2HD4A 2IEGA 2D1FA 5HM8A 1HEYA 3M9LA 2BRUA 5JIBA 2VKQA 3B5JA 4XW2A 3OKFA 2ZROA 3GELA 4A23A 3IYLW 4AS1A 1GN8A 1W47A 1R6UA 1Q0QA 2XGOA 3G8BA 3GDOA 1FFXB 2BJWA 1X9GA 4WV3A 1UKZA 1C1DA 4Z4FA 4RD3A 2FOLA 2M6SA 5JSKA 1WLYA 3GMIA 1L5QA 2AQIA 5DLEA 4LISA 1P2SA 1SR8A 2Z2ZA 1VSVA 1DC7A 4B83A 2ZREA 1EXDA 1VG8A 1Y6JA 4OPMA 2GBFA 1EWQA 1EEXB 2HMSA 1XYGA 2C5AA 3IXLA 4G5YA 3U48A 4OYLA 3ZQKA 5H9WA 1LSSA 2MYNA 1A7AA 1ZM7A 3MFQA 4Z7NB 5AMXA 1UEJA 1II8A 4RIFA 1ITZA 3HKCB 1R5BA 2IDZA 5HK8A 4FLMA 3QOFA 1T4CB 1EVLA 1PEKE 4LFBB 3P9KA 2WFAA 4OP1A 3RWMB 1COWA 2HJRA 3WLIA 2HK7A 5BUQA 5FLKA 4Q3KA 4UBLA 3DULA 2VEDA 4PR0A 1VL6A 5AVJA 2AUTA 1P91A 1EDEA 1U3WA 2CHGA 1UDAA 4JBWA 2RHGB 1QQ7A 3Q88A 1AC5A 1M6NA 2PQ0A 4A7PA 3E22B 2BBSA 4IDNA 2X4GA 4WW0A 3NC4A 1NURA 4MSUA 1ONPA 3ZCRA 1VI2A 1P2FA 4G8JA 4CLEA 1JHUA 2DY0A 2J3KA 3IT0A 2REQB 2O2SA 3SZLA 5BQFA 2YWJA 1R8XA 4UHEA 2HCJB 2OXEA 3B9QA 4JELA 2WHXA 3K2BA 2Q5IA 2Y9MB 1GUFA 1MRSA 3THYA 3JQFC 4NBKA 3W2IA 4M99A 2BF4A 4LX0A 3B6MA 4AO6A 3EGVA 3L0BA 1FRNA 3IXMA 2BEVA 1KJWA 2YN4A 4REMA 1P7PA 4RLSA 4RZUA 3D6HA 2VK2A 4YPVA 2C59A 3QKSA 2VZEA 4J1NA 1KH3A 1YRLA 5CT8A 2B30A 1UZMA 4X5OA 4OTZA 4MYRA 1Z8HA 1HLFA 1WM1A 3AM5A 1EXMA 1US8B 4KQKA 4PAWA 1OLXB 1QAOA 1RWVA 1NMEA 2E89A 3L0OA 4X6XA 4PYKA 3AJ9A 1QU2A 3LTEA 2C0QA 3P9QA 2IH2A 4A0GA 521PA 3O8OB 1NBMA 1XZGA 5EHQA 2HKIA 5B3AA 3STWA 1RM3A 5FF9A 3ASZA 5ALZA 4X00A 3DQQA 5H7XA 2VAXA 4J91A 2J8ZA 3T61A 2JBWA 4PS1A 1VPVA 2IGBA 2G9UA 2HOQA 2VJPA 1M83A 1TYCA 2EOAA 3ET5A 3K92A 4CI0B 3LNTA 3SMQA 4Z5XA 1WUKS 2RAUA 4TTAA 1C1DB 1OH5A 2FJ0A 2C8LA 5K0JA 5JBNA 4O3MA 3DD1A 1RCFA 1ULUA 1Y9DA 2B8EA 2G9VA 4LYHA 3ZHBA 1ZC4A 3O82A 5CLHA 1Z28A 3QGMA 4YCJA 4B2LA 1UFQA 3EHEA 2FX3A 2VPQA 2B6NA 2P9YA 3DJFA 2BOVA 1ZUNB 3Q98A 4E1VA 5B36A 2FMIA 4LHSA 5HEKA 3KYIB 3SXUA 1WCYA 4J4BA 1NN3A 3V8PA 5BSGA 3HVUA 5AQEA 1OKKA 4O1HA 3UMSA 1U5BA 4CCYA 4UBMA 4BC1A 1BA3A 1P4SA 2B4AA 1TEXA 2QR5A 4TV9A 2WC1A 2CT8A 3QOXA 5ANRB 4ZV9A 5HOQA 3CSUA 3KD2A 2QU7A 2WKSA 1G18A 2MMCA 3AW8A 3MUNA 3JQ8B 2CL6X 4ND4A 4O2RA 4Y2VA 2DUWA 1TQ6A 5JAIA 4X65B 2VJMB 1O3YA 3OTQA 1VXOA 4ZEVA 1AV6A 3EIEA 1NPDA 1FYXA 2FUG6 2Q4OA 5M34A 1QP0A 4CU5A 2P1DA 2V9CA 1K98A 3EBOA 4TLCA 5K0CA 4LDJA 4O1IA 3TB6A 2X40A 3Q3JB 2QIPA 2ECFA 3NWEA 2CN1A 3SKXA 2V7XA 5E3JA 4OMDA 5FNZA 1WXFA 3S2IA 4UNIA 3GOHA 5BSEA 5CDHA 5JXJA 4NOKA 4PRZA 1L4YA 4EF5A 4DQXA 5FFFA 1O95A 1Z4QA 4U7JA 3AL2A 4WKNA 1DELA 2IYRA 1X38A 1XLVA 5D3ZA 2IYWA 2YOGA 3PG5A 4R2HA 3C1TA 1GPUA 3P2IA 2YIJA 4PYNA 5F64A 1G8SA 3CGGA 1TAUA 3HR7A 2BBOA 4M1TA 4A5SA 1OIXA 1U2DC 5ALQA 1OTYA 4G4JA 3BMOA 4JK3A 4IDEA 3BG5A 2GAOA 3TIGA 4CMEC 4DDHA 2XUIA 3KQTA 4M7WA 4DCTA 2RARA 3A9CA 2NV2B 4CEIA 2QMUA 4PYRA 1ILWA 2NVUA 4ZQBA 3ZW9A 2ILTA 2M1XA 2QTBA 1NT2A 1WZUA 3BHNA 4G5HA 1CLEA 1L7QA 3WRWA 4B47A 4PICA 5ILGA 1EVIA 1WSDA 3WB9A 1O97C 1YUMA 1I6LA 2R00A 2HX1A 3DTVD 4YJFB 5C1IA 3CV3A 5EP4A 4LDZA 3SMVA 4QHTA 4KODA 4D5EA 2JD0A 2P75A 4WX2B 3SYTA 3K32A 3H5LA 5CX1A 3HB5X 2CV0A 1XPOA 1IU9A 3U3OA 4DWJA 1XXLA 4RH1A 2O2GA 1G55A 1NKVA 5A6VA 2ZBQA 3G8YA 3PRKE 1X8LA 2VT3A 3KOYA 2DFKB 3EJWA 3IKMB 1Z45A 3Q9SA 2Y1EA 4HXYA 4IJVA 4OREX 3RC3A 2M9MA 2PYIA 3CINA 4FMDF 2IRWA 4U2CA 3T5CA 1GGNA 2AQHA 5EZQA 3VHXB 5LXTB 5IUKC 3E3NA 3DV9A 4KXXA 4YMSA 5FOWA 4A91A 1ZVJA 1I0LA 3AR9A 4R5MA 3ZWVA 5A06A 4XWKA 3G17A 3S40A 5JZBA 3GLFA 2OBNA 1HORA 1TT5A 1QP7A 4R0VA 2Q4DA 4S1NA 2QZJA 5DEIA 3ESYA 3RYFB 2I22A 1SXIA 3KKPA 4PCLA 3IV7A 4B84A 2B1IA 2GLXA 2GD6A 4LTMA 3M81A 2OP0A 2OCYC 2AHOA 2VATA 2V0CA 3AGQA 4QREA 3B82A 1KC1A 4M89A 2DFTA 4RVSA 4HB0A 3U3ZA 1ORWA 4UTVA 2YS6A 2RC6A 3FWPA 1BSVA 5FWAA 3R3UA 3H97A 2P91A 5G0VA 5LL6P 3R7NA 1XAHA 3PXGA 3O38A 3C97A 4KBFA 4YMIA 3TZCA 2EIXA 3WTBA 4C01A 1CFZA 2QRPA 2C2OA 3BFPA 1JKIA 3T3EA 2RGNC 5C81A 5CDUA 1J2EA 2NTJA 2RGEA 4EO7A 4E22A 4FGLA 1A9OA 1E89A 1E1QD 1F5NA 2HHAA 2N47A 3RJZA 5KNDA 5LFAA 1KOLA 4CG2A 4E70A 5KAPA 4NECA 2QPTA 2B3TA 1J24A 3THSA 4QJIA 1TZKA 2I4MA 1ZNZA 4DIDA 5JZSA 2NSYA 2H4JA 3A7EA 1NZDA 2UXDB 2UZ1B 3S8EA 4HLQB 2I3GA 3AU9A 3K94A 5AI9A 1DQSA 2C78A 2HJGA 3KKMA 1VDZA 4AF6A 2EJWA 2DQ4A 1EDDA 1FJ2A 1JLLA 2WAAA 1TM7E 3BMQA 3RVSA 4XM2A 1BFDA 4JASB 3OOYA 4OI2A 1NAHA 5GVRA 2R5NA 4GKBA 3ZZNA 5KEIA 4W6ZA 2FQXA 4CBVA 2V0NA 4BNVA 4FYWA 2RHJA 2JIPA 2HI0A 4P4UA 3DZGA 1WV0A 1E6MA 2XUAA 4S1WA 2P5UA 3K9HA 1AV7A 2OTCA 2YHSA 5E7QA 2QLBA 3FJOA 4RFSB 4XASA 5K0NA 3F6EX 4U39A 1F0PA 3EVBA 4HTFB 1V35A 2MYTA 4LOJA 4I50A 4WN9A 3VH1A 1MDBA 3THXB 2G08A 2GKSA 4Q9IA 3N0VA 3ETCA 2ZSHA 2MIIA 1WVGA 2C77A 2PH7A 1U0SY 2Z8ZA 3I34X 4K9NA 2F1OA 4KI7A 4YPFA 1L5KA 2PEZA 1UQRA 3IE2A 2UU9B 3GLHB 1KU0A 5AVQA 5IJAA 4KKXB 2H1LA 2Q9AA 4LJLA 5AFSA 4B82A 2YN0A 1G66A 3ADBA 1QHIA 4ZO9A 4JVSB 5T4FA 4EHDA 1CWUA 1ZSVA 2HA3A 4HPJB 4MKHA 4WOPA 1N0UA 2O8DB 2IYZA 3OKAA 1MA3A 4OJYA 5I3CA 5BR8B 3NX4A 3ZVRA 3MD9A 4UDNA 2FP4B 5LBUA 1DXQA 1LLFA 1P5FA 1QIEA 4MKRA 3K09A 2P6PA 4XFKA 5JJBA 2X77A 3MAGA 3U3XA 3NRBA 3U80A 4BAGA 3S2ZA 5D3MB 5C8XA 2J9ZB 1CC1S 3MUEA 2PY6A 2Y1XA 2ZTLA 5EXXA 3CJRA 4RGBA 3MWGA 1Q11A 3LUPA 2PWPA 3VRHA 3ZWOA 4BVHA 3G02A 1TKAA 1VBNA 2F3RA 1QO9A 1V2HE 5K20A 5U4XA 1EU1A 3LPCA 5DM70 5FLYA 3W5CA 2GCNA 2G07A 3BIOA 1I80A 1KZ6A 3AFOA 3CRZA 2PGXA 1AUPA 4J7UA 3V2UA 1KTIA 1S2IA 1OBHA 3KTAB 4W5TA 2HC9A 4FQ5A 4LHEA 3F74A 1PJLA 3M4ZA 1ZGHA 4YASA 2P69A 3AF3A 3PIDA 3GG9A 1B7GO 2PL9A 3QU7A 5CB4B 1KK2A 3OO0A 3L92A 1W96A 2BCGY 3I09A 4Y2YA 3E9QA 4JOQA 2CJFA 2GYWA 3QFCA 4ZO7A 3IC5A 4IOMA 4OFXA 1HQKA 2BFEA 2HHLA 2CLFB 1ZIDA 4CLOA 1RAAA 2ZAIA 5FWYB 3TKAA 4JQZA 2YBEA 3KQQA 1MZPA 1BDHA 1NN0A 1W4AA 3O4FA 4IJ6A 5CW2A 4UNSA 2FSHA 2IYAA 1P0MA 1GUYA 3HWX1 1SG9A 3DF7A 4URHA 3T1QA 3GFBA 5A03A 2EAUA 4YJ3B 5E7JA 3LP8A 1QKKA 3GRZA 3HBFA 3DBHB 2OGZA 3CZMA 1N3BA 6ADHA 2O3JA 4S0ZA 4ANFA 1JB9A 1T5OA 1FLNA 2JNWA 2FCRA 2NVBA 1HY3A 2VUHB 2YOFA 3QI7A 3QZUA 3WXMA 1U7HA 2PKEA 3GZNB 1GTZA 1N6HA 2QQFA 1E58A 3PNKA 4BVFA 4KQXA 3KD3A 4D4GA 2A1IA 2BCJQ 1PFWA 5AKZA 5TF0A 1EZZA 2C83A 2QUIA 4TTRA 2YC2C 1JQ5A 1NJSA 3H99A 3OCXA 4QBIA 3EVAA 3URKA 1MB9A 1RRFA 3K0BA 1GYPA 4JOCA 2D5LA 1PRYA 3VR2A 3QU2A 3HDHA 3OZSA 2RAVA 1E61A 1ZK3A 3G49A 3ME5A 2VP2A 4EZEA 5AVZA 2VJMA 3BK7A 2PV0A 4RL4A 2B8JA 2Q5LA 1XZFA 3BDIA 3MRVA 4UVGA 3ZW7A 5KYYA 2PKQP 2JIQA 1BX1A 1VIVA 3CW9A 4RETA 4DA6A 1HFJA 1JAXA 1LF0A 3KDAA 3VPHA 3PPIA 3D4PA 2YHIB 1VHLA 2ACEA 1ZLYA 4MRSA 3X1KA 1YVUA 1ZD4A 4PZPA 4D92A 1GG9A 5TVKA 4ROSA 4L22A 4L8VA 3I2JA 3MTQA 1H69A 5EHXA 2VUSA 2FY8A 4JI1B 2BKUA 3G88A 3VVLA 4YYEA 2NU6B 1BNCA 4URXR 4M76B 4QOSA 2NUBA 5KTMA 3IA7A 1KMMA 2QORA 3GJTA 4DC0A 2NMVA 3RYCB 2G9RA 4RM2A 3K53A 2WU3A 2QD1A 2JFYA 4PPNA 1M54A 1Q3TA 3Q7IA 3CURA 3HJNA 4UXJA 5E4JA 1OASA 4X7RA 2DB3A 2YZNA 4MTLA 3IOEA 1CQIA 3OHSX 3OQ1A 5IXSA 4UZEA 1O8CA 4NCAA 4BV9A 4JUDX 2XUZA 3DVAB 3WGVA 5C46F 3C14C 5C1PA 5I8WA 4AMVA 3AF5A 1R6DA 4M0DA 4FYIA 3WK7A 4KAFA 2VQEB 3ZKWB 2WBLC 3TPFA 4M2LA 4E0BA 3PP8A 5CHEA 1JHYA 4G5SA 2IP4A 4JDPA 3U49A 3OKCA 2WG1A 4UHDA 3OUZA 2O4CA 2UYQA 3QPBA 1HWYA 4FMCB 3E8SA 1E2PA 4L2IA 4BCDA 1K8QA 3JWJA 2J7PD 3DXZA 1IQPA 1S8FA 1UIRA 2ZJAA 2R96A 4PGGA 2WYWA 3W7AA 1K7SN 2IPOA 1HTBA 3FDIA 3P9RA 1GPNA 5E9JA 1G5PA 4BNGA 4DLLA 3EGOA 1ESCA 3COZA 1XI2A 2PUEA 2H54A 2QJWA 4Z86A 1JI3A 2KLBA 3BEDA 1PGNA 1DLIA 1QHFA 3HBAA 1LBIA 3Q3EA 5I9LA 1W7AA 5B6IA 3FPBA 2FZ5A 5C8DA 1IATA 1ZAKA 2XBLA 2PX2A 3HYLA 4Q3AA 1TDJA 3Q41A 2HQ1A 5EQFA 3A11A 1RC0A 5CNIA 4EYGA 1ADFA 3C5HA 1C81A 4GIBA 3QFSA 5AI4A 2WJGA 3F7TA 1GQYA 1C1HA 3FYUB 2QUHA 2WDZA 4PX9A 5CT4A 2GYVA 5CT9A 4F9EA 4XE5A 1TOAA 1Z18A 1HOXA 2ZJ8A 3EGCA 4D3ZA 3ESAA 4LE1A 1NVMB 2GM5A 1LK5A 3OPYA 5KWJA 1NAIA 2QGNA 1BXRB 1BOOA 1ZL2A 2QROA 3LL7A 4G4IA 1S2OA 3DMGA 4CLRA 3U56A 3OPMA 1EFDN 2JFVA 4RHXA 5GY7A 3UJDA 5HCNA 1W1IA 4LNAA 3BBPA 4YCBA 4YRNA 1YIDA 3L6BA 2EBHX 1B93A 5KMGB 1X6VA 1I6KA 1HQDA 2HQRA 4RPGA 5CTJA 1QMPA 1CY7A 1GRQA 5EXSA 4EB6A 1XEWX 2GWHA 1DLJA 3NXSA 3PQ2A 4KO4S 4BJ6A 4UDOA 2IH5A 4DVGA 1BX3A 2VBIA 4CFYA 3DE2X 4YREA 4LOAA 4OMCA 3DBOB 3H4MA 1ODTC 3D7RA 3ZU3A 3HGTA 3SDZA 2REQA 5HWSA 2PGJA 1T8SA 5EUCA 2C7BA 4JGBA 4RNCA 2W4IA 3WL8A 1QC5A 2NUPA 2Q3FA 3H4IA 4J94A 4NF2A 1D09A 2PTGA 4HLUC 5GWXA 1E4EA 4OA8A 1ORVA 4PTYA 5IM5A 5AVTA 2FSGA 2B98A 3OU7A 4YEDA 4G0NA 4EQ6A 2GA8A 5MN5A 4N4AA 4WY8A 4KBGA 3RFTA 3BF7A 1ZC3A 3C5VA 3JVUA 4UPEA 4ZN6A 4DNXA 1JIVA 1WU8A 4BLOA 1IZ9A 4RTSA 4WE3A 1JWLA 3V46A 2Y66A 3O3CA 1SU8A 1SUCA 3X1ZA 1FXSA 2ZAGA 1OBCA 2JFNA 2H3EA 4GP7A 3HM2A 3U9TA 3SKVA 3VR3D 2XZPA 4MVJA 1R6BX 4MI3A 3IJEB 1U94A 4FNGA 3Q1KA 1UMCA 3EWAA 5KCMA 5LB4A 5A7GA 3W3AD 3N0RA 4Z0TA 4MLZA 5J5CA 5CAEA 2XNDD 5HDQA 1HG0A 4FDTA 1JQKA 4CM6A 1H05A 1B6RA 4HRAA 1L5SA 2O5VA 2XRYA 3M33A 4RE6A 5KHOC 4FFDA 3JD4A 2BEKA 3LX8A 2ACKA 3QKRB 2F1JA 1KFCB 4FM9A 4KDEA 4NCHA 4GH5A 2D1TA 4RD1A 4ZU3A 3C7KA 5LDDC 1J39A 5HRAA 4P86A 2XXBA 2PSEA 4GFDA 2FWBA 5DTMA 3V4RA 1BJTA 5HW0A 2HNAA 2PIAA 2HADA 3P2OA 3OI7A 4ZAVA 1SCDA 1HG1A 2PGIA 4F5EA 5EC8A 2QRZA 5AJUA 3ZVNA 4E1AA 2Y93A 4L75A 4X1OA 2P3LA 1QP4A 1IZZA 4RSRA 2ZQZA 3L7DA 1TA4A 1QHHA 1PL7A 1NW7A 2AS0A 5SICE 3FHLA 1OYYA 4JLBA 4M9ZA 3REQA 3A1DA 5KHLB 1ST3A 4OVKA 4YO8A 3JASA 2DTDA 4YRTA 1S1CA 4BJHB 1HTWA 2PKWA 3KJFA 5EWJA 2WR8A 3NDPA 1WBDA 1KMHA 1OPRA 3PFKA 4AN1A 2P4EA 3MRSA 2EJBA 3EMVA 4ZHSA 4Z4GA 3P4YA 5ENDA 1YRQA 4EPRA 2FN3A 3ESRA 5BWLA 3D0QA 2Q5FA 2ANCA 3A6DA 3MINB 3OZAA 3Q2OA 4WLFA 2OXTA 4BLPA 2ZUVA 3DZDA 2D1QA 2B8WA 4LI3X 3PQCA 3HB7A 4PO9A 3TSAA 3ZCSA 1KPGA 2FE1A 2WD9A 1KIFA 4C30A 6ABPA 2ZI7A 2FPGB 4L4RA 1A8UA 1X7XB 2QWXA 1AD2A 3TW8B 3OJOA 1A27A 5IT5A 3I2YX 3WA6A 1F1JA 2BFFB 4LNUA 4BFTA 3SOPA 5KS2A 1DX6A 2AI2A 1I5RA 2IEDA 2JGLA 2QM8A 3GR6A 4P3KA 4MV6A 2G4VA 1FU7A 4FBLA 3N53A 3RFVA 4B17A 1ADJA 1Q1ZA 3KSZO 1PHRA 4Q15A 3QYFA 3KYCA 3AF6A 4EKEA 1J56A 2PZGA 3OZRA 2NTVA 4TMXA 4MEJA 5CVUA 3G13A 4QXOA 3NGXA 2Q2NA 3KJNA 3AWIA 1KYYA 3KR1A 1C1XA 1NQWA 2OB1A 4OU5A 1S0UA 2YICA 1MNAA 4FX2A 1IQ0A 1GQQA 3ETGA 4RAOA 4V38A 4KPFC 2AJDA 2QUAA 2Z1NA 3LHIA 4ZYYA 2FR8A 4OGKA 3KUCA 4ZJUA 4J90A 5AUPB 2QRNA 1OLUA 3DC7A 1EG2A 4NI5A 3OECA 2WHEA 4Q3NA 4OBEA 1VYVA 4P7KA 2CZQA 5ERXA 5CU7A 4A2WA 1Y0BA 2O2JA 5BSRA 2IXBA 3C3YA 1D04A 1KZ7B 4ND2A 5F52A 1YJ5A 1E9DA 2PQ6A 2QZ9A 4JB3A 1KSHA 2MT9A 1ESZA 1V8BA 1VSQA 3BZWA 2E7ZA 4MKFA 5LJIA 3G7NA 2QV0A 1L5HB 1D0IA 4IF6A 5CX1B 3UKOA 2IFTA 1MQ9A 2ZWIA 4F9GA 3AU8A 4UJ3A 2FZLA 2ATCA 2W4MA 5BNZA 3B60A 3HADA 4DY6A 5CDFE 1IIRA 3V6LA 1K4KA 3EDQA 1WKCA 4TT8A 1NBHA 1Q7TA 2HYDA 1E6UA 3N2EA 4KE7A 5JATA 3IJ5A 1YQEA 4E7PA 4OLFA 3JQ6A 1ZZEA 2RC5A 2ZS8A 1F14A 3EXIB 5D6OA 3TLEA 3VU8A 3ETJA 1U1FA 4H2DA 4HVAA 3TZBA 1DAMA 1N5OX 1YVEI 1HSOA 3SM9A 5K09A 5FBQB 1U8YA 2JHAA 3IMCA 4KXQA 4DE5A 1CXZA 5DSZA 1S7GA 3KR0A 3OKPA 4I19A 1YTUA 4GO1A 2Y05A 2ZRJA 3REQB 3FCOA 4EHFA 2IEYA 3ZBUA 2ZJ2A 5FWNA 4L6IA 2IKSA 4CQLA 3IESA 3PQFA 4HDOB 4NTZA 2I3BA 3IVRA 1DT5A 3N6RA 1ZUWA 5L51A 4QX6A 4C04A 4QM6A 4XDZA 3OLXA 1ZK0A 1V0JA 1Z5OA 4DUGA 1V1RA 4X0EA 4RMIA 1PWZA 2R8EA 1KTVA 2ZUCA 1O08A 1ODLA 3GAAA 5JYBA 5JS6A 1DJNA 3BL8A 1N2GA 1NVBA 3KYBA 5BURA 5D7BA 2VF7A 5L7YA 2UUPA 2FFBA 3WLMA 1IY1A 1NQOA 1Y3CE 4GPTA 4X1KB 7YASA 4QSHA 3DYIA 1SUIA 3ICOA 3GQVA 3NTVA 4JROA 4Y1RA 1NBEA 3H6KA 1XZHA 4Y9RA 1E7WA 2JA1A 1DJPA 1AXRA 2QTVB 2VC2B 3CIFA 2CD7A 1FFYA 3V9PA 4KCGA 2B7CA 1U7ZA 2FUKA 2ATVA 3X1YA 4D80A 3GGCA 2D00A 4ZI3A 3MJVA 3B1JA 3QPVA 5F7JA 4QEDA 3P9XA 4H15A 3G9XA 1PU2A 3C6ZA 3IKVA 4JDUA 4LXXA 1D07A 2J9RA 3DE1X 4EUKA 2HA0A 1E94E 3JQAA 2B61A 3EUEA 3DT9A 3GCZA 4WJZA 1YOVB 1XEXB 5DGHA 3MMPA 4HDKB 1UK6A 4EX7A 1JH9A 5EIHA 4JT9A 2C97A 2XSZD 4XUGB 8AT1A 5L6MB 3SP1A 2QOEA 2DHCA 3QXJA 2ZPTX 1EH5A 1UDCA 1QV7A 2VJLA 3CB2A 3LS2A 3FYUA 2OCDA 3PZBA 4FDAA 5KDLA 1UJ6A 1IN6A 5B30A 5KNBD 1S9DA 1KI6B 2F6RA 3HGQA 3P2KA 4RZXA 1QVZA 2DEUA 2F1IA 5LR6A 4KN6A 4EHBA 2VIIA 1IEQA 4NG4A 1K8ZB 4ASUD 1VA4A 3IPAA 3WNBA 4OBWA 3ZU6A 4QT4A 3ZNNA 3PQ5A 3U3RA 4H3SA 3UOWA 8OHMA 3L7CA 2Q7XA 3GCDA 1E1YA 1G20E 1OIVA 2OHHA 3SC4A 1M1XB 1II9A 1J22A 2ANBA 1T8PA 2IKQA 2VUUA 2D54A 3K8ZA 1GKUB 1WOYA 3KCQA 1I0IA 2Q2OA 4UVDA 4WCVA 4C1NA 2C5HA 1N6LA 3ZHTA 3TOCA 2QM0A 4IHJA 1ZD5A 3UMGA 4D4MA 1O03A 4JH0A 3VDQA 3RGGA 2I3AA 3FOWA 4DA7A 4Z9AA 4EB6B 1SC9A 2ISCA 3QRWA 3AR5A 5IDWA 5BN3A 3WGHA 4HO1X 4IJMA 1EXWA 3GA0A 4ABYA 3K9FC 2PJUA 5EIOA 3FR7A 1NFRA 5H9VA 2HTFA 3OD1A 3QW4B 2ODAA 3HA5A 2EJCA 2GZRA 4CQNA 1RZRA 5M04A 2IWRA 3ZDBA 3ILYA 3QEKA 4D45A 1OXVA 3F5MA 3T5BA 3RE1A 3SM3A 4CTNA 1AQUA 3ASUA 2B9VA 5TGDA 3QWFA 3A1EA 5HBRA 1N92A 4A8JB 1K63A 1Q77A 3EUAA 1N8SA 2IUEA 3LYHA 1L4UA 3CO5A 4HDRA 4E2XA 4Y6SA 1WKBA 2WZDA 2I7TA 3WYEA 4JXZA 2CNOA 4BJ5A 5JY1A 5DHRA 4Z0NA 3FPGA 1NUPA 3OP1A 1HTTA 3LPAA 4EP1A 2DC1A 1A8SA 2F1KA 3FVVA 4ZCQA 5HIKA 1JSLA 1MORA 2GN1A 4X3CA 2XW6A 3VTFA 2JJYA 3QKWA 1OMOA 2Q6LA 1XTBA 4YMUA 4DR1B 3O8OA 3ZE9A 4RVFA 2V45A 3N7UA 3WJAA 1FVOA 1T13A 4M0LA 2IS1A 2G83A 4ZI7F 4OX9B 5EG5A 1XTTA 5C8YA 2YJTD 4I8IA 1E5QA 3RT1A 3JS5A 1O0BA 1Z7EA 1GTL1 1AVTA 1P18A 4UQLA 4DLZA 4DILA 4MAAA 5AHKA 2VYCA 3VYTB 1HYEA 1QQTA 1T5SA 1RYDA 2OAP1 3CE6A 3K2IA 3L4SO 2COEA 2AZ4A 3KDSE 3SC2B 4ZTUB 1AHIA 1KP2A 2LCFA 1MTZA 1O4VA 4JP1A 3IQIX 3Q7PA 4PCUA 3SEQA 4A6DA 3CLTC 3SG0A 3BMNA 4BQRA 3UMYA 2HMYB 1E5TA 1YS9A 4PAOA 3T7IA 4YDQA 1C50A 2LXNA 1W5EA 2P2YA 5HF6A 2G5TA 3KVYA 3UEOA 4WXEA 1UZAA 3VZRA 3KSUA 3D2CA 4RZHA 2O05A 1XZ8A 2O54A 2XKJE 1EVZA 4CE6A 4ROTA 2ROQA 1AHNA 1L7OA 2RJNA 1K97A 1EQ2A 1X7HA 3AV0B 3Q3CA 1BVYF 3LXMA 4WZBB 3TLZA 4C05A 1KYZA 4D9MA 2JPDA 3H1PA 2CB9A 4GYYA 1Z7YA 1O6FA 4RHTA 2H06A 3K1AB 2XADA 2XTJA 3JYLA 3ZWXA 2PNJA 2GF2A 3TZEA 3U39A 1PVOA 1PFVA 3SJZA 1YUNA 1E2DA 1JHOA 4PHFA 5LBIA 1JA1A 5B57C 1NE2A 3GJXC 2CJXA 3T5DA 3ILSA 3EGDA 1VECA 4FONA 1JI0A 2ZETA 4ND5A 3FCSB 4OUDA 3K4QA 3PLRA 3EGIA 4HF7A 5IKPA 2UYHA 4IIVA 1DXYA 5FKJA 4MW6A 3DOOA 3G6KA 4OI4A 4G4SP 4Q4JA 1NJ2A 4R3UC 3KQNA 3A9UA 2JI8A 2Q28A 2Z4SA 5AM2A 4MYCA 5EHGA 3OH8A 3ZI7A 3WMFA 3ZLBA 2QTCA 4EGQA 5GIPE 2V7QD 1IXSB 2NZUG 2X8JB 1CY4A 5FPPA 1KO5A 4IM7A 4R1QA 5EIEA 3ROEA 4Z6KA 1X7ZA 4MPJA 3KUDA 1LUAA 4KQJA 2BEUA 3H3FA 1Z2CA 1RHMA 2IHYA 3AR8A 1GRCA 3W9UA 3CEPB 3FJ1A 3LQ2A 4NCKA 1IOZA 1R6AA 3WQRA 2GHRA 4EFDA 2VTBB 4FCCA 2CE2X 4TLLB 4B74A 4JYZA 4TLDA 3MTAA 1Z06A 1ZH8A 3Q10A 5GINE 3RS5A 3GJSA 5AXAA 4D0SA 2CXHA 5JJIA 1B2LA 1O89A 4KWIA 1WWKA 1B0ZA 3S2EA 3W6PA 3M6WA 1Z25A 2OC9A 2YCLA 1OILA 3H6HA 2DKOA 3Q3GE 5A5GA 4CCAA 5AVUA 3NHZA 5TMDA 3WMWA 3PZRA 4M1QA 3DZKA 1RXSA 3P4XA 1XOIA 3SQMA 4HUTA 4YMHA 3H6GA 3I45A 4Q1AA 4A10A 1WPQA 1AX9A 4FCWA 1Z7WA 2YJNA 5D86A 3BJMA 2QN1A 2J9FA 4JU8A 2HF8A 1YS7A 1G5IA 1W52X 4MVJE 4JBLA 3EXHB 2V7GA 1IULA 3KZKA 4ZYZA 3ELUA 3GA5A 1CP2A 3DUWA 3SHFA 2BFCB 1CETA 5HF5A 4M9UA 4LJRA 1YJQA 2CVQA 3E2MA 1FFWA 4XI9A 4KRXA 1NSYA 1SU7A 4TMWA 3TX6A 3IAAA 4IH9A 1TJYA 5GV7A 4UOZA 3Q11A 5G02A 3CUYA 1XKXA 1Z0FA 1CR4A 2C03A 2EDCA 4N03A 1ZESA 1SQGA 1QAMA 3KU1A 3LBNA 3MB8A 4BQFA 4CGZA 4LYAA 1E6CA 1I4DD 2EDAA 2X6QA 2Q99A 1K9SA 1QE0A 4Y6RA 5THXA 4ZEMA 3EW9A 4QBTA 1VPTA 5DBIA 1SBYA 1KP3A 2C5BA 3ESCA 4JXJA 2Z95A 1Q12A 3PFWO 4YP6A 4IO0A 3BHIA 5ENVA 1ZVKA 3QJYA 5LKAA 4QASA 5IJ9A 3DZHA 1XZNA 3F78A 4L76A 2CYAA 2QK4A 4YN3A 5SV2A 4B1FA 4BMOB 3O1JC 3OFNA 5BO5A 4N7MA 3F90A 1NG1A 4X71A 3WL3A 4B6QA 5B58C 1MHTA 1SULA 1XKTA 3BREA 4MB6A 5T3UA 3GX1A 5CDTA 2QD4A 2RI0A 4UM7A 4X44A 4HGRA 4P4TA 3RSHA 1MOPA 3DV0A 4EEZA 2HU5A 3VDMA 3OU6A 1VBKA 2NXWA 5H16A 4RULA 2GILA 2H5EA 3HCRA 3H5VA 3GJ7A 4HXGA 5DNCA 3LZDA 4LVCA 2AL7A 5T3YA 4CM1A 1EMDA 3A25A 3LXUX 4GOOD 1UC4B 4LAFA 4QDTA 4D0GA 2NUPB 3NAGA 4JR0A 4B6PA 4NG5A 4MV7A 2PUFA 1BKSB 4XGKA 4TS3A 4A73A 3O74A 2QRVB 3H8SA 1T5LA 2VCEA 3JYPA 4LRWA 3QY0A 3BD6A 4BNMA 1Z15A 4CKWB 1PJ2A 1PFQA 1WG8A 4FKMA 1KSGA 4EPTA 1U0RA 3BYZA 2O0KA 4BVEA 3TBHA 3GUHA 2I6XA 3JQDA 4LSGA 1SXGA 4QU0A 2D8AA 1VKZA 3K9WA 2JH9A 3FFWA 2P7HA 5CP8A 4R2MA 4TL6A 5AW4A 1E3WB 4ZOEA 3LHDA 4QOFA 4DQUA 4H3VA 4EFNA 1WZIA 1FF9A 2FGJA 2XNJA 3ZI0A 4KFCA 1KI9A 2VH1A 5JYCA 1WEKA 1FQOA 2BEJA 3F5DA 4AN0A 4PONA 3R5KA 4OOFA 3ZYZA 3JATA 1ZHFA 4O5AA 7ABPA 1R10A 1A9ZA 1BH6A 1VKRA 2YY7A 4FGZA 4U7PB 1GKKA 4KOEC 5FTJA 5AM3A 3VUFA 1O94D 3UJPA 5LXTA 2OT3B 2HXGA 3D6AA 3LCUA 1UODA 3BXHA 3CNBA 4D3DA 4BXOA 5CNKA 4I6JA 2OOKA 2Q7OE 3AG5A 3QLJA 2ZI3A 1GZUA 2R6R1 1TVKA 1ICIA 1IBRA 1K3TA 1ZD8A 2IYSA 1RYZA 2R5WA 3B6EA 2CL0X 3IPYA 4XIYA 5JOQA 1MB2A 2W2OA 1NW5A 1ZOPA 1H5NA 2CEKA 3BBLA 1WIWA 3N1UA 2OCPA 3HGMA 5IEBA 4CL8A 1W36B 1WZ2A 3KQSA 3O31A 1NW6A 2ODEA 4HRXA 1MJHA 4PLYA 2RCYA 1UPBA 3L9XA 4JL5A 2HEGA 3F2IA 4L5YA 3TEJA 2GN2A 2VDJA 2LE0A 2ZANA 3C1OA 4R8SA 5CVTA 1A96A 1J97A 1LBHA 4KV9A 4CKWA 4U7GA 1CUHA 2ZJFA 3OESA 5FTWA 1EFPB 1IXKA 4LWQA 1X9HA 1GSHA 1V16A 2VCHA 2HO4A 1NLFA 3KPWA 5NLLA 4BEJA 4C3UA 5EHZA 1QYWA 3S1AB 2NU7B 2WZQA 1J0BA 4BLRA 4D8UA 4NEHB 3GIWA 4LRQA 1P19A 2Z4RA 1HURA 1KS2A 1XTRA 3LWDA 4W9NA 3A06A 5LQCA 3BTUA 1JSRA 3I73A 5A0FA 1EGHA 3W34A 4BE4A 4OKNA 3R0XA 2H85A 3RH0A 1FX1A 3C6BA 1EK5A 3HZRA 4GX1A 2ZCUA 4Z7OB 1PCXA 4GSKA 5LWQA 1ZZGA 5HRUA 2OG2A 1GU7A 3ZDQA 2C0PA 4DXDA 1VYUA 2W93A 1A3CA 1SN7A 4KQCA 3KYCB 2VK4A 2VOEA 1MC1A 2PL1A 4JWTA 1JR3E 4AMZA 1AY0A 1SRQA 1YB2A 5KUTA 4NARA 2HCRA 1ZUNA 3OMLA 4JWKA 2G8NA 4YAIA 3HEAA 2OHJA 2P6UA 3MS2A 3RW9A 4DA9A 2PFSA 3D7SA 3I5AA 2DH6A 3ZKAA 3L6UA 4WLUA 1YZ3A 1QF6A 4HFJA 5ITWA 5JZ9A 4AZ0B 1GQRA 2DFVA 2FSVA 3NM5A 1E2GA 4XIIA 2Q2WA 4O2BB 5JVDB 1U4OA 2P2DA 1X94A 1WCIA 1KI2A 1F6DA 2J41A 4RBNA 1W85A 3JZIA 4JX9A 2FG6C 1UBNA 2QVLA 3VHQA 4YJ2A 3M0EA 1FK8A 5JCJA 2P0YA 2HH9A 2J85A 1LY1A 3LKBA 4JQYA 1HOTA 4ZO4A 5KYYB 5LN1A 1TLTA 3SIPA 3TRHA 2WHRA 1K8XB 4NX2A 4OI1A 4E5UA 1OVGA 2JH3A 2VTEA 2X3YA 1TJNA 2V5UA 2A7XA 2YHIA 2AIRA 3OD5A 3QVWA 3VR3A 1T6BY 3V8QA 2X1VA 1V45E 4GUDA 1OFUX 2WYOA 5JW6A 2QI9C 3OM8A 5ALDA 4MV9A 5CDYA 3CQ9A 1AGRA 5JAMA 4A0QA 2B69A 3VNRA 1Z2OX 3L0DA 3C15C 1MO5A 4HYYA 4D43A 3F6BX 2QBYB 3MLEA 1QIDA 4EVRA 2A2ZA 2LIVA 2OYSA 4BKMA 5I7RA 3JSXA 3RYCA 1XCBA 2AR7A 4IZHA 2QN6A 4EYQA 1XRJA 1JHMA 5EP2A 1ZIOA 4F21A 4M87A 1IVSA 3ZNQA 4BMDA 1VJCA 2YH2A 1U9ZA 2APJA 2H2FA 2H4FA 4XD2A 2Z6VA 3ILXA 2W6JA 4O4HB 4F4CA 5L7TA 1NVDA 2H1RA 3PD7A 1R1DA 3CF6R 2VJNA 2E87A 3EEIA 3P9ZA 5GPBA 2GCOB 1MB4A 4ETMA 3FTNA 3CRNA 4JEHA 5E95A 1DEHA 3KQUA 4EW3A 2VYFA 5TEVA 3S1AA 1JAZA 3FDZB 4MUXA 4WY5A 1JQEA 3OE7D 3KHTA 3VV2A 2AG1A 4FB5A 4BMSA 2AF4C 4C2BA 3RBZA 3BSYA 3TNFA 3CMMA 4FN4A 4BO2A 3TG2A 1MVLA 5A5DA 2WWXA 3I12A 3ANMA 2IHJA 2F55A 3K9BA 1BU8A 1XPJA 3CZPA 3WAGA 4QU9A 1VL5A 5LQKA 2GEUA 4H0NA 3PUWA 3RYHB 5IRCD 2ZT5A 4MV1A 1EK2A 4FB4A 3TAUA 1WPXA 2EU8A 1ZUIA 2QMYA 4M9CA 4EMUA 4FNMA 5IT9A 4HFRA 4ZHQB 1U2SA 3BQNB 3K1JA 4B5KA 4F4JA 3JQBA 3G0GA 3BWMA 4LMRA 4RENA 3GZNA 2YV2A 5F73A 2CVZA 3ZQJA 1TU4A 2HLDA 4FHFA 1E6LA 3QK7A 4MS3B 3WZLA 4FWTA 1RM5A 4DPKA 1PFUA 3BD9A 1NW8A 4K9KA 1JA0A 4QYWA 3WLFA 5EJAA 5FBKA 3RIMA 1DAFA 2G70A 1A4UA 1NMQA 2FLWA 2BMJA 4UM9B 4OP3A 2O50A 4XR9A 3WS7A 2WQZA 5JSZB 3AVYA 4ZYWA 4F2WA 4O4LF 1UKAA 3LQYA 2GZMA 4JA0A 4OYYA 3HVHA 4V0MA 3I9FA 3AHFA 1DGQA 4KPUA 4MGZR 3QBJA 5LXTF 1DBIA 1T9GR 1TB4A 2AMJA 3FGPA 4FPXA 1K3UB 5IXJA 5JD5A 1H0SA 1JQ3A 1XL0A 1QFJA 1QGUB 2UUAB 2OL4A 3OLWA 1E79A 1NXOA 4MR7B 4LGYA 5LP6C 1L5WA 5AVWA 2A0WA 2A5GA 1Z5NA 3TKLA 2AEMA 2WTAA 4PGAA 4DLTA 3WNDA 4E5DA 1T1JA 2YWFA 3CGWA 3F47A 2XWSA 4YACA 4D3FA 4G0MA 1SQ6A 1RRVA 4EPVA 5AUNB 1XBTA 3HXQA 4DWVA 2P62A 1DOAA 4W1SA 2VHCA 2EFYA 1UBSB 3DL4A 1NBAA 2AEEA 3K9LA 3KEMA 4FMDB 3BDAA 4LY0A 3VC3A 3VZBA 4KPYA 4KXFB 2VAVA 4QQKA 1SVUA 5HIIA 5CA1A 5JH7F 2XB2A 4OHWA 1NVKA 1U0EA 2WIBA 4H31A 1XMXA 1WTAA 3VNBA 4F8EA 2WVGA 1AM4D 1KAMA 3CU5A 3T4PA 5B64A 1QFMA 3OQJA 2RK4A 2QRVA 4G4SO 1RI1A 1RYEA 4V0RA 4DLXA 5IJWA 4AJPA 2QM3A 4BAZA 5ALEA 4M9SA 1ZN9A 2FUEA 4DMUB 2FF5A 1J00A 3UK0A 4YECA 2NUAB 3G0DA 2O8BB 2I03A 4GZ6A 1Z35A 2NXJA 3ZTTA 2EGUA 4LWPA 2JJ8A 4W1QA 1DWPA 1WMDA 4J6FA 5CYOA 3SZUA 4EA7A 1TYEB 1V25A 2I2XB 1U2GC 3ND8A 3QWIA 1DPFA 1YZLA 1H0KA 4HQOA 4KUGA 1W34A 4UNPA 3PV0A 2BUBA 3L0YA 4YX9A 3TKYA 3ROTA 2XXAA 1IK4A 4F4DA 2JRLA 3G1UA 3JVIA 3PGKA 3SF8B 2CXRA 3A32A 3V3KA 3D0OA 2X4LA 5FPHA 5HR5A 5FWXA 4AS3A 4MEAA 1AOXA 3IQEA 4MW5A 1PV1A 3OQVA 1CBUA 3IQWA 3O8RA 4W1RA 2XA2A 2E85A 3H2SA 1CUEA 3IDQA 1FRVA 3MOSA 2Z9DA 1U7PA 3Q15C 5T8KC 3DAOA 3FTEA 5LYJA 4WLOA 4KLRA 2Q3MA 4OQFA 5HS6A 2NZ2A 3C3PA 2YWHA 3MJCA 1TK3A 3KBBA 1T15A 3E7XA 3R75A 3B1ZA 5HHTA 4NFYA 3FGOA 5DISB 5DYYA 2PWZA 3LW8A 4I4LA 1ZCBA 4MZXA 4NDAA 5BVHA 1GGMA 3WIOA 1HEUA 4MJ3A 3K0FB 3S7ZA 1VYHA 4WECA 3ZCTA 1G2PA 4RKEA 3NIDB 1B8OA 4KWHA 4LYYA 4HSEA 2J0QA 3U4GA 4KQFA 1QHHB 3G5AA 4Q3DA 4NQZA 5K3SA 3GRKA 3CZAA 4R31A 5IPFA 1VM6A 3EAFA 3OVMA 3LJKA 4RIGA 5F1PA 3SIXA 1G8AA 4OXXA 5BVGB 4ZEOA 1PL6A 2Z58A 5CGZA 5ALRA 3LUKA 2HGSA 4MPPA 2GZ1A 4KRGA 3ZY6A 3NHWA 4BVKA 1QOPB 2AJTA 1N9GB 3RIEA 4R0MA 2Q0XA 2Q6VA 1NOIA 5BNTA 1AQLA 1VG1A 3HJHA 4IS2A 4RKQA 6YASA 4ZC1A 4LZPA 1M0SA 3RRXA 3WIUA 2V5AA 4BGVA 4X9XA 4TYNA 1J9GA 1OXSC 1H4TA 3UG7A 2JAOA 3Q85A 1DHRA 5JS7A 4YY3B 4MGHA 3TZQA 6Q21A 4L0CA 4UNQA 4J7AA 4CMAA 4GI7A 4ALNA 3WNZA 6LDHA 1XJCA 3AEYA 2DKFA 3AILA 4JLDA 1ICEA 3TOXA 3ZOKA 5MN6A 3WIDA 1XDZA 2DQKA 3IHKA 4HRYA 3BSSA 2DAPA 5TT1A 1DBWA 1ESNA 4GI2A 3JQQA 4HYTA 1AK9A 3LCRA 4L15A 1CRLA 1N2CA 1RE1A 2FDXA 4RKWA 5L3SB 1EI9A 2C9MA 3GHYA 2I1QA 3HRIA 2JLXA 1M10A 1J7JA 1PTJA 3QMMA 4BMNA 4AU1A 4XVHA 3DWIA 5JWRA 4U3JA 1TC2A 1FCJA 1NU6A 4DDWA 4UXHA 1H2FA 1JHZA 1MC4A 4NU8X 4B73A 2NSHA 2BH2A 4HEHA 4Y9SA 3NALA 4F3RA 4Q21A 2PH1A 4EGJA 1ZOIA 2M32A 3AVPA 2GLTA 4KHPB 3JALB 5JASA 3SF8A 5ESDA 2BV3A 4Q6WA 1T10A 3GEPA 4HZUB 3U0BA 3SF0A 1XYVA 3KKKA 1YU6A 3SAJA 3GROA 3JZFA 4O8CA 4BQQA 4F2PA 5C5EA 2P6MA 2VXCA 3LZCA 1VLHA 4EELA 3OM9A 5F1YA 1D9ZA 1KKMA 4TX1A 4M7PA 2J09A 2J6IA 2C84A 2PN1A 2RHOA 4CM7A 4EFMA 5EJ7A 4IVNA 3AP3A 4KG7A 4L9AA 3FWKA 3P9IA 2QMEA 2BMWA 4R5HA 3G2PA 1GYRA 4Z3DA 2WM2A 3V4SA 5IF9A 2VHEA 1VP9A 4I4CA 2P40A 2O8EB 1EESA 3HCEA 4C0KA 1A50B 3QXHA 4A03A 3W5JA 1G1AA 2I55A 3QEOA 1YZGA 5AO9A 3TD6A 4ACBA 1Y8ZA 3MQ2A 1H2RS 3EZFA 1MAUA 4RDHA 1OXTA 1HC7A 3VNAA 4R8LA 4QYMA 4DZRA 2PWAA 1EWYA 2ZYIA 3EJ6A 4AP5A 3AO0B 3M70A 2BDEA 4PYOA 4EBBA 1JHXA 1GKYA 1T3GA 2ZEJA 3OFJA 1N75A 2E5FA 1PJ4A 4NENA 1PWYE 3PQ7A 3STXA 4IY1A 2FN9A 1E2QA 1D1TA 3CFYA 5K6RA 3W2FA 5HILA 4YGXB 4JN6B 2I2WA 3W6OA 4XM1A 5FL7A 4X91A 3DMYA 5IBPA 4MUKA 1IVYA 2ORVA 4M6WB 3WJ7A 3WHIA 5G4LA 4IKOA 4ER0A 4CRWB 4RPIA 4ZAFA 5EJEA 2OZVA 4WQMA 1T1SA 5ENZA 5KNBH 2ZBDA 3PXCX 3LBFA 2PKYX 3O9MA 3UWOA 1GCUA 4N48A 2BMEA 3ZC3A 3ZDEA 4PC2A 5DM60 4IW3B 2A84A 5GGYA 1Z4MA 1JILA 3BRWD 4QJ4A 3TGPA 4UNNA 5B6PA 2GPJA 4ZXFA 3ZGXA 2XYGA 4MGYR 1JZSA 2ILVA 2XMCA 1J8QA 1Z3IX 3GN1A 4CG3A 1HFKA 4ZVMA 3TNLA 5FL3A 4ZODA 2VNKA 2VEOA 4B3SB 1VMDA 3D3WB 3O4VA 3ZWYA 4EF6A 3FOEC 4W5WA 2VPZA 4DWWA 3HZHA 4CMKA 2REBA 1F06A 2X19A 2CMHA 2FEPA 2WZCA 2A5DA 5C7YA 3NFYA 2XUGA 4HDKA 4F5WA 2A9OA 4CMIB 1XJQA 1B15A 4BTEA 4X24A 4UMVA 4NEQA 1F2UB 5IK2A 1O58A 2GAJA 1N33B 4EGCB 3R0IA 1AKMA 2D59A 5IZ4A 4AN4A 4QRIA 2VBFA 4AJJA 4D98A 2CSXA 2UYOA 4PWYA 3E05A 1AKUA 1BAPA 3OZEA 3JXEA 2A33A 2BZGA 3NT2A 1YZHA 2IY7A 4OQ4A 4UTXA 2BFDB 5F9HA 3IAHA 1R7RA 4JP2A 1XLTA 2X7XA 4B8YA 1SEVA 3MT9A 4DV1B 2AQ8A 4KACA 2E18A 2NYUA 1R27A 1E2UA 2GPTA 1V9CA 4MIKA 4QULA 1M72A 4JQCA 3R9KA 1NWCA 2QDXA 3B51X 1SHTX 2HFJA 3B7PA 1HKUA 4NZZA 1CZRA 4IIYA 4PY2A 4OQNA 3HA3A 3Q7RA 4NESA 1ZA1A 2ORIA 4QAQA 5DK6A 1CERA 1USUA 3ZE2B 4C7BA 2YJ4A 1YMUA 3D6FA 1KKUA 4AICA 2H0RA 3DJYA 1XYYA 5FQNA 1BW9B 4JJ7A 4OO3A 2VH2A 2WMDA 4D6XA 1RJGA 3PYXA 1NMSA 4TZ6A 2PZJA 2BGMA 5DNDA 3S99A 3WLOA 1IK6A 1YONA 1N2OA 2XB8A 3A1NA 4HLCA 1RPJA 1QC5B 4HAXA 2V6BA 3OJCA 4MUYA 4LA4A 1Y8QA 2XTMA 2JGRA 3RVJA 1UBKS 1X87A 1EFTA 4LQCA 3R9XB 4PBSA 2GBLC 4NXNB 4JR1A 1M5UA 2FPPB 3WG9A 1LQUA 2EFJA 3N05A 4RF2A 3OOHA 4KIUA 4A0SA 4BWVA 2ZT6A 3C3WA 1A8HA 2R4TA 4EQZA 1MJGA 1UPTA 2ZTHA 5B5SA 2C2MA 1I9CA 5HKBA 1PS9A 4KR3A 3G8AA 3C24A 2ZBUA 4EGSA 2DX7A 1WB4A 1ESEA 1QFSA 1HDOA 1WMAA 1X1DA 2H4YA 2O6HA 3UAXA 4LDNA 1THMA 3LUGA 3LWBA 8ADHA 1XZEA 3K0AB 1G8JA 1V16B 2OVFA 3P97A 4R2KA 4BNJA 4MRAA 2JLZA 5AKIA 3OJXA 2Q07A 3AF4A 5BXYA 3A70A 3EVNA 3K0CA 4D57A 1K8YB 1SCQA 2E37A 1GCIA 4Y6LA 2P2SA 2GEKA 1IRXA 1Q7BA 2EZ8A 5TS3A 1NXWA 4LVOA 4ARSA 1T2AA 4EI2A 4WKPA 3WBJA 1KRXA 1RI2A 1N8NA 3GEDA 3IMGA 3GLQA 1DKLA 1CKEA 2N3ZA 4FN5A 1SXQA 1GSOA 4FYHA 3UOAB 3VSDA 4AY6A 2DE0X 3BD7A 1AMUA 1I3MA 2WVJA 4YP5A 3BHJA 1F2UA 1DO0A 4NYIQ 4Q9KA 2O48X 3DBVO 4B3CA 1V5EA 3P1JA 3K8OE 4HPWA 5D85A 4E5NA 3COPA 5BV2P 2DBRA 2ECQA 1DRVA 2D2XA 2BEWB 2BGRA 3IS3A 3PPVA 3TMKA 4CKXA 4NBUA 2XWBF 421PA 1U8FO 1RHJA 4TKZA 1DSSG 4RA6B 4S0XA 1Z0KA 2VT2A 1KFJB 3JYOA 1TK2A 5DBHX 1DUVG 1FSSA 1FNCA 3DLPX 3KP1A 1G3MA 3UGJA 4OX9Y 4DA0A 3ZHRA 3DTVB 5L4NA 2KJQA 4FD3A 5A5EA 5MFZA 4EY3A 1TEZA 5IZCC 2Z2YA 4R69A 1VPEA 1J8MF 2PX8A 1PGQA 2WZBA 1CHDA 1WF3A 2GYUA 1NRWA 1P8AA 4MA5A 4O4IB 4Y6QA 4M8SA 2O8FB 1JZQA 3KWJA 2ERCA 3R8CA 5HGJA 4ZVUA 1IDN1 4O1MA 2Q41A 2O3TA 1AGPA 4L5BA 5BN3B 2EZTA 4W99A 1CHNA 1ZMBA 2JVJA 3F3MA 3JRWA 4AJOA 3IP5A 1JHVA 5KYWA 3JQGA 1YR8A 3D5QA 3G89A 4X8HA 4DM7A 4DJAA 4UBIA 2IA5A 3I52A 4QTZA 3CVXA 3P5BA 4X41A 1DAGA 5FNVF 3CLVA 2CMFA 2Y27A 3KOOA 3LC0A 1EEHA 4XB6B 4ZQCB 4DMFA 2NAFA 5AXCA 1ID1A 1NONA 1I30A 1KYIA 1P4HA 3GJ5A 3AERB 4IGKA 1XWFA 1S89A 4DREA 1FY2A 4PG5A 3E9NA 3GPBA 5L53A 3L7JA 1BN7A 4PQEA 3BXZA 4C4TA 1VIDA 2NVWA 2AC4A 4YMLA 5HZGA 4Z99A 1PTKA 1GHTA 2XQVA 3T06B 4ENWA 2C7PA 4FILA 1RLUA 4GOND 1DC5A 5CEEA 3VHLB 3ZHZA 4OMFG 5HS4A 2P5TB 1R2QA 3N8HA 1QS0B 3R0VA 5DCYA 2IPNA 5EMLA 3ZNOA 3TTUA 1U9IC 1BWRA 1ZJ6A 3K0AA 1BE0A 5BYJA 3R76A 2V9ZA 3CLUD 3HZOA 4JSTA 2V54A 3KXIA 3CRRA 4LHVA 1NVUQ 5ALOA 4F5DA 4PSUA 5J4LA 4JI4B 1ML4A 4L3WA 4G1VA 4ALIA 3HJAA 2R65A 3WYNA 1Y1PA 3EXAA 3RG2A 1RJEA 2JJ2A 4IGAA 1P1BA 4OXYA 3UM9A 5DOZA 3VI4B 5JEEA 5KOJA 5ALVA 3IP6A 3N8KA 3FVQA 2FFRA 1JFVA 3SBEA 4TL8A 3ANLA 4QFDA 3V4VB 1E1DA 4YR7A 4GGPA 3ZOZA 3BTVA 1OAOA 3DLTA 3KSDO 4RKRA 2H1SA 3LRPA 3TL2A 4EGAA 4EM6A 4FUQA 2WKRA 1J33A 3LUHA 3GD5A 3FSRA 3IBYA 4P58A 3LPLA 4TYPA 1QORA 3GGJA 3PI6A 1RLMA 3AESB 2D5BA 1N8TA 3T1NA 3MJ4A 2VDMB 3JSAA 4KW7A 5I8ZA 1Y7PA 5KYXA 3UAGA 3H9QA 3RK0A 4RFLA 3ADOA 4BTLA 3CKKA 3WLQA 4C9BA 1ISRA 4KWCA 4FBGA 4UKDA 2YL2A 3N3AC 4JB8A 5EE9A 5JMPA 5FHRA 1P4RA 4BVLA 2WTEA 5KVCA 2C31A 2F48A 2GDJA 2IYNA 1DWUA 2BR5A 2ERYA 2XT9A 3HKDB 1YGPA 1CS0B 5HKLA 1DWOA 4WK0B 1QVWA 3T94A 3ZJVA 4D96A 3ZK8A 1RQLA 4DQVA 3VUEA 4V0ME 1G0NA 1XDDA 3GAFA 1LPOA 3L04A 3W1VA 2EFEB 2X0DA 2VHTA 1IC6A 3OZTA 5B7PA 1MXFA 4H0CA 4HGNA 4PX2A 4J43A 1ID8A 4ATNA 4HNRA 3QKTA 4DEVA 2L19A 4E46A 5CBPB 1BE1A 2ZDGA 1H8HA 1G7CA 2N9UA 3A6FA 1EIWA 1H1TA 3GUUA 1E7YA 1N25A 1DQZA 3D8BA 4DV2B 3DLBA 4LF8B 4B71A 2A0XA 3A2NA 5CB6A 4MUFA 1UPAA 4YFYA 1O6GA 1U8CB 1L5NA 2P11A 2A8YA 1M7HA 3BJZA 1P0CA 2FZEA 4V24A 3CVVA 1G98A 2JCSA 4TXLA 2CV2A 1QYRA 1WPGA 3CLSC 2QLMA 3LUAA 3MWLA 5D01A 3NRJA 1R37A 3DEKA 4MVJI 3OZXA 2ZVQX 3EIHA 1QYVA 3CLUC 2ZYSA 3E7FA 2OQRA 5LOVA 2A3NA 3UPDA 2V3VA 5ADVA 4ID9A 1H6BA 3PUKA 4BJ1A 2FMUA 1R66A 4R9VA 2NVUB 3WICA 1F0NA 4JC8A 1NNI1 1W1WA 4UD6A 4QLAA 4A27A 3AL3A 4DLAA 4MUHA 3THXA 1R0ZA 1M2VB 1NC3A 4BJ3A 4EG8A 4KMRA 2P5YA 5IBRA 1RAHA 3C8HA 3OQOA 4RQTA 3VA7A 1ND5A 1T6ZA 1XRMA 2FA9A 2GEBA 1EFAA 3NCTA 2J5BA 2C00A 2FE4A 3M83A 4RUKA 4D5GA 1NQUA 1B0PA 2ZYWX 2ZRAA 5CVJA 4EGFA 3H9UA 5JU6A 1JEQA 3DMTC 3MJFA 4GBMA 4D25A 3QFTA 5HKAA 3WDMA 3B5IA 1HE1C 4KE6A 2E5WA 4YS6A 5BSUA 1TQ2A 3LE8A 4YAUA 2VYVD 4Q47A 2GJ9A 3C7CB 2IJGX 1ECPA 2O23A 3WGQA 1EX9A 3GLFB 1EAMA 4CKZA 3D8SA 1IBMB 2F3QA 4X45A 4BFUA 4BQSA 2W6ID 3F2VA 1A4IA 1DBPA 2G5PA 4D8TA 2TYSB 3X1JA 5C32A 1J23A 1CEXA 2XAUA 2PTHA 3DH0A 4QTTB 4UEQA 1JVBA 3CLHA 4UTOA 3DMDA 4WCFA 1R9JA 3OQIA 1UT6A 5FPTA 4M0KA 5BVGA 4XOUA 1M2GA 3LBIA 4H6XA 4OHOA 3WL4A 4TTIA 2NLOA 4ZOLF 3WIEA 4QJ3A 3JWEA 1A2KC 1BJKA 4FFOA 1MU0A 2W9XA 3SFTA 3VBEA 4XQGA 1QBKC 1RBZA 4CW7A 5AQ1A 3I2GA 1E0SA 1L4HA 4OAQA 4NCXA 2C9CA 2ASVA 1N9ZA 3O03A 4KXLA 3VPXA 1EQUA 1SCIA 1VHWA 3AXTA 5J4KA 4XLLA 4HUQA 4ARZA 4LJAA 4QUJA 4Q4AA 1OFHA 3EYWA 5A9TA 1P9RA 4I8XA 2F2TA 2JKYA 5TY0A 4TMZA 2A78A 2PMBA 3M6MD 1XZKA 4DCVA 4M0CA 2YHBA 4DGQA 2I3ZA 3FZQA 4PC7A 4TYYA 2TECE 4FOOA 2P27A 5EFOA 1S4MA 3HEMA 2PFKA 3I0ZA 4ZU6X 1N2CB 1JG3A 3D3KA 3QF4B 3HQ4O 3QW2A 4Y6PA 3MJRA 1VLLA 4I9HA 5CXSA 4EKIA 4CXMA 1EK1A 4L8WB 4BDSA 1B73A 3VNSA 5GMOA 4RSMA 3UMRA 1Z5ZA 1W93A 4RY2A 4Q5IA 3BMNB 1AMNA 1N5KA 4UJ5A 2YMLA 1UM9A 1G9XA 4IDPA 1BE6A 1L5YA 2CUZA 4J1SA 4FEEA 3CRW1 1ZCFA 1T4DA 1PJ3A 3FW1A 2E49A 5T64A 4B4OA 5BSKA 5ALIA 1XG5A 4JJFA 1M2VA 2QD5A 4L5AA 3PGMA 4X1IA 3A1CA 4BB6A 4WZBA 4DV0B 2MINB 5E9WA 3S68A 2OO5A 2PCLA 2X0JA 5D84A 2JGMA 1NHGA 5M2QA 2FZWA 4X7PA 2CUKA 2ZUSA 3EVCA 4ID3A 4DQDA 3ON5A 1ATZA 1G3UA 1YI0A 5CTAA 1ZVVA 5G41A 2JD2A 2CLLB 1FTWA 1KDOA 3IIKA 1CNMA 2EX4A 4W63A 4E15A 4GNKA 1QSGA 3WV4A 4GM1A 1J8VA 1A2OA 1ZOLA 1GQSA 3VYRB 4LJ8A 3MIIA 5EJMA 5LOVF 3KSBC 1ZH4A 3TDMA 2UUCB 3B5EA 1T2DA 2WUGA 3G5LA 5FXMA 2O8DA 4AMBA 1K0UA 1ZRSA 3IKJA 3HJRA 4GPAA 2P68A 3SIRA 5J2TF 5FV4A 2BKEA 3DE0X 1S3SA 3RU2A 2GAAA 2XVMA 4OY3A 2R44A 4FSXA 3UXYA 3TJMA 4DCJA 1OV6A 1D2NA 3D6JA 3AERA 3TLXA 4GC9A 4EJFA 1TCVA 3DMNA 4B9EA 3OFKA 1G6KA 3BQMB 4I3FA 3U31A 1E0JA 1M0EA 2R68A 1SVIA 1AK1A 5TS2A 2NXNA 1OGIA 3G2KA 4QDZA 1MB3A 1LV7A 4LVNA 3ZBPA 2JDIA 4B4DA 3EOZA 3HXTA 5FX2A 3BL5A 1Q2UA 4FFLA 1PZEA 4CWAA 4QUAA 5CYFA 1UANA 1QS0A 4WA7A 3L6CA 4ZRNA 3NLLA 3DVAA 2OV1A 2FPLA 3AIIA 1B74A 2JCYA 1P73A 1JIJA 5P21A 4FZ3A 4OQPA 3UH1A 1LS1A 1I4WA 2XVAA 1WXEA 3OIFA 2BFEB 4O29A 4A0FA 2EP5A 1P7ZA 4IDBA 4XDHA 4Q1EA 4CLOB 1V4VA 5TV2A 4EJMA 3E27A 4WUTA 3D02A 3KZ1E 3RSLA 2HREA 4TQ9A 2EQ5A 1P2TA 4G5GA 3AX6A 5HIJA 1LPPA 3L93A 2YWGA 4RPHA 1X2EA 5EIAA 3SSMA 1XVAA 2RE8A 3CVJA 2YQZA 1CJCA 1H23A 1ZGBA 4YAFA 5EJFA 1XIVA 3E35A 2PD4A 4YJ3A 1FQJA 5T41A 4BDTA 3OLQA 1JAIA 5IS2A 4QXRA 5FWDA 4LS3A 3EH1A 5KYTA 3NOQA 2X0FA 3NEJA 4YVFA 3HK2A 3MHPA 3PQDA 4AY3A 2FR8C 2P9TA 3DZCA 1EFRA 3D3QA 3NTOA 4V3CA 3L8YA 3ZE0B 4RCYA 5H8WA 3FKSD 2HDOA 5E1OA 5JNSA 2II6A 3A4IA 5KYXB 1SVNA 3ITEA 3LY5A 1AXEA 1NVWQ 4DV7B 1JW9B 2ZDQA 2ACVA 5C1OA 2NQTA 3AUKA 3OU2A 4U7HA 4JSYA 5JSZA 4P84A 2GEVA 1N78A 1JIIA 2FFJA 3P0HA 1HDIA 4YWHA 2Q0HA 4KTTE 4QUDA 2A6PA 2WI8A 3GRVA 3HKDA 5H1YA 3RUFA 4OCZA 2L42A 1XXHB 4LOHA 3MQ4A 5DDIP 5DCLA 1OZFA 4N7JA 3VR5A 3PX7A 2WD8A 2BHRA 2GPBA 1L4KA 2F1RA 5BV0A 1OX5A 1X3LA 1ZNWA 3IXQA 4FGWA 4X95A 5EXTA 2AXQA 2RHDA 2Y76A 3V4OA 1V4NA 1U9CA 4JX8A 3OT1B 1N5IA 5J2UF 3DHVA 3G85A 3UK1A 4AZWA 1DI0A 1XCMA 2LTAA 4XWAA 3FYHA 4D9CA 4BO4A 5CIWA 2C2KA 1YJXA 4CMHA 1NW3A 1XP8A 3GFRA 1S4QA 3G9QA 1NV8A 4S1TA 3RAEC 1SUSA 2GF0A 3C8MA 3LPMA 4V39A 3L46A 1LTQA 4YBRA 2WAMA 3GYGA 2YVAA 2N42A 3CPHA 2HZ7A 2WUEA 1KO7A 5FFMA 5TQVA 2BFPA 4QBKA 1NXQA 1R4NB 3L8CA 4LV5B 1LTKA 3L1KA 3E9MA 1ZSNA