1DG9A

Crystal structure of bovine low molecular weight ptpase complexed with hepes
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
157
structure length
157
Chain Sequence
AEQVTKSVLFVCLGNICRSPIAEAVFRKLVTDQNISDNWVIDSGAVSDWNVGRSPDPRAVSCLRNHGINTAHKARQVTKEDFVTFDYILCMDESNLRDLNRKSNQVKNCRAKIELLGSYDPQKQLIIEDPYYGNDADFETVYQQCVRCCRAFLEKVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TYROSINE PHOSPHATASE
publication title Crystal structure of bovine low molecular weight phosphotyrosyl phosphatase complexed with the transition state analog vanadate.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
total genus 64
structure length 157
sequence length 157
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 1999-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1dg9A00
3O1IC 3A0RB 1QPZA 3TMYA 4TN5A 4EVRA 3DBIA 2FMKA 2FKAA 2L18A 1QP0A 1M2FA 3D02A 3F6PA 4RDCA 5EWLA 4F12A 1SD5A 2XDYA 3CTPA 1NXSA 2JK1A 3NNDA 3MF4A 2WJAA 3ROTA 4WZZA 1ZITA 3H5WA 3LUHA 3OLVA 2V0NA 3LKVA 4UHKA 3HVRA 4OTZA 4CBVA 4F8JA 2PUBA 3HM9A 1YK1A 1A0OA 2AYZA 3JS5A 4MLCA 1M2EA 3KKEA 4TLMB 4Z0NA 1VRVA 4MQEA 2MYUA 4MS1A 4PZ0A 1W9HA 5DTEA 2PUCA 3K4HA 1K68A 3CG0A 3W9SA 2PAFA 3LOPA 1PEAA 3URMA 2FTKE 4RXUA 5TPZD 3GBPA 1ZH2A 1DBPA 5T7BA 4MQFA 1DJMA 2JRLA 2FQXA 5TQ0A 1JX6A 2OENG 4KK4A 3KHTA 4L85A 4F3TA 4KMRA 5KWSA 3KCNA 4H60A 2R47A 5FBHA 1WETA 4YO7A 1R8JA 3OMWA 3SAJA 4O1HA 4IMJB 1SXIA 5CNKA 4DQDA 1XHEA 3O1HB 4G0QA 5HQJA 5HM6A 4JAVC 3H6HA 3CS3A 3TB6A 1BDIA 3RVJA 2ID7A 1AB6A 2ID9A 3BREA 3SM9A 3DLHA 5TQJA 1JBEA 1QQAA 2VK2A 4ML3A 3BRSA 1L5YA 2E4VA 5KQLA 3MM4A 5HKOA 2WB4A 3DZDA 4PE5B 3T38A 2JBAB 3H1FA 4G86A 5KC8A 2A9QA 3GWGA 5TPZA 4MS3B 3LUAA 4S04A 1SXHA 2A9RA 5CNMA 1QQBA 1RNLA 1Z13A 4OBBA 3HV2A 4W5TA 9ABPA 2JVKA 3I09A 5IBQA 2FN8A 3SG0A 1PNRA 2R48A 2RDMA 1FQWA 3S99A 1Z16A 4RU1A 2WJWA 3T95A 4G0YA 5T3YA 4GNRA 5FBKA 2O20A 1JLKA 4MS4B 1Z18A 2QV0A 1ISRA 1Z2EA 4H3KB 3K9CA 4RWEA 1DP4A 2YHAA 3CRNA 2MSKA 2MSLA 3N0XA 4D6XA 2NZUG 5E3JA 4W5OA 4MR9A 4ETMA 1VKRA 1SRRA 1A2OA 2FXIA 3I42A 1GLGA 3BBLA 4JASB 5KC9A 5KI6A 5DGCA 1JDNA 1VPWA 1ZDMA 4Z4CA 4EY3A 2WY2D 2ZWMA 3L49A 4JB0A 4EYKA 1C0EA 2FLKA 1KRXA 4MPTA 3KYJB 1LBIA 1JFVA 1M5TA 1P6UA 2A9OA 2L2QA 4RY0A 4P1ZA 5GOTA 2BGGA 2FVYA 3H1GA 3T6KA 4YLEA 4OLAA 1Z2DA 3N0WA 4IF4A 3IP6A 5IC5A 4Q6WA 3HJFA 1CYEA 4HNQA 2FSPA 4S05A 4F06A 4KK3A 1DCFA 1ABEA 3QK7A 1IIBA 3EQZA 2PUEA 3F7NA 8ABPA 1EWVA 1W25A 3FMVA 4RZSA 3JVIA 4W5RA 4NCBA 1FFSA 3RH0A 4EYQA 3MQ4A 1NXOA 3H5LA 1D4ZA 3ILYA 5TPWA 1D1PA 4MQEB 5HSGA 3JY6A 3LUCA 4MS1B 1JWLA 4MRMB 4EUKA 5EWJA 5KQPA 4PEVA 1ZGGA 3A10A 5CHYA 5C5CA 3QELA 1U04A 4N47A 5C5EA 2WMYA 2FMHA 2FEPA 2NZVG 2J48A 3FGZA 5TQ0B 1MB0A 3UK0A 3G85A 1I3CA 3H5OA 5DKFA 3KLOA 1DZ3A 4NCAA 2R25B 3LKBA 1DCKA 4MR7A 3Q7TA 3FFWA 4RSMA 5JNTA 4KPYA 2F8SA 2IPAB 1J56A 4KZKA 4F11A 1ZAYA 4IILA 3CZCA 3Q41A 3RVPA 4G0MA 2MYPA 3OLYA 4TLLB 3N6VA 4RK4A 3H1EA 4MGEA 3QEMA 5TQ2A 3E3MA 1Z12A 1E6KA 3IDOA 4YGXB 1GUDA 1D1QA 2GKGA 1HEYA 2LUOA 3KJXA 1FSPA 1TJYA 3IP7A 4LRQA 1PUXA 4EVQA 1YMVA 3E61A 3TD9A 2QZJA 4G97A 2A9PA 1S8NA 2Q5CA 1JFTA 4PYRA 1MIHA 4YV7A 3GT7A 3B2NA 3MA0A 3SNKA 1ZN2A 2B1JA 3N53A 4ETIA 1PEYA 1QO0D 4KQ9A 4O1IA 3OO0A 1Z17A 1KRWA 3T8YA 1L5ZA 4EYOA 2IPMA 3N75A 2CHFA 5I4CA 3IP9A 3LUDA 5BRAA 1EFAA 2AYXA 3EQ2A 4RXTA 4MAAA 4N03A 1GUBA 4NICA 5JNUA 2QW1A 2E4XA 2PUDA 2M98A 6ABPA 3HS3A 2FQWA 5JS2A 2JCGA 2FW0A 3GA5A 3KS9A 2PUGA 2LIVA 1Z26A 4D6YA 4KREA 4MR9B 2IYNA 2X7XA 4G0ZA 3CZ5A 4RS3A 4RY9A 1RZRD 3RVKA 3RVNA 3L6UA 2PE5A 2PJUA 2QU7A 2MYTA 2QVGA 3QLUC 4N0QA 4WWHA 5IUNC 1Z25A 1KMIY 1QO0A 3LUJA 3NHMA 4W5QA 2PL1A 5CNIA 4RK0A 1DC8A 1URPA 3QLTA 4JP1A 2R4QA 3IPAA 4E7PA 4FE7A 3H6GA 1E6MA 1QKKA 3N0RA 1YTUA 1LBHA 4GPAA 1D2AA 4FE4A 1QP7A 1ZVVA 4MR8A 2OQRA 3VNBA 5JNRA 1OXKB 1EWKA 1KGSA 4RV5A 1YMUA 3D8UA 3NNNA 1YK0A 5FWYA 1FFGA 4LDAA 5TPWB 3OMXA 3CG4A 3CKMA 3LFTA 3O74A 5EWJB 3NBMA 2NT3A 3RQIA 2E4UA 3HXMA 2FLWA 1ISSA 3QELB 1VLZA 2PMCA 3C6QA 2VYCA 3MYYA 1USGA 1QMPA 2F8TA 3OO1A 3KYIB 1DCMA 3BRQA 1DBQA 1JHZA 2FMIA 3CHYA 1LJLA 2GWRA 3GV0A 2DRIA 4MR7B 4XFKA 4Z9BA 1ZHHA 1JYFA 3CLKA 1D5WA 5EWLB 2CWDA 4LE0A 1U2QA 2N9UA 3QEMB 4XAQA 1DG9A 2IPNA 4NQRA 5JNVA 4Z4FA 1JF8A 5BR1A 1NY5A 1ZY2A 4NV3A 2P4UA 3N8IA 5TE9A 4L4UA 1NXTA 4IMIB 4MS3A 4YCSA 7ABPA 2IOYA 4LX8A 4G0XA 2QXYA 5ABPA 3Q9SA 2GX6A 4RKQA 1NTRA 5IEJA 3TO5A 5JNSA 1B00A 5D2CA 1EWTA 1PNTA 4LZLA 4O5AA 1NXPA 2IPLA 5F64A 4MQFB 2E4YA 2QR3A 4KV7A 1T34A 1M5UA 1PHRA 2H3HA 3KTOA 3A0UA 3O1JC 1H9CA 2H0AA 1UDRA 2PKXA 4XARA 4ZJPA 2PUAA 3RVQA 1U8TA 5FWXA 3DLBA 2JB9A 5JNWA 5KQGA 3SY8A 2FEKA 1TM2A 2HJ9A 1K66A 2B4AA 4QPJC 3F73A 2L19A 3JTEA 2FMFA 1QNLA 4KQCA 4ZMRA 4H3HB 5ED4A 3C97A 1DRKA 1ZH4A 3UUGA 5IEBA 4XLTA 1P6QA 4WT7A 5IUKC 4RK5A 5IX8A 1YS7A 4QYWA 3NHZA 1BAPA 2QVCA 3KG2A 5DLEA 3KLNA 3OM1A 2FQYA 3I45A 3CU5A 4RY8A 1CEYA 3I5AA 2HQBA 4HNSA 1NXWA 4M88A 3OQNA 4W5NA 5PNTA 1QP4A 3JVDA 3R0JA 4KNYA 1NXVA 3A3KA 3LUFA 1DC7A 1C4WA 4Z4EA 5JS1A 1JL3A 3O75A 4MYRA 1F4VA 4N0PA 3H5VA 3JPYA 4YR7A 4MR8B 3OQMA 1AB5A 2RJOA 2HPHA 3G1WA 4RK7A 4HNRA 2GBPA 4JB2A 1BA2A 2P9HA 4PICA 1FFWA 5FWYB 4IGAA 1NXXA 1P8AA 1ZESA 2ZAYA 4IRXA 4XASA 3LMKA 4MRMA 1E2BA 4WUTA 1P2FA 4N41A 3RVSA 1JDPA 3QLUA 5EWMA 4Z99A 2PL9A 3C3KA 1NATA 1YS6A 2WWVD 3DGFC 3OQOA 4Z9AA 2MYNA 2E4WA 3C3WA 1RPJA 2I6FA 1RXIA 4KRFA 4RK1A 4Q6BA 3QLVA 1F51E 3LTEA 3MMNA 4YWHA 5B3JA 2NUBA 3FFXA 3OLXA 2L17A 4YRZA 2JVIA 2VUIB 3JPWA 3M9WA 4TMYA 1JFSA 4XXHA 4ZMSA 3EULA 5IULC 2IDMA 3QLVC 2HSGA 2LBPA 4Z4GA 1TMYA 3GBVA 5B3JC 1U2PA 4WXEA 2LPMA 1CHNA 6CHYA 4G0PA 3H75A 2LP4Y 3O2QB 3QX9A 1APBA 2NT4A 2TMYA 1JYEA 2FN9A 4YS6A 2MSWA 2E4ZA 3Q15C 3HZHA 4P98A 4EVSA 3TX6A 2RGYA 2JVJA 1RZRA 4RKRA 5BRJA 1JH9A 3F6CA 3HUTA 3C3MA 3GYBA 3GL9A 3HK2A 4G0OA 3IP5A 3CNBA 2PLNA 5GQSA 1YIOA 3UKJA 3HDVA 1LJUA 4JOQA 4WXMA 2GI4A 5BQ3A 1GCGA 3O2JA 1YVUA 3M6MD 1DBWA 4RK6A 1EHCA 4B09A 3EDCA 5FWXB 4OLBA 5CNJA 4YP9A 1SXGA 3EGCA 5DCLA 3RVOA 4LE1A 3DGEC 3ILHA 3LUKA 3RVLA 3LUGA 3RVMA 3OLZA 4ETNA 1E6LA 1ZGZA 2KYRA 3IPCA 5IUJC 1MAVA 5TQ2B 2YHBA 3Q7RA 1XHFA 4D74A 4MLDA 1ABFA 3O2SB 3P9YA 3Q7SA 3QX8A 3SQNA 3MIZA 4N76A 2JBAA 1TLFA 2M1ZA 1EAYA 1TVMA 2RJNA 3O21A 4HYEA 1USKA 3HDGA 4OG2A 2QSJA 1XWWA 3ROFA 3CFYA 5KQMA 4EYGA 3HEBA 2CHEA 3EAFA 3M9XA 3HO1A 1BDHA 2HQRA 1A04A 1GCAA 2FEWB 3GRCA 4QICA 3HCWA 4FB4A 3BILA 1LK0A 1MVOA 3HSYA 3EJWA 4LE2A 4DADA 4KFCA 3OLWA 4KVFA 1BVHA 3H5TA 4ZPJA 1OXBB 4MS4A 1BDJA 4E7OA 2PUFA 1DRJA 1RXEA 1USIA 2IKSA 3EODA 4ZYLA 3VNAA 4Z4HA 4RXMA 3KSMA 3FDFA 3NNSA 4LDZA 3H5IA 2CD7A 4Y9TA 5EWMB 4DN6A 4QYMA 1U0SY 3OM0A 2VUHB 3QEKA 3FFTA 4UHJA 3RVRA 3HUUA 4Q7EA 4EGSA 1Z15A 4JA2A 2WRZA 1Y1LA 2W42A 2HQOA 1MB3A 4Z4IA 4OATA
chains in the Genus database with same CATH superfamily
4KKVA 4Y2SA 3I9LA 4LYYA 1GCUA 3W5CA 1XNGA 2FMKA 2P69A 2XNJA 4HUJA 4IQ8A 4PBTA 5G02A 4CIWA 3I1IA 4WRRA 5JCOC 5JQWA 2R3SA 4PCLA 5CD1A 3AEZA 4XCVA 2WW8A 4AUEA 2G04A 2XDYA 4U7HA 5K6AC 4XGKA 3TTSA 2QDKA 3ENZA 4HEA6 1LZKA 2I7DA 3OLVA 3SU8A 1E5XA 2A84A 4DV2B 3VPSA 1DKRA 1MJHA 1U3DA 4QO7A 4YONB 3W8NA 3MJSA 3HM9A 2MR6A 4QASA 2UZIR 3IRUA 4H7KA 2PQ0A 5L7YA 1ZOPA 3FPCA 2R4UA 3SIXA 2X5XA 4G1CA 1GZDA 2HK9A 4PGGA 3SJBA 2YV4A 3ICQB 4DMLA 3DDSA 4D9EA 3QVVA 2FTKE 4OJKA 4R3WA 4RIIA 1ZL2A 3QV1A 3GBPA 3D4NA 1T91A 721PA 4BEJA 2CGEA 5IMSA 2QF7A 3FFAA 4FGWA 4UM9D 4XQ0A 4IKPA 3DDWA 3EVTA 3QKUA 5FBHA 1ECGA 3SAJA 1F6DA 1YI1A 1WPGA 1FB5A 4J43A 4DVJA 4G0QA 2C7BA 2AOUA 2BGTA 2NO0A 2RHMA 4KG7A 1E3LA 1Q1AA 4OLHA 4QYXA 1RRCA 3C6MA 2H8KA 4GLLA 4UZFA 1D2HA 3FSJX 2F7SA 4OM8A 4X1IB 5DRYA 5GP1A 5HYVA 3X3HA 3MBIA 4CR6A 2Y1FA 1Y82A 3OC6A 4TMWA 4BLVA 2JHGA 3W5SA 1KVRA 3C85A 4IJ5A 5KIAA 2PGNA 3D8RA 2DKFA 2C4TA 4PAOA 2JH9A 1PZNA 1JHQA 1GTVA 1TW2A 3R5KA 4AQDA 1JIQA 2QRUA 4A2PA 2V3VA 1Y5RA 2V58A 3BWCA 2GNOA 2ZDGA 2A5LA 2J5XA 1T8WA 4YCAA 1EK2A 3CTMA 1ARZA 1UJBA 3KQPA 3G5LA 4BOYA 3HCBA 4XVQA 2PGOA 3EMKA 2ZRQA 1AA9A 1VKNA 1I4OA 4AX8A 1HNNA 2BI8A 1J22A 1FQWA 4HB4A 2AZMA 5HUJA 1M1YA 3A1VA 2DZDA 3IMEA 1IUKA 4J7AA 1GZUA 2JDID 2BGRA 4ABYA 2ERCA 4D9FA 3PT9A 5DHPA 1FW6A 4BFUA 3CUVA 2QZPA 3FRHA 2BI7A 4MLZA 2XRYA 3OJLA 3FA2A 2QQGA 2ZI3A 3N8DA 5EPOA 3R6TA 4LWPA 4ZZ1A 3ONEA 3WK4A 1KFCB 3LDGA 4GQIA 4F3KA 1EFUA 2VAPA 3VR5A 1KEEB 3PS9A 1UJ4A 4C06A 3I05A 2GEUA 3ANLA 5EJ4A 4IIBA 3R77A 5FWNA 1CULC 1SRRA 3N7TA 5ARDA 2P8JA 2XUKA 4JP5A 3O5AA 1O6CA 2HHLA 3WLQA 4GR9A 4AXBA 4YCLA 3DTVA 1GRQA 4O4HB 3DE0X 5A9SA 4YUVA 3F8TA 1JN0A 2CK3A 4Z0HO 2IH5A 1JZSA 1KS2A 4MKXA 2D8AA 2FV8A 5L53A 1FFXA 3IIIA 1DXQA 2IEYA 5IT0A 4DA4A 4P1ZA 5E4JA 1ULZA 2OP1A 3ADBA 2AMLA 2G8LA 3U7QB 4G81A 4Y2QA 2QGFA 2FGJA 3JQ9C 1GL6A 4AJNA 1IG3A 3DUWA 1SVIA 4W8GA 5AUQA 2J0VA 1DARA 1F0YA 3RH0A 4N0MA 4HAYA 1R0KA 3VPXA 3Q11A 4B3MB 3N8HA 4WXHA 5LMNB 4MS1B 1V1JA 2X2OA 3LUCA 1B41A 4EGQA 3Q4GA 4ON9A 3HNPA 1XL0A 1TK2A 2XUQA 4C9BA 2O57A 2ZQ5A 3QLEA 1Y1QA 4BBAA 4YAOA 3BTSA 1V16B 2CEAA 1PTKA 4DJEC 3UPDA 4OHUA 3VR4A 2BKLA 2X7JA 3R76A 1IUOA 1KMHA 2H2FA 3TZKA 4Y2UA 3WIOA 1PD1A 3QPUA 3Q40A 4LY0A 4OH7A 1N5OX 4NDZA 1OPRA 5D6OA 3T41A 2V8BA 4ZI7F 4Q1BA 1EUDA 4RMJA 1G3RA 5CXQA 4JJAA 2AN5A 2ZYHA 3V1NA 4CGZA 2WP8J 3DFFA 4KZKA 3G2KA 4WBXC 2DOKA 5K3EA 1GL7A 2GDJA 3PWSA 4YP1A 3OZEA 2Q2WA 4PLTA 3GUUA 4YO8A 3V9PA 4EITA 1O96A 5TV2A 3NTXA 3HG7A 4MVJA 2HUPA 3K73O 4P7KA 5ECWA 1GTRA 3O2NA 2OPHA 3GLGE 1QUFA 2A1TS 5I9LA 1PTJA 4POAA 4MXDA 4ZC8A 4ZT5A 1DKOA 3DMRA 3AKDA 4R2JA 2E5WA 4G97A 1DADA 1H3FA 1XMPA 2Q5CA 1KMMA 1NUTA 1J2YA 4FYVA 3Q7IA 1IVNA 1JSRA 2QGZA 1ZA2A 2DCUA 2JGMA 4M1QA 2OO5C 4ARVA 4CMIA 4X62B 1SB9A 2K6GA 4H59A 1FOEB 1G5FA 2F1JA 3CRMA 5TDHA 2Q6LA 5HKKA 1JP7A 3OO0A 4Z5XA 3G17A 5J1SB 1L7XA 3KBOA 1FFHA 1C2TA 2ZBRA 3MJEA 4B75A 1XG5A 2GZAA 3GW8A 3ZWKA 3E3AA 3GLVA 1WHTB 3RKRA 4P38A 2OFWA 5DM1A 3SOPA 2QLJA 4A8JB 1X80B 1PJTA 4N03A 2E49A 4EEXA 1JA0A 3EF3A 3FPGA 2CLKB 3AHIA 2NU9B 3RFTA 2Z6QA 1R64A 4LKRA 4BXOA 2Q5EA 3GARA 3C5WP 5ES4B 2FQWA 1EB9A 3AM5A 3FBTA 2DLDA 3LECA 4NVRA 3ZZNA 3HZOA 4ER3A 1ACMA 2VJPA 3KYCA 4L5YA 5AK4A 3TRDA 4IXMA 2COEA 2I3DA 4RS3A 3RAJA 1K27A 4YQYA 3RROA 1QWSA 1JFFB 1BX0A 4FNAA 3HM2A 1PG2A 5HK9A 1BOOA 3AUXA 3D64A 3ESQA 3HJTA 5E6RB 5LP6A 4BNJA 4CL3A 3UQZA 1UPTA 3UGJA 3JVVA 2OBLA 4QDUA 3S2SA 4NZYA 3KUUA 3A26A 5TRTA 4OJQA 4FFMA 4NE2A 5BMVA 2GNPA 1NQOA 5BV2P 4RK0A 5TLSA 4GQBA 5CFLA 4XUEA 3S5JA 5DBIA 3FPHA 3H6GA 1B6TA 2VDPB 2YWHA 4MCJA 5K3DA 4TLAA 3I01A 3L7JA 1QP7A 3F3MA 4JR2A 3FZGA 3RC2A 3UENA 2AFVA 3JV7A 5E38A 3D2CA 3LQQA 2GETA 3W79A 5CFQA 3R7AA 4EPYA 5LMZA 1VCOA 4DQKA 4YMUA 1ODCA 1CJMA 4B76A 1ZU4A 3KOYA 2QRVA 3D54D 1C7FA 5JTUA 2ZYIA 4GBGA 5BV8A 2Y92A 4ZCLA 3EIWA 4PX3A 2C2KA 3FOBA 4BJ5A 3EEYA 4N5LA 4R8VA 2C84A 4WLFA 2AEEA 1PL7A 3A9WA 1NGSA 5AI8A 4MYSA 5DIZA 4XFJA 1B23P 3DS8A 5KYYB 5HZKA 1JEJA 3C24A 1QHSA 4R8KA 2VPQA 2H1RA 4ZEMA 1NQTA 1X15A 3DVAB 3IGFA 3IIEA 4JJ8A 1Y80A 5IARA 3I3SR 3L8CA 3P0EA 4RMGA 4TL8A 4YJ2B 3TOZA 3VJLA 3BE4A 5C1DA 3M4YA 4U9UA 2ZRKA 3FTQA 3JQPA 4DBLE 2AF3C 5K3OA 3PVZA 1EDZA 2BKEA 4MV0A 2YJ3A 4F3YA 3DR5A 2Y9PB 1IN5A 3RI3A 1Y5MA 3A4VA 4GGOA 2Q1YA 1OC4A 5TX7A 4E2FA 2GTIA 3L79A 4HO1X 1CY6A 4Z7OB 1WP4A 2WWYA 2WF7A 4WECA 2QD4A 2FU5C 2IOYA 4YIKA 1KFKB 5K45A 4CEJB 1MENA 4M0FA 3C7KA 2V59A 4A92A 3FTFA 1MQ8B 5ABPA 1CZUA 3C5HA 3CH5A 2QY6A 2YZ7A 3ELBA 1GZHB 3QXXA 4FDMA 3RNLA 5IEJA 2XV1A 1ML3A 1QS0A 3L0ZA 3PWTA 1RYEA 2QMOA 3NBFA 5E2IA 4B4OA 3HNRA 4BWYA 3MUNA 3QMWA 1O3YA 2E4YA 3ETJA 4JB8A 4JLSA 2VFAA 4B6GA 1GAQA 5DLPA 2H0AA 2QN3A 3EGDB 2VATA 4XARA 4EY4A 1XRQA 1PKXA 1IMJA 1CC1S 1G59A 1WMFA 2FX3A 4JA0A 1V3VA 1Z7YA 4XOUA 4BQQA 2G1UA 2NZJA 1EGVB 2HMUA 4LRSB 1Z0AA 3MERA 5IJ9B 1EVLA 1UXIA 3LPMA 1X7GA 1E4EB 2J3HA 3UUGA 4BLPA 1SBZA 1XZLA 1X7DA 3V1MA 4E51A 4GH5A 1BJTA 2JEYA 4EUFA 4URVR 3LZ6A 1TVKB 3DTNA 1YACA 4ZZ2A 4RY2A 2VRCA 4O4JF 3T9FA 5CB4A 2ZRCA 3ESDA 1J99A 2X2EA 4NU6A 1BU8A 4YJ3A 3ITEA 2NYAA 4NR0A 5DLEA 4BUZA 3DQZA 4F9GA 5K3BA 4OCZA 3D3NA 3RT7A 1B73A 1N5LA 1QIFA 3ZIUA 2IEGA 4M88A 3T1QA 4JR0A 2BL4A 5BW5A 4HLCA 3WYGA 1Z63A 3VC3A 1BCRB 1DI0A 2I80A 3N05A 3PUKA 3R0JA 4IDCA 3WHKA 5KOJB 4UTNA 3SS9X 1FZQA 4UM9B 1QIMA 4DDUA 2ZPTX 2J3EA 1J00A 2FW9A 3RHZA 3A1EA 1BG6A 1RWWA 3ZJ5A 2Y67A 2ZJ3A 5EEGA 2ZIXB 4Q7QA 1XMIA 4HNRA 4FCCA 1L5FA 3NTUA 3VR1A 3ZE9A 3TAHA 2ZUBA 4CI9A 4DDHA 2IHBA 4OSEA 3LRTA 1E2BA 2GM9A 4BO2A 2VOEA 4EJ0A 2EKQA 5JHHB 4FM9A 3QLUA 4D9KA 4JCOA 2H2GA 3O03A 8GPBA 2MTBA 4LFBB 4FX2A 4AQ7A 1U7WA 2X5OA 1BYIA 10MHA 4IEEA 1NFRA 2I6FA 2OHFA 3BGDA 2HZBA 3CLRD 3E35A 5LXTF 3UATA 4B40A 2QG4A 3MTBA 4LJYA 1AXGA 1P1CA 4Q47A 4X1YA 4DCPA 2Y6VA 2P4HX 2RARA 1RKQA 4TMYA 5EJ9A 3TYXA 3QPWA 5IC6A 2A35A 3EHEA 3L4KA 4CMBA 3GVXA 2GEVA 1DC5A 1QDUA 1WMBA 3K5IA 4LJ9A 1U0EA 2R7AA 1TMYA 1Z6YA 3BFKA 3LYAA 4X9XA 1S9HA 1AA6A 1J4AA 3N2ZB 1PU2A 2Z3VA 1YJQA 2PFGA 3U56A 3O2QB 5A06A 4RVDA 2H92A 4IX1A 1A8QA 5D3ZA 2ST1A 4FFRA 3S70A 3S44A 2GVZC 2Q6OA 3HXLA 1RYHA 3L0DA 5CEJA 1RRMA 1NF2A 2EFCB 2FN9A 2VDVE 3MWDB 3QF7A 2WPNA 3EWAA 3UK6A 2CE7A 4HD8A 5A0FA 3RTCA 4C4ZA 2XMGA 2QVYX 4EYSA 4WCFA 3EEBA 1VBNA 3GJXC 5BN4A 2OBYA 2MMCA 5L51A 3LBAA 1FRQA 1ZL0A 4QG3A 3CXRA 3DYIA 4K5QA 4UEOA 3AVUA 1Y1PA 2ZR7A 3SJCA 4BS9A 4LQDA 4Y2XA 2M6LA 3KWLA 4F46A 4B0PA 2H07A 3SR3A 1RI4A 3DOHA 4QPPA 4YACA 3TBHA 4QGAA 4IDAA 4RSHA 3KZKA 3KTDA 4BXOB 4OHXA 2UXBB 1T5TA 3WGUA 4GP7A 3PFWO 5AW0A 3G8DA 1JQAA 2RHBA 4FPXA 1K6MA 2G9ZA 2HXYA 4Q00A 2ATCA 3EZXA 5J4HA 1J9ZA 3U4QB 3D8HA 3LUKA 5LL6P 3F3YA 3GT3A 2XKAA 3AKZA 5FQOA 3CF4A 2ZU6A 3WC4A 5J2UA 2O2HA 4AO6A 4BAUA 2W71A 1XVIA 2XE8A 3ASVA 5CIQA 3TZCA 1QZTA 3FI9A 4OUKX 1Z4NA 4NBVA 3MWJA 4GPIB 5I7HA 4RTPA 5KOIA 3U0VA 5LZ2A 1YRHA 2CFRA 2M1ZA 3ED5A 3ER8A 1ZI6A 4PLFA 5MN4A 4CV0A 1U3FA 4LYGA 4C4YA 4F38A 4WOPA 3OECA 4IAOA 2NGRA 4O4IA 2KSQA 2ZKLA 3HCDA 4RIGA 5HS4A 1A5AB 1RM4A 4BVJA 5L40A 5ENZA 4E12A 1YJBA 1KY3A 5DSTA 1AQUA 2CHEA 4PPGA 5LYYA 4RF4A 2ZQYA 1KO4A 3CX4A 2ZRAA 3R7LA 1RSZA 4KXLA 4URFA 1DDOA 1GNLA 1ZS9A 2HJSA 2Z2KA 3Q6MA 3HSYA 5ALMA 5F21A 2Q0HA 3W3AA 4DUGA 3OLWA 3PICA 3NBXX 4QHYA 2PUFA 4YT8A 4M38A 1QYWA 4DLAA 3QBJA 3REGA 1O8CA 1QFMA 1P0PA 3JQAD 3KHKA 3MCWA 4HUQB 4IR7A 4OOFA 2GK6A 4LYJA 4PPYA 1IYZA 4IYJA 5T57A 4X1OA 4Q9IA 1NKVA 3RC1A 5EKXA 4LDZA 1NN1A 2OYSA 3H5IA 4RYDA 4AP5A 2YHIB 2XYVA 4RGVA 3I37X 3SMQA 1ZG3A 3JALA 4ALIA 3QEKA 1ZX1A 4LUCA 4MW1A 5CLQA 2P4SA 1DTEA 2EYUA 4UHJA 5AXBA 5JCOA 3VU9A 2BZ0A 4LBVA 4EGSA 2I66A 5K6AA 2AN1A 2C7RA 1A4XA 2PZJA 4P83A 3U6KA 3FYHA 1JEQB 1G3UA 1SKQA 2PG3A 2V6BA 2HA7A 4KOAA 1QGAA 3TMYA 2WT9A 5FADA 4PPNA 2L18A 4I6JA 4DLYA 1UH5A 2WAOA 4OX9Y 2VRWA 3KRTA 1AGYA 2CVPA 4LTMA 5AMXA 5JMPA 3W06A 2AVNA 3NNDA 4FUQA 1JQJC 1FXSA 1IY0A 4BO8A 2PANA 3K30A 3K09C 5K5EA 1TC2A 4P7BA 4Y6PA 4OHZA 4MVJI 1FW8A 2V0NA 4TWRA 3QKWA 2OCIA 3HVRA 3BZBA 1JDBC 2PUBA 2C9MA 3LVQE 1JKJA 4DA7A 2HFJA 1EIWA 3ZE0B 5A4IS 4WUVA 1BQEA 1P9WA 1NBMA 2ZUVA 3LIIA 3BHNA 1W9HA 3ADPA 1T6YA 2HK6A 3DBVO 4ND5A 4AS2A 5M04A 1SQFA 1PJ4A 4NDNE 1J2RA 1N25A 4GX0A 4O1MA 3ZXXA 1EE1A 5KWVA 2G3YA 4TKUA 1RZUA 1LPBB 1RBZA 2NACA 1NJ5A 2WWRA 4XLLA 1UMDA 1YFZA 4G9GA 1RQRA 4UUBA 5D5QA 5ALVA 4PSVA 5IKEA 1E1RD 1JX6A 4AD8A 3NRJA 1HMYA 2XT9A 3LUBA 1SKYB 4CQMA 1PT8A 2R87A 2EP8A 4NC9A 1GNRA 3UOAB 2R65A 3ZWMA 3OQBA 4DQDA 1NNSA 1AGPA 3KLBA 3R6GA 3O1HB 4AAYA 1IQPA 4ZC1A 4UQLA 1S01A 4EGCB 3ZV5A 3D0QA 1AKRA 5COBA 3G2JA 3BREA 1CRPA 2Z9BA 4NK4A 3HN7A 1M73E 1QH8A 2CDNA 4ML3A 3KQYA 4M9RA 3VHXA 2HWWA 4LISA 3AIIA 3WGMA 3ZW9A 3ISVA 4FVTA 3UK1A 4U5XA 4ZT7A 3N2YA 4O25A 4WL0A 5DNYB 1UZUA 5G0VA 3UOWA 4EPRA 5C81A 2ONZA 3IUMA 4B34A 3V4VB 1PV1A 1M2KA 4Q5IA 1MABA 4HGYA 5C1IA 1YUBA 4BGEA 3CB2A 3SC6A 3BB4A 3IQIX 4UHEA 4CQNA 4KE6A 3COJA 1DOHA 1EFTA 1SUWA 1U5CA 2PMKA 3KP1A 2POCA 2IH2A 1SOAA 1KI4A 2FPMA 2I65A 1I4WA 2D1TA 1HLFA 4L1KA 4Q82A 5MDHA 3KT3A 4LFAB 2H31A 2P2YA 2YYAA 4C7VA 2C4UA 3ZZMA 3KXDA 3ZQ6A 5INTA 1T1EA 1VL8A 1W8DA 2D62A 4MS4B 2DB3A 2Y1GA 4LXHA 2HPZA 3WRVA 4B73A 3TQTA 5IDWA 1JHMA 4BMVA 4BCCA 2F8LA 4KNYA 1Z88A 2MSKA 1Q0SA 3X2SA 4X3OA 2XWSA 4M37A 3LP6A 5CEEA 5K0ZA 1LLDA 2BFEA 1GKKA 1OLXA 3CUYA 4Z9FA 3AI1A 4BO7A 1CZOA 4BVAA 4C43A 4EY8A 5ICCA 4KR7A 5MHTA 1V1MB 4BQOA 1MW8X 4OL0A 3B1XA 3HYSA 1XDSA 1V35A 3L6OO 3RIYA 2PSDA 2X86A 5KTRA 3CJTA 3OX4A 3RC3A 1P1BA 1YI0A 1XLVA 1QHHB 2II6A 3O8RA 4PLZA 2YV2A 2PO7A 4BECA 4DAOA 3GOHA 8AT1A 1K8QA 1BW9A 3A11A 1N0VC 4HJXA 4RH3A 4N18A 1P0MA 1WZIA 2GAOA 3QP9A 1ODFA 2IHVA 4AB1A 1YHYA 2JKZA 1EA5A 5FL3A 3K7EA 1YZQA 2PIAA 4NIMA 3BXGA 4G36A 3EA0A 5JVDA 1OLUA 4JV5B 3HA2A 4FN5A 5D7BA 2UXCB 4G07A 2Z9DA 3VZQA 1GFWA 4QGSA 5C8YB 1MRSA 3TVYA 3OPMA 2H29A 1JVSA 4FOSA 5CDSA 3A3PA 4MWOA 3MQ4A 3GJYA 3ZVLA 3BORA 3PQ6A 3AF5A 1ZYUA 1YS9A 1O5OA 3GHYA 1JR3A 1CUIA 1PT5A 4IHAA 5EAIA 5HSGA 1JEYA 4X7MA 3DZJA 1CWUA 1LUAA 3UAWA 4FIZA 2XLCA 3OWOA 4OXRA 1OB2A 1N77A 2WJYA 1GFSA 5KJ1A 1LDEA 4KTTE 2BJVA 3WK5A 5CHYA 1SO8A 1SVWA 2BDTA 2QTCA 2ZIFA 1SGWA 2JGLA 2Q3HA 2ZBDA 4TSRA 4I4TB 4EW1A 3DQQA 1QCCA 2IGBA 4IIUA 3M6LA 2ACWA 1E3TA 4W6ZA 2NW6A 5KVSA 3VV3A 5DZSA 2IDZA 4IXDA 1LBSA 2HNKA 3A05A 5P21A 1L4EA 4UMFA 2A14A 2WOJA 3DEJA 3LPCA 1XJCA 5H9VA 2G08A 2EDAA 2RHGB 2X0RA 1QLJA 2ZSBA 3T1OA 4CUKA 3L8DA 3FYUA 2WAAA 3A6FA 4IILA 1QFSA 5A4FS 1AKQA 2FGKA 1DHTA 5C31A 1NV8A 2I76A 1MHPA 2W2NA 1TM4E 1KAOA 4HFMA 5JSZB 2YYZA 4BDTA 1CKEA 2X6QA 3OF5A 3OIWA 1LH0A 3K8OE 4MVJH 5IWAB 3KB2A 3VSCA 2OO5A 3SC2A 2CLDX 1HOTA 1ZNXA 4MA4A 1BO6A 3PJDA 4LRQA 2ACEA 5ENDA 4E13A 1XTBA 3E61A 1YHNA 4R0VA 2A9PA 4XQ9A 5F4ZA 2LW7A 3AHCA 2B21A 3PEVA 3PFIA 3TFQA 1M0TA 3UH1A 2WU8A 4YV7A 4RV9A 5D3QA 4Y9RA 1MKYA 2DWUA 4TV8B 3ABQB 3DQPA 1SC6A 1MPTA 3I4CA 3RV4A 4AMYA 2I78A 2A1UA 1N32B 1PG5A 4TRJA 1V37A 4LJRA 1TXGA 1RJ9B 1U4SA 2W6JD 1LWNA 3AIMA 3DT8A 4PAMA 1LWOA 1N7IA 2DR0A 5GIOE 1NTOA 3HCRA 4CM5A 2V6IA 2GLXA 4MWGA 1UF9A 3A3OA 4RCVA 3TG2A 1XLUA 4OQDA 4PHHA 1UAAA 2IYTA 3HS3A 5DX1A 3KEOA 2DBVO 1QU2A 4EJ2A 3SLRA 1NFFA 3B5IA 1GQOA 4I9FA 3ONDA 5ITZA 1RU3A 2YJZA 3E53A 3MSCA 3PRJA 4A1FA 4WK0B 3BDVA 4JC0A 3RVNA 1ND6A 1MX5A 2C77A 1PWEA 5KHAA 1MTOA 3KFLA 3L7IA 4C01A 1VDMA 4Q9LA 4YRMA 4GI7A 1VCHA 4LX0A 3BXEA 4KO4S 3FTDA 3V8BA 1B6GA 1XQYA 3LUJA 4H7PA 5BNFA 4AW9A 3HY6A 1YS2X 5CYGA 2OG2A 3KZCA 1WIWA 1SK8A 2ZRHA 3L4SO 3PNOA 1NQ5A 4LSZA 2XAAA 5TVGA 1Z6ZA 3DV9A 4G85A 4PYJA 5KDDA 4GPAA 2XA2A 3NWOA 5BRNA 4EFLA 2UU9B 2WIJA 1C4XA 4MR8A 1AURA 4FYHA 1KZ7B 3IERA 2VHJA 1Q12A 2OHJA 4KXNA 3RBXA 1DSSG 4OXNA 2GPTA 4O2LA 2V0GA 1BXRA 1NXQA 3OWHA 4OLAA 3VJRA 2EP5A 2G17A 1L5KA 2ZETA 1N2ZA 3THRA 3W5DA 2XCIA 4XWOA 1CEXA 5K0JA 3HKBB 1EESA 2OXRA 1S3SA 4UU8A 3NO4A 2J09A 1P2BA 2NLOA 2PZ8A 3QE2A 4HWRA 4O2AB 3OPYA 5AKIA 2XBLA 2ZB4A 1XQ9A 5LQMA 5JWHA 5BNIA 2R8RA 4N82A 3USES 1C7JA 2ZIZA 3N6RA 5HILA 1IPFA 3R3JA 1IN1A 2F1RA 3PR3A 3GLFA 2P1ZA 1KP2A 2GJ4A 4I3HA 2FN3A 2IX9A 5C8DA 1E2IA 1A4RA 2C94A 4GKVA 4JIGA 3C8DA 3OEEA 2GZRA 1TEXA 3MTIA 2AG6A 4H9GA 3OD1A 4I1RA 4HQ6A 4FOOA 4EKDA 2AE1A 4TL9A 2ZATA 3GP3A 1FSGA 1RPNA 3N74A 3C3AA 4UFNA 1KDRA 3UXHA 4CM4B 4F3CA 4N5NA 4F6LA 4GMHA 1E9FA 3PGJA 4II3A 5AW4A 5CYPA 3KXIA 3MWEA 4MUYA 1CK4A 4NNPA 4S35A 1KSHA 4E21A 5FNVF 3WK6A 4H6PA 4PZLA 3D4LA 4NYIQ 3N2KA 2ZUWA 3E05A 4L5CA 2OBNA 4K9OA 3I1JA 3JQAB 4B6OA 3JWPA 2QM8A 3INNA 5M34A 1GO2A 1TUBA 2DTEA 4BATA 3UM9A 1MEOA 4JVOA 1ULHA 4ZQBA 2OV6A 4CODB 2EJCA 4B71A 3DR3A 5AI0A 2G88A 3AEQB 2BGLA 2VJCA 1U0TA 2FOIA 1BMQA 3SSMA 5IABA 5JNSA 5D2CA 1IJFA 2IKQA 5DX8A 1QMGA 1DO2A 2F3PA 1H2ZA 5JD4A 1R9JA 1R0LA 3KTOA 1TM7E 2IYLD 4FE3A 2A30A 4FW9A 1JSCA 3VYUB 4CG2A 2WQ7A 1O95C 1TYBE 4JS0A 3K92A 1KORA 1T0BA 2QUHA 4WFQA 4DY6A 5K2MA 3PPWA 3QVKA 4NH4A 4DSUA 4LKOA 5B1YA 1GTG1 1K66A 4AWXA 4OHYA 2X6RA 1USUA 2X3FA 1YJCA 2IPOA 4ZMRA 5ED4A 4QXRA 3TLMA 2DEUA 5LB4A 3NV7A 3SXUA 1CFJA 4IUCS 4ROTA 5EE5B 1F5SA 3T1HB 3K4PA 3KAPA 4C4SA 3HN2A 4Q9DA 3CLUC 4UVGA 1JU9A 1Z4OA 2WNSA 3P19A 5EG5A 2RGDA 3WGZA 5B55A 1DB3A 1KF0A 3EDMA 1Y6FA 1QR6A 4OUDA 1N4DA 2VRBA 3RUDA 2HA0A 2GH1A 2IU0A 3DAYA 1NXWA 1EUCB 4Z3DA 3U4CA 2PEYA 1JA1A 2OGZA 3I5UA 3MB8A 2NSHA 3JWHA 2FFHA 5K0SA 3NGMA 4PG8A 1NI3A 2IYXA 3F46A 3PI6A 4Q24A 5JYBA 4UNSA 2JIQA 3I8XA 1HKUA 2X0JA 1X86B 3MD9A 1OIWA 2VZEA 1VPDA 4WY2A 1HG1A 2RJOA 2HRBA 3GZNB 2HPHA 3RRZA 1S2OA 2XCRB 3IDFA 4KN5A 1NVEA 3B7PA 4HQKA 1MO2A 2VDJA 3QKRA 4EENA 1V8FA 4IRXA 2BAGA 1MIOA 4REQA 5A6SA 1P8JA 1P4GA 1KTIA 1C2YA 3PNMA 3FWKA 1V6SA 3DC2A 3RFCA 3QJ5A 3H9EO 3GJTA 2C2GA 5JZVA 3BQ9A 3C3KA 2I4NA 3QFSA 3SYNA 3HWRA 4NK5A 5FNZA 1A50B 1EK0A 2CFIA 2ILTA 5JI2E 3NVKI 1U5BA 5KNBA 1QG2A 3AC0A 1L6IA 1VE9A 1L8LA 3IUYA 4XSGA 3T5DA 3EMDA 1TTPB 1II8A 1CP3A 1CY0A 1F60A 4A2QA 1ZEJA 2BR3A 3C1TA 4FSXA 3EC7A 4OIFA 5HJ2A 2XDQB 4N6GA 1SRQA 1Q0ZA 4U7PB 5C7IO 2JRCA 3DPIA 1HDEA 3E23A 4RDXA 4PFQA 5K51A 3RYFB 2P5SA 3S55A 4IIXA 1RWPA 2FW1A 3EUWA 3QLVC 4Y2RA 5HGJA 4ZRDA 2JJMA 1WCWA 3EXIA 3IB3A 1U2PA 4W6QA 5DMHA 2N75A 4D5GA 3PWZA 3GLIB 1I7LA 3VC2A 4OKSA 3QZUA 3M49A 4LXGA 5FOXA 4MLPA 1J24A 3A70A 1RWXA 1GSAA 3QHAA 1ZOLA 4ZJZA 2AFHA 1K06A 1RWMA 1CUJA 3K8ZA 2J31A 4NJOA 5B1IA 2CFSA 1B42A 2C58A 3HCEA 3HBAA 4YRIA 5D87A 1GA6A 3KEGA 3IAFA 1ID8A 3QE0A 1WEHA 4DILA 4NLLA 3F6CA 5IFLA 3L8MA 1R4AA 2OQIA 5BWLA 3HK2A 4L8YA 1GZ4A 4GU5A 3D0OA 2E5FA 2BHTA 4UD6A 3C4VA 4CUZA 4BQFA 3HB9A 3K1TA 16PKA 2ZAOA 2ZR0A 4XE5A 1H3EA 1EHCA 2G9UA 2GK4A 1QGED 3VDXA 1E79A 3CSDA 4BLQA 3I5MA 5BP7A 2DU8A 4BNVA 2FWBA 2H0QA 2HO4A 4OBWA 1KY5A 3PYXA 5E9AA 1K2VN 7MHTA 4KGDA 2EF0A 2V7WA 1EK5A 1M6HA 1KGDA 1O87A 3PC2A 4MO2A 1E6LA 1JUDA 2N1BA 3IPCA 5TMBA 5IM4A 2UUCB 1MAVA 4BZXA 4CXMA 4HPWA 4QQ8A 1VECA 4KDCA 4OHVA 3EQ8A 2FFQA 4ZQEA 3FY4A 2OAP1 2SKDA 3O2SB 3R3SA 3FYSA 1JEOA 2WSIA 5KMGB 1JH9A 1LTQA 3HYNA 3HLTA 1E4VA 2O7RA 5L4LA 1UK8A 1MG0A 1HTWA 4CHTA 2O2IA 3HUFA 3QKSB 5EVCA 2WAXA 1VBKA 5KS2A 1OFHA 4EYGA 2XJ9A 5IAKA 2O05A 1V2HE 2HCRA 2BFDA 3DZIA 3LJKA 5JI3E 2FCAA 3G5TA 3A6EA 1D0VA 3P71T 3R9IA 1G0OA 1L5VA 5EJAA 2JLWA 1DIHA 1RC1A 1TJPB 3EDYA 4LE2A 3PGMA 4LI3X 4W7SA 5J4LA 2EFHB 2QTVB 3FPAA 4KVFA 2MR5A 1FX0A 2QQ5A 3A36A 1IH8A 3GQBB 3W3AH 5EKTA 3B6ZA 2ERXA 5CT6A 3GLKA 3VR3A 2H59A 3IUSA 1RXEA 4NG5A 2BFCB 1QFZA 3YASA 4M8LA 1YRQA 4DLPA 3I6MA 3EC2A 3CKLA 3PFCA 4JR1A 4KBFA 4KH0A 4CWAA 1Z37A 3X44A 5LDDC 3KSMA 1YWGO 3NFYA 2GARA 1ZONA 2Q62A 2AZDA 1MTZA 2XQGA 2YMMA 4AZSA 1AS2A 1XK7A 2VT6A 2NVOA 2SCUA 3AUKA 4ONEA 3WDLA 4LSMA 3FFTA 3KYDB 4ARCA 4PQRA 2XZDA 1ORRA 2EV9A 3TK1A 5B4TA 2DPLA 4NZNA 1PDWA 3SFZA 1M7GA 3QXGA 4MW2A 5F73A 3K09A 4P8RA 5FPTA 5CFPA 4CTJA 1Y9DA 4YRCA 1DLIA 4O2BB 2BEVB 5E4TA 3UGTA 4BVFA 4BNHA 4KRYA 3G0GA 3DW1X 4TTIA 1Z33A 1SELA 2HJGA 4F12A 4J8PA 3WO0A 2PU5A 2W00A 1KHHA 5BV1A 1ZMBA 4BJ1A 1IEVA 5EIFA 2PKCA 3ROTA 4H7IA 4RD1A 3H5WA 4RHUA 1D04A 1GUYA 2ZJ1A 3KZ1E 1QIEA 4RMIA 5A71A 1XTTA 4EFKA 1ATIA 1ONNA 1YK1A 3H1PA 4HLQB 4L4ZA 1Q6YA 3KQSA 4LXYA 3TQQA 3INRA 1JFSA 3PRYA 4G8BA 1CT9A 3M6UA 4N7RA 4TLMB 3ODGA 4BO3A 3O4GA 2RK4A 4KPGA 3CG0A 1GRNA 3BIXA 5KCMA 2ZB2A 3W9SA 5KNCA 1N9KA 2BTQA 2JCSA 4HDSA 5JAHA 4CW7A 2ZRMA 1KJNA 3IAHA 5LN1A 4ALLA 1E9RA 2FSHA 3T12A 1RRKA 1DBPA 1YNOA 1M8JA 5K03A 1Q1BA 1NOKA 1JIJA 2OV2A 2ALJA 2GBGA 3GJSA 1CLEA 4KK4A 1AK1A 1FXWF 1BIFA 4X7RA 1XN4A 1KU0A 1KSFX 1EM8A 5FPYA 3E1GA 1MH1A 2H2AA 1WETA 1TAGA 2HLPA 2W2VA 4CRWB 4DTIA 5J58A 2Z1MA 4WOBA 5EZYA 4M1MA 5KX5F 1MR3F 2V97A 2VLIA 3NKVA 4H35A 5FULA 3LFHA 3COZA 1Q14A 1QOQB 3I4LA 1D2GA 3WAKA 3T52A 4Y98A 3NORA 1QQAA 5BYJA 4MVWA 2GD6A 2I2BA 4MUEA 1BEUB 2XNHA 4B82A 5EIBD 3LSTA 4UD2A 4XCXA 4I66A 2XUPA 3K31A 2IOHA 3DDCA 5CFRA 1QLWA 3LGSA 4LNHA 3L4EA 5LJIA 1A95A 4R1MA 3DLTA 4JP3A 1SXHA 5EJFA 2O54A 1MFZA 1H6AA 2DP4E 3FRJA 1KEZA 3BK1A 1UANA 3N8GA 4I2VA 2Q0SA 4L72A 1LNZA 4PX9A 2ZJ0A 4RM3A 1F3OA 4LYFA 1SHTX 1W73A 2JVKA 3AVQA 4PGHA 3T9CA 4B6SA 3WY9A 1T4CA 1HT3A 2ZI5A 3JD4A 1G8PA 3A4IA 4MUKA 5KVQA 3DWIA 2D3WA 2D1YA 4CQJA 2PT6A 1ULBA 1SXQA 3GRAA 4CI0B 3TJRA 1Z4IA 4GS5A 5AKEA 2NP7A 1OZ0A 3ZE2B 1M9NA 1PAUA 4K9QA 1OASA 2B5OA 2ZTLA 1U1GA 5LPNA 1JXAA 4P3YA 4X8OA 3LKZA 3SX4A 3N86A 3PWKA 3OWXA 1S89A 1I13A 3T5PA 3PUVA 2AIRA 4D6XA 3ODPA 1YJAA 1E9SA 1IWBB 1L5GB 4A8JC 2RKWA 4GGMX 3SHVA 1D2MA 4Z54A 1OYVA 3E9QA 5DSXA 1TADA 3BBLA 4IKOA 4U3JB 3H19A 2ZYTX 3DOCA 3GFFA 1OQAA 2P3LA 3IBGA 4KMMA 2Q3MA 4DIOA 4DNOA 4FU0A 4Z4CA 4YXFA 2WSSD 4JGGA 3G9QA 4PG7A 1EPUA 1KAEA 1I0LA 1W85A 5IP5A 5SV2A 2J4FA 6NULA 3THYB 3PYLA 1RIFA 4B85A 5JH7F 1E98A 2V5VA 5KTYA 4C6TA 2C1EA 3GGPA 5JSHA 5ALUA 2ZYUX 4IJ6A 1NW4A 4HWGA 2IZOA 1UDXA 4FYIA 2RH5A 4WX2B 1N2IA 2XYRA 3GEEA 3HB5X 4Q6WA 5DBEX 3BX1A 4HNQA 5CVVA 4EHFA 4I8XA 2OKCA 3WRXA 2C61A 4M89A 2FPGA 3CZMA 3N5CA 1WW2A 1AN0A 4MCHA 4BMOB 4RTLA 1PT9A 4ASUD 4W5RA 5HFNA 4WV3A 1E9VA 4LOHA 2CB9A 1E2LA 4XX0B 2PGXA 5IT9A 1NXOA 5J2TB 3U3JA 2BMJA 5EP2A 1UINA 3C3CA 2C97A 3JY6A 5LXTA 1SUBA 5H7XA 5CRIA 3E2MA 2A3RA 2ZDHA 4HDNB 3PU6A 1AS0A 1XAJA 4BDSA 2J3JA 3S8MA 4ZTUB 4B7XA 2UUOA 2DCMA 3V7YA 4KMSA 4JLKA 4QFMA 3ROKA 3AP2A 4ND8A 2AXEA 4WOJA 4YY3B 2XVMA 1K63A 1MOQA 2QQEA 2XNCA 4R81A 1GG5A 5G4KB 3SXUB 3WMFA 4BFSA 5BPHA 2QYTA 5LC1A 2AMFA 2J0QA 4HDMA 1QGOA 4FGSA 1AKVA 2DJ5A 4BNUA 4UQOA 1GGEA 2CVQA 1SN7A 5K3CA 2V3CC 3QY0A 2ZE7A 2D0DA 4Z2YA 3VZBA 1Q57A 3Q41A 3TM4A 3MQFA 5KU1A 3UF0A 5THXA 4BKQA 4F4IA 2WJHA 4EDHA 1A9XB 1KVSA 1QG0A 3FWPA 3M6FA 2Y1LA 1YKFA 1Z12A 1JIVA 2NVUA 3CLSC 3OBIA 3OEWA 1SBHA 2QRLA 1EVIA 3RNOA 4E5YA 3BBPA 1EUZA 4WD3A 2OZLB 3GFSA 5JDCC 3RHSA 3Q1KA 5JC8A 3NHWA 4BP3A 1K3FA 3MTAA 4QUAA 2D54A 2G7ZA 2Q1XA 3L1IA 5IK2D 5EA2A 2OGUA 2BH2A 1WABA 2PT9A 3F7MA 2PMEA 5EFZA 4IDEA 3GT7A 4K8OA 5DTIA 2C8VA 3REOA 3IULA 4WBNF 4O1IA 4ZI7B 1L1QA 3UVEA 4XD7A 3T8YA 1QV6A 3LDFA 1WO8A 1SZDA 1QIJA 3CSUA 1KOLA 4QDXA 3RQSA 1LFDB 4PNHA 3ZTWA 1Y8QB 4TT3A 1P62B 1Y4AE 2PXXA 2W2KA 1U8UA 2WMDA 3C1UA 3ZDZB 1DAFA 1PWYE 2J0UB 2JFVA 3AI7A 3DOIA 3LS2A 5HTOA 3EZ2A 1GUBA 3ABSB 4E5KA 4DV3B 1T2DA 2B37A 3MJTA 2BDEA 4EW6A 1YQGA 3ZV3A 1RHJA 4IXNA 2OSVA 3FRIA 2PLAA 1PDVA 4INZA 3SSOA 3FPKA 3FXAA 3KVVA 2IC5A 4NG4A 4UM7A 3ZPXA 5KYUB 2BWJA 3OZCA 1QQ7A 2IS4A 3VR6H 1BVYF 3HY3A 2I6QA 4UHBA 4DV0B 3JYQA 4ZVNA 3NGXA 4CTOA 2HRQA 4IYRA 3DBLB 5KWEA 4U00A 1W46A 3A1TA 1Z0UA 4QOFA 1J21A 2OHGA 1X19A 4N0QA 3VVBA 5K0BA 1Z25A 4HGQA 4MVJP 4ZAGA 2FK7A 1VBMA 3DE2X 1AQNA 3M5WA 2CJYA 3KKLA 4EO9A 3BA1A 2Q6VA 4PHTA 3BCSA 5FHQA 1X7WA 4CKZA 5ALKA 3IPAA 4NF2A 2I2DA 1CUBA 4QARA 1TU3A 2DBZA 3WWCA 1N5JA 3MFQA 5I5GA 2H5LA 5EJEA 1LV7A 2QORA 4MPPA 4GBED 5EIHA 2BGUA 3H3JA 3MT9A 3PL1A 5T41A 3AL3A 3IB6A 5AW6A 1HDXA 1L5LA 4I99A 1W35A 4YP5A 1AKNA 2RH9B 2QTFA 4LBZA 5TMPA 4I1SA 4H4EA 5DV9A 2Q8PA 1LS1A 1XP5A 4QXMA 3NVDA 1XROA 1DJNA 2QZSA 5JASA 3OTHA 1U5AA 5TY0A 2F4NA 1Z06A 2B7LA 4DR1B 4DARA 1E8NA 1IOVA 1VLZA 2PMCA 1UZLA 3LCRA 4FZRA 5CB4F 4BV3A 2HJWA 2J07A 3C3YA 5DXJA 4OAOA 3W05A 1GL3A 2XDWA 4F04A 3CPHA 1ECBA 3F7TA 2HYIC 2AX4A 2PWZA 2JFOA 3A6LA 3FR8A 3NM4A 2O2DA 2H9YA 4UZEA 1OKKA 1J9GA 3FNBA 3UUEA 3RU2A 3SFVA 1Y9EA 1UPUA 2C92A 4XB6B 4NPCA 2CHGA 3P9ZA 4FLFA 3W4KA 1FMLA 1N0WA 3KWJA 2OXCA 2V9ZA 1FS4A 3WB9A 4EQ6A 5DMXA 1ZGBA 2EU8A 2VKTA 3I6ZA 1I1OA 3G2IA 3PGVA 4GWKA 4NZZA 3UFXA 1KZGB 3V3KA 4PVDA 2UV8A 3L6EA 2J6IA 2PV7A 1AF7A 2PSEA 3SR0A 4BX3A 2BFNA 2VT2A 2XHZA 3TZEA 5HUQA 2GM3A 4ETWA 3WKAA 1Y0BA 3WJ7A 2PGAA 2AKAB 2Y27A 3LQKA 3TSOA 3P5SA 4KFRA 5KYXB 1A2BA 3I64A 1UT8A 3WO1A 4D7AA 5KZMB 3Q9SA 4RKQA 4L9RA 2POQX 1O95A 1TT7A 3EEIA 2IYRA 1G1MA 2SBTA 2WVHA 3ANYB 4HWSA 4LZLA 4D8TA 1JQEA 1L8AA 2HADA 2HN9A 3TQSA 4QT4A 5F64A 2AQHA 2IV3A 4CKCB 2H11A 1QVZA 1RE0A 4K9RA 4QLBA 3A6GA 4WI1A 1ZD4A 4KJZA 3DWFA 4DIEA 3WGIA 2PUAA 3F9RA 4IS3A 5DTRA 1HKHA 3T5CA 2Z6AA 5IVDA 2BKVA 3IVAA 4B35A 1KJ9A 3ANXA 2C2OA 1QIKA 2IA5A 4L0CA 5ALYA 3S4YA 1J1ZA 4ZTZB 3LQYA 5CA0B 1UFOA 1TTTA 2HCTA 4RTOA 3ZI0A 2W2PA 3FVVA 4GEGA 4CMEC 3WXBA 2ZBGA 3MT0A 2YW2A 2O0MA 4YRLA 4DQUA 3Q12A 1T2EA 5B2ZA 3QXCA 2FW6A 2VAVA 4JQCA 4P7GA 1N8KA 6YASA 1FJHA 2FQYA 3LWNA 3R7DA 1W8IA 1R6BX 3OOSA 4JVNA 3CQ9A 4OLJA 5F7XA 3FB1A 1CQIA 4A8PA 3E7XA 5DP1A 4RZQA 5IPFA 3K5HA 2GN2A 2WMNB 3AWIA 1S1MA 3C87A 4Y9UA 3TX2A 3H0CA 2NVBA 2QBYB 3B9QA 4G6ZA 4K88A 5LZ7A 3QVTA 4DAEA 1UC5B 1KVUA 2IYYA 1A8PA 3SZGA 3C6XA 2Z09A 4Q3KA 2HCBA 1KYQA 1NBAA 4IVPA 1F4VA 4KUHA 4LDJA 4ALNA 3TLKA 4G0UA 3UT5A 1EXNA 3DO8A 3MAAC 2Q07A 1TTHA 3V8NA 2AE2A 2QUBA 1XD2A 1VGRA 1J97A 2JIMA 1H1LB 1VIAA 3AUTA 2A5DA 3T7CA 4YMVA 4XASA 4O4JB 1K4KA 1R0ZA 4V0RA 1JAYA 3Q6IA 1VFNA 3RVSA 3LCJA 1JDPA 1M0WA 1M8PA 3GGDA 1VJTA 2AK3A 3WWOA 2JLVA 3NFRA 4HDRA 4HGPA 1DFHA 4ICIA 2OOKA 4Z9AA 2R6CA 4CM8A 4EI8A 4JJEA 2X0EA 5E3IA 3T3HA 1EFVA 1H0RA 4CTMA 4KRFA 4NOJA 3QLVA 1E3WB 5KNBH 2YFYA 3DM9B 3PDIB 3ZNQA 2OQVA 2VTBA 2XX3A 3EDQA 4XWTA 4YPOA 4QOGA 3ETDA 1KI6B 3MCVA 3TW0A 2GM4A 3B51X 3BIOA 1F2VA 1Z6QA 4LN1A 4J3NA 2QPLA 1HYQA 2WBLC 3MGGA 2OXIA 2JAQA 3WI7A 5I4KA 2C7PA 4LVUA 4B3XA 5LD2B 2OTCA 4K87A 3WLFA 5E6UB 2R751 1YE3A 2LP4Y 2G76A 2VEDA 4KGVA 1UKAA 1XRJA 1CY8A 1L5QA 3KL2A 4QLAA 2FCRA 1Z8HA 4AULA 4QVIA 4O59O 4ZV4A 3VZCA 1T9DA 1COWA 1YZKA 2Z3WA 4OYLA 1K98A 1Q5PA 1Y6GA 3L8FA 4GL2A 4FYXA 3OY7A 2H4HA 2DTXA 1U31A 3CO5A 3C3MA 2JNWA 1MW9X 3V5NA 1JMVA 3NTOA 2AYYA 3HDQA 2VSQA 2HR1A 1CNMA 4L8GA 1JZQA 4PZZA 4DJJA 5FI1B 5AW1A 1KEUA 2B7CA 2A5YB 2CFTA 2JFXA 4BFWA 4R7ZA 1BE6A 4RENA 4D9JA 3VNUA 3IOMA 2XHEA 4G1VA 5FWXB 2H52A 2WTXA 5F2EA 1P9OA 2H17A 2RKOA 1VIMA 5M3BA 2IEDA 2NNWB 2B4KA 1H4VB 2Y68A 1SUAA 3KB8A 1MF7A 3FIUA 2XUFA 4UUMA 4X1IA 4DEVA 3Q87B 5JAIA 2HLDA 2V7QA 3O7MA 3PZRA 4HH3C 4OQPA 2OE2A 5K1ZA 1JHDA 4E31A 4AZTA 4E11A 1YC2A 4KQJA 2WFLB 3TCXB 1VC2A 1NR7A 3B89A 4QYIA 1DKUA 4EKYA 1IM8A 3AEKB 1TLFA 2RJNA 3NTVA 3HL0A 3NWJA 2I0FA 5JRJA 4IIDA 2HH9A 4K2AA 4DM4A 3ZVRA 1OJLA 1V4NA 3HE3A 2AMVA 1WQ3A 3IE2A 4KAAA 4BHTA 2QHXA 1C9DB 2QNIA 5CX4A 5JXIA 1FP4B 4X93A 3GRRA 1BEEA 2PGJA 2CMKA 4UDYX 4HS9A 3X1XA 2FSVC 3OE1A 2AFIB 2HU8A 1C41A 2DPMA 4ZU3A 3SFTA 3HGMA 2C7OA 3U3ZA 1ODKA 2WZCA 4YH1A 3V6MA 1SBQA 3I9OA 1BVHA 1JR6A 1NSYA 3TNFA 1WR8A 1OXBB 1V3UA 3C39A 1WOMA 1JLMA 4LJ8A 4AM8A 3SBOA 3CZQA 3I9KA 3OKPA 2CSUA 5JMWA 4JI1B 3KB6A 2ZBEA 1NUHA 2D2XA 2DUNA 2QD5A 1R5BA 4MVJM 1AMUA 3NPMA 4YAGA 1Z62A 1KO8A 5JS8A 4JJZA 4G5RA 4IEFB 4Y1EA 3H9BA 4HADA 1ZNQO 4LMAA 4OMCA 3LOUA 2C96A 3HUUA 2ZIVB 3MWKA 1HF3A 4MGYR 1E3MA 5HIMA 1BWRA 3IAUA 2W42A 3JQCA 1BS9A 3EMBA 4OATA 4Z4IA 3U7HB 3SQXA 4G5HA 1CRLA 3A7DA 2BH9A 3E15A 1NF8A 5EWLA 1CDOA 3Q6NA 3U7QA 5G4LA 3AZPA 1XSEA 3CTPA 1NY6A 1NXSA 2CXNA 1J6UA 2E82A 5ALGA 1OIVA 2WJAA 5ETJA 1Y1KE 1WAMA 2VBCA 5IBPA 3W2TA 1V9SA 1XV5A 2WVGA 1VOTA 1C4OA 1IQ0A 4ZO7A 3RSQA 1DRUA 3VSBA 4EFNA 4F8JA 5IF3A 1ETUA 4HPJB 5JU6A 2C82A 4LWZA 2JCYA 4B45A 2LCFA 4RULA 4KYVA 3L8HA 4LBWA 4OBEA 1HE3A 3ACDA 3LP8A 2O3QA 2XTZA 3E70C 3QSYA 4MS1A 2PUCA 1MU0A 1QDLB 1ETHA 5EEHA 2V7PA 3UHFA 1NNLA 4M9XA 1KAHA 4BKRA 3HB0A 3TZHA 1PEAA 5TPZD 4RXUA 1KMQA 2N46A 5KNCH 2D74A 1V16A 1QH1B 1L4GA 1PUIA 3GA0A 3EGEA 4QYSA 3WYAA 4BNTA 3IBTA 3IV9A 4JI4B 3EZYA 3E3OA 2GHIA 4LGCA 5BPFA 2EX4A 4TS9A 1NQUA 4MGZR 3VPGA 3P2YA 4WKGA 5DXFA 1U0BB 2YY5A 1UM9A 3FDXA 1VHJA 2HTEA 4X6UA 3EQ6A 4JAVC 3KJFA 3EC1A 3MMSA 4FKMA 2JJ2D 4GPBA 4AP6A 1FFAA 3I9MA 4QDZA 1VG8A 3PCXA 2HREA 2EZ8A 1TCVA 1U80A 4MYUA 5LP1A 2W6OA 3RRYA 3ZDEA 1CZHA 1MJ5A 5HGXA 3DJYA 3T34A 5LM3A 3HACA 4NMLA 3NIBA 1R0YA 3T38A 2XSZD 3ENNA 1H8ED 1RLJA 2KM1A 4HDCA 2BBSA 2JFFA 4KAXA 1E60A 4DKXA 5C8VA 5LR6A 3ADDA 4TYWA 1CTQA 3UV6A 1XTJA 3PF8A 3SJ7A 1VJDA 3ESYA 4AS3A 4B3HA 2FZEA 1U9CA 1DWQA 2I4LA 1YRAA 4RESA 5LFAA 1UBGA 3MTGA 4U6SA 1E5TA 2ORYA 4AC9A 5IVPA 2JLQA 3TBFA 3WLNA 2GPWA 1WHTA 1STOA 4TQAA 3TQHA 2GA9A 2P0EA 1GILA 4XYLA 4A8JA 1X80A 1GUFA 2O20A 3PFKA 4FT4A 4MPDA 2GESA 2NU9A 4E14A 1P0CA 4AQYB 4JU8A 2ZJYA 1WZ2A 3C6ZA 1EVQA 5CT9A 2ZSIA 3WNQA 5JZMA 3N0XA 2XVZA 4GBJA 4ZAZA 2WKSA 3L0PA 1FNDA 1K5HA 1I10A 5DN6A 4A0QA 3LNCA 2W0MA 4JUCA 2ZB3A 3TBKA 4FGLA 4ITRC 4CL2A 4TVSA 1M34E 2DVMA 3D5QA 4HAIA 4M21A 3PTZA 1ZA1A 1ULTA 3EEQA 1ECCA 4FOLA 1JFFA 4TTSA 3W6ZA 1CDDA 1E7RA 2R8ZA 4FMDB 5DM60 1JDNA 1XZKA 1VPWA 1EH5A 5E6RA 5GINE 5F5NA 1X0VA 1LPNA 1B8OA 2RGGA 3W9UA 4CG1A 5BR7A 3PL5A 2CLEB 3ECSA 1R12A 2YZMA 2B4TO 5HX7A 1NJ2A 4KNWA 1KKMA 3WOVA 1JTFA 3RS3A 4IF4A 1BHSA 1RYMA 1T0IA 3B2EA 3CGGA 5K6TA 2YMQA 4ESHA 3E5HA 2LCIA 5GY7A 4S0XA 3RGWS 2OCBA 1ENPA 2VNJA 3ABZA 3ZTYA 1UT6A 3ZDQA 1YR8A 2PS0A 7ADHA 1JIUA 1N5RA 1YCHA 3A4YA 5EMMA 1L5SA 5FOQA 1ORIA 1O97D 4TWAA 4KI0A 1T1GA 5IJ0B 4KN6A 1F06A 5HF9A 1EUQA 2DE0X 1WPXA 5EHQA 3B1KA 3L7CA 4XVHA 3KPVA 2YICA 2J6CA 4AZWA 2V03A 1LF5A 1KFJB 5ALRA 3DZ8A 1J0XO 2CDBA 5KYYA 2E37A 4CDNA 1WXEA 1YFJA 2VP9A 1PJZA 3PLRA 4YMWA 3TS1A 3ZK9A 1OZHA 3O8OB 3OTWA 1JFLA 4RPHA 1E58A 3CT6A 2QTHA 2QE6A 4KPYA 4P4LA 2YWBA 1TO6A 2VL7A 3IEXA 4CN8A 3BZUA 4YJ2A 5JDCA 3ZZ0A 1KL7A 1LVUA 4NMWA 3P4YA 4NBTA 2O0KA 2OB1A 1JH8A 1QG6A 2E2WA 3NBQA 3U9LA 4AL4A 2EHDA 5FJIA 2ZRJA 1GUDA 4B3FX 4C07A 2LUOA 3PC7A 1NOIA 5ELMA 1RABA 1W29A 3IV6A 3Q10A 2Y77A 3G5MA 3GLHE 3JU3A 2Z8XA 1DT5A 4HNHA 2DT5A 2ZYVX 1I6KA 3LQRA 3OP4A 4PGMA 1Q6ZA 1DV2A 4OJMX 4CEJA 2O7VA 3JSAA 1XDZA 3QJGA 4MVYA 3TEFA 1T1SA 3PD0A 2Q1SA 1X9HA 5DGDA 4C7MA 3D6AA 2VPYA 1VHWA 3JX9A 3AYXB 3ZIAA 4E22A 2YDXA 4FYPA 4A3SA 3NWEA 2Y2VA 3IRVA 5FTJA 4BNDB 4FR0A 2H4YA 2UVDA 3REQB 5KKAA 1D2CA 2WEKA 1TYZA 1QHGA 2FP3A 4XIGS 2J87A 3PD7A 1NN3A 4BE4A 3PJFA 2P79A 3I9FA 1RHKA 2C4WA 4HBGA 2G9VA 4NICA 5IAAA 1I7SB 2VDLB 4TRRA 2R7LA 1XEAA 4QJ5A 1F2TB 1Y9JA 3KVOA 2XMRA 2EERA 4URXR 5IJ9A 3KS9A 4FEGA 4JQYA 2NU8B 1P4AA 2F3QA 3WLTA 1FIUA 1PFGA 1YJ5A 2XCTB 4PAWA 1ZJZA 4CTKA 1TVKA 4DWWA 1IOWA 4K7JA 4M0PA 4CLEA 1J8FA 4U7DA 3W04A 3GLSA 1X3LA 1NFQA 2Y0PA 2PL1A 3HJCA 4PFKA 1BCRA 1JALA 4JNCA 4M4SA 1PJQA 4Q1EA 1YR2A 1MOSA 3P2OA 4P33A 4Q48A 3DUFB 4V0NA 3VYVA 2IHUA 4GYWA 2JATA 2HL6A 2VHYA 3JQEA 1KKUA 3BJIC 1YTUA 4R69A 3OPQA 5ENVA 2QL6A 4ITUA 4EX6A 3NAGA 2ZIXA 4RACA 1SOVA 3LSYA 1YMUA 4LA4A 1ZUIA 2GR9A 1KAMA 4N6NA 1ZEMA 3K16A 3QWIA 1VMEA 3U1BA 5BN5B 3WGGA 1MFPA 1IM2A 2WVAA 3KE9A 4M9SA 3EWIA 2XD4A 5FQNA 2JIPA 2OCXA 4MDFA 3DHYA 3I9V1 3IAEA 3AIOA 4F8EA 2JZNA 3FDZB 1FU7A 2NT3A 3ENKA 4HXGA 2HT6A 1I3OA 4XM0A 4G5SA 1SU6A 1I6LA 5EFOA 3V7FA 1FYXA 2QU8A 3QMPA 2ANCA 4ZK6A 5K0GA 3F8SA 2IV2X 1T5IA 4WADA 4Q4HB 5EKUA 1ZKMA 1IM5A 2J7PA 3OQJA 3P2KA 3PDHA 1W0KA 3KR1A 2XQFA 5AVXA 3IEUA 1JDSA 1FQJA 1JYFA 2DQSA 3ADOA 3HYRA 3P32A 2EBHX 1EX1A 1RQPA 1L7PA 1ZK0A 3GLQA 1O89A 1RYNA 5EQFA 2O3SA 2PX2A 3H9UA 4OP1A 1VPEA 3V8QA 4E07A 5GZ1A 2P6MA 2FW8A 1N34B 5C1BA 1IZ8A 3TQFA 5H1YA 2WINI 4J1SA 1NUUA 5BXQC 5A4JA 1OTHA 1T9HA 4XUGB 3KC2A 3E22B 3ZK8A 4F0JA 1I0ZA 1RP1A 3EYAA 2CJXA 3AR4A 1TZJA 2H8GA 3M5PA 4MB0A 1CETA 3PRKE 2NO6A 4A26A 2CL5A 2PUHA 1E7SA 4EPTA 2GZHA 2H3EA 1B00A 1X9GA 1EWTA 2CLHB 4AN1A 2HFKA 2RI1A 4IDDA 1XAIA 3LRXA 4ZK2A 5IHPA 4L9WA 3AJRA 3L7BA 3WBFA 3PDWA 2VHQA 3R3HA 3GDGA 1Q7BA 4HN9A 3RBZA 2AJTA 5TGDA 2K7ZA 1GNVA 4M8SA 5FOTA 3RVQA 2MMGA 3E7FA 3MGCA 4CMEA 3FNRA 2A4MA 4HGNA 1RPTA 1JWAB 5FNVB 5JPCA 2EGHA 3GVHA 3CVOA 3GRFA 3U4QA 4ZVSA 1WB9A 1VMDA 3DHEA 1FYEA 3HJRA 3NCTA 4N3CA 1U0GA 4CM3A 2Q7DA 4UNIA 2OV3A 2YWCA 2WTEA 1QNLA 4E5VA 2ZTMA 3GX1A 1ZICA 5DHQA 5HKAA 1TIKA 1YV9A 2C1ZA 5H0IA 1G1AA 4WT7A 2BR4A 1KXZA 3UICA 2WU4A 3WZMA 5DNUA 1K0FA 1MJGM 2HA3A 2XKJE 3ZCSA 4B3BA 1F2UB 5KYGA 3DOJA 4F96A 2VPXA 4OJNA 1EA7A 3RUEA 3IQEA 4HYTA 5E7IA 4I5GA 4E6EA 3C5VA 1T1JA 3W8FA 1U8YA 2VJKA 1F8YA 4G0NA 2PUWA 5ER9A 2CCKA 4WLUA 4IVRA 2X4GA 4OM7A 1V3TA 4F21A 4FHGA 4BP1A 3JVDA 3OIYA 1C8BA 2VP4A 2XI4A 4LF9B 1QCYA 5C3UA 2FG5A 4ZARA 2UZ0A 5T5QA 3IEKA 5FLXA 4H1WA 2BGMA 3MUFA 3VHLB 4IJVA 3RIGA 2O0LA 1LEHA 1T3TA 4RK7A 1NF3A 1UKEA 2WU1A 1Z75A 3D6UA 3HFGA 3QQPA 1PP4A 2VDUE 1B8UA 1XZQA 1Q50A 4MQ4A 4N12A 5KYVA 1HH4A 1ZIXA 1ZJWA 3ZW7A 1NQXA 1OA1A 1T8SA 2VNAA 4BMCA 3ORYA 1WZCA 5G1OA 4N41A 4R1TA 4BFXA 4J0QA 3IVRA 2XXAB 2VAXA 3MTQA 2NTEA 5KJFA 1OWLA 1MXHA 1VIVA 2LE0A 2LZ0A 4PS0A 4PYMA 4TL7A 1RKBA 1UCFA 3K9FC 4CLDA 2HWYA 3OHPA 1PYOA 2Q9CA 5LBTA 3VSEA 5I5EA 1Q77A 1Z6TA 5ARBA 4HUTA 2P90A 1CDZA 1B1AA 2NPIA 3D8BA 3G13A 3AX6A 2J3MA 3VA7A 3FWYA 3QVGB 5F1KA 1JG7A 3EULA 1RYFA 2L69A 2GUGA 1LU9A 2B99A 2AR7A 1EZ4A 3S2FA 2AZTA 3SZRA 3IMGA 3PB3A 1CZLA 3H2SA 3H5RA 3DP7A 3M83A 4ERNA 1U28C 4J4BA 4ANFA 1I94B 3DWEX 4DMUB 3E9RA 2JIOA 3WYEA 3T5GA 3EJ6A 4UCXA 3PHBE 2VQDA 4B3SB 1P9LA 3FJOA 5F12A 3OX1A 4ZJYA 5KYKA 3NAZA 4KO8A 1T0HB 4CF7A 2ZU0C 1HFJA 3SMVA 2ISQA 5I47A 3FOCA 2X5NA 4JITA 3CH7A 5LWQA 3ZNOA 4LGVA 2GYVA 1E7WA 5FBRB 3K9BA 2ZBQA 4GT1A 4TS3A 3RANA 2HPVA 4N4AA 3ZDRA 4E33A 5EKDA 1X7ZB 3I83A 3HZZA 2DETA 4DXAA 2W8ZA 3Q72A 4Z9XA 2Q5OA 4Z4QA 4G09A 2VXOA 3AZOA 4HNGA 4MVJG 4BMZA 4CM9A 1U2ZA 1KK1A 1M7HA 1XXHB 4RHXA 5HF5A 1OI4A 3P2IA 1R8XA 1NIJA 3U81A 2ODQA 1H4SA 3DGEC 3I92A 4ZCSA 2GB4A 1HQDA 4D80A 4F86A 4FMCB 4BTLA 4DC0A 2W6MA 1ZGZA 2YINC 4LHSA 1Y7TA 1X39A 4HNTA 3H83A 2D0IA 4LNUB 5HQTA 1GRRA 1R00A 2GHQA 4OLFA 3R8XA 5FR2A 3Q7SA 2I1QA 1BE1A 5BSVA 1AY0A 1FP7A 4MRAA 3L0YA 5I7EA 4U2GA 2FSVA 3VTZA 3ZBPA 4ZVQA 3JWJA 2PH5A 1OH6A 3EXEB 3VPHA 1RJGA 3VZPA 2QMQA 2QSJA 1NE2A 2CEKA 3AHDA 3M4NA 4Q4LA 4Q7KA 3R9XB 1E9AA 4FWIB 4PC1A 3H86A 3JR7A 3E48A 1JTVA 5A0VA 2X8BA 3B70A 4DYVA 1NW5A 2A3NA 4PR0A 4MX8A 3VNSA 2FHSA 4ZHSA 1U7OA 5CVCA 3ZHTA 1NRWA 2HF9A 5COAA 5J3JA 3EXFB 3OCUA 4MS4A 1ND5A 1G7CA 1NN0A 1UC4B 3QU2A 5GPBA 3S2YA 1AE1A 1B14A 1P4RA 3GD7A 3CRQA 5IYZF 3VNAA 4KZPA 1E92A 4K2HA 5T8KA 1BKYA 1ISFA 1YE8A 3A1UA 1GVNB 1HURA 3B1JA 1M1UA 2FWAA 2W6IA 1WF3A 3PQ7A 1DHRA 2CD7A 1X1EA 3KWFA 4MMZB 5DCUA 3ZCQA 1GTJ1 2P75A 2CMFA 1J2JA 1V1MA 1KYWA 2O2CA 3EZFA 3Q5GA 4QYMA 5CVEA 4LZZA 3LX6A 2E3JA 1ZOIA 1N4AA 1QHHA 1JGTA 4Q12A 1ZNYA 3IESA 2ORWA 4OMFG 5AM0A 4AY3A 4E5NA 1C0KA 2DKNA 3LF1A 4XUDA 2HKIA 4OL9A 5JY1A 4I50B 2HDOA 2X9LA 3SYRA 2YJNA 4RE6A 4M7RA 2QW0X 2Q4RA 4PIPA 5GAJA 1T6XA 2HCJB 1SUSA 4RDCA 4YRNA 1D8TA 1U4NA 1Y3FE 2X8AA 3ZVNA 1LNSA 1WXGA 3RB8A 4DPMA 1A9QA 2JK0A 3CC8A 4WAUA 5F7ZA 5BN3B 1YGYA 2GD2A 3EGVA 3LKVA 5C8YA 5JJBA 1SBIA 1CJKC 3REFA 4WHMA 3GN2A 5AHXA 3EIQA 3BRWD 2I99A 2JD2A 1I3LA 1M2EA 1UK7A 1ZMTA 3KKEA 3RAEC 4XJVA 4URZR 4I1YA 4G5XA 1IE3A 2JAPA 1TE2A 2O1EA 1Y6ZA 4HZUB 3BD6A 4NXMB 5LQDA 3Q85A 5CH8A 2B0CA 1TEHA 1T8UA 3MS4A 3NRCA 3EVFA 3MXTA 4QUHA 5CCDA 1G20E 3V8RA 4DLSA 5J4VA 2ZRLA 5LLDA 1K4YA 3EFBA 4BLRA 3LY8A 1ZCAA 4I4TA 4DCGA 1WUJS 2GPNA 2ZROA 2IIBA 1Y4DE 1DJMA 1SCIA 3EOZA 3PEEA 5CMLA 4H6VA 4JKIA 4J3JA 5AVOA 4FHCA 4H60A 1ABBA 1H0SA 4PBRA 2XQVA 4EF4A 4G5YA 3OMWA 2QJWA 4RM2A 8MHTA 2YFQA 1U99A 3BHMA 4Y18A 3WISA 5HQJA 1BD3A 3GJ5A 4IIJB 1DS6A 5AIBA 5HS6A 3H6HA 3CS3A 3SKVA 4NZOA 3F4LA 4ZANA 3SM9A 1PJ8A 3A4TA 1MC1A 4BMNA 4DSTA 5EPUA 4WJLA 5G1NA 5BW8A 1P5FA 2VK2A 1GKUB 2XVYA 3L92A 2IYQA 4PGAA 3OFVA 5EXPA 2YV1A 3UY4A 1I14A 6ADHA 2E4VA 4B3CA 1Z47A 4IRUB 4YA6A 1GGHA 4PO8A 4R9VA 1VPLA 2Z8ZA 3HA3A 4DC1A 2DFVA 2E9SA 2ZULA 5AH0A 4FQ8A 4JT9A 1EX7A 4KDRA 1CERA 1FTGA 2NPOA 4Q4JA 3VUFA 2BRUC 1ES9A 3TUIC 5LKAA 1W96A 3AESB 1M8FA 3BWVA 3L1HA 5IS2A 1THZA 4XFDA 3S3TA 4BE9A 3U7JA 4TV8A 3M0EA 2OZVA 4OBBA 3CW8X 4UMVA 4BGUA 3S81A 3ZHUA 2IXAA 1CB7A 2REOA 1S2NA 1ZVMA 3SOZA 3FF4A 4BO4A 2ZE8A 1RJ9A 3T54A 2Q1UA 3E8XA 5HR5A 4B4VA 2BW0A 2R4TA 5K3SA 3VPAA 3N8NA 2ZJBA 2EBFX 4ZCPA 3EIFA 2W8BB 1CSEE 4DCVA 2QT9A 2WT4A 1ONPA 1GKLA 4X20B 1H2BA 2C99A 4GR4A 4DG8A 2ZYRA 3LA8A 2M1XA 2G4VA 4O3MA 3A3NA 3ZGLA 4IIGA 5H68A 3I5XA 2Q3DA 2IY7A 1MOPA 5B1EA 4D0GA 1V2GA 4YLYA 3CEJA 5TEWA 4LY3A 1RAHA 5CYOA 3PC4A 5ICFA 4ENQA 1DPGA 2P4QA 3GU3A 1NMEA 4MKHA 3FCAA 1ZDMA 2OK8A 4XYMA 4KIFA 3L49A 3IQZA 2ZPUA 3NT2A 1C0EA 5CH5A 4LHZA 3FB4A 5I7AA 2CBZA 4FYYA 5U4XA 2I4MA 4DJAA 4LJ5A 2QRHA 3G0CA 3O4RA 1CZKA 3N3BC 5IH3A 4MW4A 1M6YA 2BGGA 1EVJA 3UTDA 3AG5A 4MW6A 3DOEA 1PK9A 3BJZA 3F1LA 1KZ1A 1XMVA 2WAMA 3A1NA 3KDSE 2IYWA 4O4LB 2KX7A 4KK3A 4Z6KA 3BQNB 3K1YA 1Z6GA 2CNLA 4JKOA 4Q9AA 4G0VA 3GXOA 1W25A 5L9AA 5KTKA 2XAUA 3FD8A 5G1PA 3EQ9A 4R01A 3IEIA 2PK3A 3HKBA 4H6WA 1N9GB 1E2MA 5J5VA 3A6JA 4KQGA 1C4KA 4DZRA 4U0JA 4URYR 2I22A 3B48A 1DQPA 3N28A 4G37A 4PEVA 4TRMA 1A9RA 2IY8A 3I6QA 3WS7A 2PX3A 2WMYA 1AQJA 4C2AA 4LF6B 3G23A 4FJ2A 4DV5B 3OZXA 2A6PA 2W2QA 1QC5B 3NTQA 1ZRMA 3W3ZB 3K0CA 4Z7NB 3DAGA 1HE5A 3KWMA 3M89A 3OE4A 1A8UA 1DCKA 2B20A 1XYVA 4R40A 4PSKA 5D84A 2LWIA 4NULA 2V98A 3K2EA 3ZU3A 3VI3B 1TK9A 3W7BA 1BGVA 5FTLA 3P5BA 4CM4A 1CF2O 4G0MA 3TKYA 1Z7BA 4AURA 3N6VA 2PJRA 1T25A 4W9MC 1YULA 3KXLA 1G3QA 4MJXA 4JYAB 3WNVA 4UUQA 1LDYA 2QYHA 3AJEA 3LT1A 5G53C 1I5EA 1A3CA 3IDOA 7GPBA 1WCIB 1DE0A 1FDOA 1TCUA 2AR9A 5EKSA 3K9LA 1MAUA 2APJA 1CR2A 1PQWA 1UQUA 3U9SA 1Q3KA 4XLZA 5KB3A 4CMCA 3KX2A 1QWOA 3RU7A 3AEQA 4DS3A 1T2NA 2C8LA 4PCAA 3H2YA 4Q3CA 1E32A 1QO0D 1OWPA 3ZHSA 4TX1A 3UH0A 1RLIA 5IXYA 3BGSA 2EFEB 4MV3A 4C3ZA 3MWGA 2R2GA 2VHVA 3D9QX 1NLYA 1O94C 2C7GA 3F6RA 2VZ9A 5HE9A 5T64A 2ZZMA 2Y4OA 2O19A 4DNFA 1NC3A 3T9EA 3CF4G 2YNMC 4JUAA 1MNQA 4DLZA 4EOGA 2DPGA 1NAHA 3A28A 3O8BA 1YR7A 4LDNA 1L4HA 3KCQA 1VG1A 3AFHA 3N9IA 1GQRA 1P33A 5DTJA 1GLVA 3EVEA 4NATA 2UAGA 1V4VA 1M6EX 2QSZA 5JJLA 3U7GA 3G2LA 3TQCA 2IUYA 4KAFA 3W5JA 2IYNA 1KSGA 5IKXA 1XIVA 1YDFA 2JIBA 1XCPA 1DC3A 5CLIA 1DRVA 2XNDD 3C3PA 1LCIA 3AFNA 2CSXA 5B3KA 1EHIA 1G8KA 3EQ7A 3L6UA 2WF9A 3CO0S 3JZDA 3D0KA 2CLCX 4X8MA 2F48A 4H0CA 4J0EA 4K3VA 4QUIA 4WWHA 4AFNA 3RASA 3OKAA 3W6PA 2D1FA 2D6FA 1Y9ZA 1EUCA 2WDZA 2Q4BA 5TS2A 1QIDA 2QP4A 3PYMA 2JCBA 5CNIA 1RQXA 2BBWA 2F6RA 2W6CX 5TVKA 4ZHQF 3FNQA 2Q2OA 4UTZA 4OI0A 1W0JA 4P58A 3TOCA 3KKZA 3R5FA 2OB2A 3CX7A 3CX8A 2IUEA 4DGQA 4YMLA 1I2MA 3AVXA 2PH1A 3DO6A 4V0OA 3E5RA 3GZNA 4YYZA 1FRZA 4D57A 1Z5OA 2NU7B 4CF4A 1Y3CE 1VCNA 3BF7A 2O8VA 3HCNA 4QUKA 4BBZA 2JFWA 3DZFA 4NU8X 3RWMB 1E64A 3CA8A 2HW8A 2FZLA 4GD3Q 4RUKA 3L6BA 1M1YE 4V39A 1G17A 3HU3A 1KYIA 1MAAA 3PC3A 1KK2A 4X95A 3BSWA 3WQRA 4EK9A