1DG9A

Crystal structure of bovine low molecular weight ptpase complexed with hepes
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
157
structure length
157
Chain Sequence
AEQVTKSVLFVCLGNICRSPIAEAVFRKLVTDQNISDNWVIDSGAVSDWNVGRSPDPRAVSCLRNHGINTAHKARQVTKEDFVTFDYILCMDESNLRDLNRKSNQVKNCRAKIELLGSYDPQKQLIIEDPYYGNDADFETVYQQCVRCCRAFLEKVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords TYROSINE PHOSPHATASE
publication title Crystal structure of bovine low molecular weight phosphotyrosyl phosphatase complexed with the transition state analog vanadate.
pubmed doi rcsb
source organism Bos taurus
total genus 64
structure length 157
sequence length 157
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 1999-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1dg9A00
4NICA 2RJOA 2FMHA 1C0EA 2QVCA 2VUIB 3H5VA 3JPWA 4G86A 2NT3A 1Z2EA 3NBMA 1MIHA 5CNJA 5IEJA 2E4XA 3EQZA 5FBHA 5B3JC 5DLEA 4G0ZA 1YS6A 3NHMA 1EWVA 3QK7A 4YO7A 4NV3A 1DRJA 1QO0A 4ETMA 1FFGA 4LX8A 4MS4A 4JP1A 3KG2A 1LJLA 4MR8B 4MR8A 1A04A 3JY6A 4N0PA 4LE0A 2E4ZA 1ZGGA 5DCLA 5KI6A 4IMIB 5HQJA 1NXOA 2MYTA 3OM1A 3LUGA 1Z18A 4E7PA 4RY0A 4F12A 3RVRA 3SNKA 2O20A 1ZHHA 3N6VA 2RDMA 3QX9A 4QYWA 3KHTA 4Q6WA 5E3JA 1YK0A 3HSYA 1PHRA 4H3HB 3LUJA 3H6GA 1E6LA 3TB6A 4D74A 2VYCA 2B4AA 2V0NA 1JBEA 2WMYA 3H5OA 4RXTA 4RK6A 3JPYA 4Z9BA 4WXEA 3EODA 4RU1A 5TE9A 6ABPA 3T6KA 3CZCA 4DN6A 3H1EA 5BRAA 5KQLA 2A9QA 4EYKA 2QVGA 3FMVA 9ABPA 4F06A 2VUHB 4GPAA 1NXPA 3QEMA 3H1GA 3RVSA 3CKMA 3CTPA 3N8IA 5HSGA 1LJUA 1BVHA 7ABPA 3T95A 3B2NA 4WT7A 5KQGA 3IPCA 2CHFA 4W5NA 4QYMA 4HNRA 3BBLA 4KK4A 1K66A 3CG0A 1D1PA 3A3KA 3QELB 1D4ZA 1ISSA 1U04A 3URMA 3T8YA 3I09A 5D2CA 2OQRA 1Z25A 2RJNA 3DZDA 2M1ZA 2F8TA 1GCGA 1MAVA 3O75A 4JB2A 4MRMA 4MRMB 5DTEA 5BR1A 1F4VA 1DJMA 2BGGA 3HVRA 3H5IA 1SXHA 4F3TA 1JHZA 1ZITA 3HEBA 2MYNA 2FEKA 4PEVA 3OQOA 3BRSA 3GRCA 1YMUA 2LBPA 1EAYA 2MSWA 3E61A 1FFWA 3LUAA 2CHEA 4HNSA 1ISRA 3NNNA 3OMWA 3RVJA 1EFAA 2PUBA 3HJFA 2FMIA 4JAVC 1LBHA 1PNTA 2LPMA 4MS3B 4EYGA 3ROTA 3GT7A 3FDFA 4G0XA 1QNLA 3CS3A 3CLKA 4MQFA 4MQFB 2FSPA 4MQEA 1BDIA 1ABFA 1SXGA 5EWJA 5FWYB 4IILA 5BRJA 3RQIA 1PUXA 2A9OA 4WXMA 4F11A 4JOQA 1KRWA 3FFTA 2LIVA 5TPWA 4RWEA 4L4UA 3LMKA 1USKA 4RZSA 2GBPA 5CHYA 4P1ZA 4EYQA 2I6FA 1NXVA 5KQMA 3ILYA 4Z9AA 3DGFC 3MYYA 1D5WA 5T7BA 1ZESA 1XWWA 4RSMA 2PKXA 4QICA 3D8UA 4XARA 3OLXA 3HXMA 1CYEA 2FQWA 3F7NA 3O1HB 3OLVA 3RVMA 3BRQA 2WY2D 3H1FA 4Z4GA 1RXIA 3SQNA 4G0OA 4RKQA 2L18A 1MB3A 4PE5B 1RZRD 4KREA 4N03A 2GI4A 1PEYA 5CNKA 1APBA 2PUAA 1ZH4A 4W5RA 5T3YA 1Y1LA 2TMYA 2FEPA 2ZWMA 3N0RA 4PYRA 3UKJA 2PJUA 1BA2A 5TQ0A 5TQ0B 1DBWA 3N53A 1GCAA 1M5TA 3BREA 3O2SB 2ZAYA 2QR3A 4N0QA 3Q7SA 2PE5A 1JDNA 1P6UA 1ZY2A 2FXIA 3LKBA 2PUFA 4S05A 1P6QA 4KQCA 2LUOA 3UK0A 3QLVA 1DC7A 1ZDMA 3MA0A 5EWLB 5EWLA 4OLAA 1PNRA 1KGSA 3HM9A 1U2PA 3IP5A 3MMNA 4JB0A 5DGCA 5F64A 4H3KB 3KYIB 1W9HA 3KS9A 4G0YA 4Z4IA 4D6XA 4MR7B 1A2OA 2FMFA 3EJWA 5IX8A 1JX6A 1QQBA 3HDVA 2PUCA 3C6QA 3A0RB 2PMCA 1TM2A 4IMJB 3F73A 1BDHA 1YK1A 1YMVA 5JS2A 4EYOA 4G97A 4OTZA 1IIBA 1NTRA 3G85A 5FWXA 5FWXB 1QP7A 4Z99A 3GV0A 4YP9A 4B09A 2PUDA 3HS3A 3M6MD 3KJXA 3HV2A 3CFYA 1USGA 3MM4A 5C5CA 1DBPA 1FFSA 8ABPA 3O1IC 2JBAB 2JBAA 3EDCA 1TJYA 4WWHA 2JRLA 5IUKC 5ABPA 3BILA 2ID7A 1Z16A 1SRRA 4Y9TA 1MVOA 1A0OA 3GL9A 2R4QA 1M2EA 3Q9SA 1B00A 1FQWA 2QW1A 1Z26A 5KC8A 5I4CA 1UDRA 1TLFA 5C5EA 3CNBA 1FSPA 1D2AA 3LUFA 4MGEA 3O1JC 4RK4A 1EWTA 5FBKA 4DADA 1DBQA 1U2QA 1P8AA 3RVOA 1Z12A 1ZAYA 2PL9A 4D6YA 5TQJA 3QLUC 4MLDA 3QELA 5TPZD 4EVQA 3GWGA 5IUJC 3LUCA 3D02A 3RH0A 2R25B 3MIZA 2JVKA 2QXYA 4O1HA 2WRZA 5GQSA 3I5AA 2AYXA 1AB5A 1DCFA 3P9YA 3RVPA 3H5LA 2PUEA 1Z17A 4RK0A 3HO1A 4O5AA 1RNLA 5HM6A 5KC9A 4ZPJA 3EULA 3A0UA 1BAPA 2FVYA 5B3JA 4S04A 4P98A 4O1IA 1DCKA 1JLKA 2P9HA 3O21A 3QEKA 1EWKA 1ZVVA 1DP4A 2FLKA 3VNAA 1L5ZA 3QX8A 2FN9A 3OLWA 5IBQA 4KPYA 4MS3A 5JS1A 5DKFA 3K9CA 3ROFA 3QLTA 3NHZA 5JNWA 1QQAA 1ZH2A 3LUHA 4ZMRA 4W5OA 1NATA 3C3MA 4YV7A 4RXUA 5FWYA 3O2JA 1W25A 1Z15A 4ETIA 3M9XA 1MB0A 4YGXB 3F6CA 4KVFA 2HSGA 3LOPA 2L2QA 5TQ2B 2JK1A 5TQ2A 1SXIA 3IPAA 2MSKA 3A10A 4EVRA 2PUGA 4W5TA 1F51E 1OXKB 3OM0A 4ML3A 2X7XA 3CRNA 3KCNA 4MPTA 4RXMA 1JDPA 2ID9A 4OATA 5IC5A 4IRXA 3TD9A 1LBIA 1RZRA 2FTKE 2IPAB 1RPJA 4LDAA 1BDJA 1E2BA 3RVQA 3C3KA 4GNRA 4RS3A 4MR9B 2P4UA 4YWHA 1Z13A 4TLLB 3SY8A 4XASA 1JFSA 3IP9A 3RVLA 2PL1A 2IKSA 2H3HA 4RK5A 1I3CA 3LTEA 2A9RA 2QZJA 4L85A 1D1QA 3FFXA 3OMXA 1LK0A 4KMRA 3IP6A 1QP0A 2GKGA 1Z2DA 1JFVA 3EGCA 1SD5A 2Q5CA 3HZHA 2HQOA 3F6PA 4FE7A 1JF8A 3CU5A 4ZYLA 4YS6A 4HYEA 1ABEA 2MYUA 4Z4HA 4LRQA 2XDYA 5EWMB 5EWMA 3DBIA 3EAFA 1JYEA 3E3MA 2GWRA 5IULC 3LUDA 4Q6BA 2NT4A 4UHJA 3R0JA 3G1WA 4N76A 1JFTA 1ZN2A 4KV7A 1T34A 6CHYA 1KMIY 2KYRA 3DGEC 3NNDA 2N9UA 3I42A 3N0XA 1YVUA 4MR7A 3T38A 4F8JA 4KFCA 4RV5A 2NZUG 1NXSA 1YS7A 4OG2A 3GA5A 3KKEA 4TMYA 1QP4A 2R48A 2B1JA 2DRIA 2E4VA 1S8NA 2FN8A 3SAJA 4RK7A 3L6UA 4G0PA 1L5YA 3O2QB 5GOTA 4G0MA 1RXEA 4MS4B 2HPHA 1CEYA 1R8JA 4Z0NA 3HUTA 2H0AA 1DZ3A 4Z4CA 5JNRA 1WETA 4E7OA 2JVJA 3OO0A 5KQPA 1NY5A 4H60A 4FE4A 4MYRA 4NCBA 5IEBA 2QU7A 1AB6A 1E6MA 1QO0D 3JTEA 1CHNA 2QSJA 5TPZA 2E4UA 4YCSA 5JNTA 2NUBA 4OLBA 2HJ9A 3KSMA 1VKRA 2GX6A 4PZ0A 4EUKA 3SG0A 2R47A 4RK1A 3HDGA 2YHAA 3KLNA 3C97A 1DG9A 4NQRA 1VPWA 1VRVA 1M2FA 2L19A 4IGAA 4LZLA 2AYZA 2JCGA 2MSLA 5ED4A 5CNMA 3OLYA 2JVIA 3SM9A 3HUUA 2L17A 4WUTA 2A9PA 2PAFA 1ZGZA 3DLBA 2IPNA 3KTOA 4XAQA 1NXTA 2MYPA 3EQ2A 2E4WA 2QV0A 3H5TA 3IP7A 3QEMB 2FKAA 4M88A 4YRZA 3OLZA 2FQXA 3HCWA 2FMKA 4XFKA 3NNSA 3JVIA 4N47A 4KNYA 4LE2A 4YLEA 2IOYA 3GYBA 1P2FA 2CWDA 5JNSA 3LUKA 4CBVA 2F8SA 3OO1A 3OQNA 4KK3A 4ETNA 1NXWA 2HQBA 4MLCA 3Q41A 1J56A 2JB9A 2IYNA 2M98A 3MQ4A 3Q15C 3GBVA 3TO5A 3QLVC 5KWSA 2WB4A 1DRKA 3TX6A 1JWLA 4FB4A 4EVSA 1JL3A 4ZJPA 1GUBA 4PICA 5HKOA 1M5UA 4G0QA 4WZZA 3IDOA 3S99A 3K4HA 3HK2A 1GLGA 4Z4EA 5IUNC 2IPMA 1DC8A 1USIA 2NZVG 3OQMA 2FEWB 1KRXA 3KLOA 2IDMA 4YR7A 1VLZA 4LE1A 3KYJB 4Q7EA 3N0WA 4LDZA 1JH9A 3LFTA 3L49A 3LKVA 1URPA 3TMYA 3VNBA 1QMPA 3W9SA 2J48A 4OBBA 4RY9A 4KQ9A 1OXBB 1XHEA 2FQYA 3FGZA 1U8TA 1JYFA 4XXHA 4RKRA 1TVMA 2PLNA 2WJWA 1DCMA 2WJAA 1K68A 4UHKA 3N75A 4EGSA 4ZMSA 4MQEB 3I45A 2RGYA 3ILHA 4RDCA 4JASB 1NXXA 3CHYA 4MR9A 5EWJB 3RVKA 1PEAA 4EY3A 1QPZA 2HQRA 4MS1B 3FFWA 4MS1A 3UUGA 2LP4Y 4IF4A 2W42A 1GUDA 3M9WA 1HEYA 5TPWB 1XHFA 2FLWA 1TMYA 3MF4A 2WWVD 3DLHA 1E6KA 3CG4A 1EHCA 5JNUA 4Z4FA 4QPJC 3Q7TA 2FW0A 1C4WA 4NCAA 3JVDA 4JA2A 3H6HA 4TLMB 2IPLA 1QKKA 4MAAA 5PNTA 2YHBA 3QLUA 4HNQA 3RVNA 1U0SY 4W5QA 5BQ3A 2VK2A 5CNIA 4N41A 5JNVA 1YTUA 3CZ5A 3C3WA 4KRFA 3H5WA 3GBPA 4TN5A 4RY8A 3JS5A 3H75A 1H9CA 3O74A 3Q7RA 4XLTA 4KZKA 4DQDA 1YIOA 2CD7A 2OENG 2E4YA
chains in the Genus database with same CATH superfamily
2YBEA 4RKFA 1YACA 3BE5A 2Q29A 2QVCA 3KKLA 2QD2A 4FP9A 2SCUA 3FUUA 3IYLW 2OTCA 4NYJR 2V7UA 2QUJA 4K9MA 4TQAA 1EHIA 5ALQA 3TL3A 3G79A 3HNPA 3LKDA 5J40A 5CDUA 5CFOA 3AY7A 1S2LA 4F6LA 4NDZA 5DASA 3DE0X 5JQGA 3TL2A 2QL9A 3HABA 4NE7A 2H4HA 3E3AA 1KSGA 3UT0A 4CKZA 4K2HA 3GEEA 4N54A 2WIBA 3F9CA 4QFDA 3UNXA 2QR5A 3AC0A 1HYQA 3BX1A 4HDNB 1YS6A 2ADOA 1SVOA 3MT0A 3WXMA 5CA1F 5E6UA 4PC6A 2HJGA 1MT3A 1V4BA 1YCHA 5DNEA 3AX6A 2BCEA 2H4WA 4LV5B 3RRXA 2W7TA 5IJZA 1JR2A 2MR6A 3FNBA 3SVTA 5A6SB 4Z51A 4GPBA 5EUBA 4ZWNA 3M5PA 5LMUB 4FT4A 1D6JA 1MFZA 1Z29A 4KMSA 4HEA1 4WA7A 4IMIB 2DH5A 2Q8PA 1EI9A 3UOGA 2ACEA 1OGJA 3HWRA 1GPJA 3C7CB 3EF1A 3PKIA 4M55A 1YB5A 3PEYA 4I5DA 1ZNYA 1EJ6A 1M67A 1S2OA 2QMEA 2RDMA 1N3YA 1QHIA 3B7WA 4KIWA 5LYJB 4IBOA 5A0FA 4ZYWA 2AR7A 3QE0A 5FTMA 3GA0A 4BC1A 1BXGA 3U09A 4QODA 3ABRB 3GDHA 4YEDA 1K08A 1SVKA 3ZE9A 2W58A 2WT8A 4H77A 2F4NA 5A7FA 3JPYA 4Z9BA 2XYQA 2UUCB 3UCFA 2OM2A 3GLHB 1K92A 2AR0A 4RU1A 5HILA 3YASA 1BWSA 1KJ9A 5SYNA 2F00A 2QVGA 3E8SA 1YRQA 1RLOA 2XDQB 1WNFA 5T5QA 1X8XA 1ZIDA 3GD7A 4YMWA 4AQ7A 1M5RA 3OQ6A 3CKMA 2AOTA 2GDZA 2VLBA 3D0RA 4R41A 7ABPA 4M37A 1MJ5A 2D0PB 3FPGA 1CW2B 1ODCA 3FVWA 5FL7D 1CX9B 3S55A 3IEVA 4I46A 5F21A 3ZY4A 2AG8A 1X7WB 2P35A 3JAKA 3ZV6A 2ZRFA 1DV2A 3CG0A 5EXEA 4CM6A 3ANYB 2CC2A 3ECAA 5JU6A 2PVCA 3SX0A 1UXOA 3R3ZA 4TTAA 1M6VA 3GEHA 4EHDA 3OFVA 3EK2A 4PTZA 4BX2A 4TSFD 3EW7A 2GPYA 4GNKA 4BUJA 3OZUA 4EDFA 3F78A 4D8VA 1EVJA 1L7MA 4WE3A 1VKOA 3NKLA 4JL6A 2QE7A 4MA5A 4AJ2A 2R60A 2FPOA 4GGPA 2FN3A 2DZDA 4MRMB 3ZGXA 4FGLA 5A4AA 2FFHA 4D9IA 5KWJA 2J5RA 3HKDB 3A1FA 1H2HA 4R1LA 2ZTUA 2CV0A 5J4KA 1T2AA 2PPLA 3GJ3A 2O7RA 3FGOA 1TU0A 5CHEA 4A1OA 4J2OA 4BLWA 2NV2B 3QE2A 4F97A 2XXAB 1WXWA 4G4IA 2H5LA 2RGGA 3KQWA 5FULA 4FILA 1EWYA 4K81B 3JASA 1LK5A 2B4YA 4B33A 2X7HA 1CWUA 2PGIA 3SFVA 4CL2A 1LBHA 4LHVA 3MGCA 1PNTA 3BFJA 4TUYA 3PFGA 1GGJA 1QNLA 1J99A 1NLMA 4TTIA 2UAGA 2CZGA 3AFNA 4CG2A 4BO5A 2O2XA 1U7OA 4B6OA 5CLFA 4QEDA 5EWJA 4Z3KA 1EKXA 1ENZA 4IILA 1G3QA 2HQSA 1JKJB 3FPKA 3JQFA 2HPZA 3RU7A 4LECA 4GPZA 1N6OA 1YB1A 4NPCA 3RKRA 3ZI7A 1KRWA 3UJBA 8AT1A 2HXYA 4KPEC 2Z5LA 3BSSA 2OZEA 4HAVA 2VRCA 3FOCA 1BWRA 4JHXA 2MINA 4MWSA 3CEAA 4CEJA 2GBLC 4P3KA 1ZK4A 2CFTA 5LA6B 1T2UA 2YN2A 1KVQA 2HHCA 1IXRC 2Y4NA 1XRNA 1V9CA 1VE3A 2OOKA 4RD2A 4FN5A 4CTOA 3DOOA 1CRPA 3HNRA 5K0LA 1DX4A 1O94A 4Q4JB 1XWWA 1QOZA 2X4DA 1Y8QB 2YVAA 3VI4B 4DMHA 4AJHA 1A97A 5IT0A 2J33A 2P11A 2C7VA 3K92A 1Y8ZA 2FQWA 4HRAA 1YUBA 2H8GA 2WWFA 3U7IA 2H18A 2HEIA 4LJ8A 5LU9A 1WE2A 2HK8A 4RCVA 4ZGGA 3L7DA 5FB3A 4I1RA 1UBOS 1VMEA 4QFBA 4CF6A 1YU6A 2VYVA 2XUIA 3AY3A 1RPZA 4OQPA 4MTLA 3KD3A 4INOA 2OXIA 5KWVA 5BSGA 4QPPA 4MW5A 3QVSA 3ESRA 5CTAA 1E3LA 3EZFA 4MQMA 2ZSBA 4I0WB 1Z39A 4OHUA 3O03A 2C2XA 2O8CA 3GELA 3OG9A 3V1LA 4FDTA 5EY5B 2YWJA 4FEEA 3ZWOA 3I2IA 4I1OA 1KORA 1P6UA 2A5DA 2H1IA 2X0KA 3RSOA 1YHZA 1SBTA 4UZFA 1RFLA 2ZWIA 4RVGA 3WHPA 3U44A 3O73A 3Q7QA 3U5ZB 2Q4RA 1HZZC 1QSGA 2JFGA 4IJ5A 4D8TA 2C0CA 1EXNA 5EWLA 3IB3A 4DV6B 3OUZA 1YGYA 1CFZA 4DNOA 4C4YA 2I65A 3IP5A 4FZ3A 4EBFA 2ZB2A 4MGIR 2V6BA 4PR3A 2GZHA 2J3JA 4B84A 4D8UA 1J8YF 4I9GA 4DLVA 5LWQA 1WPRA 3OE1A 3ND8A 3PJDA 1AIPA 1YULA 2ZJ5A 3HDVA 3PFFA 2OBNA 3HBMA 2E87A 4GXTA 4TL6A 1P0PA 1M83A 1M8FA 3A4MA 4HBGA 3I61A 1PF7E 2ZBRA 2F3TA 3JQCA 1RWMA 2HUPA 2WQZA 3EVZA 3ZY5A 1U28C 2JIQA 5AT1A 3RSGA 3UT6A 4V03A 5A02A 5EJ4A 2FW8A 1YBVA 3QX3A 4KXWA 1LQ2A 2EJBA 3Q8XB 1NGSA 3CH7A 3F8TA 4L5YA 2VHVA 1VE9A 4R7GA 5ICCA 5F76A 3VJMA 1FSGA 1GPBA 1E7MA 4YMTA 1TEHA 1OPRA 3QUAA 1QVWA 4ZFNA 1P2BA 4MUBA 4RVSA 4HGZA 5CB4B 3U61B 4O4IF 2YS6A 4XD2A 3DZBA 1Z16A 3QXJA 2PQMA 5GJWC 2YV5A 1YI8A 4FJ1A 2WD9A 4N40A 4U00A 5JAQA 2QLFA 4EA9A 3KQQA 3A4LA 3W05A 1ZGBA 3FYHA 2GTPA 2O3JA 5EMKA 1WSAA 1Z26A 3BBPA 4V0RA 5KC8A 5HRAA 1VI5A 3BD9A 3DXFA 3SIXA 1SU7A 4F2PA 1VG8A 4EKDA 1ZC3A 3CLUC 1L4EA 4G9GA 4NMWA 5K05A 4IDDA 4H1VA 1SUCA 4PQEA 3A6DA 4HWSA 4Y1RA 1MVLA 4GRIA 1P4SA 3PI6A 1G4UR 1JU9A 4HUJA 1Q3KA 2WMOB 1MHTA 2H3EA 5MFZA 1ZISA 3FPAA 4V2UA 4CFSA 3QKWA 4OQZA 2BELA 2FPIA 2ZB7A 4W7HA 4DKJA 4O1HA 4QBHA 2VT2A 5IDXA 2R2GA 3OD1A 1DCFA 1SG6A 3IQWA 4RADA 5TX7A 3TRFA 1E9CA 1GRVA 1RXSA 4Q00A 4YJ2F 3SQMA 4PLZA 3GZJA 1W4AA 3EEIA 2BFFA 5A9RA 5BQFA 1YHNA 2JCSA 3JQ8B 4U5QA 1V0JA 5G0WA 1T5HX 2GJKA 4ZIRB 3VV2A 4NXNB 4OIFA 3S27A 3L01A 2DP4E 4O33A 3AIMA 4C08A 4D02A 4ENUA 1KETA 5CDTA 1G291 2ZJAA 2V4ZA 2HW8A 1SU8A 3PGMA 3UA4A 5K0GA 2C4NA 1JHQA 4E5MA 2CUZA 4GGMX 3GLGA 1D0IA 3L0CA 4MPJA 2O8FA 3L4KA 3OE7A 1R3UA 3HA5A 1LPBB 4JLBA 4D8YA 3PDIB 5JROA 2AK3A 4YDHB 3ROFA 1FY2A 1MOSA 4D3DA 5ITZA 3BIJA 4HDSB 2I78A 2C4MA 2MSCB 4JUBA 2OV4A 3S68A 4W5OA 3BJIC 3PL1A 2XJ9A 1BMFD 3LCUA 3JWJA 3M9XA 1ZOSA 3AU9A 5I9IA 4R84A 1GNTA 3EX7C 3LWDA 4P4UA 3IPAA 1NLYA 5DT2A 3TKLA 1OFUX 4U7DA 2W42A 5ALPA 5CLIA 5BSVA 2NUPA 3N70A 1H0SA 4JEHA 2ZRHA 4W1RA 4IRXA 3UFXB 2X5XA 3QYAA 3TQFA 4IWXA 2EW1A 4C0QC 3SP1A 1I7PA 3WK7A 3AVPA 1K6JA 2J3KA 4X3CA 1PZNA 3ENWA 1Q92A 3AJEA 3RDPA 2BMVA 3P32A 5CFMA 4FFRA 1XTPA 2ZVDA 5J4YA 1F3OA 1P19A 4Q21A 5DM4A 2Y1EA 3B1FA 2BFAA 1B76A 5AOCA 3TUJC 5FAXA 2A9RA 1XIVA 3P19A 1QP0A 1C9YA 4GMKA 4NNPA 4GX5A 3CJRA 4B3FX 4XKJA 5BNZA 3M49A 2DBVO 4HDKA 4EPVA 3KSBC 1N9ZA 4AUMA 2HQOA 2O5VA 3VKGA 4O25A 3OCZA 3WGKA 4XJVA 5JAUA 4Z4HA 3R5FA 4UUMA 4CGZA 5LVAA 3VZRA 4M76B 2XNHA 5EWMA 1EFVB 3DBIA 3PI7A 1WY7A 4HB4A 1PJLA 2QPOA 3UXEA 1S4QA 1S6YA 2EF0A 4M7PA 1NYLA 3H19A 4WOPA 4HXYA 4C29A 3R0JA 1ZM3A 3CONA 2ZB8A 3L84A 3TZCA 1NA5A 3ESCA 4JL8A 2HJRA 3LGAA 1Q22A 1ZONA 2H1LA 2TMKA 3BKXA 3GUHA 2DTEA 3W3AH 4KFCA 3N0XA 1SY7A 1JECA 4O4HB 1WTAA 4K9KA 5D3KA 2R48A 5JVDB 1J2YA 1QTIA 3OZRA 1DFIA 5H8WA 3RRBA 3U13A 4FXPA 2YWBA 1YZGA 3ZH2A 5GZ6A 5K8LA 3LO5A 1IHYA 4NG4A 4Y2TA 3NBXX 1YVEI 2XA9A 1EVEA 5AW5A 3UGTA 4A5SA 2JLCA 2JAPA 1OI2A 1IHOA 1PGJA 1RRVA 4H7JA 1RWOA 1NN5A 1T91A 3Q7EA 4OQDA 5CEJA 5IMSA 1EX9A 3I12A 3M81A 2JG3A 4RH1A 4FYKA 3UK2A 4AW9A 4LHXA 5KQPA 1FX1A 3P2IA 4HLNA 2H2AA 3BHJA 1CR4A 1I8TA 2WP0A 1W19A 2ZDHA 2BFEA 2E5LB 4LVNA 5KOHB 1PP4A 2B2NA 2HU7A 4O2AA 4TMTA 3FTQA 4BE7B 1MNAA 2CMGA 1XZAA 3OQBA 4LVOA 5ERYA 2OEPA 2PXCA 4K9RA 3TFOA 5HX7A 2IV7A 4I50F 4HX9A 1CHDA 3GLHE 3U17A 2UZ3A 3WGTA 4L7VA 1WUHS 3X1XA 3LPAA 4BFUA 2PBRA 2JCGA 3RUCA 5SZKB 4M8IA 3WKEA 2XMBA 2QN3A 2P77A 1FTNA 4WOCA 4KPUA 4XAQA 3I0ZA 5FJIA 5EXTA 1YR7A 2JIDA 3FR7A 4M88A 1WXGA 4YRZA 4YJHB 3D8TA 1C7JA 4KYUA 2P30A 2NXEA 4YJ3F 5HS4A 1PJ3A 3JR3A 1ZU5A 3NR2A 5IK2A 3DNFA 1ID1A 3EA5A 1E94E 4FCWA 4NMXB 3NYRA 3LOUA 3KL2A 1WX1A 3IJRA 1QIHA 1FZQA 3LUKA 1HZZA 1XLTC 2VKTA 4JSYA 3RASA 1Y7IA 2YJZA 4D9JA 3HSKA 4BN4A 1M3SA 2PXXA 4ICIA 1CP3A 4OV6B 4TT3A 1Q74A 4QYIB 5T64A 4TYWA 2D1SA 1WDTA 3KUKA 1A2QA 4HRVA 5DBOA 5LNK1 4GEKA 1NQWA 1XPJA 5DYYA 3S99A 1P61B 1E1CB 2BFDB 1U0TA 3RFXA 1M33A 5E3HA 2X4GA 3A06A 3JVVA 3N2EA 1GDHA 4ZMSA 4A7PA 4UKDA 3AFGA 1ZVJA 4GC9A 2UXCB 1A8PA 1L5VA 1RRMA 2FYTA 1MDFA 1MC1A 2J9RA 2QE7D 1XFDA 3IHTA 4OBBA 3TIXB 4BMSA 5LBTA 2X8JB 3LHSA 4BLVA 1GU0A 3K05A 1Z4PX 3ABOB 4GMFA 1I4EB 2CXRA 5L4NA 1AD2A 2FZVA 2OCKA 2P0YA 4TS4A 4Y67A 5EIHA 4AMZA 4MQEB 1OHHD 2QRZA 2RGYA 3RVKA 2BY4A 3CHYA 4UU1A 1OFTA 2RAVA 1QPZA 1W2WB 4DRXB 4U8HA 4CR7A 3MWFA 4TRMA 5ANRB 3FJYA 1QK4A 2Q49A 4P3YA 4TYMA 1WQ3A 2C3OA 5LN1A 1DRUA 1UODA 2JI6A 3TGWA 1C1DB 2WWVD 1TUBA 1TMYA 4EY8A 5KKCA 3H9BA 3OC0A 2A88A 3OZSA 3VJLA 1NUUA 2Z57A 2A0XA 1P31A 3PYXA 1E3MA 3LD9A 2D5CA 4IIJF 1P4GA 1XTIA 3HU3A 2Q5OA 2Y0DA 4BO9A 1J07A 5DEIA 1VE7A 5HS6A 2R7LA 3ZTTA 1DJQA 2A9FA 3VAZA 4RZ3A 1ONPA 1SQFA 1Y1SA 4RV9A 3S1AB 5BORA 1CEXA 5K0ZA 4F4HA 1V25A 2VRCD 3CZ5A 3Q6MA 2QD3A 2R7MA 2Z0MA 2OYCA 3RAGA 4EY5A 1Y1PA 1QF7A 1U9JA 1ZJ4A 3JS5A 4JGBA 4O2BF 3KQSA 1IY8A 4Z2YA 3IBSA 4PQGA 1YJAA 4ONEA 4KZKA 3AM1A 3CPEA 4INAA 4R8LA 3TUIC 4LZJA 1IHDA 3R5SA 1CUUA 1I2MA 1Z36A 1H1TA 3BUSA 4U7JA 4ZVKA 2ANCA 2YV1A 3N8GA 4D7AA 4EF4A 3L04A 4ESVA 4EH1A 4OYHA 4EG5A 3E70C 4Y1FA 2XMPA 3BZWA 2QROA 1W47A 1PFKA 3EGEA 2EBFX 3QWBA 3QW4B 1C80A 4TXMA 9GPBA 3F6SA 1DXYA 4TV8F 3K9WA 3N07A 4GKBA 4Q3EA 3SZGA 3T7TA 1RMQA 4EFMA 3LV8A 2VYVD 4EHBA 4G0ZA 4HDOB 2EP8A 3IA2A 2FX5A 5LUAA 1O96B 1FFGA 4MKHA 2BUAA 3AVQA 1A04A 3JY6A 4M9SA 4R1QA 2IT1A 3OY2A 4LE0A 4TT8A 4X90A 4R8RA 4GKKB 2Q3JA 4EATA 4JVOA 5KI6A 3KLBA 1A9OA 4CN9A 4V0SA 3ENNA 1JDBB 4EG4A 2FPLA 2IP1A 4L15A 1V6SA 4N48A 4GBJA 4CDGA 3GA7A 2OGWA 2HF9A 4UTRA 2RGWA 4YGYA 1ZHHA 1HDZA 3KZKA 2NPIA 1T6YA 1Z3IX 3FCOA 2C5BA 3KHTA 3NKFA 2R86A 4N3GA 1ES9A 5HKLA 1CJUC 2EZ8A 5C46F 3H6GA 5FBRB 1ECBA 2RHMA 2WG2A 3HN2A 4BAGA 4JL5A 1Z5WA 1C7FA 2ICAA 2PWBA 5C31A 2BZSA 3PNYA 7REQB 3OIUA 2P9GA 1PGQA 2QMHA 2OMKA 1C9NA 5I9BA 3RUDA 1YR2A 5ITVA 3A26A 4OM8A 4YJKA 3TLGB 1JT9A 4LXTA 1QB8A 3FCEA 2YZKA 1TLLA 3D7MA 5A3SA 4NATA 4PBTA 1YZFA 2YZGA 1A72A 5JR3A 4Y1EA 2A9QA 3LCJA 3C3YA 4P4TA 3SJBA 1SEVA 3ZHTA 5C51B 4K0KB 5HIIA 1CCWA 1I4TD 1J22A 2QRNA 3SOPA 2Q9BA 4Z7OB 2VSXA 5HSGA 2IHNA 5K3OA 1BVHA 4P86A 1W5FA 1YJ5A 3OP1A 4UUQA 4IJQA 1GAWA 2WIKA 1RTTA 1B14A 2FDCA 2GNPA 1W44A 3HVJA 4HQ6A 4IHJA 5KVQA 3P5BA 4H7HA 1OCEA 3PNSA 4KMMA 2OZVA 1MAWA 2H85A 2VF8A 3L0OA 3NTOA 5KINB 1LSUA 2IYEA 3I37X 3B8EA 3JATB 4JOBA 2F8LA 4ND8B 3EGXA 2IELA 2WZCA 2P6RA 2Q3HA 4DQ0A 1MA0A 2OQRA 1R9MA 2VA9A 1THGA 1Y8CA 2Z98A 3MCWA 4KXUA 2C03A 4X61A 5FYQA 4Q1DA 4H0FA 5IC6A 3L8CA 3ENZA 3VSAA 5DVZA 3QEJA 5T6BA 5DTEA 1HK7A 4ZPXA 1YQ9A 2QN1A 2QTAA 4PSKA 1UPFA 1XCMA 4O4LF 1DV1A 4XEUA 4GVXA 2Z2JA 4M89A 4Q3LA 3R7SA 3LLVA 4F3TA 4CCWA 1ZITA 1NJ1A 2H59A 2ETVA 1U0NA 2Q5LA 2VR1A 1N1GA 3W5HA 3OT1A 4FQ7A 1EIZA 1GL7A 1Q95A 2EKQA 2ISQA 2V6JA 1EAMA 3K0FA 4EG3A 5B6PA 3BIXA 3GJ5A 4QOJA 3PNVA 4YRRA 2G09A 4TTVA 3X2SA 1L9KA 1I3NA 1I2DA 3CX3A 5B30A 1FLVA 1NRJB 1JHAA 2WMDA 2F17A 2WU8A 2FZCA 1D4OA 1DVRA 1H69A 4WPGA 5BN3A 3IPYA 2HIAA 3L4JA 1GR1A 3C5WP 4DTCA 5IJXA 2C2YA 4HQNA 3WAKA 4BDTA 5IAOA 5U9CA 2V1UA 1TJPB 2RC6A 4MQFB 4PGFA 4TPKA 2O3SA 3FHTA 1ZNZA 4DWOA 2ZIFA 2ZQZA 4CLRB 5TARA 3TTVA 1FLNA 5CDYA 1N0UA 4L5IA 1PUXA 3OE7D 4TROA 2DLDA 13PKA 1RXVA 4MRPA 2G0TA 2F3QA 4RANA 3HXOA 1F8UA 1FU7A 3VOAA 5CW2A 5B7NA 4OP2A 2IFTA 5FR2A 4UCFA 1IUOA 3LX6A 4GG1A 2I6FA 3GVPA 4Z9AA 1DX6A 3DGFC 4CODB 1J8VA 3R7NA 1RAIA 4XM2A 5A4IS 3ZDQA 4AD8A 2VDVE 3KJFA 2OD9A 2PV0A 2R8ZA 4L3WA 1ND6A 1NW8A 3T4XA 3W5IA 1B8VA 4ZXFA 3DL4A 3CLVA 3O1HB 2OAQ1 2CMFA 3BULA 4C04A 1HYEA 5TT1A 4V1CA 5LOVF 4RDIA 4LFAB 2L18A 2GETA 3C3JA 5TEVA 4I50B 2Q5EA 2JA2A 2OECA 1WZEA 1IZ9A 3WYDA 1TECE 2YOHA 5ESXA 3AR5A 3SIWA 3RD5A 2VL7A 2Z8ZA 4QUKA 1RQ2A 3PITA 1DBWA 3N53A 3PICA 1XLTA 1WRBA 3L9WA 4RMJA 3TOVA 4E3WA 2WMNB 1VLVA 1KI6A 1AMUA 1J1UA 3RABA 5KIAA 1DIHA 1ZY2A 2CN1A 3LKBA 1YQQA 1PZMA 5F51A 4XIYA 3VVCA 1ZI9A 2F59A 3PRYA 4NJEA 1EM6A 1DOZA 3II6X 4HX5A 4P31A 3U37A 3I6QA 2EX0A 3O4VA 2NMVA 5KUTA 1YE3A 2H48A 2HD4A 1UJNA 2G1UA 2XD9A 2BBTA 3AUJB 3DTVA 3PDCA 4GI3A 4WK4B 5F64A 5A5GA 3C5EA 1YQTA 5IHPA 1KI9A 2JKZA 1J4AA 1NW5A 2FOXA 1PQ4A 4E09A 4Y6OA 4DJDC 3TSOA 5FTJA 4RYDA 2J09A 3O8BA 2P1RA 3LFUA 5IKEA 3UMMA 4D9GA 1KMMA 5K0CA 1M1NA 1N6HA 1WW8A 1WV1A 3HU1A 3LI2A 1IOZA 1NULA 4QT4A 2RHRA 4L9AA 5IANA 3D6AA 3GV0A 4ABTA 3Q8MA 1R64A 1RHQA 3C0KA 3PC4A 1GWNA 1OW3B 1UZUA 4IDBA 5JYCA 1X8JA 2FWJA 3R7DA 3V33A 2YKGA 1GEGA 2ZS7A 1BJTA 2JBAA 4OM7A 2DWPA 2GH1A 1MV5A 1HETA 2VP5A 4KACA 3ICOA 1CS0A 2GEUA 3BILA 5IUKC 4M99A 4GZLA 4DCPA 5C7OO 3K6RA 3SWWA 3T3GA 2B25A 1GA1A 4KVAA 3IPXA 4MWTA 3ZV4A 2BTEA 1EPUA 1ISMA 2JFVA 4X94A 5FD8A 4LJRA 4MJ3A 3PGJA 1ACJA 3CW2A 3KOYA 4CLHA 1UOOA 3NHRA 4FN4A 2CDBA 5JYEA 5BR8B 2BEUA 2ZJYA 3IMKA 3TQCA 3D2CA 3R0XA 3RVOA 4X5OA 3BRWA 4CW7A 1WLSA 2NGRA 1IULA 2YJ3A 1AZTA 2NZJA 1XK7A 1XCGB 3GWGA 3QP9A 3KYDA 3D64A 4ER6A 4YLGA 4BCDA 2ANBA 1O6ZA 2WU3A 4V1CI 1C1XB 1OZAA 1QCDA 4AP9A 1SHUX 2JIRA 5AW6A 2XF2A 2EZUA 2C2WA 4IIJB 4Q24A 3SXUA 2TYSB 3B12A 1R1DA 1TT7A 2AOXA 3H5LA 3K1ZA 1U6IA 5KAPA 3ZLTA 3QVTA 4O5AA 3D5QA 5BW6B 5KC9A 1EB9A 1I0IA 2ZYWX 1I5EA 2GN8A 1J2TA 2WNHA 2I6QA 4B31A 4EMBA 2QP4A 2WM9B 3PLNA 1DCKA 2L42A 2CL0X 2QL6A 1OFGA 1UKCA 5AVRA 2FLKA 5B4VA 3TZQA 1PEKE 1XTSA 3DKIA 1HL7A 4GQAA 2Y92A 3KQUA 1N34B 4FB5A 3A9TA 2J46A 3RS2A 3ZHOA 1ZRHA 2PHZA 4IYRA 1J2EA 5L53A 4NDNE 1JEEA 5BV7A 1RT9A 4QELA 4EVIA 5IK2D 3A6KA 3FSJX 2ODEA 1Z0SA 4C7OA 4PX2A 4YX9A 2YVQA 2QNRA 4TV8B 2QNBA 2Z9DA 2HF2A 1QH8A 1V7CA 1VLJA 1A88A 3O2JA 4ETIA 3EGDA 3DFZA 1KDPA 4FINA 1E2MA 4KUGA 4LOLA 4LXIA 4B40A 2XE7A 2AKAB 1S8AA 4KVFA 2EG5A 5TQ2A 2P6UA 4JB8A 1J97A 1NF2A 1Q1GA 1QRAA 4TT3D 3M6LA 4HHEA 4MDYA 1YDGA 3WMFA 5IDVA 3ZV3A 1L4GA 4RXMA 1WG8A 1GAQA 2A67A 1WCXA 2XQKA 3K5WA 3TOSA 1OYWA 1UM9B 3HFRA 3ENQA 5AKEA 3UMBA 1RZRA 3R74A 3F7TA 5KO2A 3EIFA 1GFZA 2WSBA 4WLNA 2B5OA 1RPJA 3FWZA 2YOGA 3E15A 1Y4DE 4G9EA 1KC1A 2A1IA 4YRLA 1OLSA 3C3KA 1TVCA 1ORRA 3NCHA 3R23A 3ZVRA 4BVFA 2XX3A 2H4XA 3MTGA 4Q9NA 1SNYA 4A2QA 1RJ9B 2O05A 1NVBA 1PK8A 3CUKA 3NT2A 3SMVA 2FHSA 4KH1A 5IM5A 4L5CA 4MWCA 1PE0A 2Q6VA 2PL1A 2C7RA 3OU2A 1YZHA 1VJTA 2IS4A 3NJ8A 5CB6A 1NUTA 1U3TA 3WWEA 3NIFB 4X1KA 1QDEA 1Z2DA 4K40A 3V42A 2VFAA 2PZAA 1KBZA 2P7IA 3M3PA 4OSPA 4WNYA 1V9LA 1U8UA 5BURA 4EUHA 5H68A 3MWDB 4JR2A 3MD9A 5HJ2A 3VOTA 3FRJA 3ZCVA 5J2UA 4RW0A 2XMCA 3PEWA 2G9VA 1K75A 1KHHA 3CN9A 4L0MA 5FORA 1O5IA 3SX4A 3GDOA 1Y81A 3CLUD 2H29A 2VUUA 4X85A 3RLFA 2VC2B 2GWRA 5IU6A 1FTYA 1SIUA 3IRVA 1F20A 2ZE8A 3LZCA 4IOJA 2YTZA 4L4XA 4DDTA 3B3GA 2VJAA 5ARBA 1AUPA 2VP9A 2EEPA 2OVFA 1SVMA 4DSAA 1MN6A 3A1DA 4R9NA 3NBQA 4H18A 5JRDS 5KPDA 5EIXA 2ZTMA 2WE7A 4DMKA 2DRIA 1JPUA 2QQGA 3AK4A 3UIEA 3VNVA 3TMAA 2EIXA 2FN8A 3DB2A 4KQFA 5F9HA 5J59A 1L7RA 2WFLA 1J25A 1YR8A 1RTKA 3E1KA 3P9PA 5JISA 4TV9A 4YT8A 4DLZA 1XA3A 2FFJA 1JHDA 1EG7A 3HRHA 4O4LB 3MS7A 4MS4B 2PPVA 4AMYA 4AX8A 3KJZA 3NOXA 4JFRA 2A1UA 2G88A 4K6GA 4NHEA 3TR5A 1NI5A 3AJAA 3CZPA 4URUR 3AUSA 3HWWA 1E5VA 1NY5A 1Q1ZA 3QH4A 4MYRA 1CPYA 1U4SA 1LLCA 2CXNA 2QM3A 3A6JA 2X0EA 3D5EA 5AM2A 3HKEB 4RSRA 5H4GA 2QL5A 2X3YA 4ND5A 2VTDA 4M0KA 3LAWA 1ODLA 3PCTA 4FEYA 4QULA 3M3DA 4JLMA 4GIBA 4PZ0A 3NP7A 4J6FA 3QW2A 2QVYX 3SC2B 1KIAA 1XLVA 1YRWA 3ZHSA 2C59A 1YS9A 4RK1A 2YQ4A 5ELLA 4I1SA 1CEEA 4D41A 4AX4A 2XQVA 3BICA 3CURA 4G1MB 2XE6A 3GBSA 5I5EA 3V48A 3T3IA 4L0QA 1A4UA 5F35A 3D81A 4WZ6A 2ZKIA 4CM5A 1KPGA 2PH3A 3G2QA 4FQ8A 1Z62A 1BQ3A 4J16C 4OFXA 4JXXA 1PKXA 2WF8A 4WK6A 2IXAA 3AINA 1XDDA 2PAFA 1PZGA 8LDHA 5AJWA 4B46A 5A4FS 2V6GA 4DMLA 2J6HA 2MYPA 4MXDA 4B6RA 5DISB 2VXYA 1QIEA 3O7MA 4O0LA 4P35A 3TTYA 3H83A 4B2YA 1RJDA 3RUFA 1J0AA 5L4SA 2BEWA 3DO8A 1DDIA 2JHFA 3GZNB 2PQ0A 3LBHA 4WLOA 3V46A 4LE2A 5K6AC 1V11A 2GM5A 3IT1A 5AHKA 5LOVB 2IS1A 3OHPA 3L82B 1R18A 2OYSA 2P9CA 4ARAA 4QJIA 4ETNA 2HTFA 2FNAA 2N3ZA 3ASYA 2QNIA 4OYYA 4KUEA 3ZHCA 2FDXA 5IG2A 3AVTA 3NYWA 1X2BA 1BNCA 2C7QA 4REQA 1AY0A 3GU3A 4WZZA 3NFRA 1TUEA 5AJZA 3GMTA 5DRTA 5AJYA 1USIA 1EFTA 3O91A 3OCWA 1SUFA 5G53C 4BQQA 4RL4A 3S5UA 3U31A 4BZPA 7YASA 3AVYA 1MO4A 3AHCA 3WGGA 2POQX 3CTMA 3ZQKA 2JAUA 4OF4A 1EB8A 1O2DA 4PYLA 1GTJ1 1OXBB 1G8AA 2QTZA 4KSYA 1IVYA 4FONA 2XRZA 1QC5A 3FETA 1DQPA 4ZQGA 1V1MB 2C2BA 5A5FA 3FLMA 4JVLA 2J31A 3DE1X 1E79A 2GXQA 4EGSA 2GKOA 5KX5A 2I8AA 2GEKA 1GXSA 4MR9A 3PQ8A 3FX2A 1NN0A 4YMHA 5JT1A 2PSHA 3PXEA 3WGLA 1OAAA 2P9ZA 1JEJA 2QD5A 2UUPA 2QP9X 4AULA 2HHAA 2DUMA 2RBKA 3MF4A 1J33A 2PRJA 1MG0A 1IQUA 3DOHA 2BONA 4CFZA 4R2LA 4BU0A 2I2CA 3KXDA 5GPBA 1LLFA 5CFPA 4NCNA 2EFHB 2PX4A 4W6ZA 4KN9S 2YHBA 1P72A 2B61A 4YAWA 5K3EA 2HJVA 3ZJ5A 3LP6A 4C6TA 1NL3A 1B41A 2HLNA 3R5JA 4NULA 4HF7A 1RHRA 5CNIA 3E3NA 3LBAA 4FMBB 3L02A 4Q9AA 3Q4GA 2AT1A 2R8RA 2YV3A 2R6HA 5AKJA 3V6MA 3H5WA 5JH7B 4IG9A 1Z5NA 3T99A 3EG9B 2O8BB 2OL4A 1JTVA 1XZEA 3OOSA 3BXXA 2CNBA 2GPTA 2VJYA 3CRMA 2B98A 3GNQA 4WASA 2NVWA 3BXGA 3F2IA 4HTFB 4CI0B 3HL0A 5JSUA 1EUCA 2K7ZA 4KGDA 3L6OO 2G5PA 3WSVA 1I13A 3UHOA 4Q7KA 3L92A 1OU4A 1UBCA 2E1RA 4BZWA 1P2UA 2GZDA 4ER7A 4AJNA 1FRNA 4FS3A 5IEJA 4CG0A 4IIXA 4AFNA 3GWZA 4XWTA 3OA0A 5JBIA 2IYSA 3M1AA 3RO7A 4BJ3A 3R7LA 1C9KA 1NLFA 3CWCA 1QYRA 3GLUA 2PLAA 3THYA 3AEUB 4LRYA 3FFBA 1FFCA 2AZ4A 3JSXA 4MR8B 5JNLA 2RKOA 5B1DA 1Q2XA 1R4NB 2YNMC 1DXOA 3GZTB 3P7MA 4Q0MA 8ADHA 4TKVA 5EIFA 3ZJYA 1T24A 1IMOA 2JI9A 1PHPA 3BKWA 2JW5A 1FYDA 3DAHA 4LYYA 5CMLA 3RVRA 5L4LA 2VHXA 1OE0A 3SNKA 1NI4A 1IN7A 3MJTA 1F1JA 1ZUNA 2OZLA 1SXJC 4QYWA 3FMOB 5G3YA 4RTLA 4B75A 2IUTA 1EDEA 3AXSA 4B73A 4OKNA 4KAAA 2WM8A 1U65A 3DTVD 3D4NA 3GLKA 1S5PA 4HS9A 4WAUA 5DX8A 1QTNA 1SGWA 4QJ4A 3W6OA 1BCRB 1EA5A 1NT2A 1VMAA 5L6MB 2VYCA 1BVRA 4Q9HA 4UE6A 4QARA 4LKRA 4C76A 3RODA 4YB8A 4CEIB 4CLDA 1LI4A 5JTUA 1XRQA 3A8TA 4LJ4A 2ZR8A 4OQNA 4BGEA 4X6YA 3N7UA 1MW9X 2GZ3A 1DC3A 3ADPA 3GRZA 2ISCA 4ZDIA 1NT4A 3L0ZA 1P75A 1N2XA 3JARA 3OVMA 5KQLA 1M2GA 4F96A 1SHTX 5GAJA 1FSSA 1DG3A 4F06A 4BWVA 2LR0A 4L8WB 4MRVA 3GFFA 1AHNA 2QSUA 4NOLA 3N8IA 3ZV7A 2R97A 2VBCA 5A2GA 1SBNE 4MA0A 1ZUHA 4EA7A 2YH2A 4HLCA 3VI3B 4YV0A 4AJJA 5KQGA 2BKVA 5ADHA 4PRLA 4TXNA 4YJFB 3CWZA 3JZAA 3PFNA 1MABB 4KK4A 3ZGYA 4EENA 2JJ1A 1T8TA 2AMFA 1VP9A 2Y6UA 3L4EA 2HNBA 2X40A 3DBOB 2Z58A 2O59A 2LE0A 3MTAA 3A3PA 3KUDA 3SFTA 1LV8A 3FWYA 3U62A 3OJEA 4D0RA 4HXEB 3INNA 1WUYA 4P0QB 1EE9A 2WUVA 4TMWA 1NFRA 3O8NA 1DO0A 5LB2A 4C5CA 1GNPA 2PGAA 3EIEA 3QU2A 5ECDA 3ZN2A 2ON6A 4J76A 1VA4A 3WA7A 3EDQA 2X76A 5D51S 5DGIA 2PMKA 3CRZA 1UOQA 5E6RA 4HEHA 3BB4A 4QYSA 2GBGA 1AJEA 3U0BA 1GV0A 1JBKA 1U0OC 3TW4A 5CM8B 2Z95A 3TXYA 1E59A 1PG5A 3TTSA 4HQ0A 1ZICA 3ZZUA 4NZZA 1SULA 1YOVA 2CLIB 4GYWA 2WVGA 1E2FA 1E58A 2HGSA 2X0FA 1U5AA 2GAJA 2X0IA 2OV6A 3N2KA 3ESYA 3TJRA 3SJAA 3GG9A 1GFIA 3DMFA 3P96A 5DBGA 1KQGA 5L3QA 1SXGA 4E3ZA 3JVUA 2QG9A 5ECYA 2JLUA 3HUFA 3W06A 3ZLVA 2TS1A 1KVSA 3IBGA 3N59A 4XTRA 1GGNA 4F11A 1K2VN 1QGDA 4ARBA 3LGSA 2ZAGA 4P7BA 4QQNA 4RJTA 2DEUA 1AHHA 1Q0ZA 1V37A 5F1OA 4MEAA 2GBPA 4WLUA 3IQFA 1YR6A 2BLLA 2V6FA 4NBLA 2R8XA 4AAYA 2LD4A 4BWYA 4H4EA 4FDAA 1Z0AA 3IHKA 3IIKA 3LL4A 1ZIXA 1LFDB 2H51A 3TR6A 5AIBA 2ZSFA 1HPLA 4J3JA 3FNHA 1GQQA 4J16A 1AS2A 4MW2A 4RSMA 1QQ5A 3V4VB 5KNDA 1NDQA 2OWDA 5K3AA 4DRZA 2J4FA 2VPZA 1OH7A 4OXQA 3ZNNA 1EDDA 5I51A 3AYXB 3I64A 5ALMA 1IQRA 3SQNA 5L40A 4L5JA 1GG8A 3KXKA 3ZE2B 1P2VA 1M6NA 1RZRD 4BNUA 1E1KA 4D79A 1PEYA 3AETB 3RJ5A 4RL6A 1YD7A 2R6JA 3ZNQA 4WNCA 2Q7OE 4CMAA 3ACCA 2OUIA 1IY0A 1PJZA 3IV6A 5AHXA 1LPOA 5K6AA 1UEXC 3ZCUA 3H9UA 2JFPA 1LZLA 5TQ0A 5KZMB 4AY2A 4GSYA 4A0GA 4NVRA 4BFWA 2BGLA 4QJ3A 3VYTB 4NJMB 2C07A 3V9PA 4RPCA 1AKEA 2QN6A 4MEBA 2O0HA 2Z56A 4JLWA 5A9TA 1K8ZB 2RC5A 2CL5A 4HDNA 1V5WA 2ST1A 4ZKDA 1ZD9A 2ID4A 1ACMA 1BVYF 2BKXA 2ZIUB 3GFRA 2VJQA 5DMHA 2FG7C 1JB1A 1XEXB 2CJWB 4WRRA 2MCFA 5A6SA 4JB0A 5E4JA 3GUZA 5HGXA 3EFOA 2H1WA 3QM1A 4EW2A 4JODA 1L7XA 1OSNA 1IXKA 4IO0A 4JT9A 1WXDA 3ZJ4A 1N2GA 3G1TA 2HO5A 4TMVA 4LC9A 1H9BA 2Q9CA 3KJHA 2G6BA 1W94A 3N8NA 3T61A 2P1ZA 3O8LA 4IJUA 5FH9A 2JDID 1MXFA 5LYJA 3TLAA 1D09A 4C4RA 4R9UC 4YXFA 3DM9B 3OF3A 4NZMA 4YFVA 5FWXB 5A4JA 4Z99A 1O9HA 1Q0SA 1AGPA 2BSAA 2PS1A 4IFIA 4TZKA 5DX0A 3SKYA 4R1SA 1PTKA 4OQLA 4HD8A 4MVWA 3BF7A 1SKYB 3RK4A 1VP3A 4HH4A 3T3OA 4WL0A 1JU3A 5CP8A 1F48A 3BA6A 2PUWA 1M34A 4L7QA 4O1MA 4QC2A 4FOSA 1MO5A 2BHLA 3IRUA 3ZWMA 2I9KA 1SRRA 3HCCA 5C9ZA 1JLSA 4B8ZA 4DPMA 4MUMA 2XDQA 3GJRA 3NHFA 4P0TA 4AL4A 4YBRA 3CNEA 1ZN8A 3K09C 4PWZA 4Q1FA 5AOBA 3GN1A 1UFQA 4BEJA 4DJEC 1E2JA 1I5RA 2YVLA 2OFFA 1T5BA 2JLYA 4DUGA 4MYDA 1NZJA 3PFCA 4RK4A 2MT9A 4W1QA 1M7HA 4B2LA 4LGCA 5EA2A 3BIOA 2WSYB 4DADA 1WV0A 3LQRA 1CLUA 2XEDA 2X15A 3UJNA 3WGHA 4HQKA 4D1YA 1TIBA 1Y6FA 2IS6A 2ZQYA 3K9QO 1Q1NA 5IUJC 3A6PC 1WHSB 4I14A 3LSTA 1V95A 5HWSA 4DWVA 3UV7A 2WF5A 3E5MA 1NVAA 2Q6OA 1NVEA 1GGVA 4YJDA 4IDAA 5KTPA 5JCJD 4LNUB 4JQCA 5KVSA 3HCAA 3HKDA 1F8FA 1IZ0A 1HURA 3JD2A 4WY5A 2XGOA 1IZ8A 4XGIA 4YMSA 3O38A 5DJ5A 2OKCA 3WSWA 4RGBA 1LDBA 1Y7PA 2GRAA 3DUFB 5MFPA 1ZQ9A 3LT0A 2FN7A 1S01A 4P98A 3UJ3X 4CRWB 2XXAA 4JC4A 3TQTA 1DKRA 1I2ZA 4LXXA 4DQLA 4B3BA 4IDNA 1DP4A 1SCAA 2VH5R 1L5ZA 4UM5A 1FMJA 1QVZA 3G5AA 2PS9A 5K4AA 3N0VA 4PYIA 3GP3A 2YNMA 5EJEA 1T4MA 2C77A 2EW8A 2NPOA 4RPKA 2B3DA 3DEKA 1QQAA 3RIXA 2GCEA 1C81A 2G9UA 3OKFA 5CT9A 1S3SA 2AL7A 2A35A 4KRXA 1ZM9A 1XEWY 4D82A 4JGGA 1N8NA 2EZ9A 3I76A 1JKJA 3ZUGA 1IMJA 4B6EA 5BSEA 5CG1A 3BD7A 4MX8A 3WGUA 3ZDXB 4EHLA 3LOPA 1C5KA 1IZYA 5JSKA 1BRTA 3WB0A 4B8YA 1KZ1A 4HH3C 4ZO9A 5HG0A 1W2GA 5FYDA 1QFSA 4RTMA 2X58A 3RSZA 1ZVQA 1AKTA 2FPXA 5CYGA 4L74A 2KSQA 1Q17A 3QUSA 1E3JA 1SVWA 2SKEA 5LP6F 2P40A 3AU8A 2G70A 1Z88A 5E2IA 1A7UA 4Q4JA 3TZ6A 2D2FA 1ZBQA 2R0QC 5K4HA 4IR7A 1CZHA 3ORSA 1XD9A 3VZPA 3ICVA 3AW8A 3E22B 4QO7A 3ZQ6A 5JZ9A 3ZC3A 1PKEA 4UHDA 1AOXA 2E2WA 4UM9D 3GT3A 5DHQA 4YCJA 2I7TA 3PIRA 5I4KA 4MVJG 4JXKA 1O8BA 2QZJA 3HHEA 3I9KA 2HJSA 5HP4A 3PJEA 1J23A 1RQ7A 3GEGA 4F6RB 1GNQA 3EAQA 2R6ZA 3K96A 5AOVA 5LJIA 2AC4A 3AUKA 4ZK6A 3P0FA 3TVDA 1JF8A 2CEKA 4FHGA 4X62B 4P5PA 1COWA 2P2YA 4YS6A 3KXLA 1CUIA 3H8JA 4U2KA 5C7YA 3BWVA 4UAVA 2QG4A 4B3MB 5DLYA 5EMNA 3CQ9A 1CEQA 4G0NA 4LK2A 1FXUA 2FW9A 2OKGA 3JQ7B 3UG6A 4DUYB 4YRAA 4QRHA 1RCFA 2AOVA 1XMSA 2WM2A 1MX3A 2FI1A 3HFSA 1PFYA 4UHCA 2W9XA 1H05A 1GTMA 4HG2A 4X93A 2WPNA 1ULAA 1BTOA 4CIBA 5CIYA 3AF0A 1QIJA 3G9XA 2JLBA 3H1TA 1FEZA 3D0QA 3DKVA 3UBMA 4JBYA 3OKPA 3JZMA 4GX1A 1X7HA 5BWLA 1N77A 4OJTA 1VIYA 6CHYA 2V3CC 2AE1A 3E1SA 4K3VA 5B3AA 4P4SB 1MJFA 2NZUG 3ORHA 5MN4A 5A04A 4BEVA 3BD8A 1SPBS 1ML4A 4R68A 1I10A 2E4VA 3I8OA 4I4TF 4DIEA 5I01A 3L6UA 4NWIA 2BHNA 1YRLA 3T1NA 1HL3A 1NWCA 3SYLA 1Y3IA 1YF3A 3T4PA 3FJOA 4YVFA 1O4WA 3Q2IA 3VTKA 1PCXA 1U3VA 1CEYA 1YR3A 2Y99A 3L7OA 1J2UA 3NAMA 3L1KA 3HC7A 1ZEMA 2BCGY 4E5UA 1WETA 2QQEA 4E7OA 3G8DA 1D03A 1T4CA 1XMVA 1Y9AA 3C6MA 3LY9A 4GYKA 3GJ8A 4B3IA 1YAJA 3WYGA 4IQ4A 1ATIA 3GR6A 4H3SA 4U39A 4YCSA 2YC2C 1UDWA 1UMBA 3AP3A 1VZ2A 2GQ0A 1T0JB 1VKRA 2EWWA 2I2XB 2ZDGA 3A37A 3UMRA 1H1LB 4EB3A 1CUXA 2CFIA 3Q87B 3UKDA 5E9QA 4GM4A 2H0RA 2YX1A 1WVMA 1QONA 2CNOA 2X9GA 1WO8A 3D5TA 1DG9A 4BNWA 4BOYA 2RCYA 2XCLA 3G49A 4XFDA 4F45A 5A7HA 1SQ5A 2YINC 5H02A 3GEMA 5CNMA 4OMFG 3OPNA 1FP4A 2JVIA 3DEIA 4A82A 3HUUA 1DJLA 3DLBA 1ZGZA 4S1PA 2ZRGA 3FDJA 4IOKA 5TJHA 1FXWF 1NE7A 1RI5A 2E4WA 2QV0A 4PFSA 2GBFA 4D92A 4GXRA 4JV5B 1J5XA 3CUVA 4G4SP 4IJMA 5ALOA 2ECOA 4G0VA 3FHLA 3CJTA 3NIDB 3GUCA 2B7BA 4ZIRA 4RTSA 3NNSA 2HMSA 1KYZA 3TVTA 1WMFA 2P9TA 2PKQP 2YRWA 4CGYA 3RF7A 3G5MA 3EQ7A 1QYXA 2ECPA 2B1QA 1MU0A 4DW8A 1VG9B 4DJTA 4ZVRA 2TSYB 4JHLA 2WVAA 2X8BA 2K7FA 5B58T 2OXTA 1FUUA 2CFSA 3Q41A 4YLYA 3U1TA 1UFKA 1OD6A 2WB4A 1WUKS 4YRFA 3AZPA 2WJ6A 2EZ4A 4HDSA 2XE4A 3HLKA 4EVSA 1TD1A 4LYAA 2AQKA 3ZZNA 2PMBA 3MS2A 3IKLA 3KUCA 1YXMA 4RIHA 1GLGA 2YXEA 1S1CA 4LV6A 4QTTB 2C00A 5F5NA 1D8TA 5CA1A 2DLNA 3HKBB 2Y4OA 4ISBA 4MHOA 1UM8A 1WNTA 1RP7A 1V3QE 2AA3A 3LECA 2DQYA 4GZ5A 5HDBB 4DF3A 1FQKA 3MERA 4LZNA 4D74A 2NQ8A 5BW4A 3QKSB 2HT6A 3B6JA 4CFYA 1CUFA 2ZYGA 3HBLA 1NBWB 3ASVA 3R6GA 4MUKA 2ZM5A 3IE1A 2AXEA 2I03A 3C7AA 3NCTA 4LA4A 5DTMA 1NYRA 3K09A 4GGOA 1HLPA 2CFOA 1C8BA 1HEYA 2OHIA 3MD0A 4HRXA 1CR1A 2QN2A 4UCWA 1N78A 3FLBA 1L8XA 3OZFA 2ERCA 1HUQA 3CX8A 3ZU2A 3AIKA 3KOUA 2ZT6A 4OXIA 1OZ0A 2PQ2A 2VDNB 2HCRA 4HNQA 4JI2B 4FFBA 2GM3A 4UBOA 4PXYA 3KSUA 2PQ6A 3U4CA 1G9SA 1EFVA 3DYVA 3G02A 3G9TA 3G0OA 2WHRA 3I4FA 5CA0B 3BAZA 3QHAA 1K2WA 1NOIA 1W30A 2FDRA 1JDJA 4IFBA 2I2FA 3PZBA 4FPXA 4NYIR 4RQTA 2OCBA 3AVUA 1PR2A 1S0UA 2D4AA 2IL1A 3A6EA 3HZRA 4FYIA 4OKIA 1BE1A 3D43A 2VRBA 1XQ1A 2QGNA 1JQAA 5KNDD 4LCBA 4URWR 4LF9B 4E4YA 1PV1A 4CCYA 2C3PA 1ICIA 3QVUA 4ZI7B 1JJFA 4BRUA 4YCAA 3N05A 2E4XA 4XOUA 2E48A 3EUWA 3NJ4A 3QMWA 1G2OA 1U7UA 3VHRA 1KVUA 3RYIA 3RG8A 3TSZA 4ESHA 4BHTA 1CC1S 2P4QA 5DLEA 2Z5FA 3GVHA 2YXNA 5F7XA 3NHMA 1A71A 3A9RA 3IQXA 4NE2A 5JAZA 1X1QA 1B8NA 3FPBA 3HO8A 4M7RA 3DHVA 4PR0A 3DVAA 3M3HA 1G7CA 4MP3A 2CW5A 1D9XA 2GJAA 1HQDA 1JHMA 1CQJA 1XJQA 1BJRE 2PRIA 5B57C 6ADHA 3ZWAA 4HNAA 1YRBA 5BN5B 4LHWA 2ZOSA 2J9FB 3LUGA 4GE0A 4FMPA 1LNQA 1TL7C 3IEKA 3ZXIA 1QYCA 2A2ZA 2WIJA 2ZUUA 1Z07A 3D4BA 1JIIA 1ODKA 3EZ2A 4OHVA 4O2LA 9LDBA 2HLPA 1FDSA 1DKNA 1RYYA 1CY4A 1EM8B 1S7CA 2HA0A 1D0VA 2NYAA 2VHUA 3KFVA 3NV9A 4KX5A 4EDHA 2CFCA 5COAA 5INTA 1JIQA 2OHXA 5KNBD 4Z3OA 1SKYE 2O5CA 1UP4A 1DLIA 1QRSA 2DTDA 4UDOA 9LDTA 4RXTA 4C5AA 1A5BB 2RGXA 3LCCA 3FNRA 2JLWA 4GWKA 3OZXA 5C4IA 2O7VA 2J6CA 2VUTA 4FI3C 1I7LA 5TE9A 5E4FA 4WN9B 4DN6A 5KYWA 3PQ6A 1UBSB 1E9EA 4Q02A 4C7MA 3WKAA 1F0NA 2R84A 1XDZA 3AILA 4BNXA 2FZ5A 3R6LA 5LP6B 1N5IA 4W4TA 4HK4A 2H1FA 3PUVA 4YJHA 2HMYB 1UR5A 1RQPA 3LK6A 4KTTE 1R4AA 1RC1A 4OH1A 1P7YA 1X94A 1BGXT 3B2NA 3R5HA 4WT7A 2CHFA 3JVEA 3RBXA 5AW3A 1QIIA 3M6UA 1Y89A 3EXFB 1PW5A 4C6SA 1SZDA 1Q0UA 2L82A 4YRSA 2BGJA 5DPMA 1D1PA 2FWPA 3IS3A 5ADWA 1XPRA 4TZ6A 2GJ8A 1BWPA 4JJKA 1H2EA 4AUEA 2CEAA 5D2CA 4D9KA 3TJZA 1QCYA 2IA5A 4AXBA 4DIBA 3A4NA 4DUGD 5JSZB 2V0CA 1GA6A 1U0GA 3IJPA 4JVNA 4QYIA 7MHTA 4JB2A 1ZPDA 1IXYA 1OX4B 2H2DA 1PNVA 3UYKA 2ZFUA 4L3VA 1SQ0A 3ORQA 4L5BA 4RD3A 3V1NA 1X7YB 1G38A 5CBPB 2BEVB 3N2LA 1QFYA 5JV5A 5D3MB 3HU5A 4QTUB 1J1IA 4M8SA 1DXQA 1TKBA 4E5NA 5CB8A 4NU8X 3RRFA 2DUJA 1TJ4A 3GRCA 4XFJA 4GL2A 1VJ1A 2QRKA 3U60B 2MSWA 2RKWA 2Y77A 4RM3A 4UD2A 2XJ4A 3HY6A 4HNSA 1ENYA 5DFAA 2RGCA 4BO4A 1XA4A 4MS3B 2AN4A 4MUHA 4BFZA 1IK6A 4XUDA 4Z8XA 2DVMA 4JKYA 3PNLA 5EAIA 4ZHSA 5HPYB 3S1SA 2V03A 2QLJA 2NVBA 2SECE 4KUHA 4MQEA 4UZEA 4E94A 4CMJA 4EGJA 2VAPA 4M9RA 5BP7A 3RC8A 4BAZA 5LQKA 4HVAA 2A9OA 4OEHA 1FS6A 3JQAB 3Q3IA 3AB8A 1KTIA 2YNMD 1LPAB 5TGTA 3ZGZA 1TOAA 2BGTA 4A3SA 1GPUA 4EL0A 4J07A 3RTDA 3B89A 1SCUB 3CXRA 1MQSA 1E20A 3EMBA 4FYJA 1M10A 3EXIB 4O4IA 3EN0A 1LW7A 5KQMA 2NAPA 4CETA 1SZCA 3WIDA 3P2EA 4AWXA 5C7LO 3LFHA 4PLGA 3ELBA 3WIBA 2FJPA 2OO3A 2PKXA 3IA7A 3NOOA 4ZVSA 4ZEMA 5HFAA 1MGPA 1TQ8A 5I7UA 1YFJA 5C52B 2J3HA 3B2QA 3BHNA 2HXSA 3OLVA 1CJMA 4ZV9A 2XA1A 1LQUA 1RXIA 5LXTF 3RSQA 4EJFA 1GT6A 3IJEB 5C1IA 3GN2A 2GCGA 2FZEA 3PPVA 4L0DA 4QAQA 1DS6A 2PUAA 2JLAA 2IX9A 4GP7A 4C88A 3ZJVA 2XBMA 1FNNA 1RPTA 2IK8A 3UKJA 1JQDA 4QUHA 3ADDA 4JBHA 3RC9A 4N0DA 1H23A 5CVJA 4M7OA 3OPVA 4B3RB 4GVPA 1U3UA 1WCIB 4QUGA 2XGSA 4N0QA 4I8XA 4AZTA 1RWNA 2FXIA 3EVAA 4YJ2A 2HCJB 4JX8A 4UNNA 3TIVA 2YWCA 5IVHA 1R4MB 4DIFA 1WQ4A 2DHCA 2DSNA 3IIEA 1O96A 1DEKA 3LDFA 1COWD 1VI6A 4QXPA 3R0ZA 1B2RA 5IAGA 4ZYTA 5KTMA 3ONNA 1IN8A 1V7QA 3DP7A 3MOGA 4B6PA 5IJ0A 3EEOA 3KS9A 3L7NA 3FFAA 2JFUA 1RQNA 3WLPA 5ICEA 4QFMA 3NM4A 3EJWA 1Q11A 3OTHA 3FNEA 3CO0S 4EK9A 3MRSA 1XV5A 4F3KA 4E2YA 1L1FA 3DBVO 1ZCAA 3PQ4A 4TWJA 4EYOA 4QLAA 2CMKA 3RTAA 2XKKA 4HSGA 2QUIA 4M98A 1L0BA 3WWPA 5LQNA 4AMGA 1W8DA 1CP2A 1L5OA 1UBMS 1GRRA 3C48A 1H0RA 3HBAA 2ASEA 4FSXA 4PC7A 4EFNA 4TZ0A 3PC2A 4LXGA 3TLGA 5BV8A 1PS8A 3HBNA 4OK3A 2QRPA 4WWHA 1M2KA 5HCNA 3M6WA 2E9SA 2XUOA 2EL9A 3R5TA 2R4TA 1Z06A 2WWTA 2FRDA 3IAEA 4Y9TA 1NVVQ 3ESBA 4LJSA 4U4AA 3IVGA 5GADl 3OWXA 2ZYDA 3FMFA 5EIAA 3B5JA 2B36A 4BUZA 2I80A 2OV2A 4GI1A 1A7KA 1QX4A 2RAPA 4R8MA 5ALJA 2OLEA 3RYTC 1WW3A 1CQIB 4DPLA 4E88A 2DR2A 3G3EA 1DBQA 3QVKA 1P8AA 3WIUA 3Q9NA 1RAFA 1A3CA 1B8PA 2P2SA 2QRVA 2PL9A 3E35A 3QA3E 4N9QA 3AEXA 2BEKA 4UTZA 5DK4A 3ZE6A 3ZBUA 1CKEA 3FDIA 4QTZA 2WD7B 1X8KA 3A4YA 5JASA 4LZAA 5K20A 1U7TA 4ZP1A 4EHHA 1M8GA 3VQTA 1RWXA 1C4KA 2WRZA 4EW6A 3QU7A 2BFCA 2W2TA 2DHQA 1X6VA 1L4NA 2VDOB 4AN4A 3BWMA 2LCIA 1WKVA 2DBZA 1R0KA 1SO8A 1QLWA 1UF9A 2AI3A 3OAAA 3AEQB 3IURA 1RNLA 1RWQA 3PA6A 5EJMA 3VNSA 4CMIB 1HF3A 1O97D 1ECGA 3FB1A 3L4SO 2WVJA 1JG3A 4GBED 3BG5A 2PL3A 2IPXA 5IKOA 4OHYA 2BKAA 1JLKA 5ILGA 1A2KC 3P2JA 2XVAA 3DDUA 1KYYA 1F2TB 3WP0A 5K3FB 1WU7A 2FN9A 2H8KA 4B3DA 3AEKB 1WD5A 4L75A 3WHIA 3WYFA 5EQDA 3AZQA 3U4GA 1EHYA 1JJAA 5F2KA 1U5BB 2Q3CA 2H5EA 4PRKA 1UT8A 2C78A 4FFDA 4BVHA 5KWEA 1EXDA 1EBBA 3EAGA 5KYKA 3HRKA 4LZWA 4JLKA 4CLRA 2A1TS 4QJBA 5IT9A 1QKJA 1I9GA 4TMXA 1KYVA 1MB0A 1PVDA 3IVCA 3F6CA 4ROSA 4ZAXA 2HSGA 2PJDA 4LXQA 2QD1A 2A9JA 3V97A 1IBRA 1OXKB 2XXJA 3HLTA 4MV0A 3GPDG 3PHJA 4KR0A 4MWGA 4OATA 3ZWKA 2QV7A 4DL9A 3IXLA 1IWPB 4I1PA 3R8FA 5C4GB 4H7DA 2QIPA 2QYTA 2RHGB 3DCJA 1AGNA 3UAZA 2AEMA 3DOIA 5CFRA 2IPAB 3ESDA 2P6OA 4HAYA 3SEFA 3U49A 2PFSA 1BDJA 3I9V1 4DNXA 1MG5A 3ER9A 3JYHA 4KLAA 3SSNA 2AMVA 4E11A 5EXSA 4JI4B 3IHWA 5K0JA 2WTMA 3VZQA 3IP9A 5DCUA 5LIPA 4JC0A 1TMOA 1WZNA 4JYCA 2X3FA 3COZA 2IKSA 1CNFA 4P7JA 4DXDA 4I50A 3EWNA 4IH1A 3SOZA 1AQJA 3AFOA 3UT5B 1XRJA 3T3PB 3SZLA 7ADHA 4GOOD 2XTJA 3EGCA 1XNJA 2CL6X 1HT1E 1RKUA 1LPPA 1UC9A 2C1XA 2G71A 3EXHB 4UBMA 2HWUA 3KJEA 4KQ6A 3SR3A 1AKWA 3FRIA 4FE7A 4P5EA 1ULBA 2ZT8A 4QHYA 3NTXA 4BFCA 5HRCA 1T13A 5EKXA 5GIPE 1LK7A 1RYFA 3AONB 3ELUA 2CXHA 4KAFA 3VU9B 3I2JA 4DCJA 2QTBA 1M1UA 1MRNA 1PFQA 3ZXSA 3BFXA 3LUDA 3TEJA 4YPOA 1T1GA 3DCIA 4YJ3A 3KYBA 3VR5H 1KVTA 5C37A 4KV9A 1VRCA 3IOMA 1JFTA 3GNLA 4I3HA 1T34A 1UEJA 2AJTA 5CXUA 4CKCB 4YT4A 1E32A 3COPA 1L1QA 1YVUA 3JQRA 5GJVC 3T38A 4BMZA 3D6UA 3K9LA 2Z08A 1DJPA 1OYOA 2AI1A 4IZHA 2JS7A 3HY4A 5BMVF 2HBZA 5FAKA 1OYYA 3HZZA 3QWAA 3SC3A 4W7IA 3K0AA 4G0PA 4C5BA 2ZUBA 1Q83A 1ZJWA 1QFMA 3JQQA 3IO3A 3CPHA 3QEAZ 3KR9A 3D3JA 2BMAA 3KOXA 2AGVA 1PNQA 2CE2X 1C1HA 1PT9A 2ARKA 3BRCA 3LQ4A 1PYOA 3MTJA 2V4UA 3P9ZA 4EB8A 4QDXA 2W8BA 4JQZA 2HT1A 1M2WA 4B34A 1B7GO 2NSLA 2G28A 1GRCA 3KZXA 2Z6QA 5I7VA 1ILEA 3W34A 2OBXA 2EWMA 2ZEJA 3KPWA 1SQSA 2ZQ5A 4KXXA 2N46A 1KGDA 2B0JA 1I4OA 3LP8A 1PS9A 1QLHA 1OBOA 4WX2B 4BKRA 2ADMA 3A9SA 4ZTZB 3A6HA 4BFYA 1Z4QA 2Y9MB 2FVXA 3VO2A 3KLNA 3WOHA 3UJ6A 2Q6TA 4NESA 5KS2A 1JE0A 1FTWA 4A15A 1ZVMA 3DBLB 4RPIA 3IOCA 1WU8A 4RD1A 2QS9A 1H2RS 1T2EA 1FZTA 1E8NA 3AHEA 1Y8AA 3FYUC 3PQCA 4U2CA 4D56A 1FOEB 1GV1A 4DLXA 3ETHA 3EZ6A 4A27A 2DBYA 3HDYA 3H87A 2G80A 4IIJA 2PUJA 3PXBA 1E5QA 2QN7A 1KMQA 1Y9DA 1F4PA 4B83A 3M6FA 3HJBA 3CLTC 3MRVA 3ANLA 3J7TA 3Q7IA 1IPEA 3QE9Y 1WPXA 4MQ6A 4O2BA 2AN9A 2CJXA 1CUHA 2RHJA 1C0PA 3FF4A 4HEJA 2IOYA 3W8EA 3V8RA 3B85A 3AWDA 1TZMA 4OJKA 1WF3A 5CYFA 1A27A 3OQNA 2X2EA 1L5MA 1U2DC 2GEDA 2NYRA 1GL3A 3F6EX 3RS9A 4D57A 1ARZA 2M98A 1KTVA 4B6JA 3AESA 4F9TA 1ZZGA 3L7IA 4EY4A 5CVVA 5HTOA 3F0TA 1TPZA 3NO4A 1AKMA 5JZMA 4L9WA 2SBTA 2N75A 4TV8A 1UAGA 1Z9BA 3F96A 2D0OB 1ORWA 3IDOA 3Q40A 4Z4EA 1Y5IA 2I3ZA 1DC8A 1HBJA 1GPYA 2I5PO 5JDCC 2VJCA 3QIVA 4RZIA 3T3DA 4I1UA 3PXCX 2AN3A 1ULSA 2YRFA 3TDKA 3B9BA 4EG1A 1UBKS 5H4HA 3PDWA 4LDZA 1KOFA 4KPGA 3TSAA 4ASUA 3T7CA 3VNBA 4IXNA 1FW8A 1KDYA 16PKA 2C4WA 2RI0A 4TWZA 1XHEA 1WB6A 1UM9A 1QE0A 1U8TA 3CH5A 4GMHA 4G0WA 3M6AA 1JYFA 3IKTA 2C82A 3NQ41 3L1VA 2PLNA 1GKKA 3OURA 1BROA 3DW1X 2NSHA 3QI7A 3T3NA 2XKAA 1B0AA 3C8DA 1FSFA 1UFVA 1Z33A 4Q19A 1GT91 1RJ9A 2YHSA 3ZZ0A 1TZJA 1XKXA 3B60A 4HVCA 2KE5A 2QGZA 2RGNA 4J4TA 2BMDA 1V43A 1N7HA 1VMKA 3HL4A 3K2EA 1GUDA 3M9WA 4O63O 3TM5A 2ROQA 3B1XA 5HNKA 1YT5A 1D1TA 2QA5A 4LVUA 1JIXA 2AG1A 4YP0A 3K1AA 1PJ2A 3HP1A 2VQSA 1UMCB 5B3LA 3R9XB 4AF7A 1PJAA 2CHQA 1E96A 3Q7TA 4UE2A 5KOYA 3JVDA 1U1GA 3H6HA 4WKGA 4NABA 1KYWA 3RPEA 1CXZA 3IOBA 4B5KA 5JHGB 3INTA 3WNBA 1J8QA 3MWDA 4C0HA 4TTTS 4XWYA 2VRWA 5BQ3A 2GFQA 2OHVA 1Q57A 3LA8A 3PKZA 4UEJA 4WCDA 4N41A 3BWCA 4X0EA 2C94A 2ZIVB 3K70B 4TN5A 1RC8A 4DZTA 3TR0A 3H75A 5DBHX 3O8RA 1H9CA 3IP3A 3Q7RA 4OLFA 1IU9A 3U48A 1VYVA 5D00A 2BM9A 2NO0A 2J9ZB 3IMEA 4AJOA 1Z6PA 1TKCA 2XWSA 4IV5A 3F5FA 3ZX5A 4H6PA 5U4XA 3GGGA 3I3OA 2DQKA 3WL3A 4JA0A 4NBVA 3P0IA 4BB5A 4YUWA 2C0PA 4BGVA 1E1RA 1D07A 1IRXA 5DTJA 5DCWA 3T34A 4YACA 4CQLB 2H6EA 4Y2RA 3M6VA 5AO9A 2H1HA 4KOAA 1GYRA 3TSCA 4WNAB 4B5LA 4B44A 1W52X 2R6FA 1DRJA 1R9JA 4JS0A 2FWMX 4O4LA 2A30A 2NNWB 4DQUA 4L22A 4L4YA 4MS4A 4MRSA 2Q9UA 5IASA 1Z5UA 1X39A 5AVQA 3A4VA 1YBFA 3DMRA 1ZYUA 2P79A 4XIGS 2NUAB 1WCV1 2Q7XA 4AKGA 4E5YA 5TQVA 5P8WA 4M1SA 2VF7A 5HQJA 2XIJA 4WCFB 1EDOA 1V3TA 2QTMA 1Z18A 4E7PA 3K31A 1QGAA 2JEZA 4MWBA 5GGYA 5SZJA 3V8BA 3QHPA 3HGQA 4DR1B 3P9RA 2WWIA 1TAUA 2ZRQA 2DCUA 4XDYA 2B8WA 1YQXA 2G4CA 2NYUA 3LVQE 3ZE1B 3UWDA 1YVDA 3UYLA 4M6WB 3GRPA 3SC2A 1N7GA 3GJ0A 4NOJA 3SHTA 1NBIA 2QY9A 2GN1A 3PHLA 1WPQA 4HEA6 4XB2A 4TYQA 3NMUF 2QDKA 2WMYA 1M2OB 3OEYA 3KTAA 2BR3A 1IEWA 3GUYA 4LJAA 2VNIA 4I08A 2CGEA 4B6FA 3TEMA 2F9MA 3CF0A 4IIVA 3HPQA 3U7GA 3UMYA 4OMDA 4PSCA 4XE5A 5EN4A 1S2MA 1VJCA 4C6RA 1GTL1 4KQGA 4H3VA 5IZCC 3BA1A 3HXQA 4KWHA 3X1DA 3FM9A 4LF7B 1NVXQ 3FKSA 4XPIA 4QTYA 4F1WA 1JB9A 3M5CA 4YAOA 3NHBA 3WL8A 3GZNA 1KYXA 4YT2A 4RE6A 4W5NA 4G8JA 4RVNA 5F78A 2CHVA 3L1JA 1SKUA 1FDWA 2ZWOA 4N7JA 1C3OB 4EAAA 5LOVA 1IJFA 2GHTA 5CB0A 1XRSB 2M32A 3K2IA 1VB5A 2Z83A 5KJ6A 5K8TA 5AI4A 4ZAWA 3R9WA 3HYCA 4XOIA 1HLDA 1KFCB 3ZIDA 4OQQA 1NUQA 1T9AA 4ALIA 3BDAA 4EG0A 4IRMA 1GA4A 4GUAA 3W8FA 4CM4B 4MLZA 1TZKA 5FOSA 1BS9A 3DVLA 5BR1A 3BM5A 1UIRA 1U8FO 4LJ9A 1ANKA 4CZ2A 3OQIB 3IAAA 2JHGA 3HVIA 2XTMA 3JWEA 4NNJA 3BJMA 4G1EB 3WB1A 2Z5GA 2ZBGA 3BGIA 2CLSA 3EBLA 1Q20A 4KGXA 4W63A 3S2YA 5IVKA 2ZRNA 1M9NA 3OJ0A 3O5AA 2RE8A 3EJ6A 5DCYA 4KOEC 3W5DA 2FUNB 5TT0A 4R2HA 1ZOLA 3A2MA 1Z8FA 1J49A 3RWBA 3WDSA 3WBJA 1TRHA 1A1SA 1CUGA 5IMBA 3ROTA 4G0XA 4BX9A 5DO9A 1V1MA 3NHLA 3S7ZA 3UWPA 1E0DA 2RJ3A 3DFMA 4PG6A 5BVGB 4AY3A 3ESAA 5DYTA 5BMVB 2DMRA 3C2QA 2IEIA 2Q3BA 3B6MA 4K9SA 4ND7A 5J4LA 4GM1A 1DC4A 3EIQA 1Z47A 4M53A 5BRJA 4OHZA 4G8BA 5LDHA 2IYFA 2VBFA 4R2WA 2ZXUA 4PSDA 1NUHA 5E4YA 2GCOB 2ZWPA 4EF5A 4QDTA 1XT6A 1ORHA 2HDHA 3VX4A 1T2NA 1TM5E 3RIGA 2XCSB 3KALA 4MKZA 3K0HA 4EYQA 3QY0A 2ZXFA 2WU0A 5A62A 2OWEA 1RYDA 2FSIA 3N7TA 1YIDA 1WULS 3RFTA 4EUNA 4HBZA 3ZHQA 4CHGA 3M0EA 3E6AA 2Y71A 4H27A 4J0KA 3A6LA 4UE3S 3W2IA 3IUPA 4E5KA 1FB5A 4LGVA 2QEQA 2HCFA 3EG9A 1QH1B 4UU7A 1JJBA 4BP8A 3Q8KA 2KMLA 4MVJE 2VJDA 4ZQIA 4C3UA 4PE5B 2H9AA 4Z7NB 4KREA 2WZQA 2YCLA 3BERA 2QAGC 4QASA 4HNTA 4KQHA 4PF1A 1JTEA 2ZRBA 2HFKA 2XOKA 3D1VA 3G89A 3NHUA 5THXA 4A91A 1ZI8A 2IYYA 4PYRA 2XW6A 2XSZD 3L7KA 2QTLA 2WSLA 1FYFA 1N8KA 1OROA 4OQYA 3FIJA 1JKIA 3F1LA 2C5GA 1M5TA 2F8MA 4AT1A 1T0BA 4OHPA 2PJZA 1U2DA 4ALNA 4GPD1 4DVJA 3WWZA 1DBSA 2VQDA 1WSWA 1GY8A 1TQ2A 2A33A 1CIVA 3C8HA 3SHOA 3V4ZA 1EESA 1VQ1A 3AEUA 3BF8A 1ONBA 2ZP1A 2VAVA 2ZSAA 5H9VA 1KGSA 3JD4A 3TTXA 4C7XA 2HSEA 5LU8A 1LZKA 2CHGA 1ECCA 5EP3A 3LXUX 4ZVPA 4H3KB 3GJTA 3GQBB 3ZEAA 4K86A 5JDCA 4WERA 1OH5A 4Z4IA 3V8MA 3F4BA 4J0JA 1I7SB 3RYCB 3N1UA 4N5NA 1JX6A 1KMCA 2XEXA 3NHSA 1O95A 2PMCA 2Z2IA 4IP0A 5AXDA 3AH8A 4RLHA 2HCBA 4I36A 4U7WA 2ATCA 5EHIA 2YZNA 3B6IA 2WOJA 2BE7A 4F21A 2Y66A 4FR0A 4BO7A 1IIBA 3ZHBA 1G8MA 1VJDA 1HI9A 3P97A 3FDXA 4DKXA 4BFLA 2FEAA 1O6FA 1H4SA 3LC2O 4ZODA 4BX8A 1EUDA 3IP8A 2HU8A 1FPMA 4Z1MA 1N57A 2IEBA 2O8DB 3A11A 4CEIA 4H7FA 8ABPA 3WDMA 4E32A 1GFWA 2VYNA 3O95A 4GBMA 1TJYA 1PBNA 3IUJA 3GGJA 3LBYA 4QO8A 3RU3A 1KZ4A 4HUTA 1K7CA 5E2BA 4JXJA 1PV4A 1E3EA 1AKNA 3JYPA 4KG7A 3WO1A 1T9BA 2PNJA 6YASA 2ZYHA 4N5IX 1K8XB 2BH9A 3GJSA 1PJTA 4IHAA 3CYFA 4U1RA 3RT7A 3VSBA 4BUCA 3KQMA 2IUYA 2G04A 1V71A 3R20A 5ALVA 3A6GA 4IS2A 3VHLB 1D2AA 4JYPA 5I7SA 1FSPA 1Z6TA 3O1JC 1RP1A 3D3QA 2OFWA 2KLBA 4RGVA 3V2HA 3I52A 4YJFA 2CXPA 3CIOA 2F1JA 1BFDA 1DBVO 1MABA 2A9KA 1Z4IA 2CJFA 2H2HA 2PTHA