1DG9A

Crystal structure of bovine low molecular weight ptpase complexed with hepes
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
157
structure length
157
Chain Sequence
AEQVTKSVLFVCLGNICRSPIAEAVFRKLVTDQNISDNWVIDSGAVSDWNVGRSPDPRAVSCLRNHGINTAHKARQVTKEDFVTFDYILCMDESNLRDLNRKSNQVKNCRAKIELLGSYDPQKQLIIEDPYYGNDADFETVYQQCVRCCRAFLEKVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of bovine low molecular weight phosphotyrosyl phosphatase complexed with the transition state analog vanadate.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
molecule keywords TYROSINE PHOSPHATASE
total genus 64
structure length 157
sequence length 157
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 1999-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1dg9A00
3F7NA 1ZDMA 5E3JA 1VRVA 2L19A 3MF4A 4RV5A 3M6MD 3N6VA 4N0PA 4EYGA 1SXGA 4YGXB 1QPZA 2PUAA 2FXIA 5IEBA 1U8TA 9ABPA 1FSPA 5BRJA 4ZYLA 2ID9A 5TQJA 1A2OA 3OQNA 2FN9A 3BREA 1SXIA 3BRSA 1JL3A 4IF4A 1EWTA 4WWHA 4WZZA 4MQEA 1RXEA 3IP9A 3H5VA 3P9YA 3KCNA 4IMIB 3RQIA 4W5NA 1EAYA 1GUBA 1DBQA 3IP6A 3T38A 2E4YA 3SNKA 5TE9A 3EDCA 3KHTA 2IDMA 4F06A 2OQRA 4MS3A 4KZKA 1QKKA 3A3KA 1Z2EA 2LIVA 3BBLA 1D1QA 3LUAA 2DRIA 7ABPA 3GA5A 2B1JA 4XXHA 1NATA 4WT7A 3H1GA 3RVPA 4CBVA 2WJAA 3C3MA 5JNWA 4LX8A 1YS7A 3RH0A 1NXSA 5FWXB 3LUCA 1TJYA 2W42A 1BDIA 3LUDA 2X7XA 8ABPA 2O20A 3OLXA 4LDZA 1ZY2A 1KMIY 3CU5A 4M88A 3RVRA 5EWMB 4EVRA 1SD5A 3C6QA 3QK7A 4MS1A 2PUFA 2FLWA 5FWYB 4RK1A 3A0UA 1FQWA 4F8JA 1YMVA 3H5WA 3JY6A 3OO0A 4Q7EA 1KRWA 2PUBA 3OO1A 1QNLA 6ABPA 3ROTA 4MR7B 4YRZA 3QEMB 2CHEA 5TQ2B 2YHAA 4EVQA 4DQDA 3DZDA 3R0JA 3VNBA 1QO0D 3F6CA 4Z99A 1U0SY 4FB4A 5TQ0B 3Q41A 5JNSA 2A9RA 1DP4A 4EUKA 1ISRA 3LUFA 2QZJA 5C5CA 2PUCA 1XHEA 3HZHA 3KTOA 2JRLA 4O1IA 3Q15C 5TPWB 1JWLA 3KG2A 3Q7TA 1FFWA 3MIZA 3URMA 1HEYA 3IPAA 4KK3A 3QELB 3CNBA 3C3WA 5BRAA 3Q7RA 3KSMA 4L85A 5DCLA 5HSGA 4OLBA 3TX6A 5B3JA 4NCBA 1CHNA 1A04A 3G1WA 1FFSA 4RDCA 2I6FA 1JF8A 2QV0A 1OXKB 3OM0A 3O2JA 4Z9BA 4RY9A 4KQ9A 4OLAA 1YK0A 2IPAB 4MQEB 4MLDA 4OATA 4JOQA 2PJUA 1KRXA 1EWKA 1PEYA 3NBMA 3B2NA 1ISSA 2NZUG 1Z16A 3IPCA 3M9WA 1TLFA 3JPWA 4E7PA 3W9SA 4HNRA 4W5QA 3RVLA 1JYEA 2JK1A 2E4UA 4ZMSA 4MLCA 3IDOA 4G0ZA 1PUXA 2RGYA 4QYMA 4IGAA 4YP9A 3BILA 4WXEA 1P6UA 1URPA 1NXXA 4MQFA 5FWXA 3OQMA 1Z18A 5ED4A 2QW1A 5CNJA 1JFSA 2RDMA 1DC7A 3RVQA 1NXTA 4EYKA 1PNRA 1VKRA 3CG0A 1DBWA 4PICA 4GPAA 2HQBA 1UDRA 4IILA 1OXBB 1QMPA 3RVNA 3SY8A 1P6QA 3A10A 4MS1B 4G0PA 4N0QA 4KRFA 1SXHA 1DJMA 2R48A 4G86A 4E7OA 4W5OA 4WUTA 4YWHA 1ZGZA 2IPMA 4MR7A 1RNLA 4RK6A 3H5IA 1NY5A 3QLVC 2LP4Y 4UHKA 4MR9A 5T7BA 2FMKA 2LPMA 3EULA 3LFTA 4NQRA 4RXUA 2IOYA 3N53A 4RK0A 2GX6A 3DBIA 3O1IC 3NHMA 3HK2A 2RJOA 4G0QA 5JS1A 3HDVA 4Q6BA 3FDFA 1M5TA 4G0XA 3CZCA 3N0XA 1Z26A 3GV0A 1Z12A 4MGEA 2F8TA 4QYWA 5EWJB 4IMJB 1M5UA 4O1HA 2MSWA 4G0OA 3FFXA 3ILHA 4ZPJA 1ZHHA 1AB5A 1GCAA 2PUEA 5EWLB 4WXMA 3M9XA 2QR3A 2MSLA 4RXMA 3HDGA 2FMIA 3FGZA 3VNAA 5HQJA 3I42A 4KMRA 4S04A 3HUUA 4MR8B 1LBHA 1F51E 2NUBA 1DCFA 2E4WA 3OM1A 1JBEA 1USKA 2JVIA 1WETA 3SM9A 2FVYA 4MRMA 4N41A 3CKMA 3N75A 1APBA 5CHYA 3RVMA 3TB6A 5JNUA 4YV7A 3D8UA 3HM9A 3UKJA 2JCGA 3N8IA 5DGCA 5I4CA 1D5WA 1C4WA 4EYQA 2WWVD 1GUDA 5IUKC 3OQOA 5F64A 4Q6WA 3H5TA 5B3JC 2AYXA 4DN6A 3KYIB 4HNSA 1XWWA 2A9OA 1PEAA 4XFKA 1ZITA 4ETNA 4G97A 3H5LA 2LBPA 2IYNA 2R25B 5IUNC 3EGCA 4RK5A 3NNDA 4RZSA 2FEKA 1SRRA 3O21A 3CFYA 2GI4A 3CLKA 3FFWA 2QVCA 2PKXA 1B00A 3QX8A 2R47A 1XHFA 3N0RA 1M2FA 1NXVA 1QO0A 2VYCA 4EGSA 3O75A 1MVOA 2PL1A 3HV2A 1JH9A 2JBAA 3CHYA 1ZVVA 1LBIA 2BGGA 2TMYA 1U04A 1D4ZA 3CS3A 3OMXA 4JAVC 3LTEA 3HO1A 3UK0A 1DBPA 1YTUA 3I09A 1IIBA 5IULC 5GQSA 3ILYA 4KNYA 4F3TA 3O1HB 2FW0A 2HJ9A 3OLVA 4RY0A 3JPYA 2B4AA 1JFTA 5IX8A 3QEKA 2IKSA 4Z4EA 1RPJA 4MPTA 1F4VA 3S99A 1ZGGA 2WMYA 4IRXA 5HM6A 1CEYA 4XAQA 4Y9TA 1MIHA 2PL9A 3OLYA 1LK0A 5KC8A 2MYNA 3RVSA 1AB6A 2QSJA 2FEWB 1MB3A 5KWSA 5EWJA 3CG4A 1DG9A 2XDYA 5EWMA 3OLZA 1ABFA 4LDAA 1MAVA 2IPLA 5EWLA 3LUKA 3G85A 3H1FA 3SAJA 1PNTA 1JDPA 2E4VA 1TMYA 4JB0A 5FWYA 4MYRA 5JS2A 2F8SA 3HUTA 4G0YA 4KREA 4MAAA 2QVGA 3KLOA 3DLHA 1GCGA 3TD9A 4PE5B 2M1ZA 3O2QB 3RVOA 4RKQA 1E6MA 1Y1LA 4EVSA 3LKBA 3CZ5A 4LRQA 4PEVA 4N03A 2Q5CA 3JVIA 5BQ3A 4LE1A 3RVKA 2ZAYA 1JFVA 4Z4GA 1JDNA 2FSPA 2HQRA 5JNRA 4PYRA 4ZMRA 1QP4A 1QQAA 3QLUA 3JVDA 4NICA 2HQOA 4RXTA 5TPWA 1JYFA 4D6XA 3HSYA 4ETMA 3EQZA 5KQPA 1NXPA 2AYZA 1YVUA 3GYBA 4MS4B 4QPJC 4N47A 4TLMB 2VK2A 1DCKA 3UUGA 1YIOA 1Z15A 5TPZD 3TO5A 1GLGA 4MS3B 2PMCA 2QXYA 4TMYA 5FBHA 3QX9A 2PUDA 5CNKA 3LOPA 1W9HA 1VPWA 3QLVA 2VUIB 1E2BA 1USIA 1J56A 1U2PA 1RZRA 3LUGA 5BR1A 4XARA 2FN8A 3C97A 4FE7A 5DKFA 5IUJC 1TVMA 3HCWA 2MYTA 2JBAB 4YLEA 3DGEC 3H6GA 4LZLA 3HVRA 3IP7A 5KQGA 2E4XA 1BA2A 3N0WA 3FMVA 1DC8A 3Q7SA 3QLUC 3O2SB 4P98A 1JHZA 5IEJA 1QP7A 3CRNA 3OLWA 4RSMA 2J48A 2E4ZA 3L49A 3F6PA 2FQXA 4G0MA 4KFCA 1L5ZA 1PHRA 1BDJA 2A9QA 2GWRA 1ZESA 3JTEA 4EYOA 4S05A 4Z4IA 2VUHB 4B09A 3HJFA 4N76A 3JS5A 1W25A 4RS3A 4RU1A 2GKGA 2FTKE 2N9UA 4RY8A 5CNIA 1EWVA 4XASA 3K4HA 2FLKA 1A0OA 3H75A 3L6UA 4YS6A 1P8AA 4D74A 1Z13A 2P4UA 2H3HA 3TMYA 4H3HB 3I5AA 3MYYA 1ZH2A 4L4UA 3LMKA 4LE2A 1ZN2A 2P9HA 5KQLA 4Z4CA 3RVJA 2MSKA 2L2QA 4W5RA 1BDHA 3GBVA 1K66A 5JNTA 1YMUA 3GL9A 1NTRA 4RKRA 4F12A 3MA0A 5GOTA 1NXOA 3K9CA 1S8NA 4DADA 4MR9B 5D2CA 3QELA 4KVFA 4W5TA 4RK4A 4QICA 4KPYA 3O1JC 1H9CA 1RZRD 1USGA 1ZH4A 2ZWMA 2QU7A 1QP0A 1R8JA 3KJXA 2WRZA 3EQ2A 3MMNA 4TLLB 3LUHA 4XLTA 3NNSA 1TM2A 1D1PA 3KS9A 3EODA 4NCAA 4MS4A 4O5AA 5HKOA 3LKVA 1U2QA 1C0EA 5CNMA 1EHCA 3OMWA 5KC9A 1LJLA 1VLZA 3E3MA 3T95A 5DLEA 1JX6A 2IPNA 4RWEA 2JVJA 3HEBA 2YHBA 3FFTA 3MM4A 2V0NA 1QQBA 1RXIA 2L17A 2PLNA 1K68A 3EJWA 4Z4HA 5KQMA 4HYEA 1YK1A 1BVHA 1DCMA 2WB4A 3I45A 1LJUA 4MQFB 3Q9SA 4TN5A 3GBPA 4KK4A 4YCSA 3KYJB 2CHFA 3NHZA 3H1EA 4YO7A 1E6LA 2PAFA 1D2AA 3GWGA 4FE4A 6CHYA 2LUOA 4UHJA 2ID7A 4JASB 4EY3A 5C5EA 2R4QA 2GBPA 3SG0A 3GRCA 1FFGA 5T3YA 5TPZA 2PE5A 3DGFC 4Z9AA 1BAPA 4H3KB 1E6KA 1ZAYA 4OG2A 3HS3A 4RK7A 2NZVG 2CWDA 2FMHA 1YS6A 2NT4A 2WY2D 2MYUA 3T6KA 1DZ3A 2FKAA 2MYPA 5DTEA 1NXWA 2PUGA 4ETIA 2L18A 3NNNA 4OBBA 1ABEA 3IP5A 1P2FA 1Z17A 2OENG 3H5OA 3HXMA 1Z25A 4LE0A 2CD7A 2RJNA 2FEPA 1T34A 3H6HA 3QLTA 3DLBA 1Z2DA 4OTZA 3SQNA 4PZ0A 4KV7A 5IBQA 3GT7A 3MQ4A 3T8YA 5ABPA 2H0AA 4YR7A 3O74A 2HSGA 4GNRA 5PNTA 1DRJA 3A0RB 1DRKA 3KKEA 1EFAA 2KYRA 4JP1A 5IC5A 2HPHA 4P1ZA 3F73A 4MR8A 2JB9A 4NV3A 3E61A 1KGSA 3QEMA 1MB0A 2FQYA 5TQ2A 2NT3A 4Z0NA 2FQWA 5KI6A 2JVKA 4ZJPA 3C3KA 3LUJA 4MRMB 3ROFA 4D6YA 3BRQA 4H60A 4HNQA 4JB2A 1L5YA 2WJWA 2A9PA 3CTPA 1M2EA 4Z4FA 4ML3A 1I3CA 1JLKA 3D02A 5TQ0A 4KQCA 4F11A 3EAFA 4JA2A 5FBKA 1CYEA 3KLNA 5JNVA 2FMFA 2M98A
chains in the Genus database with same CATH superfamily
1V41E 1G5FA 2X58A 1F3LA 1TIKA 2NSLA 3PWZA 3BFKA 1HE5A 5EHNA 3DEHA 3FB1A 3N6VA 3GDHA 2JI6A 4IH4A 5IAKA 4GVXA 1JHQA 3KVVA 1EVQA 3K1AA 4HLQB 4CV0A 1EINA 2M6SA 3EWIA 4IZHA 4JEMA 5BSGA 4G0UA 1FSPA 1FP4B 5J2TB 2P90A 1L8OA 3KLPX 1GIAA 3OQNA 4F0JA 3BREA 5LD2B 1X9HA 1U94A 1O8BA 1Z4LA 3H83A 3I01M 2XVAA 2ZIZA 3WK8A 3K05A 4XYMA 5FNZA 2XNHA 4MWBA 5JMWA 5JXJA 1EAYA 1GWNA 3QUSA 4BO3A 4EEZA 1USWA 2WHXA 1WL8A 2O2ZA 2YDXA 3KUKA 3JARA 4IWNA 3WJAA 4F06A 2O4UX 1MABB 3NH9A 4P4SB 3TFOA 1QKKA 4MRAA 2PFSA 4ZAZA 2P9GA 4L3WA 3U09A 3LUAA 2EP8A 5AM4A 3FIUA 4CQMB 1Q2UA 5CFQA 1YR3A 3AWDA 2QD4A 5L3QA 2XKJE 3PWKA 3G89A 1O6FA 2WU4A 4YPVA 5IC6A 2I4NA 4EA6A 3IQHX 3M5WA 2HMVA 3LOQA 4KXLA 1NBHA 3FTCA 1NKVA 4X6LA 1KMCA 3NS7A 4MYHA 4HH0A 4G5XA 3QSGA 3COVA 1G8HA 2HJRA 4FYHA 4OU4A 2PUFA 2E37A 4GM4A 4D4GA 3O31A 1MTZA 1HTWA 3CXRA 3NG1A 3VZDA 4QFDA 5EP1A 1JWAB 1W4LA 2IBTA 2BZGA 2B5OA 4XIYA 1U3VA 2IYTA 2HA3A 3RRFA 4TXJA 3ZV6A 3EQ8A 4B6FA 3OCXA 4IIJB 4JT2A 4ZICA 4KCGA 2IIQA 4KW7A 1PX2A 5IJ0A 1EEXB 1GPDG 2FJPA 3AFOA 3OJWA 2OV8A 3USZA 3Q41A 2A7QA 2CXSA 1Y4ZA 5T57A 3MBIA 3SC6A 3IEXA 2JH3A 2GM3A 3RVBA 1W4RA 4CQJA 1XHEA 2H18A 5ES4B 1L7VC 1YAJA 3D0RA 1O0BA 4CXMA 1I9GA 4DB4A 2NU6A 2WJJA 4WESA 3CINA 4NJMB 4HRYA 4EUNA 3CNBA 1RYEA 3V8VA 4M46A 2C2YA 4CVNA 4ICIA 1Q0QA 1WOMA 2QNIA 4UHDA 3D7SA 3KZKA 2Q45A 1QG2A 2ZB4A 1HLDA 2HZ7A 4TMVA 4Q02A 4B34A 5TARA 1YBVA 4BS9A 4RDCA 1PWZA 4PIMA 1JIUA 2IYYA 2HSDA 4OLAA 3ZE9A 4DANA 4TN1A 1I7PA 1GPAA 5J2UA 3ONNA 1C3EA 1O5OA 5ENVA 2O8CA 2AN4A 3R2JA 1XXHA 4NU5A 3TKLA 1EWQA 2NZUG 4XJTA 3ZWPA 4CMBA 3F3YA 5H3HA 2UUAB 4AJOA 3UO8B 3VOAA 1F48A 1NQWA 2Y4NA 1ZOLA 4JXJA 2R751 2E4UA 2XCLA 4P58A 4X64B 1X1AA 1U31A 1IXKA 1DAFA 5IC4A 1EUCB 3ZD8A 4BNMA 1HYEA 1PCXA 1Y9DA 2GPYA 3DL0A 4DGQA 5DO9A 2Z6VA 3HR4A 1X1TA 1M66A 5FI1B 2LRHA 4ZJYA 4RTLA 4U2KA 1M33A 4HDCA 5B1DA 1DL5A 1QKJA 1GRNA 1A5SB 4RJTA 3RYCB 3CG0A 4QLAA 3OY2A 1EI9A 4NV0A 2OILA 2WM2A 3WGIA 2VP6A 4D3YA 5KTKA 1FE8A 4RTNA 1JJVA 3RYIA 3VFDA 4B75A 5ECGC 1CZHA 4YWJA 5BRNA 3TI7A 1UJ2A 1WXHA 4RK6A 4R0VA 4HDMA 2UYYA 4R6XA 5GAJA 1F17A 2ATVA 2WF8A 4ISCA 1HDYA 1P1KA 2VNAA 3FYSA 3LSYA 3RT9A 4MUJA 3CLTC 4ZPXA 3FYCA 1WDLA 3PA8A 4DLVA 4J1NA 2OWDA 3FR8A 1D9ZA 1PZMA 4AJHA 2FYTA 3HCAA 4HB3A 3Q4GA 1P9RA 2F48A 1XFAA 4OJTA 1JEQA 5LDDC 1MW9X 4IG9A 4NDNE 5EJIA 2ZP1A 1N1GA 2A94A 2WPDA 3BCSA 2XA9A 4MGEA 2F8TA 3KKZA 2CE2X 4U3JB 1GDTA 1X39A 4IMJB 5KDOA 1DTWA 3IQXA 4OXXA 4P3PA 5DF1A 3GAFA 4ZT4A 4JJ7A 1F2UB 3B89A 3S40A 5FL7A 5DASA 1QUFA 2VRNA 3EVZA 4MP3A 2ZR7A 2RHRA 2BGMA 4C6TA 3HUUA 4ENQA 2AOUA 2ZGVA 3SZUA 2Q3JA 2E4WA 3D4LA 1JBEA 3SX4A 3ESAA 1UT6A 3CLUD 4ARAA 3HI6A 3L4SO 2ONYA 5JWHA 5ARCA 1JU4A 2FPXA 2XCUA 2H2HA 4BFTA 1V9CA 3Q2OA 4URWR 4A4DA 1D2CA 2VNIA 1U0BB 2K4MA 4N8EA 4YFVA 5DHRA 3S2YA 2VPIA 4R2JA 3S8YA 1Y8ZA 2PS3A 2O3SA 2GN0A 2NO7A 1I94B 1S4MA 3VPAA 3NQ41 2WWVD 5KU1A 2D0PB 3MTEA 4XWGA 3HBLA 4HAXA 3NLLA 4OYRA 2JGEA 3D8RA 1CG6A 4AP5A 2CXPA 3M83A 1FUYB 1KL7A 4X97A 4AMYA 4K28A 1OXVA 4G97A 3CTMA 5I9BA 1W34A 2LBPA 3PI6A 4D8WA 4B3JA 4DCJA 4K81B 2O2SA 3EB9A 3KAQA 4Z4QA 2FP3A 1ODLA 4RF5A 3BULA 3H2YA 5AW5A 2YXDA 4EDFA 3CGWA 3QBTA 5DSZA 5K45A 3WRWA 1X70A 5IF3A 1N8KA 3T94A 1JG2A 1CRQA 3PRJA 1XHFA 4V0QA 4NZPA 2HTEA 1OT3A 1VYUA 4LUCA 3ICEA 1UBMS 1LDGA 5EESA 2X22A 4UXIA 2CHUA 1NIJA 3GJRA 4IVPA 3OMXA 4XH9B 4C7MA 3ZU2A 4E09A 2B7BA 2YINC 3IE0A 3R5SA 5JVDB 3I09A 3R9XA 4MKHA 3OCVA 2A86A 2AWOA 1A97A 4ZHQA 2LDXA 3ZI4A 4Z51A 1U9IC 1JEYA 1JLMA 1MQ9A 2AJTA 2BFCB 4RY0A 3F74A 1XPRA 1B8NA 3PFWO 4CIWA 2AZ4A 2ZRJA 4ZANA 2JASA 1JR3D 3E9NA 5CA0F 4NESA 1L7NA 2JGIA 4N9QA 5MGBA 3KQMA 4N5HX 1CY0A 4HWOA 5CBPB 1AXRA 1IBSA 1TT5B 1Z37A 1OIXA 2QUKA 5DCWA 1LI4A 1U5AA 2GEJA 5BWBA 5CYGA 5IT4A 3TEJA 4KR6A 3DD1A 3EGIA 2BSQA 1PZNA 2ZETA 4L7QA 1Y3CE 4R7GA 5F5NA 5K8TA 1Z0UA 1ABFA 1T8RA 2GDJA 1F2UA 1MAVA 3SQLA 3DMRA 4BQEA 3G85A 2YXNA 1QG6A 3OZUA 1SO8A 521PA 2DPLA 4CCYA 2ENWA 2QY9A 3I2KA 4DCOA 2O5EA 4PGFA 4FOLA 2JZOA 3S44A 2X6QA 4I1SA 3IEUA 1EVYA 3TM4A 3OCZA 1UXHA 3WP0A 5ALXA 3RTBA 2C31A 3LRPA 4KMMA 4NNPA 3KT6A 1N92A 2CMDA 3V3TA 1CZOA 2J5RA 4KE7A 4KV9A 3W5CA 4BE9A 5K51A 3M82A 3VNQA 1IDOA 3DE5X 1T9CA 3VISA 3VTAA 2P11A 1UBSB 1QYIA 3OZDA 4RHYA 3T3DA 3BS4A 3OJ0A 4FGZA 4V0OA 3RTEA 3DWFA 1KI2A 3MSCA 1Z5ZA 1HMYA 2XQVA 3DBLA 4LGMA 2HSEA 1U0NA 4MARA 2IS2A 2H7YA 2R5FA 5I9NA 1K06A 1UBRS 3CZMA 4GEGA 1YIOA 5KB3A 1TT7A 2BLLA 4WDQA 2KWIA 1IHPA 1XN4A 3IESA 3P0JA 2ZUCA 1ZD4A 2Z1DA 3MUFA 4FFOA 2Q0SA 2AJCA 2PMCA 1ZJ4A 4Y2UA 2JHFA 2YUIA 2YYAA 3P9KA 4LC1A 4OA5A 2GGSA 2AF4C 1E2BA 5JFOA 2XB4A 3RPEA 2AF3C 4URZR 1KPHA 4ZMBA 2ZIXB 3OMLA 2ODAA 2GD6A 2OGZA 3HDJA 5EJ8A 2Y1WA 5EHIA 4FLMA 5JVDA 3AVTA 2QB5A 3BD9A 3AQ4A 3FUCA 3B1JA 4CLDA 1P74A 3AIMA 3PDIB 5I48A 1U8ZA 5IEJA 4K46A 3AETB 2BFCA 4RSMA 1VIYA 1D2MA 1IAVA 3BXZA 2EOAA 3QXHA 2PKQO 2WIGA 4WZAA 1T9HA 1HQDA 4BNUA 4EF4A 4N76A 1C3XA 1DFGA 3N1UA 3T4PA 4H3VA 2WE7A 3K70C 5CLHA 4RY8A 1PV2A 3L1JA 4FQ7A 1WOYA 1A0OA 4HC4A 1H1LA 4MA4A 4UBNA 2QT0A 2R5WA 3JYHA 1MX1A 3P1JA 1QVVA 2BMAA 3TMYA 2D1YA 1OXUA 4HQNA 1I7QB 1R16A 2HK9A 2JDID 4CCYB 3AONB 1TF2A 2PWAA 2DBRA 2PH5A 4LXTA 3OZBA 1CUUA 1B26A 1P5HA 3BB4A 3DOFA 4TKVB 5G0UA 4D96A 2Z5LA 5LOVA 3RADC 3K9WA 1NXOA 3K4QA 2ZJFA 2FCAA 3C4VA 2P69A 1K5GA 2HUNA 2YWBA 3H4IA 3W8FA 4PF1A 4F96A 3OEYA 1J1UA 4O2BA 3SS7X 2WK1A 4W5TA 3GDWA 1TNDA 2O1EA 4B0PA 3T34A 3WNQA 4JLOA 4EFDA 3QHQA 3W5HA 1L3IA 1T10A 4JR0A 5ICFA 1YIDA 4BP1A 1JAZA 1X8JA 2QN2A 3F5SA 3QBEA 4FDAA 4KOEC 4MK4A 2EZ8A 3U48A 3GGDA 4BAZA 3AL2A 4ANFA 1H3FA 4YUZA 4H6VA 1MC1A 4EJ6A 3V1YA 1G21E 1QS0B 1U2GC 2J4DA 2PBLA 4OY3A 5J4HA 2YCLA 1MC4A 2ASEA 3DBLB 4U7JA 3JQCA 2XXAB 1JT2A 3LXMA 4MS4A 2B4TO 2FWNA 2VF8A 3VR0A 2VT6A 1Q22A 3UGTA 1PK8A 2JLQA 2FFJA 2NSDA 2XXJA 1KZ9A 2Z30A 3JQBC 5IH7A 3CVUA 5BT8A 1ADJA 1HYBA 3JZFA 3LYAA 3UQZA 4RE6A 2ZRKA 1BQ3A 1J8MF 2ST1A 4Y6OA 3R7WB 1J0DA 1KYYA 3DKKA 5HGXA 2XCTB 1QQBA 4WEOA 1E1LA 2WIDA 2BRUC 5CVCA 2J3DA 4LYGA 1KEPA 4AWAA 1YCFA 2DUMA 4RVOA 1I2CA 3JQ8B 3V8BA 5REQB 2W2KB 5FYQA 1D2GA 1RZ3A 3UTDA 5JCPA 5JQWA 1E6LA 1RBZA 3R5KA 3PDIA 1RLOA 2ZEJA 3IJEB 3VPDA 4C21A 3D6JA 1WUTA 3KNZA 4PC2A 3PL5A 3AO0B 2VDMB 4JFRA 3VAYA 1RIIA 1CQXA 3TSZA 5T3YA 3VR5D 4HXEB 4GPIB 4Q3DA 5IT5A 5ADWA 2GEVA 5C1IA 1X1CA 3EXFA 4RV9A 5IAAA 1JAIA 1WPXA 3RAFC 3RIEA 1YS6A 3T0FA 4EDHA 1BGWA 4US0R 4E5SA 4OHFA 2NGRA 4U0KA 4AWBA 1NKTA 1ZCBA 4M0FA 3T7EA 4OBBA 5KTYA 4PHGA 2EBFX 3MRSA 1G9SA 2E49A 1SU4A 1QRDA 1WEHA 9ATCA 1K7YA 3H5OA 3HXMA 4LE0A 1WCYA 3IBFA 1M1NB 2AOTB 4G5HA 4A6DA 4R1QA 1T3TA 3LYUA 4J1TA 2PGDA 4WDRA 1O97D 4R8SA 3GT7A 4QDZA 3V8PA 4TKVA 1JQEA 1KDPA 2H0AA 3F67A 3HBMA 3ZK7A 1NLMA 3FYUA 3SSAA 621PA 5I3ZA 4GNRA 2UYHA 4GQIA 1YR1A 4TVKA 3QFHA 5EMHA 4C0KA 4G5GA 1JR2A 3MRXA 1O95C 3KKEA 3K71B 1EE9A 3RO7A 4ZAWA 1QCYA 5IC5A 3S2FA 1Y4SA 1C29B 3UXMA 3IKLA 4IFEA 3OWOA 3PFBA 5J43A 3WYNA 2CBZA 2J5XA 4PW0A 2W2VA 2X6TA 3ZU4A 2HD4A 1C8LA 4UHCA 1P7WA 2ZWPA 4YMSA 1N77A 3WIOA 1J39A 2F1RA 3PPXA 3THXA 4NOKA 4OH7A 3F6EX 2IHNA 2ZM5A 1XKXA 1JLKA 1N3LA 2Z6AA 3E22A 1UJCA 4LAFA 2Z2IA 1G7TA 1L6RA 2VEDA 3BYZA 1QK5A 3PUXA 4KUGA 4MV0A 1PG2A 4DG9A 4QUGA 4LV6A 4LY9A 4NE2A 5K0EA 2NAFA 2WU0A 3EIOA 3F90A 2XJ4A 1WDTA 3MTGA 5EGNA 3C3AA 2W6ZA 4BBJA 5LNK1 1IVNA 4E03A 1YI0A 3AHIA 3UJCA 3IA7A 4DMGA 2CN1A 2DUWA 1ZAKA 2M98A 3E81A 1K8XB 3VH4A 1SK9A 2R8XA 3G2PA 5BORA 1DMSA 4J0IA 1NR7A 4WY2A 2CY0A 3PUHA 4NYMQ 4BFUA 5AVJA 4Z2YA 1NAIA 5CMLA 3B6EA 2P4EA 1L4UA 2W6OA 3C3YA 2H8KA 3FRIA 2NXJA 4HX2A 5HS6A 3KPVA 4GI2A 4XR4A 4LZPA 1QHYA 3FI0A 2W2KA 4TWZA 3CF2A 3Q3VA 1QGZA 5M04A 1Q0RA 3DLAA 3R3UA 3UJPA 3SQXA 2O8BA 5IKEA 2Q46A 4D4IA 3U6BA 4P53A 2ZI9A 4DDTA 3AF1A 1HTBA 1XEXA 2ZQYA 3KHTA 1RHMA 5TQVA 4BPBA 2JC3A 3DTTA 3CT4A 4AUEA 1UBTS 3A3KA 4GAEA 2Z57A 4JNKA 4MKZA 2BR5A 2OE2A 2R7AA 1D1QA 5AJYA 2VTKA 4CM7A 4JBXA 3DHWC 4MV8A 4HNTA 1RRCA 1S3FA 4WT7A 2XYPA 2MINA 1Z63A 4RVDA 1QORA 4LX8A 2ZRCA 4NCHA 1XVLA 2OV6A 4D9JA 4P35A 1RWVA 2YZKA 3E9CA 4LF4B 3LUDA 3OC0A 4LRYA 5JCJA 2OHJA 3L7BA 4Q7JB 2B4RO 3HFGA 4NIMA 2Z9DA 2ZR9A 4EG3A 1OZGA 5B12A 3DDCA 1Y6RA 1F0PA 2X42A 1T2UA 1POXA 2X5JO 5H82A 1SD5A 2ACWA 2IU6A 3GLGA 1Z4PX 3TF5A 1G20B 2WD7B 4GYWA 3PFGA 3ES9A 1GGHA 4CLHA 3OKAA 2OFWA 1KRWA 4NXMB 1UBOS 1ZU4A 1IZ7A 1WUKS 3ROTA 6ABPA 3MINB 5JS7A 3O0TA 4ND1A 1I3NA 4URUR 3VAAA 2PKRA 5AVZA 2FRDC 3MNFA 4RLQA 4C43A 1LV7A 4KDCA 5G0VA 4EVQA 5LQRA 3DMTC 4NHOA 1WXWA 3UW1A 1DUIA 4D9EA 1ZGBA 1NGSA 3D54D 1LKZA 1W1IA 4TVBA 1XYYA 1VJ1A 3R6DA 1S2OA 4F46A 3REQA 4FB4A 3R7FA 4MZDA 3GEHA 3K9FC 3A9CA 3B5JA 3LQ2A 4XVCA 4YMUA 4OK6A 4XDZA 1T0PA 1SKYB 4KXQA 1G63A 1SNYA 1TA0A 2XOXA 3OOHA 2W90A 4KWCA 4PXSA 2JBHA 1XZDA 2FF7A 2WWRA 3KTOA 1QKIA 3Q7TA 4ND5A 2RHLA 1JDBC 2PZMA 2D5BA 1QPBA 3ELWA 4ZIRA 3KQLA 1JKXA 1I2BA 4WVFA 4O8CA 2QVBA 3URMA 2I8CA 4J7XA 4LTDA 2ZJAA 2HRRA 5KQSA 4BNHA 3WKBA 4FMPA 4MGHA 4MPRA 3UC5A 1XXHE 4DR1B 3Q7PA 1GG5A 4QPCA 4RIIA 2J9XB 1FFSA 3TQFA 1ECLA 1FW8A 1JMVA 3JYLA 1K5DA 3ESQA 1YZQA 3S2UA 5C5IA 5FAKA 1JXQA 1YFZA 1TCBA 1D09A 1NMXA 4NDAA 4RY9A 3UJBA 4PCLA 4RVFA 1I36A 4PQEA 2VR1A 3EWSA 4MLDA 3ZKWB 1AMOA 3FDZA 5IZ4A 2ACVA 1YJQA 4KN5A 4AX4A 1RU3A 1C1YA 1JH8A 1Z83A 3IIJA 1R8XA 3IPCA 1E9AA 5EPEA 5MF6A 4AZVA 2JEZA 4PNEA 1CR6A 3IP3A 4RH1A 3VZCA 4X20B 5LZ2A 4ZMSA 4NDZA 1KETA 4CMAA 3NW9A 1AKWA 3NBQA 1XX6A 4ONEA 1XVTA 4N7BA 4EF5A 1US8A 4XTCS 3LHDA 3ESYA 5CM8B 4KQ1A 3K5PA 1K92A 1MHPA 4MP6A 4C4SA 3GXBA 4AX8A 3W3ZB 1AK1A 3JD0A 4HH4A 1VLVA 5TF0A 3SC2B 4CL8A 2OCIA 2YVUA 2B92A 2Q4OA 4LWOA 4EQ6B 1QMPA 1N3YA 5I7HA 4URFA 3DMGA 4LSMA 2Q7OE 2IVZA 3GJXC 3H8WA 5JIBA 7REQA 4O2BF 3GGCA 3A04A 1YUBA 3A6GA 4IRMA 1W5TA 3GW8A 2V6BA 3MINA 3DLIA 2GZAA 2BDEA 3GRVA 1J06A 1RWKA 1EK6A 2OC9A 1KY2A 2QZ9A 3G8CA 4EG7A 3PRKE 3DCJA 3SSNA 1FVOA 4WXYB 3K0BA 5AHWA 4X63A 2VSXA 1DCTA 1CDDA 3NGMA 2QJWA 4PTYA 5IW8A 1Z22A 4Q6BA 4F6RA 1JSLA 1R12A 4HNAB 2V3WA 3BK7A 5JH7A 3CWCA 5LU9A 1VM6A 2UYQA 4C07A 2JGFA 2AJBA 1GDDA 4DC9A 3AUAA 4C30A 2IOFK 4UZEA 4FW8A 1P31A 1FLVA 3RHFA 4K3UA 2PX3A 1ZWLA 3BWYA 3PI7A 1C5KA 1ODJA 1XA0A 2J4FA 4YHBA 1YJXA 2DHRA 3WSWA 3CNLA 1XZHA 3H05A 1K0FA 3H84A 3ZWQA 1GAXA 1LBHA 3F78A 1HURA 3VC2A 3B12A 3DBHA 4DJJA 1GU0A 3FVQA 1A9XB 1DWQA 1T4GA 5SZHB 4LI3X 3NDPA 3TEMA 3PHGA 1WETA 4OUDA 2C4KA 4X41A 1M34E 3TNYA 1W8DA 1BGXT 1KVRA 1PKXA 3HUDA 4KGZA 3DLPX 5TB5A 3IKJA 1U7OA 3IAEA 4R54A 4Q7MB 4AS3A 3HM9A 2XNSA 1L5VA 2XWQA 3N8IA 3P0FA 2D5CA 2KLHA 4KOAA 5I4CA 1U0JA 4XX0B 1NJ8A 3KZVA 4DV7B 1HSZA 4UUNA 4CRWB 1G98A 2NQTA 1GUDA 5DDIP 3ROGA 1T3SA 4HNSA 3DWIA 2NU7A 1B6RA 4J91A 5FLXA 1D6SA 4BJ3A 2QBYB 5EAIA 3CNQS 3FX2A 4Z8XA 2VWQA 5EUBA 1ZD5A 1YKGA 4FSXA 1P5JA 1SRRA 1GPKA 4LDRA 3RAJA 2P2YA 4BCDA 5JJBA 1H66A 1SZJG 3WNCA 4L5AA 4BB9A 4E33A 4PFJA 5DHQA 1SUDA 3KEOA 3KWFA 4ZCQA 5E0KB 1L5FA 4OBEA 4PWYA 4CIYA 1M2NA 3R8CA 4YI5A 2BEKA 3KPWA 3V6MA 4PFQA 3UIEA 1AHHA 3O75A 2FK8A 1GG2A 1MVOA 1DEKA 1MQSA 3Q10A 1WCIA 3H4MA 1UKYA 4I4IA 4YYEA 3FJOA 5F51A 3UYKA 5E1OA 5EJGA 2ZRHA 1DOHA 1SCQA 4BP3A 2RGUA 4EFLA 5LP6A 3ZJVA 2UVDA 3BWCA 3CVJA 1T26A 4PZDA 4BYMA 1XA3A 5IAOA 4M7RA 1JFTA 2BR4A 2IKSA 4RKYA 3GG9A 4DCSA 1UAGA 4MPTA 4P2BA 4Z0PA 1KE2A 4J0KA 2C4HA 3AR3A 1W76A 1AGPA 5AUQA 3DVRX 1XQXA 4HADA 4H27A 2R6DA 3OQHA 3TE7A 1P9NA 5G0SA 3I0NA 2IHVA 4O2RA 4HNAA 4JMPA 4I7EA 4D9KA 4ER3A 1QPGA 1RLUA 3ILXA 4FVTA 3H8VA 3BSWA 3U9TA 4LSZA 3O9ZA 2C7QA 1W35A 2ZTUA 3ELYA 1ZG3A 2ZSHA 4D43A 2D4AA 5A3SA 2QMOA 4KQEA 1S2NA 2ZYGA 1NJ1A 4ESEA 1RXYA 2WTEA 3AKYA 2OB2A 3KR1A 5CLIA 4CDMA 5G3YA 4EJMA 3JZDA 1KF0A 4MAAA 3Q3GE 5JWOA 3DLHA 1GCGA 1VKNA 4BO0A 2VDRB 1NJSA 3RVOA 3EPJA 2P4QA 1KY5A 2C5BA 4RKQA 3WLSA 2BR3A 4QYIB 1AQNA 2QKYA 5BV8A 3KZMA 1WLYA 4OUDB 4PRLA 4Z3DA 1QRTA 3OE7A 2Q3EA 2H1SA 3PHHA 3KDAA 1F3OA 2NTEA 4R1TA 4BQIA 2D62A 4TS3A 2ZSKA 1X77A 5K09A 2QZ4A 1G2OA 4DT1B 1FUKA 3VSEA 4XX1A 4F4HA 1BDMA 3EQZA 5ILGA 4D56A 3CE9A 3SYKA 1UPAA 1WHSA 4M1QA 4LOAA 4Q4HB 4ZDKA 4KQJA 1M6NA 1L1EA 2B0JA 1OVMA 2OXIA 5BMVA 5JVDF 2Q1UA 3ICOA 4R83A 4R8MA 1KSGA 3V48A 3CRQA 4HPJB 4OQFA 2QROA 3QLJA 5JOQA 3FOFC 4XWTA 4JLDA 2F55A 2ZJ8A 2WHQA 4NFLA 3V34A 1GCUA 2X9VA 3LOPA 4ENTA 3KR2A 3L92A 2WU3A 3MTDA 2LW7A 3KTFA 3TZHA 1LV8A 2VBCA 2GBLA 4OSEA 1NYRA 5KAPA 2XTMA 3MT7A 1ZOSA 4FE3A 3HGTA 4L08A 4IQ0A 4C4TA 1RZRA 1FXUA 1I6LA 4EAAA 3ZGNA 4AY6A 2JAHA 3L9XA 3EXG1 4EA7A 5F9FA 3LA6A 4LZLA 4YGYA 5KWEA 2BBTA 2H8GA 3IP7A 3FPHA 5HIMA 1U0FA 4D79A 9LDTA 3EOAI 5JSHA 3L4BC 4GRDA 5H81A 3KB6A 3W5AA 1VRWA 2QD3A 2QTTA 4ER5A 3CRNA 4HBGA 1V37A 1MXFA 2HCJB 5JZBA 1LF0A 4RD4A 1XQ1A 3AVXA 2R6CA 3WXMA 2JJ1D 5LP1A 4ADSG 4GE3A 1XJWA 1ZESA 3A6FA 3E3OA 3IKTA 4JXXA 4OA8A 4PM4A 1JYSA 5JUWA 1BWQA 1HDEA 3PDUA 2FTKE 3C1UA 3ZD6A 1EG2A 1CUDA 1CIPA 1SG6A 2AT1A 4JYBA 5HILA 2X5XA 2CLKB 2HOQA 2PH7A 1E79D 2XUAA 3D8SA 3K4HA 1O6ZA 2OBLA 3L6UA 4IXMA 4QHSA 3T1VA 4F04A 4HTFA 4KMOA 3WGUA 3ONEA 1MEEA 1SIWA 4DRXA 2BJHA 2QN7A 4KVZA 4UREA 1Q14A 4XCXA 5I7VA 2I2XB 3A4MA 1XLUA 2P7HA 2C59A 3OJXA 4HYTA 4KXXA 1JIJA 3EFHA 2XECA 3MC1A 1W5SA 1YCGA 1ZHOA 2NVWA 2WYHA 2R3SA 3UFXB 4W1RA 2YN0A 1VCNA 3CUEF 1HZJA 1L4YA 2HIAA 2PKCA 4NV1A 4EPTA 1K8ZB 4KVFA 4OFBA 3ZV5A 2BOVA 4BV9A 2F4NA 2XQFA 5BSHA 3R4CA 4EEXA 2EL9A 5BN1A 2IEDA 3ETHA 1JHRA 2D0OB 4U5QA 1YH3A 4B80A 2VHEA 2X15A 4P0QB 4GLFA 2CNBA 2IYVA 2ONKA 1J5EB 4L73A 1R8JA 3QU7A 2V54A 1J23A 1WKBA 1EK1A 4FT4A 2AI3A 2FQQA 4AS2A 3NTOA 4OQEA 1LZKA 3PQDA 1TDJA 4IIUA 1MIOA 1DKPA 4I3GA 1IXSB 2OO7A 4MCIA 1WHSB 3WOHA 4KAJA 3IEMA 3BRWA 4O5AA 3U26A 2R1ZA 3GH1A 1C0EA 4UUQA 3AM5A 2FPUA 3HI4A 4KIGA 4QOEA 4U2EA 5CNMA 4YUVA 1N2IA 3V8RA 3WNVA 2VA8A 4NZMA 5KJEA 5SYAA 4YYZA 3NRCA 1ZS9A 4G81A 4B2LA 2NXCA 4E15A 2ZJ7A 3W78A 1QHFA 1VLLA 2CL7X 4OF4A 2JFQA 4KXMA 4X6XA 1AA9A 1F14A 5JPIA 4MYUA 1MX5A 3W90A 4CKWA 3GZNB 1E92A 1UM8A 2JD2A 1YNOA 3QMVA 3GUUA 1Z2NX 4MOWA 5C9ZA 1DO0A 5LMNB 1OYYA 3GGJA 4L8LA 1S01A 2JH8A 1WVIA 4YY3B 4B6RA 3OI7A 4E3WA 5JJKA 1ULAA 5EXTA 4FYKA 1T6BY 2CHFA 1OA1A 1TUBA 3JD1A 3QFFA 2WWWA 4AF6A 2G0TA 1QDLB 2AYYA 2P2DA 2YWRA 1P2SA 3MAJA 3W5IA 3HWSA 4EY3A 4IDCA 2O50A 4URHA 3AEKA 4YRRA 3E5NA 3AVPA 3KCQA 4B7ZA 5JY6A 1UODA 2IHJA 4H3KB 4LYHA 4PLCA 3ESDA 5BSVA 4RESA 4ZI2A 5C8ZA 1GTZA 3DT6A 4RTSA 2VF2A 2BFOA 5FA8A 1RQPA 1H0SA 2ZRDA 2IXBA 2MYPA 1R5OA 1IPHA 1KP2A 2VZLA 3UMSA 5B6IA 3KTAB 1QCZA 4W82A 2BEWB 3OPYB 1AKUA 2WA1A 4DRXB 2NV6A 2YS6A 2R44A 3F5DA 5JMPA 4GW3A 5ALPA 2OENG 1Z25A 2P65A 2CD7A 2YWDA 3NBYC 4BMDA 4UMDA 2AFHE 1CS0B 1Z2DA 3N5CA 1QR2A 5ALZA 3UMRA 4IMRA 3D6TB 4C4PA 3GGPA 5IBQA 1IXYA 4J0GA 1Y1PA 1ADYA 3EC7A 1J5XA 1P5ZB 3OZWA 1WU7A 1BOFA 2QM8A 2JLAA 3A0RB 2VTVA 1HYQA 4EKGA 2Y0EA 3DCNA 5LZ7A 4B6QA 3FUTA 4B76A 1BNCA 2XMPA 4JKYA 5KHOC 1SG9A 2Z5GA 4MR8A 4FGKA 1WMFA 4F1WA 1R37A 1LLUA 3E61A 1VBNA 1KAMA 2BBSA 5DJ5A 1ZONA 5TVGA 1L4MA 3AF0A 3BCUA 5FUVA 4Z7OB 2I29A 3C3KA 1TU3A 2VDWA 3DO6A 4Q3LA 4HNQA 5FFMA 2OV3A 2R6HA 4DIFA 4DYDA 1ZX1A 3LXRA 5FNVB 5IASA 1S2LA 1J1IA 3IAM1 3O47A 2NM0A 2IV7A 3QFSA 3QI7A 1E9EA 3H2GA 2XYRA 1SD2A 3G13A 4MW5A 3CB4A 1CYEA 1YQQA 4BFVA 4EHHA 3I34X 1U4SA 4ZYVA 1CY7A 1ULSA 3QUBA 1IOVA 2AFHA 2FW9A 2Q4BA 4PYNA 2R8PA 2V55B 3EUAA 2HWUA 4IEFB 4F3RA 4OFZA 4RHEA 4NBRA 1GNRA 3B85A 1KJ9A 1ZM4A 3PIRA 3THWB 3PVSA 1ZK1A 3PC6A 1CNMA 4KQWA 2Z1NA 5IEBA 4LKOA 3RS7A 5IKMA 1JLLA 2FJ0A 1KZ1A 5CFMA 4DL9A 4CKCB 4B3TB 1RQ7A 4NP6A 1YVPA 6AT1A 1TUBB 1ZKDA 1CERA 3GUHA 1S3SA 2Z43A 1QDUA 3U4QB 3NHJA 3OHMA 4A2PA 5JR3A 4XGNA 3Q0IA 3G2MA 3I0MA 3O8DA 5DULA 3HN2A 3MFQA 3KCNA 4IDDA 2NYUA 4M0CA 3T38A 2H2DA 3FUWA 4HEJA 4Q19A 3EDCA 3UMYA 1RAEA 1U7TA 4NXNB 4BVJA 5HTKA 5ELXA 3MWGA 2VZEA 2W6NA 3L7LA 2D00A 2OCDA 3ADKA 4FU0A 2OLEA 3GFFA 1RM0A 4PLYA 4RSGA 2DRIA 2A3NA 1S2DA 1Y9JA 1NATA 3I9NA 3ZY3A 5FQNA 3PXAA 1QHXA 4JODA 1J07A 1YHZA 2GJKA 1S89A 3WRXA 1S2GA 3SBDA 4IV8A 2EARA 3ZIDA 5LL6P 2QXTA 2J85A 4NYJR 4CKBB 1X80B 2NNWB 3K16A 1R7RA 3EIEA 3DOOA 2B8NA 4YMLA 3DF9A 5CDGA 1E6UA 1UANA 1PUIA 4P3OA 4MUXA 1QYWA 5KWJA 1VGQA 5DYWA 3LDGA 2PDAA 2PEZA 3QK7A 1T5IA 4PAQA 4Y2JA 1VPDA 2OQVA 3VH3A 3VOTA 2WAYA 4MVJH 3U3JA 5EJ2A 1F20A 3FTPA 4WV3A 4QSHA 1CXZA 1SELA 2GXUA 2R1UA 1WNFA 3BMCA 3NYWA 1SEPA 2EZTA 1WZNA 3RIMA 1RPAA 4R8VA 3LIPA 5DBOA 4Z2AA 3SICE 3OFND 4DQDA 3DZDA 3VR2A 2J3HA 1NASA 4DA0A 4DMLA 4FS8A 3T5PA 4ID9A 4ZHSA 1BC5A 2AXNA 1N2ZA 2XEXA 5FNVA 3T7IA 1RWWA 4Z7QB 1QGED 1PYOA 2PMBA 3H5RA 4IX9A 4IV0A 5BR8B 2F67A 5L45A 1MNQA 5DNWA 2IUEA 4JK3A 1Q15A 3CUSA 1Q16A 1YB1A 4MW4A 3WGNA 2LE0A 4LOJA 1A9PA 1E1MA 2G5PA 3AV3A 5I51A 2Q8NA 4P3YA 2AFHB 3KU4A 1NULA 4KK3A 1EFTA 3QELB 5BUSA 3X2EA 3STVA 1ISPA 1Q6ZA 2IZ1A 4F38A 4BQRA 1KRHA 1GUAA 4LNUA 2I1LA 4D9IA 3THWA 4WH0A 1NMEA 3OUZA 3ZHRA 2RGAA 5J63A 3W8NA 4HGOA 4BNYA 4G67A 1MGPA 4D02A 2D7CA 4N12A 4X91A 5AM1A 5HBGA 3RARA 5BYAA 1CLUA 1XQYA 1KOLA 5ALSA 3DE6X 3QTLA 5F1PA 1TL7C 2HT6A 1RWQA 3K2QA 2VRCA 5JATA 4KODA 4UDOA 2J9GA 4PIPA 1BXRA 4C6SA 4QGBA 3K6RA 3G17A 2Q3MA 1X7DA 2Z83A 3DL7A 4MUYA 3ZHBA 4DLNA 3PNMA 2MHCA 2A0XA 3HXOA 4FNMA 1RBQA 1IK6A 1F4PA 4L4ZA 5U4XA 1IULA 1NVVR 4WFKA 3ZE8A 4OB8A 1FPMA 1JBQA 4ZEOA 2RGYA 4IGAA 2XUDA 4J9VA 2IGBA 5CLLA 4YLGA 2PR2A 4AYTA 3PP8A 1E2DA 3HB0A 1EP9A 1E96A 1H2HA 1KK2A 2WMDA 1YVDA 1ZSVA 2ID8A 4P92A 4NNJA 2VH5R 3HJTA 2JGNA 5AKEA 5AOAA 3I12A 2C2MA 1JIKA 3IMCA 4UEWA 4C22A 2UVQA 1RJEA 1T36A 2WA2A 2X2PA 1JR3E 4FJ2A 4TZ6A 3EPLA 1I7NA 1HO3A 3TIXB 4C5BA 4HRXA 2A7XA 2KHZA 3HKBA 4MZXA 2GTIA 3WLQA 2COUA 2EV9A 1L7OA 4ZO9A 3CB2A 3NORA 1GZSA 3NWJA 4YV0A 2Q5QA 1D5CA 5G2OA 4BVBA 3BMCB 1PGPA 4ES6A 3RRXA 1G8KA 3KYDB 3ROEA 3FYHA 1QFXA 4MR9A 5ECDA 3DTVD 5T7BA 3TQOA 4NQRA 1F6WA 2IHUA 3ZQJA 2IOYA 4Q3AA 4QGAA 1YI1A 1IQPA 5CD1A 1T13A 2MU1A 5CDHA 4D9HA 3VR3D 5JS1A 2DUJA 5FBQB 2R8YA 1TAUA 3Q11A 3D1JA 4AKTA 5MGNA 4TSFD 3HEAA 2YJ6A 1RYBA 1ISIA 4HBZA 1O9GA 4P93A 5EWJB 1Y7HA 2JFXA 4LDPA 5TGZA 3FCCA 3C6YA 1M5UA 3SI7A 3JALA 3UICA 4G0OA 1W2WB 2V1XA 1ZHHA 3LG2A 3O9VA 4Y9RA 2H5IA 4JA0A 3DAOA 3G23A 3NGXA 4L27A 4UFOA 5LNK6 1HNZB 2F4VB 1CUVA 2I4OA 1OTXA 2QPTA 5H83A 4JL8A 4LNUB 3T3HA 2FZLA 4LGCA 5DHPA 3QXXA 1OYVA 3CWZA 5LBUA 1PQUA 4DF3A 3PXBA 3PNVA 3CUWA 1V9LA 3DPIA 4AN0A 5AUNB 1IN1A 2YCBA 1MRNA 2F3SA 3CKKA 3H2KA 4MRMA 1UWKA 3KKQA 3TW6A 4JS0A 4TTIA 3F7MA 4YP6A 4L28A 1DQRA 3UAXA 2UZ4A 4B4VA 1UM9B 1A4UA 1DQSA 4UHFA 3QKSB 3L8DA 1QWOA 3I9V6 4GWGA 4YJ3B 1L7BA 3GDOA 4M60A 4B8WA 4HH1A 5A3QA 4J7UA 4Z7JA 4X95A 3ZLVA 1ONBA 4GKAA 2DFKB 3B2EA 3ITEA 3BSFA 5E8RA 3ZW9A 1YZTA 5ICEA 2AEEA 1JFFB 3NBZC 4G0VA 3OEEA 1IQRA 1ZNXA 3UBTA 1Y8RB 1NVDA 1MEJA 1TKBA 3JWHA 5FBVB 1LB1B 1QP8A 3U7RA 3IE2A 4BRUA 3F47A 2X13A 5CXSA 3ORRA 3RNOA 4BASA 4R40A 1JILA 1M1YB 4DM3A 3N8KA 1W85A 2OKCA 4ZOEA 1R88A 1CCWA 1U2TA 2F00A 4XGIA 5GJVC 4R1UA 3CJQA 3GX1A 1YJ8A 3IOYA 4IEEA 4DR6B 2JLRA 2SECE 2P78A 3I4CA 5CFZA 1O7JA 4XWOA 1TJ5A 5DIZA 1LBIA 5E6UB 3KM0A 3HKBB 5K7SA 2F1KA 4Q4LA 2HZBA 3R24A 1IIBA 3D2CA 3M3HA 1YS2X 2PU7A 3NBUA 2AX4A 2Z3WA 4FD3A 3ILYA 2CLIB 3P2YA 3RS8A 2FGJA 2B37A 3EWAA 5KWIA 3L43A 3VTFA 5JCZA 1UOQA 1XDDA 5LA6F 4LBYA 3COPA 4AP6A 3WXBA 3VYSB 1K1EA 5HM6A 5HZKA 4PS1A 1W0KD 2BW0A 4JI2B 3QI2A 1XVVA 2G0NA 2F3TA 3G88A 2P9BA 3HFSA 1E7WA 1P9WA 1FDRA 3PQ5A 1RRPA 5EWJA 3W79A 1KQPA 4O2LA 1J4AA 4YDHB 2O1XA 5A4MS 4HZIA 5AR1A 3A37A 4O25A 4H0FA 4QJ5A 1C7JA 2Y8EA 3ZHUA 4BLSA 2GN1A 1CUGA 3DMFA 3FPCA 3LBIA 2P5YA 5H3CA 1UH5A 2HPVA 4NS4A 1Q0LA 4MV3A 4ALKA 4DUYB 4RF2A 4X6YA 2OAGA 3YASA 4XJXA 4D2IA 4H31A 3ENVA 1A76A 8GPBA 2QE6A 4Z9YA 4C3VA 1MN6A 5CGQB 4S35A 4TQUS 1DDIA 1MJFA 1XTQA 3LP6A 2WVHA 4OREX 1JQBA 5LU8A 3B1YA 4BVEA 2G9QA 3CLVA 4LXQA 4O63O 4CMEC 4E46A 5JXHA 4PC6A 2BP7A 4QUEA 1NL3A 2ES4A 2GO7A 1RD4A 2XLBA 5LN1A 3ZQUA 4E11A 1EFVB 1EGQA 2WFZA 2ZVQX 2O3RA 2ZUWA 3HXKA 4ZU1X 1MDFA 4DUGD 1UL1X 4I2NA 1NDQA 3PQCA 2PZBA 3NM5A 5ENZA 3ST7A 5F2KA 2RE8A 1W93A 2DWCA 4YJ3F 1X74A 5SYMA 1G9XA 1WSWA 1VI6A 3WICA 4MS3B 2QXYA 3QX9A 1M1YA 4NCKA 5CNKA 4CV2A 4RTOA 4RAOA 3TBKA 4M4SA 3PIIA 3IBSA 2IV3A 3E58A 2VYVD 1CJVC 2QIOA 3EXHA 4I55A 4BX3A 1MKYA 3BKWA 1GPNA 3QVUA 3E1KA 1PT8A 2ZI3A 4LQDA 4M1OA 1Q7CA 3WVNA 1T1SA 3ASYA 1GYPA 2OCKA 2JCYA 3DWGA 3QTBA 4HMQA 4TQGA 3GCGA 2RCYA 3OQIA 2HCTA 1U1EA 3NXSA 3Q7SA 4C4YA 4RQTA 3ANTA 3CNNA 1QP7A 2IYAA 4D99A 3CCCA 2ZJ6A 2F17A 1HGXA 1T9KA 2QN6A 4TVSA 1XALA 2FDXA 1OD6A 4OCZA 5AW7A 3HUFA 3OOJA 5KTMA 2BFNA 4GSLA 4I66A 4A8HA 1QAQA 3W2HA 2AUNA 3LPAA 5CNIA 5LZ9A 2Y9PB 5CD9A 4WBNB 2YOHA 2IX9A 1CUSA 3FMPB 5EHQA 5KX5B 3NVAA 3OEHD 3SXUA 1UMDA 2QYTA 4JR2A 2YRXA 3OESA 2H2AA 3ME5A 3QJGA 6ADHA 3PUKA 3QUQA 4B8YA 5HKKA 4WASA 1EFDN 2JIQA 3CW8X 4TROA 1PZGA 3RU3A 1NQVA 2G77B 4FI3C 4P81A 3PTZA 5JBQA 4XM0A 1YIAA 4W5RA 5E9QA 2ATIA 1L4EA 1E2NA 1NTRA 2I8AA 3HLYA 1FF9A 4FDVA 4FDTA 3DBOB 4P3XA 4UVGA 5KBYA 1NW6A 2GLTA 1A7UA 1E59A 1S8NA 2R6ZA 4QRDA 1SZCA 1Z73A 1RM3A 2FEOA 1C2YA 3F9RA 1ZVMA 3OHPA 5EJMA 2O7QA 1EVZA 1ILWA 1PWEA 1SQGA 1HT2E 2XMSA 2GD0A 3BN3A 3CBGA 2D5LA 3TDNA 1MH1A 5SZJA 4WLVA 1NVWQ 4RHCA 1N32B 1RAAA 3MWJA 1HFKA 3EBOA 1QTNA 1T1GA 1Q1AA 4YR9A 3OZEA 4OQMA 1WZ2A 5JSZA 1G7SA 1YDFA 3BICA 3A26A 4P86A 3IBTA 5JC8A 5K0BA 1AQJA 3A7EA 4Q39A 3C1OA 5DCUA 4M1KA 5ALRA 1EFVA 1GVHA 5AHRA 1GZVA 2NAPA 2PKQP 4FFSA 1XKQA 4DRYA 3LAWA 4FFRA 5D3MA 3U3MA 1STOA 4FHGA 1WY5A 1N6KA 5AW8A 4YAEA 3GJ8A 3CZ9A 5ALUA 2W58A 2IPNA 2N75A 1KI6B 3C74A 1R64A 3IHTA 3S5JA 2EW8A 1HNXB 1H8EA 2CEKA 4TM7A 5ALOA 4L8GA 2WF5A 5ARBA 1BXKA 3SFZA 1K3TA 3EXHB 4FZVA 4Q9JA 2CXHA 2XT9A 2C2ZA 3ZWNA 3NHRA 1UC8A 1TM7E 5A05A 4D3SA 3T5AA 2C0CA 4BE4A 1CULC 1MJHA 2OK8A 1LJUA 5C8XA 1ODSA 4V2IA 2D2XA 1XMSA 2PXHA 3G79A 4Y2SA 4PSUA 5IRCD 1MMFB 3GI1A 4KEAA 3RS3A 3B6IA 3IKMB 4L4RA 2HI0A 3WWDA 3RS0A 1D2AA 2J0VA 3KB2A 1TYBE 1UMBB 2F1IA 2LIPA 2NN3C 2VJBA 1B8PA 3L7YA 2HDHA 3KP1A 4CTJA 2HY7A 3EW9A 3ANLA 1JTFA 2HJWA 2X6RA 3HCDA 5HQTA 1R4MB 1WD7A 1XP5A 4INJA 4NFYA 4OM8A 1INLA 4OG2A 2QOEA 2PSJA 2Q5LA 1MABA 1PW7A 3BE5A 3LP5A 2CNWD 4O4HB 4QVGA 3USES 4D4KA 2GVNA 3WQBA 1XTJA 5C46F 1KWKA 3W04A 1JDSA 4XDYA 1WPRA 3M6IA 4WBNA 2R7KA 5G1PA 2CNKA 3IP8A 5IVDA 3WL7A 5KX5A 1KC1A 1F8FA 1ABEA 1SU8A 2CLHB 4Q1AA 2EW2A 1TF5A 3FFAA 1KS2A 4R68A 5E1DA 5AW3A 3MHPA 3CUTA 2P6RA 1AHNA 4ZOLB 1XTVA 3KPUA 4F4IA 2X1LA 1P17A 3I6MA 5BSMA 1MPXA 1J8VA 3RBZA 3WWZA 1BFDA 4PZPA 2Y4OA 2V7GA 4KV7A 5KCZA 4TV8A 1C1XA 3F49S 1L5WA 3DOUA 3NKVA 3UV6A 4C6RA 5JFGA 3K4PA 1QZXA 3CRMA 4R1NA 1SRQA 4R8LA 5CM2Z 3DA8A 2HSJA 2O5CA 2BGKA 3OZGA 4RCVA 1CIJA 1TTHA 2HQSA 3AUTA 3NASA 1CUXA 4B2IA 1SKBA 1XPOA 2G8LA 4LOIA 3AXSA 3O3NB 4P7GA 4MRVA 1NVTA 1IWBB 4HSGA 3MW8A 2R7MA 2V8OA 1NLUA 4NENA 4QEZA 2W71A 1J2RA 4JCOA 1Z33A 5CHEA 1C30B 5IARA 4IM7A 1P75A 2NUTA 2VHQA 1M2EA 1EDBA 4REMA 1UFVA 3PR1A 4HO1X 5DLDA 1FXSA 4BV2A 2QSZA 3IOEA 5IKXA 3A2NA 2RAPA 1XZAA 5F3RA 5AI6A 4US2R 2G36A 3IGFA 5FPKA 3OQJA 3FHCB 1UUFA 4M83A 3WYFA 1PHPA 4C0AC 2C8VA 3A4NA 3IT0A 2NU6B 2Y71A 1FS6A 2CK3D 2Y2UA 4FONA 3PXEA 4R1LA 4S0XA 1EXWA 4DZZA 4QT4A 5EXDA 3W6ZA 4QGHA 2AL7A 4L2IB 2KLBA 1VG1A 4W8GA 1BX1A 3H16A 2PUVA 3I73A 4L9AA 4NZZA 1P1FA 4CR8A 5FI3A 2PUAA 3GRAA 1L4BA 2H9YA 3NIFB 1SXJA 3QMWA 4LVOA 5L7WA 4JI5B 3Q5EA 2ZULA 3WLRA 4BN0A 2LTAA 3U37A 3QSYA 1NF9A 3HN7A 1RAFA 1T5SA 2V6MA 1JJIA 3WIDA 1A2OA 1JDJA 4EHFA 3VR3A 5HX7A 4YV1A 5IJWA 1E9VA 5LYJF 5ANRB 4ZYTA 3GZ4A 3M6LA 1GKKA 4F1KA 2NUPA 2W2NA 3QXSA 2IK8A 4X61A 5CT6A 3NDBB 3IMKA 3P9YA 2BMJA 2D2FA 4B82A 3IVXA 3ZNOA 3IIKA 2Q2NA 2PN1A 1SR8A 5IJXA 4L3VA 4ZWNA 1HDRA 1ZGJA 2C8JA 3FWYA 2NPIA 2GB4A 3GLTA 1JIQA 4WQMA 5BMOA 1NJ2A 2ORVA 5BWMA 3TLYA 2B1JA 1VCHA 1EUCA 2CJWA 4EUEA 1JKFA 1TM4E 3TKAA 2G70A 1IBCA 3IS3A 1C0IA 2GXQA 2BI8A 1NIPA 3TL6A 2AZXA 3HCNA 1A9RA 1EWRA 2P27A 4JQSA 4OQPA 2QUZA 4FGLA 3OLXA 1W4BA 1DJOA 2GEUA 2HO5A 3S68A 1ESEA 1G66A 1V2HE 5IXJA 2XWBF 1HT3A 4XVHA 3KQOA 5I45A 4B1FA 3GFPA 2Y93A 4C2BA 3CY6A 4HUTA 4CE6A 1IIRA 4LKRA 5HF9A 2XLCA 4N0MA 4E6EA 3OM9A 1AT1A 1WX1A 1FQWA 2V7EA 3RYIB 3JQDA 4Q7EA 1OE0A 2G9UA 4DR7B 3AEZA 4BNTA 1XZFA 3B78A 4US1R 3BH7A 1KZ6A 4NK4A 1RRGA 4O8ZA 4O4LB 1VSBA 4INOA 2O7SA 4X93A 2ZPTX 5LLTA 4K6GA 5I7RA 5E3HA 1C30A 1J0AA 2R60A 2FZEA 3MT9A 3BZUA 1PGNA 2ARKA 4ZJZA 2A9RA 4V0KA 1G6KA 3M7IA 4D0NA 2IDZA 1EGVB 1ISRA 4HGZA 3M4ZA 4XE5A 1Z62A 2IEYA 3TAXA 1UC9A 1QVWA 2UKDA 4JXZA 2CLEB 1PNRA 3AUUA 1B1CA 4ZVQA 1SZPA 4NZYA 3AK4A 1YQEA 1M2KA 3NUQA 1H8HA 3MWDB 3CMCO 3K8YA 4PR3A 1PD1A 4NPCA 3GLQA 5JCOC 4TRJA 3WAJA 2R00A 4C6TB 4DIMA 1VXRA 4JITA 3TX6A 1OZ0A 3ZDEA 1CHNA 2BCGY 3SX0A 5BN4A 5DTIA 1W0KA 3W5SA 2A92A 1OH7A 1I1OA 4MVWA 1R9JA 1ZVJA 3EG9A 3LY5A 2DQYA 5T5QA 1ULZA 5TGDA 5J4VA 1B2LA 3B6ZA 4G1FA 3ADOA 4HDAA 3U7QA 1WMSA 2W5UA 3H2BA 1MD9A 1FX0B 3DJYA 8ATCA 5AXAA 3T5BA 1KH2A 4HNRA 3AVQA 1NZFA 5TC4A 1Q1GA 2WJHA 3R7DA 2N42A 1HXHA 1WZUA 1LRLA 5LCXA 1BG6A 1K5PA 4OP2A 5MN4A 4ZYXA 3AIIA 2XNDA 3FR7A 3I64A 3A4LA 3IDOA 3QYPA 4DGSA 4DLSA 5U9CA 1XCBA 4G0ZA 1PUXA 5F1OA 4B6GA 1F2TA 4YP9A 1SVIA 1EX7A 2CB0A 5K3EA 2DQSA 4U2DA 3RJMA 4TRNA 3AC0A 3OQMA 5GJBA 1D4FA 3OURA 3H8SA 2YICA 1YQDA 4KIFA 1JFSA 4JD5A 1DEXA 1E4YA 1ZK2A 3A2KA 5IBCA 4PICA 4QUDA 5LQJA 2IXEA 2Z6QA 4M55A 3I61A 3M6VA 1R9GA 1QZTA 3T1NA 4N0QA 4EYSA 1B23P 2RI0A 3G9QA 3O4VA 2P68A 2X9NA 2ZU6A 3C5CA 5FLYA 5CFOA 4UEQA 1WO8A 3SBXA 2WTMA 1CY2A 5AOVA 4Q3BA 3NH6A 3V97A 1ZD8A 1OAAA 3UT5B 3IXMA 3RDPA 5JTUA 2G4LA 2BFMA 3UF0A 3LFTA 4DA7A 3LPLA 1Y9ZA 3MCWA 4D0GA 5KEIA 4RTKA 2XVZA 3K0EA 2C5AA 5P8WA 2JGRA 2ZQZA 1YR6A 2FZ5A 5CBPA 4ZHQF 1U3WA 1N2CB 1YRQA 4JLKA 3SKVA 3QVJA 4RVGA 2XOKD 1AGXA 2P6MA 3STXA 5JAHA 5LBIA 1V0JA 3ROPA 3AHEA 3ILHA 4ZCPA 2OXTA 3RYHB 3O82A 4ENPA 2UUBB 2ZI7A 1F60A 3UUWA 2QTMA 3G5TA 4DXHA 2PUEA 2MSLA 3ZDXB 4RL4A 4B74A 2GR9A 5J4YA 2BGWA 1IM8A 3UWOA 1OYOA 2IDKA 4S04A 3FPEA 1RQNA 1S4QA 3VJLA 5JQGB 3NKFA 1DCFA 3X1JA 3H04A 2GK4A 2QRZA 2ZJBA 1HEIA 3B7WA 3CH7A 2WYVA 3K9BA 2O0MA 4OB6A 1B7GO 2JLVA 4YUAA 5H70A 2IZ0A 1U0LA 3DW3X 3ZLUA 3SOPA 2QTVB 4OHBA 4CWAA 4CMCA 3PNKA 4EGAA 5EHGA 4M9QA 5DGCA 2VXYA 1HL3A 3BERA 5A02A 2O8DB 4IHAA 4M0EA 2ZIAA 3EFOB 4W4TA 1W5EA 1XVIA 3V4RA 3GN1A 3QNUA 4DN6A 1FCJA 4AZ0A 4OGKA 4MRRA 1NUUA 4L4XA 4BFSA 4DSAA 5CDUA 3CZAA 1E3LA 5K4GA 2ZZNA 2ZTSA 1NMYA 3D3JA 2AJDA 4PYOA 5TMEA 1SN7A 1YFLA 1XZMA 4K9OA 1RPZA 3WFIA 2I78A 4WNYA 4HYQA 2JJ1A 3K8ZA 221PA 1F2TB 4R1OA 2GAFA 3TR6A 4G1VA 1XXLA 4QUKA 3NB0A 1XI2A 1XMVA 4MICA 1E1YA 1S7CA 5JI2E 1GU1A 3IHWA 1SULA 2R47A 1LX7A 2TECE 5H80A 1P7CA 3MTQA 3ACDA 1NLFA 4O4LF 1SVKA 1K08A 2VATA 3HV2A 4J3FA 4PCAA 2ZSBA 3ENQA 3RSLA 4I1OA 3TK1A 3I53A 3W6NA 2Q0XA 1XZJA 5AJVB 1ADBA 3UW3A 4I1VA 2E5LB 3OETA 3WLFA 5CCDA 4WZ6A 1Q20A 4KUEA 5L6LB 5KTPA 5B6PA 3A25A 1PWHA 3Q7EA 5T8KA 1NZJA 3BQ9A 1XNRB 2PD3A 4OIMA 3D2BA 1WXDA 1F9EA 5IDYA 5JYBA 3U62A 3M33A 4LY6A 4ALNA 1EQUA 1V45E 3PHJA 4Y9TA 1YA8A 5FOXA 3SHOA 1VMIA 3ITNA 5IJ9B 5KOHB 1KJWA 1LK0A 4DJAA 3OX4A 2D8AA 4CEIA 4K0RA 4JI4B 1H1LB 4IHJB 1G5QA 2QLTA 3BD8A 3KSRA 1JQDA 4R2IA 3VR4A 2B83A 3PXGA 2C2OA 3RYHA 3N7AA 2VT3A 1IB0A 3OBIA 3G1TA 1IRXA 2NX2A 4TTJA 4JJFA 4Q3CA 2XE6A 2FUEA 2Z08A 5ILQA 3QZUA 4G0YA 3F6BX 1R0KA 1QZUA 1W9MA 3C8MA 3PQEA 4YRQA 3HP1A 5ADVA 2CLFB 2JA2A 4BKPA 1B14A 3O2QB 1KO4A 1BSVA 1YS4A 4Y6GB 1UFQA 1T2CA 2RGGA 3CZ5A 2QI9C 3VMFA 3GFRA 2CVOA 4CUJA 1QYXA 3JSXA 3KJEA 5T4EA 4ZEWA 4U39A 1GAJA 5LB2A 4L16A 4WHMA 2YMQA 1Y1TA 3ZKAA 1KORA 1YR2A 2Z3ZA 2OXRA 4QUJA 1EX9A 4RO0A 1C9JA 1YB6A 1P2TA 1ZCJA 4V24A 4PXYA 5KDLA 3P19A 1CE8B 4KLNA 4EW6A 3LCVB 3HHEA 3TH5A 1E99A 1SHUX 2IQ5A 3HXTA 2GN2A 3EX7C 2JATA 4KSYA 4M9XA 4MS4B 4OMCA 2DH5A 1H2WA 1PS9A 2A4KA 3CEHA 3N58A 4DKXA 5J2TF 1GOTA 5HIKA 4LBWA 4LDJA 1PJ8A 4R6WA 2BEVA 4UBLA 1OMOA 1XELA 2NQ2C 1SU7A 3EDRA 1E3TA 3HBFA 5DHAA 4E14A 3J81k 1WV0A 1OAOC 3KUUA 4G5YA 1VBKA 3WHKA 5DM2A 1N36B 3P9NA 3WYDA 1RIFA 3ESZA 1PG0A 4JLPA 4UOZA 1SUCA 4N6OA 1OB2A 3A9TA 1ZJYA 2ZROA 4GM1A 3C97A 4OYHA 1KC3A 3M6WA 3L93A 1K89A 3DC2A 3JQPA 3F98A 4JI0B 3WYBA 2BHRA 1E5XA 3ZEAA 4GRAA 1R18A 2GKSA 2J30A 2Q3CA 1UBHS 5ALWA 1Z4JA 5BSFA 3JYPA 1V39A 4FEEA 1SHZA 2JIRA 3I52A 1GADO 3TLGB 3BIXA 5FCDA 2QTAA 5I47A 3EYWA 2BDTA 1O1YA 2G06A 4M54A 1Y8QA 1EFKA 3BD6A 1L5ZA 4R2XA 1XBTA 4CEJB 4XQCA 4AZ3A 5JPDA 2QTGA 2VUUA 1EP2B 1W25A 1GU7A 4D1YA 4DNPA 2N9UA 3M6AA 3PQFA 4OHWA 2BKAA 1LWOA 3DFKA 1NLZA 2ADFA 2R8BA 3H99A 3MT8A 4JLNA 3W05A 2VK8A 1SUSA 3RRBA 4BO1A 3FBGA 4REQA 3P9ZA 2EFGA 3I5AA 1U9IA 1ZH2A 1MC8A 4QKQA 5IVPA 1X7HA 1XCPA 2YMLA 2ZT7A 2AOTA 1HFEL 4KFTA 4W9NC 3IT2A 3FWZA 5GZ1A 1KJ8A 3KT3A 5GOTA 2JG3A 1XQ9A 3GK3A 5K3OA 1YI8A 3EH1A 3ECCA 4FKBA 3F71A 3A7DA 3MG9A 2NSYA 4W6QA 4QICA 3C3DA 3ZUGA 5ENDA 3BA1A 3SF0A 2PMDA 7MDHA 3M9LA 4EHJA 5ERYA 3EEOA 2VQDA 1NF2A 3H13A 3RFXA 4UEJA 1NRJB 2DZDA 3C1AA 1JP7A 3JQAD 2JZCA 5B1IA 1C14A 5MFZA 3DVLA 2I7VA 4Z5XA 2QSUA 1UOOA 4FS3A 1IU9A 1Z35A 2C29D 2A0KA 1KOFA 4D81A 4BWFB 1DXOA 2GNPA 3L1IA 5DTRA 5YASA 3ZBPA 1ZN9A 4CZ2A 1V26A 1GPH1 1ZJ6A 4F5WA 3PSAA 4Q7LA 2JD0A 2FX5A 2AI1A 1VLZA 2I1WA 3S7ZA 1LU9A 2PVSA 2JVJA 3CZPA 3HEBA 4OP1A 3MM4A 1E2LA 1K7SN 2V0NA 4PX2A 3RJ9A 1JUDA 3UMVA 3R40A 2CXTA 2PLNA 3V4OA 3AB7A 3EJWA 4GIBA 5BN5A 4JBIA 1GY8A 2C92A 1K4KA 1JLSA 5EIBD 2WUVA 1YRHA 1LDNA 3I45A 1RM4A 3QENA 4BNXA 4HRAA 1BW9A 1I80A 1FDWA 4RA6A 3TW8B 3VZSA 3UFBA 5A6SA 5FOTA 1GZ7A 2W6QA 3QVVA 1DV1A 2FOIA 4PO3X 3RU7A 1ZMXA 3EW7A 2EIXA 5ER9A 4EQZA 2N1BA 3FBWA 1DDGA 3N8DA 3RC8A 1TA4A 1EQ2A 2YJ4A 1TD9A 4MI1A 1EDZA 1R66A 4DQUA 2OCBA 3QA3E 5AICA 1WU8A 2ERCA 4Z8YA 5JRJA 1ODTC 2JA1A 3DGFC 3TVYA 5FUXA 4ZKDA 1L4LA 2VDVE 2VJDA 3JWIA 5CH5A 3KZXA 2NT4A 4WN9B 4KPUA 3THRA 3A1TA 5ILOA 3W5VA 5BXYA 4K03A 1N2OA 3Q3HA 1NXWA 1UKZA 2HA5A 1FTSA 2P9CA 3EGVA 4ETIA 2YYZA 3IP5A 1QGAA 2D1RA 4GR9A 1Z17A 1T8UA 3URKA 2XHZA 5CG1A 1XEFA 3BFVA 3QLTA 1UAAA 1F38A 5F7JA 2I4IA 2E1RA 2CC2A 3JASA 4PZ0A 3SVLA 3PJFA 1ZYUA 3MBOA 1AX9A 2I9PA 1QV6A 4FHFA 2GDZA 3LC2O 3LVFO 4AVYA 8ADHA 3RWMB 2I3ZA 1N4AA 5FPHA 1HL7A 1XEAA 2D1QA 1V4BA 1AGRA 2G82A 2CSUA 2UVPB 3KHKA 2DSTA 1OFGA 4REOA 1J0EA 4WLOA 4CFZA 2YWFA 1GRVA 2HFJA 4TL9A 3MS4A 1XLVA 4M8SA 4MKGA 4E5NA 4H7JA 1BD3A 1HY3A 1KGSA 2YV4A 3EA0A 3RSSA 1TADA 1NMSA 1E8NA 1ZR2A 4OMFG 5CFRA 4MGIR 5BW6B 5CBKA 4IUBS 1VFPA 2ZE6A 2ZK7A 5THXA 4GE0A 4OQXA 2Q8QA 5CYFA 5KNCD 1KEWA 1GR1A 3WKCA 1H1TA 3P2KA 3A06A 4JGGA 3SXJA 3OPNA 2VTBA 5M7EA 1BE6A 1VECA 2N3ZA 4Y30A 3ZBQA 4Z6KA 2EHJA 3PDWA 1ECJA 4JA2A 3SR4A 3MWEB 4DLUA 1WXEA 4LK2A 1NOJA 4CM8B 1FL9A 3AI1A 4HGRA 3AW8A 4ZIRB 4I55F 4QPNA 2Q49A 1I14A 4NJOA 2YDYA 4P7FA 2AFVA 3MMPA 5GOZA 4BBPA 5EFZA 3ONWA 1PE0A 2RGEA 1VRVA 1JHYA 2GESA 3OFNA 4I1UA 2YRWA 3N2KB 1T9ZA 4OL9A 1NJGA 5EUMA 3X1DA 3VR2D 2QTCA 3L7OA 3E35A 1QG0A 5F7OA 1GN8A 2OXCA 3AFMA 3QWIA 4OXQA 3NXKA 4PRKA 4RA6B 3TD6A 1M1ZA 1PJAA 3PFNA 2VA9A 5H0IA 3WZ2A 3QU5A 2CZQA 1ISHA 1KO7A 2P91A 4GX0A 4IF4A 3G5UA 4H7KA 4EHDA 1A9TA 1J2YA 4ZC8A 1JG1A 3M89A 1BCSB 2B69A 4IF6A 2J7KA 3BQMB 1IBKB 2IZ6A 1T5DX 2CLCX 4MJ7A 4W5NA 3PFCA 1DBQA 4ZXFA 3N05A 3O8CA 5AVSA 4M6WA 3L77A 1CJBA 2CFRA 4PC7A 4DLAA 1BEUB 1DTSA 2ZUVA 4KZKA 1NA5A 2CDAA 3KLBA 1W47A 5C1BA 2QLJA 2ZWVA 3EBLA 3LCMA 4KYIB 1FX1A 3AG5A 4ME6A 1TD1A 3HP7A 1Q7BA 1DPFA 2DFLA 1M75A 1CQJB 1SG0A 4E4RA 1SKYE 3RH0A 3WISA 2JFPA 2GOYA 3K0AB 5A3RA 5DI3A 4NARA 1ZFNA 2GPBA 3IYLW 1OWOA 3M2TA 1XAJA 1ZCZA 1WS6A 3PIDA 3DO5A 5TMDA 3R3SA 1WQ3A 2HK8A 3AFGA 2W2OA 5HYVA 1UEIA 2V59A 2WQZA 2BM8A 1ZPDA 3A0UA 2W2TA 3E9MA 1D9XA 4QVKA 4DCVA 2E89A 3HU3A 2HDNB 2WLSA 4AJIA 1D8AA 4F3YA 2PUBA 3FRHA 1UFOA 2HBRA 1SC9A 1XZBA 1S8OA 2YHAA 1H9CA 3F5FA 1T4CA 2FZCA 4XM2A 5D7BA 4J1TC 4DAOA 3CRVA 2BWJA 3WGMA 3AUYA 4HDOB 1Z06A 3NATA 1SCUB 3IO3A 2H51A 3UCFA 5LP6F 4NVRA 2VTBB 1RACA 1ULUA 2OT3B 1R6XA 4S2UA 5CJJA 3JQ7A 3IEVA 1PVOA 1PR4A 1D1TA 1QFYA 3MPUA 3OZCA 4OOEA 1WCWA 4CM8A 3RE1A 5FQOA 2IWRA 4MVJP 3MMSA 1A9SA 1HDIA 4O3FA 1COZA 5K3DA 2J07A 1PL7A 3N2KA 4N5LA 4L85A 2FI1A 2J5QA 5DCLA 2WABA 1RPNA 1EJ6A 1QH0A 4BKRA 3DPUA 1A04A 3M8KA 1KDRA 1L7PA 1LEHA 1ZIPA 3C15C 5GJWC 3AM1A 1KHTA 3KWMA 1LVUA 4G36A 3RBXA 1Q1ZA 2G17A 3GQVA 1GQ2A 1TAHA 1QOZA 1RLMA 1WTAA 2DTDA 2V7BA 4BQQA 4LX0A 1BCSA 3RRJA 1I6KA 3W9BA 1VPLA 5BQFA 3J7AC 1LGYA 1IONA 3JQRA 1L4GA 4AXBA 4MMYB 1EWKA 1BVUA 1JSCA 5MDHA 1W5FA 1W1WA 4NPHA 5I9TA 4EATA 3A11A 2H11A 3RUAA 1KAQA 1B76A 2BFEB 3DH0A 3NRJA 3RVLA 2QIPA 4LHVA 3SSOA 3ZH9B 2WKPA 5A4AA 1C7FA 3ANNA 1C7EA 4K9RA 1ZO8A 1R8SA 2W6CX 4ZGBA 1Z75A 3KUCA 5AOBA 1M8GA 2E7ZA 1UXKA 2G63A 3PEUA 4BEJA 2OGUA 1D0VA 2V9CA 4D8XA 1ESMA 2FEMA 3LLSA 4DJTA 4KFRA 2BONA 3L41A 4CLOB 3KL2A 3THYB 4DMCA 4DR4B 4J1QA 1ADFA 3SQMA 1OKKD 3ROMA 5JAZA 2R97A 4KXUA 2O6LA 2A5FA 5C7OO 1QQTA 1K9VF 2QRVB 2Z2XA 4YRIA 2PD4A 3H1TA 4W7SA 5IN4A 5AK6A 4CTKA 3K7EA 2X2EA 4LXUA 3RIXA 3W4JA 3ZDAA 2H31A 5K03A 1Y4UA 1BS1A 2WTAA 3HKEB 5F98A 4E7OA 2VJAA 1KNQA 2ZB3A 3IOBA 3NHUA 1ZGZA 3FTQA 2IY9A 3P0IA 1ISMA 1QGUA 1NY5A 2GSWA 2LP4Y 4G63A 4L9WA 3TCNA 3WX0A 1KSFX 2DAPA 3W7AA 4ABTA 3R76A 3OT1A 1XMPA 4MGKR 2VPXA 2XDQA 2AJ8A 4RXUA 3N53A 2FW8A 4U02A 3DBIA 3S55A 3NHMA 1P7YA 5LC1A 1KVUA 2PS1A 4HGPA 1I7LA 2BVNA 2EWWA 2YR0A 3NTRA 4JB3A 4LHSA 3I5YA 3HYSA 4ARZA 3K35A 3PWTA 3N0XA 1KZGB 2CXQA 1NDHA 2YHSA 1KEEB 3C6BA 3LLUA 2JCXA 4HUQB 4OAPA 1O94C 3BB3A 1EFPA 4JKOA 2WWXA 1E3SA 2ZJ0A 1MX3A 4LIPD 5AXCA 4W6ZA 2ADMA 1QHSA 1WB9A 2COKA 3I28A 3HO6A 4PFSA 3K1ZA 1OI4A 4YEDA 5HQJA 2RGXA 3VNAA 1E5QA 3U7JA 4ARSA 4DUGA 1JJFA 1Z28A 2XNKA 4MVCA 3JVUA 1KEVA 4L95C 4OVKA 5DU2A 3WO0A 4KHPB 1LTKA 3KKMA 3OM1A 1O77A 5EL0A 4YRFA 2Q1TA 1WHTA 2JVIA 4GUDA 4LQLA 3HVUA 5ITZA 4HVCA 3WB1A 1OT5A 1AN0A 1QF9A 1X38A 2NYAA 4IW3B 3EGXB 2EWVA 1JJBA 1K7XB 1HDXA 1OBVA 3EEQA 3PLRA 1ARZA 4II7A 3QP9A 3RANA 3WLKX 1WUYA 4ZGWA 4NFHA 3Q3EA 3CPSA 4WEQA 2XGSA 3BJRA 4J0EA 1C4XA 2Q6VA 2VHTA 3GAAA 4Q01A 3TOZA 1CJTC 1Q7RA 3SIRA 5EJ6A 1FFXB 1SVUA 1NOIA 1P0CA 5JDCA 3M5PA 1UK9A 2J9RA 5KOJB 3OPYI 3EVCA 3LHFA 3PQ2A 3CLTD 2W6MA 4RS4A 5IUNC 3C70A 3DTYA 3P2IA 1H2BA 4HN9A 1SKMA 4D5GA 1LDMA 1ZH6A 2O2YA 4RZSA 4YJGB 4I4TF 4AJ1A 1QU2A 3LXUX 4RC9A 4XYEA 3KBOA 4HPWA 4F85A 1JKMA 2MSCB 3RAPR 5AVWA 5EXPA 3ML1A 5AJTA 1FRVA 2D59A 2O8NA 5JJLA 5KNCH 1Z2AA 2G08A 4H18A 1YQGA 3DDUA 2QRVA 1SUAA 2VBIA 3JQAA 4PBRA 1U5BA 3HO1A 4BLOA 3SX2A 1C1HA 2XE8A 5LXTA 2XA2A 4JVOA 2CVHA 3OKPA 3QG5A 1A8HA 4RJKA 4FHZA 3DM5A 3CZ4A 3GH3A 1BEZA 3JTMA 1Q3KA 4QSMA 1F0NA 3AEXA 5E7QA 4P4SA 6GPBA 1QGUB 2OVFA 3ENNA 5HMMA 2FE1A 3OT1B 4M98A 1RXUA 1AUQA 3AG6A 4BO7A 4ZOBA 1M6VA 4W99A 4MXDA 4BZWA 3LV8A 1WJGA 3CW9A 4MEJA 1R3DA 1VHWA 1DEOA 4TTTS 1H3EA 1L3BA 4PTZA 1A9ZA 4NLLA 1BCRB 4CIBA 1VOTA 2NU8A 3W4IA 1KY3A 2QSJA 3S1AA 1FB5A 1DAKA 3HZRA 1N5JA 4PYIA 5BT9A 1PR1A 2OKGA 2VEOA 3CF4A 3EZ9A 1JDUA 4HFJA 4KE6A 4KIWA 3ZI7A 3MMZA 2ZYUX 3A1DA 3H1FA 3MIIA 1NONA 4RM2A 5K8IA 1YZVA 3Q9LA 1WY7A 1TPYA 3KLOA 3EHDA 3H4TA 3QOXA 4M1MA 5BY2A 5L7TA 1JFLA 1CJMA 3L6CA 4XPZA 1UXGA 2X7JA 1IN4A 2QQ0A 3LT4A 4P4LA 1RS0A 2PYZA 3AJ8A 4J90A 3K2EA 4PEVA 2OK7A 1YVEI 2LCIA 1H8ED 1LC0A 5GVRA 3GRPA 4G9EA 2J32A 1IFXA 5AHOA 3UJDA 2E9SA 1AO3A 2YJTD 2G6TA 3D8TA 4IYJA