1DG9A

Crystal structure of bovine low molecular weight ptpase complexed with hepes
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
157
structure length
157
Chain Sequence
AEQVTKSVLFVCLGNICRSPIAEAVFRKLVTDQNISDNWVIDSGAVSDWNVGRSPDPRAVSCLRNHGINTAHKARQVTKEDFVTFDYILCMDESNLRDLNRKSNQVKNCRAKIELLGSYDPQKQLIIEDPYYGNDADFETVYQQCVRCCRAFLEKVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of bovine low molecular weight phosphotyrosyl phosphatase complexed with the transition state analog vanadate.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
molecule keywords TYROSINE PHOSPHATASE
total genus 64
structure length 157
sequence length 157
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 1999-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1dg9A00
1BAPA 1YVUA 3KS9A 1P6UA 4H60A 4KK4A 3HXMA 1K66A 4XARA 3HDGA 2B1JA 4MAAA 1A0OA 2ZWMA 3A0UA 4IF4A 5EWJA 5DLEA 3I45A 4QPJC 1DP4A 1KRXA 1R8JA 3OLYA 4MS4B 1W9HA 2P9HA 4XLTA 1GCAA 1J56A 1AB6A 3BBLA 2E4WA 2PL1A 3I09A 4N41A 1KMIY 3HUTA 2NT3A 5BQ3A 3BRSA 1GLGA 3IPAA 3O2SB 3HV2A 3QELA 1MB3A 2JVJA 3KCNA 1LBIA 1JX6A 4PEVA 5EWMB 1A04A 2YHBA 1S8NA 1RNLA 4MR9B 3OQMA 3GL9A 4MRMB 4XFKA 4MR8A 5GOTA 4MS3B 5IX8A 4MR9A 1SD5A 2IOYA 3CLKA 2WWVD 4MR7B 4KREA 1B00A 1C4WA 2MYNA 1DRJA 1JLKA 1SXHA 3EQ2A 4GPAA 2PUDA 1P6QA 4LE2A 4Z0NA 5JNVA 2HQBA 4G0YA 2QZJA 4M88A 1VKRA 3O1HB 2IPNA 4NV3A 5IC5A 7ABPA 2VUIB 3RVPA 4DN6A 4PZ0A 4HNRA 3NBMA 4DADA 5C5EA 1Z2DA 3EQZA 3DLHA 3QEMB 4LDAA 1CHNA 1BDHA 4LRQA 3NNNA 5E3JA 4Z4HA 4Z4FA 1T34A 5HKOA 3HK2A 1YK0A 2E4XA 2FEWB 5EWJB 4MS1B 4N47A 4NCBA 1BA2A 3LUHA 2PUBA 2L2QA 5CNKA 1M5UA 5FWYB 3G85A 5HM6A 1ABFA 3H75A 3MMNA 1E6KA 4YO7A 2FEPA 2PUFA 4FE4A 3TMYA 4MQFA 4ZJPA 1M2EA 3OM1A 3T38A 3DBIA 4H3KB 4N0PA 1YTUA 2J48A 5JNRA 1QP4A 4MR7A 2JB9A 3TX6A 3LOPA 4RY9A 1ZHHA 4FE7A 3SM9A 4RXMA 1ZVVA 3OLZA 4OLBA 5KQMA 1QMPA 2FQYA 1MB0A 1SRRA 2MYPA 8ABPA 3RVRA 1GUDA 3H6HA 4RV5A 3Q7TA 3EODA 3EULA 4ML3A 5TQ2A 5CNJA 3F73A 2E4ZA 5TQ2B 3CFYA 3CNBA 3OQNA 4W5RA 1Z12A 1Z15A 3OO0A 4P1ZA 5IBQA 3RVJA 3F6CA 1Z17A 3I42A 2H3HA 2KYRA 2JCGA 4MS1A 2IPMA 4YR7A 1FFSA 2AYXA 4XXHA 4N0QA 2FMKA 1TLFA 5IULC 1XWWA 3RVMA 1Z25A 1JWLA 3UKJA 3D02A 3M9XA 2FXIA 3RVQA 3MF4A 4EY3A 2P4UA 3VNBA 3Q15C 3SNKA 4YCSA 3N53A 2VYCA 4G0OA 3N6VA 1RZRA 1BDIA 3QEKA 2FSPA 2PKXA 3H1FA 1EFAA 5TPZA 1RXEA 3CZ5A 3N75A 2R48A 4KZKA 1ZESA 4MQEA 1EWTA 4P98A 3B2NA 1NXPA 3I5AA 3O1JC 1RZRD 3LUAA 2MSKA 3EGCA 6ABPA 3TB6A 3H5WA 3OMWA 4KV7A 1GUBA 2HJ9A 4KRFA 2GX6A 5JS2A 3CTPA 4G0ZA 3QLTA 2QVCA 3H5LA 1EAYA 4KMRA 1ZH2A 1M5TA 4JA2A 3LKBA 4EVQA 1U0SY 2WJWA 5CNIA 3CS3A 2PUCA 1ISRA 4RKRA 1XHEA 5JNUA 1JHZA 5T3YA 4G97A 4G0PA 1JDNA 2CHEA 5TPWB 4NICA 1MIHA 1P8AA 3OMXA 4JB2A 4UHKA 4ETMA 3UUGA 3CU5A 1DCMA 1GCGA 1ZDMA 3L6UA 5DTEA 4YV7A 1QQAA 2PJUA 1XHFA 3LUGA 3H5VA 1AB5A 2IKSA 2ZAYA 3FDFA 4XAQA 3SY8A 5IEJA 1Z2EA 5TQ0A 5KC9A 3EJWA 1NTRA 4RDCA 2PE5A 1LBHA 1ZITA 2JVIA 3HDVA 2FW0A 3SG0A 3N8IA 5TE9A 5IEBA 1JBEA 3IPCA 3KTOA 5PNTA 1PHRA 4OBBA 1URPA 2F8SA 2LP4Y 4EUKA 1D1QA 1QP7A 5T7BA 4NCAA 2YHAA 5TQJA 3KHTA 2FN9A 5FBKA 3KSMA 4W5OA 4QYMA 1NY5A 3FGZA 4MRMA 3T8YA 1LJUA 3D8UA 1NXWA 4RWEA 4LZLA 5TPWA 4MQFB 5CHYA 1DBQA 2JVKA 2NZVG 2QR3A 4F11A 5DKFA 4LX8A 2FVYA 1QKKA 2M98A 4EVRA 3ILYA 2QSJA 1LK0A 2RGYA 3N0XA 2Q5CA 3CRNA 4RKQA 2A9RA 4TLLB 4Z9AA 4RK4A 1D4ZA 1EWVA 4IILA 1NXOA 2L18A 2E4UA 3BILA 3A0RB 3GA5A 3KJXA 2LBPA 2FQWA 1USIA 1TMYA 5KI6A 2MYUA 2JBAA 1U8TA 4PE5B 1E6LA 4O1IA 1D5WA 4FB4A 4RSMA 3GV0A 2OENG 3GBVA 2PL9A 3A3KA 3QX9A 3JY6A 3KG2A 3LUFA 1YK1A 2CHFA 5BRAA 2WB4A 5JNTA 1JYFA 3KYJB 3LMKA 3CG4A 4Z9BA 2M1ZA 4LDZA 5DCLA 3F7NA 5KQLA 3GT7A 4S05A 4JASB 1NXXA 3K9CA 3O1IC 4E7PA 3G1WA 2QV0A 4MS3A 4RK1A 1F4VA 2QW1A 1QQBA 1CYEA 2FLKA 4ETNA 1KGSA 1QP0A 3F6PA 3GBPA 4EYKA 2GI4A 1MAVA 4G0XA 3LUDA 3FMVA 4MPTA 3M6MD 5BRJA 1YS7A 3C6QA 3QK7A 4JB0A 3H5IA 4CBVA 1Z13A 1U2QA 3HEBA 3KYIB 3CZCA 1JFVA 3JVDA 4RK7A 4MLDA 3LUJA 4Z4IA 4RZSA 3JPYA 2HQOA 1L5YA 1SXGA 1W25A 1USGA 2IYNA 4IGAA 4KVFA 2LIVA 1E2BA 3HSYA 1Y1LA 2O20A 3O21A 1DCKA 2HSGA 3KKEA 1NXSA 3ROFA 3T95A 2FTKE 5DGCA 5ABPA 4HNSA 3C97A 2FMIA 1A2OA 2RJOA 5B3JC 1PEAA 5JNSA 1YIOA 5KQGA 4MLCA 1YMVA 3Q41A 4Z99A 2E4VA 3UK0A 2XDYA 1JH9A 5EWMA 3C3KA 4D6YA 3NNDA 4Q7EA 1K68A 1ZAYA 1EHCA 4RK6A 4NQRA 1M2FA 1ISSA 4PYRA 1DRKA 6CHYA 4F12A 3O74A 3HZHA 3FFWA 1FFWA 3L49A 3LFTA 3OLVA 2NUBA 1JL3A 4G0QA 4MYRA 3Q7SA 1DCFA 3IDOA 1DBPA 2WMYA 3OQOA 2R4QA 4EGSA 5C5CA 2PUEA 4QYWA 3T6KA 2IPLA 1IIBA 3C3WA 4IRXA 2FEKA 4RK0A 4ZMRA 4EYQA 4EYOA 3DZDA 3IP7A 5BR1A 1TVMA 4O1HA 2MSLA 4N03A 4G0MA 3A10A 4L85A 4W5TA 4ETIA 3RVOA 2IDMA 4RK5A 2GBPA 3RVNA 3MQ4A 3O2QB 3QLUA 3VNAA 4ZPJA 3DLBA 1PUXA 3MYYA 3RVKA 1ZH4A 4JP1A 1DC7A 1RPJA 2GKGA 3E61A 2ID9A 3QX8A 2V0NA 3H1EA 3JS5A 5FWXA 1QO0A 3CG0A 3RVLA 2H0AA 2I6FA 2QVGA 3HVRA 1NATA 4YLEA 4Z4CA 2ID7A 5B3JA 2CD7A 1HEYA 4HNQA 4JAVC 3O2JA 1JFTA 2AYZA 1Z16A 3CKMA 1P2FA 4HYEA 2WJAA 1U04A 1ZN2A 4TLMB 3HJFA 3M9WA 2B4AA 3P9YA 1DG9A 9ABPA 3RVSA 1DZ3A 1QPZA 2QXYA 3HS3A 4PICA 2LUOA 1Z18A 1WETA 1SXIA 4WWHA 4WZZA 2JK1A 1UDRA 3QEMA 1I3CA 4TN5A 5JS1A 4F3TA 4JOQA 4Z4GA 5KWSA 3O75A 4GNRA 4LE1A 1JF8A 4WUTA 1JYEA 2HQRA 1PNRA 1VLZA 4IMIB 4RY8A 4KK3A 1Z26A 5KQPA 4F06A 1FQWA 3CHYA 3QLVA 4S04A 1F51E 5TPZD 2PUGA 3JVIA 1E6MA 3QLUC 4ZYLA 3MIZA 5EWLA 2FQXA 3EDCA 3Q7RA 5JNWA 4WXEA 1NXTA 4QICA 1BVHA 3SAJA 5HSGA 2VK2A 3RH0A 3JPWA 3OO1A 4KNYA 3N0RA 5FWXB 1LJLA 3ROTA 4Z4EA 4UHJA 5ED4A 3QELB 2QU7A 3JTEA 1QNLA 3MM4A 4XASA 1FSPA 1PEYA 2A9PA 3BRQA 4G86A 5GQSA 4E7OA 4KPYA 1JFSA 4H3HB 3DGEC 3LUKA 4L4UA 3TO5A 4YRZA 2TMYA 5FBHA 4EVSA 2WRZA 2PAFA 4IMJB 2FLWA 1JDPA 3LKVA 3SQNA 3HM9A 2PLNA 2JRLA 2R47A 4Q6BA 4OTZA 1YMUA 1C0EA 4KFCA 4MQEB 1TM2A 2X7XA 2F8TA 2MYTA 1OXKB 3FFXA 3R0JA 4WXMA 1BDJA 1ZY2A 2DRIA 2E4YA 2FMHA 3EAFA 3QLVC 4LE0A 4MGEA 1USKA 4B09A 3DGFC 3OLXA 4KQCA 1MVOA 2FMFA 4TMYA 3N0WA 5IUJC 1DJMA 1PNTA 2GWRA 4MR8B 3IP5A 1RXIA 5EWLB 1APBA 4WT7A 3HCWA 3NHMA 2RJNA 2WY2D 3E3MA 1ZGGA 4KQ9A 2FKAA 3IP6A 4RU1A 3Q9SA 4RY0A 1H9CA 2OQRA 4W5NA 2L19A 2NZUG 3GYBA 3ILHA 2PMCA 2R25B 4YS6A 2HPHA 3KLNA 5IUNC 1EWKA 5TQ0B 3HUUA 5CNMA 2A9OA 1CEYA 2RDMA 1OXBB 1VRVA 2L17A 4OG2A 4RS3A 4N76A 4MS4A 2JBAB 3GRCA 5IUKC 1TJYA 5I4CA 3NHZA 3IP9A 3NNSA 4YP9A 3OM0A 3S99A 4EYGA 2CWDA 3W9SA 1L5ZA 4OLAA 3TD9A 2BGGA 3LTEA 3GWGA 1D1PA 3HO1A 1KRWA 5D2CA 1YS6A 2IPAB 3RQIA 1QO0D 4YWHA 5FWYA 1NXVA 2A9QA 2LPMA 4D6XA 2W42A 1VPWA 4ZMSA 2MSWA 1U2PA 4W5QA 2VUHB 4RXTA 3H5OA 3H1GA 3H5TA 1DBWA 2N9UA 4O5AA 4YGXB 3BREA 1FFGA 3LUCA 4OATA 1DC8A 4Q6WA 4Y9TA 5HQJA 4F8JA 3FFTA 5KC8A 4RXUA 1D2AA 4DQDA 3OLWA 2FN8A 2NT4A 3URMA 3MA0A 2PUAA 1ABEA 1ZGZA 3K4HA 5F64A 3C3MA 3KLOA 4D74A 3H6GA
chains in the Genus database with same CATH superfamily
2FW6A 3B48A 4GE3A 2CYAA 2FCRA 1DMSA 1NM5A 2P3QA 5JAMA 2C2YA 3KZNA 1AN0A 4Y1RB 3Q3VA 4IOJA 3IUEA 4EH1A 4MV6A 1XFDA 5C8ZA 1M8GA 2ZIZA 3A0UA 2O06A 4U8GA 5J5VA 5C31A 4MWEA 3RTCA 2PZBA 3O2NA 2C4NA 4H9GA 2AQ8A 2NZ8A 4K9NA 1P5JA 2IV7A 4XRGA 3CKYA 1GU7A 4Q0MA 3VMMA 1NX9A 4W9RA 4J0DA 4R2MA 4AQYB 3EQ6A 4UATA 4YY3B 2H65A 3PWZA 1QV7A 4JX8A 1DARA 5I01A 3Q10A 3L1HA 3DDHA 3ZBUA 1GFSA 1NJ5A 1YB7A 1EP9A 4GKKB 2PRJA 4TM8A 1EA7A 3SHOA 1NJGA 2YXPX 3AWDA 5AW9A 3LBAA 1X7GA 1RWBA 1WZIA 3WLJA 4MGKR 5KJ1A 5M34A 2ZZKA 3NTXA 1P7PA 4GLBA 4BV3A 1QVWA 1NFFA 4JVMA 4ZCQA 1VHQA 3ENKA 3EQ2A 2FMUA 3FYUB 3MGBA 4UZFA 4WGGA 4AAYA 2I7VA 3OCZA 4DWVA 2HXYA 1J0XO 2PSFA 1UFQA 4QQKA 3SDSA 5KWJA 1T5OA 3NVDA 3DMTC 4L7VA 4DADA 3GCDA 2EJBA 2OHJA 4L3WA 2BH9A 1F8GA 5IASA 1N9GB 2H4YA 1G1AA 5G02A 2BFBA 4O3FA 4Z0TA 1LBQA 1G2IA 1HETA 1AA9A 1O6BA 1T5TA 1V5EA 3I8OA 1W1UA 3NNNA 4S24A 5E3JA 4A26A 1C7JA 3EXIB 3LYUA 1J8QA 2JJ8A 4ZZ2A 2ZRKA 4HNVA 3AF6A 3K73O 1I33A 1YB1A 4ME6A 5FUBA 2ODTX 2GZ2A 3MMNA 2YRFA 3MQFA 3UMRA 3VR5D 1NW9B 1XTUA 1Y8CA 3D6AA 4B48A 4BB0A 4AUMA 1UBRS 4BFUA 5ALHA 2KI5A 2WAYA 2WF7A 4QJ4A 3V7UA 2CV0A 3P2EA 4KYVA 4TTQA 4JI8B 5B3LA 4FCWA 1NFQA 4NCHA 1J2UA 1JQLB 1RBZA 1GPH1 3HYTA 1N1EA 3I39X 3MGGA 3QXSA 4NH0A 3GEEA 1V48A 5LDGA 3QTTA 4PLWA 3FRHA 4EB0A 4P82A 3TQRA 1OLOA 4I50F 3T7EA 1F60A 2QE7D 5EN4A 2PH3A 2PJRA 2JIRA 4BAUA 3V8RA 4FGUA 1SH7A 1ND6A 2XI4A 4G8BA 2HWXA 4DZZA 4O2BF 5DHTA 1WVMA 3H4TA 3B8EA 2C00A 4AM8A 4NFSA 2P8SA 3NHAA 3SX4A 4OJMX 4IIXA 5CT5A 1JDSA 5TGDA 4CETA 3O83A 3K0SA 1N5OX 3N9IA 2CLIB 4IDGA 3TCXB 5A04A 1PWYE 4RKYA 4I4TA 5EP4A 1QH1B 3C8UA 5KYVA 3ORRA 4W9MC 3SJBA 3M9XA 5EHNA 1YBMA 1XQXA 1QF9A 5AWFC 4F9FA 2W4IA 4FXOA 1TECE 2YV3A 4G67A 3GMTA 2ZUVA 3CVWA 3JYLA 4Q9NA 2VZ0A 3U3KA 9LDBA 2NYUA 9GPBA 3WLKX 4DC0A 4RFVA 4UUQA 4QUKA 1Q1BA 1XAJA 3RABA 4XYLA 1PGNA 1EFAA 3M49A 4XM2A 3A4TA 4AP9A 1HE8B 3OZFA 1C7RA 4RIHA 5ALFA 5A4IS 2O8FB 3QG5A 1P33A 4BQSA 2WYHA 4PGFA 3DKPA 1OGYA 5AQ1A 4NYMR 4XW2A 1JHQA 5KYXB 1BXRA 2JZCA 2JPDA 2RAVA 1PO7A 4LCJA 3PEEA 4J1NA 4UCFA 1WV1A 4CR7A 1GVNB 2HJ9A 3RKRA 5JS2A 3CTPA 4MVJI 3D0KA 2JCSA 2ZDHA 3DBOB 4OU5A 3RC9A 4DIDA 1XCJA 4EGQA 3GPLA 1W1IA 1Y9EA 1T24A 2HA7A 3JWGA 2WKWA 2V5UA 1OYYA 3C5EA 3Q9LA 4IZOA 4EHJA 4XUGB 1LFDB 1LSJA 2RK6A 5AW8A 3CRVA 5A6SB 1QX4A 1NNLA 4RKRA 3WB2A 5EJEA 3OWXA 3LCVB 2O5CA 2PUTA 1YL5A 3FR8A 5KYGA 1QUEA 1Q95A 3RSFA 4DJFC 5TPWB 5JCZA 2O2CA 3G7SA 4AS2A 2YVLA 4UHKA 4N49A 3JARB 2Q3EA 1CJCA 2HIAA 1B0PA 4MUEA 5DYWA 1TKBA 1J33A 1W35A 2A5LA 2QRNA 2YIMA 4FR0A 4RIFA 3RRMA 3WLOA 3TTSA 3TOXA 4JCOA 5BWCA 5ECWA 5FRDA 3SK0A 4MOWA 3WJ7A 3DZBA 1E69A 4ZDIA 1V8DA 5CX1A 3C3AA 4F0JA 5A0TA 2X1VA 1P7YA 2IOQA 4PBTA 1NW5A 3KTOA 3RAPR 4B3XA 1PHRA 4H59A 3C45A 5FUXA 2PS0A 3E8XA 3L5KA 2A33A 2NVOA 4PZYA 4UNNA 4X85A 4QAJA 4W8HA 4CTOA 4EUKA 4ZO9A 2CJPA 1Q7GA 4NPCA 3GZTB 3GX1A 1F2VA 2FN9A 2WU1A 1W52X 2CSXA 4FQ7A 2DTEA 3WRVA 1LSOA 2V4MA 4B3TB 2YUTA 1UXOA 5I7AA 1SY7A 5KCZA 5CYOA 4DA4A 5CHYA 4B35A 1MC1A 3OE4A 1WJGA 4N5HX 3DMHA 2IXEA 1ORWA 3BCHA 2OV4A 3QJYA 3KB2A 2RHBA 4WAUA 3V1NA 1PFQA 4KMOA 3WWDA 1E4OA 2QSJA 3N74A 1KI9A 3RD5A 2HM7A 3A6DA 3DDUA 3GNLA 2IOHA 3HFRA 3I1YA 3IPRA 1NXOA 3UCFA 2E4UA 3WTBA 4RZQA 2CNNA 1YJ5A 4ZI3A 3UO8B 4UHFA 4FLFA 3DBHA 3I2FA 4CKEA 1JT2A 1J0AA 2VK8A 1G18A 3QV1A 3ND5A 5KTMA 5T5QA 2BSAA 4O4JA 3HU3A 1PJQA 1YI0A 4FCCA 4K2AA 4QDTA 1P19A 2XUIA 3G13A 2OENG 2DOKA 4D8TA 3VO1A 1JS1X 4Z7NB 1XRLA 3A6FA 3OTGA 3R20A 1NI5A 1BHJA 4HY3A 4TOIA 4CLOA 1IK6A 1K8RA 4CM9A 1G20E 1NBME 1TI7A 2GZRA 1P0MA 1PVOA 5LBIA 4G0VA 3ANSA 4LDZA 5DCLA 3AR3A 4S05A 4YT8A 1C5KA 2O2XA 4E7PA 1V8OA 3CPSA 3LDGA 1TQ8A 3RBVA 4NOKA 1T2EA 3A9SA 4MI6A 3L0IB 3MJSA 3HJUA 3EPHA 3QQ5A 2G6TA 4IOLA 3RYTC 4B3JA 3X1ZA 5HUQA 2R68A 3G2HA 2L42A 3DL0A 4AMVA 1OX5A 3WWZA 1PD0A 3DEIA 3FOWA 5DNAA 1A5ZA 1G98A 2WNIA 4YJKA 4KI0A 1MRSA 4WLNA 3OZRA 5FBQB 3EZYA 1AKNA 1QANA 5EJAA 2C95A 3PRKE 4WUVA 1KDVA 4CKXA 5J2TB 2PEZA 4BLRA 3CZCA 4Y18A 5JO9A 3SR0A 1DO0A 1F7UA 5CEEA 2XQGA 3WR5A 1E18A 3B70A 1C0LA 1DJQA 1U4NA 3GF4A 4GHWA 3RGWS 4C1BA 3LRTA 3SLRA 4J1TA 3GB9A 3TGWA 3BOSA 4MVCA 1P5FA 6GPBA 1H8HA 2AI1A 2QJFA 2HIHA 3JXEA 3OE5A 3OX4A 4JDPA 5JCJA 1EWYA 1MTOA 1Q0ZA 4C6TA 1YC2A 4YLYA 2C3YA 1I2AA 4XEHA 4HNSA 4QFMA 3OUUA 5BV2P 3HKBA 1O97D 1W48A 2QYHA 1XPJA 5B3JC 1ZR4A 2YNMA 1R9GA 2CKMA 2DHRA 1CJTC 1G8JA 2XJ4A 4BKOA 2GNAA 3TWOA 3VSEA 4EPXA 3ZXIA 3MWJA 4PBSA 1ZS9A 3HKEA 2BHTA 4UU7A 3M81A 3ZGNA 4BKRA 4W4TA 5CDGA 1NR1A 1F4PA 1DUIA 4ILKA 4QUDA 3TZQA 5C9ZA 2F43B 3KOZA 3JVUA 2FMTA 4N5DA 4M49A 1Z88A 4W5WA 2PJDA 5MFZA 2HA4A 2P68A 3IQDB 3UPUA 3V1KA 1DRKA 4BKPA 2WF8A 1U2RA 4F12A 1R6UA 1VSVA 3OH8A 3RF7A 4EW6A 5AI5A 1GQ2A 2QTMA 4DMUB 4GRAA 1SBZA 3WK5A 5A3VA 1JJVA 3VH3A 3W3AD 1HYEA 3RR2A 5BSEA 1S5PA 5D8DA 4DT1A 3K8YA 2ID8A 1V47A 3C70A 3VKFA 3BSWA 1ZNYA 4LHXA 3K2BA 3DE1X 1GL3A 1GKKA 1Q74A 2KBEA 5JAQA 2QRKA 3ORFA 3IP7A 4PHCA 1KIMA 4RX1A 1YS4A 2GEUA 2VRNA 4OFBA 4Q24A 4CQLB 1A77A 1DZIA 1EFRA 1RRMA 4MW5A 4RMGA 3VR0A 5B2EA 3TSYA 5DI3B 2ZR7A 4UBOA 3LP8A 3BMXA 3RVNA 3I2YX 5CX1B 3R7AA 1Y37A 2A86A 2V96A 2B25A 4QG7A 3V80A 3KTDA 3ZV3A 4F97A 4RAOA 2O19A 4Y2YA 3RVKA 5LM3A 2O2EA 1X1TA 3HFSA 5FPPA 1WUJS 5J58A 4C5BA 4HDRB 1KMCA 2FB9A 1COZA 2IPXA 1ISMA 4R7ZA 2A0YA 4Z4CA 2PGLA 4LQCA 5EXDA 5ERXA 2DX7A 5KJFA 2UZ3A 1AMNA 1ZMBA 2G82A 4EKDA 4WOPA 4H7JA 1O6CA 5IANA 1T15A 4DFDA 3AHDA 2JNWA 3HY3A 3UA4A 6REQB 1GGJA 3OIWA 4QNMA 1N7IA 2GM3A 2QL7A 1DZ3A 5I9NA 1NRIA 1A88A 2PL3A 3KELA 5TVKA 5FI5A 5EJ7A 5JC8A 2RK3A 1Z8HA 5LA6F 1R4MA 3VTKA 5D51S 3OT4A 5EIOA 4E13A 1M34E 1SXIA 1KS2A 3IERA 4AL4A 4ENRA 1ZGBA 4MVJG 3LLSA 2XXBA 4F3TA 4LF5B 4M8LA 4CF6A 4K6MA 1L5OA 4E51A 4UCXA 1BOFA 2R8PA 4OVKA 4B0OA 1KU6A 2FR8C 4TYMA 4XWGA 4L8LA 4PWYA 2HUNA 2LNDA 2XW6A 1Y98A 5FTNA 4UUMA 4WK4B 2BSXA 3BZUA 5IVPA 1XLVA 3R7LA 4EG8A 3EA0A 4ZQFA 2MMGA 3Q8XB 1RLUA 3JVIA 3QLUC 1CDEA 3KLMX 3ZV6A 5JALA 4D9CA 1LY1A 3AIIA 3THXB 1U02A 4GZMA 2YC2C 4QTYA 3BXOA 1OB5A 1ZNWA 2XOKA 3HWSA 1GG2A 3I9NA 1GZ5A 4S1WA 2BC9A 3BDIA 3WMEA 2XITA 4KNYA 1P1KA 2QE6A 3PIRA 1IG0A 4QVIA 3IR7A 3F78A 4MW4A 3BGVA 2C9ZA 3I04M 5DGXA 4HLCA 3H9JA 4JMLA 4X92A 5TMEA 4FGLA 2HMYB 2YNMD 2XNJA 5T4FA 5IKXA 4Z4EA 2HPVA 1HT0A 1NVVR 2IYTA 2QU7A 1XK6A 2PX4A 2XNHA 3C6MA 5D3QA 4LFAB 3RYCB 2Q7OE 3OQBA 4CI0B 2OLEA 5HKLA 3CVOA 4LWZA 4S2EA 2OV6A 2QUZA 1TZMA 5FBHA 3L8YA 2ERXA 1XZJA 3M4NA 2A92A 3LKVA 4BWVA 2QUKA 1LZLA 3W5AA 5AP9A 5CB0A 3EFHA 5AVZA 3L8ZA 1BOOA 3RJ9A 2YWDA 1FYDA 5DM4A 1C0EA 5CXSA 3L6BA 4UHEA 2G1UA 1J09A 3LLUA 3LQFA 1NR5A 5ED0A 4QLOA 3NV7A 3UAZA 3PNLA 1X8KA 1ZIYA 3H8SA 2AD5A 3W7VA 2WYVA 5DZSA 2I55A 1K3UB 3OEHD 3PEVA 2VQDA 2YL2A 2B94A 1IXKA 4ACBA 4ED9A 1GZ3A 4H3SA 3W06A 2AJTA 4IRMA 4EG7A 2HLHA 5LN1A 2F3PA 3HGQA 3WRXA 2IUYA 2AOUB 1TXGA 3K0CC 1E61A 3CYFA 1ZGGA 2IYYA 4JEUA 3C3PA 4MV0A 4TT3A 3IP6A 4EHBA 1YJAA 1H9CA 3RFUA 4QVGA 1TKAA 4KFTA 3ZCPA 4KSCA 1IRXA 4YS6A 3MB8A 2Y27A 4UVIA 1TLLA 4HS4A 1QG4A 1SHLA 5D7NA 1TEZA 2CJYA 3I0MA 3AB8A 1M1NA 3CCBA 2XRFA 2VCYA 3EY9A 2O1WA 4PX3A 5DV9A 2OV1A 3IPXA 3ZDFA 4BGUA 5JG7A 3RHZA 1PCXA 2ZIXA 5HF9A 4JI7B 1GLNA 4RV4A 4MUMA 3ZE0B 5CBKA 2V5VA 4PCLA 3N7AA 2DWPA 3NNSA 4R1OA 1V4BA 1GSOA 1US8B 3GT4A 4XD7A 1M3SA 2JLSA 4OLAA 3ZX5A 4LWOA 2P2DA 3VSCA 1GPNA 2EBWA 1XTRA 1P31A 2M6SA 1T9ZA 5JMPA 2QTVB 3PVZA 4RZ2A 2WOOA 1G9TA 4EG0A 5EKUA 5FOTA 4INZA 1ISPA 1A4UA 1K89A 4D3YA 4L5YA 5ESRA 4HWSA 4B7CA 3HXPA 4D9NA 2VQSA 2GCOB 2DPGA 2PIAA 3AUFA 3F3YA 1XJCA 2NU6B 3TS1A 4LF4B 1GPJA 3LAWA 1GU0A 2QG9A 3CZAA 4PG5A 4EHHA 4RDXA 5LYJB 2IYOA 4BHTA 2BDUA 5AIBA 1Z0IA 2PK3A 3GGJA 4FYXA 1RI3A 2DJIA 2G67A 3J81k 3UW1A 3PXAA 4F6CA 1G17A 3KPJA 1Y81A 2BRUA 4IS3A 4KIUA 3V2HA 1LNZA 1OMOA 3LYHA 5GY7A 5GGYA 2ZRGA 3A9VA 1TZCA 2XMQA 5BSKA 2A9VA 5K8VA 5E3IA 1WPXA 2V6IA 1LC0A 2VH5R 3H5NA 3RREA 1NJ2A 3PUHA 2NPFA 4PCUA 3S70A 7ADHA 3E8SA 3FGOA 1I9CA 4IF4A 4OGWA 4CDMA 4PX9A 4FHEA 4DLRA 4BMVA 3I45A 3QXJA 5SY6A 3SSMA 5CFQA 3P97A 3L1JA 3OZCA 1RW4A 4AZTA 2AKEA 1DQSA 3D54D 3FH0A 1CXZA 1YRHA 2P9TA 2QRHA 3V1LA 4A0GA 4AJPA 3MGAA 2PUVA 3MUFA 3RRNA 1AB6A 1JKIA 1U2DA 4DGQA 3QPVA 1JKJA 2A30A 5T67A 2BEKA 3BT7A 4OUKX 3Q2OA 2ZAMA 2G72A 3HC7A 3DVAA 4B3RB 1YUBA 4MWBA 1JKXA 2P69A 1XJ5A 4KXNA 1LVUA 2GXUA 4COKA 4CCSA 1GQQA 3L6DA 1G6Q1 5EZYF 4TSKA 4LGMA 3RK1A 2J33A 1N3IA 2DCMA 1FPMA 3IUBA 4NH4A 3HB7A 4C4OA 1JG7A 1UK8A 4WFQA 1OV4A 3FJOA 5IAKA 3BS4A 4LBVA 4QASA 4TVBA 2D2XA 3OCXA 5FUQA 2EFEB 3BWXA 2FA9A 3TOSA 2VP4A 4WA8A 3DZCA 3SR4A 4WJLA 5HUHA 5K3EA 1IIRA 1ADCA 1U2DC 5A4JA 5CB4F 2D5LA 1VOTA 4QC2A 2ID4A 1PJ2A 1TM7E 2IPNA 3KKQA 3LS2A 1E2MA 1X3SA 1G3MA 4Q4JB 4U3JB 5BT9A 3RVPA 3TZHA 3WIEA 3EQZA 2FUEA 4A2WA 1VECA 1M34A 1OH7A 3I9JA 2Q28A 3P4UA 1YE8A 4R41A 3RS9A 3NRCA 3UXMA 3TG8A 2GERA 1QC5A 2UZ1B 5PGMA 4B6GA 1DB3A 5K0TA 5MGNA 1IQRA 2IEDA 2YH2A 4I1PA 4D8VA 4AKHA 3E7DA 5AVJA 2D1TA 4GXQA 4KGVA 1SQSA 5FWYB 5LQRA 4XR4A 4MLPA 1TFRA 2UZIR 3OICA 2PUFA 2QENA 3CUKA 4ZEVA 2VHYA 1NG1A 4OX9Y 2ZCUA 5JANA 1UDXA 3TINA 5IBCA 1S4MA 4R3UC 4R6WA 4R84A 2FPMA 4ILEA 5G0UA 1RHMA 2VYVA 3HGTA 1DFIA 2UYQA 3C85A 4NTZA 1I5EA 3UC5A 1AKMA 4HYQA 2G04A 4GAEA 4GWGA 3O9MA 3AHGA 2FQYA 3UUWA 4BQEA 2YYZA 2FSFA 2K7ZA 2YXLA 4BNLA 3KU1A 1P60A 4PLGA 1QPBA 1T0PA 3QFHA 5KNCD 2FPRA 3H6HA 4HO1X 4RV5A 5J2TF 5TQ2A 4ZAYA 3UJ9A 4D9GA 2I6XA 4DM7A 5BORA 1BQEA 1FFYA 3FYTA 5BYKA 3GBSA 5TQ2B 5EHXA 2FPLA 4GOND 3OMLA 3EUAA 3HCEA 3LNCA 3ECCA 3IT3A 4QGBA 4RL4A 4WXRA 1QTQA 5B53A 4GICA 4NBWA 5FUYA 1XVAA 1TQ2A 3JD4A 1NW4A 3UYLA 4YR7A 1H2BA 4XXHA 4XM1A 3ETEA 3QFRA 5T3UA 4P2BA 3RYHA 3NGMA 3O0TA 1UK6A 4D4HA 3BMQB 1V26A 4HVCA 1UBJS 5T64A 4Q9HA 4MKRA 3H2KA 1IY2A 2WJ3A 2WTBA 3ILXA 4DA6A 3H99A 3WIOA 5HBGA 4UHBA 5CGQB 3C87A 4RE5A 1RZRA 1OWNA 4TWIA 2IU6A 3NDPA 4AZ0B 2Q1WA 3WNVA 3UAWA 2AOTB 2FG7C 4IXMA 4MO9A 3HL0A 4HLNA 4LOIA 2R44A 4R40A 5JT1A 1X3LA 5KPDA 3D7SA 3BORA 2XWSA 3WQRA 1VM6A 3ZGYA 2R5FA 2Q2NA 3T3PB 3OHMA 4MWGA 2B78A 3A4MA 3ZQ6A 5JRDS 2UKDA 1WXHA 2VF5X 3GUUA 4MHSA 4R2WA 4BXOB 2WIAA 3KYCB 3VDQA 5B12A 2QVCA 4K9LA 3PA6A 3Q3HA 1XCOA 3LC0A 1C1DA 3OTIA 4ZVPA 4IYJA 2J32A 3EZFA 4Y2VA 4RVHA 1CFJA 1JHZA 2A5JA 2Y68A 4V0MA 5DWQA 5IHPA 1Y34E 1KERA 3ABSB 3D1LA 3HXLA 3A37A 4E1BA 1XRPA 1CUUA 2VQEB 3A14A 4QHYA 4PSVA 1N6OA 4M2LA 3LX5A 4C6RA 2CXQA 4PS1A 1KTVA 2BONA 4QEZA 2ECPA 3WFIA 4MVJA 2FP3A 1B73A 1IH8A 1JLMA 1UKYA 2D5CA 4QYXA 1KSGA 2DXIA 5LQUA 4MUNA 1FNSA 3EJWA 3WDMA 1DKLA 1UMKA 3ZIDA 3PKZA 5LLSA 2IDKA 1H4QA 4PBRA 1W85B 3CWZA 1GQYA 1EXVA 2EZ4A 5GM2A 2ZI4A 1OB2A 3R7BA 2XQVA 2AW5A 4IIYA 4EJSB 1R74A 3NT4A 2ZT7A 3HWRA 3QXGA 4N5MA 1YFZA 3EC2A 3H4VA 3AHFA 3OVMA 3B6JA 2WJYA 4X7BA 3KHTA 1CP3A 1L9XA 1G4AE 4HAZA 3A1EA 4GLLA 4KX5A 1YZYA 2R65A 1JDUA 2BR3A 2WKPA 4WPGA 3K09C 5G0VA 4ZJUA 1H2RS 1CC1S 4IJUA 5LP1A 3PDIA 4K87A 3MEQA 2X14A 1AKUA 2A8YA 5DKFA 1MLDA 2FVYA 4YLGA 2M98A 4B9AA 4EVRA 4E2ZA 1KJIA 2ZU0C 4Z9AA 3B1ZA 2GRAA 4MKIA 4LXGA 4GIBA 4JI4B 4W1RA 1LRKA 5TGTA 2PRZA 4DMKA 5HM8A 1K0UA 1O5TA 1O8BA 4LDQA 4IINA 2C42A 4LTDA 3V46A 4YIHA 3NZEA 1VPTA 1UBNA 2RGNA 2FZ4A 4ZCSA 5KI6A 4K2HA 3WQQA 1QE0A 4PE5B 1BE1A 1PBTA 4YXFA 1W9MA 3VKUA 4RSHA 5MN4A 2YDXA 4HEA1 4NZMA 3GLSA 3A3KA 1AH2A 1T1JA 1I3MA 1Y42X 3VYVA 5BRAA 1EDEA 1OFGA 4QDOA 2DBVO 4Q4AB 2XQIA 3KYJB 4JJGA 3BHMA 5M2QA 4NYJQ 3F2VA 4ALIA 1F2DA 1FDWA 2WA1A 4BNHA 2JFUA 3D8HA 3V00A 2NSDA 5T4BA 1EM8B 4W99A 2HJSA 3PS9A 1UZUA 4HWKA 1OZ0A 1ZWKA 1ZL2A 1IN7A 3F6PA 4LZOA 4PC7A 1SBCA 2NM0A 3IDAA 4WXPA 4NENB 3RIXA 1S8FA 1NQXA 2GUWA 2AV6A 1MTZA 2JAHA 1WB6A 4INAA 4C0KA 2Q0QA 4YRGA 1V5WA 3ZNQA 2RCYA 4E11A 1DKQA 3FWPA 4OSPA 4B3BA 5C37A 1AV6A 2CGEA 3DR3A 3K09A 4R5HA 1WB5A 4QEDA 1LNQA 1Q0PA 5HYVA 1Q0LA 1YRYE 2QAJA 3GRVA 3SBOA 1EG2A 1VCMA 1XQWA 2WIFA 1I7QB 2P6RA 2I3AA 4S1OA 4DSNA 4ZC1A 2ANBA 4K8OA 3AT1A 4H4CA 4XSGA 5DIFA 5AVUA 2R2AA 4Z4IA 1BWPA 4ZARA 4EJSC 2PYDA 2REQA 4LHVA 4L3VA 4AU1A 2JLUA 4UCQA 2WHPB 4LNUB 2BM9A 2Q4TA 3T94A 1QIGA 3QXCA 1NXSA 5BW6B 2R66A 4CKBB 4M7RA 4BO9A 1JSZA 4C0AC 3A6ZA 4MVXA 4AXXA 1OIXA 1O96A 7MDHA 5E4YA 2NVBA 2WWRA 4HWGA 4MLCA 3K20A 4OQNA 4TTAA 1SCQA 5ANRB 4ZEWA 4C05A 5CH8A 3FXAA 3L7MA 5KKNB 2AX3A 3FPGA 2AZDA 1BFUA 4X1OA 1GNTA 5ALJA 1P9LA 2DKOA 3DV0B 4CW7A 1R66A 2WTMA 1PR2A 4XTRA 4MHTA 2HO5A 2BBWA 4DUPA 4EUSA 1I4WA 4J4TA 2FOIA 4UMFA 3EOBI 4F5WA 2Z5LA 4EKIA 4CIWA 3CSUA 2YV4A 2G9NA 3AI2A 2EYUA 3T34A 1K4MA 5IJZA 2EU8A 1U7ZA 3Q1KA 2HQ1A 3U4HA 3PGXA 1OYWA 1SEVA 5AKLA 4D82A 3RBAA 1M2VA 5JD3A 4P86A 4IG4A 1MH1A 3V8QA 2WMYA 3F5SA 1G5FA 4RY2A 3UMFA 4PSAA 1RVV1 4WNIA 3U44B 5DNWA 1CX9B 3PQ5A 3ZH2A 2NO1A 1WKVA 1Q1QA 5ER9A 3RDPA 3KKPA 3VO8A 1JQDA 4P7GA 4XB2A 4W5TA 2JD2A 1WNTA 4MIYA 2QN6A 1XRQA 6Q21A 4QOJA 4XLZA 5FA8A 3V8BA 3CX3A 3BN3A 1SBNE 3R3ZA 1P1BA 2NTNA 4B5KA 4HFRA 4FMDB 1U28C 2VDWB 3NJ8A 4LJ9A 2BEWA 5ETJA 1F06A 3EA5A 1DE0A 4NDZA 4NNPA 4RD4A 4UC0A 1M1YA 1WKCA 2JEOA 3JASB 5L45A 3N8GA 5CH5A 1VJGA 1UR5A 3DEKA 2IF0A 1FU8A 3T61A 4M0MA 4RHFA 2JEYA 2I34A 3LT5A 2C4HA 3QEOA 1NT2A 2J6BA 1J0EA 4I55A 2IEZA 4JNCA 5DTMA 1YZTA 4DTIA 1XMVA 3QE0A 1L4NA 2WFZA 2AEMA 5K2OA 1C7EA 4YQFA 2OCYC 5EIEA 1Z6YA 4L5IA 2C7RA 3WMFA 1WM1A 1K1EA 1WZUA 2FEOA 3L1IA 1FUIA 4D8WA 4P4TA 1KJ8A 3PIIA 3PJRA 4R9UC 2IP2A 4MGHA 5L8VA 4HLQB 4LXUA 3WFZA 2ASVA 3I9KA 2OZEA 2Q6IA 3E9NA 2P65A 1DCTA 4OM7A 5D87A 1I4TD 1H0KA 4H27A 3NHSA 4LE1A 3WRYC 3ZWVA 3QNMA 3PFCA 2GKSA 1RYMA 4PXAA 4UOEA 4DV3B 3NYWA 2B3DA 3PC3A 1GG8A 2FPGB 3ZHUA 4BX3A 1ZD8A 3H11A 3MOIA 1OR8A 3MJTA 4B4DA 2P1DA 3AKYA 2JLXA 1O7JA 5JHGB 1QS0B 5A5FA 5HQ3B 1ZO8A 5C5DA 2GF9A 3AETB 2BDTA 1OYVA 3QQPA 4P5PA 4D99A 3TECE 3SAJA 1YCFA 4Q7LA 1MQ8B 4G09A 1F0PA 2QE7A 2UUOA 3R5XA 4XWYA 3V2IA 3L77A 1MAAA 4BBPA 3WK4A 1LUAA 2HA6A 1WAMA 2PGJA 3I5UA 3NCHA 3P71T 3SZ3A 3IIEA 4OMUA 3V8EA 1B14A 2AFHA 4XI9A 4BIIA 4UEOA 2G9ZA 4HUQA 4UEWA 2VTBA 3CKKA 4FIDA 1X70A 2A9PA 4C3UA 2X0FA 3I4LA 3WGGA 2JIMA 1D6MA 3T52A 1QLJA 2QORA 3SCZA 1G8PA 1Y8ZA 2ZSKA 3EDYA 4F2GA 3EF1A 2H1LA 1YASA 5T8KC 2L0XA 2XOEA 2JI6A 3NALA 4IMJB 1NQWA 3W5BA 3EEFA 2P6NA 3ONVA 1SOMA 2QA5A 4YJ3B 1KI3A 1F6WA 2XMCA 4CF3A 3IJPA 4YP1A 1HX7A 1X7YB 4ND2A 5B6IA 3GLVA 1FDTA 5LIPA 1BWSA 1QVZA 2QZ4A 2UYGA 3GD7A 2MR5A 3Q0EA 3CN9A 1LKZA 3VVCA 2H4FA 5K03A 2ZETA 1T43A 1XC7A 2PX0A 3W6OA 2RHHA 5C1PA 4KSYA 5HOQA 1RAEA 4R1PA 2NO5A 4PHHA 3ZD7A 4HF7A 3N0WA 3P52A 3SLGA 3SX2A 4E2WA 3HABA 2EHJA 4ZCRA 4CIAA 2X4GA 4FT2A 4JXKA 4MR8B 4P0PB 1V6AA 3IVGA 3HCWA 2YVQA 3OTHA 3NHMA 1E6UA 1UFOA 4GXTA 1E96A 2VZEA 1P29A 1ZEJA 2FPIA 2YJNA 1IG3A 3CM0A 3E27A 3HJBA 3L7BA 4GW3A 3KZ1E 5DEIA 2HHAA 4X8LA 4IR7A 5EMMA 4F84A 2UU9B 3SJZA 1CQZA 3OPVA 1WCIA 2L19A 2NZUG 3DZJA 4KUEA 3SM3A 3ZHQA 4I66A 4P5DA 3HR7A 3R5HA 5T4HA 1P0QA 5BWNA 3RJMA 3W04A 3UTDA 3S81A 4AMBA 3GU3A 4EHNA 2XJ9A 2IE8A 4OFWA 1P2DA 3IHLA 2ARKA 4UASA 5DHAA 4F1JA 1BMQA 2BUAA 3E9DA 2H8GA 2I3ZA 1XA0A 3DCIA 1GNPA 4U2KA 1ZLYA 3U61B 1NMSA 2X40A 5CLLA 1E6WA 2V59A 3UYKA 4FYMA 4BNTA 1Q6YA 2G0AA 4RL6A 1V4NA 3G2IA 1KAQA 4IX9A 2DFTA 4O59O 4U5QA 4YP7A 1AY0A 3RIMA 5G4LA 1NDHA 4WV3A 3V1YA 3FGPA 4S1PA 5AXAA 4JKYA 1U5BA 3D0OA 2NPOA 5SY4A 4JB3A 3TEJA 3OZXA 3TIXB 4MPDA 3UN1A 5JR3A 4W5QA 1V96A 4WLVA 1DKOA 2VDKB 3AX6A 1ZXBA 3NBKA 4XVQA 3JAWA 1XA4A 1Y8AA 3I58A 1SIWA 3VU9A 1RMYA 3LUCA 1DC8A 2P9JA 1A72A 1OD6A 3QJ5A 3WAKA 4DWOA 3VR2A 3H7AA 1SUCA 3FWNA 2V6FA 2OK8A 2GXAA 2DHCA 1BE0A 2HDOA 4H6VA 3URMA 2XCOA 4UVEA 2Q3JA 4EMTA 1D04A 4YFVA 4JQZA 3SS9X 2Y1LA 4BMPB 2GCIA 3UICA 4B6EA 5BR7A 1K27A 1Y4UA 3SDBA 3HN6A 3WRXC 3KS9A 2GJ8A 2Q2VA 2W98A 4K3UA 5AHWA 3H6KA 1H93A 4L8YA 1GGHA 5K8LA 4FWBA 4I5IA 1MNAA 4RMIA 2J9RA 3QF4A 2G63A 3LLVA 3OPYI 5GJWC 2JJ1D 2CSUA 3HVHA 3NWPA 2X23A 4BO2A 1IAVA 2W2VA 4OQLA 3D59A 2DBYA 1DKPA 2PZEA 3IT0A 4KXQA 4KGZA 4PFQA 4PYOA 3ZE6A 1L5RA 2W2MA 4B3FX 3Q12A 5AESA 4KQIA 2R6CA 1OQAA 2ETXA 1Q91A 3STUA 3LNTA 4D8XA 2BJVA 2IXDA 1NKSA 3KQQA 1JFLA 2WU8A 3DT9A 3GMSA 3FAKA 1FVOA 3K32A 3P9QA 3LRPA 3OZTA 3HV2A 4HDCA 4NENA 3F67A 3KKNA 1LBIA 3LQ1A 4M99A 3SWWA 1A4XA 1RLTA 5GTDA 4KMMA 1UDAA 5ALMA 1OF1A 1SKMA 2WJPA 1T2FA 1JJBA 4YT5A 2QLFA 2HL6A 2RC6A 4LV5B 1K8ZB 1MC5A 3G2JA 5CH3A 1GQFA 2ORWA 2QN2A 3KUKA 3ILSA 5D3MA 5B2ZA 1FRVA 4FZJA 3E1KA 1CW2B 2XIJA 4BVLA 3U4CA 2PUDA 3LP5A 4NSNA 4HUTA 821PA 1MB4A 2OAP1 3W8RA 2RH4A 3O8LA 2ZSBA 4EB6B 4M88A 2GZAA 1WNFA 3SC3A 1KPHA 3QE2A 5DM0A 1P45A 1XDWA 3BTUA 2IITA 4GECA 4I9FA 1Z0UA 4JDUA 1CHNA 1DAHA 1SJ9A 3KZVA 1PTKA 3OBIA 4G5GA 3A1FA 1P8JA 1Y4SA 2GJAA 3UW3A 3K8OE 3L7CA 3BVPA 5FBLB 2GGSA 3NPMA 5KPJA 1ZOLA 1HKHA 3DULA 1UMDA 2D4AA 3E3AA 4URUR 3USES 4DNOA 3AW8A 4HGNA 3W34A 1HF3A 1BA2A 1NE2A 4D5GA 2L2QA 4TTIA 1M5UA 5BV7A 4CKZA 4KIJA 4NI5A 2DWCA 4P38A 1G20A 1G8GA 2CN1A 2CLSA 2XWBF 3X43A 1U7TA 4TWZA 4YCMA 4FE4A 4HPWA 3VFDA 2IU4A 2FWPA 2J67A 4JLWA 3CF4G 4W1SA 2QG6A 5EP2A 1Z4JA 3BTSA 3GA0A 3ZOZA 1K7EB 3A04A 4H3KB 2J48A 3KR1A 3VC2A 1EBUA 4GH5A 1D8AA 1IUNA 1QJCA 2F7SA 2QL5A 4PAGA 4JA0A 3TX6A 4E32A 1U2TA 2VEDA 4X9XA 4F4FA 5CBPA 1QGZA 2O1EA 2VAPA 2ZR0A 3KXLA 1UDCA 2OCGA 2XTNA 4ICIA 5AHRA 3UOWA 1E3TA 1OREA 2YMLA 5DNUA 2C9BA 1ZGCA 3HKDB 3L46A 5KKAA 1N0IA 4H1HA 3DMRA 4L9WA 3SMVA 1FNDA 2FGKA 2P2CA 2JARA 1XHLA 3DEYX 3WLPA 4ZHQF 4LOJA 1A9QA 5EIFA 3S8EA 2OP1A 3CNBA 1BVUA 3U3XA 3IVXA 4TV8B 4W5RA 1Z12A 4QKQA 5IBQA 3RV4A 3CMCO 2Q1UA 3F6CA 1XRRA 3JYNA 4IJ5A 5CRIA 1LLFA 5A3JA 4MS1A 3ZR4B 3QKTA 1TGVA 5K0EA 3T5AA 1FFSA 1VG9B 2BISA 1QRUA 3LBHA 4PC6A 1HSOA 2HLNA 2WU3A 1M8PA 4NULA 3NBAA 3TFWA 1EFCA 3RVQA 1K2WA 3NHBA 3QH4A 4UNPA 4W82A 4F71A 3MOGA 3GJ8A 3O8OA 2EKPA 4QDUA 1TEHA 1KNQA 2VYCA 4BUJA 1A8PA 2D0OB 3BRCA 3M34A 1DTWB 3A58B 3MB5A 4YYEA 2FSPA 3KEQA 2AT1A 3ROGA 4DYDA 1KBQA 1CDOA 1QBKC 4MRVA 1PZGA 2BJHA 2R48A 2QZPA 2DQKA 3KP1A 2IYRA 4PHTA 3LCJA 3R7WB 5EPEA 4D41A 3S5JA 4EF6A 3O1JC 3K30A 2QJRA 4TXNA 1QQ5A 3G5TA 1Q0HA 1YRBA 4ZQEA 5EMNA 2D5BA 3VRHA 2JIPA 4KRFA 4XD2A 1DAPA 1FP1D 2REBA 2HXGA 4NYMQ 1R6VA 3RC3A 3RYFA 3SS7X 2CL7X 1EAYA 1R5JA 5KNDH 2JIOA 3JATB 4R2IA 1Q2XA 1YR7A 4ND3A 1G3QA 4YRMA 1KK3A 1DG3A 2XX3A 3JQRA 5BMVA 2PS1A 2NO0A 1PJBA 3UAVA 3U26A 3BJMA 4B3IA 1ZCAA 2Y9MB 1TRHA 2IRWA 3CRW1 3NVAA 3O4FA 2DFVA 1FP4B 1XZFA 1ZH6A 4BNDA 5I7SA 4DR6B 4POOA 4G0PA 2NUAB 1XDGA 1QB8A 2P27A 2CB0A 2GT1A 5IDVA 1V5FA 2ORIA 3I6ZA 1P1IA 1R0WA 1XTIA 4HN9A 4ZVVA 3OJLA 5DTEA 1CRWG 4CQJA 3W5CA 1T8YA 5FYQA 3H5VA 1N2ZA 1WS6A 3OFJA 4OH7A 4RPJA 2VT2A 1Q22A 1E9VA 5EZYB 2GN4A 4BASA 3HDVA 5KSZA 3PEYA 1VJ1A 1Z6TA 5BT8A 1PZNA 1MCZA 2C94A 2HU2A 3S1AA 3SXUA 3CZRA 4UVHA 1SB9A 3I34X 4QE3A 3EEIA 2A0KA 3BYZA 3EVDA 3UY4A 2AGVA 3AVQA 1JHOA 4IVNA 5AR1A 5I8WA 4EMSA 4B47A 2XLBA 4KQXA 2VATA 3KSMA 2G7ZA 2XCIA 1NY5A 1ZG3A 2H06A 4TVSA 3N2LA 1J39A 2I2DA 5IMBA 4DJEC 2J6IA 4BUCA 3THRA 3HQ4O 3OFVA 2FJPA 3GELA 2WKQA 3B7GA 1UZAA 3FZQA 3MS7A 1KYWA 4LX8A 4BOYA 1JEJA 1JMVA 1N7GA 2UVPB 3GI1A 1KKMA 4RA6B 2H0QA 5BVHB 5HKKD 2C92A 3CH4B 4HNTA 5J4VA 4ABYA 5AICA 1U98A 3AXTA 3D7KA 1FFBA 3B12A 1KEWA 1W0KA 4H7FA 4JLAA 4YUXA 2XNDA 1HYHA 2AR7A 2V3VA 3BXHA 4JITA 3T99A 1ST2A 1QE5A 1T0UA 3R3WA 4P3YA 2G9QA 4QPCA 5IBPA 2ZIXB 2C0PA 5JAUA 4XGRA 2PQ6A 3ITDA 4JIGA 4JQOA 3QVLA 2VS1A 3H83A 5IAAA 4PONA 3QXHA 1JIUA 4YJFA 3UANA 4DCJA 4TLDA 4PO1A 4ZV7A 4HD8A 4U2GA 2WAAA 2W6MA 3EVCA 3U7GA 4PYLA 3L0CA 3ZHXA 1FMJA 1V71A 1WD5A 3HYNA 4LYFA 5CLGA 4RK1A 5TF4A 4TVKA 1QQBA 2AFIA 2AMFA 4GWKA 2GEBA 4MGIR 4G3XA 1RT9A 3A1VA 4CDRA 1M66A 5IXSA 3H2BA 3LUDA 2YWBA 1JEAA 1ZP6A 2V6GA 1BQ3A 4MPTA 4FYYA 3ZKWA 3WAJA 3FNGA 4ITRC 3HACA 4JB0A 4KGXA 4KLAA 1YWGO 2XF8A 3HO6A 2OPHA 3UOGA 4A27A 1U2QA 4FDUA 4RFSA 3QVUA 3F5DA 4WJZA 3TLMA 3FHOA 2PU7A 4FDTA 1E0DA 1HDZA 1A7UA 1U9JA 2B20A 2ZXFA 3F71A 4JBLA 2X9QA 5I9MA 3VDMA 3IP1A 3H0EA 3LCUA 4OI4A 2C1EA 5ISMA 3IKMB 2ZYRA 1ISFA 3LBIA 3IRUA 4O2BA 5CITA 3KAKA 1K7FB 1RHUA 3O21A 1FVXA 2AN5A 1POWA 2HSGA 1NVWQ 5CDTA 4GZ3A 4QX6A 4H4DA 2EL9A 1A2OA 1SG6A 2QN9A 4WESB 2OC4A 1E9EA 4O4IA 3UWOA 2H4JA 4GC5A 1CS4C 3INTA 3H8JA 1EFVB 4EJ0A 5DCUA 2BE9A 2BM8A 2QW0X 1OBHA 2XAAA 1BXRB 4RPIA 3N2GA 3T7RA 3ZE8A 1N2JA 1B76A 2PV7A 1EFDN 2ZWVA 2MT9A 4FNAA 2K4MA 2WP0A 4EB3A 2J3JA 1R8SA 1BDBA 1QTIA 3W0LB 4E46A 4V1CA 2JCVA 4RENA 3DMPA 3LZ6A 4S1TA 3UJ3X 4KVAA 1VBFA 2H1OA 1W5AA 4B6RA 2G4VA 1WZNA 4O6VA 2J3HA 5T6MA 2OAEA 3OX2A 5TEWA 1NPYA 3LFTA 3BFXA 2YZKA 3SEZA 4G0QA 1CE8B 3LF1A 1HFEL 5B1DA 4J91A 3WSVA 3NEYA 2RC5A 4IFIA 1F12A 4DLTA 3TLAA 2AKYA 4QYWA 3MGKA 1VHTA 4Q3CA 2FEKA 4P7FA 1CRLA 2B9EA 2HNBA 1KFEB 1XWFA 2NADA 2ZIUB 2N75A 4XDGA 1QCDA 5F2OA 3D64A 3AFGA 2CLCX 4MJXA 4ETIA 2UAGA 1P44A 4M54A 2HHLA 2WJHA 4X63A 3AY7A 4L0MA 3IOMA 4DLUA 3FCXA 3RHTA 3ZE2B 2ZUEA 3OOWA 1O9HA 1PZEA 2O7QA 3D2LA 4YEDA 4BNFA 3TX2A 3TD6A 3PX2A 1T5HX 5CCDA 2QMOA 4X97A 2IIQA 1XRSB 1T1IA 2QVGA 5JJKA 1GL7A 1FFDA 2H29A 1KEUA 1QHXA 4K9PA 5LP6F 3PXUA 4IJMA 1NA5A 5EOVA 1Z68A 1EQ2A 4C2AA 1W7AA 5CA0B 4HNQA 1ULTA 3KV1A 3L04A 1ZGAA 4ARIA 3KQMA 2AYZA 3AHCA 2A0UA 1IZZA 2Z57A 3RSQA 4TLMB 3I5MA 4G56A 1Q50A 4WINA 3F5QA 2JGNA 1FC0A 1RHKA 2VWHA 2JGLA 2ZANA 3QSYA 1BJTA 3UHOA 4NU8X 1GPYA 4CEHA 5KX5F 4YDRA 4X95A 5I7RA 3RU9A 4M0PA 4DCCA 4DJDC 1HG1A 1KP2A 5BUSA 2B8EA 3B78A 1UDRA 4MYCA 3U9SA 1N9GA 1BCRA 3PNKA 1JG6A 4N0MA 5B1EA 2HNKA 1XQ9A 2R84A 2O4UX 4Z4GA 2HWYA 3U56A 2V9PA 4EVQA 3L8FA 1DKNA 4CODB 3FNBA 4FZ5A 1GTMA 2I67A 4J43A 6LDHA 4KK3A 4PWZA 1AX9A 3BL6A 2XGGA 1SELA 2QGZA 3KJIA 3QMWA 4B82A 4AT1A 1CNMA 2GFIA 3TLYA 4A9AA 5CU7A 4CLDA 4HRAA 2R60A 4ZT6A 5DB4A 2RHGB 3C5CA 4JJ7A 5FLYA 2ZPTX 2QX8A 1GUFA 2UVQA 4EDFA 3PVCA 2JZNA 1G38A 4R2LA 4UBMA 5B2FA 3FZEA 1ISGA 2DB3A 3KALA 1GTZA 2PX2A 3MERA 3Q5DA 4KIFA 2D4HA 1EE2A 2C9CA 4ZP1A 1DGQA 1DQRA 3ZC3A 5FL7A 1LI4A 1XZCA 2CL0X 2CCKA 3GIDA 4JBXA 4QHSA 4CT0A 4GBJA 1E7MA 1OXUA 1TOAA 3DP7A 1XTVA 3GLTA 2AL7A 4HFJA 4KO2S 2WICA 1KZ6A 2QYTA 3NJRA 4GQIA 4XASA 3ZW9A 4BMYA 2OD7A 4XYGA 5HDBB 1OC4A 2R5NA 5LA6B 4ALLA 1DNPA 2ADMA 3PUKA 3RYIA 3BJZA 3JQCA 3ZWWA 1JFSA 1BS9A 1O95C 5AVWA 3I2HA 2G4LA 3GXBA 1I4DD 2TMYA 3GJQA 4ZVLA 3VR4A 5F73A 3IMEA 2FLWA 3DVAB 4A0HA 1ZH0A 3VA7A 3BBPA 4Q6BA 4HDAA 1HDCA 5IFLA 2W0SA 3RG2A 1C1XB 3AL3A 2D1FA 4KH0A 2Q07A 4BLOA 3OHPA 1BSVA 3IPYA 1YQUA 3PC8C 2HKIA 4K6CA 5CX4A 4BNWA 4EEZA 1ZSYA 4KVGA 5JEEA 4JC5A 1SWVA 2G40A 2V7VA 4M55A 3WZMA 4IDHA 2YJ5A 3LZDA 1C0PA 2VOEA 3TR0A 2OMEA 1USKA 2NOAA 2HMAA 3ZVMA 1TJ3A 2G5TA 3VJKA 1TADA 4GSLA 3MJDA 1P2UA 3PWTA 2CFOA 4BP1A 4DY6A 1RWXA 3M6VA 5K0JA 3PFWO 1O9GA 4PO8A 4LPKA 2VSXA 1APBA 4UNRA 1XSEA 5CJ2A 2BDEA 4E03A 4N8DA 2DSTA 4H7KA 1B93A 2HJRA 1KDZA 4R81A 4LYHA 1NZDA 2IBMA 3LKDA 1N7HA 5E8JA 3SU8A 3E1SA 2ORYA 2FUKA 4QXMA 1DLJA 2WTEA 3U5ZB 2R25B 2H5LA 3UWMA 2D00A 3IRVA 3L41A 5BWBA 3U4QB 1HFJA 1U7PA 2UXBB 2R1UA 3F4KA 1ULHA 2A9OA 4UULA 4NAVA 1HDOA 2VLIA 2QTRA 2L17A 3OT5A 5LYYA 2KMLA 1ISHA 2V54A 4XDYA 2MJLA 4BCCA 3T1HB 3NM6B 1D7AA 1YBVA 3B3FA 3L7IA 4Q93A 4TL6A 2VNSA 1RI1A 4EYEA 5EXSA 2ZIFA 3GWGA 1Y4DE 2N42A 2NVWA 1SIUA 2H1VA 3ZI7A 4CMIB 3B3GA 1G20B 4FDVA 4TMXA 4CMIA 1Q7BA 3PNPA 1JQKA 1TQ6A 3H9BA 4I3HA 3RWBA 1VI5A 4MYTA 3UH1A 3HXTA 1GEGA 2CXHA 2FPIB 1XVIA 1R5BA 2PGAA 3ZXSA 4DLWA 2Q41A 9LDTA 2HTEA 3V33A 2X13A 1E2EA 3MJRA 4GMKA 4YCBA 1Q77A 2UYYA 3OLCX 1O2DA 1UPCA 3BREA 4F8JA 4FX2A 4U0JA 5DVZA 2MTBA 2FFAA 4EJ6A 4QZVA 1D2CA 5JTTA 5A2GA 4RFLA 3GH3A 3MTEA 2M6LA 4IVQA 2GHQA 3AV0B 1K9SA 4RZIA 3HLTA 2RONA 2ZT6A 3GAZA 1XROA 4X3CA 5HFJA 1N2HA 3SS8A 5M3BA 1J2RA 4EKGA 1PK8A 1UZLA 2R1TA 3KOUA 4NBVA 5E9WA 1PR5A 2OCKA 4KXUA 3ZDZB 4CJXA 1ZL0A 1CZHA 3I9MA 1PJZA 1P6UA 2DULA 3KR0A 5AI0A 4Q7QA 5KNLA 1ZAKA 4XPIA 1YHYA 1XZ8A 3LX4A 2QRMA 1GT91 3QYPA 2VK4A 3W5IA 1KSFX 4KIGA 5L3QA 5AKGA 5EWJA 3E9RA 4RD2A 2XA1A 1JB1A 3CW8X 2XWJI 3R3VA 2WWTA 1SKYB 2UUBB 5JSKA 2CL5A 3PFGA 4OMDA 1QGYA 2WMDA 5ITWA 4C0BA 3KJEA 1GXSB 3GVIA 5TR9A 4JJ4A 1GGKA 1L1EA 4MUIA 4P4GA 5FQNA 3SYLA 3FY4A 2QI9C 3BRSA 1SVNA 4JUBA 2QNRA 4TMVA 2P0AA 4OQMA 1O5IA 1E2NA 1BMFA 3K0AA 4PINA 5JSQA 1Y3HA 2GN8A 2JKZA 3EOAI 1SKYE 2BHLA 3GWZA 4RNCA 3OKCA 3H87A 4Y1EA 2H7XA 3RRFA 1DADA 1JG1A 1RWQA 1V6SA 3RYIB 1PI3A 2OD9A 2ZSHA 1F6BA 4KRXA 3R8FA 4OLFA 3HZRA 2ZRQA 5JSYA 4W1QA 1X9GA 4BBJA 2SNIE 1SXHA 4OYRA 2WMOB 1L5VA 4ZA2A 5KWEA 4OMFG 1SVUA 4Z0NA 2XUDA 3K70B 3LQ4A 1JILA 3OQIA 2QZJA 3W2TA 4OKIA 2XRZA 5ALRA 1M7BA 3B36A 1QLHA 1UC5B 3HP4A 1HE5A 1ZINA 4M1QA 4DV1B 1OSNA 2F1HA 3IBGA 2GZ3A 4M6WB 3TTTA 1YA4A 2DPMA 1IVNA 4N65A 4R0MA 3WLMA 5KVAA 1LQUA 1AO0A 2N46A 1XEWY 1X7DA 1YK0A 2Q45A 1XL1A 1PLKA 3EDQA 1M5RA 4NDNE 3FLEA 1D2RA 1AUXA 3WMWA 5BSTA 3WGLA 5F3RA 2AVDA 2P4SA 3FKJA 3GROA 3COSA 3UV3A 1U3GA 3CNNA 1VPDA 2DTDA 2NO4A 3BD7A 3I83A 3N0VA 4BNKA 4ZTZB 4BMNA 4AX4A 1YA8A 2N3ZA 2ON6A 3D0QA 3M5CA 4D9EA 3LCRA 4GBMA 4H2DA 1CUWA 2P3LA 2V7EA 3ORQA 4RY9A 2RGRA 3N87A 4D92A 3OLZA 3Q7EA 5KNBH 2UV8A 5IAOA 1R3DA 3MYRA 2CWWA 2X42A 1QDEA 3KKZA 3OIVA 3A31A 2PWPA 3HPQA 2Q3HA 3OZ7A 1RS0A 3QV2A 3MUEA 1QTRA 3QPWA 3KOMA 4DLZA 3ZNPA 1TF2A 2X6RA 3IUSA 4LVOA 4M1KA 3RRZA 2YIDA 4FN5A 4BGEA 2E82A 4I08A 4KR2A 5JH7F 4B34A 4K0RA 3QPBA 1PL0A 1V7ZA 4EL5A 4X7PA 2A1IA 1E60A 3F6SA 5A5EA 1NW6A 3Q7IA 5IT5A 2FMKA 1U63A 4J07A 3UMBA 1VBKA 1ZJYA 3NLLA 2R7MA 3BGIA 4U39A 5AJXA 3GPCA 2HRBA 3JQAA 4HQ6A 1FQKA 1FYWA 3KRTA 3SBDA 4DG5A 2BFDB 3CE6A 1K6IA 2HBYA 1UMBA 4RMHA 1W73A 1OCEA 2R00C 2XXJA 4OYYA 4R3NA 2PKXA 5CCBA 3KO8A 1T5IA 3CO5A 5TPZA 3IO3A 2HJWA 3N75A 1WG8A 3V4FA 1K63A 2IY8A 3QVOA 3NH9A 4HT3B 4EY8A 3TRFA 3G8YA 2AI3A 1PS8A 3DOFA 2ZK7A 5AVYA 3DWIA 2COUA 3QVXA 3IKLA 4B79A 3H9EO 2H1FA 2CXXA 3ETJA 1GZ6A 4IWXA 5HEKA 4DXHA 3AHEA 5AI8A 1F9EA 1C9NA 5IAEA 4G07A 3GW8A 1I7PA 2ONZA 1MG0A 2JDID 3NB0A 2GA9A 4EHLA 4DCUA 2WHEA 2GN1A 2BE7A 2YJZA 3UCEA 5KHOC 3ZWBA 4DV4B 2B4RO 3U0BA 1Z5NA 5C8XA 2BR4A 4LGYA 4D44A 2OFWA 3UK7A 2ZJAA 1L5HA 2O0MA 1OAOA 1LSUA 1N2BA 2IHJA 3UWKA 3LW8A 4NICA 4KH1A 5KTSA 4I5EA 1DCMA 4O2BB 3RUPA 4G2NA 3AP3A 5CLJA 3WA6A 3GZNA 3GG2A 4PLZA 2PE5A 2W8BB 3QWAA 1LBHA 1EX1A 4CV1A 4EG4A 2WJGA 3OLQA 4A91A 4QOEA 4EIWA 4XYEA 3NS7A 1TYEB 1KJYA 1SUWA 1Y5NA 3RUHA 1E2IA 1J20A 1GCUA 3FMIA 2ZYAA 3RIHA 4CMBA 3A6GA 2QOEA 3PJFA 3RM3A 4AJHA 4QOIA 3AF0A 1UH5A 1MD9A 4NPAA 2EFJA 4Y30A 4RA9A 4JJAA 4K8RB 5T6BA 2BH2A 5L95A 3CRQA 4KN6A 3DBRB 3PVSA 1GA1A 4IOMA 1SXJD 1EUCA 3H13A 5H68A 2O59A 1ESMA 4CEJA 1RU3A 5EIBC 4ASUD 5H1YA 5TMDA 3VH4A 1XCBA 1QZ3A 1Q84A 2O2HA 3RASA 3CO0S 3II6X 2GPSA 4Q3KA 4ENQA 1KP3A 2XBLA 2PRIA 5JWRA 3LE8A 1OZGA 2F8MA 3DQZA 3FCEA 3GXOA 1VL5A 3IILA 3T5CA 3T4PA 1L9KA 1LK0A 4RKQA 1VB3A 4RK4A 5BR8B 1AC5A 4WI1A 1XEFA 2K2WA 1EHIA 1K6MA 2FAXA 4IMRA 3ZUGA 5HZGA 1AV7A 1RAAA 2BFBB 1KOJA 2W2KA 1X74A 1Z2OX 2IUSA 3EVAA 3PXBA 4IY1A 3V7WA 4KTTE 3KDPA 5IW8A 5K6TA 2QBYB 2GF0A 2QTAA 4P84A 1QZXA 2WIDA 3LHFA 4YREA 4L76A 4EQ6B 3HA7A 1KZ1A 3ZH9B 3BE6A 4OL0A 3AB7A 1A5SB 2CXSA 1GADO 1IB0A 5ALZA 3LYLA 4FKZA 2X9VA 1SCBA 3PQCA 4O4LA 5FI3A 3UHFA 3ZX4A 4F3YA 1JSRA 1KAHA 5FIUA 2WJ6A 1H2ZA 2GVZC 2QM3A 1JQEA 2ZIEA 4A10A 4E1VA 2CNWD 1N2IA 2QLTA 4JT2A 4OSOA 4UM5A 4IQ4A 3AU8A 3TRIA 1D4FA 1GR1A 3EVNA 1DFHA 2FVXA 4M36A 1QH9A 1XLTC 4ETNA 1VCHA 1U7XA 5KTKA 2BFFB 2VSYA 1ZM9A 4EJSA 3W2GA 2DR3A 3DZKA 1G3IA 2BL4A 2ADOA 3SBEA 2H2WA 1Z5UA 3DL7A 4ALKA 3LD9A 3I6BA 2BKXA 4PSDA 3ZZ1A 5F1OA 1YDFA 1B41A 3HY6A 3NXKA 1FLNA 2AEEA 2XE4A 1DEXA 3LX8A 1PGQA 3TGLA 3PC6A 3PR1A 3OCYA 5FOUA 4L15A 3E81A 2WV9A 1UKBA 4TRRA 5ALLA 5K3FA 1YZGA 2Q9UA 3BIFA 3H4MA 2A0XA 4BCDA 1HR0B 3ZGLA 3CF4A 1ML4A 1MORA 3CA8A 5HJ5A 1K6JA 5SICE 5F98A 1M6VA 3DJFA 1ONOA 4YAGA 4HS9A 2J9FB 2NU6A 5CT6A 3TLCA 3USCS 2O20A 5FF9A 2PNFA 3AF4A 4K3VA 1TYDE 2NUAA 4ZI7F 2H7VA 5JS6A 1T3SA 2IVZA 4Q21A 3OX1A 3VDRA 5JVDB 2HJGA 2GZ1A 4E4RA 1PEAA 3BE4A 3TD2A 4GLJA 1VSBA 1XLWA 3JR3A 5F12A 1CIVA 4WKBA 4AN4A 4DQ0A 1ZW1A 4EBBA 4YV1A 1R18A 4MRSA 2XODA 5P8WA 2XDYA 2GM4A 3B5JA 4AUNA 3S8YA 5JSZA 4ZU6X 1SKBA 1G2OA 2C1XA 2DH5A 2I1WA 3FPKA 3B2EA 4W7IA 5IAGA 1HT3A 3FYUC 3FPFA 3UXHA 3FLMA 4XOIA 1M2OB 3WOHA 4IF6A 4N5LA 1L5LA 2Q9BA 1OAKA 2L69A 2XCRB 3HADA 4Q9AA 1ZBDA 3IKTA 3RSZA 1Z82A 1M2FA 2WEKA 4FFDA 1JFRA 3P2JA 5BOVA 4AJNA 3NHKA 2J7KA 3RFVA 2TRSB 1KI6B 1MGPA 1KJZA 3PHIA 2VIIA 3SOPA 1ORDA 3ZJUA 2W6JA 4RULA 3A6PC 4QT0A 3ZNNA 1Z0DA 3M3DA 5CW2A 3OQOA 3SC2B 4EGSA 2FGJA 3PJEA 4ND4A 3KUUA 3V7FA 4UTRA 2IPLA 4ZMRA 2DKFA 4QYSA 3SC2A 1JG3A 1YL6A 4EYQA 2ENWA 1KF0A 2ZJZA 1XDSA 5BR1A 3HJGA 2F9FA 4OGLA 4Y9DA 1HLFA 4WOKA 5EPOA 2GK4A 5CYGA 1P2SA 3D8BA 5JPCA 1KFKB 3S1LA 2PIDA 4C3VA 3L8EA 2IDMA 1S3SA 1VJTA 1EE1A 1E5XA 4IEEA 1QJ4A 4MPRA 4RYLA 1F0YA 2C5AA 2WHPA 4D9JA 3IUMA 3EPJA 3P2IA 2N47A 4UDYX 4CKWA 4KN9S 1JTVA 3NYIA 4OUDB 3I3SR 1GPMA 1E3MA 5DLQC 3CLRC 3G82C 4BL5A 4BPRA 2GKGA 3RG8A 5CFMA 4LJKA 4A8PA 2XWPA 1VMEA 1C30B 3W90A 1UAGA 2RGGA 3SZGA 5C1DA 4YBZA 5F77A 5C8VA 4FBMA 1JHXA 1H0SA 4YXWD 3ZJTA 1JU9A 2QLLA 1U0OC 1MV8A 3DOOA 3EQ9A 1YOBA 2AMVA 3DHWC 1J21A 3UC9A 3VMFA 3V8NA 1K7SN 3O4VA 3WMRA 1X2BA 5K3OA 1W5BA 1N4AA 3T0IA 3DMNA 3C1UA 2FRDC 4JBHA 5TT1A 2CZGA 1ODKA 1THMA 2ZB2A 4JLUA 3OPQA 5JSFA 2IQIA 4BJ5A 4Y0VA 4IWNA 2VP6A 4D96A 2F59A 1KO5A 3DBVO 1LV8A 1RP7A 2IBTA 5LD2C 1E20A 1FUEA 1R1DA 3NTOA 3VU9B 4XGNA 2GTPA 3R44A 1B1AA 2HQRA 2IIVA 3A1WA 2B7BA 3AINA 2AR9A 2QLMA 4JK3A 4AWAA 5A5DA 2WI8A 3KT0A 4GRIA 5KQPA 2FPSA 1I14A 2J5XA 1ZM4A 4NMXB 4G84A 5HG0A 4AKTA 1Z4NA 1U5BB 3IUQA 4F46A 4PX2A 4JI0B 3FTEA 2OORA 4NABA 4TTRA 3W2IA 4H1WA 1E6MA 3B1WA 3HZOA 4L5CA 1E0AA 1Z4PX 1BKDR 1D2HA 2RIRA 4PQEA 1N6NA 1NXTA 2JFNA 3AGPA 3TRDA 4AQ7A 2H1RA 3WDSA 3INGA 4KDFA 5JC1A 3I6QA 4JUFA 3QKUA 4TL8A 1CEEA 4R4JA 4LC1A 2YZMA 3U2QA 2VJDA 2GPYA 2QTHA 2FJ0A 2RGCA 2VHWA 2J85A 3ZDRA 3U3ZA 1CR4A 3VKGA 3CLUD 4O33A 1UWLA 1R6XA 1PRYA 2ZRDA 3QPCA 1BZYA 2Z2XA 5FA5A 5ULLA 4D9MA 3LHKA 4MTCA 1EXDA 2FQQA 2PH7A 4QGHA 4K9DA 1YQQA 3KT8A 1ZRMA 3PTLA 3T12A 5KTNA 3U81A 1OH8A 2IZOA 3BB4A 4FIZA 5KYYA 1I6MA 1X13A 2OB2A 3PHJA 5C5IA 2PLNA 5A7HA 3E23A 3HH8A 4PLCA 2B83A 2ZVPX 4WN9A 4C0SA 5MFPA 1SU4A 4IIJF 4DL9A 4FINA 4RTLA 1ECLA 2PL5A 2ZP1A 3EAFA 2J5BA 3O94A 4FEGA 3SZOA 4KUHA 4LE0A 3KTAB 1SUBA 5F52A 5KJEA 4PYQA 2XKKA 1PP4A 3FPHA 3FOZA 3CXRA 2Z1DA 5DULA 3DEZA 3ESQA 4Z9XA 1G21E 3U7JA 1LTHR 1U3UA 2ENUA 3DC7A 4QGFA 1CQIB 3NHLA 5IYZB 1PNTA 1JZQA 2JI8A 3JD0A 4N12A 2PVPA 3D6JA 5EWLB 2JBWA 2G77B 3IAAA 1E7QA 1UBSB 1QX3A 1T1GA 4FFSA 1J6UA 4PFKA 2C4KA 1A7JA 5CW1A 3RHSA 1IYZA 1JQ5A 2B3TA 2PMCA 1IWBB 3KM0A 1VTKA 2VCEA 5CDSA 4YMTA 2ZZNA 3NETA 1GUZA 3TNJA 4CM8A 1NBWB 2HWWA 5TQ0B 3RAEC 2JFVA 4FEEA 3GZNB 4C9BA 3I62A 3CVJA 2ZEJA 2MINB 5C8DA 4MS4A 4K0KB 3UTCA 3ACDA 3NI2A 3ZHCA 2DPXA 2RI6A 3OCJA 1OTHA 3IP9A 4U7TB 1AGYA 3Q2IA 2E5FA 1XAHA 3CLHA 3IDQA 4ZAWA 3QY0A 5BYBA 3HR4A 1P4GA 2Y0DA 1Q3TA 2X5OA 2LKDA 3AI7A 2J31A 3G59A 4JLMA 5KOJB 1N5JA 1DAMA 1V1RB 1QYIA 4ZGBA 1IUOA 4D6XA 2W42A 3QVJA 4L5JA 5JPDA 1JHMA 4RLFA 2WIGA 4AMUA 1LS6A 4TS4A 1TUBA 4CL0A 2HRRA 2X1LA 1SWWA 1R64A 4IXNA 3L6CA 4WLOA 1NW8A 5AM5A 2MHCA 2BHSA 4FFBA 3X1YA 1U1EA 4IIJA 3W6UA 1JUDA 2Z2ZA 5EE3A 3ND8A 1B42A 4N39A 4IDBA 1DG1G 3A3PA 3QYFA 1C3JA 3IMCA 1WPGA 3BIJA 1KH2A 2H92A 5KBYA 3HDHA 1MGOA 2XUFA 4M1SA 2OYCA 1AA6A 3MG9A 4OMCA 4G0WA 2D59A 3KZXA 5K05A 2BLNA 5FI0B 1A0OA 5C4GB 4MKHA 4IDQA 1QFSA 3ZLBA 4ARZB 4C4PA 3K4QA 3K6SA 4E5SA 4ZYYA 1V5IA 1MJFA 3K5HA 1TK3A 3AP1A 4QUIA 3GEMA 4QPJC 1JTFA 4BP8A 1N9KA 2AX4A 4EZEA 1R8JA 2ZIVB 1KRXA 3ICOA 3RTDA 1W9HA 5DNEA 3GDWA 1PD1A 1CS0A 5EUBA 3WXBA 3CBQA 2WR8A 1WW8A 1B4DA 4LKRA 4QATA 3R74A 5GONF 2FPGA 1H2HA 2HLPA 3V5NA 1OFIA 3EBPA 3VISA 4GZLA 2AMYA 2FX3A 1JAHA 1K7CA 2RHTA 1J49A 2QP4A 3N2YA 4KG7A 2BKVA 5DBEX 4B2LA 1EMDA 1GLGA 4JODA 4YIKA 2XZDA 1PHPA 3JQ9C 3D31A 1H42A 2ZFUA 1QO7A 1EGVB 3IVMA 3S28A 2PX5A 4MR9B 4E15A 4I4TF 3Q8LA 1O58A 3W5DA 3P9XA 4U6QA 5IX8A 2X0JA 4OBXA 2JFYA 4MR9A 1F2TB 2FXVA 2ZI5A 3LXXA 1SXJA 3QU9A 3K7EA 1DAEA 4AO8A 2MYNA 2W2LD 4GI2A 4ISBA 4M0CA 1ZVQA 3LIIA 1S2IA 4ZOEA 1Z0JA 4CN9A 3IAHA 3WJ2A 4IQ8A 1AQLA 2QAGC 1EK0A 4LC9A 4AF8A 1KI7A 4H17A 1XIVA 3KFVA 3H1PA 3V32A 4BRZA 1ZD2P 1M6VB 2F62A 1SULA 2C3MA 2UZAA 1J9GA 3DC2A 1YQEA 3K70C 3PSAA 5REQB 2EKQA 3L07A 2G1KA 4NCNA 1GGNA 3DLHA 4UU1A 2VYQA 4QPPA 1P2VA 3IV6A 2PZAA 1AUOA 5ILQA 3AVWA 4ZYUA 2IZ0A 2I22A 1T8RA 2VP0A 2DH6A 1ZIXA 2O3SA 4H1TA 4MLZA 2FK8A 4QTXA 1EXNA 4OHCA 3R6WA 3CF6R 3DM5A 4WEQA 1I30A 4KFUA 3A27A 3O8CA 3REGA 5B1YA 2G80A 1F48A 1HT1E 2QTVA 5CYFA 2YMMA 2WINI 5D84A 2WUDA 1ECGA 5DIZA 4UBLA 1XALA 3QKSA 4H08A 2D3TA 2GBLC 3AW9A 3GFOA 4IQGA 3CSSA 3P26A 4URZR 2NU9B 2R4UA 2Z9DA 3CF0A 4FD2A 1TQHA 2DETA 5H4GA 1NQAO 1GOTA 4DMMA 4XFJA 2VR1A 2YXEA 2WSLA 1M1XB 4M1EA 1H1LB 1EX7A 3GJ3A 1WCV1 3A2NA 3I52A 4HX2A 1BO6A 2MYPA 3N59A 3ZKAA 2CNDA 4BWGA 1N6PA 1Q1NA 3BA6A 2VHCA 4LUCA 3EODA 1LI7A 3GLIA 1TAQA 2W6ZA 2Q3DA 5B1SA 4AO7A 5DHPA 1HNXB 4LDNA 1E2PA 4XDZA 1CSEE 4EECA 4JUCA 5IU6A 1KIFA 1AQNA 3O9VA 3WO0A 1Z17A 2OWDA 3D2CA 1TVEA 3SXPA 1OI3A 2R00A 1JIIA 2IPMA 2ZJFA 4ZYZA 3GLFB 2Z8XA 1QIJA 4LMRA 3G0IA 3FPAA 3ON5A 4QGAA 5AKEA 1NASA 4DR7B 2E6KA 1JWLA 4G36A 2ZYSA 1KU0A 4MVWA 4NP6A 4N54A 2Z9CA 2RJ3A 3PZBA 4QFDA 2J07A 4R8SA 4C7JA 1KJWA 1WPRA 1X15A 3WFJA 2Z2IA 5A03A 2OOKA 3FI0A 2P1RA 3NOQA 3Q87B 4IIUA 3E5MA 4KPFC 3AYXB 3TIVA 3WYAA 3HBLA 1DXQA 1EWTA 3OECA 2O2YA 1VXRA 2YDYA 1RZRD 4H18A 1B26A 3NWJA 4KCGA 5KO2A 2ESRA 3EQ7A 1RJEA 3LIPA 3OMWA 2ZOSA 1N8KA 4LOHA 3RKSA 3TTWA 3Q6NA 5K8CA 5B58C 3DDCA 1PJTA 4P08A 1V41E 2V3CC 1SXJE 3TNFA 3JD3A 4EPYA 4J49A 3G8AA 3HJAA 4GL2A 3B5EA 3DXZA 1I2BA 1S7CA 2NUTB 2PVCA 4RVFA 3OIGA 1IY8A 2A0WA 3CTMA 2GO7A 4FFRA 3ANLA 4DKJA 1TM3E 5HR5A 3TNLA 3CS3A 1BEUB 3TL3A 1EB9A 5GZ6A 2CUNA 3ELYA 3TEFA 3ADCA 3MHTA 2HMWA 1ZN7A 3OOSA 3IVCA 3AKZA 5JNUA 1YNOA 3F7TA 1O0SA 3MWKA 4ZTBA 5TY0A 4F2HA 2ORED 5BOSB 4YRKA 4KQMA 3R6DA 3MXTA 4A0RA 2V7UA 3ONWA 2DEUA 2AZTA 4UE6A 4JB2A 3D4LA 2UUPA 1ZDMA 3QUAA 2WSSA 4AJJA 1NDQA 3VI4B 3Q6MA 3TGPA 3ZGXA 2FLVA 2ISQA 3TXYA 4M1YA 2DSNA 4XLLA 4LZAA 1DAKA 4GUDA 1MJGA 1JEDA 2JAUA 3A7DA 3L84A 3QHPA 4IH9A 4JL5A 1CUJA 3BK2A 3IE2A 1FFXB 1MHTA 4OBBA 1URPA 1ZC4A 1P74A 1D1QA 3B3AA 1YVRA 1N0UA 1V2HE 2WKSA 5ILOA 4OXKA 2CB9A 2O6LA 4R2XA 3R41A 1C7QA 1NGSA 2YYYA 4XGKA 1C50A 5G41A 1X8JA 1SQGA 1YR6A 1AHHA 4O63O 5KOHB 2PV0A 5LSAA 2FG5A 2VEOA 1I2MA 1HV8A 4LZLA 5D01A 2CLLB 3W77A 2R8YA 1U7WA 4HWRA 1G3RA 2QR3A 4HDKA 1ECBA 4RLHA 4ATNA 1DJLA 3PUJA 3R0QA 1UAAA 1XLUA 4TZ6A 2RGYA 3W6PA 4I4LA 1HORA 3MQ2A 1JRLA 3VR4D 4RTNA 1DU4A 4WZAA 2B0CA 2EG9A 3VR3A 2DP4E 5FTMA 4EG6A 1VIDA 5BW8A 3PDWA 4C7OB 3BMNA 4D4LA 1ADBA 4BWYA 4F45A 4F56A 2OP0A 3SHWA 2HH9A 1TCAA 1U94A 2RARA 1GRCA 1TZJA 3FOAA 4KWTA 3T1TA 2O50A 3ORHA 5F21A 1NUSA 1Q0SA 2XTMA 4MH0R 5DI3A 4D9KA 3TQSA 4OHYA 4FHDA 4BFLA 5FX2A 1ZVMA 5JNTA 2D1QA 4F5EA 4BLUA 4ER7A 4CRWB 4Z9BA 1P1FA 2XE6A 3HB0A 1XU4A 2YWRA 4U1RA 3PF9A 4JASB 1REQA 4EGFA 2IDJA 2YN0A 4EATA 5LNK6 3LPLA 5F7ZA 1CVIA 5F3DA 1GSHA 1XNGA 1L7PA 2FLKA 2SICE 4CEHB 4TYPA 4L0CA 3PC4A 4J1TC 1VYVA 3B3JA 1MZVA 1SMKA 4K9QA 2IY7A 4LJ7A 4AJEA 4CF4A 3EMDA 1D9ZA 3C6QA 1ULSA 2ZJ0A 3BFKA 3QK7A 4N9WA 4S0ZA