1R10A

Cystic fibrosis transmembrane conductance regulator (cftr) nucleotide-binding domain one (nbd1) with atp, i4122 space group
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
280
structure length
264
Chain Sequence
GIIMENVTAFWEEGFGELLEKVSFSHLCLVGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGRVSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSELQSLRPDFSSKLMGYDTFDQFTEERRSSILTETLRRFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords Cystic fibrosis transmembrane conductance regulator
publication title Structure of nucleotide-binding domain 1 of the cystic fibrosis transmembrane conductance regulator.
pubmed doi rcsb
source organism Mus musculus
total genus 90
structure length 264
sequence length 280
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1r10A00
2HJGA 2PLFA 4TYQA 5JJIA 3BH6A 2VP5A 2WJVA 2VLIA 1NBME 2A5DA 3CX6A 3EG5A 3PUXA 1CR2A 2H1LA 1GP2A 2EQBA 3FE2A 2B7BA 1W46A 4FCWA 1A7JA 2ZS7A 2GZHA 4XIGS 3RYTC 2H18A 3PFIA 2BHRA 2QY9A 3LA6A 4P4TA 4ZDKA 5FOVA 2XZOA 3RS5A 2QMEA 5AK0A 2QPTA 3ZVRA 3AVXA 2Q3MA 1OH5A 3FGNA 1OSNA 4XWOA 5CITA 3LXXA 2BJVA 1VMAA 3A8TA 4WAUA 3F8TA 3F3YA 4DLWA 4UNPA 4TLEA 2W6JA 1Q1EA 4CW7A 3K09A 1T8TA 3I73A 3AH8A 1LVGA 3GEEA 3TJZA 3QKTA 2F9LA 2WOOA 1ELOA 3O8BA 4UNRA 3B1VA 4IVPA 1P75A 4HLCA 5FL7D 3ZQ6A 3NG1A 2VP0A 2ZRCA 4NYIR 2QBYA 1PJRA 3B82A 4DEYA 4GP7A 1CJKC 3CR8A 4ZI3A 1UBCA 4QXAA 1IN5A 4FMCB 1F5NA 1G17A 1JEDA 1QG4A 1WE2A 1WF3A 2BCJQ 3EA5A 4IEEA 1Z0FA 2ERYA 3KB1A 5JSZB 3FTQA 1E2IA 5KSZA 2VBCA 2QG6A 4LJAA 2G3YA 1D2MA 4PQFA 3T1OA 1IQPA 2GF9A 2QROA 1E1RA 2Q9BA 1N5IA 4PPFA 3U7FB 1OXSC 3I5YA 5DI9A 4HYYA 5AUPB 5L3QA 4JVMA 1DG3A 1ZINA 1R0WA 4M53A 2JJ8A 3NBZC 5JWOA 1M7BA 5KDDA 1Z6TA 3GP8A 2J0QA 2HF9A 1FFHA 2QP4A 1E9RA 1C1YA 3NC0C 4QHSA 2FSHA 2QENA 2E1RA 2ZYWX 3TUIC 4DLZA 3FWYA 1KDRA 3FHOA 4LBZA 4L15A 1FPMA 1YR8A 1HUQA 1CJVC 1YZKA 2D2FA 1ZYUA 2OCBA 4IFEA 3LVRE 4CRWB 3SHWA 2VF7A 1WBBA 2C03A 2ZROA 1RC8A 4LPSA 1N3BA 2YOGA 1OB2A 5GJVC 5SZIA 1OH7A 3N70A 2DB3A 1SKQA 3HPRA 1RRPA 1JECA 1E0SA 4B73A 3OAAA 1R0ZA 2R9VA 4XVQA 3OEHD 4KFTA 3EZFA 2RMKA 2CMKA 1G6HA 3NXSA 3JVVA 4LC0A 2FFBA 1WXQA 3PUVA 5DN6D 1TF5A 2ZRBA 3VHXA 1HEIA 4I1VA 3CNOA 2F43A 3K0EA 4PPQA 1LV7A 3CBQA 4B74A 2QAJA 4W9MC 2FPKA 1E2MA 3ZVNA 1S0UA 4RD2A 4DWJA 4QGFA 1S9DA 4XSGA 1XD9A 3WMEA 4B2PA 1D9ZA 2FSIA 3AP3A 4B34A 1DAFA 2ECKA 3RS4A 5GVSA 1ZM9A 4YMSA 3X1XA 3ASYA 4DEXA 1OXTA 2JLXA 3EZ6A 1DE0A 2GNOA 4POAA 3PENA 4OQXA 4ZKEA 3C41J 4NU0A 3K9LA 2J45A 4IDNA 5H70A 3B13B 4CDGA 3KTAB 4O0MA 3SN6A 1E6CA 1VG1A 3BRWD 3T12A 1E1QD 2J1LA 4D4KA 3ZLJA 3W5JA 1SXJD 4GNKA 5JCPA 4PR0A 5M04A 1D6JA 3PCRB 2KJQA 2P65A 2ZJZA 1VKJA 3MJRA 1LW7A 4YQFA 1KDPA 2XJ4A 1VTKA 3Q5DA 4R7ZA 3TE6A 2MSEB 3FMFA 3TQFA 3N2EA 2FEMA 4WW0A 1MABA 1NVWQ 4F4JA 2QGZA 4BFZA 3QF7A 4AKEA 1E0KA 3QEJA 1L2TA 4EPXA 1LF0A 3VNVA 2O8FA 4M2LA 1Y3AA 2IT1A 2GHIA 1P9RA 1G4UR 1VIAA 2R6FA 3V00A 1CKEA 2QN6A 1XTKA 4KFUA 4BUJA 4NBSA 2C98A 3I72A 4KFSA 2BEKA 3WP1B 2GA8A 2FNAA 2D3WA 2ZI4A 4P32A 5JEEA 4ZPXA 3PEYA 2C5LA 1DVRA 1HY3A 3HYRA 3GJXC 1KJZA 1NMXA 1LS6A 2ZI3A 2ZYUX 4DLTA 3KKPA 5JCZA 4RCZA 2UKDA 1CR1A 2W6JD 3HP1A 3KXIA 5BYKA 1COWA 3E2IA 4IJMA 2VYFA 4A8JA 3ZVMA 2ATVA 4OJKA 1U98A 5DHFA 5J47A 2IYTA 3W6PA 1KYIA 3THXB 4CEIB 4HDQB 1NVXQ 1XJ0A 4A82A 5L3SA 4LZZA 3TSOA 2P6UA 5CIQA 3LW8A 3RS3A 4ILEA 2A78A 2ZU6A 3RNLA 1TEVA 2WWIA 1KK3A 4Q7JB 3AVUA 1VG0B 2ZR7A 3LRPA 4HB2A 5SZKB 2ZRLA 2WICA 4XWAA 1I2MA 2ZE8A 1R5NA 1E1RD 1SXJE 3BFKA 1XEWY 3K70C 1EG7A 3KDSE 4KYUA 3VR2A 4LHYA 2CLCX 4IDHA 2QZ4A 1JB1A 3G5UA 4OK3A 3CH5A 4X8HA 3WYFA 4XVUA 1C4OA 3IO5A 3AF2A 1X8LA 4G5QA 2YYZA 3TMKA 2F1RA 4TTRA 3REGA 3LY5A 2ODEA 1W2HA 4KHZA 2FPMA 2F1JA 4IHQA 2QORA 3ZQJA 5LD2C 3MD0A 1E2HA 1II9A 3SFVA 1W0KA 2IEYA 1TX4B 1NLYA 4FCVA 2IHYA 5DHAA 1ZRHA 4URYR 4Q1BA 2IYYA 3CZQA 4AYTA 2OAQ1 1G41A 1QVAA 2PZEA 5JI2E 1J90A 2QP9X 2GILA 3ND8A 2JLZA 5BN3A 1XFAA 3THOA 2GDJA 5AUNB 1XP8A 2HLDD 1CR4A 2PCLA 1ZD9A 4QC2A 2EFCB 1D5CA 1G19A 4EQ6B 2ZXUA 1N5LA 3OAAD 2W83A 4CVNA 3SQXA 1DS6A 1CJTC 1QHHA 2G9NA 1G1MA 2FH5B 3K53A 2ONJA 4G1UC 4EPVA 2GKSA 5E7JA 4B2IA 2IW3A 5IK2D 1CTQA 1KKLA 3A4NA 3NWJA 4IEIA 4TLCA 4F92B 3H1TA 2CE2X 2IS6A 2RGBA 1ESMA 2REBA 4JLVA 4L9WA 5SZJA 4HDCA 5EE3A 2O8DB 3K0AA 4YMWA 1RKBA 1SZPA 1KI2A 1FTSA 1M7GA 1YRBA 3MCAA 4K81B 4Q18A 1IY0A 3KFXA 3B9PA 4LYFA 3KQNA 1NMZA 2GXAA 2WWFA 2GJ8A 2J0UA 5IT5A 3PEWA 2IYWA 2ZU0C 4H1VA 2UZIR 2ZRPA 3LWNA 2VRWA 2P3SA 5E3HA 3AM1A 5GADl 1GOTA 5J4VA 2ZUCA 4GSYA 3G82C 5EJEA 3M4YA 4D4LA 3GJ4A 4I4LA 4KBGA 4TTQA 2ZUDA 3IHLA 3THYA 4B2LA 4OQLA 4MYTA 3D31A 1P4SA 1RPZA 4AI6A 2QU8A 2BMEA 4RY2A 4XOIA 1QHSA 1A1VA 4PQRA 2GXQA 2GJAA 3HWSA 4JBYA 4AYWA 3LBNA 4M4SA 4B71A 1Z6GA 2P5TB 1KI7A 1KK2A 3LLUA 3QVVA 4P0TA 4P3YA 5A0FA 1JALA 2VHUA 3DO6A 3T35A 2RGEA 1NI3A 2HYIC 1G5RA 1T3LA 2OLJA 5EQTA 2BDTA 1SVKA 2B92A 1KNXA 1ONBA 2IXEA 3ADDA 4I81A 3KFVA 3KZ1E 2DYKA 2GEUA 1A82A 1ZCAA 2VPPA 1N6LA 1X8KA 1XTSA 2NO0A 3LVQE 1M8PA 4BQSA 3EWSA 1TF7A 2BBSA 4LBVA 2ERXA 4C2UA 1FMLA 2ZRNA 5BN5A 3LO5A 2VHQA 2NIPA 4L9SA 1OHHA 5FUYA 4NCJA 3AVVA 3CWQA 4IOLA 4BFTA 2RH5A 4MH0R 3BBPA 3TQCA 3EA0A 3DZDA 4EFMA 1AZTA 4EUNA 4M1SA 1KMQA 2JAQA 3L8ZA 4OHXA 1JJ7A 2C95A 1W36D 4B33A 5GJBA 3A1UA 4KU4A 2BEJA 4TL9A 1G64A 4AD8A 2IUSA 5IHPA 4US0R 1KJYA 2O8CA 5EUQB 3NBXX 2BBTA 2BWJA 3IDQA 3ZZUA 1G8HA 3LDAA 1FOEB 2C96A 3CRW1 1Z6XA 2OBMA 2A5JA 4BE7B 1ZU4A 2XEXA 5B58C 2BMJA 5C4MA 5DISB 1KI6A 2EFEB 2XAUA 3T1TA 1JNYA 4NPHA 1Q21A 2OESA 3IUYA 3GLFB 3QKRB 3TGPA 4NCHA 2LKDA 4BFWA 2FEOA 4ZI2A 4OQFA 4RFSB 2CK3D 3RC8A 3NIBA 2ZRDA 2AFHE 2OXRA 4JZKA 4NYMQ 3AF4A 3L2OB 1JPNA 2DBYA 4PC6A 5HZHA 1XMJA 1T5LA 4A0RA 3KXKA 3RC3A 1XWIA 2Q3FA 1RYFA 1N6PA 4NL4H 2IS4A 3P27A 1N25A 1KHTA 5CB8A 1H65A 3VQTA 2XOKA 4F4CA 4BFYA 3HPQA 1W44A 1IJEA 1DADA 3K9HA 1FQKA 2V4ZA 4Q4JA 1IN8A 1GFIA 1GTVA 3ZIAA 4ZIRA 1W0KD 2IF0A 1UKYA 2D4HA 3X1WA 4ERNA 1YRAA 3UANA 2F7SA 4PAMA 3GJ6A 1NN0A 2RKOA 2J5XA 3JZMA 5JI3E 2QT1A 3GLGE 4HB0A 4GL2A 1DEKA 5CLQA 4B3XA 3QOFA 1G3RA 2I3BA 1T6NA 1Q20A 1OXVA 2W58A 4KYIB 1E2NA 5J40A 5JWRA 1XXHB 5F9FA 2ORWA 3AB3A 4V02A 3UWOA 3WBKA 4JYBA 5CDFE 2JASA 4QNRA 5CIWA 5TY0A 1N5KA 3E5HA 3U3RA 2XNDA 3FMPB 2X2FA 5BXQC 1TU3A 3SE0A 2RHDA 3CPJB 1E9DA 2ZRGA 3CPHA 4WZBE 2GAAA 3H84A 1ANKA 1M34E 4TWZA 3UG6A 3W8RA 5CYOA 4UJ3A 1G4AE 4HZIA 4RZ2A 5HE9A 4DLVA 2YWEA 1DO0A 2QPAA 1FW6A 2XB4A 1Z83A 4Q4HB 1XCMA 4A15A 1QZXA 2K5UA 4Q4LA 5TXGA 3AGPA 3LLMA 1NJFA 4E07A 5K8UA 3ND9A 2GZDA 2DFNA 3QF4A 4URXR 1YHNA 3SC3A 1DAMA 4A0FA 1EFHA 1CU1A 1YZLA 2XSZD 3TSZA 1HURA 1P2SA 4D81A 5F9HA 1AJEA 2W00A 1T4GA 1GITA 1W2GA 3SJBA 421PA 1YR6A 4PPNA 4XD7A 4URUR 4JLBA 2GXUA 1SXJB 3C14C 3QY0A 3VHLB 3R20A 3ZH9B 4JKYA 1XX6A 121PA 3BXZA 4F93B 3V4FA 2O8BB 5FOWA 1XTIA 4RCYA 1EX6A 3MWLA 1Z0DA 3X1ZA 4YDHB 1XF9A 3H2YA 1SGWA 4U02A 5FFMA 5C1BA 1XD8A 1GILA 4MRNA 4GFDA 1E9AA 1E9BA 1GSIA 2P5SA 5FPHA 4E5UA 3WY9A 2JJ2A 1CS4C 3TR5A 4JJKA 3QBTA 3X1DA 3UXMA 3T5GA 2YOHA 3BOSA 5LBIA 3TRFA 4B75A 1CP2A 4PHGA 5FPKA 1E2KA 2H57A 2W2XA 2RGNA 3KQUA 1G7SA 1OHHD 1OKKA 4PO9A 3BB3A 1XBTA 2FN4A 2HXSA 4C4PA 2NG1A 4IDPA 3K0FA 1VG8A 5C46F 3LV8A 3B5JA 1LB1B 2MMCA 3FMIA 5EP3A 2CHVA 4RVCA 2CVFA 2J9RA 2X2EA 4RD1A 3THWB 4LDJA 4KLNA 4G5RA 2YVUA 4A6XA 5DH9A 2CLDX 4TQUS 3W3AA 1G3UA 3Q85A 4YXWD 3TLXA 1QHXA 4OI1A 1W4RA 3SHFA 4NCIA 1MR3F 1DTSA 1WA5A 4G0NA 1Z3IX 3LX5A 4V0LA 5AWFC 1HT1E 1JR3A 4TYPA 1UEIA 4D2IA 4M9ZA 3SOPA 4DLXA 2BJWA 2DR3A 4V0ME 3FFAA 4WXPA 3RVBA 4QHTA 1KO5A 4MRSA 1MH1A 4K8OA 3OE7A 2IYLD 4L16A 1P2UA 1DAHA 2ODBA 1XTQA 521PA 2RGDA 4HLUA 5G3YA 3UMRA 5JRJA 1RE0A 1JXMA 2WAXA 4RZXA 4OJQA 5G40A 3VKHA 5L3QB 1Z0JA 3NH9A 4C0JA 1PV4A 2MSDB 4GT1A 4LV8B 4L8GA 4JJZA 1TUIA 5FR2A 1KI8A 5JHHB 1B23P 5KSPA 2AKYA 5BN4A 3I3SR 2GRJA 4ASUD 4MKHA 3IIMA 4AIIA 4KJZA 4GZMA 4DT1A 1SXJC 1U0LA 1I2DA 4QGHA 1G20E 2J87A 3B60A 2ZSAA 1BMFA 3WHKA 3U7HB 1IAQA 2E9SA 2R44A 1BKDR 3QENA 3FYHA 2GBLC 1Y63A 3AF3A 2ZJYA 4PX9A 4A0HA 2OFOA 2FZ4A 2EFDB 4DSOA 2WIAA 1K6MA 2J59A 3VAAA 5CM8B 3WNDA 3KUDA 4RZUA 2IYVA 2F9MA 2VTKA 4ZV4A 5DI3A 1G16A 2WAYA 1BO6A 2NMVA 2ZRFA 3SJAA 2IBMA 2JDID 3IPYA 4AK9A 4EIWA 1NLZA 4JT2A 4LV6A 4FWTA 1WP9A 4IXNA 1AGRA 2WV9A 2GVDC 4JLJA 6Q21A 1T3SA 2ZETA 3IO3A 1YQTA 2XZLA 3TVTA 1EFRD 3GFTA 1KY2A 2BVNA 2WPDA 3MJHA 4C2TA 4BLPA 3CF6R 3CF0A 1OYWA 5LPNA 1F60A 3TAHA 2IA5A 3X1YA 4BGDA 2EW1A 2H7VA 4R2HA 3EXAA 4HUQB 3CPEA 4A92A 1E2LA 3AEZA 4CZ2A 5GVRA 1KDOA 3PUWA 4MRRA 1A2KC 4ON9A 3SDZA 4OHYA 1Q3HA 2G0TA 1TUEA 5FOTA 5DNYB 1GWNA 3GJ3A 4LK2A 2WWYA 2DWQA 2G0NA 3GLHE 4JLNA 4QNMA 4WZ6A 4TL7A 4XD7D 1RRGA 4PQYA 3PJRA 2GEDA 4PHTA 1OF1A 4E03A 1Q1QA 2NOAA 1Q3TA 2O5VA 2RCNA 5LB4A 4R71A 3U6KA 2QSYA 4YLGA 2A30A 1DAEA 4Q66C 4OL0A 2D7DA 4FD2A 1F3OA 5FI1B 4HAWA 4M1OA 2V55B 3GLIA 2G6BA 3DM5A 1OH8A 1YR7A 3UATA 1J8YF 1NVUQ 1J99A 1P9WA 3RRYA 4HAVA 1D2EA 4F7WA 3KXLA 3CRQA 1FNMA 2ZI9A 2NO1A 3SS8A 1OB5A 4X8OA 5KPDA 3J81k 1XZQA 1E0AA 2QE7D 2O8FB 4MA4A 3K0SA 4PFSA 4QM6A 2Z4RA 4R9UC 4Q9LA 1OKKD 3NH6A 3UPUA 4D0LB 2N1BA 4A6PA 3GLGB 1FTNA 1UPTA 4KXFB 3W90A 2AFIE 4LJ9A 1G6OA 2FU5C 3AF0A 5DIFA 1OE0A 4EJSA 5JZVA 5JS7A 4Q02A 3DM9B 1QHIA 1HT2E 2NO6A 3NDPA 4P4SA 4JYCA 2AWOA 3IGFA 4A1FA 1ZBDA 2J41A 1W36B 3QNUA 2WSSD 1ZJ6A 1Q57A 4RZ3A 4KFRA 2KI5A 1NN5A 2WMNB 1HE8B 4DUGD 2IC5A 1XRJA 3U61B 3DPUA 1P3JA 1KI9A 3TIFA 2PT5A 1OYYA 5G53C 1NP6A 4DDWA 1N5JA 2QAGA 3TSWA 2WKRA 3IEUA 2FDCA 1JR3D 4Z8YA 2O52A 3P4YA 4Q01A 2CNWA 5L3SB 1S8FA 3R8CA 3B78A 4YC7A 1W4BA 1G8YA 4DSTA 3SBEA 1J2JA 2FFQA 2GK6A 1FX0A 2JIZA 4NYMR 4U5XA 3I1FA 3RSLA 1LF5A 2CBZA 2GVZC 2GEVA 5KNCA 3KB2A 1OFUX 1EXMA 4JLMA 4RD4A 4B3GA 5J5CA 2WJHA 3IIKA 3SNHA 4O25A 1DAIA 3CF2A 4LPKA 1AQYA 1RRFA 4CT4B 2DY1A 2VH5R 3GLFE 4M9XA 2ZQ5A 4ZDWA 1E2DA 4Z1MD 3O8DA 1ZD8A 2VSFA 4QBGB 4TYNA 1UBEA 3W9YA 2ODWA 1U8YA 2V7QA 4C0QC 2Z0MA 4MGKR 1X1RA 1N2CE 1M74A 2NGRA 4IOKA 1ZP6A 5FBWB 1E9CA 3LXRA 5J4YA 4Q19A 4FIDA 1GNQA 3W34A 3OFND 1BMFD 5FOUA 2IXGA 3PEUA 4NP6A 2BMDA 1BYIA 5H1YA 5HCIA 2FX3A 2O0KA 3CKLA 2H92A 1T9HA 5C4GB 2ANCA 4AG6A 2REOA 1UADA 4KVGA 1XMVA 2Z5FA 3G0HA 2JLRA 2QPOA 1QDEA 1T0HB 2GZAA 4IKEA 5FBLB 4JVLA 4C0SA 4Q9JA 2R62A 3AVTA 1SVMA 2C04A 1XDBA 2AN9A 1XJCA 1Z2CA 2XTNA 2JJ1D 1NRJB 2VP9A 1QBKC 2A5YB 2QA5A 4F4IA 3FKQA 1RRCA 1GNRA 2W2TA 4D0NA 1YKSA 4TQ9A 5KU1A 1II0A 1XPUA 3K0AB 1XTJA 1OXXK 2G1JA 2WPDD 3ZDQA 4BEBA 1XXHE 4Q1CA 1SVSA 1G8GA 2HJVA 3OIVA 2CL6X 5CB6A 1JXOA 1WMSA 4FMDF 2KE5A 5FBQB 1W36C 1P60A 2DCUA 3CB4A 3CW2A 1EFCA 4AWXA 1IOZA 3B7GA 5HKKA 5EXTA 2GCPA 4ZCIA 3TNFA 4Q5IA 3AVQA 4HB3A 1SVOA 1Q44A 3CO5A 2NQ2C 3EC2A 2BMFA 1TQDA 1NVVQ 2PMKA 4JBXA 1NLFA 2VA8A 1V5WA 2IYUA 3R7WA 3I92A 1NSTA 2IWRA 1JAHA 4NZYA 5EZ5A 2D62A 1RW4A 3U6BA 4HSEA 2VQSA 2A5FA 2AWNA 2J7KA 1E79A 3DOEA 4JBWA 4MUBA 2F55A 2VO1A 2WJIA 1XMSA 2V8OA 3V9PA 3ZD6A 4C0KA 3O47A 4Q1EA 1GIAA 4EPRA 3I62A 3FVQA 2IXFA 3OF5A 3SFZA 1IN4A 3GEIA 2ZRIA 3BK7A 3EAQA 5KNBA 1EFUA 2NZJA 3Q3JB 1KNQA 2HF8A 4A36A 8OHMA 1SVLA 1AKYA 1MKYA 4LOAA 4PZYA 1ZIPA 3K9GA 3MWJA 1JPJA 4R98A 4IW3B 1U2RA 4LC1A 1II8B 1ZNZA 2EFGA 1EX7A 4B47A 2RHMA 1T0JB 4OK6A 5EXPA 3K8YA 4PPGA 3Q9LA 4W5WA 2O0JA 4BASA 4CEHB 3CX8A 1E94E 3FDIA 2VIIA 2WZQA 1W49A 1IXSB 1KOFA 3IEVA 2AXNA 3A58B 4YMUA 4O2LA 1YZTA 3MUFA 4MGZR 1DPFA 3P26A 2O8CB 5JWHA 1GUAA 3EZ7A 3MLEA 1H8EA 4KLZA 2ZJ5A 1XPRA 1K5DA 2AD1A 2GXSA 4GBMA 3HU3A 621PA 5KTYA 4B76A 3VKGA 2WKPA 2CJWA 2B8WA 2RGXA 4AKHA 2CNWD 2I4IA 3EWAA 3FFBA 1KMHB 1KO1A 2GWHA 4LBYA 2PX0A 5AJWA 2GTPA 1NIPA 2NPIA 2VF8A 2QQEA 3MWYW 4AKGA 4N3NA 3NTUA 1GZSA 1S2MA 2IEZA 3NEJA 3U3MA 4PO1A 3OIYA 2X77A 2IWHA 3T06B 1OXUA 1D9XA 3A6PC 3DOFA 3HU2A 5FUVA 1NKTA 3A1SA 3CUEF 4D26A 1FUUA 2PCJA 3SEAA 3KQKA 1XEWX 3VX3A 2ZM5A 3C4JA 4D82A 3SQWA 3GLHB 3M1IA 5TARA 1ETUA 2IYZA 3R9IA 3AVOA 4YDSA 2PLRA 2JATA 3KKMA 4Q4JB 2EVWX 2QMHA 1O87A 2XTMA 3CX7A 1YZUA 4GOJA 4ZIRB 2VEDA 1KO4A 2W6IA 3FPAA 1VCMA 5L8VA 4TL6A 4PSKA 5JFGA 3U7EB 1ODFA 3U3JA 2F1IA 2X1VA 4DCUA 3T34A 1OFTA 4IOMA 4D4MA 4C0AC 2B7CA 4Q1DA 1OIVA 1R8QA 3L0SA 3K0CC 3T1VA 2AX4A 5CYPA 3GPLA 2B8TA 2ZJOA 2A5GA 3CONA 1EESA 4M8NE 3SYKA 1M2OB 2XNSA 4MRVA 5EZ6B 1IONA 3PEVA 1XTRA 4Z54A 3B8HA 3QKSB 3U3KA 4I1UA 1QF9A 4C9BA 2GCOB 1AN0A 1M1YE 1OIWA 2DFLA 2QTHA 2TMKA 5HZKA 4N0EA 3L8YA 4BLSA 4UNQA 3PITA 4URZR 1NNEA 4EKDA 1G291 3CRRA 1N6HA 2OAP1 5K8TA 1TL7C 4B48A 1CJMA 1KSHA 3LNCA 3NBYC 1F2UB 4ESVA 2VHCA 2ZJ8A 5DYIA 1U81A 1LS1A 2PMDA 1KO8A 4NKRA 4E22A 2ZRJA 5CK4A 3EX7C 2IF2A 1ZUIA 5HKKD 5CLLA 1J70A 1AM4D 3DKVA 4QG7A 4DCSA 3T61A 4D6PA 4ZDIA 3AGQA 1LTQA 2GJ9A 4IDOA 1JR6A 3THXA 1HTWA 1X8JA 1ZAKA 4EFLA 5L3VA 1XEXA 2J7PA 1UDXA 4A2QA 3B1YA 4HZUB 1XCPA 2BC9A 4ZCLA 4YMTA 4OHVA 1ZNXA 1QRAA 4WA7A 1VG9B 2ZS9A 1COWD 1S1MA 3TUJC 1ZC4A 4NCKA 5LB2A 3KX2A 1UFQA 3K9NA 1R6BX 5ANRB 1E79D 3BGWA 2L0XA 2ZE7A 3PV0A 2QRNA 1IJFA 4TMZA 2ORIA 1G8FA 2OM2A 3Q8XB 1J7KA 4LJ8A 1TAGA 1U9IC 1Q22A 3C8UA 5CJ2A 4BLQA 1P72A 4JS0A 1E2GA 1G18A 2IYRA 1NG9A 3KJHA 3WRXC 1HE1C 5K8IA 4KVAA 1Z2AA 4FN5A 2HXYA 4QHYA 1AA9A 4UQOA 1E99A 1RJ9B 2D7CA 2DFKB 4UXHA 3L43A 3UMSA 4AYXA 2VSOA 3IHWA 3LH5A 3UKDA 4US2R 3REFA 1UKEA 4TL8A 3K0FB 2CXXA 4MYHA 1W47A 1VYVA 5DGXA 3BFXA 2CLSA 2C99A 3FB4A 5UKDA 1NIJA 1UF9A 1DELA 2DWOA 1Q0UA 2YC4C 1NBMA 3MAAC 4NCNA 4QJ3A 2HT1A 3EPJA 3W6NA 1BS1A 2IL1A 2V6JA 1TTTA 1YE8A 2AK3A 3W6OA 4V0KA 5K8LA 1G7RA 4OI4A 4Q7LA 3KJEA 3VR5A 1H8ED 4GPTA 4LYJA 2O8EB 3D7MA 1BYUA 2AKAB 2C8VA 1LNZA 2C2HA 5KSYA 1RIFA 4G5OA 3E1SA 4RD3A 5JMTA 4EPTA 1UEJA 4MKFA 2BKEA 2IS1A 2QP3A 4BRUA 4DRZA 3H4MA 3GJ0A 3H86A 3MFYA 2WJYA 5G3ZA 1HV8A 2ZRHA 1X6VA 1E69A 5H8WA 2WHXA 3K70D 1OIXA 2H5EA 2FGJA 3EZ9A 3TK1A 2ORVA 1US8B 4RD0A 1PZNA 1P61B 3ZJYA 4V0OA 3P20A 1XD2B 3TKLA 5AR1A 3WYGA 1I4DD 3KJIA 1Z28A 3I5XA 1GAJA 3P1JA 3QVUA 4TLBA 3VU9A 4DCTA 1FP6A 4Q4AB 3R9WA 2PH1A 1PLLA 2FPLA 1E32A 2OCAA 4NH0A 4FXPA 5DO9A 1V43A 1S3GA 3BIFA 4DHEA 4HB4A 3R9XA 4JLAA 1XPOA 2W6ID 1GL6A 2XTZA 2JLYA 1UDWA 4DLYA 1G9XA 2PEYA 4C7OB 1WQ1R 3DVLA 4MGIR 4ACBA 5TVKA 4BFSA 3GJ8A 2WWXA 2C9OA 2FFHA 1YU9A 5CM9C 4XTCS 2ZRKA 5DSZA 1SHZA 2C9YA 1OLOA 4HDOB 1XCGB 3LFUA 1NSFA 1U0JA 1XZPA 3WMFA 3BORA 4IVRA 4PHFA 2YZ2A 1N0WA 4LHWA 1G3QA 4QBFA 2GETA 1M7HA 1PUJA 2WMOB 4OYHA 2ZSBA 5DI3B 4B3DA 4EAQA 1DAGA 1Q1ZA 2A9KA 2BV3A 3EPKA 3WNCA 2Z43A 5E7IA 2FG5A 4FW9A 2ONKA 2ZSEA 4QFMA 2D2EA 2C78A 1G21E 4Q1FA 3PUYA 5C2JB 3ADKA 1DG1G 4NE2A 721PA 1N0UA 2BM1A 3VMFA 5KDOA 1EGAA 5J4HA 2WJJA 5SZHB 2Q0HA 1GG2A 3U44A 1W7AA 3U3OA 3PUZA 1L4YA 1MV5A 2A7QA 3BB1A 5AJYA 5E7MA 1MOZA 4P4UA 5FTKA 1EK0A 3IQWA 2OLKA 3SBDA 1KAOA 4LUCA 3M6AA 3GD7A 1IBRA 2YJTD 1QVRA 1P73A 1IN6A 2FV8A 2YOFA 2LWIA 3IBGA 1AS0A 1IXZA 3QKRA 2VP2A 3T1QA 3SR0A 4DSUA 2YWFA 4RFSA 3ZGXA 4B32A 1ZM4A 5ELXA 2ZRMA 3I4LA 4NYJQ 4P31A 4MUAA 4KSBA 5TV2A 1NVVR 5HR5A 1RVDA 2V1XA 1S4QA 2HV8A 2IYXA 3N2IA 5EXXA 2QGNA 2AD5A 2OHFA 2OBLA 2BBOA 2ZI6A 4TYWA 5KNDA 3CIOA 3R8FA 2QQ0A 3ZZTA 2QBYB 2BOVA 2FSGA 2QNRA 4LJYA 1P2VA 1G7CA 4W5HA 4CT5A 4FINA 2GAOA 4HATA 4DB2A 4LRWA 1T3HA 4B6FA 1FP7A 3KQHA 5L3RA 1UAAA 2VSXA 4LHXA 1AS2A 1Z0KA 2D74A 4QJ4A 2E87A 1KIMA 4JVSB 3IBYA 4ACAA 4IVQA 3NC1C 2AL7A 1S9HA 2PZFA 4ITRC 1VHLA 5FPTA 5G41A 3WMGA 4BLOA 1GL9B 2QTFA 1CIPA 1CULC 2XOKD 4EJSB 5KO2A 2R8RA 4A2WA 5A4JA 3AVYA 1T91A 4TYYA 1E0JA 4G3XA 4DDUA 3AVPA 4J0QA 1JQLB 1JAIA 1AGPA 1I4TD 4G5GA 1SULA 2IK8A 4PO8A 5AJXA 1S96A 3ZIAD 3EPHA 2CHQA 1VYUA 1G7TA 2PEZA 2YHSA 5A5GA 1HH4A 4RKEA 5EP1A 3NHAA 3CRVA 1PLJA 3C5CA 2FFAA 5KDLA 5KHOC 1GM5A 2ZE6A 3N5CA 3TW4A 1UBGA 2IYSA 3C5HA 4IOJA 3EIHA 2QAGB 3IILA 3TBKA 2ZAOA 1WBDA 1RZ3A 5DN6A 3AUYA 4CEJA 1FQJA 3GCGA 4JKIA 3Q7PA 3L82B 3BH7A 3VR4A 4Q4HA 4DLUA 5FI0B 4W5JA 1L8QA 2Z83A 4KV9A 1UJ2A 3MMPA 5TB5A 2XNDD 2PBRA 2Q9CA 3U4QA 5JEDA 5FTLA 1DOAA 3ZS8A 4FMDB 3AV0B 4B43A 1N6NA 2GJSA 3DL0A 1GRNA 2DPXA 3AKEA 4A2PA 4KCGA 1E4YA 4JL5A 4QBHA 2F1HA 2F43B 2G83A 1GKIA 3AP2A 3B1WA 3BH0A 4V03A 4CGZA 2XGJA 1F2TA 3VR3A 5FH9A 4D0GA 3U2QA 4NTZA 2FF7A 5TMPA 4L5BA 2C9CA 4M21A 3WRYC 4UXIA 4DCNA 4N1AA 4PHHA 2WOJA 4PXAA 5DYGA 4URWR 2JLSA 1SXJA 2V54A 4JSTA 3FMOB 4LJ7A 3Q7QA 5HCNA 2JLUA 1KAGA 3HU1A 4KITB 3K09C 1BIFA 4MDFA 1MO6A 5GJWC 2O8BA 2H16A 2NZ8A 5B2ZA 2GBLA 2WBLC 3SYLA 1GDDA 1TMKA 3RABA 5JHGB 1UBFA 2ANBA 1KK0A 2KBEA 5LDDC 3GJ5A 1DBSA 3HYTA 3W8NA 3VR6A 4QL3A 3TAUA 4RKFA 2OT3B 3F5FA 3RRZA 2OSBA 3QPVA 3RSOA 4EDHA 1TF2A 1SVIA 1GNPA 4WIAA 2ZI7A 4U7DA 2WKQA 3SJCA 2AHOA 4JIMA 3UMFA 1F48A 2HCJB 1JJVA 3WBJA 1MABB 3T15A 5IRCD 2JJ2D 2PT7A 1TQ2A 4EJSC 5FTJA 2QT0A 3PIRA 4Q9KA 4ZDJA 1VIYA 3THWA 4II7A 2HUPA 4UXJA 4PZLA 1T5IA 2DHRA 3S1AA 1IHUA 2WSMA 4WOPA 3WYAA 1Z22A 2R6AA 3CH4B 1E96A 2WVJA 1NY5A 5F2EA 5EP4A 2W2VA 2YNMA 2B6HA 4PAQA 3VFDA 4JL8A 4DDTA 3DEFA 4Q48A 1PUIA 1PVOA 1Z06A 4KBFA 3AQ4A 2QAGC 1AQUA 3DHWC 3TR0A 3LW7A 3EARA 1W5TA 2I1QA 4LX0A 2R6GA 3B9QA 4JSYA 4MRPA 4QBIA 5J4KA 1NJGA 1SHKA 2OCPA 1LFDB 4A9AA 2XITA 3R7WB 1EFTA 1L7VC 3ZD7A 2J0SA 3A36A 4JLDA 4M1YA 2A3RA 1E2PA 3PXGA 4A8JB 1R0YA 4HAXA 1P62B 5FPSA 2OZEA 1AK2A 2C77A 5BW8A 1N0VC 5EE9A 4M9QA 1R5OA 1D2NA 1XU4A 3BAFA 4G5SA 4PTLA 2EWVA 4TMWA 3QSYA 1TADA 4PC1A 3TH5A 4LJ5A 2DFTA 1CRPA 2O0HA 2HDNB 4MYUA 4WVFA 1GKYA 2FA9A 5KYKA 1A5TA 3AP1A 3RWMB 5D3MA 4TLAA 3FHTA 3IPXA 2F6RA 3OE7D 5FBRB 1Z07A 3V4RA 4LJ6A 1CF4A 3CRMA 2FSFA 1I4LD 4DLRA 2EWWA 3GMTA 4BFXA 1W0JA 2CCJA 1M6NA 1YR9A 3QG5A 2YWGA 1TU4A 1K8RA 1GKUB 2HLDA 3ASZA 1SQ5A 3EIQA 1Z6YA 4OQMA 1KY3A 4R2IA 4Q7KA 1FNNA 4BLRA 4F91B 3C16C 1Z8FA 1J8MF 2EYUA 4NMMA 5FOXA 4C30A 2XXAA 2WIBA 2QEQA 1NN1A 4NONA 3RRMA 2XJ9A 2ZUBA 3QXHA 4HLDA 2FZLA 4DLSA 3LQQA 4ARZA 2BBWA 1OW3B 2CJWB 1GRQA 3AF1A 5IK2A 4E09A 1IY1A 4JL6A 3ZYCA 3HDTA 2X19A 1IY2A 3QXXA 2JLVA 2ZE5A 3RWOA 1Z6AA 5FBVB 1ZC3A 4RFVA 1U0HC 2D06A 2WM9B 2ZEJA 3MG9A 4TMXA 1R0XA 1MRSA 2ZR0A 1CLUA 1CXZA 3QG1A 2CDNA 3K70B 4H1UA 4MDEA 1QHHB 4QOSA 4EPWA 4IDQA 1QHYA 2ZVPX 2VHTA 3RS2A 1WCV1 4HUQA 4TT3A 1RFLA 5EE5B 3B1XA 2Q9AA 3GFPA 3D8BA 3U60B 2NTYC 1JR3E 2PL3A 3BFVA 4I1SA 5LD2B 3P4XA 3L0IB 3LBIA 1AKEA 1ZD1A 2CEAA 4GRAA 1OPXA 2ZS8A 2G77B 2J0UB 1B0UA 2QSZA 4PANA 1CJUC 4B3FX 1XMIA 2QM8A 4HAZA 4UNNA 5FL3A 4YMVA 3A37A 2J3EA 2FWRA 2Y8EA 3AUXA 4Q47A 2RGCA 1E9FA 3ZS9A 4QKQA 1F6BA 2JLQA 1ZCBA 4A8JC 4TSFA 1KJWA 3NEYA 3QXCA 4XWKA 2F3TA 1N6OA 4LHVA 1GL7A 2EFHB 4W7SA 2R6CA 2HEIA 4GI7A 4JT4A 4C3ZA 3THYB 3OESA 2GCNA 2ZSDA 4UNSA 1E2JA 5JSZA 3RS7A 1KI4A 3VR1A 3B2EA 1NG1A 5AUOB 1FMJA 3A4LA 1N6KA 4ZO4A 2ASEA 5FUXA 3FOZA 1E98A 1HA3A 2Q6TA 4MYCA 2JGNA 3GLGA 5HTKA 4BZXA 2ZR9A 4M9SA 4JVNA 1W48A 3OHMA 1R8SA 2WWWA 4XSHA 4XJXA 4US1R 2GESA 1TQ4A 4M22A 4A4DA 4M1WA 2KSQA 2FMXA 4Q1AA 1SKYE 2KB0A 5CDFA 3SU8A 2Q3HA 3OIUA 2PJZA 3X2SA 1S3SA 2MMGA 2HT6A 4CYMA 1W4CA 2EU8A 2B21A 3NDBB 3WNBA 2FE4A 1IM2A 5KPJA 3ADCA 1TQ6A 4B3BA 2RAPA 5FUWA 1XEXB 2G88A 3C15C 3SYNA 2CK3A 5JRZA 1YZGA 4LYAA 3AKYA 3CNLA 4NYJR 4Y0VA 3W5IA 2CE7A 4MGYR 4GOXA 5FPYA 2CCGA 3LBHA 2P67A 1E2EA 1IXRC 2IUUA 1P2TA 1KO7A 1JBKA 1R2QA 3QBVA 1KI6B 2JEOA 2IUTA 3QEOA 3IIJA 4FMCF 3L0OA 3AKCA 2Q21A 4UJ5A 3M0EA 4GDFA 1P6XA 2CL0X 2HYDA 2JIZD 4M1TA 3W3ZB 1G3IA 3PQCA 4TTPA 3KKOA 1X3SA 3SJZA 1HQCA 4HEJA 4CIDA 4KODA 1BH2A 3RHFA 1KI1A 4JLPA 2QMOA 4PC2A 4YONB 2YWHA 3E70C 2BCGY 5B57C 1L4UA 2OFWA 3GQBA 2J0VA 1CBUA 2IHBA 3GLIE 5JS8A 4OKSA 1E4VA 1W0JD 1YJ5A 5C18A 3WP0A 3ICQB 1ZU5A 1W5SA 4TMVA 2KWIA 2UVQA 3KUCA 3KTAA 4MKGA 2CCKA 2FGKA 4DSNA 4OK5A 3K1JA 1NL3A 1QG2A 2V7QD 1AS3A 4Q9IA 4BFVA 4ESHA 4NHOA 2CHGA 3UIEA 4ABYA 4Q7MB 4XTRA 5EP2A 3OZXA 2A2ZA 3Q5EA 2HCBA 3ETLA 3D3QA 5AUQA 3DDCA 4ZCMA 4TQAA 3WXMA 4M0LA 1AIPA 1KSFX 3AVWA 2BM0A 2NO7A 2R6DA 5HE8A 1Z63A 3VNUA 4DVGA 3HR7A 4NDZA 4DXAA 2V3CC 4Y0AA 2P6RA 4LHZA 5FR1A 1VPLA 1W4AA 3OIWA 1KZ7B 2ZIAA 3HR8A 2ZRAA 3U5ZB 1OV4A 1XJQA 4HI0E 4PSAA 4KO8A 3NBFA 5EUMA 3QPUA 4URVR 4A0GA 3QE0A 4TT3D 2R2AA 1OFHA 4GMXA 4TMTA 1NKSA 2X8AA 3Q72A 3CLVA 3LAWA 3BD9A 2XSZA 3VU9B 2XB2A 4LWZA 4FMBB 4V0MA 1ZW6A 2P2LA 4HAUA 1E2QA 1UKVY 1EWRA 3F0TA 4GOKA 4Z51A 3T5DA 3CWZA 4DBLC 5HPYB 2JLWA 4OHZA 1MT0A 3BJIC 5KUTA 2V1UA 2FJUA 3LD9A 1Z08A 3K0CA 3QF4B 4BEJA 1Q12A 4QGGA 5FOSA 2IS2A 4TZ0A 3DMNA 1ZUHA 4S35A 5KOYA 4TSFD 3QUSA 5JBQA 4M1KA 2LKCA 4NYIQ 4IXMA 5B64A 5DE3A 4CEIA 1KK1A 4LBWA 4JLKA 3QQ5A 5E95A 1JI0A 1E9SA 3RDPA 1R5BA 2OUKA 4B35A 1VYTA 3B85A 3RRNA 1VECA 1ZUNB 2ZSFA 5TDHA 1H8HA 4TN1A 4WXRA 4Z8XA 3VKWA 2RGAA 5F3WB 2G1KA 1KGDA 2RGGA 2AR7A 3EIEA 5BWMA 4HAYA 3VX4A 4D25A 2QM7A 2SHKA 4OQNA 1CRQA 1KSGA 2I1VB 3IQXA 1II8A 4DJTA 4MQBA 2W0MA 1W1WA 4AG5A 4CEHA 3ZVLA 1OT3A 3KL4A 1Q1BA 1GVNB 1K5GA 1R7RA 1VCIA 3LX8A 3B1ZA 4RJLA 1ZM3A 3U44B 3EC1A 1XNJA 4OI2A 1YZQA 2PX3A 4YXWA 2ZJBA 5IDVA 1XB2A 5H68A 2H8KA 3TVDA 1A4RA 4BPBA 3FHCB 4TZ6A 4DDVA 3QI2A 3DMDA 2W0SA 4S2EA 1KMHA 1FUKA 4QRHA 3VTKA 4PSVA 4D80A 1KSJA 2IX3A 4RSGA 1E3MA 1G3MA 2DWPA 5FTMA 1QHGA 3DKPA 2OO7A 3SI7A 4EQ6A 1GRRA 2P0EA 3ONWA 4LV5B 4DC9A 5AJVB 1G8PA 1ZMXA 3GFOA 3C7KA 4XVRA 1MO4A 3JVUA 3O8CA 1KZGB 3O8RA 1Z5ZA 4Q03A 1E2FA 2OFXA 1U9IA 2NPFA 1U94A 3GJ7A 4QGAA 3GLHA 3ZZ0A 4PC7A 2O8DA 4LYHA 1WB9A 1TNDA 2PJRA 3FKSA 5JJLA 1X86B 1NN3A 4C0LA 3KJGA 4O3MA 1BOFA 2YKGA 2ZAMA 4C0BA 3RAPR 4ASUA 1YZNA 1DO2A 2OEPA 5E4FA 1ZM7A 3LQRA 5EXSA 4LSGA 3I32A 5JECA 3MGCA 1DARA 2R65A 3RANA 3A4MA 2ZJ2A 3AKDA 3MWKA 3OEEA 1N6IA 2CL7X 4U00A 4AC9A 1ZNWA 2H17A 1MRNA 4UKDA 1LY1A 2ZYVX 1A2BA 3MRSA 3QKSA 2JCSA 5FTNA 2GCOA 2J46A 1EWQA 2REXB 2WWHA 3D6TB 4TMKA 1OFIA 2YINC 1ESNA 1O3YA 2PZGA 2ZREA 3I8XA 1OJLA 3CNNA 2JDIA 4DT1B 1U8AA 1MO5A 3H0KA 2WTUA 3KKNA 4IFBA 3BWDD 4D4JA 2FOLA 5EE1A 3A1VA 4CEJB 2V9PA 1SKYB 221PA 3BE4A 4FWIB 2ZPTX 1R10A 3PVSA 3DZ8A 4ZKDA 2N46A 1U8ZA 1EFRA 1KI3A 1TEXA 4DIDA 4I1OA 1F2UA 4JMPA 3TW8B 3KKQA 4M1MA 4LCBA 4Q00A 4GMDA 1P9NA 1UM8A 2XZPA 3U4QB 2QRZA 2OV2A 5BYJA 4L4UA 4DB4A 3MSXA 1ZNYA 4HLQB 3ECCA 2RGNC 1U99A 5BQ5A 4Q9HA 1PLKA 2GK7A 2WJGA 1F2TB 4HZUA 2OE2A 2ZANA 3BC1A 2OG2A 2Z6VA 4BRWA 1Z0IA 2QUZA 4B6EA 1XEFA 1S1CA 1KDTA 3NKVA 1Z0AA 2JA1A 4MKIA 5DLQC 2ZJAA 4AKIA 4FI3C 4IRUB 4KI0A 2VHJA 1C9KA 4BLTA 4BZPA 4BECA 3EASA 2F3RA 3QXSA 4DIEA 3JZAA 4JLOA 2NO9A 5FL7A 3I8SA 3NHBA 3GLFA 1T8UA 2BKUA 2J7PD 2Z4SA 4KAXA 1CEEA 3HJNA 2V6IA 1RYHA 3ICEA 4PAOA 3NVAA 3PG5A 3EW9A 3TUZC 2YV5A 1NMYA 1H8HD 2QE7A 4PZZA 1WRBA 2MSCB 5IF9A 1RJ9A 3ADBA 4OHWA 3L0PA 2UZ3A 4LJ4A 1UKZA 2GJKA 3GLIB 4QJ5A 4EPYA 2OXCA 4HLUC 3U7GA 5EE0A 3CM0A 1NF3A 2ATXA 5GJCA 4BFUA 1ZIOA 1U90A 1JQJC 4CF7A 1NY6A 2ZTSA 3PR1A 1YVDA 2EYQA 4XH9B 4PC3A 821PA 2WSSA 2QMUA 4WBSA 3S1AB 4DUGA 2OBNA 1WDTA 3P32A 2O8EA 4BZQA 3BS4A 5CJPA 1X1SA 4K46A 4V0NA 2VP4A 4X8LA 3QKUA 3RLFA 4WZAE 3B6EA 4TLDA 1OH6A 3SZRA 4GP6A 4I99A 4P33A 1NBMD 4F38A 5CK5A 1KTVA 4O2RA 1VCNA 1XXHA 4P4SB 4RD6A 2ODNA 1KKMA 4EFNA 2QI9C 4OI0A 1E9EA 2QL6A 2IYQA 1HQYE 1HYQA 2GF0A 3OEHA 1AZSC 1TPZA 1US8A 2OCYC 4DZZA 2LCFA 2RB4A 5B30A 1XD2A 4G01B 4C0HA 4MITA 3GEHA 3KQLA 1VDZA 4HUTA 4Q4AA 4FCTA 2KBFA 4QM7A 3WHLA 2AK2A 4Z1MA 1G5TA 1MO3A 3FKSD 4BWYA 2P6NA 3UK6A 3QPWA 1FL9A 4AURA 5D3MB 1FX0B 1VHTA 5D3QA 3A1WA 2ZITA 3EZ2A 4DKXA 4DCVA 2ZVQX 1CR0A 3BB4A 4C7OA 5P21A 3BERA 1P7CA 2WWGA 3QIAA 1SVWA 2ZYTX 1DAKA 1VCOA 4B44A 1FZQA 4OBEA 4LY6A 3OFNA 2CVHA 3OEED 4N0DA 1D8TA 3IKJA 5AJZA 4KSCA 3CR7A 1QHNA 5F98A 5KSOA 3EPLA 1G5PA 5JLJA 3RS0A 5J4LA 1ZM2A 1R4AA 4LI0A 1E1QA 1P5ZB 2VP6A 2XX3A 3UG7A 3A1TA 4AY2A 1N6RA 1Z29A 1IN7A 1ZVQA 4LGMA 2AXPA 2QTVB 3CZPA 2XXAB 4H9GA 2YC2C 2BIFA 4GZLA 3QXJA 1Z47A 2JJ1A 2ZI5A 3QJYA 4ARZB 5JJKA 4X8MA 2VL7A 3UWKA 1JEEA 4Q21A 3I61A 4B3CA 2N42A 2OILA
chains in the Genus database with same CATH superfamily
4TYQA 3NNNA 5T8KC 5COQA 3R75A 4D41A 2VP5A 2XB9A 4BIIA 1ID8A 1NBME 5ALMA 3GEDA 2A5DA 1L4BA 1R9GA 1U4NA 4REOA 1LCIA 3HA3A 3JQFA 3V48A 4UUOA 1JLHA 3MC1A 4BVFA 4DQVA 3LDHA 4S12A 3T5TA 4OP1A 4FCWA 5ALNA 1AVTA 4C5BA 1A7JA 4JJIA 5KJ1A 4ZV7A 1QTNA 1UBNA 3PFIA 1F9AA 3LA6A 4P4TA 2HMWA 4BBAA 1XGKA 4OFZA 3JRNA 1UINA 4Y1RA 1A9XB 1JVNA 3LPLA 2YDXA 4K9LA 2QMEA 2PNJA 4EY8A 3VNSA 3VSCA 5CX4A 1GNTA 2W2LA 5IU6A 2JKZA 3WLQA 3FUVA 1QGDA 3B1JA 1R4MA 3ETDA 5CG1A 3LXXA 3M2TA 4AQ7A 2VYVD 3F8TA 4DLWA 1JLKA 4FQ8A 4UNPA 4TLEA 2GRUA 4KOEC 2CXRA 2H59A 1T4DA 2OHXA 2G9QA 3GEEA 4FU0A 3TJZA 1NF9A 1U6IA 3QX7A 1ELOA 3E9RA 3P96A 1PD0A 1P75A 2QN1A 4HLCA 3CLHA 4R2WA 2YQ5A 5EPUA 3NG1A 2VP0A 1HFKA 4ZT7A 3VSAA 4CG0A 4HNRA 3B82A 1N2IA 3MCWA 4GLJA 4GP7A 4QLBA 5EHZA 2IS1A 2YYSA 3PIDA 1UBCA 1WZNA 4FMCB 1P2BA 1P1KA 3AJDA 1WF3A 5FOVA 1OH5A 4AMZA 4ER7A 3BGVA 2FUG1 3NIFB 4NFSA 3EZNA 2DBQA 4AZVA 1VLHA 1TOAA 4IJ6A 1D2MA 4PQFA 1W19A 4UM9B 1IQPA 4PLFA 2GF9A 2AH5A 3V2GA 4Z3OA 2FP4B 3GV0A 4RM2A 4CM8B 4PPFA 5DWDA 1V7CA 1OXSC 2ISQA 3UKOA 3KOUA 1SELA 1S6YA 2O3JA 3OPYB 1FS4A 3W4KA 1CNEA 5JT1A 3KHSA 2JJ8A 1O6BA 2BGNA 1JEAA 5KDDA 4CMIB 1T6XA 2FVYA 4DSAA 3O0TA 1P5RA 1P1IA 1MC4A 1NJ1A 1V11A 3U0BA 1FFHA 3TJMA 3MT7A 1RM4A 3W5UA 5AIAA 5ILOA 3DTVD 1POWA 2ZYWX 1KS2A 3TUIC 1L4GA 4RH1A 4LRQA 3IV6A 1KDRA 2C3MA 3R7NA 1PZGA 1P8AA 3FMVA 2D2FA 2OCBA 3W0LB 3O6VA 4CRWB 2H1VA 4GPZA 1W6UA 3SHWA 4F7DA 3JAMA 1WBBA 5JASA 1AQJA 1E58A 2I6GA 3U4CA 3P0IA 5GJVC 3QVWA 4GU5A 4MLDA 3SZLA 4FSHA 4PBSA 2JHCA 3Q7TA 2ZUVA 2X0FA 4YJGB 3ZWPA 1OH7A 2HJRA 1X7XA 1QCYA 3N70A 2CXOA 3NGLA 4HV4A 2DB3A 1JKJB 4V2UA 1SKQA 4BKMA 1RRPA 5ALYA 1JECA 4L2IA 3DE4X 4FGLA 1SC6A 4UPDA 1MN6A 2DG2A 3U7HB 1O95A 3DKKA 3JQGB 4J7UA 5KX5A 3EZFA 5AVJA 4Z0HO 2YIJA 3JVVA 3ZUPA 1E7QA 4PU0A 1OD6A 4MS1B 5D01A 2CXUA 5THXA 2J3KA 3OURA 3HY4A 4JI4B 1CP3A 1C0IA 3REQA 1B0PA 4OAPA 3NHWA 1MENA 1XKTA 3A25A 1UQTA 5IS2A 1YL7A 2HQBA 1BQEA 2WE7A 5DV9A 1YB7A 3GHHA 4B34A 2HNBA 4KPGA 2ECKA 5GVSA 2QL5A 1ZM9A 4YMSA 4MVJH 4HP8A 4LGVA 3ASYA 4AS2A 2ABWA 2V65A 4K5QA 2ZZKA 2AQ8A 3EZ6A 1HFWA 9LDBA 4POAA 1XWWA 5EPEA 1RXUA 1YV9A 4ZVKA 1CB0A 5DNVA 5K3CA 2ZM6B 4ZKEA 5JVDA 5CVCA 1RFGE 3L6OO 3MSCA 2NUBA 4QYIA 2XBLA 1YDMA 4BFCA 2ZCUA 4IDNA 4F60A 3QW4B 2IH5A 4H4EA 5EFZA 4CDGA 1P1CA 3KB8A 2I87A 3OOHA 3ET5A 4ZI5A 3W4JA 5BW4A 1Y6GA 2IHNA 2WJWA 3DW3X 1AUXA 1E6CA 1W52X 3FZEA 5EFOA 5I51A 2A0XA 4XYLA 4GNKA 1W9MA 1J7JA 3OEYA 4PG8A 3E7DA 2P65A 3BMCB 1SN7A 1VKJA 3Q1KA 2X7XA 3HC7A 2ZKLA 1U7PA 2I66A 2XJ4A 3R40A 1VTKA 3COPA 3TE6A 2ZUUA 1FRQA 5E1OA 3TQFA 4GPAA 1ZR4A 2Q1WA 3CLKA 2FEMA 2DH6A 2H9YA 2OMEA 3PFGA 1EJ2A 4WW0A 1F0KA 3HKDB 5IWCA 1HOTA 1C30B 1K8XB 1NVWQ 5K0EA 4PLPA 4BFZA 2AJ8A 3QF7A 4LXTA 1UC9A 1E0KA 3NHKA 3D3WA 4JU8A 2VN8A 3ZXXA 4AKEA 3KHKA 4KKXB 1L5WA 5JJBA 4A03A 1VPVA 3HKEA 4M2LA 4UVDA 4D43A 5FWXB 3TQRA 4WD3A 4MW4A 4Z86A 4DGSA 2BH9A 1LPNA 4ZAGA 3TLGA 5HM8A 5KX5F 3FYSA 2R6FA 1ZQ1A 3U13A 4L57A 4HRXA 1NFFA 2C98A 2W42A 7MHTA 2POCA 1SCDA 1UJMA 2WHYA 2YV1A 4JC0A 4F1WA 3I1YA 2GA8A 3C24A 4NAUA 1JDBB 2W2LD 3EIOA 5CFPA 3DOIA 5K0TA 1P7ZA 4L0QA 3EYAA 3USCS 3HYRA 3GJXC 2XOXA 1ODCA 1X80B 1D6NA 5EMMA 4INZA 4RGVA 4KW7A 1LS6A 1QGYA 2ZI3A 1QH8A 3I2IA 1MQAA 5GP1A 1C8KA 1QG0A 3KKPA 2VDJA 2XMRA 2UKDA 1CE8A 2WVGA 1COWA 1HFEL 4R0NA 2FZCA 2J31A 3O91A 3IOYA 1BTOA 1J20A 5TR9A 4QICA 2J8ZA 1U98A 1SUWA 4UATA 3MCTA 1L4HA 2IYTA 2IZOA 3UH0A 4JDUA 4WESA 4CF5A 3G2LA 1O0CA 2OGUA 2GASA 2ALJA 2QGFA 4UARA 3G9UA 3TSOA 2XH8A 3E8XA 2NQTA 5CIQA 5FI5A 3LW8A 1U8FO 3NAQA 1B0AA 5K4AA 3RS3A 3TLAA 1JV2B 2IJGX 3A4IA 4K6OA 1VG0B 1ZGHA 3FIJA 1F8YA 3OZTA 1UXJA 1XQYA 4NBRA 5SZKB 2XI4A 1CEQA 4LMRA 3BIOA 1CF9A 1UK8A 3UCFA 2G80A 5K9ZA 1AQLA 3IBSA 3UPDA 3LTNC 1YQEA 1K6JA 4YCLA 1VMEA 4MB6A 3ZWVA 3MS7A 4KYUA 2BDUA 4ZU3A 4DTCA 3VGJA 5K1ZA 3W06A 2YHAA 2YMQA 4IDHA 4C6TB 3OQIB 4F45A 1ZI8A 1YS2X 3Q2KA 3ZU6A 2EG9A 3TCNA 1J5XA 2NM0A 3WYFA 1USUA 1V6CA 5AVXA 3O95A 3G02A 1Y34E 3OZAA 4G5QA 1KPHA 4H4DA 4RGQA 1PV1A 3REGA 2ODEA 2P3OA 1NM5A 4J3FA 4KHZA 4PR3A 3UY4A 2FPMA 4GP9A 4LOHA 1TM3E 4X6UA 4E7PA 4EKYA 1U0SY 2VJNA 3TLYA 3B51X 1QAQA 4X20B 1D2HA 1TFUA 2IEYA 1JIUA 1SB9A 2J5QA 2JFFA 2O2YA 3NHYA 4I3FA 1NLYA 1T36B 5AT1A 4CETA 3IP8A 6YASA 3LRTA 3KHUA 3P9KA 3CUSA 1EEXB 1KFJB 4OUDB 4E3ZA 2BEUB 3FWHA 4Q1BA 2IYYA 3CZQA 2OAQ1 4F72A 3EY4A 2O0MA 5JI2E 3ND8A 3IODA 2JLZA 1SPBS 2Z9CA 4KQIA 4OATA 2FG7C 1XP8A 2HLDD 1EDBA 1BKSB 5GY7A 1PFVA 1CR4A 3LC7O 2I4MA 1ZD9A 4PRYA 5DM4A 3STYA 2FSSA 2NVUA 3ZOZA 1D5CA 2XWBF 3N8KA 3A2NA 3ASVA 4RVOA 4S3MA 1ESEA 2W83A 2PPVA 3I9MA 4EQ6B 1BWPA 2XNJA 3N7AA 2I7XA 4TZTA 3LK7A 2FH5B 3DCYA 3SC2A 1VIVA 1GLNA 1RHRA 5LJLA 1DMRA 5HVNA 1KKLA 3PGMA 3H1TA 4F5DA 3MTEA 3QEMB 3MS2A 5D84A 2PKXA 4L9WA 4G1VA 1BAPA 1SUIA 3STHA 2GPWA 3MAGA 2PZBA 4OOEA 1NRXA 4YMWA 1LQTA 5LQJA 1SZPA 1KI2A 1M7GA 1IH8A 4Q18A 4ENUA 3Q10A 3KQNA 2FFJA 3KFXA 4OMCA 1OU0A 2EZUA 3PEWA 1LV8A 2CEKA 2G5TA 3GGDA 1C50A 2ZU0C 3QFTA 1J0BA 4H1VA 1ODIA 4WECA 5I9BA 3UTCA 4BNDA 5B6IA 5ERXA 2JBAA 2OQIA 3SLRA 2GN9A 2A59A 5E3HA 3JYOA 2PRYA 5GADl 1GOTA 4RBNA 2X0KA 2ZUCA 2C2WA 3HN6A 5BR4A 4LFBB 2VSNA 4BOYA 1Q84A 5A0VA 3LXMA 4DNQA 4RXUA 4TTQA 3FOFC 2W6OA 4QA9A 3DFKA 3GVCA 4LKRA 4MYTA 4O29A 1AZLA 4B2LA 1KWGA 1P4SA 2EP5A 4MYRA 2YN4A 3VNRA 2C82A 2XUZA 1P29A 1Z8HA 3O31A 4PQRA 4AZWA 1MOSA 2WW8A 3UAWA 4JBYA 2PT9A 2IYOA 4AYWA 1GXSB 2WABA 2A9FA 4WTOA 3RNOA 2NU7B 2PIAA 2P5TB 2PMFA 10MHA 4YT2A 5A0FA 3EMBA 2AMJA 1NI3A 2D3TA 3SF0A 1T3LA 1FXWF 3U9SA 3OVMA 5IBRA 5E9AA 1ONBA 1QUFA 1UXGA 3OPMA 4NEGA 4RELA 4ARSA 3MHTA 2R6ZA 1UC5B 2IXDA 2QVBA 2VCYA 2E4UA 2DYKA 2AFRA 1ZCAA 4OXXA 3MWEA 1XTSA 4UHDA 3VKVA 1U3TA 1SCKA 3X3HA 1NBAA 1XZIA 1TF7A 1YSCA 2X5XA 3EWSA 2BBSA 1PJSA 3JALB 4PYNA 4CU2A 3KKKA 3K4QA 1GQRA 5DHRA 3TMYA 4Q3AA 3TW0A 3K6RA 4L9SA 2XCRB 1OHHA 5FUYA 1YU6A 2BGTA 1QYWA 2GUWA 2OBYA 1T8YA 3VDNB 4BFTA 4ZEXA 1QPBA 3USZA 5T6MA 3EA0A 2WB2A 2QJOA 1D7OA 5BUQA 4V1CB 1TJ3A 4LWQA 2RDMA 2V7GA 2CLIB 2PBFA 4EMBA 2JAQA 4R1MA 4OHXA 5ADWA 3UA4A 1W36D 2YV2A 4B33A 3O4JA 3GVPA 2BEJA 1NJ6A 1G64A 4TL9A 1I8TA 5HZMA 2IUSA 5IHPA 2XKBA 1PQYA 2C0QA 1VJDA 2CJFA 3PPIA 5DRTA 3F4BA 2Q7OE 2BWJA 4XFJA 1A5ZA 5MN4A 3H9UA 4MPTA 1FOEB 2C96A 2GBFA 2OBMA 4ZYTA 4BE7B 4E11A 2XEXA 4UZFA 1M6VB 1XNQB 3QLUC 2IYPA 1T15A 2P91A 2PKWA 4KDCA 1ORDA 1QJCA 1Z82A 1SM4A 3ZKWA 2XAUA 3KZOA 1JNYA 1JTEA 2VPQA 4NPHA 5IVIA 4QUAA 2Z57A 4BVEA 2CJYA 4MLCA 2FEOA 2QMZA 1TJYA 3RU2A 1PL6A 2CK3D 2YV3A 3ID6C 1ULUA 3NIBA 4JZKA 4OB8A 4RKRA 3VOTA 3L2OB 4PC6A 4ZOBA 1NJ2A 3P0HA 5AW4A 1M2EA 4BBZA 5EVCA 3I9JA 4HNHA 3AM5A 1T5LA 4XSVA 1M0WA 3ESZA 3QE2A 5CNIA 4Z9FA 2FDRA 3DZCA 1YZ3A 1CIVA 1N2CB 4IL5A 4A0RA 4ETIA 3TFWA 4WSOA 3SK0A 1UK9A 3FM9A 1YWGO 1N6PA 1R9JA 3I5UA 3TR6A 2Y66A 5CEJA 2FWBA 4Z4IA 2HCFA 3OCCA 3R0VA 2W2NA 1EKXA 4QASA 3VQTA 4E09A 3F3MA 4OHPA 2J0EA 2C8JA 4JUAA 1R8XA 3EH1A 1C7ZA 1XZFA 2WY2D 3OCZA 1UOOA 4RYDA 1V9CA 2I2DA 3WK6A 2IOFA 4FLFA 3Q6MA 2V6MA 3K9HA 1GRCA 3O75A 4LE0A 3KQWA 4F4UA 1CB7A 2IF0A 4MVJM 4JBGA 3FX2A 4RENA 4RNCA 1RQ7A 5ALTA 2OO3A 1LRKA 1HR0B 3M6UA 5CNKA 1WWKA 3IMCA 2RKOA 1ZOIA 2ZK7A 1JZTA 1OU4A 5JI3E 3PC6A 4YGYA 4HB0A 4MUNA 3GLGE 3F4LA 5ALSA 5CLQA 3SX0A 1HO3A 1DLIA 1V47A 4LISA 2QX6A 1G3RA 4WERA 1B6SA 2GFQA 3WLJA 1XTZA 1JG6A 4KYIB 5J40A 4GICA 2I7VA 1U04A 5DT9A 2QQGA 4V02A 1LBSA 2HIAA 1RWBA 3ROEA 2TRSB 3VSEA 4RGYA 1BE1A 1R6UA 2JASA 2OFPA 4LZPA 1UWLA 4BKUA 3S2SA 2WF7A 4PXYA 4RORA 4BE4A 4EYGA 3ODGA 3FMPB 3P0EA 3QU2A 3IKTA 1C2TA 3SE0A 3FPHA 4GM1A 2IY9A 3BDIA 4ZGGA 2Z6QA 2FPIB 2GAAA 4C4SA 4R1OA 3L1KA 5CW1A 4HX5A 3LF1A 1QFXA 4C7XA 5J5VA 3RRJA 3AY7A 3MCVA 3HI6A 1MZPA 1G4AE 4RZ2A 3I2KA 1Y98A 2V5AA 2QPAA 2BEVA 2A0YA 4RLQA 2IYNA 1Z83A 2HMSA 4Q4HB 4Q9NA 1HT3A 4D8YA 4PCUA 1QZXA 2FW7A 4JGGA 1VXRA 1PSWA 2K5UA 2IIVA 3PC4A 1B74A 3FJ1A 4LRYA 4BMPB 1H05A 4FSXA 3ZWQA 1E6KA 5K8UA 2GZDA 3LG2A 4FFNA 5K6AA 3V4SA 2DFNA 3U4DA 4U8HA 4WN9A 5C5IA 1TD1A 3STWA 3D1LA 2INGX 1BCRB 4FM9A 2EARA 1GPUA 3OC0A 1YHNA 2J32A 3SC3A 5LC1A 3MB8A 3PXAA 3TSZA 4U6SA 3ACDA 2PD6A 5E9WA 1M2WA 3RSZA 1T4GA 2I65A 1GTG1 1GITA 2H3HA 1Z5WA 3ETCA 4MUFA 4NCXA 4DIKA 4ALNA 1O6FA 3UOGA 4Y6RA 3BMNA 3ULKA 4CI9A 4JLBA 2WZBA 3OH8A 4PLWA 4BX3A 1STOA 2GXUA 3BMQB 3QY0A 4DF3A 3S2UA 1PN3A 2QDKA 4HOYA 3DUFA 4W8HA 3AR2A 2GLXA 3H8JA 3C6QA 3ABRB 5TF4A 3ZHSA 3AQIA 4FE7A 2O8BB 5FOWA 2D6FA 3FUUA 3ANLA 1H2YA 3GRZA 1WIWA 4YDHB 2P9ZA 3ROMA 4OSPA 1T0PA 2L17A 3Q3IA 5BT8A 3DZJA 1P91A 2AR0A 2QZSA 5J2UF 1E9AA 1TCVA 2P5SA 3ENKA 2ZWMA 1BROA 3KTDA 1C80A 4LZAA 5AKEA 3TR5A 3WY9A 4E5UA 3X1DA 5JAUA 1CFJA 2SICE 5I7FA 4KBYA 5FPKA 3E22B 2W2XA 4XE5A 1G7SA 4TS3A 4YRPA 5CDGA 4OLBA 1OHHD 1OKKA 2DQKA 4AJNA 3BB3A 3MJTA 1AKRA 1HXHA 1K7YA 1K08A 2ZJ6A 2HXSA 2NUPB 4PZ9A 3U37A 3UWMA 3AU8A 2ZUFA 4MHSA 1VG8A 3HGMA 5DMXA 1GG9A 5FRDA 1PDOA 3U9TA 1LB1B 3EIXA 2C2YA 3FMIA 3SQOA 4HWTA 3BRQA 4JR1A 4MLZA 4RVCA 5JR3A 3O3OB 2WFMA 1JHOA 1M1NA 1PW5A 1WZEA 3DQPA 1OYVA 3GHYA 3HBAA 3LUDA 4IZOA 5DBOA 5EN4A 3EGDA 5A7GA 4HMQA 4G5RA 2PO5A 2CLDX 4LEIA 2NO4A 4UFNA 5DH9A 2JHFA 3SQDA 3ZPXA 3BJZA 4LF8B 3PHHA 3EFEA 2PKEA 1J0AA 2F1OA 3PGVA 2C2BA 1MR3F 3JCZA 4MV9A 2X0DA 4ZREA 2YVKA 2IU0A 1PE0A 3FCSB 1KFCB 1Z3IX 4IS2A 4RSHA 2VPXA 4WLOA 5DKFA 3L8FA 3ZLUA 3NNSA 4TYPA 2B37A 4LDAA 1UEIA 3LZ6A 4D2IA 3F5SA 1IMJA 2BJWA 2WU4A 4MIYA 5T4HA 4QHTA 4TRRA 4GC9A 3U9LA 1SCUB 1KO5A 3HCPA 4MRSA 3X0DA 7ADHA 2XDAA 4AB1A 2IYLD 1WAMA 1Z4OA 4HVAA 521PA 4HLUA 1N2GA 3E48A 1X9GA 1RE0A 2WAXA 3HMQA 3WGYA 4Y9UA 1SXPA 2QZPA 3N1UA 1VHWA 3VC7A 4HLNA 4IDEA 1Z0JA 5H59A 3NH9A 4C0JA 3TG2A 5ALXA 5K0JA 2ZUWA 4W5RA 5JZ9A 3PC7A 4QQ8A 2FUG6 1KAMA 4CR6A 3ER9A 5IAGA 1X1TA 2F62A 2B6NA 3IEXA 1YQGA 5BO5A 4HDMB 4QPCA 4QQRA 5JHHB 1I36A 4Q15A 2CLEB 4QZVA 1I3LA 1JB9A 3HVIA 3L0DA 4QSHA 1OCEA 5C53B 1UEXC 4IJUA 4KIFA 1PQ4A 2R85A 4XIYA 2WRZA 5KYUA 4D3FA 3OOJA 1FK8A 2D2XA 4GZMA 4DT1A 1NVBA 3QXGA 4QGHA 2ECFA 4MVCA 4REQA 2YWDA 4DJDC 1GYPA 3FRJA 5JQWA 2A7XA 1IAQA 1BKDR 1H2FA 1PS9A 1RLJA 1FRFS 2GBLC 4U3JB 3BL6A 1BXZA 6GPBA 2B35A 3AF3A 1T3TA 2XCSB 1WV0A 3IT1A 5H80A 5IAOA 2FZ4A 4DSOA 2WIAA 2NUTA 3TW8A 5I7UA 3HXKA 3WNDA 3CO0S 2A1UB 1IOWA 1ST2A 4ZV4A 1G16A 4LS3A 1WM1A 4I5DA 3WK8A 2ZRFA 2I2FA 3SJAA 4RHFA 2JDID 3U5TA 3I83A 3RUFA 1LDNA 1SUCA 5EUBA 5G4KA 3DOUA 4ZYZA 3GRPA 2YS6A 2QMYA 4XWGA 4IXNA 3ELUA 3LT2A 2FTKE 3L6BA 4UHEA 3D6FA 2JJMA 4GI3A 4YCBA 2Q4OA 4LDZA 3PI7A 2C7RA 2FJPA 1GSOA 2YTZA 3F7NA 5A4MS 5BURA 3KWFA 2BVNA 2WAAA 1LQ2A 1SKAA 2P6OA 2BF4A 2ENUA 3R6DA 4K6GA 3CMMA 4N49A 2JA2A 3JQAA 4DA0A 3A2LA 5BWLA 4BGDA 1ORIA 5I8PA 4I5IA 2DMRA 2OB2A 1OAOA 1OAKA 2XMQA 3FSRA 4I9NA 1DRUA 4OHYA 1B43A 2I4TA 5IHXA 1NFQA 1XCJA 1TT5A 2G0TA 2GPTA 3SJ7A 3IBFA 2JARA 4YMGA 5DNYB 4LK2A 1MAWA 2O2IA 2DWQA 3HWWA 4JLNA 4HQLA 5K0SA 3HM2A 1RRGA 1ZIXA 1QH1B 2ENWA 2OKCA 3KU4A 4K6MA 1T9AA 3EIWA 4G8BA 1PEAA 5FOQA 2CSUA 1F2VA 2XDQA 1F3OA 3T9FA 3DBVO 4DCPA 5JW6A 1ZL2A 5AO9A 4FS3A 4AWAA 1DCTA 1E3TA 3RASA 2PS1A 2WQZA 5DXJA 2XUFA 1SUDA 5C35A 1J5EB 5C5EA 3RRYA 5IKEA 2IZ1A 1WY5A 2HA7A 2LPMA 4WY5A 4DQLA 4RTPA 2WDZA 3AL3A 3MBIA 4B7CA 2NO1A 1RBYA 4MVJG 1JU4A 5KPDA 2DKFA 3YASA 3J81k 5HHTA 5IH7A 2P7IA 2P7HA 4TKLA 1L7PA 1FQOA 3HDVA 2RJOA 3EG9B 1PJCA 4EVRA 3D8NA 1OKKD 3G79A 2C7QA 1HMYA 2N1BA 4A6PA 3GLGB 1QK5A 3JQQA 4JX8A 1YCDA 3SC6A 2Q7XA 4D45A 2UXDB 4XCXA 1FBNA 2GAFA 4YWHA 3W90A 2FU5C 4EJSA 2FN9A 4B84A 1B76A 5D8DA 1DAOA 4D8WA 3LBAA 2JAPA 2NO6A 1X1BA 3GFSA 4L5CA 4KXNA 4M0CA 4YV1A 3H2ZA 2QN9A 2ORYA 4PFJA 1THZA 5A9RA 2H00A 4DQUA 1HZJA 1WS6A 2JIRA 1NN5A 4DR7B 1H6CA 5DT2A 2WTAA 1KI9A 4V3BA 1JYSA 1NR7A 4MWTA 1OYYA 1RP1A 1NP6A 3H4IA 4DDWA 1KEEA 2QAGA 3TSWA 3UMYA 1QO7A 2DBRA 3C0KA 4KWCA 4QTUB 5L7WA 2ZWAA 4Q01A 4KPUB 4ZO9A 5BNWA 1QK4A 3IVXA 3GNSA 3R3SA 4PSUA 3R8CA 1ZKDA 1ZIDA 1VP9A 4L72A 3H3XA 4PONA 5EIAA 4DSTA 2JAHA 3SBEA 3DLPX 1LRLA 2GK6A 4RJKA 3TL3A 4DLKA 5U4XA 4CMAA 2XQVA 1SXIA 1Y3CE 1PNOA 5EOVA 3I1FA 2WWTA 3K4HA 1LF5A 2CBZA 2VSQA 2FZKA 1G9SA 2GEVA 5J5AA 4WKOA 3KB2A 4BO2A 1SD1A 2HA4A 4B4VA 4UEOA 4M46A 2C5HA 4L9AA 1SBNE 2YJ3A 4G1MB 3PQ5A 2B4YA 4F3KA 5J5CA 2APJA 2WJHA 5I8ZA 3SNHA 3ZXUB 2HQRA 2CHFA 4BMYA 3EDYA 3CF2A 3QUCA 4LPKA 1QUEA 1QP7A 1JJBA 1RRFA 4M9XA 3PNPA 3RU3A 2VYCA 2H2FA 1C4XA 1YJCA 2G40A 5HIJA 2FX2A 1P2GA 2L2QA 2Q8PA 1N2HA 3JRXA 3A6KA 1ZHOA 1A7UA 5B37A 3RYHB 2ZZMA 2V7QA 4C0QC 4NZOA 5ER9A 4CQNA 4MGKR 1X1RA 5THQA 5CXUA 1JHAA 1J09A 4EI7A 5L95A 1LDBA 4GE0A 5J4YA 1D0IA 2QLMA 1P77A 4Q19A 1DU4A 3GQBB 1FDIA 1NXOA 3QH4A 1Y4ZA 1WMDA 4NP6A 4IIDA 1VRVA 2ZIGA 4EHBA 3ITNA 4HK4A 3CKLA 2F00A 2H92A 1T9HA 2HPHA 1N7HA 4LY9A 4TS1A 5C4GB 4R84A 1UADA 4TTAA 1BG6A 2ETVA 1XMVA 1IQUA 2WLTA 1DKLA 1MNAA 4AUNA 4TWJA 1Q6ZA 4IKEA 5K3EA 2VZ8A 4YBZA 4XQ9A 5LQKA 1IG3A 1XMPA 2R62A 2XF8A 4UQPA 4YQYA 3WO0A 3B53X 1XQVA 4UDOA 3G6WA 1J2UA 1ILEA 2V6BA 4YQEA 5J2TB 1WUHS 1FY2A 2VP9A 1RHUA 2DPHA 4FFDA 4I55F 4M86A 4LSZA 5LP6F 4PLCA 4D0NA 1YKSA 2DUWA 2EBUA 4KNVA 2HRRA 5D1NA 1UT5A 4CQMD 1XPUA 2D54A 5LDHA 4YWJA 3J81A 2Y0CA 4BEBA 2G1JA 1GPDG 1QX3A 4LTMA 3SXJA 2CL6X 3G5AA 1JXOA 2G1UA 2HLHA 4U6QA 4FMDF 1CQIA 2DSTA 2KE5A 5FBQB 4E6EA 1W36C 5BWCA 4AWXA 4AF7A 3K2QA 3ZCRA 2VLBA 3LP5A 2GCPA 5EXTA 3TNFA 1GZ4A 3ELDA 2WTBA 3LOQA 4Q5IA 3UJ6A 4XWWA 4EO7A 1RWPA 2AJDA 4PLYA 3SVLA 1U2TA 4DUYB 3L8GA 3CO5A 4Z99A 1XZBA 1MQ8B 5CLFA 4WLNA 3FNGA 1T4BA 4EWLA 2P35A 1FRVA 2BGJA 1I3CA 3AU9A 3DZIA 4O8CA 2PMKA 2G7MC 1W0CA 1WD5A 1WVMA 4O6VA 4YR9A 1NLFA 2PRSA 4FJ2A 3WFZA 3R3UA 5EEHA 2PFKA 1NSTA 4KMOA 1GQ2A 4L85A 1H0KA 4D56A 1BWRA 1RW4A 4J1NA 3ZTWA 3N2LA 5K01A 3P9YA 1A7AA 3DOEA 3P97A 4WFJA 4UAVA 2YRFA 3ZD6A 4C0KA 1SMKA 5E6UB 3HDYA 1A8IA 5TS2A 3RWBA 3SDBA 3HCWA 4CGYA 4Y2SA 3SS7X 4DIUA 3FVQA 5I4IA 2GKOA 3NAZA 2IXFA 3L7JA 4MUJA 2X3FA 3SFZA 1Y8QA 4BLUA 2ZRIA 3NTRA 2OLEA 1U6KA 1VBNA 2ZXFA 3Q3JB 2BGKA 5G0VA 4KQFA 1NM5C 1SQ0A 1Z17A 1GPLA 2IU3A 3DT9A 4ZWNA 3ZDRA 4XYBA 1U2PA 4FNMA 4QJIA 4NMHA 8OHMA 1BVHA 5IWAB 2I8CA 1MKYA 4PYLA 3TXAA 4QSMA 1IPHA 1ZIPA 3BRCA 4C06A 1TTPB 1U2RA 3IAEA 1II8B 1ZNZA 5B3KA 1EX7A 3T3HA 3WSTA 2B5WA 4UTRA 2ZJ1A 1JE0A 3Q9LA 4P84A 4IHJB 4W5WA 5JJKA 4BASA 4LSWA 1ZGGA 2VDMB 3FSGA 4YREA 5D2CA 3FDIA 2VWPA 1SU6A 4NBNA 1W49A 1Q7GA 4L0DA 4DMMA 3L18A 1GZDA 1L8AA 2QF7A 3RW9A 3LP6A 3NONA 4FC7A 4O2LA 4MGZR 4ZGBA 3UAYA 1CUCA 1RXSA 1GUAA 4R1TA 1OT5A 2VJDA 2HTFA 1H8EA 4QTTB 3RTEA 3ILSA 4G65A 1BNCA 1KXZA 3HM9A 3KAKA 2AD1A 5KTYA 4MEAA 1P44A 2I2BA 4FHZA 3PQ8A 4FTWA 4B76A 4YRZA 4PG7A 1UPFA 2B8WA 2V98A 4H6VA 1SC1A 3ZWNA 3VKGA 1T2FA 4BVJA 1R8YA 2JLBA 2CVPA 1R3UA 1V3QE 3BWVA 3I42A 4KQHA 4TM7A 4AKHA 3FFBA 1KMHB 3N0XA 4LBYA 1DEHA 4CG1A 4MW9A 2HU7A 5AJWA 4Q7QA 1NIPA 2VJMA 3OM8A 4G81A 4N3NA 4BPRA 2MWMA 1S2MA 4BQIA 2VXOA 1OZGA 2GD6A 2AI1A 1WBJB 3EVZA 4XDGA 4H77A 4N18A 3EXFA 2IWHA 3T06B 1D9XA 4AN0A 5CX1A 4R81A 2JC3A 3A1SA 4UMVA 2X86A 1O94C 1ULAA 1DIGA 1I1HA 2YUIA 3CZ4A 4P3NA 3C4JA 4D82A 3SQWA 3CSSA 1QCZA 4CKWB 3F3SA 1MAAA 4W82A 1AD2A 4MINA 3EBLA 3ZHUA 1I01A 3AVOA 4KH0A 4YDSA 1GUFA 3KKMA 3RHTA 3H65A 1N5MA 3RAJA 5ALQA 4IUCS 4OGWA 2ODAA 1DXYA 3OC6A 4TGLA 3KE8A 4Y30A 5IAEA 5HYVA 1T5DX 1VCMA 4MMYB 4TLLB 5L8VA 4RHUA 5JFGA 1SOWA 3O83A 5DASA 2F1IA 3RAGA 4DCUA 4E70A 1T1JA 1H4QA 2YJ6A 1Q83A 1I7LA 1G5HA 5CXXA 4D4MA 4DJAA 1MTZA 4UPVA 4H1TA 3L4BA 1W8DA 2ACWA 2AX4A 4G0UA 3CW9A 3CONA 3DNMA 3FYUB 1EESA 2WVAA 4Y2HA 2WFLA 1VSUA 1M2OB 2XNSA 1ORWA 5EESA 5KNLA 1IONA 3UTDA 3E3NA 1XTRA 4JYMA 3DHYA 1F0PA 3OT1B 4OGGA 5K3FB 4Z54A 3QKSB 4G0QA 4L8LA 3V32A 1HDOA 1JYFA 1PT5A 2E85A 4P82A 3VH3A 4D9KA 4DZRA 8MHTA 1OIWA 1ZXXA 5G1OA 3WLPA 1KZ9A 1RI5A 2HQSA 4P81A 2TMKA 3FDJA 3QBEA 3DV0A 4I4NA 2D0DA 5HZKA 3L3BA 3K2IA 2BZSA 5EMHA 3ZE6A 4C78A 3WZLA 4BLSA 4LJKA 4UNQA 4URZR 4OHUA 1EFPA 3TRJA 1U63A 1G291 2C5SA 2GBGA 4KVFA 3SXPA 4V0SA 1FUYB 1EYZA 4D9FA 4DGQA 4F86A 3ROXA 4KK3A 1KSHA 2R4UA 2RGWA 3E8MA 3KOXA 4F1JA 3N59A 3KNZA 3JXEA 3PJEA 4UBOA 1DUSA 4BTVA 1LS1A 1QZTA 5JXGA 4ESVA 2IX9A 1MH9A 1VC2A 4E22A 2IF2A 5JS1A 5ESWA 5C0OE 4G0WA 1B93A 4FX2A 2Q3CA 4X1KA 1C8BA 1NUTA 1F17A 4D6PA 4ZDIA 1UP4A 2GBCA 4ALJA 1LTQA 1YRYE 4IDOA 1JR6A 4KPYA 3THXA 4XX1A 1X8JA 3DAFA 4RPHA 3CF4G 4Z1OA 5ICCA 1P45A 5L3VA 4YMTA 4X66B 1XCPA 3DL7A 1Z16A 4OHVA 5JFOA 3TQTA 4RAQA 1ZNXA 2OWEA 3DJFA 3KAQA 3BTVA 1S1MA 3GUUA 5HQ3B 1SRRA 1ZC4A 1DEOA 4NCKA 4L28A 4R69A 5CVDA 5LL6P 3O82A 3PV0A 2QRNA 3R7LA 1EX9A 4QIHA 2WP8J 1XK6A 1G8FA 2OM2A 2P40A 3UJ8A 4EF5A 1J7KA 2FG6C 2OO5C 3ZI0A 4EG1A 2IUFA 1TZKA 4ZFNA 5KC9A 4PGFA 1E1MA 4RY9A 5CJ2A 1KGSA 1P72A 4AJIA 5ADVA 1Y5NA 3PNQA 5KYWB 1CQXA 4X6LA 2M98A 3TDNA 2DPMA 1NG9A 2AUTA 5K8IA 1C3JA 4Q0MA 4NMLA 4LG1A 3DCNA 3H6GA 4I50B 3HCEA 2ZT7A 2Z2IA 1GTMA 4QUHA 4N5MA 2SKEA 4IDDA 5CPBA 3TTUA 1DEXA 1L9XA 1UC4B 1RBMA 2NU8B 1DC4A 1N2JA 5HUHA 1L1QA 2W22A 1ZS9A 4US2R 1MHPA 1UKEA 4TL8A 1NNLA 4MYHA 1EVKA 1W47A 4N7BA 1NBIA 1NXWA 4OGKA 2PR2A 5BNFA 4CKZA 3RYCB 2C99A 2QN7A 2DE0X 3EW7A 1JH9A 3UWPA 3VR0A 3PQ6A 4YRLA 4BAZA 4QJ3A 5A4DA 3PFKA 4MP6A 2CZQA 3EPJA 2PU7A 3T7TA 2JANA 3ETNA 3GN1A 2V6JA 3EZYA 3IMGA 5EZQA 3ZHZA 5IYZA 1TTTA 1WCYA 3G5MA 2GZSA 1ACJA 1NKVA 3Q2OA 3BIXA 5J1SB 1HMPA 3PFFA 4Q7LA 4OA8A 1V1RB 1H8ED 1IRIA 4TUYA 2QRVB 1DQPA 1KYZA 1KYYA 4LYJA 1AY0A 5ARCA 2ZIXA 2I78A 4WT7A 3ROTA 3G8DA 1OLSA 4ZVMA 4ID9A 3C6KA 5HMLA 1GARA 3ZR4B 1R6AA 5KQMA 1JBQA 1FQWA 5L9AA 4BAGA 5CLJA 3MFYA 4ZRDA 3D0RA 3DKRA 1HV8A 2ZRHA 3R44A 4YAEA 1M2HA 2C3OA 3ZHBA 1KF0A 2OPBA 2QTGA 1CJCA 2FGJA 5C34B 5EWLA 1MC5A 2ORVA 2CUZA 2I76A 3A3YA 3IQEA 4N5IX 4RD0A 1P61B 1EQUA 1CHDA 1D4ZA 1WPQA 5A3VA 1Y7PA 3KSMA 2CVQA 1XRMA 4V0OA 5IJAA 2GZRA 4EGQA 2B9VA 3WYGA 1I4DD 4QOEA 1Z28A 3I5XA 1GAJA 5AVWA 1T5TA 2C4HA 4EJMA 1FP6A 3JQ8A 1ZHFA 5JD5A 4PVDA 3Q0EA 1PLLA 4M76B 5F73A 5LXTA 4AP5A 4HGOA 2QRPA 5KQPA 2KW5A 4RXTA 1S3GA 4DHEA 4PYMA 5HKLA 1XNGA 2FQYA 3RUIA 3T4EA 3WVNA 1XSEA 4ZQCB 1T34A 1SA0B 2P2ZA 4GNRA 1ADGA 1YRLA 2G36A 3J7TA 1G9XA 2PEYA 1WQ1R 4FZ3A 3UGJA 1LNQA 1ZMOA 2JFPA 3HYCA 5TVKA 1C3XA 4BFSA 1JTVA 1YU9A 1IEVA 3JD0A 3DAHA 5DSZA 3D6AA 1EFKA 2ZWOA 4GR4A 1XCGB 3TQSA 2UXBB 2DHQA 3IMFA 3LFUA 5HF5A 3FTCA 4YRRA 1U0JA 2BM8A 4IAOA 1L4FA 3G2JA 4F3TA 4IVRA 3A1DA 5B58T 4JVOA 4D8TA 3LUPA 4E2XA 3NP7A