1DG9A

Crystal structure of bovine low molecular weight ptpase complexed with hepes
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
157
structure length
157
Chain Sequence
b'AEQVTKSVLFVCLGNICRSPIAEAVFRKLVTDQNISDNWVIDSGAVSDWNVGRSPDPRAVSCLRNHGINTAHKARQVTKEDFVTFDYILCMDESNLRDLNRKSNQVKNCRAKIELLGSYDPQKQLIIEDPYYGNDADFETVYQQCVRCCRAFLEKVR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TYROSINE PHOSPHATASE
publication title Crystal structure of bovine low molecular weight phosphotyrosyl phosphatase complexed with the transition state analog vanadate.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
total genus 64
structure length 157
sequence length 157
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 1999-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1dg9A00
3CHYA 1EWKA 2PLNA 3K9CA 3O2QB 4G0QA 2FLKA 3DZDA 5KQLA 2CHFA 1VRVA 4ETMA 2KYRA 4YCSA 2GI4A 3OO0A 3SG0A 2WRZA 3H6GA 3H5WA 3RH0A 4LZLA 3EDCA 1ZGGA 1DCMA 4KRFA 1YVUA 2JVKA 4XFKA 2E4XA 3BBLA 2H3HA 3ROFA 3W9SA 4JB2A 4JP1A 4MAAA 3OMWA 3EAFA 4E7PA 4Z4CA 1EFAA 4GNRA 1FSPA 1XHFA 3GYBA 3Q15C 2HSGA 3QELB 2FTKE 4KK3A 3B2NA 4RK4A 5KC9A 3N6VA 4RK7A 4OBBA 3C97A 2MYPA 3OLZA 3SQNA 1QKKA 3IP5A 1EWTA 4KFCA 1E6KA 1U2QA 3EULA 4YV7A 3MM4A 2B4AA 4YS6A 2L18A 3O74A 2L17A 3EGCA 5FWXA 1DZ3A 1R8JA 3H5VA 4IMJB 4OLAA 1I3CA 2QU7A 4RU1A 3OM0A 1BDJA 1EAYA 3G1WA 4HNQA 4JOQA 4YGXB 1C4WA 2ID7A 3R0JA 1ZESA 2MSLA 4MLDA 1FFWA 3KCNA 3QLVA 3N0WA 5DKFA 2GKGA 3IDOA 1NXTA 4GPAA 2CD7A 3SY8A 2IDMA 4NCBA 3RVMA 3O1HB 5PNTA 1RPJA 3GV0A 5DGCA 1F4VA 3QLTA 4IF4A 1QO0D 2OQRA 4RK1A 1Z12A 1NTRA 3A0RB 4MR8B 3O1IC 1M5UA 1QNLA 4Z4IA 1NXPA 3MMNA 3DGEC 5KQMA 2A9RA 3QEKA 1JBEA 1GCGA 4N0QA 3HV2A 3FGZA 3E61A 4WZZA 1GCAA 4F8JA 3F6PA 3TO5A 3OQNA 1JFVA 1U04A 4RXTA 4HNSA 3H1FA 4KK4A 4RWEA 4MR7B 4ZJPA 3LKBA 3GA5A 4IMIB 2FMFA 1OXBB 2NT3A 2PJUA 2RJNA 3K4HA 4B09A 4H3HB 4P1ZA 4EYGA 5IX8A 3S99A 1PEAA 3HDGA 3TMYA 4O5AA 3LFTA 1LJUA 3N0XA 4F3TA 1D5WA 2PL1A 3SM9A 3EQ2A 3UUGA 4NICA 6CHYA 5TQ2B 5TPWB 2NZUG 3CU5A 4LDZA 2JBAA 4MGEA 4MQEB 3RVJA 4TLLB 1ISSA 3T38A 3C6QA 2LBPA 5I4CA 3RVNA 4KPYA 1USGA 4KREA 3KSMA 5CNKA 3D8UA 3HDVA 3MIZA 4MS1A 8ABPA 5BRAA 3M9WA 5HKOA 2LUOA 2VYCA 4DADA 2Q5CA 3Q7TA 4W5RA 5IULC 3M6MD 5IC5A 2WWVD 1YS6A 1PNTA 4QYWA 3KTOA 5CNMA 1JYEA 2GWRA 1CHNA 4H3KB 5FWYB 5KI6A 4ZMRA 1MAVA 2H0AA 2FLWA 5KWSA 4G0OA 2IPMA 4H60A 5DLEA 5ABPA 1K68A 4G0ZA 3FFWA 2QV0A 2FMKA 2PUBA 2CHEA 3CG0A 1NXWA 3O2SB 2R47A 4JA2A 1Z16A 4W5OA 1JFSA 4F11A 4MPTA 4N47A 4EGSA 2PUAA 5BRJA 3M9XA 4XLTA 2QVGA 1DC8A 4MRMB 1JX6A 5ED4A 2FMHA 1QP0A 3GBVA 3JTEA 1U2PA 2FN9A 1ISRA 3JPWA 4MQFB 3N75A 1P2FA 2BGGA 3BILA 1W25A 1YK1A 3QELA 4IILA 4UHJA 1ZGZA 1MB3A 2FEPA 3CFYA 5KQPA 1QO0A 2JCGA 5JNUA 3RVLA 5JNVA 2IPNA 3JVDA 2FKAA 4XASA 2QXYA 2WY2D 5IEJA 3OQOA 3I5AA 3IP9A 3HO1A 4FE7A 1YS7A 4W5QA 2OENG 2A9PA 1ZAYA 5JNTA 6ABPA 1A04A 4OATA 1JLKA 3I45A 4XARA 5E3JA 3LUHA 1JYFA 3OM1A 3H6HA 3P9YA 3NNSA 1JDNA 4TLMB 1NXOA 3H5IA 4DN6A 1YTUA 1DJMA 1FFSA 4M88A 2FXIA 1JH9A 4NV3A 4UHKA 5HQJA 3KLOA 3FFXA 4G97A 3Q7SA 4WXMA 3HUUA 2PAFA 1SXIA 5T3YA 3H5OA 4D74A 2QVCA 5EWJB 3CS3A 2JVIA 4G0MA 1VKRA 2QZJA 3HZHA 4OTZA 3A0UA 2PL9A 1LBHA 1BDIA 2R4QA 1UDRA 2FVYA 3CZ5A 3I09A 5C5EA 2V0NA 4G0XA 2VUIB 4JB0A 4ETIA 4RK5A 4YR7A 4MR8A 1P8AA 4Z9AA 4N03A 4EUKA 5IUJC 2FQYA 2N9UA 3N8IA 1TVMA 1ZH4A 3CRNA 5CHYA 4NCAA 1F51E 3VNAA 4MR9B 2E4WA 1M5TA 4RY9A 4TN5A 4O1IA 1JHZA 4LX8A 2PUCA 4RDCA 3Q9SA 2ZAYA 3NHZA 2FEKA 2I6FA 1LJLA 5JS2A 4MR7A 2R48A 1HEYA 1VLZA 4E7OA 1APBA 1BDHA 2IKSA 2IPAB 4O1HA 3JS5A 3O1JC 3URMA 3L6UA 1U8TA 3LOPA 1Z18A 1DCKA 1RZRD 3HCWA 4CBVA 1QQBA 2HJ9A 3DBIA 3EODA 4MS4B 3IPCA 3T8YA 1JF8A 4RXMA 1OXKB 5TPWA 5TQ2A 3KYIB 3QX9A 4KNYA 4XXHA 5IUNC 5IBQA 1MVOA 4Z4HA 3CG4A 4N41A 4MQEA 2QW1A 5BR1A 1ZDMA 1M2FA 4G0PA 4MS3B 4EYKA 1LBIA 4Q6WA 4N0PA 3LUGA 1QPZA 3QLUC 1ZHHA 2MYTA 1GUDA 4RV5A 4S05A 2E4ZA 2W42A 5EWLB 1TMYA 3FDFA 4G86A 4RSMA 2L19A 4Z99A 4PE5B 2PKXA 1QMPA 1YK0A 4Z4EA 2VUHB 1S8NA 2WB4A 3BRSA 3LUKA 5IUKC 2YHBA 2FQXA 3CTPA 4KZKA 3TB6A 4FB4A 2F8TA 3FFTA 4LE2A 3HSYA 5IEBA 1P6QA 1TJYA 2A9QA 1E6LA 2P9HA 1DCFA 1RXIA 1AB5A 2R25B 3LUCA 5C5CA 4RK0A 4S04A 4QPJC 1W9HA 3OO1A 2O20A 3KYJB 3I42A 4N76A 1ZVVA 1D2AA 2JRLA 2GBPA 1DBQA 1Z13A 3RVPA 1TLFA 1RNLA 1ABFA 5D2CA 5JNRA 3D02A 4MRMA 5TPZD 5TQ0B 1FFGA 3GL9A 3RVKA 1WETA 1BAPA 3A3KA 5B3JC 4MQFA 1Z2DA 3H1GA 1SXGA 4RK6A 3RVQA 3DGFC 3JVIA 4HYEA 3QEMB 5EWMB 2GX6A 2F8SA 2WJAA 1KRWA 1SXHA 4HNRA 4PEVA 3IPAA 2MSWA 1ZY2A 2CWDA 3LKVA 3HEBA 3OLYA 3BREA 1JL3A 3H75A 9ABPA 1DRJA 1Z17A 2FMIA 4F06A 4OLBA 2DRIA 2B1JA 4EVRA 2A9OA 2PUEA 1DBWA 3KS9A 4LDAA 3KG2A 4RY0A 1CEYA 4OG2A 4IGAA 4ZYLA 1QP7A 3G85A 1DC7A 4JASB 3IP7A 1JFTA 2HQOA 4EVSA 5KC8A 4ZMSA 3UKJA 3EQZA 2ID9A 4Z4GA 4WUTA 2LIVA 3HXMA 2QR3A 4RKRA 3N0RA 4TMYA 4PICA 1IIBA 3H5TA 4KQCA 2WMYA 3QLUA 4ZPJA 1PUXA 3NHMA 4RKQA 4EYQA 3E3MA 3O21A 1RZRA 1CYEA 3RVOA 3NNNA 5EWJA 3ILYA 2FQWA 2AYXA 1KRXA 2MYUA 4RZSA 3JPYA 3OLXA 2WJWA 1T34A 3CLKA 3O75A 1H9CA 1ZN2A 5GOTA 3HUTA 4ML3A 4PYRA 4DQDA 3SNKA 3LUAA 2PUGA 4MR9A 1DP4A 1M2EA 2TMYA 3QX8A 5JS1A 3ILHA 3RVRA 1YMUA 1DG9A 1FQWA 2E4UA 2RDMA 1BVHA 1QQAA 4WWHA 5T7BA 5TE9A 3KLNA 3L49A 1E6MA 1YIOA 3UK0A 3GT7A 3GRCA 3MA0A 5GQSA 1EHCA 4LRQA 4F12A 4EVQA 3KKEA 4RY8A 2PE5A 4RS3A 2LP4Y 3H5LA 4ETNA 5B3JA 3HJFA 1PEYA 1USKA 2FN8A 2J48A 3BRQA 4MS4A 5CNJA 1TM2A 2QSJA 1NXVA 3N53A 1VPWA 3DLBA 3O2JA 1XHEA 5FWXB 2AYZA 4YRZA 4FE4A 4P98A 5DCLA 3LMKA 1ZH2A 5FBHA 2VK2A 1D1QA 2P4UA 3HM9A 3F7NA 1NATA 3A10A 4MS3A 4D6YA 5TPZA 2IPLA 1BA2A 3CKMA 3MF4A 3OMXA 4JAVC 1E2BA 3QK7A 4D6XA 1Y1LA 4Y9TA 1JDPA 5TQJA 2FW0A 5EWLA 4Q6BA 2NZVG 5KQGA 3T6KA 1B00A 2JVJA 3CZCA 3MQ4A 3TD9A 4EY3A 1ZITA 3H1EA 4EYOA 4MLCA 1KGSA 1P6UA 3IP6A 4LE0A 1XWWA 4KQ9A 4NQRA 4YP9A 1K66A 3F73A 4YO7A 2RJOA 1YMVA 1DBPA 3EJWA 4KV7A 2NT4A 4L4UA 4L85A 2YHAA 4YLEA 1Z26A 1NY5A 2IOYA 3C3MA 2M1ZA 1C0EA 3KJXA 5FWYA 3VNBA 1ABEA 2HQRA 3JY6A 3OQMA 4PZ0A 2PUDA 5JNWA 1SRRA 5FBKA 1NXXA 3NBMA 5DTEA 1KMIY 4IRXA 1J56A 3LUJA 3OLVA 1PHRA 5CNIA 5TQ0A 3T95A 1MB0A 3GWGA 2M98A 3Q41A 4YWHA 2IYNA 2FEWB 3C3KA 1Z25A 3KHTA 7ABPA 5BQ3A 4Z9BA 1D1PA 3LUDA 4G0YA 2JK1A 3HVRA 4Z4FA 1USIA 1QP4A 2XDYA 3QEMA 1EWVA 5EWMA 3DLHA 1SD5A 1GUBA 2L2QA 1Z2EA 2JB9A 1LK0A 1JWLA 4MYRA 1U0SY 2JBAB 1A0OA 2E4VA 3Q7RA 4WXEA 4Q7EA 5HM6A 1RXEA 1Z15A 4WT7A 1PNRA 3GBPA 1A2OA 3NNDA 3CNBA 4QICA 5JNSA 2HPHA 4W5NA 2LPMA 4LE1A 5HSGA 2MSKA 3QLVC 5F64A 1L5YA 2E4YA 4QYMA 2MYNA 2NUBA 2PMCA 1NXSA 1D4ZA 2HQBA 3F6CA 4XAQA 4MS1B 1MIHA 3OLWA 1URPA 3LUFA 3HS3A 1AB6A 3LTEA 1GLGA 1DRKA 2FSPA 3MYYA 4RXUA 3RQIA 3FMVA 3TX6A 2PUFA 2RGYA 4Z0NA 3SAJA 3ROTA 3C3WA 3RVSA 4W5TA 2X7XA 4KVFA 3HK2A 2ZWMA 4KMRA 1L5ZA
chains in the Genus database with same CATH superfamily
3KKNA 2PZBA 3Q10A 4KYIB 1EWKA 2IV3A 5I9MA 3MQFA 2WKWA 1XZBA 3H18A 4IDAA 4EO7A 1XPUA 4BL5A 4IIVA 2VIIA 4RA6A 5EE0A 1ZD8A 4GPZA 3AVUA 1VRVA 4LX0A 2WJZB 1WPQA 2ZYIA 5E8JA 1NQXA 4TXNA 2PG3A 2R6R1 2F43A 3MTAA 2RKOA 4URWR 1E2GA 3TM4A 3VU8A 3PFWO 1MN6A 4TLAA 3WRYC 4X7RA 4U2CA 3T9DA 4XFJA 1GTJ1 1X7HA 2QTTA 2J7PD 4O63O 4DLNA 2Q0XA 3A6FA 3IEXA 1QKIA 3OAAD 1XCJA 4R98A 1KK2A 3VR5A 3F2IA 1N3BA 4D3DA 2C3MA 1TT5B 3ID6C 3HWX1 3PFFA 5JZOA 4N3BA 3NCTA 1Y1PA 3CA8A 1RT9A 2BM0A 1DJPA 2VPXA 1TU4A 2ZSEA 1MX3A 2D5BA 1PK9A 3I30X 4P0PB 4LW8A 4PYMA 1CSEE 2JFPA 221PA 2ZR9A 2JGFA 3IP5A 4KRGA 4O4HF 5AKHA 1ADBA 4E4TA 4JQZA 3NBFA 2YXEA 2J30A 2WUFA 1YQEA 1XA3A 4P54A 3SHOA 1SUDA 2F3QA 2WD8A 4MQMA 1BRTA 4H17A 1PJ8A 1ZUD1 1LPBB 4M22A 4UTOA 3KKMA 5HTKA 3TXAA 4F6CA 4EELA 1M6WA 3FTFA 4I9NA 4DQKA 2PUWA 3F3YA 3DOFA 1FP7A 121PA 1TM1E 2I7TA 2C31A 4OO3A 4A73A 4WDRA 4FCTA 1ZSYA 5DBGA 1L1FA 2EJTA 5LJIA 3AVPA 2C2KA 1R66A 3D0KA 5BW4A 1OBOA 5LPNA 1W0CA 5G4LA 3KUKA 3V4PB 2HYIC 1M67A 4GGPA 1GR1A 3O1HB 1RRGA 3TW6A 3W0LB 3HV0A 4LOHA 3L5KA 3MTGA 5LB4A 5KNBH 1NW6A 1QO0D 1JAHA 3TIVA 4BVJA 3C14C 4FNMA 2HBYA 2WD7B 3EVAA 1IBLB 2A6PA 1TLLA 1XQYA 5JPIA 2C77A 4AURA 3O4RA 4GMGA 3GMDA 2AEMA 1B26A 5BMVA 2IXEA 3PHHA 1SU8A 3HWSA 3IELA 3K1AA 3SDZA 4CODB 4YPVA 2A1UA 1F4LA 1PFVA 3FVVA 4Q7JB 3SKYA 4ZFNA 1J0CA 1XLVA 2VRBA 1A4XA 1HNWB 1HEIA 4NH0A 1YUBA 5ICEA 3B82A 1FJ2A 4D3XA 3IVCA 3BH7A 3K2QA 3QMVA 1KOFA 4JI6B 4MPPA 3UAZA 2V7EA 4PANA 4D3YA 2F59A 5I7SA 4G5YA 3H2IA 4Q3DA 1W2HA 1IRXA 3ICQB 2WAMA 1ZN9A 2WWTA 2AFHE 3GW8A 3VRHA 3HVUA 2CMKA 4L5YA 1Y80A 4QM7A 2H7YA 3PNLA 2ZJZA 1PJTA 9LDTA 3S8YA 3N5KA 3VAAA 5AVQA 1FPMA 2PUHA 2E0IA 2GDZA 2WJVA 3AERB 4G0UA 2CNKA 1ECPA 2JBAA 5BNZA 1KEUA 3RV4A 3NHLA 1K9VF 1QVAA 3IT2A 4TLLB 1FY2A 4NHOA 1PAUA 5CJJA 2DY1A 2G7ZA 2PRKA 2DHDA 4DCGA 4RESA 2NPIA 3K71B 1W48A 4KSCA 1ESZA 5KOHB 1EDDA 1R9MA 1KO7A 4C4ZA 5AVZA 3JU3A 2XYQA 1THZA 1S9HA 4B9AA 2X2EA 3Q7TA 3EE6A 2H4JA 4B3FX 1LDEA 2YL2A 3DLIA 3Q6MA 3QVJA 4LSMA 2FSGA 3J81k 3UXHA 5G0WA 2GJ9A 1E2NA 2VCYA 3EWNA 4NE9A 5CVJA 2JFHA 2GN1A 1BXRB 2H06A 2BWJA 1IG3A 4FLEA 1X7YA 3RUFA 3GJSA 1PT6A 4P80A 4BBPA 4RPKA 3RJZA 4JX9A 4ZAFA 2R1UA 5G0TA 4DEXA 2QRUA 4LKOA 3I1IA 4ITUA 2QYOA 3KQYA 4C7OB 3W2FA 3PUYA 1CUFA 4ATNA 4K3VA 1PD1A 1XVVA 1X80B 2AFHA 3PHGA 4NR0A 3QVMA 4BTLA 4W7SA 1T5LA 5FI0B 1K7XB 5JAMA 4YJHB 1JG3A 1RLMA 2AE1A 2FMHA 3W5JA 4BNWA 4K26A 2I4OA 3D3NA 8LDHA 3AVTA 1ZOPA 2OHIA 3A1WA 1I4WA 4TVBA 5IJXA 2ZJBA 3TLXA 4AX8A 3CEMA 2C7VA 3PT5A 1NQTA 1T29A 3I8XA 2QDXA 3U7IA 2FI1A 1WCWA 2IXTA 4PYIA 2BFAA 4DBLC 2Z3WA 3K30A 1DKLA 3NHKA 4MQBA 1L5LA 3GLIA 1GQ2A 3UWDA 4BE9A 2JJ1D 1CPYA 1CUUA 2JCSA 3M6UA 4HAUA 4IWNA 2H17A 3RBZA 4E12A 3H3JA 4BVBA 1XTUA 3T9BA 1DTWB 4JBWA 4AS3A 1K4YA 3FBTA 4JBIA 4MB0A 3T1TA 2XRMA 4NZYA 5K9ZA 3VPHA 4YRSA 3DV0A 5IH3A 3AESB 5HCNA 3PUJA 1K86A 2VJOA 2CFOA 4TX1A 1FDSA 1GPUA 2REXB 1L1QA 1U3WA 2ASEA 3OP4A 4Y2RA 3QU4A 3TIGA 5IJ0B 4IWXA 1G41A 3GVCA 5T57A 2C2XA 3H2YA 1GL7A 1Q2XA 3C85A 3LNTA 5FIUA 2HCRA 5LYYA 5C81A 5I7HA 4LDPA 5C3UA 3FPSA 3D8NA 3VOBA 1O4WA 4YJDA 1E4YA 3I04M 1M34E 1RHQA 3HBMA 4R8RA 1OKKA 2Y76A 1NBWB 3EISA 4HTAA 4AO6A 4OTZA 1OWLA 1FIUA 3A31A 2XZPA 1VXOA 1WPXA 4I3HA 3L4BC 2VT3A 3GLFE 4QU0A 4DCTA 5EUCA 1RWNA 2C1ZA 3PRJA 4ZAWA 2Z56A 2Z58A 1F17A 1ECJA 3FYDA 5EVCA 4YREA 4K88A 1BQ4A 4LOJA 3RTDA 3DV9A 1XJWA 3FSGD 3MOIA 3GAAA 4PPQA 1P33A 2QPAA 4DCVA 4WZBE 1E7SA 1CETA 2EWMA 2G83A 5EXPA 3WA6A 1H23A 2PUCA 1GLVA 2GAAA 1SHTX 2PFKA 2X1HA 3BJEA 4EIWA 3A37A 3MAGA 3NS7A 3GEPA 3V80A 3K8OE 2H65A 3OD5A 1G5RA 1L7DA 1N5DA 2X5JO 1NPTO 2XOXA 1J21A 4RZHA 1JIVA 2BGRA 1PKXA 1Y3BE 1T9BA 1H9BA 1YUNA 4IJ5A 3FF1A 3FYTA 1PSWA 3L6UA 3D6VA 1H8ED 2WIJA 1GZSA 4YAGA 4RDXA 1WABA 2PUJA 2BKLA 4TTAA 3DFUA 3F6EX 1L7AA 4BN4A 1UFRA 3OLQA 1KFCB 1R74A 1E92A 4KOAA 4M99A 3NFRA 1M34A 2J0UB 3CX3A 4HNUA 1LDGA 1S1MA 1CUGA 4ZTBA 3IHTA 4ENQA 1G7SA 1M2FA 4QEKA 4EYKA 2IZOA 4BJ3A 1VKZA 2EGUA 2CXUA 1JB1A 2FUG1 2H1FA 2QAGB 4PSUA 4LXQA 5CBPB 3PJEA 3Q5DA 5IWAB 3PJRA 4FDLA 1MX1A 3AL2A 4IGIA 1EINA 1R4AA 1V4VA 2QGZA 3CEAA 2YBEA 1E5XA 2ZJ2A 1G3UA 1KK0A 2FSVA 2PQMA 2II6A 1IWBB 1Y9DA 3LLCA 1T2VA 4R2HA 4WZBA 4JOCA 1GZ5A 4OQNA 1JJ7A 5JXWA 1W19A 4D92A 4PZCA 5T41A 4KCGA 4ZRDA 3TB6A 3ZJUA 1EEXB 4KKXB 1P2UA 1R37A 4RD0A 2P9HA 5CB4B 1EVJA 4IDOA 5ALYA 4LOAA 4YR9A 4OB8A 3KLMX 4PNHA 5EMNA 2PLRA 3GXBA 9MHTA 2O20A 3ESDA 2QMHA 2EP7A 1XCPA 3OEED 1CUYA 3RYCA 1C0IA 4N3GA 4Z5XA 2BCEA 5F7JA 1C0LA 3E18A 3BH6A 1ABFA 3AVOA 1KU0A 1KYZA 3EA5A 3IVRA 1CUSA 5G02A 3GG2A 3W2IA 4I1IA 3IH5A 3OT1A 3ZQKA 4X94A 5AVOA 3C6BA 3K94A 3RFCA 2P1RA 3AUSA 2JLAA 4R41A 5C51B 4Q19A 2PCLA 1LW6E 4WESA 3T1OA 1TEZA 4LF8B 1KTVA 3T5AA 1CG6A 2J0QA 3HY3A 4EMTA 2JW5A 3LDGA 2XQGA 2EBHX 4M0LA 2MSWA 4E30A 2NN3C 1Q7EA 4J1TA 3FZGA 2X40A 2PWZA 4UXJA 1AKEA 1RYEA 1YZ3A 1DX6A 1BQEA 3H7IA 4ZYYA 1JG2A 2PO7A 5C3MA 5C8DA 2O59A 1KOLA 2AI1A 2GLTA 2PZ8A 1N34B 4HY3A 3IR6A 4MUJA 3UOWA 5CLJA 3GRKA 5KHOC 1EK1A 1JR3E 1DBWA 2XVAA 3HYTA 2R97A 3UBMA 2PUEA 5KYXB 1X1RA 2J5RA 2Q1SA 3TBFA 2P77A 3UJHA 1IN8A 2R4TA 1P4SA 4ZAGA 5KC8A 3CX8A 3OEHD 3FW1A 2VTEA 4ETWA 3IBYA 2IS6A 1PUJA 2LIVA 4QBTA 1EDBA 2E21A 5HK8A 1D09A 4BNDB 1OCEA 1LDBA 4BZXA 3LF2A 3EFOA 3QLUA 1PUXA 2D3TA 4BUZA 2DXIA 1OX4A 3MRXA 4I08A 5KAMA 2YJZA 3WGGA 3BAFA 1TYCA 3Q7PA 2GK4A 4KFTA 3MJRA 4X9XA 2OBFA 1MEEA 2CJXA 4JGBA 3QX7A 5K3EA 1NRWA 4A8PA 5HPYB 2AUNA 2XMQA 1ZN2A 2P6PA 5HG0A 5EG5A 4CLRA 4BQSA 3CXUA 2DFDA 5AW1A 5CK4A 1ZJ5A 3L8MA 3UMJA 4LXTA 1I7LA 1KFJB 4ZOLB 1KMHA 4DIKA 4GH5A 5A06A 1IXKA 4YAWA 2FWJA 2BF4A 1XGKA 5C2JB 3FPJA 1CUAA 2UZIR 4QUAA 5LBIA 1VECA 2HMUA 3KSDO 2BGWA 4MX8A 4R68A 4ZVPA 4YV0A 4HH0A 4S0XA 1VHJA 1VDZA 3G5TA 3THYA 1JR3A 4JVMA 1N77A 4B6JA 1U0FA 2B8WA 3BD7A 3RTGA 3OIDA 1JHUA 1DU4A 1E89A 2ACKA 1SY7A 3IMFA 4L2IA 1J5EB 4GMKA 4Y1FA 4YRTA 4GXRA 4RS3A 2VZ8A 2Y2UA 3QTBA 2E89A 3DOUA 3PNOA 3N1UA 1XXLA 1GGHA 2FZLA 3I04A 4GLBA 4XJSA 5D51S 4DUPA 1F2TB 2RARA 2CDCA 4ZEVA 1VPWA 2G07A 2ZRQA 3ZWNA 1NI5A 3CNQS 3OY7A 4RZQA 5DI9A 2C2MA 1XHEA 3NG1A 1SPBS 4FKZA 1W75A 4KMSA 2B8TA 4OJTA 4M0DA 1XRQA 1P18A 3KOWA 4Y2YA 3GZ4A 2YJTD 4IIFA 3FB1A 5FA5A 2GD1O 1JJFA 1T43A 3LPNA 1HEUA 4KBGA 5G0VA 3KVOA 5J63A 3REOA 4DLXA 1AQYA 3LA6A 2O2JA 1V6AA 3HZOA 2HV8A 2LKDA 2IP1A 2VG8A 3FLAA 3VC7A 3VSAA 5CM2Z 1GG8A 3VR5D 2NMVA 4HLNA 3CSUA 4YXFA 4EZIA 1VG1A 1X8JA 2P6OA 1JDBB 4HWSA 1WBDA 1PRYA 2QG6A 2H16A 3PT9A 2BEWB 1C1XA 2IZ7A 2ZPAA 3W8RA 3LHSA 2ZYHA 4C20A 5AQ1A 1FS5A 3PUVA 1MR3F 2WLTA 3HB9A 4IW3B 3KEQA 4NQRA 3TINA 4G2TA 3RRJA 3GLKA 1IY0A 4N0EA 4BLWA 1GZHB 1Z7YA 2OFWA 3GGOA 4L4UA 4ZYVA 4W99A 2LV8A 4DWOA 3L01A 1BKSB 4PONA 1JLMA 1Z26A 2IOYA 2XYPA 1VB3A 3AEUB 2SECE 3FSJX 4KPFC 4HPWA 1ZM9A 1ABEA 4JYBA 1SJ9A 3LQFA 2R2GA 4OHXA 4PZ0A 4RL4A 1YFJA 1NXXA 3JCZA 4N49A 1ZOSA 5IM5A 3L5OA 2H4XA 3AQ4A 1DOAA 5HQ3A 4EPWA 1NNI1 2VSFA 4QDXA 4RV9A 5A3QA 1XCMA 4UNIA 1EFKA 2F2TA 4OHKA 5HGJA 3H0CA 4EAAA 2GYYA 1KPHA 4HVAA 4OXRA 5EY5B 4X7MA 3EIXA 2FMXA 1U8EA 5CW1A 2YYAA 2YXBA 3UW3A 4BQRA 4FFWA 1VJ1A 4KWCA 1XELA 1LF5A 3FNIA 4ROSA 2DG2A 2VDVE 3ACCA 4GVXA 3PTZA 3S2FA 2L2QA 1ISGA 3PC8C 2JCBA 5E6UB 5HZHA 1LK0A 4MDHA 2HW8A 3LYUA 1U0SY 3FKSD 5ALNA 4DCNA 3M6XA 1JLRA 2EQBA 1Z15A 3CUTA 4G24A 1JAZA 4AIIA 5IFLA 3UFXA 1ZWLA 3KZKA 5DXAA 4MIKA 2JIOA 1DUVG 3QLVC 4PQGA 3SR0A 4FQ7A 1FVHA 3TMAA 1WV1A 2UXBB 3KDPA 2BT4A 3QF4A 3IBSA 1QBGA 3HRHA 3KQWA 1P7VA 4WGFA 5ECYA 1UANA 3DBHB 1RVV1 5EP3A 2FV8A 3WIUA 3L40A 1A5TA 1SUFA 2I22A 1DRKA 3FMVA 4J6FA 2H9AA 5JD5A 1GPNA 1GNPA 3C3WA 4E5PA 2QI9C 5BNWA 1K7CA 2YTZA 4YCBA 2HPAA 2FUNB 5D7NA 4L72A 2OLEA 4EG3A 2YN4A 4ZIRA 1FS4A 2Y9PB 3FTEA 4UBJA 1ID1A 1LWOA 3KBBA 3DC7A 5FO0A 2FLKA 1FSSA 3WQHA 2FX5A 4C2BA 4C4SA 2UXCB 3D5TA 2Y1XA 2XTMA 5BQOA 4RVCA 4FFMA 2PXAA 3K5IA 4E0BA 3LA8A 3P0IA 1EE2A 1QDLB 1O6CA 2H9YA 4FP9A 2WT4A 5GV7A 4F92B 4QNNA 5IT4A 1I7QB 4RIEA 3BBLA 3RUEA 4DR7B 4KYUA 1YZTA 2X8JB 2YHUA 3ROFA 4E7PA 2AG6A 3OMWA 3OZSA 4L8GA 2FF7A 4B45A 2OK7A 4YDHB 2HSGA 3BWEA 4UNNA 3I5YA 3QELB 1NN5A 3T7JA 4YLYA 3AU8A 4KMMA 2XUAA 4OYYA 3C7TA 4BUJA 4ZYTA 5LQDA 4ZKDA 1U9IC 3RUAA 1XCGB 1N25A 2C4UA 1Z35A 2JJ8A 4JSYA 4YCMA 2IEBA 4IEIA 4YH1A 4EG6A 3ITEA 5HRAA 3E7WA 4BX2A 2V97A 2IYYA 3SYNA 4DCSA 4QEDA 1NV8A 4IVRA 5DP1A 4GSKA 3VR4A 3D7MA 1KJJA 1F14A 2ZIEA 1FYXA 4YRKA 5BVHA 5TXGA 3ESYA 4F4JA 4HNAA 2I3DA 4IXNA 5ESRA 4UAVA 1R12A 2YS6A 1VGRA 1HR0B 2FUCA 4RY2A 5FUQA 4D46A 2Y9MB 3D7SA 2XEXA 1N2HA 3LCRA 3P2IA 3IDOA 3ZWCA 3RWBA 3F90A 1OT3A 3TLGB 1PW7A 1VPLA 1LDMA 4EG1A 1ZGBA 5I7RA 2I6SA 2BZGA 3X3HA 1A9RA 4HC4A 1YKGA 1P5JA 2HA3A 4XUDA 1Q7GA 4H9GA 4ZCLA 2VF5X 4FC6A 4C9BA 3JAKA 2V6GA 2WFLA 3MMNA 3IB6A 3R7NA 2REQA 4D5EA 2PFSA 2XR1A 1XAGA 4LDNA 4QC2A 1RRMA 3PV0A 2DWUA 1O8BA 2Y0CA 1U9CA 1OY1A 2VPWA 1A82A 2ZDHA 3G5LA 4OQQA 1V16A 1OH6A 2CGEA 2GUWA 1LNSA 2TMKA 1UP4A 4JYAB 3E8XA 2J33A 2XMRA 5E2AA 1TAHA 1RWKA 4J9UE 5HILA 4MUMA 3E8SA 3WC4A 4CL2A 5L3QA 4QU9A 1OXBB 1V96A 4H2DA 1PEKE 2W71A 4JKOA 4MO2A 3SHVA 1GQQA 4H7JA 4EJ0A 4EYGA 2WNHA 3P9SA 4ESOA 1E6UA 4COKA 4P93A 3GFQA 4L6CA 3TMYA 1EFVB 2A78A 2QJTA 1ODCA 3O03A 3TKYA 3MSXA 1OKKD 1DX9A 2PL1A 3KD3A 4U7GA 3SM9A 4GL2A 2ATCA 3NYIA 1T26A 4HEQA 2OO5A 4KI7A 2IX9A 2ZGVA 2IIPA 2JARA 2DLCX 4GWLA 1RKQA 2QUKA 1SXPA 1HLFA 3ONVA 1PSZA 4R54A 3TM5A 3UAGA 3WVNA 4BMOB 4ZDIA 2NZ2A 3HUFA 1WW3A 4QQRA 4NU0A 4L15A 3E2PA 1W581 1RYBA 2GJ8A 3IPXA 4OL9A 1Q6YA 2GASA 3TBHA 1WJGA 5AM2A 3ENQA 4UNRA 5AM3A 1PUIA 3OMLA 2NTJA 3G2NA 4CG2A 1Q74A 4LZZA 4NATA 4NESA 2OGTA 4XYBA 2B0JA 5EJFA 4FD2A 4PLFA 2EP8A 4MMZB 4XJXA 3ZD9A 3COYA 3D4OA 1ISHA 1PNTA 2JIPA 3PG5A 4IJVA 5BYBA 2FLWA 3KLBA 3UWMA 3TG2A 2O8VA 4UVGA 2ZREA 1EJBA 1MV8A 4FXPA 3S2EA 3PQEA 1EP9A 2G72A 1JHVA 4FGWA 5L3SB 1RCTE 1YBMA 2JD2A 1FYVA 2Q9AA 3HP7A 4G1VA 4PIMA 1C3OA 4YNBA 4CV2A 1SXJE 3FI9A 1NVEA 1ORTA 1MCZA 4X6XA 5E1BA 2ZJ1A 1R7RA 2CL5A 3KUUA 1WWKA 3PWKA 5ALJA 3SYMA 3UGTA 2WSSD 1Q0PA 2RAUA 2WJHA 3AYXB 1S9DA 1MXHA 2D5LA 1OVGA 3HEAA 3N6RA 4TRNA 4DMCA 3K0SA 3CE9A 3EPPA 3SC4A 2EZTA 5ER6A 2FN9A 5JYDA 4LNAA 3UJBA 1OH7A 4ZK2A 2OTCA 1MLDA 3JPWA 2P2YA 3N75A 4IYRA 2FLVA 1DAPA 4X8HA 1T5HX 2F48A 4CCAA 3ZR4B 1NPYA 3RWOA 3QA9A 5BWCA 1ZVMA 1E77A 1IIRA 5F5LA 4CNQA 1HE1C 3N2IA 4PQFA 5TSDA 4K8RB 2X41A 3BMXA 2O7RA 3N86A 1G6Q1 1FTNA 3EGEA 4IL5A 3L0YA 3SKVA 1B0ZA 1R2QA 5A6VA 5JWOA 5HS4A 3SYRA 2E87A 2PFGA 3TTTA 2VK1A 4HQKA 2IYQA 3LZ6A 4LCEA 3KU4A 1O2DA 1U8UA 3KZXA 2XE7A 1NOJA 2FPGA 3I8SA 1P2DA 4EA8A 1JLKA 3TCKA 1SUIA 2H1CA 4UTVA 2XKAA 1EGHA 3H4IA 3DHWC 1SKYB 4M88A 1SXJA 4OBWA 4XGIA 1VE5A 4TS4A 4FMDB 2CZGA 2I03A 3FFXA 4MHOA 1DINA 2WMOB 1CR1A 1RMYA 2VTVA 2CUZA 4EW1A 2H1OA 5T3YA 2IGTA 2E1PA 3QUBA 1QHHA 4JVSB 1FFBA 2WZDA 3ROGA 3M81A 1MVLA 1YBHA 4BMXA 3HZHA 1J20A 4KO8A 2Q6KA 2H2FA 4BBJA 1G1AA 2B6NA 4KL8S 4D45A 1RWQA 4Q3AA 2R751 4XEHA 2VUIB 1P91A 1VSTA 1UJCA 4P5EA 1BWPA 5J4HA 1K3TA 3SZLA 5JI2E 1MO4A 3HKDA 4MUNA 3N8IA 1E0JA 4COOA 5AHWA 2ZIFA 2FMUA 1M8PA 3ZCQA 4X45A 4I99A 4RY9A 4LJ4A 5DV9A 1TUBA 4NEQA 3TZKA 2EFJA 1KU6A 2ZAYA 4C06A 4EF5A 3D2BA 5IF3A 2VH1A 4URZR 3SBXA 3BULA 5CMLA 1OQAA 3TD2A 4UDOA 3VZBA 4IXMA 3GCGA 3Q98A 3X2SA 1APBA 3BKWA 2EP5A 3UW1A 1YT5A 2JZOA 2ZB3A 1O6BA 3O1JC 1DMSA 3CSSA 5FNVF 1AQJA 2H0QA 4HZUA 3PEYA 2ZOSA 2I7CA 4O2BB 1A4RA 4IF6A 3OCWA 3T8YA 2I5PO 2EGGA 2E6KA 2YCLA 1NQ5A 5JNVA 1HE8B 4WVFA 3W1WA 1Q83A 3BFVA 2PA0A 3FN4A 5LP6A 1C8BA 1PQ4A 3ENVA 2C1XA 5TGZA 3A4NA 4FHGA 3UAWA 4D98A 4J7AA 2Y99A 3UJ8A 1XJQA 3GD7A 4G0PA 3EAGA 2BMDA 2O7QA 2A0YA 3FGOA 2RHMA 4D4KA 4CUKA 1KZHA 2F3UA 2BE7A 3LF1A 4QSHA 1J97A 3NHYA 1P9LA 1QIMA 4X62B 4DXDA 3MZ0A 3HL4A 1FLNA 3D6MA 4H1HA 6NULA 2CLKB 1Y7HA 2JFFA 4IV5A 5EWLB 4DNOA 3NDBB 2YWDA 1T4MA 2IH4A 1MABB 4ZYWA 5IAEA 1MMFB 1U02A 2P9BA 1JR3D 1LLUA 5K3FB 1K97A 1W4BA 4Z4EA 3Q1KA 5DASA 1NJGA 1Z5WA 2EJCA 3CTPA 3ICVA 1M2HA 3L0CA 4KZKA 4PO1A 4WEQA 3O8NA 5CLGA 3D6HA 3IYLW 3V1MA 2PSDA 3P2KA 4E3ZA 4ECEA 4ZT2A 1SKMA 4R4JA 5HIJA 5BNTA 4G8JA 2JFOA 2WAAA 3DE5X 2G1KA 4QPJC 4EHJA 4MUYA 4XKJA 4UNSA 4BAUA 2VP3A 4KVZA 5BR7A 4C7XA 3PS9A 3U0BA 1EVYA 4M0CA 1OX6A 5HK9A 1KVRA 1OBFO 3B3FA 1DBQA 2BL4A 3ONWA 3I9FA 1TCVA 3PQDA 1YZUA 3IP3A 4MRMA 2R1VA 2AXQA 5JS7A 1Z28A 2BGJA 4BNHA 1TO6A 2FH5B 1PQYA 7YASA 1WETA 2CLSA 3T7DA 1GTRA 2R1ZA 2BMJA 4GMFA 1TJ3A 3ENWA 3P0EA 4JCCA 5EXDA 2H8GA 1U0EA 2IYVA 1I4OA 4MPRA 3VJMA 4L4XA 1T8YA 5K8UA 1MQ9A 4JI7B 2XYHA 1AZSC 4MINA 1KR5A 2V54A 2ZDGA 4QXQA 5DP2A 4QJ3A 5B1HA 1PR5A 3BRCA 1H2EA 3QWBA 4A6DA 4C2AA 4UTPA 2DEUA 3MWJA 3AY6A 4ALKA 1LBQA 3CVXA 1LTKA 2OILA 4BFVA 2P9CA 1Y9ZA 3PICA 2CWDA 3LKVA 5F7ZA 4TTQA 1UADA 9ABPA 1BD4A 1CZOA 1SG9A 4QGFA 2CKMA 4YIKA 1TJ4A 4UBNA 5CTJA 5KMGB 1AD2A 2A9OA 2WT8A 2WHYA 4KIUA 4O4HA 5AUPB 5IJ9B 2AKAB 3W8DA 1E3JA 3QY9A 1DAEA 1WLYA 4INJA 5BSHA 1KY2A 1YOVB 5K3BA 4D02A 1I01A 1K63A 2HOQA 4O1MA 3ZHSA 3OZCA 4U1RA 1RI5A 4KQCA 1Z8HA 3T15A 2HUNA 4EYQA 3EBLA 1RZRA 2IBMA 3PSAA 4HQRA 2SKCA 4RMIA 2NSYA 1RPTA 3M4NA 4I4IA 5I6DA 3DMGA 4ZDWA 4EW2A 5CCEA 4RZSA 4QREA 1T34A 2KM1A 3DDSA 2PYIA 3EZ6A 3HSSA 3O75A 4GMXA 3WSWA 4B85A 3AEKA 2J3QA 2XMZA 3EDMA 2G06A 2HT1A 2GOYA 4RPCA 5LNK6 4I4TB 4JLPA 4UEJA 1IK4A 2C94A 4PFSA 1M1NB 3Q87B 1SMKA 2MTBA 3R44A 3CVWA 1TNDA 1G6KA 1XZ8A 2TMYA 3T5GA 2JD0A 2REOA 3HL0A 3PNVA 2MSEB 4H16A 4F86A 1NC1A 1XZKA 5CYGA 4CDNA 4Y2JA 3UJPA 3G2OA 1Y8QB 4Y2XA 5JAZA 3UK0A 1R4MA 2I4LA 3NR2A 2JL1A 3QPAA 2YWRA 3CVUA 3G0GA 1K5HA 4OBEA 4P5DA 3RS7A 2ZM5A 4PVCA 3PVSA 1DCTA 2Q6LA 3VJKA 1FFDA 1JVSA 4EGFA 4F12A 4YPFA 3DVAB 4YT2A 1NLFA 5ALQA 2G80A 1ZJJA 3DBRA 2V6MA 4ZI7B 1XI2A 2PQ2A 3CW8X 4JLJA 1RKXA 4HB3A 3D7RA 2X15A 3D3QA 4YONB 3UKDA 3EG5A 4A2PA 3I4LA 3DW1X 3LQQA 3H83A 1U2GA 1A77A 3OU6A 1X1QA 2M1XA 2YHIA 3JSAA 3K0CA 4D57A 1AKRA 1TPZA 1NATA 4MS3A 4GDFA 2HBZA 4TLEA 3Q7QA 4HPXB 4QUGA 3MF4A 4Z1MA 3HYCA 5TB5A 2QTVA 4Y67A 3UF0A 3ZG6A 5IAKA 3DBLB 4E6PA 2DWQA 3H0KA 4CQLB 3Q40A 5I51A 4RSGA 3N2GA 1OBVA 3BDVA 1BCSB 3DE7X 4O33A 4OSOA 1J07A 1XTJA 5JXGA 3T7KA 5AESA 2ZBDA 3KM0A 3QA3E 2O50A 3F9RA 3K9WA 4G63A 3F73A 2JLXA 5NULA 1CNFA 2H7CA 4FC7A 1YQTA 5AI6A 1TK9A 3KSUA 1NY5A 1HYEA 4HMQA 4QZVA 1NWCA 3NBZC 5H7XA 2Z6UA 3NAZA 1D2RA 1IY1A 1ZLXA 4MIOA 2LIPA 4KE8A 4B84A 3VR4D 2ZSJA 2QVYX 5JNWA 3FZNA 1BE6A 4YRLA 3E7XA 3WYGA 4AW9A 3ZCTA 2PMBA 4KLRA 1E3SA 1HL7A 1UOQA 2W93A 4N3CA 3TOSA 4BB6A 5C53B 2LW7A 3JWIA 1GFSA 2IF2A 2F3RA 4OMDA 4US1R 1HQDA 3GWGA 2M98A 1FRNA 3VR0A 2V55B 2B78A 2BRUC 4HAIA 2YKGA 4LDRA 5IK2A 1L5OA 1NW7A 4Q4HB 1N5JA 3GT4A 5JATA 2IGBA 1SD1A 1Y8RB 2F8MA 3JQEA 3GH1A 2XDYA 3V4VB 2UVPB 4YA6A 3DLHA 3DD5A 1WMBA 3PGXA 4LFAB 3DP9A 3OQIA 2PZAA 2DQZA 3N3AC 3PQ6A 4D79A 5KBYA 2YIDA 1NN3A 4U2DA 1RXEA 5GIOE 1EM6A 4XGKA 4ZO6A 5GY7A 5JCOC 1L5WA 2K7ZA 2OY0A 4O3FA 4B2LA 4FMPA 4X85A 2FW6A 1FP4A 3LYHA 3CINA 4RVSA 3PPVA 4QYMA 2IK8A 1XVLA 1GUZA 5DOVA 5AM1A 1JZQA 2WTEA 3VU9A 5H59A 1YA6A 4WLUA 1MIHA 2KJQA 1URPA 3OLWA 3QPWA 5HS6A 4BV3A 5IVHA 3IX7A 1G42A 4V03A 1KZGB 5FOTA 2TS1A 1AB6A 3MWDB 2Z0MA 3MYYA 1Y6QA 1KI8A 4QG7A 4RXUA 3RFVA 3TW8A 1GPJA 3H3FA 2QBYA 3PP8A 3V6LA 1XTPA 2FJPA 4KVFA 1QDEA 3L8GA 5FPSA 3G23A 5EJAA 5FTNA 1D07A 4R1OA 4KB5A 2CXQA 4ARBA 5JPDA 4CIBA 4LMRA 1Q6ZA 5CX4A 3RRXA 2I8LA 2IP2A 3CLUD 1G55A 2FW9A 2C1EA 5IX8A 2OBMA 2CLDX 1RQGA 2HMYB 3OUZA 4G0WA 1AM4D 4UNPA 4H35A 3VOTA 2RH4A 2PX0A 1S2GA 3ETJA 4ZV4A 1B8UA 1GHTA 1QH0A 3KR2A 1F0KA 1Z63A 3ZXUB 2BAGA 1T0BA 2AMLA 3OETA 1ZM4A 2ISSD 4IIYA 3RG8A 1R8QA 2IKQA 1SCUA 2DQSA 4BY9E 2Y1DA 3TYXA 4JP2A 5D5PA 2IYOA 1M1UA 2GS9A 5COQA 4EKDA 4XDHA 4J16A 2C2GA 1R00A 1TTHA 1WW2A 1JWBB 2I2BA 1Z73A 3BZUA 3QE9Y 4KITB 3TZCA 5A0VA 3RSOA 4RKWA 1M7GA 4IDBA 1SOWA 2O14A 1EU1A 2CLEB 2MYPA 3PNPA 5A9RA 1P2GA 2D1TA 2BFNA 4Y1EA 3T12A 4AI6A 3FYSA 2FPOA 4K9RA 4Y6PA 1OXTA 4KQ6A 3ORQA 3K9LA 4PLVA 2WF8A 2DCMA 5DK4A 4GI2A 5B1SA 1CD5A 3JQQA 4X7BA 4YV7A 1IN1A 4Y2GA 2RGDA 1LUAA 2B4AA 4L7VA 5HMMA 3ROEA 2L18A 4LECA 1WP9A 4S35A 5KVSA 4G37A 2JI4A 5FWXA 2OHOA 4EK9A 2B30A 2OV2A 4TUYF 3F5DA 5DM4A 3RKRA 4RABA 3SU8A 3O3CA 3I9V6 2CMDA 4Z0HO 3ZZNA 1WY7A 1SBCA 4MZDA 4PLHA 3WL4A 2JAWA 1V8OA 2ZE7A 1Z6XA 4RGVA 3L4KA 2GA8A 4FGUA 1LU9A 4Y6LA 3SS9X 3JQ8B 4REOA 2XB4A 2JKZA 2R60A 4YV2A 1WBJB 4M7OA 3WO1A 3FMIA 1YFZA 4FKBA 4DCMA 3NTQA 3W2HA 5NLLA 1M72A 3SP1A 1H8HA 1QF9A 4R2LA 3L0IB 1XKQA 2ILTA 2B94A 5KOJB 1EM8B 2FW1A 4RK1A 1GKIA 2JLBA 2XUGA 1AZLA 1DRUA 1G8PA 1M1YB 1NXPA 4IQ4A 3CV3A 4XQ0A 3VPDA 1P1CA 4CM8A 2FW7A 4R3WA 1O95A 1BOFA 3DNFA 2ZZKA 2G17A 3E2IA 1QVVA 4F38A 3AM5A 3IV9A 5HNKA 3FWNA 1AV6A 3AF5A 4DV3B 4A27A 1RAFA 1BS9A 1BN7A 1Y9EA 2WINI 2Z9CA 1KFKB 3HA5A 2Q27A 3DDCA 4N7JA 4BNGA 3EAQA 2OT3B 4RXTA 1QNFA 4MXDA 4DCJA 2A5JA 2CHGA 3O84A 4JKIA 1SXJD 2I0FA 3CX7A 3AZQA 3HC7A 4LOLA 4ZQBA 3TZQA 2JDIA 4DRXA 2R44A 4NDAA 4ZRMA 1T4CB 2UAGA 2XQKA 2H07A 5DEIA 2XUZA 3IAXA 4GQIA 4A0QA 2IYZA 1Y63A 1X77A 1YJBA 4O5AA 1RPZA 4JT8A 1NRIA 4U00A 2AF4C 3ZU4A 3NJRA 3C7DB 4ENSA 6CHYA 4PX9A 4LYHA 2C8VA 3U61B 5AM0A 4PZDA 4CFZA 3Q6NA 3C6ZA 1RZUA 4IYJA 4XIYA 1ORVA 4MKGA 4EYEA 2IDJA 3MCUA 3KDSE 4I55F 5DO9A 5F5XA 3LC7O 3K0FB 2JK0A 2NTEA 4RD6A 5SYMA 4BO1A 3V9PA 4KE6A 1QFJA 1XRSB 4IIJF 5AVYA 3BSSA 5BSGA 3W4JA 2E9SA 1Z3CA 3RNOA 3M4JA 2P4SA 3VJLA 1X0XA 1ZI8A 4BV2A 1E1CA 4AKHA 4UUNA 4LHXA 1P72A 3C15C 3K1JA 3PDJA 4UEOA 5FPYA 2ZIXA 5ALEA 4AUKA 3N7TA 1MAVA 8OHMA 3ON5A 5B3LA 1W36C 3AIKA 2IPMA 3B1KA 3BMNA 3EVDA 1KYYA 2BFCB 2H7VA 1OI4A 3C8DA 5B7QA 2FMKA 1OF1A 2HCJB 1P7WA 3DFMA 3PGVA 4BJ6A 2BUCA 3T54A 4Q82A 1QH1B 1Z16A 3IQXA 1Q3KA 3C3DA 1BQ3A 5JZSA 1Y5MA 3O4IA 4N47A 4MVJG 4EGSA 3ACBA 2EZ4A 2ECQA 3B2EA 4IMRA 3HKEB 4GX1A 1IBRA 4CZ2A 2CDAA 1NP7A 3H3XA 4J4HA 5H4HA 2XMSA 4LYAA 2VWPA 4YJ2F 3JQAA 1TU0A 5E0OA 3VDQA 3V42A 4R2XA 3IIIA 4Y2SA 1SOAA 4P4TA 1NAIA 4B0PA 5BN4A 4RHYA 3CKKA 4CKBA 4X84A 1ZXLA 1TI7A 2FVXA 2MSDB 2C03A 4BFXA 4KN8A 3C41J 2QU8A 4KXVA 4P4UA 3OEYA 5KHAA 4DT1A 4BVHA 2I3ZA 4ND6A 2DX7A 3OH8A 3E2MA 4EARA 5AIAA 1LVHA 4R7ZA 1RRVA 4MPDA 5DNVA 3ANSA 2Z57A 4AZ3B 2GEJA 5DULA 4AYXA 4D0LB 4W5QA 2W9XA 4H15A 4AJJA 1VGQA 2IELA 2FFHA 2HBQA 5EJ6A 5ALHA 4LMPA 3TFWA 3SX0A 3S2GA 3TNYA 1LLDA 1Q1EA 5BUQA 2O2SA 5TIIA 2CLIB 3ROZA 4DN6A 1D0VA 1YTUA 4TMWA 2BFBA 3HM9A 4DM3A 1KEZA 1DE0A 1JH9A 5JW6A 2H4WA 4BZQA 1CQJA 1AX9A 1GT6A 1GPKA 4YY3B 5KYTA 1CXZA 2YBDA 3C3XA 3CLVA 3EGOA 4B7UA 5B55A 4ODIA 2GRUA 4UCWA 3H9BA 1U6JA 1ZA2A 5HZKA 4QUEA 5A6SA 1NYRA 2P1ZA 1LF0A 5HCIA 4TXHA 3BQNB 3MBOA 1LBHA 1PV1A 2XOEA 5D3MB 4CHTA 3I09A 4AIRA 2ZR8A 4BNYA 1O9BA 2DLDA 1PO7A 2B5OA 2BLLA 3ZGVA 4IQ0A 5HIKA 1E3DA 2YIVX 1R0WA 3PZBA 4EUKA 1SCIA 2PGLA 1YRHA 3MNFA 4OLJA 1TVMA 1WCIB 2VF2A 4GP9A 3CRNA 1N8KA 2J4CA 2GNOA 2R68A 5B7PA 2FF5A 1GL9B 1NVKA 2EC5A 3QPCA 2RAVA 4FYYA 2P40A 1WSAA 5DLYA 1AGYA 5C34B 1JXMA 3OFJA 4NOMA 4Q47A 4CKWA 2DJ5A 1QUEA 2WDPA 3LX6A 2UYGA 4TL6A 3OZXA 1HEYA 5T4EA 3HMQA 2H3EA 3DQQA 3P7MA 4RH1A 5H3CA 5KSWB 2OV4A 4HYYA 4JJ7A 4V0ME 5AK5A 3ZNNA 4ESVA 3ZJTA 4QU5A 1RZRD 2AVDA 1TMGE 3K8YA 4CDGA 4DYVA 4MS4B 3ENZA 2ZUFA 2QRGA 3VSDA 3G82C 3FTCA 1KZ1A 1BXGA 5AKLA 2WIFA 1TCBA 1HYBA 2BR4A 1I4EB 3CCCA 1I4DD 2D2VA 4I3FA 1T36B 3QSYA 1ORWA 1RJGA 3B7GA 4L7QA 4CI0B 4GVLA 3HFGA 3HI6A 4J91A 3L1IA 4OHUA 2EERA 4NOJA 2QW1A 5ALTA 3SSAA 3SS7X 3PEUA 3WISA 4BB9A 4WHMA 1E63A 2IPOA 3UWSA 4F9TA 4K6HA 4OHYA 4F2WA 1SBZA 2FPIA 1X3SA 2A9VA 2ZRFA 3U3JA 5EJGA 2IQ5A 4A2QA 2EFGA 3ML1A 4Q9KA 2Z09A 3NBUA 1W73A 4HDSA 1TJ5A 1B14A 1QF7A 1RFLA 1UKVY 2YWFA 1A5ZA 5FBWB 1LX7A 2HRBA 2P5SA 3AUFA 3SOPA 1NAHA 2N47A 1OT5A 4KQWA 4FB4A 3QVGB 3ZE7A 5EJ7A 3AHJA 3B38A 3JQBA 4PZEA 3V8QA 3HJRA 3JYNA 5CDFE 2D5AA 3DKVA 3I05A 4GBMA 2W5UA 3USZA 1AB5A 1EJ6A 4XQEA 1JIQA 2HU7A 3CB2A 1VIVA 1Y8AA 1NRJB 4L74A 3U1VA 4E1AA 1Q7TA 2O2YA 4TM7A 4WX2B 4YRPA 1YOBA 2Z1NA 3PUIA 1LBTA 1D2NA 2XI4A 4OQPA 4PGAA 2FWIA 4URFA 4K9SA 3OEWA 2O8BB 5EMLA 3RSHA 8GPBA 2I6TA 3NHPA 4Y0VA 3MTIA 4UOEA 4I8XA 3IEUA 4GHWA 1E1QA 5B2ZA 4JLWA 1OR8A 2YW9A 3C4VA 2YQ5A 4L0CA 4U2EA 1JE0A 3ZEIA 2BFDB 3RVQA 4ZCSA 3P9CA 4OH7A 3DGFC 5SY6A 4C43A 5LIRA 5J3JA 3R2JA 4BU1A 3VO9A 3NEPX 1CUVA 4JYZA 1C4XA 3KZ1E 1SVLA 5ALUA 1N0UA 5AHKA 1YR7A 4Z49A 3OIGA 4OJQA 1WPRA 3FOCA 3EWAA 5JOQA 2QLBA 2D2FA 4A8TA 1VLHA 16PKA 3WLIA 4M83A 4PSAA 3RC7A 5CDFA 1Z0DA 4V38A 4UVHA 3WAKA 3Q8KA 5BWLA 3ICPA 2VJBA 3KG2A 4P4LA 4PO9A 3FUVA 4ZYLA 3RYIA 4AF7A 1V1RB 2R1TA 3IP7A 3KELA 4M1EA 4EVSA 5IHPA 4EQ6B 1NUUA 4ENVA 3SPXA 4TV8B 4A16A 2Q2WA 4LIPD 4YIHA 2NUPA 2VBFA 3NIGB 2ZFUA 3ED5A 1UBLS 1A8UA 3GVIA 3OKFA 4D0NA 2VHUA 2ZJ4A 3UWKA 2QQEA 5IBCA 2WMNB 3FOAA 1XNJA 1X3LA 4Q9DA 2IF0A 4PQEA 4Y2QA 1RJ9B 5SY9A 3PA6A 3A28A 5CX1B 1XL0A 2R4UA 1FMFA 4EY4A 1I2CA 4KXFB 4NJEA 3RJTA 3TEJA 1OIWA 3SM3A 3RYTC 2IZ5A 1JIIA 2HRDA 1P4HA 5ITZB 1FDTA 1W9MA 4ZT4A 1UKBA 2VHVA 3EOAI 3DTVA 5K03A 4OQ4A 3CT6A 1U0RA 5IDWA 4OLAA 4B8ZA 2NAFA 4AJEA 4DQXA 4MR9A 3TQCA 2NU6B 1UDAA 4WEOA 3W6UA 1C0PA 3ILHA 5JDCC 1YMUA 3HJGA 1IHXA 1LPOA 4TWIA 1XLTC 3IAM6 1KKLA 5KQSA 1VCIA 2VNAA 2WSMA 4QECA 5IZCA 3V1KA 4BX3A 4Y7DA 3G0DA 2HREA 3R0VA 2K4MA 3EPKA 2PZGA 5JG7A 4EJSC 4PBTA 1UPAA 3IBFA 1U8YA 4L5JA 3DT9A 4ACAA 2QP9X 2C9YA 2BW0A 3D8TA 4GZ3A 3MFYA 4YRRA 4IGEA 1JQEA 4HL6A 1FB5A 2IE0A 2PGXA 4JJGA 5A71A 3SSMA 4CNBA 1WDLA 4QO7A 4KVAA 4JMPA 1L1EA 1Q19A 2PBRA 4D3SA 1ZK0A 3L6BA 4LYFA 3QFFA 4BQNA 1VL6A 2JIMA 1PE0A 2R8XA 1O6ZA 4D6YA 1RRKA 1BA2A 1O97C 3CKMA 4B6OA 1OTHA 5CA1B 2PKQP 1V48A 4PQYA 4MV1A 4RVHA 4Y9TA 3ZW9A 3OE4A 4CF4A 4M0UA 3TRFA 3ETEA 4UASA 3LGSA 4D4IA 1K98A 1BU5A 5DW0A 4EBFA 3RIXA 1B00A 1L5QA 3R7SA 1RKUA 4TMVA 3HBAA 2A5LA 1QYIA 4X71A 2NVUB 4C6HA 4MVCA 1W34A 1DQRA 1QE3A 2K6GA 3FFAA 4CM6A 4D9JA 2B5WA 4JUCA 4XWTA 3U44A 5H80A 3JD2A 4QHSA 3SQWA 2H31A 5BPHA 1XZMA 2RJOA 3KXLA 1DBPA 4WBXC 1HFJA 4BXOA 1ZW6A 3PXCX 3U3OA 2D1YA 5K8JB 3VV2A 2GZ2A 2VA8A 3LXRA 1G2IA 2WUEA 5CLHA 5K3CA 2NVOA 4E5NA 3VNBA 4V0SA 4NS1A 3A25A 3ND5A 1Z5GA 5DBFA 1E9EA 1SRRA 5LQSA 4F6LA 1Y98A 3NBMA 1T6YA 3AEYA 1LC0A 1R0RE 4UBMA 3OLVA 1HDCA 4YCJA 5G4KB 3GNQA 5DF1A 6ADHA 4L9WA 1MOPA 2GTPA 3GXOA 3P2OA 3UJ7A 1KP3A 3F67A 3DZKA 3Q41A 1X15A 2X3UA 4HUQB 4QT0A 1HDXA 3CYFA 4HX9A 5I5GA 3GQBA 1IJEA 2NZXA 1WHSB 3H42B 3O8LA 1GSOA 1RWWA 3QUCA 5G53C 3ZY3A 2AX3A 4ESHA 4LTDA 2P4EA 4CM3A 3GZJA 3WMFA 2XBUA 4JR2A 2EFHB 4WBSA 5KINB 4C5CA 5CIQA 2JB9A 4FSXA 3W8NA 4FYXA 3W6ZA 4KRFA 3N7UA 5AVKA 2G9NA 3F6SA 1J0EA 2ZLBA 3ZWAA 1PNRA 1LPMA 1O95D 4X8OA 3WK5A 1QVWA 2HPHA 3MOGA 4XGQA 5HSGA 5C46F 5IKOA 1JJIA 1VMDA 4I8DA 2Q50A 5JZBA 2AR0A 1XXHB 2N46A 3DTTA 5L40A 1G6HA 1D4ZA 3AHEA 3FUCA 2VWQA 3LBNA 5EUQB 3ZQUA 3LK7A 4DILA 1AQNA 4BV9A 1DHRA 2FPKA 3GPDG 3VHXA 2O23A 1JJAA 1E69A 1R6UA 3DJYA 3IKTA 3P1JA 3EF1A 4BB0A 1OB5A 2QRMA 4I8IA 1T6XA 2JDID 2C5GA 2ZI6A 1V3QE 4MGIR 1JHRA 2B4KA 2PSFA 1KFEB 1TF5A 3GDOA 2VZ9A 1U2DC 2PYZA 3QOXA 4YT5A 3UCXA 5IVDA 2EAUA 4B87A 5JXHA 2DB3A 4HO1X 5K0NA 5FD8A 2Q4RA 3OX2A 4OQLA 2Y1WA 1Q91A 2HPZA 3PGA1 4U5XA 1E9AA 5M04A 3ORRA 5AXDA 5HBGA 1XMPA 2CJPA 4G5RA 1CF4A 5CB8A 1EXNA 1AMNA 2VP5A 3CURA 4HH4A 3TUZC 4TQAA 4QTZA 2ECPA 4OIMA 3NVKI 2FZVA 5D85A 1EGVB 3H5WA 3RT1A 2UZ1B 2P0YA 3IB3A 4BNXA 5C5IA 3EX7C 5A3SA 3B3GA 3G49A 4Y6QA 1G8AA 4CCYA 2OYRA 5FORA 2Q3MA 1GNSA 3GCWA 3STWA 3DMTA 1FSPA 4W9NA 3K5PA 3AEXA 2VUUA 1TU3A 3PD0A 2WUDA 2GN6A 2R7MA 4MYCA 2CLFB 3COWA 4MI1A 5CGZA 5DNUA 4EEZA 5F9HA 4IIBA 3AXSA 1MENA 1PZMA 3EVGA 1UMCB 3HXKA 3IE2A 5LUAA 4CM4A 4KFSA 3OICA 5IAGA 2BH2A 1F8FA 4EHDA 1H5QA 4CQNA 3AILA 1PT5A 2BGUA 5G1NA 1IL0A 2V3WA 4EO4A 3JVEA 5FNVA 3HRIA 4AMUA 1I14A 4J4BA 2EZ8A 5DM1A 5COBA 5K4AA 1W59A 4XSGA 4JN6B 4Z0TA 1KE1A 3VSEA 2GCOB 3X1XA 1E4EA 3OFVA 2VDRB 4KUHA 3VSBA 4LCBA 1DG1G 1HZJA 2Q9CA 1KSHA 3ELWA 3LLMA 5DTJA 3TOXA 4OI4A 3OM0A 3U4IA 3G1WA 1S2MA 1X7GA 1YDHA 2ZUCA 2I67A 3MUEA 3MXOA 3JARA 3NAQA 4LWOA 2VI5A 2WE7A 2WHPA 2MSLA 3JQAD 4N7BA 4NV0A 4XX1A 3WKDA 2M6KA 4F46A 1EFLA 4MAMA 2NO1A 2Q4OA 4RIHA 3RDPA 4U0JA 3UT0A 1YQGA 4HSEA 4QUBA 1RD4A 5JRDS 1V4NA 3R5JA 1UXGA 2EFYA 1GTVA 3ERCA 3GV0A 3SYKA 2BSXA 4J1QA 2AQ8A 4INPA 4YVFA 2ZAGA 4KGXA 3ROKA 1BFUA 4MR8B 4OQXA 2B37A 2Q29A 1A2QA 1T35A 1WZUA 2AFVA 3AKYA 4X6UA 4AZ0B 1SIWA 2ZUUA 1U3DA 1KQOA 2JLSA 1CIVA 2C7BA 3DXZA 1G17A 3QVTA 4RGYA 3WE7A 1XMSA 3AR9A 2LCIA 4AJ4A 1KIAA 2QTHA 3MTQA 3GC6A 4F8JA 5CH8A 3ZDCA 2D59A 3PNQA 3Q7EA 5DGIA 1GQSA 2D4HA 4PLYA 4TTJA 3UH0A 4EI7A 7MDHA 2I54A 3QYAA 4WCFB 2J3EA 2PX2A 3EA0A 1S6YA 3GA5A 3KZVA 4TMZA 1IUNA 5EQJB 3W2EA 2NT3A 2NACA 2QLTA 3C0KA 4X00A 1HH4A 4B09A 3K70D 4HG2A 1XOIA 2QMOA 2JGAA 2WYVA 1LJUA 3THXB 2GLXA 4MGYR 1VJCA 1QQ7A 1Z7EA 2I78A 2M6SA 1GEGA 4HWOA 1UBKS 4M60A 4PZAA 2NZUG 3W04A 1ZIDA 5JTUA 1IY2A 2DPYA 1RMQA 2OKCA 1N1DA 4LSWA 4J0FA 1ZNYA 3BWMA 3P2MA 4EI9A 2WF6A 2R00A 3QFRA 5JFOA 3IDSA 2BVNA 1NUQA 3D7KA 2GD2A 5A4MS 2FR1A 2YZNA 3HR8A 4Q3LA 4KWEA 1IHPA 1UJ4A 1UZUA 5HKOA 2R6ZA 3PIRA 1DBSA 3B1VA 3TF5A 5IULC 1ESEA 1YS6A 3Q3EA 3WB2A 3QIVA 4DMFA 2JBWA 3QBTA 1CZNA 4N65A 5JALA 5CB4F 4QARA 3NIWA 2ONZA 5DLEA 4A0RA 4YP7A 1G8SA 1W4AA 4NMWA 2AQIA 5HMLA 1UWLA 1LSSA 5FUMA 1YZVA 3FBWA 4CKCA 1N2SA 2CBXA 3G79A 3C6MA 2JATA 1CUIA 3E05A 3O5AA 4M89A 1GCUA 2W37A 4MW4A 4PSCA 3I3OA 2QVGA 5F3DA 1YB4A 4W8HA 4AJHA 4DR5B 4AN0A 4MW6A 1GFIA 1QRAA 3PJFA 3QKUA 5LA6F 4MSUA 1R8YA 3GFVA 4V0OA 4Y0NA 5CH5A 1J99A 1YKSA 1P2FA 4BJ1A 4PG8A 2FG7C 4XM2A 1AZWA 3AG5A 3BM5A 4W5HA 3PC2A 1B3BA 4LF4B 3WL5A 1H66A 2JFXA 2V6BA 3TZEA 4NZOA 2OHVA 3ITNA 1OWNA 3GEEA 4UM9D 5J4KA 1U65A 2HK7A 4IOMA 4G23A 2I71A 3UQYS 1A9PA 1O3YA 1VGVA 2WF9A 3T9CA 3ZE1B 4QU8A 4RPLA 3AHHA 5DBOA 5JZMA 2I2WA 1ZK4A 4TGLA 3ANYB 5L8VA 2LDBA 2QL6A 3MWEB 1DQZA 4NBKA 4AM8A 4HT3B 3ES9A 5AJYA 5HP4A 3NPMA 1LZKA 2GM5A 3I45A 3NDRA 4X92A 1JYFA 3OJOA 3T5BA 4NCIA 1JDNA 2EBUA 1SQFA 1ZMTA 3DAYA 1GARA 2FXIA 3MPUA 4TSKA 4WOPA 1U9ZA 4C1NA 1E1QD 2PTHA 3L6OO 1JQDA 3IR7A 5ANRB 1MOZA 3Q0IA 5BOVA 1GNLA 1SHUX 1XG5A 1J8MF 1DDOA 1LI5A 4TLCA 1CBUA 1GAQA 2IYWA 3D6TB 3EDYA 3RM3A 1I2MA 3MGBA 1TC1A 4D2IA 1HI9A 2J31A 3AF0A 3DMRA 3H87A 4UUOA 1H94A 1VIMA 1U0GA 3T7CA 1E62A 1YKFA 2V7WA 2VZLA 3C3BA 1BDIA 1G20E 1SKBA 4TYWA 2XNJA 1J2YA 3MT9A 5J4VA 1P31A 3QUQA 4C2TA 1P77A 4ZOLF 5DLPA 4C4XA 2WSBA 4K9QA 5CP8A 2NU9B 3D81A 1D2CA 2XUJA 2YV3A 4KHZA 5JD3A 2AN3A 1FNDA 4MVYA 1QTIA 1GU7A 2GEFA 1YL6A 3QGMA 1N4AA 4JGIA 3RK0A 1WULS 1BMFA 3ND7A 4BFZA 3HG7A 3VFDA 2FEKA 2I6FA 4LQCA 1DKUA 1HFEL 1OV6A 3IHLA 4GE3A 3WO0A 4NKRA 1YNOA 4M55A 4DB2A 1V4BA 2R85A 3A3PA 2JASA 1LA2A 2NYRA 1QVRA 1YB5A 5JV5A 3FG9A 1AKUA 4KDFA 1C3LA 2PBLA 1HT2E 4O4JB 1DIOB 2IPAB 3OTOB 2ZE5A 4LTMA 3LY5A 3JRNA 3PFCA 2PJRA 1CRLA 1DCKA 1L4YA 1D8TA 3G5MA 4CV1A 3P52A 1G1MA 1TK2A 1UMDB 1Z2AA 2VCEA 3PKZA 1JR4A 3RHTA 4EENA 2X1VA 1NZFA 1GYPA 1AURA 5IUNC 3WK9A 2GPTA 4N9QA 1C7IA 5CG2A 2CYCA 4IJQA 3W6PA 1P8JA 5T6MA 1X1TA 4RA9A 1EFDN 3I1YA 3PC4A 2YWBA 3RS4A 3AKCA 4AMGA 3DTVD 1G20A 2DUWA 3ROPA 5JAPA 2NYVA 1M2OB 2A67A 5EHXA 3LUGA 2HF7A 1QPZA 3KOOA 3KB6A 4ZJYA 3HA7A 3HUDA 2QVZX 3L7AA 2CMFA 2XT6A 4UCFA 3G68A 5E95A 4B4VA 3DONA 3U7RA 1INLA 4D97A 1CLEA 3PYMA 5KX5F 4P35A 1TF7A 3B6IA 1KI7A 1EA5A 2BEVB 4Z8XA 3UK2A 1G8YA 3NOOA 3SXUB 3VI3B 4EF4A 2XGOA 4R9RA 2QOEA 2EHDA 2NOAA 5IUKC 2O0LA 2QGNA 3VH2A 3ETDA 2HK9A 5I5EA 2ANCA 1RXIA 1NY6A 2Q3JA 4L9SA 3TNFA 1ITZA 1H2RS 4F6RA 2BR5A 2PGNA 1QX3A 2I9KA 2WDZA 3STXA 4N76A 2YXDA 5DTIA 1ZVJA 4WGGA 3PIDA 1KVQA 2BN4A 2YDXA 2YY5A 3RROA 1I7SB 2ZT6A 2WU0A 3LT2A 3NM5A 3NM6B 4URHA 2Z2IA 2GEDA 2WA1A 5JAUA 5F7XA 1I3OA 4WECA 3ZE6A 2Y27A 4YYZA 1C9YA 2F3TA 2K7FA 4QELA 1FDIA 2VP9A 5A0TA 3DKRA 2YYSA 3DHYA 1KR2A 3L0DA 1U7TA 3GLSA 1U90A 1ZNXA 3BQ9A 4PHFA 3U5ZB 1EVKA 2W11A 4IG4A 1OH5A 3HFRA 4E08A 4OOFA 3YASA 3LVQE 4GPBA 3JVIA 2V6JA 1WCXA 4HYEA 4RNCA 5SICE 2YZKA 1WDTA 2AOVA 5KOYA 1RQLA 1SXHA 4K9PA 4PEVA 5B37A 4B6RA 1OMOA 1P45A 3MMSA 4QVKA 1TIPA 3ZTWA 4ND8A 2WHQA 5CT8A 4ENTA 1X87A 5F4BA 3EPJA 2B1IA 1QHEA 3VH3A 2CYBA 1WM1A 2XJ9A 3EXEB 3F46A 2DPGA 1SZCA 2W2MA 1G21E 3KJHA 3NKVA 4EM6A 4JU9A 3S2YA 3VH1A 2OXRA 1XZEA 1H5NA 5ECGC 1EGAA 4KPGA 4BCDA 3VMMA 4GOKA 1NIJA 4RE6A 1W5TA 3I5XA 3G85A 1KYXA 5MFPA 1Z0JA 1KAHA 1NGSA 4FWBA 4KDCA 3A04A 4X1KB 5B6PA 2PWPA 4QX6A 3RSQA 4IG9A 1T4DA 4TUYA 1SKAA 2FFAA 4TMYA 4ZVUA 3ER9A 3H11A 3WDSA 2H5LA 3NC4A 4ZZ0A 3QE2A 2P6RA 2BTQA 3ICWA 1CYEA 3LHFA 4DMUB 5EWJA 4FDUA 1YCDA 4CFSA 2FQWA 2IC5A 4WY2A 5GJWC 1YAJA 4HQ0A 4RORA 5CFLA 1BEUB 1UQUA 2J3KA 2WJWA 1ZIYA 4U02A 1CW2B 2ONCA 1MDBA 4RULA 5AVTA 1CK4A 1XQ6A 2PU7A 3DDOA 1GSAA 1SC3A 1T2UA 3DWFA 3OKAA 4QATA 4EX6A 2GAJA 1HLGA 3OBBA 1UEIA 3Q3CA 3GP8A 4PYRA 2CXSA 4MMYB 2XB6A 4OHOA 3S2ZA 4DQDA 2TSYB 2GH1A 4GLJA 3LUAA 4C0KA 1WQ3A 4C4YA 4W4TA 1ZN7A 2P79A 5KYNA 2B21A 5FB3A 4ZP1A 2XYGA 1A9OA 3ZZ1A 3TQOA 2GJ4A 4C0HA 3N8KA 4FZ5A 4FZVA 4M9QA 1GPYA 1G21A 4R8LA 2G04A 3NBQA 3TSAA 2YXLA 1XX6A 3QBDA 1FXWA 2BHTA 2NO4A 4E5VA 1VE9A 3FZQA 3RC1A 1F06A 1DARA 1XEWY 4FGLA 4DV4B 1GG9A 2HKIA 3AIOA 4QLAA 4GD3Q 2GZRA 4TTTS 4CG0A 2BFPA 3FLBA 4M98A 5DHQA 3P5SA 3I9OA 5AW5A 3X1JA 3HJFA 5B3JA 1FBNA 3HABA 4MRVA 2ZE6A 3EFBA 1TM2A 2AOXA 2EFEB 5TGDA 5LQRA 1B43A 4REMA 1O08A 2OZEA 4GFDA 2ZUTA 4C6SA 5EJ9A 3JQ7B 4F9FA 3MJFA 4JL8A 4DW8A 4RTJA 3FNEA 3M4XA 3I01M 4YDSA 1W0JA 1EMDA 3MHPA 1ONSA 3TN7A 5IJZA 1QP8A 1K89A 4ZQIA 2B0CA 2OKGA 3HADA 3VNQA 4B31A 5FBLB 2ZSUA 3G6WA 3ZNOA 3A4YA 5IASA 5SZKB 3U4CA 3VKHA 4IFBA 2ZB7A 4I55A 3R75A 3WG9A 5ALVA 3F8TA 4MUIA 2BBSA 1N5MA 1KHTA 1E2BA 4Q4JB 1RDFA 2GN9A 2WKRA 2FNAA 1E7YA 4HLDA 1W88A 3AR3A 3W9YA 3X1DA 1US8A 4Q6BA 5IDXA 4IIJA 2NZVG 4RD4A 3ZLVA 4HEA6 2NU7A 1E6WA 1M0SA 2HLNA 2P68A 1KGSA 1YR9A 5AKKA 4DSTA 1MTZA 2ZWIA 2GZDA 4PY2A 2YWXA 2CFCA 1HE3A 1Z6PA 4Y6RA 1YC5A 1BW9A 1ZIPA 3BTSA 3COZA 2QJRA 3JWJA 1X6VA 3NT5A 1OAOA 1KNQA 2G76A 3WFZA 2NSDA 2SNIE 2RCNA 5LLDA 4DLLA 4Q01A 5KTTA 1A97A 5J1SB 2IBSA 2PUDA 1UJNA 1RCFA 1RKBA 4RF5A 1YSCA 4RX1A 3PI6A 3VM6A 1V26A 4NG4A 3HLYA 1A5SB 4E11A 1Z22A 3JAWB 4KWHA 2XCIA 2RG1A 5FTWA 2H4FA 1JDSA 2YMLA 1G63A 1QGZA 3GP5A 1XLWA 5LQCA 2AKYA 2DECA 1ZXBA 1S7GA 2MINA 4Z0PA 4M53A 4MK4A 2VQ3A 5ADUS 1C7JA 1NHGA 2KLBA 1BJKA 3CUSA 1ZL2A 1OGYA 2VDUE 1J8VA 3LUDA 1PR0A 4HBZA 4OLHA 3E9NA 3VH4A 3HVRA 1YF3A 4L51A 2ASVA 1Y3DE 5K2MA 3JALA 2WUWE 1NVBA 3B6KA 2QLFA 2VTKA 4MB6A 2IWRA 2G9UA 2EYQA 1A0OA 4ZCQA 1WCV1 1Q84A 4MV8A 4WT7A 2WAOA 1OPXA 1HDZA 1EJ2A 3OZDA 4JGGA 1LKZA 3DH0A 2O0MA 8MHTA 1Z4OA 3F7TA 2AJBA 1UAYA 3P8ZA 2XOKA 1FP6A 1GKUB 4OK6A 2X86A 5DN9A 4JQCA 2AC7A 3PJGA 2MWMA 5ER9A 1MH9A 1XF9A 2HXGA 5EPUA 5WRFA 3UEOA 3QP9A 2IITA 1WNTA 1MIOB 1UBGA 3KPUA 4O2LA 1SZDA 3K32A 3KB8A 3C8ZA 1AXEA 3EXG2 1FZQA 4WFIA 3GO4A 1A9XB 2RB5A 4KBYA 4PNEA 1JDJA 3NH9A 5IZ4A 3H84A 4EW3A 2PIDA 1JVNA 3TLKA 1QM5A 1NVWQ 1V47A 4R8MA 1HLDA 4ARIA 1RLOA 4PHHA 2FSSA 5LXTF 1MQ8B 3JAMA 3CCFA 1ZJZA 4JMLA 2G4VA 1SR8A 3GDGA 5K1ZA 5HW0A 2BBTA 3O2QB 1NX9A 3K0HA 2EKBA 1GRNA 1H69A 3HWWA 3QI2A 2QUZA 3WZMA 4ZQHA 2I66A 5K8VA 3KVRA 1IEQA 1RJDA 3S3TA 4QM6A 4RHFA 5LXTB 4UPEA 3U60B 1UFQA 2HEGA 3CR7A 4XYLA 4C0XA 4LJRA 4XFKA 4UU0A 4Q9JA 1PK8A 1JAXA 3DEHA 4L02A 2VBCA 4YMGA 3BQMB 2QMQA 4BQPA 3EAFA 3UTCA 2XZLA 1IE3A 2QN9A 3QUSA 1J0DA 1ZOLA 5L3RA 3W9UA 4JXXA 1EUQA 3N87A 4KO1S 3OESA 1JJBA 3FCUB 1NUPA 2C2HA 2DCUA 4JUFA 3V4SA 4OBBA 2FRDC 1KY5A 5K99A 1UMBA 1FJXA 1GVNB 4D8VA 4U7PB 3OLZA 2ZETA 3IIKA 3WGYA 4B35A 2H2AA 4HB0A 1BFKA 3N05A 3A14A 1V1MB 4I1UA 4LDJA 3AR7A 4PN7A 821PA 2ZRNA 4TMFA 5FLEX 1N1MA 1DI0A 3E23A 1EESA 5HGXA 4LYJA 2QT0A 3DDWA 2VHTA 4K9KA 2XTZA 4BKOA 3THWA 2A92A 4H0CA 1BHQ1 3O8DA 4UZEA 1V11B 3KHUA 3V3KA 2H52A 3TVYA 3KJFA 1CB0A 1HV8A 1L3CA 1SC6A 3HPQA 4TROA 3U3MA 1GOTA 2GKOA 1YZLA 2W6ZA 3TX2A 1UAAA 3E5HA 3SIXA 4IDCA 3S6JA 2WYIA 1JU9A 5F78A 4ZXPA 3RVMA 1I0IA 3H97A 2EOAA 1I3LA 1MJGM 1ZD3A 2GZ3A 2RHDA 2OV8A 2IZ6A 2YHSA 3MUFA 3PNMA 5HF8A 2D0DA 2PRIA 4ENUA 1M2VA 5KPJA 3JD3A 3D64A 1NTRA 1Q7BA 4AP5A 2XNDA 4JI0B 4KR2A 5T4FA 4UTRA 4F93B 5JMOA 5KQMA 3TWOA 1GZVA 1KC3A 3TEMA 1W49A 3EOZA 2B34A 3CSDA 3WK6A 3HV2A 4GO1A 2O8DA 3E61A 5F9MA 1QE0A 2VTBA 4BBAA 2GESA 1ULSA 5A03A 3OQNA 1OI2A 4HH3C 2EKZA 1YR3A 3EWSA 3GGDA 3M82A 1VBFA 4ZI3A 2ST1A 4F0JA 1LTQA 3QI7A 4WOBA 3ZV3A 4MR7B 3S1SA 1FNSA 2FP4B 3CUEF 4MWCA 4Q5IA 4LBZA 3AP2A 1GADO 2RJNA 1KL7A 3H9JA 1C2YA 3V7NA 4Y2UA 5KYWB 3L1HA 4MVJM 1PEAA 3C1OA 1GEEA 1BYIA 1QCDA 4EJ6A 4TKZA 1A96A 3N0XA 4MP6A 3U37A 1G0NA 3NTLA 4H08A 1D6SA 1K1EA 1P1JA 3FX2A 4NICA 4PYNA 4EFKA 4ES6A 2ZBVA 5KNCH 1E64A 2GK7A 2AH5A 2QTFA 2YV1A 3FJ1A 3OG9A 5C9ZA 1H3EA 2Q0HA 1NT2A 1GKYA 3IQZA 3VPGA 3UOAB 3X43A 3K6SB 1UPBA 1X1CA 2FZKA 4MGEA 4JIMA 5EC8A 4FYJA 3WRVA 3PR1A 3WGUA 2WQ6A 1IYZA 2ZBRA 1ISSA 2GXUA 2OHFA 3PU6A 5JDCA 1KAEA 1LK7A 3C6QA 4BO6A 2RGCA 4HK4A 3CPEA 2DBRA 1N5KA 2CHUA 1KVSA 2PU5A 2VQDA 3MMPA 2ZU0C 4C03A 3O83A 3U49A 3HDVA 1BMFD 3SYLA 4FWTA 2XTJA 4MS1A 2WTAA 3M9WA 5FEMA 5FR2A 2JHFA 2CV2A 4ROTA 3TRDA 3SDSA 4DLVA 1AUVA 5H02A 3RU3A 3LPAA 2ZRLA 2C4HA 3A4IA 2H0AA 3MJ4A 1XALA 3L8CA 4N6GA 5AW9A 5THXA 5JQWA 3RTCA 4D9EA 4XDZA 3VR6A 5ABPA 1FZTA 1Q0LA 1QHNA 1Q11A 1KQGA 3BSYA 2QXTA 2R96A 2VNSA 4ZDKA 1NN0A 2JAUA 4HX5A 1U98A 2FHSA 4HOYA 1F6DA 4JA2A 2JFZA 5T64A 3LP5A 4WV3A 4ABTA 1XMOB 3RSLA 1OI7A 1RC1A 2XUPA 3D3EA 4V0LA 2ODPA 1LEHA 3DAHA 2C0QA 4XQGA 3WZLA 1LRJA 1JS1X 1E7MA 2ZYUX 4GM1A 5FBQB 2PUAA 2FP3A 4H4EA 2PS0A 2V7VA 2XVZA 5ALRA 3EEOA 2E1RA 4PZPA 3K72B 4EB8A 3O4FA 3AINA 4FNAA 3H9QA 3PLRA 1UDXA 3DEZA 4YRDA 4IY1A 2VSOA 4M1QA 3TGLA 3PA8A 3MINB 3OTWA 2PUVA 2R3SA 1W25A 3BRWA 1TT5A 1USWA 3DR3A 2MJLA 1W8DA 4IILA 4RBNA 4M4SA 2ZB2A 4UHJA 3LJKA 4PF1A 3FY4A 4FDAA 4FHFA 1NW5A 1KPIA 1XZQA 1YE3A 1T9KA 4RTNA 4Q7QA 3OE7A 1SXQA 4MAFA 2VFAA 4F60A 5HM8A 5JADA 4G1MB 1U1EA 2WU3A 5KU1A 4XASA 3TUIC 3OQOA 1KMMA 2FR8A 4IIUA 3ZHCA 1E6EA 2YNMC 4D8UA 3BHMA 1P81A 1E8MA 1Y9JA 1BGWA 2CFSA 1YDEA 1DKNA 3OOJA 4A1OA 3PUWA 2QZ4A 4JENA 5H16A 4FBMA 4YJGB 5AW6A 3M3DA 4FGSA 3MXTA 4JQYA 1V9CA 4ZU6X 4UULA 2P9TA 3GN1A 3LFHA 2JLQA 2Q2QA 4MW5A 3UATA 2R8YA 4TYPA 2UYCA 4TZ0A 4OKNA 2FEAA 2A5GA 4MA0A 1K0FA 3N2NA 5EIAA 1IZ0A 3DCNA 2V0GA 4JR1A 1GGNA 4KI0A 1O7JA 1YA4A 3AJAA 4H18A 2WR8A 2YIJA 2ZB4A 4MUBA 4D74A 4EZEA 3FR8A 1M1XB 1U7XA 1X14A 3OECA 1VKRA 1WEKA 4ZK6A 2BEUB 3GJXC 5LR6A 2BH9A 2JCYA 2FVYA 1KH2A 2R5NA 2YJNA 1O0SA 4I1PA 4FD3A 3EIEA 2I76A 2YFQA 1ODTC 4M1WA 4I4TF 2WD7A 3JQGB 1Q1GA 3IR5A 4IWYA 3O8CA 1QRSA 2VDMB 2GMWA 3CNLA 3AV3A 3GMTA 3VX3A 2N9UA 4D99A 1Y1TA 2EJWA 3BIOA 1EQAA 1RHRA 5HTOA 1ZH0A 3ZWPA 1LV7A 1O03A 3LOUA 3QKSB 4FLMA 4MWEA 4QVGA 4O1IA 4BEWA 4OK3A 3FPGA 1KSFX 1VFNA 3FB4A 4Y1GA 4DIFA 4RFLA 1E2PA 4CEIB 4O4LB 3WQQA 4CLOB 1P0MA 4MIYA 4E5MA 5D84A 3W5AA 1IN6A 4DDMA 2FJ0A 3FRHA 1GL6A 3KQOA 5EZ6B 3KL4A 3VC1A 4IXTA 4S1WA 3KSBC 3HI4A 1AGXA 4P7BA 4ZI7F 4P34A 4NAHA 1K06A 2Q5LA 2FN3A 4OXNA 5ALXA 3KQVA 1XRMA 1ONBA 4L4YA 3DBIA 2C07A 2WILA 5DGDA 3QLJA 3CF6R 1CC1S 1PGNA 2P2LA 3IPCA 1NIPA 5K6AC 4M54A 2OCIA 5LQNA 2GXQA 2ZR7A 3BHJA 3HYNA 3OHMA 4AMVA 1RI2A 3HVKA 3QE4A 2C84A 3H17A 2YY7A 3OI7A 3AERA 2ZK7A 2W4IA 4N0DA 1UKEA 5IT9A