1DG9A

Crystal structure of bovine low molecular weight ptpase complexed with hepes
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
157
structure length
157
Chain Sequence
AEQVTKSVLFVCLGNICRSPIAEAVFRKLVTDQNISDNWVIDSGAVSDWNVGRSPDPRAVSCLRNHGINTAHKARQVTKEDFVTFDYILCMDESNLRDLNRKSNQVKNCRAKIELLGSYDPQKQLIIEDPYYGNDADFETVYQQCVRCCRAFLEKVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TYROSINE PHOSPHATASE
publication title Crystal structure of bovine low molecular weight phosphotyrosyl phosphatase complexed with the transition state analog vanadate.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
total genus 64
structure length 157
sequence length 157
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 1999-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1dg9A00
1B00A 2HPHA 2E4XA 4ETNA 1LK0A 1ISSA 4FB4A 4NCBA 2PUAA 4JAVC 1JFTA 2M98A 4KQCA 2E4UA 1NTRA 4RK1A 2GKGA 4G0PA 5IX8A 5FWXB 1USGA 2HQOA 3DGEC 5TPWA 2FLWA 2JVJA 3O75A 3FGZA 1QP4A 5BQ3A 1WETA 3BBLA 1EHCA 1ZHHA 2X7XA 3N0WA 1NXOA 1DCMA 2M1ZA 1U2PA 3E61A 3JTEA 4G0MA 3NHZA 3OLYA 1E6MA 5CNJA 5EWLB 1Z2DA 4RY8A 3D8UA 3QX8A 2NZUG 2FN9A 3CNBA 1GUBA 1YTUA 1EAYA 4RV5A 5HSGA 1JX6A 5CNKA 2NT3A 5IULC 3K9CA 3O2SB 3QLTA 4KPYA 1MB0A 2QSJA 3DLBA 3JY6A 3JPYA 4EVRA 4RXMA 1NY5A 3RVOA 2FQYA 1APBA 3H5WA 4KK4A 3OMWA 1QPZA 2QW1A 4QICA 2MSKA 5I4CA 1JYFA 1D1PA 4YP9A 2IOYA 4MYRA 5HM6A 1VLZA 4H3KB 5KC9A 2FMHA 1URPA 2ID7A 3F6PA 3H5OA 3O1JC 2OENG 2ZAYA 2QU7A 3HUTA 2JVIA 1NXPA 5JNSA 3EULA 4LX8A 5FBKA 1DJMA 2H0AA 3RVLA 5GQSA 2R4QA 5FWYB 5B3JA 1P8AA 4JASB 2W42A 1TJYA 4CBVA 3DGFC 4N47A 3Q7SA 1JLKA 1AB5A 1ZVVA 4JB0A 5TPWB 3OLXA 3H5TA 4L85A 4XAQA 1A0OA 2PLNA 1RPJA 3NNSA 4QYMA 3RVPA 4ML3A 2MSWA 4OBBA 4LDZA 4XLTA 5KQPA 3CLKA 5KQLA 1SXGA 3HDGA 5IUNC 2O20A 3LUKA 5IUKC 1PNRA 3BREA 2F8SA 2FVYA 4RK5A 2FMIA 3O1IC 3IP6A 1Z2EA 1JDPA 4D6YA 1BAPA 1ZITA 4D6XA 3LUJA 1YK0A 4G0YA 3H1FA 5FBHA 4EYQA 3RVSA 2GX6A 3RVMA 4ETIA 1XHEA 3QLUC 4JOQA 2GBPA 1R8JA 3IPAA 3O74A 3QLVC 3RQIA 5DLEA 4P1ZA 1EFAA 3LFTA 1SRRA 2FLKA 2RDMA 4N03A 1ABEA 3IDOA 2WRZA 3G1WA 4RS3A 3KKEA 3NBMA 5DGCA 3ILYA 3OM0A 5IBQA 4Z4EA 3H6HA 1M2EA 4YLEA 3OLZA 3JS5A 6CHYA 2AYZA 4MS1A 4RU1A 4YR7A 2VUHB 1UDRA 4B09A 2E4VA 3CS3A 1VPWA 3RVKA 1F51E 1YIOA 2A9OA 3B2NA 3F6CA 4Z4CA 1KRWA 1SXHA 1Z15A 1NXVA 3IP9A 4LE0A 1DC7A 4MRMA 4OATA 5ABPA 2P4UA 4EY3A 3CG4A 9ABPA 2L2QA 2PUCA 4WXEA 1D5WA 4GNRA 3EDCA 2L19A 4YGXB 1ABFA 3HSYA 3LMKA 4MS4A 1FFSA 1OXBB 1YK1A 3BILA 3C97A 3SG0A 3T8YA 1S8NA 4E7PA 3CZCA 1PHRA 1Z16A 2JBAA 1AB6A 1C0EA 3EGCA 5IC5A 2PUFA 3W9SA 4EGSA 3CTPA 3H5VA 4RK7A 2CHEA 2WY2D 4XASA 1YS6A 1JYEA 3N0RA 3OO1A 2J48A 2MSLA 1P2FA 4S05A 5ED4A 1DCFA 2RGYA 3T95A 4RY0A 3IPCA 3HS3A 3KLNA 5T3YA 5JNUA 5JNVA 3MYYA 3UK0A 1LJLA 3NNNA 4EVQA 2VK2A 3HXMA 1A2OA 3HVRA 3MQ4A 1DG9A 4MS1B 4JP1A 1E2BA 4JA2A 2QXYA 3R0JA 3KLOA 1K68A 2WJWA 3LKVA 4O5AA 4LRQA 3TB6A 1C4WA 3GBPA 3HM9A 1JWLA 2E4ZA 4EUKA 3JVDA 1IIBA 1LJUA 4G0XA 4WZZA 3QK7A 4MRMB 4RKQA 2LUOA 2NUBA 4XARA 3MMNA 5GOTA 3H5LA 5TE9A 5JS1A 1EWVA 3BRSA 4Q7EA 3VNBA 4S04A 2PUBA 2JCGA 1PUXA 1U8TA 3LUDA 2IYNA 4MS4B 2ID9A 4MGEA 1CHNA 2GWRA 4Z4IA 3C3KA 2JK1A 2JBAB 1RXEA 1ZH4A 4PEVA 5D2CA 1USKA 4KQ9A 3C3WA 4MR8A 1Z18A 2A9QA 4KV7A 3N75A 3L49A 1VRVA 1E6KA 1GCGA 2FQXA 4MQEA 4G0OA 4IMJB 1ZGZA 2H3HA 2QV0A 4OLBA 4O1HA 4MLCA 5EWMA 4LDAA 4RK6A 3GBVA 3CKMA 4WWHA 1QP7A 4D74A 4EVSA 1HEYA 1JHZA 2FQWA 1QKKA 2YHAA 1GLGA 3FFXA 1QQAA 4FE7A 2VUIB 1NXSA 3SQNA 3G85A 2RJOA 3CU5A 5C5CA 4MS3A 5TQ0A 1Y1LA 1YS7A 1QO0A 3OQMA 1CEYA 2DRIA 1LBIA 4H3HB 3TD9A 4N41A 5IUJC 4PE5B 1ZN2A 4XXHA 3Q9SA 3QEKA 4IRXA 4Z0NA 3C3MA 4EYKA 2R47A 3H1EA 1KGSA 3GV0A 1J56A 4TMYA 5EWJA 1MIHA 4RDCA 4MAAA 2A9PA 3MM4A 3RVRA 5JNRA 4RK0A 4YWHA 4KMRA 2MYUA 2IDMA 3HV2A 3EAFA 3VNAA 2PL9A 4ETMA 2E4YA 4TLMB 4JB2A 2LP4Y 4YO7A 1M5TA 5PNTA 4ZMSA 3BRQA 1DBQA 3OLVA 4WUTA 3A0UA 3LUFA 5CHYA 2FEPA 4ZJPA 3MF4A 5BRJA 3CFYA 2LIVA 1RXIA 1Z25A 2PJUA 1XHFA 2PAFA 3QEMA 4MR8B 5E3JA 1JL3A 4XFKA 1VKRA 1U04A 2FMKA 3HCWA 5TPZA 3KYIB 1T34A 3DZDA 3KS9A 3N8IA 1P6QA 4MQEB 3EQZA 3P9YA 4G0QA 1QQBA 4Q6BA 1CYEA 5EWMB 4YCSA 1EWKA 3QX9A 4HYEA 5BR1A 1BDJA 4LZLA 4MR9A 3QELA 1H9CA 3SY8A 1E6LA 1SXIA 2FW0A 2OQRA 4YV7A 5KI6A 3A0RB 2IKSA 4QYWA 4OG2A 5KQMA 2KYRA 3OO0A 1ZY2A 3Q7RA 2PKXA 4HNQA 3ROTA 4KZKA 3RVJA 3HDVA 2WB4A 4MS3B 4Z9AA 3FDFA 3HUUA 3LUCA 5TQ0B 4QPJC 5C5EA 2IPLA 3M6MD 4IF4A 2A9RA 2IPAB 1M5UA 4W5OA 1JFSA 1ZDMA 4G86A 3MIZA 1NXXA 3SNKA 2IPMA 3N0XA 3MA0A 3F73A 1PEYA 3O2QB 3Q41A 5EWJB 4RY9A 5HQJA 2HJ9A 3D02A 1QNLA 5CNIA 2QVGA 1NATA 2YHBA 1KRXA 4MQFA 1YVUA 3KHTA 4ZYLA 3JVIA 1DC8A 2NT4A 3IP7A 4TLLB 5IEBA 1ZGGA 1USIA 3F7NA 4FE4A 1Z26A 3CZ5A 3GWGA 1BVHA 2HSGA 3QLUA 1QP0A 1FSPA 3O21A 5HKOA 4PICA 3QLVA 1FQWA 1I3CA 4RSMA 1PNTA 5KC8A 3LUGA 3O2JA 2RJNA 4IMIB 4Z4GA 4DN6A 3QEMB 3OM1A 2JB9A 1BDIA 1TLFA 3KJXA 3GT7A 2FN8A 4N0PA 5B3JC 2HQBA 3OQNA 2L18A 3EJWA 4KREA 2B4AA 1OXKB 1DP4A 3LUAA 4UHKA 1JDNA 2PE5A 5TQJA 3ROFA 4MR9B 3QELB 7ABPA 5IEJA 1RZRA 2BGGA 2B1JA 2CWDA 4MLDA 4W5RA 4Z9BA 3FMVA 4EYGA 4KFCA 4G0ZA 1A04A 3UKJA 4HNSA 1BA2A 5JS2A 3KYJB 4RWEA 1BDHA 1DRKA 2PMCA 1FFWA 4DADA 2WJAA 2MYTA 2R25B 4HNRA 3ILHA 5DTEA 4LE2A 3LTEA 4WXMA 3GYBA 5TQ2A 1YMVA 1W9HA 2NZVG 2E4WA 1P6UA 3KTOA 1PEAA 3I42A 3NHMA 2FKAA 2FSPA 1K66A 2QZJA 5JNTA 4IILA 1QMPA 3JPWA 2IPNA 1QO0D 4Z4HA 4RZSA 1NXWA 5F64A 4TN5A 3RH0A 1ISRA 4UHJA 4MQFB 3N53A 4O1IA 2ZWMA 3LUHA 3N6VA 1U0SY 2WMYA 4P98A 3UUGA 4PYRA 2P9HA 3CHYA 2TMYA 4GPAA 3K4HA 5DCLA 2R48A 2PUGA 3T38A 4F12A 4Y9TA 2PUEA 2FTKE 4L4UA 1LBHA 2I6FA 3HO1A 1MAVA 3CG0A 3RVNA 4OTZA 4Z4FA 5JNWA 2LBPA 4YS6A 2JRLA 1Z12A 3M9XA 3NNDA 5KQGA 4F06A 4LE1A 3EODA 3E3MA 3I45A 4NICA 2Q5CA 3Q15C 3HEBA 3GL9A 5CNMA 5TPZD 1F4VA 2PL1A 4ZMRA 1Z17A 2FEKA 4NV3A 1W25A 4MR7A 1ZH2A 3A10A 4OLAA 1YMUA 4W5TA 2HQRA 4N76A 4W5NA 3GA5A 2LPMA 3HZHA 1EWTA 1JH9A 2F8TA 1JBEA 4YRZA 2VYCA 4KRFA 4F11A 2FEWB 4Q6WA 4MPTA 1GCAA 1KMIY 1D4ZA 4Z99A 5TQ2B 3KCNA 6ABPA 2FXIA 4KK3A 4RXUA 4KVFA 3C6QA 2QR3A 3TO5A 1DBWA 4N0QA 3OMXA 5T7BA 1NXTA 1MB3A 1SD5A 8ABPA 1U2QA 4KNYA 3LOPA 1D1QA 1L5YA 4WT7A 2PUDA 4EYOA 1JF8A 2MYNA 4RK4A 3EQ2A 3Q7TA 3HJFA 1RNLA 5FWXA 1D2AA 3O1HB 4NQRA 4IGAA 2FMFA 5KWSA 1L5ZA 3FFTA 2GI4A 3H75A 1ZESA 3HK2A 4DQDA 3KG2A 4M88A 2XDYA 4G97A 5EWLA 3H5IA 3DBIA 3OQOA 2N9UA 1DZ3A 3H1GA 3IP5A 3DLHA 2CD7A 4W5QA 1Z13A 1XWWA 3M9WA 4ZPJA 3SAJA 3TMYA 1TMYA 4MR7B 1DBPA 4PZ0A 1JFVA 2WWVD 4F3TA 1GUDA 4NCAA 2AYXA 3I09A 1TM2A 2QVCA 1FFGA 3H6GA 4RKRA 1DCKA 2CHFA 4F8JA 1RZRD 2JVKA 3LKBA 2MYPA 3FFWA 3L6UA 3SM9A 1MVOA 4E7OA 3OLWA 3T6KA 2L17A 3KSMA 3TX6A 3A3KA 2V0NA 1ZAYA 1DRJA 5BRAA 1M2FA 3CRNA 3RVQA 3S99A 3URMA 4RXTA 5DKFA 3GRCA 3I5AA 1TVMA 5FWYA 4H60A
chains in the Genus database with same CATH superfamily
4CQNA 1RXSA 3W6UA 2EXXA 1OX6A 3PNVA 3KUDA 4TXJA 3C45A 4JI1B 4NFYA 1XZJA 3PJDA 2ZDQA 4NESA 4DIFA 3CSUA 3TZLA 4UVGA 1XP5A 2HI0A 5FP0A 1TVCA 3LXRA 1Z6AA 1BGWA 2VXCA 5IJZA 4KW7A 2JA1A 5IAGA 4YJ3F 4DIKA 3QIVA 1E63A 3FGZA 3NHBA 1RHMA 3GDHA 1UM9B 1JXAA 1ZONA 2FW1A 4X85A 4OHUA 4TTJA 4EO9A 1ZKDA 3Q8KA 5K3EA 3L0BA 2JLXA 4EL5A 3F6BX 2JAOA 1E6MA 3OFNA 5BUCA 5EWLB 1H8ED 2GN4A 2GYYA 1TZBA 3HUEA 5ALEA 3EFOA 3K0AB 4BGDA 2Y1LA 4Q7QA 1P4SA 2FUG1 1ONSA 3UWKA 3ZJ4A 1FOEB 1HE1C 1G21E 3DNMA 4MTLA 1MXHA 2I03A 4IDNA 4XDYA 4U2BA 3WV4A 1U4OA 2PD3A 4WCVA 2JEOA 5FA5A 1QPZA 4QICA 2WU0A 3DVAB 5K0ZA 4V0SA 4D7AA 2Z1DA 4IIBA 4EH1A 4UM8B 3BMNA 5D6OA 3VR2A 5CFZA 4E3WA 5F7OA 4HXEB 9LDBA 5EMHA 2WHPB 4J07A 4R8VA 2A84A 3AVOA 2C94A 3NGLA 3GRYA 3IT0A 4KJXA 1CJUC 1GTG1 4B4WA 1CVLA 2I3DA 2A78A 2JVIA 2E2WA 4KPUA 2I3GA 4RHUA 3ZWMA 2X6RA 3AVPA 1NDQA 1QIFA 1YGPA 3GFPA 4DS3A 4IF6A 4E4YA 1DJMA 2HSWA 3KVRA 4HZGA 3SDZA 4C6RA 4LJRA 1AUQA 3G9TA 4PGFA 5AYVA 4MYCA 1DDGA 2C04A 2PL3A 4KXXA 1J2YA 5FPHA 3OQVA 5CFPA 1XG5A 4JZKA 1BKSB 1USVA 1ZQ9A 2GZMA 2VS1A 3LHIA 1E0JA 1WTAA 4RQUA 3UWDA 1C1DA 2DR2A 3R3ZA 1LLCA 2B7LA 3MILA 1EAMA 2GXSA 2JI7A 3DV0A 5C34B 4G5XA 4J6EA 4EB3A 5L3ZA 1FY2A 3L82B 1O1YA 3FLMA 3I12A 1RJDA 1IQUA 4OUDA 5J59A 4B34A 2PMWB 3GLIE 2JKYA 1FDVA 3EUWA 5E8JA 3TJRA 3P5SA 5KQLA 4XB1A 3KXLA 3P96A 3RTCA 1G8AA 2OE2A 3WWEA 3ZZTA 2F8SA 5A1TA 3FUVA 3HMKA 3PZRA 3Q0TA 4BTLA 4ETWA 2EX0A 2Q5JA 3DOOA 4HKTA 4WN9A 4E08A 3KXPA 1RP1A 4XM0A 3U4AA 4RTSA 4DL9A 1U7ZA 1EFPB 4D6XA 1YACA 3MHPA 2LKCA 3OJXA 4QHYA 5DT2A 3T5MA 1AO3A 1Q7BA 2C5SA 3VKFA 4I8IA 4NFHA 1QNFA 3H1FA 3JZAA 1HYQA 1ZH6A 2NSLA 2GX6A 4D4LA 4LMRA 2QW0X 4L95C 1NQVA 1QIEA 2P69A 4JFAA 5CH8A 5DLEA 2H4WA 2AJTA 1NNI1 1TU3A 2DWPA 1ABEA 2FPSA 2WU3A 1DE0A 3BQMB 3LT2A 1U7WA 5EAIA 4TRRA 1M2EA 5FR1A 1PWYE 4EQZA 2C77A 5BWCA 1XQXA 1YZVA 3G0OA 3LBIA 2P5TB 1QYXA 4JT9A 5ALDA 3C5CA 1PJBA 4BFUA 4NZMA 2H59A 4BRWA 3CSDA 5KNDH 1YIOA 1L5QA 2P4EA 3EVAA 4EZIA 2WAYA 1DI0A 1T8YA 5D3ZA 2FB9A 5DM1A 1LI4A 5K20A 2PWZA 4KAJA 2H8GA 4LDQA 1GA4A 1ML4A 1XZKA 3AQ4A 4EA6A 1ZJ4A 3PTZA 3G2MA 4ESHA 5ABPA 2G63A 3MB8A 4RD1A 1BFUA 2PUCA 4AJHA 4UHEA 1D5WA 4GNRA 1ZD3A 3QBJA 2M6KA 4Z8YA 4FD2A 3ZU3A 2F6RA 4B85A 1TA9A 4QUGA 1O6GA 1TL7C 4X8LA 4G0VA 1K7CA 4Y7CA 4ZK6A 2V74B 2WI8A 3FH0A 3PLNA 5JQWA 2VOJA 5EP2A 4MWZA 4BVLA 4NARA 2W6CX 1IMOA 1FXWA 1ZPDA 3FVVA 3R7BA 5AVKA 3FOAA 3VAAA 1MFZA 4MVJE 3HVJA 1ADFA 4NMMA 2OHOA 1X2BA 4C4ZA 4JHXA 2H5LA 2MINA 2GD2A 3D1LA 4G1UC 4TZ0A 1K9VF 1MA0A 4MUMA 4HX5A 3GPBA 4B83A 1E96A 2JJ1A 5CA1A 2BGJA 2VQSA 3CUVA 4JBNA 1ETHA 4IVRA 3UWSA 4FZRA 3VJMA 4AJNA 1L4HA 1UBUS 3ZR4B 4YAUA 3GJXC 4DCGA 1RLIA 5LDGA 2VDMB 4XTCS 2QLFA 3HBMA 5AI8A 1LK7A 1NQUA 5A5DA 1EJ2A 1H0RA 4G8DA 2OCKA 1Z62A 4JP1A 5FORA 5JARA 1VDMA 4OJYA 4KHPB 4J90A 4YHBA 4PLTA 1IBCA 1Z0DA 4UCXA 2HSDA 1YUMA 1Z0JA 5LP6C 3OQHA 1PR6A 1PO7A 4XD2A 1UQTA 1CF2O 4LYAA 1M8FA 1PT9A 2AJ8A 3WGLA 3TFOA 1DQRA 2EG9A 3V6LA 1CUAA 2I2AA 3MINA 4RKQA 3H9JA 3NVDA 3WNDA 1VL5A 2Y0CA 2FMUA 2VDNB 4M55A 3UWMA 1AZSC 1P2TA 3LH5A 4P4NA 4BU0A 2NZXA 3RTDA 1CS0B 1IEXA 2WOOA 2XA9A 3KR1A 5DEOA 4HLUC 5IAJA 1UMKA 4R8KA 3IEXA 2J3EA 4LRTB 1RIIA 1KI8A 5LYJA 1JP7A 3FHJA 4PC6A 2GWRA 3PJRA 4L74A 1E1QD 4IUCS 4C1BA 5HXAA 1DRVA 3V4RA 3HYCA 3CRQA 3GRFA 2ZIFA 1AV7A 1G5PA 2VHJA 4U2KA 2UZ3A 2WD7B 2O8CA 1FX0A 2DVMA 3L49A 2G06A 4GXTA 1T8SA 4US0R 4OSEA 2VYVA 4IFIA 3DFKA 1S6YA 4PLYA 1Z0UA 3EFBA 3PICA 5DJ5A 3WIOA 4N9WA 1GR0A 5HOEA 5C3MA 4PTLA 4RK6A 3GUVA 3A25A 3DOHA 4ISCA 1OV6A 2W6IA 4LK2A 4M1YA 5T4EA 1MRZA 4L6CA 3IEKA 4Z54A 2CJPA 4LN1A 1Y48E 4Q4AB 5I9NA 2XAAA 3N28A 2O3UA 1KI2A 2QMYA 5DGIA 4WLOA 2RJOA 3CR8A 1PJLA 3CU5A 4G56A 2QTCA 3GLVA 3EEYA 3DWFA 2NNLD 5BSVA 3QVUA 4K3UA 2PMBA 4YCAA 3WG9A 3GGOA 4Y7DA 5JSZA 5CR9A 4N41A 4G2TA 2QX9A 3G02A 1FTWA 2A9JA 4HAZA 1BEEA 3PRJA 5KZMB 1SFRA 4X62B 1OGJA 3NAQA 1YZUA 2NO9A 4KQGA 1U3GA 5T6MA 3BFKA 3UBTA 2A9PA 3MM4A 3EOBI 5FADA 3GMDA 3TZEA 3UB4A 3WXMA 2O8DA 1KP3A 2EQBA 3BJZA 3FF4A 5E7JA 2OXTA 3A4VA 4PC2A 5F76A 4B0PA 4NBTA 5HIIA 4ZYVA 2O6LA 4PHFA 4AN0A 5LQMA 1E3QA 2AEMA 3NHJA 4D42A 1K4MA 3VU9A 3RRNA 1TPYA 1V11B 4CYMA 1II8B 1U7HA 1MQ8B 4YCBA 4FIDA 5G1OA 3T7KA 1B6TA 1JR6A 2ILTA 2LIVA 3RAPR 3PUHA 3LX6A 4ZQCB 5B3AA 1CDOA 3EBOA 3QEMA 4H0NA 5DIZA 3OE4A 3AUKA 2IFTA 3CLTC 3RLFA 1E61A 2J6HA 1JNXX 3BKXA 4NCJA 5F12A 5H7XA 2R7AA 1X1RA 3KS9A 1XEXA 3B6ZA 3QWBA 4GUAA 4BP9A 4HDSB 1F6BA 1OZ0A 1RYYA 2GMWA 5DHSA 4DV5B 4MR9A 3WQBA 5D3MA 5KYXA 1H9CA 4E5PA 2ZJYA 1G5QA 4E51A 3IALA 5FUMA 1O96B 1TKRA 2Z98A 2H4XA 4Q48A 2JFUA 5CM8B 5CK5A 4ZYZA 3CEMA 5EMJA 3K71B 1DBSA 5D3QA 2VAXA 3BKWA 1XNRB 2X0FA 4NBLA 2QX7A 4CW7A 1TVEA 2O14A 4AYTA 3RR2A 4DA0A 3I9NA 4AJOA 5I7AA 3OE1A 1G4HA 4DR7B 1TU4A 4XUDA 2HHJA 5JBIA 2XCRB 1OV4A 1C1YA 2H1FA 3M8KA 3MA0A 1Z06A 1FRFS 4JUCA 1FJXA 3UFXA 2ZS9A 2I22A 4NFSA 4Z3DA 4EI7A 4MEAA 1O9BA 3N8DA 2PSDA 5C0OE 1CZNA 3R9XB 2UVQA 5A3JA 1V6SA 4JEIA 5I9LA 2R65A 4GGMX 3WX0A 1DELA 1ZINA 1I4WA 1V8DA 1K92A 3KHKA 5BQXA 3GF4A 3IP7A 1OKKA 4WH0A 1K8YB 2W8ZA 3U7IA 1D6SA 3K30A 5F73A 3IXQA 2C1EA 3H4VA 2FU5C 2DFLA 3EVCA 1WZ2A 1A5ZA 3C1TA 3CEHA 2ZSEA 3NORA 3BC1A 5JCJA 4V0OA 4DCCA 1AMNA 3C5EA 1O94D 1UT6A 3ANTA 3BGSA 4AROA 2L69A 4WASA 2PPVA 2H7VA 3H9UA 1PCXA 4A0FA 4Z49A 1Q84A 1OLOA 2C3YA 1GO2A 1Y8RA 1JSZA 2BGKA 2RAVA 4AS3A 1G3UA 2VXYA 2I76A 4LZAA 1Q7TA 3QVVA 4TWZA 5E7MA 4F1JA 1U3FA 2C1ZA 3SX0A 1SY7A 2XNSA 2OD7A 1THGA 1VSTA 3NLLA 4KWIA 1T2FA 2P3QA 2Z4RA 3JAWA 1I3KA 2ZJ5A 1ONBA 2DTXA 4C9BA 5C7IO 1P44A 2Q3DA 3B48A 2HA0A 5TVKA 1E79D 1N5JA 1PJRA 1RAEA 2CC2A 1X15A 2FI1A 2AYYA 2MYTA 2Z9DA 3WGHA 3AFNA 4MQMA 1H4VB 3MB5A 1RP7A 4OU5A 3U4MA 2QX8A 3G5LA 4MJXA 5ALZA 2J6CA 2FKAA 3I5UA 4NYIQ 4Z2AA 4K6HA 2RG1A 4C7MA 4C4PA 2IPNA 5EKUA 1R6DA 2VSFA 1SCAA 4E94A 5KAMA 2Z09A 2WHRA 2KI5A 1Y7PA 1S1MA 4PW0A 1C7RA 1C3JA 1EFDN 1Z2CA 2GOYA 3PNLA 4O1IA 4MI9A 4RKYA 5EJAA 3TPZA 1D1SA 4BQNA 1BO6A 1W96A 2WJJA 1KYYA 2P9HA 3C74A 3LY7A 3ODPA 1D2NA 3ETDA 4TMTA 3CH6A 2C7BA 3KL2A 3T38A 3K1ZA 5TMBA 2P41A 4R54A 2GJKA 4L4UA 1A5SB 4P4TA 4D9FA 4O4HF 4EHFA 2B4TO 3HR7A 1KQGA 1Z4MA 1SG6A 4MIOA 5E9JA 3WJ2A 3NVKI 3DAGA 4BGIA 4EATA 6ADHA 1Z28A 4G0UA 2RK4A 3LC2O 1HE2A 3FBWA 4HB0A 5EP1A 1M54A 4IJQA 4B3BA 3CC8A 3FNEA 1C9NA 1H6DA 1H2RS 1K0UA 3SICE 5C4MA 2I2BA 3V4SA 1YFJA 3M6LA 2PZBA 3LRTA 1ZIXA 1O8BA 2XWBF 5JSKA 3MAGA 3ZK8A 5KCZA 4XIYA 2AHOA 4R1UA 2OCYC 1RM5A 3IDSA 2CDAA 4OLAA 2UZ0A 2E3JA 2CEAA 5ER9A 2YQ5A 1A2QA 3SJAA 3PXAA 1H1DA 1ZOPA 4BNJA 1NU8A 5GPBA 3OZWA 3R3SA 1T26A 4KSCA 5AMXA 4XFDA 4JZYA 2P2ZA 3ZDYB 4LXUA 5BVHB 3HM2A 1DB3A 1ZICA 1TAGA 4M0EA 1N6NA 1MXFA 1ZUIA 5BN4B 3UVEA 1BXRA 1OOEA 2Y1GA 4MCJA 4FR2A 5F78A 2SKEA 4KVFA 1PL6A 2VXBA 3O4RA 4H6VA 4V0NA 2QR3A 4YQFA 1MJNA 2R6GA 1UWLA 4DDHA 1UDAA 4BEBA 2I66A 3KKLA 1Q1ZA 4DSAA 4PQGA 1DKPA 1UEXC 1NUQA 3LOQA 4L75A 2XYPA 1BW9A 3BXEA 2WBLC 1QJCA 3E84A 5BVGB 4DLKA 4NMHA 1NW5A 1E1MA 2MYNA 3KVVA 1I1OA 4PGAA 1SEVA 3QE3A 1O58A 2Z30A 3HJFA 5B3LA 3ZWCA 5AVWA 1K4YA 4ZHQA 2Q1YA 2XIJA 4ZVSA 2RHLA 3CCFA 3AETA 3RI3A 3DD5A 2JCYA 3OZIA 5MN5A 2HMVA 3B1WA 4KGZA 4DQDA 1ND6A 4J2TA 3HJUA 5L3QB 3L8MA 4QC2A 4DGSA 1GAXA 4HK4A 3DBIA 4WESA 4CLHA 1FS6A 1DZ3A 3DLHA 2CD7A 3SMVA 4OL9A 4F5WA 4PGHA 3PQ6A 1XTRA 1P0IA 3WSTA 3ADCA 3UHJA 1WF6A 4ZRDA 1A7UA 1KWKA 1DKLA 3CNQS 1TM2A 4MJ7A 4AN4A 2WIBA 2FWAA 2UVDA 3ECSA 4QBTA 3LI2A 2BFDA 4NC9A 4EUHA 1BKYA 2JVKA 3W1VA 1LFAA 4A0SA 3SNHA 2V7WA 5IJAA 5CDGA 4RNDB 3KCQA 1SM4A 1JPUA 1MBZA 4PX3A 5JHGB 2QTRA 4BNYA 1T6XA 2H06A 2G9QA 1SB9A 3KR0A 3L7LA 3WLIA 4CM3A 1BCSB 1ZZEA 3WFJA 4EVIA 1RAHA 3V46A 2M6RA 4Q9DA 3URMA 1CULC 2NU6B 2W4QA 1Z83A 2WWHA 1KQFA 4NBUA 2W2TA 4OQLA 1I1HA 3OT4A 3UIEA 2JIMA 2OOSA 3GIWA 2PVSA 2PVCA 3L04A 1U5BB 2HPHA 3M3DA 2P9JA 2X8JB 4M53A 1IY2A 1X94A 1T2VA 1K6IA 2BMWA 3PG5A 4L5YA 5TV2A 1N6OA 4E12A 1Z4KA 4JYZA 4MPPA 5JC8A 1LS6A 3CUTA 2VATA 2GPJA 2X0RA 1WCV1 1WMEA 4RAQA 1M1NB 1Z5WA 3B3AA 3Q3JB 3X1JA 2OUIA 2ZTVA 1J97A 1SOAA 2YFKA 4ND8B 4PZLA 5T41A 1EHCA 1BMTA 3Q7QA 3VYWA 1NXOA 3AF2A 3CW2A 3GMIA 3R76A 3VR2D 2CDRA 3OLYA 3HCNA 3MQFA 5CNJA 1RFGE 2QG4A 4HMPA 3DC2A 3U7RA 2J9YB 4JBYA 4RV5A 1AS2A 2BHTA 2EBFX 3BSYA 3OX4A 1EX1A 3TUJC 3TTYA 3WC4A 3WLKX 5AJWA 2GDZA 2VHTA 2QSJA 3TX2A 4FFMA 4A26A 4QOHA 5LR6A 3HACA 2YW9A 4RGQA 1A50B 4QE3A 2AFIE 4EPVA 1APBA 2RH8A 4CQJA 1LPPA 1KK1A 3OZVA 4JMLA 5EFZA 3S8MA 5JYEA 1Z7YA 1ZM9A 1E2EA 1CUGA 2CYCA 1RKUA 3QPDA 4GPIB 4OKIA 4Y2RA 4ZQEA 3PFCA 2BR3A 2DG2A 2V7PA 3TKYA 4LQLA 2AG5A 4UU1A 2P9BA 2Z6AA 1QIMA 1DEHA 2A94A 1UXIA 2B5OA 2DLDA 4GUDA 4HWTA 4N6GA 4TWJA 2ZAYA 5FQNA 4PAQA 3EXG2 4TWRA 5IVPA 1L5MA 1XVIA 4BXOB 1WVIA 2REXB 2HT6A 5KMGB 2XB6A 1XXLA 1UKEA 4QARA 1YNSA 3RRYA 2G7MC 3DR5A 3UATA 3WGZA 3PDIB 2XB4A 2E89A 3RLIA 2XMZA 2YX1A 4NL4H 4RYDA 5DX8A 3FGOA 4MVCA 5EZ5A 1D9XA 5IC6A 4UTXA 1AB5A 1WTCA 4KIFA 5CYOA 4CTOA 2XH8A 2OCXA 3P9QA 4DVJA 1JHRA 5BR8B 3ASZA 2CDCA 2RGGA 1MF7A 3IP8A 2VJBA 1BGXT 3GBSA 1BKDR 3K2QA 4OXKA 4QBFA 3CLKA 4WECA 2BDEA 2YXPX 5IT0A 3L7YA 5AHRA 4YCMA 4KN9S 3CLRD 3GCXA 2OSBA 2NZWA 1REQB 3B78A 4PYNA 5HG0A 1FDRA 3FDZA 4EJSC 2C0CA 1US8A 3RT9A 5BWMA 1WKBA 3RYFA 5H80A 3AY7A 4QTUB 2FMTA 3QM1A 2AC7A 3X43A 4DMUB 3LX4A 4HJXA 2CHUA 5FLXA 2OCGA 5LZ9A 4JV5B 1NFQA 2JW5A 1JKFA 2PH1A 3JWHA 1YK0A 3LUJA 5K2MA 4BNXA 3V9PA 3I6YA 1JQDA 5J2UB 3PUXA 5E3HA 1FVHA 4WGFA 5GWXA 2J1LA 2VNAA 3ML1A 4JX8A 1R8JA 3IPAA 4RANA 3UJBA 5H9WA 1YE3A 4TL8A 1IY9A 4EARA 4PNHA 4DQKA 2P2DA 5BSFA 3T7JA 1T43A 3NVAA 2Z43A 3F6YA 4MW5A 1LDBA 4NU0A 1U8CB 2PKQO 1UK7A 4GKVA 4PGMA 4DWVA 3QUTA 1W59A 1F2VA 4B09A 2E4VA 1T24A 2A5YB 1PGQA 1UT8A 2DPLA 4J1NA 2P0YA 4JLNA 2Z6VA 4KDFA 1P2SA 1YHZA 3W4JA 3EHDA 1TQ2A 2CBGA 3TW6A 2B1GA 1FYEA 3W2GA 1GRVA 1VFNA 2J9RA 4OATA 2ET6A 3QBDA 2ZUVA 4RJLA 2GYUA 2L2QA 4X6LA 2CVFA 1HMYA 4A73A 3BB4A 4JGBA 3JQGA 3R5KA 5IDYA 4DXDA 2V7VA 2PUTA 2GXAA 3EDCA 4FS8A 4G65A 4D1YA 3BIFA 1FPQA 2PU5A 4M8NE 5KYGA 5TC4A 2HWUA 3TR6A 4EL0A 2NV2B 3BCSA 1H2FA 2XPCA 3GH3A 4ZJYA 1MHPA 1PHRA 3CQ9A 3L0DA 3Q6IA 2W2XA 1Q21A 3PQDA 4Y2HA 3QNUA 1KOJA 1J07A 1VPLA 3KAKA 2WG1A 3IQXA 3PV0A 4OXYA 4R1NA 5LD2C 1JZSA 4J75A 1NF8A 1VG9B 4LGMA 4BNVA 5DHQA 2IU4A 1Y1KE 1W93A 3SYLA 2BFFB 2WTMA 3TDKA 3D6HA 3NHSA 2OVBA 1J49A 1QPGA 4OHXA 4YMUA 3KLNA 1MGPA 4O4JF 4Q4CA 1ZN9A 1QGUA 2O9JA 4D41A 2DQYA 4IH4A 5HIKA 2QG9A 1BVUA 3DOFA 4S1NA 3TLZA 8LDHA 4ZRNA 4PVDA 5JR3A 721PA 8MHTA 1Y4ZA 3IOYA 3VNSA 1CDDA 4HDMB 4K2HA 5ALFA 3IIEA 4MS1B 1WD5A 4KRYA 3FW1A 3RS5A 3BL6A 5BSGA 1YCDA 3LP8A 1XZBA 3QA3E 4P54A 4PLGA 5K3FB 3TOVA 3DYVA 5HS4A 4N7RA 2C8KA 3T3EA 1C7JA 1WZUA 1Y80A 2VEOA 3LDUA 5CVCA 5IN4A 1CUHA 2BVNA 5MFPA 3KB1A 2B99A 3U09A 1H4TA 2TECE 4H6WA 2WTBA 1ZJWA 3MT8A 4KJZA 1T8RA 3HP4A 1TUBB 2GM3A 4OGKA 1X1TA 4G67A 3BMXA 3R8CA 3PWSA 1H66A 5B57C 2I9KA 4JCCA 2Z8ZA 1CDZA 1UCFA 1ZC3A 5IK2A 3W1EA 3ZV7A 3RYCB 3E2PA 1YB6A 1JU9A 1IVNA 1WCWA 1XXHB 4MS4B 2P8SA 3VR6A 4XWKA 2JL1A 1GUAA 1W48A 2CJYA 3GELA 1VE9A 4GI1A 3KJGA 1H5QA 1DNPA 2GEDA 1CD5A 2HRRA 3MCZA 4M6WA 1DTWB 3LPAA 4QQNA 3EX7C 1OGYA 3IOBA 4CXMA 4Y9RA 2JAPA 4MQEA 4L9SA 5AFSA 4QG3A 1NNEA 3GJQA 3HFJA 1SPBS 4O1HA 4PSCA 1CIVA 4A0RA 5REQA 4CMIB 4D96A 1T3TA 3MPOA 1DWPA 2PFSA 3N2ZB 2IITA 2Q4TA 5L6LB 2AXEA 1N77A 2YJ6A 2J5QA 4X9XA 5TJ9A 3E23A 1LLQA 1SCUB 4ENUA 1RLOA 1CBUA 1J0DA 1T2EA 2FQWA 2R6JA 2VNKA 5AHXA 1PJTA 1E2GA 3HBNA 1ZN8A 3WK6A 1FEZA 3SR4A 4HVLA 2MR6A 2WJ3A 4H3HB 1Q5PA 4UBKA 5G3ZA 2YHUA 1FYFA 2W5UA 2XDQA 1WXDA 2P62A 1JB1A 2BGRA 2ORWA 3Q9SA 2OPBA 3PFBA 4BQQA 4RNCA 4R1OA 4CDNA 4QVIA 5DNWA 3E4DA 4Q15A 2HUNA 3BXFA 1LPNA 3LWNA 4I8XA 3NHKA 5HZMA 1W4CA 5IZCC 1GVHA 1E5VA 2N47A 3HBJA 3JTMA 1CY6A 2J3KA 2Q3EA 5J47A 4BBJA 4HAOA 1XCLA 2QENA 2QHXA 3N87A 4TLMB 3ZXUB 5KOHA 1GWNA 2ZRIA 2QRNA 1FU7A 3B6JA 4L6AA 2IY8A 2F3PA 1GIAA 3FSGA 1DBQA 3HU2A 4JJ8A 4OM8A 1ZO8A 4OFXA 3L4SO 5KNCA 4UZSA 5BRJA 2A1UB 3HC7A 1ZK1A 1FLAA 4IV5A 3I3OA 3EYAA 2JGFA 5G3YA 1FQKA 2NACA 5IFLA 1OFHA 5AIBA 1P4HA 2VH2A 3I34X 4AIIA 4XFKA 1VHQA 2VK8A 3VPBA 2R1TB 2VQFB 1Z4IA 3JVEA 2YN4A 1IZZA 4K8RB 3DZDA 2EBWA 4NNOA 4Q7JB 1Q95A 3TQRA 5AD1A 3EQZA 1PNRA 3UMJA 2RHHA 4TWBA 3QX9A 1R6TA 3IBGA 3L18A 4RPKA 3IE0A 1VSBA 4PONA 3R44A 3S7ZA 1E7QA 2I7XA 4D3YA 2UYHA 2IKSA 3V97A 3JYLA 4F9EA 2PYDA 1GEEA 2RK6A 2YVUA 2ZYSA 3SJ7A 1ZD9A 2PKXA 1VGQA 3DEYX 3ROTA 1G8PA 3ZS9A 2EFYA 2TMGA 2WB4A 2HLPA 2VN8A 3UZUA 5HZHA 1Y3DE 2HXSA 3EK2A 3G5UA 3L40A 4YVFA 3VOAA 1YA6A 1P3Y1 1KFKB 1X1BA 2UYQA 5IXJA 3U0BA 4DLVA 3PEUA 1KDRA 2BZ1A 3X1YA 1I9GA 2GN0A 3LQQA 3CGGA 1BGVA 3KSRA 1V47A 1XAIA 2CL0X 2RHWA 3LAWA 3WLSA 3ZZNA 3WAKA 4YGYA 4DBVO 3ZWDA 4RD4A 5CNIA 3HU3A 1JSRA 1I9CA 1KRXA 4IO1A 4U5QA 1JJBA 4LJ6A 4LBYA 3OCUA 4DCJA 4BNMA 4AKIA 5AVXA 4A7PA 3IRVA 4FE4A 5EIWA 4HDNA 1QM5A 4GYYA 4GOND 3HXQA 1VIYA 3QLUA 3RARA 3W4KA 4YMHA 3EIXA 3R0ZA 4NEGA 4KH0A 4Y6LA 3QVGA 4M1KA 4IZHA 4E3ZA 1B3RA 1EDZA 4B3FX 2BRUA 1L4KA 1GDHA 1RAIA 3RANA 4BZWA 5KOJA 2QUZA 2CV2A 2PA0A 2FPKA 5I7EA 3HSSA 4TYWA 4JUBA 5J2TF 1UEIA 1XVVA 3SX2A 4QZVA 4MLDA 3MOGA 4Z9BA 1T9HA 2ZAGA 1W47A 2QXUA 5A4IS 5EE5B 1OASA 1W88B 5K7SA 3S5UA 4RWEA 4AXXA 1FRVA 4HHEA 2PMCA 3ENKA 1LVHA 3EXEB 4JLVA 3H8VA 2P2LA 4YDQA 1HDYA 1N9GA 5DTEA 1W5AA 5KNDA 3RT1A 1FFBA 3QVMA 3TTTA 3F6SA 3RFCA 3UK7A 4EDHA 3BGWA 5BV8A 1E1DA 2C9DA 1FP4A 1Q0LA 1VHTA 3I42A 2YXEA 4P33A 3V4FA 5JNTA 4QDXA 5K6AC 5A9RA 4CZ2A 2UYOA 5DB4A 2JNWA 2P4SA 4HQLA 5M7EA 4BFCA 1YHNA 1RWOA 4N18A 4AF7A 4YP0A 1CF9A 3D4IA 4FMBB 3AERB 2IYSA 2ZFUA 4Q5IA 4U7HA 1U4SA 2PJRA 4J7CA 1U0SY 1T8UA 2ZYTX 3EGWA 4G5GA 4KWEA 1BSVA 4MVXA 4BVJA 4DCVA 3FGPA 3HVKA 1OXSC 1ZCZA 3RHFA 1FJHA 5IN5A 2YVQA 1ID8A 1GRCA 2PQ2A 4UHDA 1H2ZA 3E48A 5K6RA 1IN1A 2V0GA 4RY2A 2ZI4A 4GD3Q 4JNKA 3QEBZ 1FSSA 2WZCA 1IY0A 3DV9A 3Q12A 4JQSA 5BN3A 3HYSA 4KLZA 4LXQA 4CM4A 3PP8A 2WSSA 2JRLA 4PLHA 1XROA 4XR9A 3RSQA 5BV7A 5GM1A 4R1PA 1JYSA 2QB5A 3M9XA 4INOA 3KAPA 5JDIC 2HMAA 4LE1A 1HK7A 4L9AA 1M2KA 2Z5GA 1W36C 1LH0A 2Y9PB 4J0DA 2R6FA 2XA1A 3HEBA 4WXHA 2IPOA 1LGYA 2ONCA 4UREA 5TPZD 5AESA 3LW7A 3WLFA 1RXCA 2HX1A 3VA7A 5C51B 4P7FA 1MT0A 2TYSB 5ALIA 4UTVA 5C8YF 2IYPA 2A0WA 1L7VC 1GAQA 3Q8MA 3GA5A 3FAZA 1PTJC 2X40A 2ZJ6A 4AULA 1BU5A 3FNQA 4MV3A 5E0KB 4CWAA 4DEVA 2Q0QA 2ZJ7A 3C3CA 3JR7A 4JK3A 4JQCA 5IT9A 4S24A 1CQZA 2ZB3A 3A1EA 3KCNA 2FXIA 4OQYA 5KYYB 2WMDA 1EG2A 3P9RA 1ESCA 5DTRA 1VE6A 4R9NA 5KVVA 3EVNA 1QFMA 3GD7A 3ZW7A 2R1ZA 2ZITA 4QRHA 1QSGA 1ZD2P 3ZX5A 1FS4A 5B4TA 2R8EA 1UFKA 1VIMA 4BL5A 3D6JA 5K8JB 1CUIA 2O4UX 1W9MA 3NVMB 4NCKA 2W2MA 2NUAB 1IULA 4JI6B 4JSYA 2QRVB 4PHCA 5FHQA 1BFKA 1NSYA 3F5QA 3FCXA 5CA1F 5EKTA 4V3BA 1DQSA 4O2RA 1UANA 3IEIA 4RW0A 3RE1A 3SDBA 2XYQA 2LZ0A 2IH4A 3IKMB 1XKTA 3VH4A 3FCCA 3PGVA 3OY2A 3FIJA 3OP4A 1UM9A 3VPXA 5JAUA 1RXYA 1V45E 4ITUA 1Z0KA 2YZ7A 4LWOA 4PPFA 4BMCA 2IYWA 1NR5A 3BWCA 3MJCA 2A0KA 2XDYA 3NHYA 5BN1A 3CB4A 4KXFB 2C9MA 5EWLA 1EG7A 1G20E 1T25A 3COJA 3PX7A 4UNQA 2QY6A 3IV6A 4LF4B 1G8JA 4BQPA 1GDTA 1Z13A 2N75A 1U2GA 1Y37A 3N5KA 1SKAA 5BXQC 4AZTA 1DAFA 2YMLA 4BECA 1A3CA 3VC1A 2GN8A 4JODA 3H17A 2FEOA 2OO5C 1XTSA 4I9NA 2QVCA 4HDRB 3QG5A 3UO8B 3DVAA 3F3MA 4UJ3A 1NI4A 2PEZA 5LYJF 3BICA 3NT2A 4DV3B 4AKGA 4U2DA 5LUAA 1EVQA 2XQKA 2ZVPX 2R44A 3A3KA 4D8YA 3JU3A 2WHPA 1T0UA 1C3XA 3GAFA 4LKOA 4TRJA 1HY3A 2QZZA 3F4LA 2YXNA 3LVFO 2Q9BA 4U7FA 5DK4A 1IJBA 3ESDA 1NI5A 4UHCA 3RC7A 3UMYA 1G18A 1XYYA 1BIFA 3BD7A 3I5AA 3GMTA 3HCWA 3TTSA 3OJLA 3IAUA 4X41A 4XI9A 5AK0A 1NSTA 2ERXA 3LC7O 3R6WA 3BZWA 2CLSA 5EIBC 4DRXA 4KO2S 4JAVC 5ES4B 1EUCA 2E4UA 4F4DA 4ZPXA 5FWXB 4WE3A 2GDJA 4E13A 2JVJA 2GEBA 1PRYA 1FZTA 4YAOA 3MXTA 3BBLA 3ZY6A 2ODAA 4KOAA 5K1ZA 2GJ8A 1Z0ZA 3G9ZA 2AV6A 1Y6FA 2Q4DA 3NP9A 4R6WA 4R68A 4LY9A 4K05A 2RKWA 4X95A 4COKA 3AI3A 3MERA 4PZDA 1J2JA 2PO7A 3K9CA 2ONZA 1MB0A 1EFPA 2C5EA 3M34A 4PQRA 5SYAA 3UQZA 4AZ3B 3VH3A 4NYMQ 5EI5A 4P0TA 4EVRA 3DP7A 4MWBA 2O2JA 3M5CA 4RPIA 3H5WA 4MQUA 3H5RA 4YMSA 3TECE 1ES9A 2QW1A 3GFRA 4M87A 4RELA 5JU6A 2XTZA 4HPJB 3FMFA 3SXJA 1D0SA 4MYRA 3I5XA 1E0DA 4HDQB 2EJWA 4DR3B 2Q46A 2WVAA 4GI7A 3BL8A 1R12A 3QF4B 1A95A 3O1JC 4ENQA 1L4BA 4L76A 3ZOKA 4NV1A 4LF7B 4X8OA 2Y93A 3SQXA 4QEDA 2MSDB 4E31A 1CQWA 2BFWA 3HJCA 3EG5A 3OVMA 4X6XA 1LPAB 1TTQB 4CG2A 3TK1A 4KYIB 9MHTA 2W70A 2AG6A 1YR2A 3LHKA 4IFBA 3U9LA 2RJ3A 4HC4A 1Q20A 2WHEA 3S8YA 4KX3A 4QAQA 3VHLB 1ODLA 4G81A 1M2JA 4TSFA 4I2VA 4YDRA 4JB0A 1BHSA 5JAMA 3WIDA 3ZGYA 4QDOA 1I6MA 4XAQA 4FWIB 1XJQA 4G1MB 1WU8A 1LSUA 1PUIA 2XUAA 3TQQA 4A6PA 3Q0IA 2OPHA 2B7BA 5BWBA 3W5JA 2BW0A 2P6MA 1WP4A 1BVYF 3B12A 4D3XA 3VFDA 1S8OA 2QSZA 4WZBA 3ND5A 4BVHA 1V3UA 1YQQA 1HZJA 3I23A 2YL2A 2Z8YA 3IIMA 1NJ2A 2CJWB 4OQDA 4YXWA 4BJ5A 2WUDA 3KQYA 4CV2A 4EFLA 3C3YA 4CV1A 2L82A 5SZHB 2B94A 1E69A 1U1EA 3PU6A 2D3WA 4YXFA 2QGNA 3EYWA 2JLYA 1PYOA 4F7WA 4WL0A 5AM0A 5A2QA 2GM4A 1DIGA 3MJ4A 2IOHA 2PZ8A 5JDCA 2WNIA 3K8QA 1E7YA 4URFA 2DU8A 4QVGA 3R3YA 3U17A 3IDOA 3GGDA 1AKEA 3N76A 2Q41A 1Z6YA 1A5TA 2CVQA 2WPDA 3ZD6A 3H2KA 4L0DA 3H6HA 1GRRA 3EWAA 4HEHA 1KMHB 4M0CA 4YR9A 5CBPB 2JPDA 2O48X 2J08A 2GCOA 4KHZA 1ISMA 1P31A 1DLIA 5AW4A 4BO3A 1JKIA 2H1VA 4L3OA 4KNWA 3NYWA 2VF5X 1KRWA 1AU9A 4QU9A 2ZCJA 1RCUA 2N1BA 3DVSX 5FPTA 5C35A 2APJA 3GAMA 1Y9DA 4B4OA 1KBQA 2WK1A 3NZEA 3HY4A 3HXOA 3ZYCA 2UYGA 4BQOA 3AFMA 1AA6A 1N78A 3HVIA 3MS7A 4ENRA 1CS0A 2Z4SA 1C2TA 1YDWA 3I1FA 4FNAA 4NBRA 5CCXA 3WK7A 4EG6A 4NMXB 3N2EA 1OYVA 1FFSA 2P65A 2WJPA 1JLSA 1I4DD 2O4CA 3FPFA 4Y6SA 3RFTA 3GLHE 2CV0A 4ARVA 1Z16A 3LPCA 1JLHA 3EGCA 1J8MF 2RSLA 4MVJI 4RIEA 3WIBA 4BMZA 2Q4RA 2YFHA 3CJRA 3M4JA 5KTNA 1WXQA 2OM6A 2WD7A 3ODGA 821PA 4IICA 4PZEA 1K3UB 2BMEA 3RADC 3G7UA 3EZXA 4Y6PA 4S05A 1YRWA 2PFGA 2EZ8A 1ANKA 2CHQA 2AE1A 2BZ0A 4IHAA 2ZIWB 3ND6A 1V5EA 4FP9A 2HYDA 2BE7A 3NBQA 3OHPA 3RWMB 4UNRA 5I9SA 3U16A 4BGUA 4FYPA 1I7NA 2AZMA 1EWRA 3FFAA 4MIKA 4P36A 1JQLB 2YXLA 4PSVA 4UAJA 4Q4AA 3SQWA 2HLNA 1A2OA 2GHRA 5IK2D 1EDDA 5EZYB 4EW1A 3MNFA 2J8ZA 2NIPA 2C2BA 4XVQA 1E2LA 1QB7A 2P9YA 3ADDA 4WVFA 4NHOA 5LQRA 3ET4A 1E3JA 1SK9A 1IHUA 2VQEB 1J9GA 1KMQA 3QOFA 1EHIA 1KS9A 4D82A 3VBCA 4EELA 3KTFA 4JP3A 2OD2A 1G41A 1S3FA 3C43A 4MUXA 4OMDA 3BRSA 4C7OA 2EQAA 1RVV1 2P40A 2HRZA 2YWBA 4GG1A 4K87A 4Q7EA 1PUXA 4TVKA 4XE5A 5BXYA 5CURA 1V11A 4F8EA 4D9GA 3RSCA 1II8A 3ZC3A 4OBEA 4ZYUA 4PZAA 4HBGA 3GHYA 1TVKB 4GYJA 1QV7A 4LWPA 3TLBA 1UPTA 3CZPA 1EK1A 1VL2A 1E59A 3AP2A 3G9XA 2H5IA 1UODA 4DA7A 1BOFA 2ZJ4A 2G0AA 3ANLA 3S6JA 3WGUA 2DHEA 2NSDA 3F8TA 5AKGA 1SXJD 2AFHB 1FCJA 2CBXA 2GR9A 2QV0A 4HDSA 4Q19A 3RSZA 1PR1A 4EY7A 3VR5D 2XY4A 1YONA 1F0PA 2WUGA 5A5EA 1IBSA 3DTVB 1UXOA 3ELWA 4BNZA 3LXUX 3LDHA 4N7JA 2YASA 3WTBA 1SUSA 1Y3HA 4OHKA 1XMVA 4ZHQF 2G76A 4OO3A 3OD1A 2BAGA 3T1NA 2CNBA 2Q3MA 5AKXA 5ETJA 2A6PA 1KEPA 1KH2A 1L0BA 3FSGD 3TLXA 3PF9A 10MHA 3TKAA 1ORHA 1UBNA 5JO9A 3STWA 4BFWA 2IP1A 1OXVA 5KNCD 3BD6A 3EIQA 1KA9H 2C2OA 2C82A 1M1YB 3RJ9A 4AY5A 4F2HA 3D8HA 1RXUA 2F1RA 3FPLA 4TMYA 4UVDA 3RS9A 1OAOA 5AO9A 4ZC1A 2NYAA 4PFKA 3FPSA 1O4VA 3JCZA 3LCUA 4PPYA 3HKDB 4PWZA 3HCCA 3KE8A 3EPJA 3QP9A 3R9XA 1DAPA 1GNTA 4CKYA 2E4YA 3K6KA 1GKUB 3NBKA 3B1ZA 3DHWC 1PG2A 3LUBA 4N9QA 3H6KA 3TVYA 4AJ2A 5HTOA 2FQ1A 1M7GA 3OLVA 3MWFA 1J7JA 4ZJPA 5KU7A 1GQRA 3K4PA 4FGLA 4DCTA 1SQFA 1Z25A 2ECFA 4UHFA 5BN5B 3BRWA 1Q92A 4CTJA 1RJWA 4CUZA 1KE2A 3ROGA 3AHEA 4X7RA 1DUVG 1W4ZA 1SCIA 2CFTA 3PCXA 2Y8EA 5HQ3B 1D7AA 2OHIA 3IOEA 1GAJA 3JVUA 5T64A 5FBVB 1N4AA 4D8XA 3M6WA 3W5DA 2Q4OA 4KNVA 3WGIA 3S4YA 1RU3A 3LCVB 1L5FA 1I5OA 1NUTA 5JNLA 1PBNA 1Q14A 2W4IA 4B48A 2O8FA 2WFLB 2Q6IA 2F1OA 2ECKA 3GJTA 3RSLA 1VHDA 3DH0A 2O0MA 2GD6A 3L46A 3PJEA 2DKOA 5HCUA 1CY8A 1OSNA 2PGLA 3AR2A 4OX9Y 3HUUA 4DQXA 1M2GA 4ZMBA 2OG1A 5BQ5A 1ZDMA 1R66A 3K16A 2A2ZA 1KJWA 1N5OX 3KKNA 1J8DA 3PDWA 1R4MB 4JJ6A 4GVXA 4WKPA 5AK6A 2NNWB 5A4KA 3O2QB 2OBMA 1XLWA 2EAUA 4G63A 5EWJB 3H87A 2AIRA 1V8ZA 4ZV9A 2X3FA 2XDWA 3O31A 4L5JA 4ABTA 3WWPA 1PYGA 5CLHA 2GSWA 4KMOA 5LXTA 3ZU5A 2QTTA 3GR6A 1KJ9A 1B16A 4TL7A 1SOUA 3CTMA 2C97A 4AQDA 3OPYI 4EUEA 3AF0A 2B82A 3OZUA 3P97A 3E58A 1YU9A 3VTKA 1N7JA 1QP0A 5HIAA 4U2GA 3I9KA 3DDWA 1I0IA 1NVGA 1W5SA 2OZEA 3H9QA 3K9LA 4KTVE 3TUIC 4RF3A 4RDHA 4AK9A 1OWOA 2GTIA 3U56A 4LYEA 1TYCA 4FZ3A 5KNDD 4UFNA 4TOIA 1R3UA 4Y2TA 3K9NA 4ZA2A 2IZ7A 1TD1A 3ZDCA 2IEGA 2HREA 3Q6MA 5BMVB 2QOEA 2YTZA 3HHPA 5JEDA 1LDGA 4LF9B 4Z4EA 3HP7A 2QG6A 3NBXX 1GNQA 3E3LA 1AKTA 3E53A 4OAOA 4ZQIA 2YQ4A 3LW8A 2J30A 5JAIA 2EKDA 4KXMA 4PPNA 5T67A 4W5RA 3E6AA 4Q34A 2BDUA 2IUTA 5IAEA 3WXBA 1CJSA 4B7ZA 3C7TA 4KMMA 1Z7BA 5JCOA 4FFVA 1VM6A 2P0EA 1E1LA 3SXUB 1WBBA 3G8YA 1G8FA 1PEKE 1UXKA 3ZU2A 9LDTA 3L1JA 1NX9A 2QLMA 4OUKX 4IGEA 4TYPA 1HH4A 1OFTA 4U7TB 1CIPA 2YFQA 3GO4A 4WXMA 4MITA 3A4IA 4BGEA 4C0XA 5BN4A 7ADHA 2A67A 2F1JA 2XECA 2ZS8A 3EZNA 3JAKB 3K94A 4A8JB 1O97C 1TEZA 3P2OA 3UHAA 5CW1A 2EKZA 3HN6A 3A14A 4DCNA 3PEWA 1T2DA 3P0JA 3E9QA 5EEGA 3RH0A 3HP1A 3ILXA 5AOBA 1AA9A 4HDKB 3QITA 1COWA 2VBCA 3M6XA 4N3GA 4UHJA 4CT0A 1VMAA 2P91A 2JLSA 3CBGA 3IB3A 1FUEA 5J3JA 3UAXA 4S0XA 3TTUA 5BVGA 4N3AA 2OWEA 1GTZA 3OESA 4PQEA 3DL4A 1Z6QA 4K0RA 3UK2A 3D4OA 1U1CA 1DAOA 2F9LA 1FDIA 2YWFA 2CLIB 4EMUA 5KREA 5LNK1 3P2EA 2C92A 5H1YA 4IIDA 1VMKA 1O5IA 3OJWA 1CPYA 4MS3B 2NO1A 3FB4A 4Z4FA 2WF8A 4WINA 4LDJA 3QEJA 3KFXA 4M1WA 5JRJA 1T1SA 1XBTA 2E18A 4WY5A 5KQGA 5KNBH 3EARA 1IHOA 3EODA 5KTKA 3HZOA 4PANA 5HIJA 5K6TA 1GYRA 3C1UA 1A9OA 3EZ6A 4JI3B 4IIJB 1ENYA 2OO7A 4M46A 3IMGA 2IEIA 1E3IA 1O5TA 4IKOA 3TSWA 3ZNPA 4BN4A 3OTQA 4E1BA 5KJ1A 3MELA 3GJSA 5A6SB 5LOVB 2X9VA 4ROSA 1C9YA 5MN6A 2QZPA 3AR9A 4MPTA 1P33A 1X7ZB 5CT9A 1T5LA 2Z6UA 4Q18A 1TOAA 1PL0A 1MFPA 1JIQA 3PFFA 2CXRA 2Q99A 3FPAA 4WADA 4XDZA 1KVQA 3EZYA 4OHOA 5A3QA 2B9VA 1BCSA 2FJPA 1D2HA 2GRUA 2AF3C 2NU6A 1DIAA 5HK9A 5DH9A 5B7NA 2ZB8A 1KRHA 2BBSA 3O83A 3S2GA 5J5VA 3FE2A 4H3VA 1SVIA 2VPYA 1K63A 1R4NB 2OBFA 2X8JA 3QFCA 2VHYA 4NE2A 4EJ0A 4QTYA 3ITKA 4EYOA 3KOOA 4EHAA 3TIGA 3ZHUA 3AJ9A 2ZWAA 2WVHA 2RGXA 4YJ2F 3KE9A 4JJIA 1M1NA 2P1DA 3TQHA 2YC4C 3U37A 4UDYX 1E4YA 5AW2A 2BGLA 3BGIA 2DLCX 1T0BA 4ND8A 1WNFA 4UMFA 3REOA 3NT4A 2RIRA 4AQYB 3CLUC 1TPZA 2VRNA 3ZWBA 1I4TD 1NN0A 2CL6X 3QY9A 4E5DA 2JGIA 2BTQB 3AG5A 3P1JA 2W6PA 4FHCA 1TW3A 4MROA 4HQ0A 4KU4A 5AT1A 1EINA 1SBZA 1EX7A 1QO7A 1F6WA 2C5LA 3ELDA 1GUDA 1KBZA 4W9MC 4LUCA 4N7MA 1BH6A 1UR5A 1WUHS 1L5SA 1Y4AE 2WV7A 3CUWA 4U02A 4CL0A 4F8JA 3EDRA 4I50B 4BFZA 5M5BA 1Y7IA 3FFWA 4D9HA 2AUNA 3ZWKA 1ECLA 3JWJA 4FOOA 1CZLA 3ISTA 3WWCA 3V32A 4L7QA 3TTWA 1DEOA 1XN1A 1DLJA 2A1TR 3DKRA 3PUWA 3R23A 4HO1X 3QBTA 5JXIA 2RE8A 2Z8XA 2V7TA 4M4SA 1LX6A 1U8EA 1GNVA 4AZ0B 1U0GA 3CWCA 2HWKA 4BXOA 3VZRA 3IEVA 5KMGA 4KYUA 3GFOA 3ITDA 2BM1A 4B1FA 3TSCA 3PDIA 4J0FA 4QX6A 4M0UA 4OA8A 5K3SA 5HZKA 3GLFB 4JC8A 4WEQA 1B2RA 2KSQA 1NTRA 4NDNE 1U31A 2GKGA 3C85A 3PNBA 5T4FA 4C5AA 1NNLA 1T9GR 1FFXB 4E30A 1H8HA 1LU9A 1T2AA 1HNNA 2K4MA 2JHFA 3ACBA 3DDCA 1I2AA 4ZAGA 1ZHHA 3N0WA 4G8CA 3OPQA 4INPA 3I2JA 3E61A 2ZUFA 4LZJA 1RCTE 4Q4LA 3ETJA 2NN3C 4PQYA 1B8UA 3JD0A 1W87A 5HKLA 2PDAA 2ZJ8A 5JECA 1J0BA 3ORHA 2W7TA 1VBFA 3O2SB 5FRDA 4LRSB 2H0RA 1JGTA 1TK3A 3L0ZA 2CK3A 4GBED 3TI7A 5A04A 3D6UA 2KQUA 3DYIA 1T1IA 2FQQA 5EXSA 1KJJA 4J9UE 3ZD8A 1A1SA 1FQJA 3NIWA 4RQBA 4I14A 3I2KA 3OF5A 1U80A 2H9AA 3ZVLA 1H2WA 4L07A 4RMJA 7YASA 3D6NB 5ALPA 2W2KB 3RJTA 2ID7A 3F6PA 4HRAA 4H7KA 1Y6ZA 1GHTA 5HBRA 2HJRA 2OENG 5FOUA 4ZDWA 5MDHA 1QZUA 1ZN7A 2IEYA 4FI3F 5CB4B 4JQZA 3TFWA 2ZIAA 4INJA 3DW1X 1H22A 3QMMA 5HCNA 3RVLA 1WOMA 4EY6A 1OYWA 3H4IA 2HK7A 3M6VA 1NMEA 2W8BB 4JASB 2MWMA 1S2IA 1YRQA 4EKNB 2HJWA 2WD9A 1QTRA 5IVKA 1TMOA 2BGWA 2V5AA 4LCBA 5ALWA 4OB7A 4Z9XA 2Y0PA 2VSOA 1UADA 1X1SA 4MP6A 4YT4A 3RVPA 2VHVA 1YRAA 5TT0A 4RV4A 2OK7A 3E9NA 4XLTA 4BUZA 4ID9A 3T5BA 5KQPA 3LU1A 1CVIA 2BM0A 1JKJB 3MTDA 3HDGA 2PKRA 3IQWA 1JNYA 1PR3A 2O20A 3AM3A 5CIWA 1I13A 1NF2A 1XDWA 4QXAA 4RK5A 4WI1A 2QE6A 3UMGA 3W3AH 1FJGB 4W63A 2XUQA 2JIZA 1U94A 1Z56C 2R8PA 2ZZMA 3U4IA 4G5RA 4M9QA 1U63A 3GFVA 4D6PA 1T5HX 4KQMA 4Q1DA 1DQPA 5FPPA 4G4JA 1P81A 2BFFA 2RC5A 4R98A 1RWVA 3WYFA 4IDQA 4UQPA 4LIPD 4F4IA 3OCWA 4KPEC 3QKRB 4AN1A 1R0RE 1KSHA 2JDIA 4GMDA 5SY6A 4FMDB 5LQUA 4RHXA 4YAIA 1EB8A 1WWKA 1UFRA 1KYWA 2XITA 3B8HA 3CKYA 3NYRA 4MWSA 5FLYA 3PDHA 2ZB2A 3ZHOA 3KKEA 2EDAA 3ILYA 2BI8A 3IKLA 1W46A 2ZVDA 4UHHA 3T15A 4HDMA 5L51A 1CR6A 4ER0A 3HO8A 1XZHA 1JI3A 3B38A 4TTPA 4XVHA 4D80A 1CETA 1SH7A 4K9OA 4MS1A 2PT6A 2XI4A 2CLHB 2RHOA 3B8EA 1ODCA 4FUQA 5K3FA 1MEOA 2HA3A 4TS1A 3RVKA 3WJ1A 5GJBA 1A9SA 4R2JA 4LDPA 3F4KA 2CLDX 1SXHA 2GTPA 2H54A 1TCVA 4ENSA 3H13A 2PM8A 1SQ0A 3EZGA 5IJXA 4DCPA 4CKZA 4PLPA 3N3BC 1TUBA 2BBWA 2ZRKA 3CLTD 4JBIA 3ZG6A 1U8UA 5F7XA 1QIDA 4RVNA 1E4OA 3KDSE 3LVQE 3PC7A 3VR4H 1OB5A 2VDKB 4FU0A 3D6TB 3IUSA 3UCXA 1ZMBA 1B0ZA 3RYCA 1PLKA 1XXHA 4B80A 3LMKA 4MS4A 1OXBB 1Z8DA 1U5AA 1EBUA 3AK4A 3UJAA 3FNIA 1M7HA 4EI8A 4CKCB 1C1XB 4DOMA 4ZVRA 1P7VA 2RIPA 2CNWA 3R75A 2PUFA 4DSNA 2VSYA 3H5VA 3L4EA 2WW8A 4LY0A 1TQDA 1DTWA 1LUAA 2JBWA 2ZJ3A 3HA7A 1TB4A 3N2GB 4DNFA 1HDRA 2PEYA 2QGFA 4E46A 1YZQA 3KEMA 3PDCA 1DCFA 2EWVA 3R3WA 2NAFA 4CMIA 5TB5A 4RY0A 3IPCA 5AW7A 5LZ7A 2Q6OA 4XQ0A 1CIJA 4QATA 3RFFA 1SNYA 1L7AA 3S68A 2FF7A 3I6QA 3ANYB 3KD2A 1ZRNA 2QTFA 1G3IA 1SCUA 4B3RB 2NSYA 1NM5A 3G2IA 1CR2A 3LT0A 3ZHYA 1KQPA 3MQ4A 3KQQA 1E5TA 1HT1E 3NANA 4GGPA 4XPIB 1E0AA 4IIHA 1BCRA 2OBNA 3UF0A 5JFGA 3VDNB 3O6VA 5L3SB 1NASA 5CT8A 3DB2A 3FZQA 1P17A 5YASA 3VR0A 2JLAA 2GEJA 4DF3A 1JWLA 3T3NA 1SAYA 4R71A 3CZ9A 4J1TA 4PO3X 1G63A 1UDCA 3H99A 1YA4A 1Z33A 4M86A 4P7BA 3JRWA 4QTZA 3BIOA 2HDWA 1W7AA 1WU7A 1CW2B 1YQEA 1GPNA 2AD5A 3MMNA 4JVOA 4OHYA 1QUEA 2Q2QA 3TNLA 4BWVA 3FJ1A 3GLRA 1LD3A 1TLLA 1UOQA 2JCGA 1VPVA 2Q1UA 3EPRA 1P2DA 3EZ7A 2G8NA 3WYAA 2OESA 1DKQA 3G2HA 1PG0A 3G3EA 2AB0A 1UBSB 4MGYR 4YAJA 3C3KA 2A1UA 1NLMA 3D81A 5AIAA 1T3ZA 1R5JA 2JK1A 1C8BA 4WLFA 5D2CA 3NHLA 1SUFA 1V0JA 4OEHA 1X70A 2O2IA 5K0SA 3NB0A 1ODIA 3VZBA 2CB9A 3O7MA 2R1TA 2C3OA 1ZG3A 1H0HA 4JH0A 1XZIA 1F2DA 1QE0A 1E5XA 2DHQA 3HA5A 1ZP6A 2ZJ1A 7AT1A 1M74A 3LC0A 3LP6A 3KHSA 5EC8A 3QJYA 4KAFA 4QBGB 4JBGA 3RK4A 1XU7A 3LS2A 4LDAA 4ZVNA 4GOXA 4ATNA 3A4LA 1KI6B 2RC6A 1A27A 2BSQA 1HEUA 2IU6A 1NUPA 2XODA 3U1VA 1QIGA 2NO7A 1AQYA 4HSEA 1GLGA 4PIVA 4RETA 4Q4JB 4QPDA 3R7SA 3PUIA 4FE7A 5DTIA 1NXSA 5TEVA 3ABSB 3TWOA 5C5CA 1VXOA 1KP2A 3ZIAA 1ADGA 2OEPA 3ZBPA 3OQMA 2I1QA 1BH2A 3EC7A 1I1QB 4R2XA 1PU2A 3KOMA 4Y2UA 4H7IA 3TD9A 1C7QA 3ZGVA 2Q2WA 2VDPB 1C8KA 2MT9A 3BRWD 3F47A 3RNLA 1QRSA 5LU9A 5A5GA 1KC1A 2WA2A 4EYKA 1TC2A 4YJFA 1Z6XA 1K7YA 2YJTD 4CFZA 1H23A 3U4HA 3D64A 3GUZA 1GZDA 1G9SA 4WBNB 2O05A 1WO8A 1YS1X 3BIJA 3BYZA 4KDRA 3ZE6A 2C29D 4F45A 4PVCA 2GBCA 2IDMA 1HETA 3BORA 4OV6B 3VNAA 4QOFA 2ECPA 3A9SA 3EB9A 1KZYC 1M34E 4CMHA 4X93A 2G8LA 3L06A 3WJAA 3A1UA 4K81B 2XTAA 1N6PA 3VI3B 4AMGA 4KR3A 1JI0A 4IQ8A 3K09C 2HBRA 3DD1A 1R0BA 2HA4A 2IHYA 4NU8X 1MZVA 5CLFA 3A4MA 4RLSA 4A92A 3L1HA 1XHFA 4K9SA 2PAFA 5E3JA 4BEJA 4BO4A 5JBQA 3GEEA 4WW0A 1HZZC 1U04A 1N36B 3O3MB 3DHYA 4YP5A 5FBZA 5C1IA 2Z6QA 4I6GA 4WIAA 3VSDA 3MN1A 2W2VA 3VPDA 3ICEA 1MOPA 3I76A 4BMXA 4RL4A 4O1MA 3NTOA 4P86A 4U3JB 4TM8A 1AF4A 2F00A 3B3JA 3U9SA 1XMOB 1YS9A 4RQTA 4EABA 2QEQA 3OZCA 1SXIA 4FNMA 4G5YA 3NHRA 4Y1GA 2FSVA 5ALNA 4GVLA 3B5IA 1NA5A 2OHVA 4ZOCA 6NULA 3CPJB 2P9GA 1OI7A 2Y1WA 3QFSA 1W88A 2KYRA 4YK7A 3ZV4A 3OAAA 3G8DA 2CXNA 2H9IA 3OIFA 4XCVA 3HDTA 3U4DA 2H31A 2WILA 5ARBA 2P2NA 4CKEB 3UK1A 5BW8A 3SQLA 1PWEA 3M6MD 3KPYA 1M5UA 4QBKA 3WRVA 2WJGA 4N5MA 3MT9A 4JLJA 1XPOA 2FCRA 2OV6A 3V2UA 4IHJB 5HCIA 4TKVB 3F73A 2V98A 2N1MA 3GGGA 3QY0A 2QP3A 2XRFA 4M0MA 3KOZA 2QZSA 4ZQGA 5ITVA 1QR2A 1Y4SA 3V1NA 2GHIA 3DS8A 4ALKA 3CV3A 2XNDA 3EVBA 2NYRA 3ETLA 3AERA 3G0IA 4OOEA 4RVDA 3W8NA 4F9GA 3R5FA 3BPSA 5AKZA 4L4SA 4GPTA 2W4MA 3QF7A 4RPHA 1QDLB 3N5CA 5DO9A 3TIIA 2YWXA 2D6FA 4YJDA 2X4GA 5BSHA 4AJ1A 2IXAA 3IMFA 4R0MA 3LIIA 3RIMA 3OZXA 3OD5A 4UE3S 1DKOA 5ADWA 1ZGHA 1Y34E 2I80A 2Y1KA 4I6EA 4RSMA 1I7DA 1HYHA 1N2GA 2WU4A 1E3MA 3EGVA 3LRXA 1K7XB 2DBYA 4DN6A 2DFNA 4HLNA 4I8DA 4EJ2A 5IF9A 2V7GA 1E64A 2ZSAA 3BHJA 5EHIA 3AKYA 1UPFA 1FJ2A 5H68A 4D92A 5ALGA 4WY8A 2BR5A 1CZRA 1DKRA 3D5TA 4I5DA 1NTOA 1RWPA 5CIYA 2I55A 4UHKA 2R8BA 5KAPA 2J67A 1NRXA 4ODIA 1GKYA 4N0EA 5F52A 2OGTA 7ABPA 3DHNA 4B17A 4RTOA 3UT5B 3R7NA 5HUQA 4ZVQA 1COWD 4QOSA 2PX4A 3ZY4A 4KFCA 4OKNA 4G0ZA 1FYXA 1OI3A 4X3OA 5D1NA 1R7RA 2JFXA 1WKVA 5LSAA 4M0FA 1F2TA 2HXYA 4UFPA 4WLVA 1DAMA 3PNSA 5CX1A 4YMIA 5HTKA 4LVCA 2X2EA 3HJAA 5AJTA 5KINB 4NF2A 1W0JD 5I51A 5KYYA 3AF4A 3J81k 4CF3A 2X1HA 5CTJA 3E8MA 4TMFA 4OYHA 1N32B 3WGMA 1FMCA 1MC8A 1VBKA 2W58A 4YUXA 5B12A 3FPBA 4MDYA 3MGBA 3RKSA 3O2NA 4WXYB 1EFCA 1Z5OA 3NRBA 4XDGA 4HUQB 1FFEA 1H6BA 3IOCA 2VWGA 1XNQB 1TE2A 2VHZA 2YY7A 1GGJA 3T7RA 3W6NA 3EEOA 4V1CB 3TRHA 3S2UA 4CNBA 3H9BA 2QRVA 2ZPTX 3LK7A 1NVFA 3LHSA 3PXDA 3K4HA 4WFIA 5DCLA 3SS9X 5AUNB 1SQSA 5F9MA 1SZCA 5K4HA 1H0KA 4RLHA 4Y9TA 3S2ZA 1UZAA 1QGAA 3TUZC 2M9MA 3CCCA 4BV8A 3MMZA 1BS1A 2DY1A 3K8YA 3P0EA 4G1BA 4GX5A 2GESA 3CG0A 1XQ9A 4J1SA 1HL3A 1QF7A 1XR3A 2VKQA 4DEXA 1ADJA 1NJGA 1O89A 2Q9UA 4QFBA 4YS6A 4YH1A 2W22A 1FUYB 1J90A 3D1JA 4DDKA 2NU7B 5J23A 3S55A 1GUYA 2C5GA 5LMNB 4F71A 4J2OA 1L5KA 4S1TA 2V3CC 3I45A 5IKOA 3ZZMA 4ZI2A 5FD8A 5LQDA 2W2NA 2IZ6A 1SCJA 4OI1A 1JJFA 2AL7A 1HTBA 1ULSA 2GZDA 3GROA 3NETA 4HGNA 1FA9A 3I8XA 3R5JA 4FFNA 2R6CA 3NXKA 4DIUA 1QAOA 2LPMA 3P9XA 4HDRA 1RWBA 4JP8A 4MOWA 3QMWA 1R18A 4A2WA 3FR8A 3H2SA 5DHRA 5C9ZA 3NDRA 2FEWB 3D9QX 4Q6WA 4YCDA 2C9CA 4P7KA 5TS2A 4BVFA 2I8CA 1KK0A 4TKLA 5EJGA 1NWHA 2VI5A 2ZP1A 1I3NA 1SHUX 4P3YA 4RXUA 2CXOA 3CUYA 1MW9X 1N57A 3TO5A 2D06A 1KU0A 3H4MA 1YRHA 3DZFA 4E1AA 1G4AE 2B78A 2NZ2A 1V1MB 3HJRA 1OREA 4Q1EA 4OJMX 1WNTA 3ER6A 2ZT7A 4YT8A 2OOKA 5HF8A 4MUBA 5J58A 5A4AA 1Q0SA 2JCVA 1T0IA 2AZXA 3TN7A 3RRFA 1D1TA 1C9JA 1HL7A 1X19A 5I7OA 3DZKA 1GTSA 2QNIA 4KTTE 1H65A 3QEOA 4MYHA 1E2UA 2R6ZA 4QT0A 1FP2A 3SZRA 5FWXA 3WLLA 3PSHA 4A0QA 2JK0A 3I9MA 4ALJA 1Q1NA 3FMGA 3GIDA 4LYFA 3SYTA 2N46A 5ELLA 4GECA 2DXIA 1KH3A 1KKMA 1UKYA 4KAXA 5TEWA 1CTQA 1JHOA 1RMQA 2QUJA 3R8FA 3KXIA 3H1GA 1L5NA 3EZFA 2MTBA 4IV0A 5AICA 4QNNA 5KTTA 1M75A 2R4TA 3LCJA 1RQNA 3NEPX 4AZ3A 2FP4B 4YTEA 5F3WB 3WL7A 4FDAA 1QYDA 4WLUA 2Y6VA 5ERXA 2B2NA 4YPVA 3EHEA 4G4SO 2AF4C 3DM9B 2JIOA 1AY0A 2GEVA 3LKBA 1GQQA 1HLDA 1GPWB 1N6LA 1OCEA 3GLTA 3HU5A 5LKAA 3DFZA 4TLBA 2FPPB 3DAOA 1KTVA 3OZFA 3TIFA 1DJPA 5EZSA 5LQKA 1ML3A 1H8HD 1ZAYA 4L5BA 4D8WA 3QF4A 1U0EA 1X74A 3AILA 3G59A 4JT2A 4I36A 5ALUA 2OV2A 4RD6A 3EG9B 3GZ4A 4R01A 1UK8A 1CWUA 4YRLA 5B6PA 4ZN6A 1EFVB 1IK4A 1T6BY 1SC6A 1R3DA 3P9KA 3WFIA 4AECA 1UJ5A 3I32A 3KQUA 2PSSA 4QHTA 3I58A 2OD9A 3OPNA 3H11A 4FYHA 4LAFA 2QMHA 4ZTUB 4ZCRA 2G9ZA 4DMMA 3F6RA 2CK3D 2ORVA 1V96A 4RK1A 4ND2A 4RVCA 4Y3UA 4BCBA 4Z1MD 5LJLA 4HRXA 2HADA 4JBWA 3HJGA 3RAFC 4FCWA 1IZ9A 4R2KA 4QREA 4UULA 4LVUA 5HJ5A 1KR5A 1PGJA 5I9MA 5B30A 1QIKA 3LYHA 1GG9A 1O2DA 2PTGA 4QQRA 5ED0A 5M3BA 2LRHA 1EZ4A 3DOJA 3GT3A 1JU3A 2PX6A 1OZAA 3FJYA 2GBFA 4S2EA 5ITSA 1XZGA 2D0PB 1YTUA 2R00C 4BLTA 1KFCB 3V4LA 2XWSA 5CNKA 1ZJ6A 2FKNA 5DP1A 3T7TA 5LBIA 2PBRA 3GLGE 1U9CA 3GUYA 1UAAA 3DDUA 3PWZA 4QKQA 3RG8A 2BHSA 3JY6A 4BJHB 1JSXA 2IHBA 3HCEA 1PKEA 1NY5A 2HK8A 3I0NA 3O9ZA 2FQYA 1L5GB 3RVOA 2OILA 2XNCA 3DBVO 4JEUA 1KZ7B 4N0MA 2XKJE 2B8EA 2AG8A 1KO5A 5EXTA 1ZEMA 4F2PA 2XKAA 1SKYB 1GPBA 4YP9A 5ISMA 2QQ5A 2CXQA 1RWKA 1O95C 2I4IA 1UWVA 3CNLA 2V9CA 3KDAA 1URPA 4KH1A 1UQRA 2EEPA 1G5TA 3FPGA 3L6RA 4FQ8A 4YYEA 3L1KA 1N5RA 3IIJA 4F93B 1KMHA 5CBPA 4WNAB 2XOKA 3FPKA 1L8AA 4OI4A 2WINI 2GAFA 1T13A 2YINC 4KQFA 1PS9A 1O5OA 3M1AA 4IUYA 4JB3A 2JIZD 4E6PA 4HNUA 2V4MA 2WMOB 4QOIA 2C59A 4L4YA 4K9LA 4DBZA 4MLPA 2JZCA 5JC1A 1MO5A 2I87A 3R0QA 4GPEA 4JC5A 1QH8B 1C8VB 1JG6A 4LJAA 1JIXA 1IHPA 1TM4E 1UZNA 2OKCA 3UMCA 1QWSA 4B33A 2YVAA 3LSTA 4ONEA 1DAHA 4A82A 4HTFB 5DNVA 3FCYA 4QFCA 1I33A 3U3ZA 1QGDA 2VBIA 1FZQA 4DHEA 4HWKA 4YPFA 2VT6A 5EE9A 4RTQA 1C0PA 1UF9A 2D1QA 2YJGA 1YAJA 3I92A 4MV8A 1IXYA 3NH6A 1Z2EA 3WK9A 4AYWA 2D5LA 3DCYA 1ZM2A 3BMQA 4O3MA 1KGDA 1W35A 4MKRA 4Q3EA 3V3TA 4BFVA 2JG3A 5LXTF 3ZY3A 1Z5GA 4J9VA 3WMRA 2D5BA 2UUOA 4D5GA 4XJTA 3RVSA 4G09A 3ER9A 2BE9A 2CSUA 1SOVA 2GBPA 4MKHA 4M1MA 1WAMA 2NZJA 5D1HA 2IDKA 2HV8A 3OJ0A 3PGA1 5T57A 2TMKA 5JS6A 2DJ5A 1VKNA 4J3FA 5G0TA 2OGSA 4PAGA 2O0JA 2JCSA 4PYKA 3O8OB 3RCBA 4GOJA 1CV2A 1YB1A 1NBME 1Q0TA 2JATA 1KFJB 2FSUA 1BD3A 3C70A 1Y3AA 5DXFA 8AT1A 2QA5A 1AK1A 4BKRA 1VPWA 1F51E 1IHDA 3DT9A 1BS9A 1DV1A 3F6CA 4B82A 2GVDC 3NTXA 3WDLA 1KI7A 5KYUB 2D13A 4LS3A 5E1OA 2X3UA 3DONA 1TJ5A 3SBXA 3GJ7A 3M5DA 1Y63A 2A0FA 3R3UA 1M0SA 1GNLA 3IV7A 3RC8A 1NONA 4G9BA 3R20A 4ZZ2A 4KN6A 1SIUA 4ED9A 3I2FA 1V8FA 1KZGB 3SFTA 3WGJA 2P9QA 5A0VA 4MWOA 2CDNA 4QAJA 4E88A 1U8ZA 2ZGVA 1X80B 2AFVA 3DR3A 4YGXB 4JXZA 2HCFA 5A7GA 5B6IA 5JE8A 5KNBA 4QGBA 4FSHA 3RGGA 1TVKA 4D9JA 2O8EB 2XCUA 4E7PA 4ESEA 1FLNA 1EGAA 3DE5X 3DMHA 4MUKA 4N8DA 1SU6A 3BK1A 2FWNA 2FOIA 1PK9A 2XT6A 4QPPA 5ECGC 4YUWA 1HTWA 3QUCA 1NVEA 2PZKA 1P2FA 1YQUA 2AFHA 3PX3A 4E70A 3ICQB 4ZOBA 1TADA 4LECA 2HYIC 1Q0QA 2QGZA 3WGKA 2H4HA 1XF9A 4L8LA 2IW3A 2ZBUA 5EQFA 1T15A 1BMFA 3AESB 2Q8NA 2X3YA 1RDFA 5CDFA 4C0HA 1NQWA 3DTVA 1H4QA 1GTL1 1NUAA 2QPTA 3MCWA 1Z2OX 2ZE5A 2OT3B 1VYVA 5TMDA 3ZS8A 2JAWA 1Y1SA 3PUVA 4CCYB 4EKEA 3QVOA 3GU3A 3MRSA 4IL5A 5KWJA 2H2HA 3HVRA 2V1UA 5CVUA 4EG0A 3KTDA 4KQ6A 1A9RA 3AU8A 4JBLA 1DOZA 2CJFA 3QUQA 1FXSA 3IEPA 3OCZA 2UXBB 5AI5A 1E99A 2GILA 1M1YA 4W9NC 3PITA 4NPHA 5KUTA 3UG7A 1GKIA 3HM9A 3GNTA 2H57A 3NG1A 1ZCFA 4FYWA 1M5RA 2IU3A 2XUPA 2NU8B 3E8SA 4JVLA 4K9QA 4YONB 1I4EB 2QMEA 3HKDA 1E9DA 4QPCA 5AVRA 4RIHA 2XXBA 2ZSKA 2VH1A 4ZARA 5IAKA 5JS1A 3L0CA 1P4GA 1U8TA 1U8FO 2FZGA 1XDGA 2JJ2D 4KSYA 4MVJD 5K3AA 3ANMA 2G1PA 4JEMA 3BERA 2X4IA 1QQTA 3GZTB 1VHJA 1AM4D 1VE5A 2FV8A 2XR1A 3QYFA 4IGKA 4WKGA 3NBUA 3PGXA 5BN5A 1OU0A 2XT9A 1RXEA 4DNPA 5ILOA 3HCDA 3ZIAD 3LDFA 1H0SA 5JJKA 1EGQA 1RSZA 2Z1MA 3BXZA 5HQ3A 4V24A 3V80A 4M1ZA 4MHOA 1P77A 1NJFA 2C3UA 1HNZB 4P3NA 1DAGA 1DQNA 4U8HA 2XA2A 3H9EO 2XUHA 2XUDA 3U7GA 1XRRA 2JFBA 1WZNA 2B4QA 4LOHA 4CLEA 1CXZA 1Q0UA 3H97A 1RRKA 4JC0A 3AT1A 2K2WA 2WFLA 3HQ4O 5HUJA 2NGRA 4IDBA 1J8VA 1VBNA 3UYLA 4A9AA 4BUJA 4AX4A 4B9AA 4DJJA 4BEVA 3F78A 3E81A 4O33A 3GJ0A 3G85A 2R8OA 3O3CA 4TQAA 4DJTA 5I7RA 1EB9A 4TUYB 3PLRA 4RH0A 5I5GA 4F4HA 5HF9A 1FBNA 3LL4A 5AUPB 4LBVA 1VDZA 4QJIA 5AM2A 3C3XA 4EI2A 3R7AA 4CMJA 1R4MA 2LWIA 2VHEA 1C81A 1QHHB 3A11A 1BXZA 2R47A 3C3MA 2YWRA 3H1EA 3P94A 3B3GA 4CN8A 4XDHA 5EWJA 3QBVA 2I3AA 1PKXA 1R8XA 4IXTA 1J8YF 2YNMA 2EHJA 2XSZA 2Y0BA 4LXIA 3UPUA 2JD1A 1QIJA 4CI9A 2LP4Y 2IGTA 3CVXA 4YO7A 1M5TA 2HBZA 1XYVA 3REFA 3W4IA 1JEYB 1FNBA 3OECA 3L8DA 3JQ7B 2SECE 1G8GA 1J6UA 3DTTA 5D5QA 1A9XA 4J7AA 1RQRA 3T54A 1ZI6A 4OM7A 4FWBA 4IDAA 3E0QA 4AUNA 1Y3CE 4C5BA 3OAAD 2BEVB 2X8LA 2F48A 3E9CA 2QTVB