1R10A

Cystic fibrosis transmembrane conductance regulator (cftr) nucleotide-binding domain one (nbd1) with atp, i4122 space group
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
280
structure length
264
Chain Sequence
b'GIIMENVTAFWEEGFGELLEKVSFSHLCLVGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGRVSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSELQSLRPDFSSKLMGYDTFDQFTEERRSSILTETLRRFS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cystic fibrosis transmembrane conductance regulator
molecule tags Transport protein
source organism Mus musculus
publication title Structure of nucleotide-binding domain 1 of the cystic fibrosis transmembrane conductance regulator.
pubmed doi rcsb
total genus 90
structure length 264
sequence length 280
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1r10A00
2V8OA 3TBKA 4U00A 1T0JB 3QVVA 3P26A 3RS3A 1E0AA 1IBRA 4LBVA 2WSMA 1QVAA 3LAWA 5E4FA 2WAYA 3EASA 4PC7A 1ZIOA 2ZVPX 3DZ8A 3EG5A 3LFUA 2QUZA 3B82A 4DLRA 4OI2A 1II0A 2PEYA 3CPEA 2GBLA 4LBZA 5BW8A 1R0ZA 3GCGA 3U7GA 5KSZA 1Z3IX 3WNBA 4B34A 3DPUA 2WTUA 3HU1A 4RD6A 4RFSB 4A92A 2ZSBA 2JJ2D 4BLRA 2EFDB 4YMTA 1T3LA 4B73A 4TZ0A 1FQJA 3AGPA 4GBMA 1U8YA 1CTQA 1P2VA 1XXHE 1DTSA 4ZDWA 1ZW6A 4PC1A 5IK2D 4JVSB 3O8BA 2NQ2C 2F7SA 2VHUA 3CNLA 4V0KA 2CVFA 1U0LA 3B85A 2CHQA 1G3RA 1E0JA 4TYQA 4YMSA 4HZUA 4W5WA 5L3QB 4NCNA 2J0QA 4PC6A 3IO5A 3VHXA 3WHLA 1DARA 4Q7LA 4YMVA 5DYGA 4UQOA 2GWHA 3JZMA 4EPWA 1CR2A 3C14C 1AN0A 3WMFA 3RS7A 1YVDA 4MUAA 4ZIRA 1X8JA 3M1IA 5E7MA 5C1BA 3MFYA 4B48A 5B58C 1G7TA 1JXOA 1OKKD 4DHEA 4RZUA 4AG5A 4QM7A 3VX4A 2C9CA 4TYPA 1Z08A 1H8HA 2G88A 2JASA 1KJYA 2QP9X 3CKLA 3L8ZA 3PIRA 2FV8A 3RYTC 1X86B 4Q4HA 4F91B 2XGJA 2HEIA 4F4IA 1HT1E 1KI9A 1TUEA 2C03A 4KO8A 2ZUDA 5EP2A 1KTVA 2FNAA 4CYMA 1JEEA 5EXPA 2G3YA 4NCIA 1E9FA 4C3ZA 1KO5A 4UXJA 2OXRA 1D5CA 1F5NA 3ZZTA 4BLTA 4C0HA 1E6CA 4A2WA 2FMXA 3UWOA 4QGAA 3REGA 1KDOA 1U9IA 1Z2AA 2GHIA 4B32A 3IO3A 2QQEA 4NBSA 4A9AA 2WBLC 3CX6A 1JPJA 3SJCA 4M1MA 1G4UR 4OBEA 4B3CA 4Q02A 1L7VC 2VF8A 4LZZA 4EPVA 4N3NA 4H9GA 3WRYC 3W8NA 2A9KA 5CDFA 5AJZA 1MV5A 1OB2A 4KBFA 5FFMA 3THXA 4B43A 3B1VA 4R71A 2QTFA 1U0JA 1UBFA 2ZVQX 2PJZA 1CJVC 2Z0MA 1ZM4A 3GJ4A 3K9GA 3IHLA 1JBKA 4JMPA 4IEEA 3H2YA 1G5TA 2JEOA 4Z8XA 5G3YA 1W4AA 4LRWA 5CB8A 5BN3A 2YNMA 4AKEA 1KK2A 4JLKA 3K0AA 2FOLA 2FH5B 4B6FA 2IF2A 2QMEA 3GLGA 2QT0A 3CWZA 1ZU5A 2F3RA 4AYXA 2QPOA 4XIGS 5E3HA 1QHIA 4BE7B 4MRNA 2X2EA 2RH5A 1U2RA 1NG9A 3EZFA 1BOFA 3T06B 1DS6A 5JJIA 2OCBA 4ZPXA 2IS4A 3UXMA 1GKUB 3W6NA 4DIEA 1FNNA 3GJXC 4BFWA 4YQFA 4PPGA 3FMFA 3KX2A 3T1VA 3L8YA 3U60B 1YE8A 5F9FA 2OEPA 1KO1A 1KMQA 3K0CC 4KHZA 2VP0A 3NHAA 1KDRA 4NMMA 5G3ZA 3GLIB 1HEIA 1EWRA 5EZ6B 4TN1A 2ZRAA 1GWNA 4JBYA 2ASEA 3CRVA 5EE3A 4Q18A 3VQTA 3IDQA 2NIPA 3LBHA 3QNUA 3DEFA 4C2UA 3K9NA 2BEKA 5BYKA 4P4SA 1N6IA 1JNYA 4Z8YA 2RGDA 1P61B 1TQDA 1N0VC 4DCSA 1K6MA 2QRNA 4JSTA 3PUVA 5K8TA 4PC2A 3K9HA 3AVUA 2ZR7A 2VF7A 4LHYA 4Q1FA 3P4YA 5IF9A 1NLZA 2HXYA 2FSFA 4F38A 5EE9A 2LCFA 1DPFA 2LWIA 2XZPA 2AFHE 2GJAA 2VP4A 1Q0UA 2HLDD 1Z47A 5FTKA 1R4AA 2F1RA 4G5OA 4WA7A 4E07A 2KB0A 4TLDA 2AHOA 1AS0A 5AUQA 5KTYA 3C5HA 1R0XA 4L15A 4DXAA 3IQWA 1WCV1 2D2FA 4PR0A 4GL2A 1SKQA 5DI9A 3BOSA 3V4RA 4LJ7A 1H8HD 4HDCA 3NG1A 2DFNA 2JLQA 2WWGA 3N2EA 3VNUA 4BLSA 2PBRA 1IN8A 4AKIA 2ZUBA 2GCNA 2R65A 2CL6X 4ZI3A 3NEYA 3FMOB 1E2EA 3CWQA 1HYQA 1OIXA 1MABB 3OFND 1NBME 3RWOA 1I4DD 3BB3A 3KJEA 3U7HB 3TMKA 4YXWA 4IXNA 4DEXA 4BUJA 2JLVA 4IFEA 4RD0A 1KY3A 3L0OA 1G8HA 1N6KA 1QG4A 4FMDB 1W7AA 2HV8A 2OLKA 4Q19A 2JJ1D 2GVZC 5KYKA 1PLJA 4ERNA 1XMSA 2WWYA 5JHHB 4LBWA 1G8PA 4PSAA 2QA5A 3LD9A 1E1QA 5JFGA 3ZZUA 2ERYA 4DZZA 3TVTA 1E9CA 4PQYA 2CLSA 1W1WA 2BJVA 4LJ6A 1SQ5A 4V0MA 2A7QA 2WWXA 1TQ4A 3KL4A 1OFUX 2Q9AA 1OH7A 4M21A 2WMOB 2WV9A 1AZTA 1HE1C 4PFSA 5DN6A 4B35A 5IRCD 2JIZA 1ZNYA 1NP6A 1U99A 1FP7A 3F8TA 1JJVA 4K81B 1G5RA 1SKYB 3KJHA 1US8A 5LBIA 1E1QD 4DB2A 4Q1BA 1XD2B 2P67A 2OG2A 5GVSA 4PAOA 1KK0A 3WXMA 4NTZA 4BPBA 1QHHA 3CUEF 2QQ0A 4RZ3A 3CM0A 5FPKA 2IS6A 3Q9LA 1RRGA 3KB2A 4OK3A 1U98A 3PUZA 2QAGB 3A58B 4A36A 3NDPA 4Q21A 2OO7A 2KI5A 3VFDA 1JQJC 1XTQA 1AKEA 2C2HA 2R6CA 3GLGE 1MR3F 3FOZA 8OHMA 2GESA 2QN6A 4D0GA 1W46A 2Q0HA 4DDVA 5K8LA 3ZH9B 2AX4A 3NDBB 1S4QA 4HAWA 2ZU6A 1R5NA 4FMCF 2RGXA 3ZVRA 3OESA 2WOOA 3VAAA 1DG3A 4PAMA 1OYYA 1ZCBA 1NKTA 5ELXA 3UATA 4ZV4A 1SGWA 2OFOA 2ZUCA 4XWOA 4CT5A 4US0R 3EAQA 3F5FA 2OT3B 4X8HA 4DDWA 2PZFA 621PA 2CXXA 2AXNA 3EWAA 3TE6A 1GM5A 4X8OA 3RS5A 3Q85A 3B1ZA 1EWQA 3QF7A 4GP7A 4QL3A 3AVOA 4TQAA 3A4LA 4D4MA 2ZSAA 1XCPA 2H16A 4B76A 3UMFA 3BAFA 1AIPA 1NKSA 2YC2C 1EGAA 4PANA 1QHNA 2IYSA 2ZE5A 4P33A 2E87A 4UXHA 1COWA 4BEJA 3WY9A 2Y8EA 4LHWA 2XZOA 4K46A 1C9KA 3GFPA 5D3MB 2ZI6A 2A2ZA 4TZ6A 1R10A 4TYYA 1RVDA 3IGFA 1UKZA 3KXLA 3MWKA 3R7WB 1AQYA 5J4LA 2Z4RA 2ZRHA 3FMPB 4MGKR 2NPFA 1P4SA 3QY0A 1TQ6A 1SXJC 2DWOA 5FL3A 1AGPA 2NO0A 1FTSA 4C4PA 4BZXA 4LJ5A 3GD7A 1JI0A 3L0SA 3X1ZA 1BO6A 3DM5A 2W00A 3X2SA 1E2NA 5SZIA 5JI2E 2QM8A 1BS1A 3LA6A 4L5BA 3RABA 3GPLA 3U44A 3ZD7A 3VNVA 3EXAA 4Z1MD 2D2EA 4QJ3A 5C46F 2W2VA 2GEDA 3CZPA 1Z5ZA 3E5HA 2BKEA 3QXHA 3EW9A 2IBMA 3AP3A 4BECA 5FOSA 5JJLA 1G16A 2DYKA 3RLFA 1FL9A 4TMVA 1E4YA 2ZRLA 3HPQA 4HI0E 3M6AA 5DHAA 2GVDC 5EUMA 2QG6A 2XITA 4ZI2A 1WP9A 1F2UA 1NVVR 2MSCB 1UDXA 2DB3A 1KAOA 5CIQA 4ZDIA 1GKYA 2UZ3A 1EFTA 1XTKA 4QNMA 2ZJ8A 1ZUIA 3AH8A 1HV8A 2C5LA 3NC0C 3OAAA 3VMFA 2WWWA 2GBLC 1ELOA 4PQFA 2EFHB 4M9XA 1D9XA 5JCZA 1B0UA 5F98A 2Z83A 1U8AA 3FB4A 1IN7A 1W0JA 3THOA 2DCUA 2WKRA 3PFIA 5JEEA 5GJWC 1GDDA 3IILA 2W6ID 4XWKA 5KDDA 2GK7A 3F3YA 3FWYA 1NNEA 3L0PA 1TU4A 2ZRFA 4TL6A 3U6BA 5CDFE 2QTHA 4ESHA 2IYWA 1G41A 3U3JA 1R6BX 3WYGA 2DWPA 4BGDA 3A37A 1U8ZA 2PLFA 3WP0A 3VR6A 5J4VA 1T6NA 3U7FB 2RGCA 1US8B 3K9LA 2F1IA 2NTYC 3IHWA 1ZUNB 3SDZA 2PT5A 3TSOA 1WBBA 2HLDA 4OQLA 1FW6A 1F2TA 3K8YA 1QHHB 4EJSA 1BKDR 1Z6XA 1P5ZB 3RRMA 2P5TB 2CJWB 5BN5A 4ZDJA 4NCJA 5BN4A 1KDPA 5A4JA 4NYMR 3V00A 1E9AA 3MJHA 3NWJA 4I1SA 4X8MA 5H68A 3HJNA 3CNNA 2XTZA 3HU3A 5C18A 5KPDA 2V6IA 3ZS8A 3WYAA 4EPYA 1GNPA 1YZNA 2VYFA 2F43B 2BM1A 1AKYA 1BMFA 1IXSB 2F1JA 1T8TA 1NI3A 2J7PD 2PZGA 1YRBA 4LJYA 4NDZA 4QG7A 4XTRA 4YDSA 4DLTA 4EQ6A 2IUTA 1HT2E 2WKPA 3I61A 4BASA 4FXPA 2GXUA 1XJQA 1IQPA 1CJUC 2AD5A 3O8DA 4LV8B 3PVSA 3N2IA 1G6OA 2QTVB 4C7OA 4Q9KA 5FOUA 3FHCB 2JJ2A 4MQBA 1A82A 4L9SA 2GJ8A 4DB4A 1G17A 3ADCA 3CW2A 4IOMA 2HUPA 2KBFA 2WPDD 5CJPA 3R9XA 3H86A 3B9PA 4DDUA 1A5TA 1W49A 3CR8A 4TTRA 1EFCA 3B1WA 4CZ2A 2WICA 1CJTC 1GILA 1A7JA 3AF0A 1X8KA 4FINA 2OHFA 3QG5A 3LVRE 3B13B 1OXXK 3LBIA 4DSUA 3CONA 2Q9CA 1WMSA 2XB2A 4LJ8A 2VHCA 4Q9IA 4IKEA 3N5CA 4TLAA 4EPTA 2WWHA 3SYLA 4Q00A 4IDHA 1LF0A 3GEHA 1I4LD 2BV3A 2XOKA 3SZRA 1OKKA 3LW8A 4PZYA 1L2TA 3EA0A 1I2MA 5JZVA 5EXXA 2QRZA 4DKXA 4OQFA 1G18A 1XEWY 4EJSB 3U44B 4XTCS 5FBRB 5KU1A 3L82B 2ZIAA 1MOZA 4GPTA 1ANKA 2X8AA 2J87A 3AF2A 2GTPA 2QZ4A 3J81k 2DR3A 3BB1A 1RPZA 4UNNA 1KO7A 1YRAA 2KSQA 3EIQA 4TYWA 1E2HA 2RHDA 1CLUA 1ESNA 2A5YB 3GJ5A 4I1UA 4F92B 1KK3A 4JVLA 4MGZR 2AD1A 3LQQA 3DDCA 4L16A 4XSGA 1J7KA 2EFCB 1V43A 1TF2A 2IXEA 1M34E 2ODBA 2ZYWX 3QBVA 1Z2CA 2BM0A 2CDNA 4FMBB 3U3OA 3REFA 3SBEA 1RE0A 2CL0X 4DCVA 5H8WA 3MUFA 1RRFA 3D31A 4H1VA 2HF9A 1LY1A 5TVKA 3U61B 3QPUA 5AJYA 4AWXA 2HYIC 1FFHA 1NRJB 5KNCA 4JBXA 1ZM9A 2ZU0C 4AD8A 2YOGA 3ADBA 1ZP6A 4CEJB 3U3RA 1HE8B 1CKEA 3I32A 4IXMA 1WF3A 2ERXA 3W6OA 3OIYA 1RFLA 4JLJA 4Q1EA 2QSZA 2NGRA 5AR1A 2VP2A 4I1VA 3CLVA 4OQNA 3ZIAA 2ZREA 4NE2A 4BZPA 4Q4JB 1C1YA 4D0LB 3P1JA 5TB5A 3ZDQA 3P32A 5J4YA 5JLJA 2PEZA 2ORVA 4ZIRB 4GNKA 1E2KA 3K0EA 1OE0A 3K70C 2QL6A 4LUCA 2ZRNA 2O8BA 1NF3A 3X1DA 2VTKA 2R2AA 4G5GA 1MRNA 3MWLA 1KI6B 2EWWA 1OFHA 3T34A 4OJQA 4KJZA 2QAJA 3SNHA 2L0XA 4N0DA 4LCBA 4KFSA 1J2JA 1H65A 3EA5A 4D2IA 3QVUA 1SVWA 4L9WA 4TL8A 4X8LA 1XTJA 3WMEA 4B6EA 3K0SA 2LKDA 2GXAA 2WZQA 2AL7A 3AGQA 3NBZC 3AV0B 3O47A 1XJCA 1GRQA 2V55B 1E0SA 5B64A 4DLXA 1XPOA 2N46A 3A6PC 1QZXA 3THYA 4FD2A 5DNYB 5AJXA 4OHYA 4O25A 5LB2A 2HCBA 1SHZA 4G1UC 2R6AA 1VIAA 4PHTA 5KSYA 3QUSA 2GA8A 4QGHA 1Z6YA 2J59A 2GCOB 3LX8A 3PQCA 4KITB 1Q21A 3WYFA 2EWVA 4W5HA 2FDCA 1UBEA 3UG6A 4FWIB 4PC3A 2ZPTX 1EG7A 1GG2A 1HH4A 4IOJA 3VKWA 3KKNA 1G3IA 2WSSA 3HDTA 2HXSA 4KBGA 2IYZA 2D4HA 2BEJA 3A8TA 3N70A 2JLSA 2Q3FA 3CPJB 5A5GA 4URZR 4V03A 2OILA 1HA3A 1IY2A 4Q01A 3WBJA 1XD9A 4PO9A 3LY5A 1H8ED 4XOIA 4HLDA 1E2LA 5CLLA 5EE5B 4YDHB 1DAIA 3KXKA 1Q3TA 1T3SA 5LB4A 5FOTA 4D81A 3QSYA 2O8CA 1KY2A 1OXSC 721PA 2ZE7A 2GRJA 2OLJA 1Q1ZA 3C15C 4MKGA 4BFVA 2FZLA 4JT4A 3D8BA 1PZNA 1KJWA 2ZQ5A 1G19A 2C96A 2XAUA 2BDTA 2YOHA 1HUQA 1WQ1R 4JKYA 5G40A 3QEJA 4DCNA 1FQKA 3LBNA 3NVAA 4JKIA 4OYHA 4PPNA 121PA 3CRMA 4M0LA 2FPMA 4FCTA 1GVNB 1DAGA 1FNMA 3PXGA 1FTNA 4RD4A 4W5JA 5EP3A 3VR2A 1W4CA 1KK1A 4LDJA 4QHSA 4Z54A 1QBKC 4V0NA 3LWNA 2YWEA 1VTKA 2BBOA 3RS4A 5UKDA 4TQUS 4F93B 2BBWA 3SBDA 2MMCA 3CF6R 4QFMA 2VRWA 2EFEB 3IIKA 3KJGA 2J46A 1QF9A 2HJGA 5KUTA 2OSBA 5FUYA 3C7KA 4M1YA 3I8XA 2ZJAA 3LDAA 2C95A 5FOVA 5JWRA 2YJTD 3EWSA 1AZSC 4QBFA 3QKRA 4A8JA 4JLBA 3FKSD 4P4UA 1X8LA 2KBEA 4NYIQ 4ZCLA 3GLHB 4P32A 1E2FA 1BMFD 1MO6A 821PA 5L8VA 1P72A 4OK5A 3IBGA 1S96A 4LHVA 1VHLA 1NLYA 2QM7A 1SHKA 3ZVMA 4AI6A 2F43A 4JLPA 1ZIPA 2FEOA 1BYUA 2VBCA 3IEUA 5BWMA 2H92A 1M1YE 2WPDA 4URVR 4MRVA 3NKVA 1E9RA 2A78A 2PT7A 2ZS9A 4GOXA 4KU4A 1N0UA 2R6GA 4FIDA 4QBHA 4HLQB 5CLQA 1DAKA 2WJGA 2W0MA 3P27A 1M74A 5EE0A 1XNJA 2FFBA 4HLUA 3PJRA 1OFTA 4I4LA 1LS1A 4DLVA 2NG1A 1VYUA 4EIWA 4GFDA 4NPHA 5G41A 3LRPA 3TR5A 1S1CA 2DHRA 2Z43A 2IK8A 1PLLA 1S0UA 3GLFE 5K8UA 3DL0A 2I3BA 3KQUA 3B2EA 4QOSA 2BMJA 5CYOA 1VYTA 5DI3B 3SYKA 1IN5A 5LPNA 2VL7A 4M53A 3OIVA 2PL3A 1VCOA 4HLUC 1ZM7A 1E9BA 1XPUA 1P9WA 3G5UA 1G3UA 3T1OA 2EW1A 3UG7A 5EJEA 4IVRA 2JCSA 3E2IA 2YWFA 2BOVA 1NN5A 2IXFA 3PUYA 5TDHA 4HB3A 4IVQA 2A5JA 5G53C 2VH5R 1NN1A 4DLYA 2J41A 1GUAA 1GP2A 1MO3A 1TL7C 1WBDA 2GK6A 1MH1A 2HYDA 3B5JA 4C0KA 2RGEA 2IA5A 3KKMA 4TT3D 3DKVA 4DLUA 2ZM5A 4IVPA 4CVNA 1CJMA 3LVQE 2ZTSA 1KKMA 1N6NA 2Q9BA 2OBNA 1LF5A 2O5VA 4PSKA 1J8MF 2PMDA 4R98A 4BWYA 2A5GA 4GI7A 3EZ7A 5DISB 2ONJA 1SULA 1RRPA 2W6JD 4RFVA 2H8KA 4UNQA 4HLCA 2DFKB 4M1WA 4ARZB 1JAHA 1SXJE 4NKRA 3CZQA 3EZ6A 5FBLB 5J4KA 4HAVA 2AK2A 3AKEA 2CL7X 1RJ9B 1X3SA 2BHRA 5CK4A 3CB4A 4YMUA 4URYR 3EC1A 2C77A 2QT1A 3NC1C 5TARA 3G0HA 4PHGA 1NVXQ 4EFMA 2RGBA 4G01B 2KWIA 4RY2A 3ZJYA 2ZS8A 4XD7A 1Z6AA 2A5FA 3PUXA 5GJCA 1S3GA 3BE4A 1PJRA 4YONB 2ZRIA 4GOJA 3VKGA 4TL7A 1PUIA 2CCGA 5A0FA 3H1TA 1KSFX 1FZQA 1UBGA 4Q1AA 1KGDA 2XXAA 2ZAOA 2OXCA 2WM9B 2GXSA 1KO8A 1NY6A 4EUNA 5JMTA 2EVWX 2IC5A 3SFVA 1Z0KA 4LBYA 2YOFA 4ZKEA 3B6EA 3D3QA 1N2CE 2YVUA 5E7IA 4ACBA 1N5JA 2ZJOA 3B60A 3SE0A 4AYWA 4JL6A 3B1YA 4XD7D 1UEJA 3OFNA 3RC3A 1QVRA 4M22A 3LV8A 3GP8A 1M2OB 2BC9A 2VHJA 4KODA 1Z6GA 4GDFA 3DOFA 4F4JA 2JLRA 4PX9A 5EE1A 1KI7A 4HUTA 3IQXA 2CBZA 4GMDA 4IOKA 5C2JB 1CP2A 4RKEA 2J45A 3RDPA 1J99A 3I5XA 1XXHA 3SHWA 2Q3HA 1WB9A 4JT2A 3SJAA 5SZKB 1L8QA 4GT1A 2IYYA 2I1QA 3E70C 4OQMA 3T35A 1GNRA 1SVMA 2X1VA 5LDDC 2MMGA 2BKUA 2C9OA 4PHHA 3TLXA 5B57C 5HZHA 4QJ4A 1DAEA 1U94A 2JIZD 1NSTA 2ORWA 3A4NA 3MG9A 4U5XA 3ND9A 4P31A 4YLGA 3Q8XB 3UANA 2ODEA 4RSGA 5FBWB 1E4VA 4HUQA 4LHXA 3I5YA 2AFIE 4LOAA 2FEMA 3OEED 1E79A 4LV5B 4WXRA 2OCYC 3S1AB 3DMDA 1DBSA 1IHUA 1V5WA 3JZAA 3WNDA 2OCAA 2FG5A 1W2GA 3TAHA 3KTAA 4JJKA 4RD3A 2JDID 3K0FA 3Q3JB 1A2BA 1G21E 4UKDA 3C8UA 1GKIA 2ZEJA 4WZBE 5KNBA 1K5GA 2BMFA 3FE2A 1VG1A 2OBLA 5FOXA 1Y63A 1IY1A 4IRUB 4KAXA 4XJXA 4D4JA 2CVHA 3W34A 3UKDA 2D3WA 4PQRA 3SI7A 4Q4AB 2ZI9A 4TL9A 5AUNB 5EP4A 2ZANA 3QXXA 2P6RA 2IF0A 4Q1DA 2JLWA 4B3GA 3RRYA 3NHBA 4ESVA 4DUGD 1XFAA 2H1LA 4PAQA 1GL9B 1SKYE 4LC0A 4B3DA 2J9RA 3LXXA 5GJVC 1EESA 2R62A 4TLBA 4MH0R 3GJ8A 2IHYA 2RGAA 3ZGXA 4MDFA 2C8VA 3GQBA 2CJWA 3MWYW 3IUYA 1TF5A 1XEWX 3QPWA 4JLDA 4JVMA 5FI0B 2JJ8A 5C4MA 4XH9B 2IEZA 1KI2A 3FGNA 1SXJA 4AKGA 1JPNA 2J0UB 2VO1A 3T5DA 4D4KA 5FTNA 5FBVB 1DAMA 1UKYA 2JA1A 3R20A 1IN6A 2IHBA 3LX5A 4KXFB 4ABYA 4C0BA 5HKKA 3ND8A 1KDTA 3AQ4A 2ZRPA 5B30A 3KKPA 1UJ2A 1IN4A 1FMLA 2BJWA 3BORA 1J70A 5JI3E 1UBCA 2JDIA 2JAQA 3ZS9A 2CE7A 1D6JA 5KNDA 3RS0A 2F9LA 1TAGA 4G0NA 4KYUA 1E69A 1N3BA 5KO2A 2HT1A 3PEYA 4JLAA 2EFGA 3TKLA 1D9ZA 1HURA 1MKYA 3ZLJA 1DADA 3ASZA 4R7ZA 4RZ2A 3RSLA 1W5SA 1YJ5A 2K5UA 4R2IA 3FHOA 5ANRB 4ON9A 1MO5A 4QHTA 4TTQA 4DRZA 1Z0AA 3Q72A 1T0HB 5TMPA 4A15A 5IT5A 1E1RA 1LB1B 1LVGA 2REXB 2RGGA 2ZI4A 1XTRA 2OV2A 3LNCA 4FCWA 4LYFA 2P6UA 3KQHA 1KYIA 3MAAC 4TLCA 4MYUA 5H70A 1FP6A 4OL0A 1X1RA 1JR3D 2ODWA 2O8FB 4E5UA 3KQKA 2RMKA 4M1OA 1E0KA 1ZU4A 3THXB 2ZSDA 4JL5A 5HR5A 4B33A 2VEDA 2CHVA 4LYHA 1XXHB 2OAQ1 1UDWA 4UJ3A 3GLHE 2B21A 2NOAA 4RCYA 3B8HA 5FBQB 3UMSA 3CH5A 2YZ2A 4JBWA 3PEWA 2AR7A 4HZUB 5L3QA 1S3SA 2R6DA 5HTKA 3VHLB 3AB3A 3HPRA 3L2OB 4JL8A 2N1BA 2FX3A 3VX3A 5JS8A 3THWB 1AA9A 1WE2A 2ATVA 3K70B 3TNFA 4Q4HB 3C41J 4KI0A 1II8B 5FH9A 1K8RA 4O2LA 4J0QA 2VP5A 2FFAA 2G0NA 3HYRA 2MSEB 4DEYA 1IAQA 4Y0VA 1FMJA 1KJZA 1NVUQ 4NCHA 3X1WA 2IYXA 5HPYB 1R5BA 1XCMA 4BRWA 2JJ1A 5FPHA 3MWJA 4C0SA 2NO9A 4A82A 3CH4B 4GZMA 1N6RA 4BFXA 4LYJA 2QE7D 4TWZA 5EXTA 1O3YA 1CRPA 4LK2A 4ASUD 3KTAB 2WIBA 4M2LA 3P4XA 2FGJA 2V1UA 4ACAA 2VPPA 2BWJA 2QEQA 2HDNB 5SZHB 1KI4A 4Q9HA 3W5JA 2CHGA 1N6OA 1E9SA 1G64A 2VHQA 3M4YA 1NBMD 4HDOB 1NMZA 4P4SB 2DPXA 4G5RA 4MRPA 2OBMA 1G7CA 2OUKA 3VU9A 3F0TA 3RS2A 3T12A 3GJ0A 3G82C 3EX7C 2JLYA 1AM4D 5KDLA 4L8GA 4CEJA 5J4HA 1E3MA 2QE7A 3QG1A 3ICEA 2XOKD 2E1RA 2QI9C 4ARZA 5SZJA 4Q4AA 4JS0A 2VIIA 4A6XA 2CE2X 4C0JA 3FPAA 5FTMA 2PH1A 5HZKA 4PSVA 1GTVA 5D3QA 1Z0DA 2XJ9A 2ZRJA 3FTQA 4U02A 5CJ2A 5CK5A 3FDIA 2CCKA 1ONBA 1OV4A 4JLNA 1IXRC 2G6BA 1OIWA 2ZYVX 1R0YA 4S2EA 1ZRHA 3WNCA 2D7CA 2E9SA 2CK3D 3M0EA 3HYTA 4G3XA 3K0AB 5J47A 4C2TA 5FR2A 2G1KA 3LLMA 3OZXA 1ODFA 4M1TA 4OHXA 1QHXA 4A6PA 4A1FA 4BLPA 3A4MA 3CBQA 1SXJB 2WWIA 3IPXA 3TUJC 1Q1EA 1XX6A 5JCPA 1JR6A 4TMXA 2YWGA 3TRFA 4B75A 5EQTA 2REOA 2O52A 1XTSA 4BLQA 3Q5DA 2ZYUX 2C9YA 1SVLA 1ZM2A 3MCAA 3ZZ0A 3QQ5A 1KI6A 4KCGA 2J7KA 2NZ8A 2AK3A 1YR6A 4CW7A 4C30A 4MYTA 3TK1A 2ZITA 1TPZA 2QPAA 2W0SA 3ZYCA 2YKGA 1NY5A 1JR3A 4OHZA 1G3MA 3BFXA 3QKSA 2WHXA 3I72A 2P65A 5TY0A 1DAFA 2BBSA 4RKFA 4NYMQ 2F3TA 4JLMA 4EPRA 4ILEA 2EYQA 1TEXA 4M9SA 5DGXA 4FMCB 4JSYA 4UNRA 2GCOA 221PA 1U0HC 4QM6A 4AKHA 4HATA 4AYTA 1JECA 2GCPA 3I4LA 1GAJA 3FKQA 4BEBA 5KPJA 2JLUA 2ANCA 4LC1A 4GP6A 3DVLA 2GZHA 1MO4A 4QXAA 3B1XA 2WAXA 5HE9A 4P4TA 1OJLA 5FTJA 3U4QB 1ZNZA 2XTMA 1CEEA 3BH0A 2XTNA 4MRSA 1VG0B 2GAOA 3HP1A 4BFSA 1N0WA 4PPFA 2ZSEA 3BJIC 4TT3A 2V6JA 2ZE8A 4EAQA 1ZC4A 3EZ9A 1HQYE 1KAGA 4JYCA 4RJLA 1ZM3A 1GL6A 1MRSA 4MA4A 1OHHD 5L3RA 2W2TA 3IBYA 4PPQA 1P73A 4IDOA 4D0NA 1ZBDA 1G6HA 3K0FB 2QU8A 4EKDA 2ZRDA 4LWZA 3NBFA 1G7RA 3GEEA 4O0MA 2KJQA 3CF0A 1W44A 3I3SR 5FL7A 2BBTA 1CJKC 2VQSA 3KDSE 3ZIAD 3AF1A 3DMNA 1EFUA 2IEYA 3FKSA 1JALA 1VMAA 3PITA 4JLVA 2AXPA 2ZAMA 4CF7A 1Z0JA 4DSTA 1W0KD 1OH5A 3GFTA 2IYTA 2GILA 2G0TA 3T61A 3DZDA 1EXMA 1G20E 2D74A 2GKSA 3VR4A 4BFYA 2NMVA 1OH6A 1G8GA 1M7GA 2GZDA 3PCRB 1OLOA 3FFAA 1OXUA 4P0TA 3T1TA 1BYIA 2F1HA 5L3SA 5DLQC 2PMKA 1PUJA 1ESMA 2WMNB 3NH6A 4HEJA 4KFTA 4LGMA 2FSGA 4UNPA 5DE3A 3QKTA 1OFIA 4A8JB 1SZPA 1IXZA 2GJSA 2JGNA 1H8EA 3U2QA 2O0KA 4DUGA 2FZ4A 3ECCA 1DO0A 4W7SA 2J0SA 4DJTA 2ZR9A 5JRJA 2ATXA 1GSIA 1L4UA 3AUYA 2O8DB 3SS8A 3TIFA 2XNDD 3MSXA 1XD2A 5AUOB 1P2SA 3SEAA 5EUQB 4AG6A 4QRHA 1NJFA 3QKRB 2WIAA 5E7JA 1KI8A 2ZJ5A 4IDNA 2O0JA 5J5CA 3HR8A 3KUDA 3GLHA 4XVQA 4BFUA 4HAZA 1NG1A 3AEZA 3DHWC 1U81A 3RAPR 1XBTA 1YZKA 5DH9A 1XF9A 3P20A 3BWDD 2LKCA 1UFQA 2IWRA 3OE7A 3GJ6A 4M9QA 1QRAA 2V7QD 4N1AA 2IS2A 4IFBA 1KNQA 3RVBA 1ZD8A 4B44A 1Z07A 4NL4H 4TMZA 4A0HA 3HWSA 3K1JA 1R5OA 4LHZA 1KI3A 3KFXA 2G9NA 2P3SA 3SR0A 2QBYB 2O0HA 4KSBA 4FMDF 1D8TA 2GJ9A 3WMGA 1CF4A 2GAAA 4C0LA 3OF5A 1E79D 4UNSA 4Q4LA 4B71A 4I1OA 3TQFA 2ONKA 3NXSA 4Q1CA 2GF0A 1D2EA 1GRRA 1IM2A 1VPLA 1E1RD 5JBQA 5HE8A 1YHNA 1QHSA 2GF9A 3EARA 4DC9A 4MGYR 2V3CC 1DOAA 1ZC3A 1K5DA 3BC1A 5JEDA 2UZIR 3SJZA 1XB2A 1N6PA 2WJVA 1XP8A 3PEUA 1SVOA 4AURA 3BBPA 2JLXA 2RGNA 2QAGA 1OPXA 1E96A 2GNOA 4PO8A 4ZKDA 4D82A 3L0IB 1CR0A 2CCJA 4GOKA 1SVSA 1JEDA 1U90A 1BH2A 3EPKA 1RYFA 1Q20A 5GVRA 3IEVA 4H1UA 4K8OA 1TTTA 2IYQA 2QMOA 2J5XA 2V4ZA 3W3ZB 4DBLC 3I62A 5JECA 3RNLA 1NMYA 1C4OA 1OXTA 1ETUA 2QORA 4P3YA 3U3KA 3BRWD 2F55A 4LPKA 1GZSA 4Q7MB 3GLFA 3L43A 4IDPA 1ZINA 1KOFA 3DO6A 4LV6A 1NLFA 4TYNA 1FUUA 1YZTA 4I99A 3TW8B 5HKKD 5IK2A 2ZROA 2PX0A 1X6VA 4LJAA 3AUXA 3GEIA 3PEVA 1F60A 4WBSA 3C4JA 4TQ9A 4TMWA 3MJRA 3ADKA 4Y0AA 3R7WA 2CK3A 1S9DA 4OKSA 3FVQA 4FN5A 4DLWA 2PJRA 3AVVA 2QMHA 5L3VA 1OSNA 4FI3C 5CITA 5IHPA 1DO2A 2H57A 5F9HA 1W36C 1M7HA 4QBIA 2PCJA 1W36D 4D26A 1L4YA 3BFKA 1YR7A 4M9ZA 1LTQA 2QMUA 3VTKA 3PR1A 4Z51A 1SVIA 4OK6A 4E22A 3R8CA 2NPIA 1Q22A 1T91A 1N5LA 5JJKA 2FJUA 1F48A 2V7QA 2XSZD 2A3RA 2X2FA 2EYUA 2J0VA 1OH8A 4AK9A 5FI1B 3A36A 3BS4A 1KSHA 1T5IA 4KVAA 1ZJ6A 3NH9A 2AN9A 4US2R 1RZ3A 1XRJA 2PCLA 2ZSFA 2W83A 1F2TB 1VHTA 4KFUA 3RWMB 2V54A 3SHFA 4E03A 3ZD6A 1XPRA 1N5IA 5H1YA 3CIOA 3BH6A 4EPXA 2FN4A 3VR1A 1KMHA 3NEJA 4CEHA 1ZAKA 1KZGB 1P6XA 4NZYA 4OI4A 3GLIE 1Z0FA 3CF2A 1VIYA 1VCIA 1HTWA 2VSFA 4HB2A 4HAUA 3CX8A 4JZKA 5F2EA 3TGPA 1SVKA 4LJ4A 4EJSC 5GJBA 5KSPA 4NYIR 2YWHA 1YKSA 1E9EA 4IW3B 3GLFB 1TF7A 1ZCAA 2WSSD 4MKHA 4TMTA 1PVOA 1TEVA 3LH5A 2V1XA 4MITA 2BVNA 4FWTA 5FOWA 4A2QA 1E2MA 1E9DA 1RC8A 2ZJ2A 3S1AA 1LW7A 4CRWB 1COWD 2B92A 2PX3A 5DN6D 2RKOA 3H0KA 1ZUHA 2XX3A 4Q7KA 4C7OB 2ORIA 2QP4A 1Z22A 2KE5A 3AF3A 2FSHA 1XMJA 1KI1A 1WXQA 2OFXA 3OEHA 5CIWA 1AJEA 3BD9A 3HU2A 2QP3A 3AVTA 4LI0A 1AK2A 4AIIA 3BFVA 3AKYA 3ZQJA 4I81A 2C78A 3WHKA 3T5GA 2YINC 3AVPA 2G77B 2BMDA 1CIPA 1Z28A 3JVVA 3R8FA 1CR4A 4N0EA 3UWKA 4PO1A 2IXGA 1XMVA 4FW9A 3SC3A 3EPLA 1DELA 4OI1A 3OEHD 4RCZA 1R0WA 1XCGB 1OHHA 2GZAA 2DFTA 2FWRA 1M7BA 1G5PA 1XJ0A 3BB4A 1IY0A 2W2XA 3A1WA 4JIMA 5B2ZA 3AKDA 4NU0A 3KQNA 4TTPA 3SYNA 1IJEA 3JVUA 2I4IA 4EQ6B 2EU8A 3CPHA 3NBYC 1P75A 1DEKA 4IHQA 2VLIA 5HCNA 3W6PA 4XVUA 2CLDX 1CBUA 2WWFA 3QF4A 4M8NE 2XB4A 1YZQA 4LSGA 2IYUA 4ZO4A 5BYJA 1FX0A 4TSFA 2ANBA 4LJ9A 1W5TA 2FF7A 1T3HA 3AKCA 3V9PA 1W47A 3H4MA 4U7DA 4DLZA 1LFDB 4V0ME 4DSOA 4O3MA 1XMIA 2DWQA 1JB1A 1QHGA 4QGGA 2RCNA 3LLUA 3EPJA 1M8PA 2GJKA 3ETLA 2IUSA 3CRQA 3OHMA 1R2QA 4URWR 2ZI5A 1CRQA 1S1MA 1Y3AA 3CNOA 4D6PA 4GRAA 1E2QA 2WJJA 1KHTA 3Q7QA 1HY3A 2AWNA 5F3WB 2IYRA 2X19A 5AJWA 1KSJA 2O8EB 1S2MA 1OF1A 3KXIA 3CRW1 2D06A 1AS2A 4EDHA 4OJKA 4DCUA 4V0LA 1II9A 2FFHA 1CR1A 3FMIA 4YC7A 3TW4A 3EIEA 3TUIC 3QEOA 2QSYA 2O8FA 2QGNA 2IYLD 5CM9C 3QXCA 1GL7A 4PXAA 3R9WA 2P5SA 3B78A 4DIDA 521PA 1MABA 2O8CB 4FCVA 2ZS7A 1P62B 4BFZA 2FE4A 1KKLA 3WP1B 4EFNA 4NCKA 1YQTA 2REBA 2O8BB 1TADA 3QXSA 1W2HA 2J7PA 1J8YF 2OZEA 3PENA 3OAAD 4HSEA 1ZMXA 2ZR0A 4CIDA 4B2IA 2I1VB 4Q47A 2QY9A 1G3QA 3OIWA 4HAXA 2MSDB 6Q21A 1KIMA 4Q7JB 2DFLA 3WRXC 1RYHA 4Q9JA 2NZJA 4NP6A 1TNDA 2J3EA 3DM9B 2YV5A 2OESA 2F9MA 3QJYA 1A2KC 1XD8A 2IYVA 4NHOA 2NO6A 3CX7A 1FX0B 1ZNWA 1D2MA 4MYCA 4PHFA 3MMPA 2QENA 4MKIA 3THYB 2QGZA 2W6JA 2ECKA 4L4UA 4A0GA 3KZ1E 1S8FA 1VG8A 3I73A 3FYHA 1B23P 2QPTA 1XEXB 5K8IA 2XNSA 1Q1QA 4IEIA 2ZE6A 4AY2A 4CEIA 5JWOA 1WA5A 2B7CA 2ZJYA 3BIFA 1WDTA 4II7A 4Q4JA 4WAUA 1QDEA 3R9IA 2WOJA 3RRNA 1E2IA 5HCIA 4B74A 3NIBA 3LW7A 1TMKA 1A4RA 1NJGA 3BXZA 4G5QA 3VU9B 3KKQA 2GEVA 1N6LA 5CB6A 2O8EA 2ZETA 1IONA 1EX6A 1N5KA 1W48A 3GMTA 2ZI3A 4MYHA 3KKOA 3B7GA 2RGNC 3PUWA 4OHVA 4AC9A 3QENA 4LYAA 1F6BA 3AVYA 2Q3MA 3LQRA 4GSYA 1MT0A 4DWJA 5KHOC 2Z5FA 1TX4B 4G5SA 1KZ7B 3THWA 1HQCA 5DSZA 1CS4C 2CLCX 4GZLA 2P6NA 4Q66C 1FUKA 5FUXA 4B2LA 1IJFA 4LY6A 3ONWA 5FUWA 1WRBA 2VP6A 4MDEA 1P60A 1Q1BA 1JAIA 1ZD1A 3Q7PA 4POAA 2OFWA 4C0AC 1XEFA 1NN3A 1F3OA 1I2DA 2Z4SA 3QIAA 4JVNA 5C4GB 2DBYA 4D80A 5JS7A 2ZJBA 5JRZA 1ZVQA 5LD2C 4RZXA 4PTLA 2C98A 2IT1A 3OE7D 5FR1A 1XWIA 4WIAA 1W4RA 1P7CA 3ZVLA 3KFVA 3KUCA 2OAP1 1YU9A 4URXR 2ZRCA 2VHTA 3MLEA 1NVWQ 2NO1A 3QKSB 3LXRA 1JQLB 2D62A 4M1SA 3KB1A 2ZRMA 1UEIA 1J90A 2G83A 3FFBA 4BLOA 1TU3A 3QPVA 4HAYA 4Z1MA 3T1QA 1UKEA 2FSIA 4WW0A 4TMKA 1Z8FA 2IX3A 3GJ3A 5AJVB 5M04A 2P0EA 1E32A 3U5ZB 4OQXA 1G7SA 3X1XA 3W5IA 4C9BA 3CO5A 3GFOA 2YHSA 2R8RA 3TAUA 1QHYA 2B8TA 4TLEA 1VDZA 3QXJA 1KNXA 1JJ7A 4B3FX 2UKDA 5TXGA 2GDJA 3IIMA 4UJ5A 1XEXA 4HZIA 5CYPA 4B47A 1Z06A 4CEIB 2ZYTX 3MGCA 5FL7D 4LPSA 2B6HA 4F7WA 2BIFA 1Z83A 2ODNA 2CMKA 2TMKA 1JXMA 3OEEA 3QBTA 2P2LA 1BIFA 3DKPA 1T4GA 2FU5C 1VG9B 4DSNA 2CNWA 4WXPA 1G291 2ZRBA 1W0KA 1CULC 1S9HA 2PLRA 2V9PA 3TVDA 3K09A 3VR3A 1KO4A 3GJ7A 4R9UC 1RRCA 1GOTA 1ZNXA 4JYBA 2C99A 3SJBA 1YZGA 1Z6TA 1RJ9A 1XZQA 2SHKA 1E99A 1P9RA 1XZPA 3EC2A 2DY1A 1Q12A 4CDGA 3SOPA 4QC2A 3UK6A 5FPTA 1NL3A 1PLKA 4V0OA 2AKYA 3E1SA 1UADA 3NTUA 4GMXA 1UF9A 4NYJQ 4QHYA 4A0FA 4YXWD 4JJZA 3BH7A 1JR3E 3RC8A 4A4DA 2H7VA 2RHMA 2FA9A 1AGRA 1RKBA 2WJYA 1EX7A 4ITRC 1R7RA 1R8QA 2WJIA 3C5CA 4KYIB 1E98A 1O87A 3W3AA 1LS6A 1P2TA 2BCGY 2EQBA 2XZLA 4QGFA 4PZZA 2VSOA 3D6TB 4NH0A 5D3MA 4NYJR 4TSFD 1VECA 5AUPB 3W9YA 1W0JD 3AP2A 4DT1B 2JLZA 3WBKA 3I92A 2W6IA 4RD2A 4BRUA 4UXIA 4F4CA 2WJHA 2A30A 1RW4A 3AF4A 1Z63A 5GADl 3VKHA 3Q5EA 3B9QA 3A1UA 2JATA 5FPYA 4CT4B 4RVCA 2J1LA 5DO9A 3U3MA 1Z29A 4Q5IA 4ZCIA 5JSZA 3U4QA 4D25A 2CEAA 1T9HA 4WZAE 5L3SB 2WKQA 1XDBA 1LV7A 5AWFC 4KLNA 3IPYA 4IJMA 3UMRA 1P2UA 2YYZA 2VSXA 3TUZC 3QOFA 1F2UB 1UM8A 2R44A 2X77A 2GEUA 3HR7A 3RHFA 2O8DA 1G8FA 2ZRKA 1SXJD 1OB5A 3QF4B 1Z0IA 5P21A 2XSZA 2AKAB 1OT3A 1VKJA 4YMWA 1NIJA 3CRRA 3RANA 3TSWA 5KDOA 1ZD9A 2IL1A 1NN0A 4WZ6A 1CXZA 1QG2A 1U9IC 3EPHA 4XVRA 3ADDA 3BK7A 3QI2A 1Q3HA 5DI3A 3I8SA 5CM8B 3TQCA 3QE0A 4IDQA 4QNRA 3W90A 3U7EB 3X1YA 2FPLA 2XXAB 2IS1A 1Q44A 4QBGB 4QJ5A 4M1KA 3W8RA 4JLOA 4R2HA 2RAPA 3I1FA 4WOPA 2OE2A 4A8JC 1E2PA 2VP9A 4XWAA 1XU4A 2N42A 2H18A 1RIFA 2HF8A 4BFTA 4RFSA 3IKJA 1NMXA 1D2NA 5BXQC 4B2PA 4Q9LA 1LNZA 3V4FA 1AQUA 2HT6A 5LD2B 4IOLA 3C16C 3IIJA 3BERA 1TUIA 2XNDA 3KQLA 4QKQA 1X1SA 3RSOA 3SQWA 5JWHA 4BQSA 3SU8A 421PA 4DT1A 4BZQA 5FUVA 3ZVNA 3AVXA 1NVVQ 2UVQA 2PZEA 3MD0A 4Q48A 3AVWA 1PV4A 3D7MA 1DVRA 2QNRA 2R6FA 1G8YA 4MGIR 2ZI7A 1A1VA 4KVGA 3LO5A 2FFQA 1EFRD 3TJZA 5DIFA 2IWHA 4OHWA 3SFZA 5JSZB 4C0QC 1P3JA 1KSGA 1YZLA 2XJ4A 1OW3B 2H17A 4DCTA 1I4TD 2R9VA 2W58A 5TV2A 3TR0A 4KLZA 4A2PA 3K0CA 3PV0A 5JHGB 4HUQB 4PZLA 1EK0A 4XSHA 5AK0A 2XEXA 3OIUA 1CU1A 4ASUA 4S35A 1GITA 2G1JA 4MKFA 3UPUA 2AWOA 5EZ5A 3BGWA 1YR9A 4O2RA 4CGZA 3CR7A 1EFRA 1YR8A 4A0RA 4E09A 2C04A 3DOEA 3K53A 1DG1G 3O8RA 2HJVA 2OM2A 1GIAA 3ICQB 1UPTA 4KV9A 5IDVA 2QBYA 3K70D 4Q03A 4US1R 5EXSA 1G4AE 2Z6VA 3EZ2A 2NO7A 4MRRA 4HB4A 1N6HA 4HDQB 1NSFA 2YC4C 1G1MA 1T8UA 1DE0A 3MRSA 3QKUA 3SN6A 1VYVA 3TSZA 1VCNA 4DDTA 2FGKA 1G9XA 1YZUA 3A1SA 4RD1A 1OIVA 5J40A 3ZQ6A 4NONA 1FOEB 2IW3A 3A1TA 5DYIA 3TH5A 3O8CA 1NIPA 4OI0A 5DHFA 1M6NA 4KFRA 1Q57A 4B3BA 3NBXX 1XTIA 5BQ5A 3AP1A 5KOYA 3FHTA 1OYWA 1DAHA 5E95A 2GXQA 3K09C 1EFHA 1GNQA 1E2GA 1TQ2A 2WVJA 1E94E 4KSCA 4V02A 3GLGB 4URUR 4M4SA 2D7DA 2IUUA 2ZJZA 4HB0A 2RB4A 1GFIA 1UKVY 2Q6TA 4DLSA 5FPSA 3RRZA 4ZDKA 4HYYA 3U6KA 1UAAA 4W9MC 2J0UA 2Q21A 1IOZA 2ZRGA 1E2JA 1T5LA 3AM1A 1R8SA 1P9NA 3SQXA 1NBMA 1W36B 5KSOA 1AS3A 1ZYUA 2F6RA 2GETA 1OXVA 4WVFA 3EIHA 4D4LA 1N25A 2HCJB 3PG5A 2H5EA 4MUBA 1E2DA 5FTLA 3AVQA 4CEHB 2BCJQ 3A1VA 2OCPA 3T15A 1GRNA 2QAGC 3KJIA 2B7BA 2VA8A 3UIEA 4EFLA 1W4BA 2B8WA 2CNWD 1VCMA 4ZCMA 3H84A 3ASYA 1FPMA 2BMEA 3GLIA 3VR5A 4LX0A 2QROA 4DVGA 1II8A 2ZXUA 4B3XA 1KMHB 2A5DA 2FPKA 5EP1A
chains in the Genus database with same CATH superfamily
4X1IB 2V8OA 3JQBC 2QD4A 5TC4A 1TA0A 1X15A 4G1BA 1IXKA 4MO9A 2HFJA 13PKA 1T0JB 1T9GR 1C2YA 2G5PA 2JFOA 3GO4A 4XGNA 1IBRA 5CEFA 1E0AA 5DX8A 3RODA 1KJ9A 3LAWA 1QVAA 4AO6A 1D0VA 1CQIB 1G5FA 4M46A 4PC7A 1Y4UA 3EG5A 5AHRA 3LFUA 4LMRA 3FNEA 2EHDA 3JQGB 2QM0A 5D5PA 2PEYA 2Q6IA 2HFKA 1ORIA 2R6JA 4RAOA 3ESAA 3DPUA 3HU1A 5B3LA 2BFCB 3VO9A 2JI7A 1HETA 3HDVA 1CUSA 4GGPA 2AOUA 2KX7A 3AGPA 1YBVA 5L45A 2R68A 1EIWA 1P2VA 3UJ9A 4O4IB 5DT2A 3ZGLA 2GQ0A 1HNWB 1DKQA 1DTSA 1U0BB 2HQBA 4PC1A 5LZ5A 2ZTLA 3AV3A 3O8BA 2NQ2C 4KE8A 4KMSA 2CVFA 4CNBA 1U0LA 3Q6NA 3OSUA 4EA7A 5J2UA 4TYQA 1GZ6A 2BGGA 2B4QA 1RXWA 2F1KA 4W5WA 1XVLA 4NCNA 2IHJA 3RJ9A 2WTUA 2J0QA 3WHLA 3RVNA 4IMJB 5ADWA 1TD9A 4YMVA 4UQOA 1SJ9A 4F2GA 4EPWA 1ZGJA 3LY9A 5AM5A 1AN0A 2RJ3A 2VDWB 3WMFA 4AKSA 4D8WA 1DRWA 3WK4A 4ZIRA 5EI5A 1X8JA 1Q0HA 5DYTA 5E7MA 3MFYA 1REQA 2XUJA 1I7PA 3JD3A 3NXKA 3MN1A 1AUVA 4QQRA 3PC3A 4LXQA 5IMBA 1T5BA 5HIAA 1L3IA 2P90A 3PIRA 4MOWA 5HGJA 1Z0UA 3AUAA 3BG5A 4D9JA 2VAVA 1THMA 5E0KB 2QIOA 2NUPA 3NOVA 4ZU1X 3VV2A 2GN6A 3ZCVA 4F91B 1QIHA 3OE1A 2PYDA 2ZUDA 3LCJA 4KO8A 4C4TA 2HJRA 4CYMA 5EEHA 4WFQA 4GLFA 2CVZA 1L5WA 4NCIA 5EXPA 2VPZA 1YXMA 2Q1WA 5HBGA 1D5CA 3OF3A 1GV1A 3ZZTA 3KOOA 3OG9A 4BLTA 4C0HA 4U3JB 4A2WA 4L50A 2QN2A 1I4EB 1JYSA 1MA3A 4CIYA 1SCIA 2GHIA 5EIHA 1MT3A 2QQEA 1NUAA 3ZZNA 1H6AA 3TIXB 2WBLC 3ZWAA 1OYOA 3CX6A 3CZAA 3G5AA 5C81A 1EXNA 5D51S 4YCBA 4KGZA 3PDIB 1XZHA 2W2OA 4O4LF 4OBEA 4B3CA 2VF8A 4I46A 3RVSA 4HNQA 5AT1A 2PKCA 1RYYA 1V16A 2DUMA 3FBWA 4HEQA 2WYUA 3WRYC 4YO8A 5E9QA 5CYFA 2DULA 3LBFA 4B82A 1PVVA 4ZQGA 3HA3A 1I51A 5G1PA 4DV6B 1PDVA 4B43A 1GPNA 4F60A 1GAWA 1UBFA 3GL9A 1CJVC 2BL4A 2WU3A 2HA5A 3DZCA 3GJ4A 1XKXA 1E66A 2C9BA 2HWUA 1T9BA 3G6WA 2CXSA 3W4IA 2QVBA 4WZAB 3TLEA 3W5SA 1G5TA 3WIEA 5HWSA 2AN1A 3OA2A 4GR4A 4N4AA 4C20A 1Y6FA 2O2HA 4LRWA 2YNMA 5KOHA 1B8OA 1WBJB 7ADHA 1KK2A 3WB1A 2A3NA 2Z3ZA 4TZ0A 3ZWBA 2QT0A 3PC8A 4CQMD 4AQYB 1Y81A 2JD2A 3I0NA 4NMLA 2JH8A 2QYTA 2W43A 5D6NA 4F3YA 1UQUA 3RRFA 1DPGA 1NP3A 3BFPA 1U2RA 3JASA 1O4VA 3EZFA 4CMBA 3OJEA 5JJIA 2I4TA 1E5TA 3M6FA 1MOQA 2OCBA 5CGZA 4PG5A 3FLMA 3ECSA 1PWXA 1R88A 3LF1A 1FNNA 3AETB 5CX4A 1DJMA 3H3XA 5TJHA 5G0UA 4OLBA 4E1AA 2D54A 2ST1A 3IP3A 2WUGA 5L95A 1SOUA 2NXEA 3ONVA 1SD5A 3GRYA 2C2OA 1QQ7A 3HSKA 4AWBA 2CZCA 5LM3A 3DTTA 1OAAA 1SM4A 3KYIB 5G3ZA 2QSJA 4YGYA 2O2ZA 1ZGBA 4OKNA 5DBOA 3O3OB 1HXHA 2DUJA 2QZZA 1GWNA 1Q1NA 5E8JA 3D3NA 4Q18A 1F6WA 3DEFA 4WK6A 3MOIA 4P4SA 1EWYA 4MV3A 4YX9A 4WRRA 4JNKA 5FNVA 4Z8YA 2TS1A 4RPCA 1UT8A 4IJVA 2IV2X 4UPEA 4EG1A 1J42A 4MWSA 3USZA 1Z15A 1QH1B 3PUVA 1UXOA 5ETJA 4PC2A 2G7MC 2NM0A 1BU8A 2FDRA 3UMBA 3K9HA 1D2RA 2ZR7A 3AVUA 3P4YA 2FLKA 4UNIA 4ZYTA 3GGCA 1H94A 2UUPA 3E7XA 3WWYA 2LWIA 1SIWA 2XZPA 4W8HA 3ZU3A 5AVWA 4RZHA 3NWOA 3E7WA 1Z47A 2OAGA 4QYIA 4AS3A 4E07A 5KX5F 1IL0A 1YZVA 2QTTA 4FHEA 4G5OA 4PSDA 4RKWA 4F2WA 1SMKA 1Q7GA 1AS0A 3RYIB 3TSCA 2VCHA 3IQWA 3T0IA 1WCV1 4YNBA 4PR0A 4IIFA 1H9CA 1DX4A 1K0UA 4NLLA 1H8HD 1MTOA 1SBNE 3NG1A 3FOCA 2WWGA 3OPYI 4WZAA 4AXBA 4HH1A 4FDLA 2PBRA 1IN8A 4FBLA 1QSGA 1RQLA 2VVTA 4GM1A 4JLSA 3K6SB 5EJ5A 3FMOB 1C7QA 3MCZA 4DMGA 1KZ6A 3ZHYA 2X3UA 2HI0A 5EKTA 1XZJA 3GRFA 5CVJA 4LQCA 1BKYA 3PQ4A 4YGXB 1V1MA 1NUHA 3KVYA 4CG1A 5K8CA 2CDRA 1GFSA 4DWWA 3P5BA 2R00A 1YT5A 3U7HB 4AZ3A 3TMKA 4N82A 3PQ8A 3P9SA 4ENSA 4D5EA 4BUJA 2JLVA 3GRAA 2X3FA 3IAS1 2H3EA 3Q0IA 4HQNA 5HSGA 2NSLA 2QJFA 2R8XA 1J2UA 3TYXA 5KTSA 2FCRA 1G8HA 1N6KA 1XRPA 3ZNOA 2OLKA 2JJ1D 4D02A 1QX4A 4G0OA 4DLLA 5KYKA 4ERNA 2O23A 1XMSA 1MOSA 2NX2A 3RK4A 1WABA 2Q4TA 3QPBA 4HFNA 4MW2A 4PG7A 1SHTX 4LBWA 3ZQ4A 5JHHB 4ARIA 1A4IA 3VH4A 3ZZUA 2ERYA 1U7HA 1Q1AA 3KWMA 4R0MA 1O5TA 4I3FA 1XVUA 1QTNA 4LJ6A 1MB9A 3IT0A 1R4MB 4W7HA 5HJ2A 3QLJA 4CCSA 2FPIA 3CVUA 4KYTA 2Q9AA 4ZYLA 2O8VA 1CT9A 3WMWA 4A8HA 3WLJA 3CKKA 4LYYA 2V0GA 1R5JA 1NP6A 1KZYC 1U99A 3BHNA 3QHQA 4QOJA 1EAYA 2ZUUA 3F8TA 3JZFA 1FYDA 1TLTA 4K81B 1G5RA 4BN4A 4XE5A 2W37A 1QPBA 1SKYB 3KJHA 2A33A 3JWPA 1US8A 3N76A 5FBZA 5LBIA 1ZI8A 2AUTA 1TVKB 1D4OA 3TTXA 2I9PA 3CUYA 4NTZA 4BPBA 1T2EA 3NDRA 3VO2A 5DHSA 2X13A 3CUEF 3IVXA 5AHKA 4TOIA 4F8JA 2IDMA 3NHKA 1RRGA 3O4GA 1XA4A 3HUUA 3KB2A 3Q9LA 4HFJA 1VCHA 3TZBA 1Y1LA 4BIMA 2GN1A 2QAGB 4R9SA 4Q21A 2OO7A 1V35A 3ZJTA 2QJWA 1JHDA 2KI5A 5ALWA 3VFDA 4DNQA 5EZYF 2C2HA 1GZDA 2GEKA 2R6CA 2QUBA 3B3QA 3FOZA 2PSJA 8OHMA 4O2AF 1JTVA 2GESA 1Z4OA 2A0KA 3NALA 3IE2A 1W46A 4H3VA 1MJGM 3H0EA 1S4QA 2EQAA 4H4DA 3C8MA 4HAWA 2YJGA 4G9GA 3AR8A 3RVPA 4B6QA 2HU8A 2RGXA 3FPJA 4WJKB 5EUBA 3RAFC 3C3DA 3VAAA 1OYYA 4YI3A 5HEKA 3V8EA 3UATA 4OX9Y 2V6MA 1SPBS 4XWOA 4CT5A 4US0R 4JLWA 1UXJA 1P1RA 1L5ZA 2GJ4A 3F5FA 1FFEA 3L0DA 5DDIP 3M9XA 621PA 1I4WA 1R15A 2AXNA 1JSXA 1SIOA 2H59A 4X8OA 3ROZA 1P7YA 1T2UA 3B1ZA 2RB5A 1HL3A 3D2LA 3Q85A 3RS5A 1PJZA 1IXYA 1HRDA 5ALOA 4U4AA 5EJIA 4Q6BA 2YV1A 3PGMA 3A4LA 4HS9A 1J1IA 4D0RA 2Q49A 2ZSAA 1XCPA 4IJ5A 4D4MA 1EZ4A 1SB9A 4Z0TA 1R3DA 2H5JA 1AIPA 1NKSA 2YC2C 4E5VA 2CV0A 1V39A 1JYFA 3I30X 4P33A 1VKZA 2E87A 4UXHA 1COWA 3QLUC 1IHYA 2D8MA 2I3ZA 4INZA 3TJMA 4YCAA 4BEJA 4FKMA 5U1PA 4B7AA 4ZWNA 3UWMA 2XZOA 2DWUA 2G9QA 1C9KA 1V6CA 3AJ9A 3DC7A 3GFPA 5FFFA 3RU9A 5CFMA 2IEAA 7YASA 3QU7A 4ZI5A 4TYYA 3MWKA 3R7WB 4K1LA 4QUJA 1FDTA 4JP5A 3WL8A 4RIHA 4KQXA 1O94A 3FMPB 4F7DA 2ADFA 2C2GA 3F98A 3E0XA 3QY0A 4RDCA 1ECGA 1TAQA 1TXGA 2NT3A 3E3MA 4UUBA 4BZXA 4LY0A 5E1MA 2Q2WA 3GD7A 1ULTA 4C7VA 1P7PA 3VR6D 1YDMA 3IUEA 3IVGA 2AZ4A 4RA6A 5H4GA 3K35A 4OCZA 5ECWA 5IBQA 1WXIA 1E2NA 1NASA 4AW9A 1O5IA 3MLBA 1UBHS 1SG9A 5H82A 1YR3A 4D9IA 2JI8A 3ZHCA 1JPVA 4QJ3A 3WK6A 4MGEA 3SX2A 3N2GA 4D4IA 2RI6A 4RWZA 5I7HA 1ZJWA 3KSMA 4YHBA 2P69A 3KVOA 1FP1D 3H8WA 4GQBA 2AI3A 1CZNA 1NI5A 1XVTA 5IVKA 5H3LA 1ECFA 3P0JA 2F2TA 2WQ7A 3H11B 4TMVA 3ZK9A 3ZWQA 4CQMA 2BFEB 2WYIA 1NOIA 1DV1A 1FFSA 2XMSA 3K9CA 1U3UA 4HTFB 2QT9A 2QG6A 5EUMA 1X7WA 2XITA 4OB8A 1WP9A 2FTKE 4OLJA 1X39A 2FW7A 1DC3A 1PF7E 1EFTA 1OI2A 2UZ3A 1K6IA 1H1TA 1U9ZA 3AH8A 1VL2A 4TWIA 3RM3A 2C7OA 3NC0C 4QXPA 3VMFA 2WWWA 2PWBA 3CMCO 3AU9A 1ELOA 1XMXA 2EFHB 4ML3A 4FQ5A 3AEKA 5F98A 5IABA 4GR5A 2VNJA 3H17A 2UZ4A 1JLMA 4MA5A 3ZCSA 1IN7A 1TO6A 2R84A 1TZ2A 5JEEA 1PFGA 5GJWC 2H8GA 3IILA 2W6ID 4RMNA 5DM4A 2Q7OE 3TDKA 2CF6A 2A4MA 1WSWA 1UAGA 2FXIA 4JJ8A 4X41A 4XUEA 4DMUB 1TU4A 1LX6A 1X9HA 4FR5A 4K9PA 5CDFE 3HGMA 3U6BA 1Q95A 3UW1A 2HMUA 2AN3A 1QGZA 1R6BX 2VT6A 1U7OA 1ZIDA 2DWPA 3ROMA 4QOIA 1Z7YA 2JKYA 5JNUA 1OXMA 2IPMA 3HGQA 3HBFA 3VR6A 1T6NA 1A5AB 2H06A 1M2JA 2YHIB 4K40A 2R4TA 2OXTA 3NHYA 1OGIA 2WVAA 3I9V1 1Q3KA 2NTYC 3IHWA 5C32A 3IDOA 2P4SA 2IFTA 3SQWA 2X1LA 4OLAA 3N0RA 2HLDA 1FW6A 1F2TA 1RWMA 2AJBA 1SCUA 3IH5A 1ZCFA 3S1LA 4O2BF 1P5ZB 3RRMA 5FF9A 4QTYA 4ZYVA 1X3LA 2BFFB 4NCJA 2IV3A 3HCWA 3ZGOA 5BNZA 1M73E 3S28A 4ZCSA 2BEUB 1IQUA 2FOIA 2OY0A 3UCXA 2JAWA 4WACA 4E5YA 3MJHA 1LQUA 3KOWA 2RGWA 3FJ1A 2JW5A 3NWJA 4I55B 3HJNA 3BX1A 2C7QA 5BUQA 4XWYA 2RHLA 2FMFA 1NYTA 2XTZA 2VWGA 3OCWA 4D0SA 4XJSA 3N1UA 1GCUA 1Z12A 2F43B 2NVBA 3QLTA 2F1JA 1AKYA 3LO8A 1H0HA 3CVVA 2QRLA 4IX9A 4XTRA 4GOND 4YDSA 5BSVA 4BASA 3LL4A 4Q3DA 2GXUA 3T5BA 1P0FA 1IEQA 1L5HB 3O8DA 4S1WA 2XPCA 1G6OA 1JZTA 2QTVB 2M1XA 4P80A 3LRTA 1W1IA 3FHCB 5CBPA 3JV7A 4MQBA 4G4IA 3BE8A 4F4FA 2H4ZA 2IZ5A 4MQEB 5FCDA 4RPKA 4L9SA 3AXSA 3C87A 2C9ZA 4OY3A 5MDHA 4MUKA 2HDHA 2HUPA 2WPDD 5CJPA 5AK5A 1A9OA 4KR6A 2QTWB 1A5TA 1EDBA 1U04A 4L0MA 3CR8A 2JGFA 2EDCA 5DRYA 5GIOE 3B1WA 1RPJA 4QU5A 3TLGA 2WICA 4X00A 1T10A 4DCGA 3AF0A 3AJ8A 4OFWA 4CLRA 1JKXA 3K32A 2DRIA 2VDJA 1AV7A 3D1JA 1PV1A 2PX2A 3TINA 1QP4A 3LVRE 3IAS6 5E3JA 4LF9B 1CD5A 1NLMA 3U3DA 3CONA 4CHTA 4KQ6A 2WQZA 1XO1A 3T9AA 2Y92A 4Y6OA 4IKEA 1M8KA 1R3UA 3QUAA 4EPTA 4FEAA 1LI5A 1I3LA 3IXMA 1LF0A 1JA0A 1B73A 1I4LD 4CBVA 4EGCB 2JFQA 1SU6A 2RHBA 2JFXA 3PVCA 1NDHA 3WRVA 1YA4A 3AONB 2VWQA 3TZQA 3EA0A 3INTA 4Y2TA 2VHVA 5J1TB 2EJTA 1G18A 2XMBA 3EGWA 2ZOSA 1JMKC 3OQ6A 2AZTA 5KU1A 1LX7A 1Y42X 2IOHA 3V8RA 1MOZA 1YHYA 1ADGA 4YY3B 1IPHA 4KE6A 4ZMBA 1ANKA 1YOVA 4JI8B 3PX7A 1K3TA 2Q3DA 1N0HA 1QYRA 1DT5A 3J81k 2DR3A 1OLUA 3BZWA 3MGKA 4UNNA 4DA7A 1YRAA 4NH4A 4XPIA 5FO0A 5TS2A 1GSAA 3LA8A 3MTGA 1T5SA 3W7AA 1CEYA 2UVPB 4B6OA 2A5YB 4I1UA 2Z9CA 3FDZB 4JVLA 3Q8MA 1A7KA 3LQQA 3DDCA 1KFCB 1G21B 3SZUA 2SCUB 4MGHA 3RJZA 1YL6A 2Q8NA 1SUSA 3V9AA 1WR8A 2GPYA 2E6KA 2IUYA 4RUKA 4TLMB 2X9NA 1U11A 1LBIA 2HZBA 3RT7A 1M34E 3ETNA 3V4VB 1VJCA 5FA6A 2CDNA 5LZ9A 1LD3A 4U1RA 4UE3S 1HNXB 3KL2A 1HZZA 2MHCA 2CL0X 3GFVA 4GM0A 4J6EA 1N2SA 3SC6A 4ARVA 1NUTA 3ENQA 3O8QB 5AK3A 3G8AA 4FOPA 5KQSA 1G66A 4KTTE 4O1HA 1PSWA 1R6XA 4HYEA 5KTTA 1FFHA 4TKVB 1NRJB 5IKMA 2HHLA 1YFKA 2XQGA 4JBXA 2P4UA 1UJNA 2OGTA 3ORQA 3PKZA 5JH7A 3WLHA 4H4CA 1ADCA 4CKYA 2CLFB 4HAOA 1YC2A 3ADBA 4CEJB 3LT4A 4R3UC 4IVNA 2NYVA 3I32A 1IUKA 6LDHA 1Z13A 3QNMA 3B7PA 3W6OA 4WCVA 2G1UA 4JLJA 2XLBA 1V4NA 5IF3A 4YCJA 4CI9A 2NGRA 4JJ7A 4I1VA 4OQNA 2ZREA 4M87A 1TJPB 2QN7A 3IBTA 3DCJA 5FIUA 4NZNA 4PGAA 5EERA 2Q29A 3R3SA 1U0GA 1E3IA 1UL1X 2PEZA 1NATA 1EJ0A 1H2RS 1P7VA 1Q17A 2VDWA 3Q3VA 4LDAA 3C7TA 4R6WA 4ZIRB 5HUJA 5KYTA 3DOOA 3IT1A 5GONA 2QL6A 4EUHA 2O1XA 3SJUA 4R1OA 4X91A 2DJ5A 3UJ8A 3VNAA 2O8BA 2I66A 4G5GA 5CP8A 1MRNA 2H2GA 3MWLA 4ZAGA 4EA6A 2R8ZA 3T0GA 4YPFA 2B8JA 3ROFA 1Z33A 4TQGA 3V8BA 2L0XA 4LCBA 1ITZA 2IP4A 2VWHA 3PQEA 2VBIA 5ISMA 2A8YA 1RWOA 5FLYA 1E3DA 1PZXA 4X8LA 2R8PA 1GCIA 5C7LO 1XTJA 4B6EA 2PMEA 1ZD4A 2WZQA 1REQB 2WYOA 3L1KA 4WK4B 3O0DA 3IOBA 1ADFA 1AKNA 3AV0B 1T3ZA 5FWDA 4J94A 3EA4A 4MVJG 2IZ7A 3O03A 4DLXA 2VQ3A 2N46A 5B64A 5CFZA 5PGMA 1XPOA 1NW6A 1QZXA 3L9WA 4FD2A 3KJQA 1ISGA 5ALIA 4YRSA 2NNLD 3OLWA 6CHYA 2HADA 2Y1DA 1J2EA 2Y2VA 5E4JA 4EO9A 1I32A 4PHTA 2ZJ0A 3LXMA 3PUKA 5DWDA 5CDYA 2VZ0A 3H7AA 3KVNA 2FXVA 1Z6YA 2J59A 3JQEA 3E2MA 4KITB 3PDWA 3K5HA 4WHMA 4YFYA 4L4YA 4WECA 2EWVA 5BRNA 1J1ZA 1K7YA 2IU6A 2ZPTX 3ACCA 4FWIB 1EG7A 1FQOA 1HH4A 1WHSA 3DMTA 4PC3A 3VKWA 2X7JA 2WSSA 1BX1A 2I7VA 2QRQA 1FB5A 1BCSA 1LKZA 1RWWA 2BEJA 3LZ6A 4OKIA 5TRTA 2PH7A 3TXYA 4NXNB 3N70A 5E1OA 1WOMA 3IL2A 2CD7A 5FP0A 1UMBB 3MB8A 2Q3FA 5E1DA 3M4ZA 5A5GA 5K20A 1GCAA 3WBJA 3VZCA 3A7EA 2X41A 3K5IA 1XD9A 1YJBA 4PHCA 4LXGA 5CLLA 5EE5B 3L4EA 3WQRA 5FOTA 3VUFA 6NULA 4B6JA 1OXSC 5LNK1 2ZE7A 1C4XA 2MU1A 4OQQA 3CUTA 3H5LA 1QAOA 1T2AA 3EYWA 2YICA 3I5AA 4JR2A 3KWLA 4JT4A 4L57A 3VA7A 4U0JA 1KJWA 3LKZA 3T7KA 1WY5A 1G19A 1NA5A 2JVJA 1HUQA 3OC6A 5JMTA 5DNWA 2LNDA 3R2JA 1HDRA 1TYZA 4JKIA 1TECE 3QBDA 3WFJA 2R8YA 2OD2A 3IJ5A 3A4TA 3OOWA 3TDMA 3UTDA 4GSLA 1VMIA 3BMOA 1ID1A 1O8CA 3DBLA 2V7BA 3BSFA 3G5LA 4HX2A 1FNMA 5JTTA 4RD4A 2XT6A 1EGQA 1EU1A 1FSZA 1PK9A 4B46A 3VR2A 4DTIA 4QIHA 3E7FA 4XUCA 4MHOA 3I23A 3KQOA 1I2ZA 5MN4A 2YS7A 1QBKC 2GBGA 3L79A 4V0NA 3U37A 4Z4QA 3DZIA 4ZVNA 1OY1A 3TPFA 3ZHSA 2YWEA 1VTKA 5JYDA 1E3WA 3RS4A 3VSDA 4TQUS 2BBWA 3QVKA 3BCHA 2CLLB 1HYBA 1WB6A 1QH8B 2GPWA 3BWCA 3RBAA 2HXGA 3EGEA 3IJRA 1A88A 3FY4A 1U3CA 5KUTA 3W8EA 5C5IA 1PBNA 3A1DA 3ILHA 4H7JA 4LK3A 3H9EO 5HKOA 3K0HA 3IA2A 3PUJA 4G1MB 3WDSA 4C3OB 5HFJA 2FX5A 2ZJAA 3LDAA 5JMPA 3C3XA 2YJTD 4QBFA 4F4DA 3E82A 1K06A 1Z8HA 4GQIA 4EQ6A 4NYIQ 1U5BB 3U4CA 3ZY4A 1BMFD 1QDUA 5AW4A 2W93A 5IN4A 1MO6A 4Y6SA 3MTBA 2PX5A 1CB7A 2XF2A 5HKBA 3C43A 1KC3A 1RHKA 5KQGA 4QYWA 2Z08A 3B1JA 3H4IA 4AB1A 3U7IA 3LOUA 4RHCA 4YRRA 3AQIA 3HWX1 1SHKA 4RGYA 4AI6A 4NV0A 7GPBA 2F48A 1ZIPA 3ED5A 2AV6A 2FEOA 4RKRA 2VBCA 4OM7A 4AG3A 3IEUA 2QNIA 1YONA 4V24A 2W9XA 1C3XA 3F6PA 3M2TA 3KB6A 1IZ9A 2A78A 2PT7A 2VATA 2ZS9A 4JENA 4KU4A 4HLQB 1WDLA 2FWAA 2WJGA 5CT5A 1TMGE 1M74A 4W63A 2IPAB 3PJRA 4HLUA 1ZLYA 3LQ2A 2JHFA 3A14A 1ZUD1 2B5VA 2PS1A 3BMCA 4OYRA 4OHMA 4K3VA 4AF6A 3TR5A 4ER7A 2DHRA 4LW8A 4GLBA 2IK8A 4PLVA 1USVA 3KTDA 4CNQA 2CF5A 2OHHA 4YHHB 3DLBA 3D4IA 3MBOA 5EPUA 1EBUA 1DAPA 5DGTA 3OMWA 3M89A 3Q12A 3NM6B 5DI3B 3SYKA 1Y6JA 1TM1E 2MSNA 4M53A 4EHLA 1TZMA 1R0SA 2FN3A 2IU4A 5E2BA 5AXBA 1U0SY 1E9BA 5LJIA 4TXJA 1UBMS 3ED1A 1EFVB 1H6DA 2ZSUA 3PNVA 5DBHX 2PU7A 1TK9A 4IVRA 2BOVA 3PUYA 1XCBA 5TDHA 5IYZA 4KXUA 1W581 2XTJA 2YH2A 5G53C 4TXLA 3Q98A 4G0YA 1QV6A 4W1PA 5BOSB 5LP6C 4HD8A 1MO3A 1TL7C 1VIVA 2VJQA 1LDMA 3I9NA 4M37A 4UEKA 2X1HA 1MC1A 3B6JA 3B5JA 3TB6A 4AX8A 1FDVA 1UWLA 4L5JA 4D7AA 2BT4A 1G42A 4TT3D 2HHJA 1MLDA 2BEVA 3D7LA 5K0CA 2ZM5A 5D00A 2ZTSA 1QQ5A 2RFLA 3JQDA 3T3GA 5KINB 2Q9BA 2HJWA 3EMDA 2JGIA 4GF5A 2WD7A 1P0PA 1LF5A 2H31A 2O5VA 5L6LB 3CLRD 2PMDA 1FS4A 2Q2OA 1NMQA 2VNIA 3D7KA 1EBFA 3JD0A 3NAGA 3E0QA 1V1RB 4OHPA 4R98A 5DISB 1PTKA 1K8QA 4D92A 1F6DA 1SULA 2Q1YA 2WUEA 1RRPA 3DKIA 3GQVA 3H6KA 3SQLA 5BRAA 5IARA 1HT0A 2DFKB 4GC9A 4NAVA 1S5PA 4PRKA 4KQEA 1KEZA 3AKEA 1AH2A 1JILA 4YJ3B 3CB4A 4QU0A 4BB6A 3EPRA 2VS1A 4URYR 3V4SA 5JZMA 3NC1C 2QT1A 1RQRA 7REQA 4PHGA 4EFMA 4RESA 1CY0A 1JFLA 1P6QA 4FGUA 4X92A 2A5FA 4YONB 3H5TA 4GOJA 3OA0A 5AKGA 5F52A 3GVXA 4TL7A 2PWPA 4K05A 1QGED 2FK8A 2PZLA 3H1TA 1IB6A 1KSFX 1YJXA 2X40A 2ZQYA 4U9IS 1GXSA 2GXSA 2B82A 1YDGA 1GVHA 3ZKAA 4PVCA 4HQOA 2ID9A 1VLQA 2VAWA 3O8QA 3U3XA 1ECBA 5HFNA 1GNSA 1DBRA 2IHZA 3K73O 1WW3A 4OGKA 4FEYA 3B60A 5FORA 1U28C 2Y6UA 3FZEA 1O97C 2WP8J 2EZTA 1ZJJA 3NKFA 3OFNA 4XD7D 4FYYA 3WLIA 2E4XA 4BAUA 4MWZA 3LV8A 2R7KA 3U19A 4L0QA 1EEHA 2VHJA 2OWDA 3DFKA 2Z6AA 3IAAA 1TRHA 5F1YA 4KODA 1J0EA 2RAFA 3D0RA 3PD0A 4PX9A 5HRCA 4X1KA 3F9IA 4RH0A 1G0NA 1FYVA 4LRQA 3WKDA 1CRLA 4GMDA 1QORA 2BHNA 5BOSA 4DUZB 2QLNA 1U3DA 3C3JA 3LBAA 1J99A 3EBLA 3Q7TA 2EBWA 4NMXB 5JSZB 4JT2A 3SJAA 1UUFA 1VJ5A 3FNIA 1LGYA 5K0GA 2IYYA 4RXUA 4WKOA 2I1QA 4ZEOA 4OQMA 5GY7A 3T35A 1KBQA 5IZCC 3STXA 3FWHA 3OCZA 1QR6A 3DMTC 4HXGA 4MARA 3NM4A 4WUVA 1DWOA 2PO7A 2DPGA 4QJ4A 5LA6A 2RK6A 2E7ZA 1U7ZA 4G0WA 4U5XA 2RGYA 2C57A 1XROA 4OXIA 1YB7A 4YLGA 2ACWA 3I58A 4MI9A 3T7AA 3W5DA 2W4IA 5ELLA 2J5QA 3UANA 2X0NA 3IUQA 2KLHA 2ODEA 1HDOA 4IMPA 5FBWB 4X66B 5JAMA 3AOEA 4OTZA 1MVLA 1T0PA 2WKWA 3V1MA 5K8VA 2B8EA 1KYQA 1GPMA 3IBSA 1XPJA 1E79A 2HMAA 1CV2A 4LDZA 2OCYC 4L75A 1DBSA 2X7XA 1C3LA 1SAYA 5FXMA 2OCAA 3G2QA 1PJ2A 1PQUA 2FG5A 5BP7A 4RBNA 3IDZA 2Y68A 3H9BA 4BX8A 3WRYA 4Y6GB 2NZ2A 3KTAA 5DN9A 2B78A 3PHIA 1WMFA 3NIFB 3HSYA 2TECE 3WAGA 2RC5A 5A4IS 2YQZA 3I3OA 1KYYA 1RLJA 3SXPA 4BS9A 3LIPA 1Y7LA 1A2QA 3SS7X 3SKXA 4CF3A 4GS5A 1YRYE 2MYNA 5C8XA 1MUUA 1VG1A 2J9ZB 3A6LA 3KHKA 1IY1A 4QQFA 1XP5A 3WSTA 3UGTA 4DC0A 4KAXA 4D4JA 1Z26A 4E21A 2CVHA 1JJFA 4OVKA 2VXYA 4U7JA 2D3WA 2G67A 5EWMA 4U8GA 1DDGA 3CNEA 4BKOA 2CBGA 3HEMA 2DKOA 1IVSA 1UXGA 4QFDA 1OC2A 3L7LA 2X4GA 4F0JA 5EP4A 5AUNB 1U63A 1N8TA 3ESBA 3FAZA 3QXXA 4ZODA 4Q1DA 5MFZA 2JLWA 1XUOA 4Y9UA 2AJ8A 2IJGX 3OX1A 4KX3A 4DUGD 1VE5A 4EYQA 1K92A 1GL9B 1R1DA 2EKDA 2VNKA 2P1ZA 5TIIA 4TLBA 4IWXA 1YFLA 1L5RA 3DNPA 1XQ9A 4TRMA 3K1YA 4YUZA 1K1EA 3NTXA 5AW8A 1WNTA 4V39A 5EIBD 3G23A 3WGKA 1RQ2A 2PUWA 4GYYA 1RAFA 4PV7A 4JLDA 3SG0A 3NS7A 5JS2A 3IE0A 5AVXA 3KE9A 4QWWA 1MW8X 3MQFA 4XH9B 1KP2A 2BGUA 2IZZA 1YRLA 3C5WP 3D7RA 3IOCA 3Q6IA 1VP3A 3OKPA 3QPCA 2FW1A 3OCUA 2DQ4A 3NOQA 1AGXA 2XRYA 1KDTA 5LYYA 2ZRPA 3AYZB 1SN7A 4S1OA 1SO8A 1FMLA 2HNBA 3D3WA 1ODIA 4X62B 1SA0B 3GAMA 5JI3E 2J48A 2QTMA 4PO3X 1ABFA 2JDIA 3HDHA 2P2CA 3H6GA 4UATA 2I4LA 4JJAA 3WKAA 3FYUB 3OTGA 3ZS9A 2Q27A 2GPJA 5KNDA 3A1CA 2JZCA 5AOBA 1ZH8A 1TAGA 4DY4A 3DT8A 4Z7QB 5G0TA 5LA6F 2R6HA 2XY4A 3W4JA 5KO2A 4UU1A 1Q14A 3UMMA 4GVXA 1MKYA 4XUGB 2O59A 4D79A 4N5HX 5I7UA 1DUSA 4R2IA 4F2HA 3JQQA 5ANRB 3BK2A 1MO5A 2E4WA 4TTQA 1Z0AA 2QM3A 4EG8A 1SUIA 1I6WA 1V45E 1XTRA 2WAMA 3OTHA 2PMFA 1T2DA 3WNZA 4UE6A 3H8SA 2REQA 3U17A 2PS0A 3MTJA 1KYIA 5IHXA 4F9FA 4FJ0A 3UJBA 4OL0A 3MWEB 1E6WA 1JR3D 3TL2A 3ZV4A 4LRYA 3MXOA 1ZU4A 3KR2A 4YV0A 3S29A 2ZSDA 2H0RA 2JD1A 4DMRA 1NUUA 3RQSA 3JASB 4MR9A 5C4IA 5KWEA 3CNQS 4J7UA 2M6LA 2X22A 4LYHA 3DOUA 2IPOA 1A7UA 1J8QA 3KU1A 3ZI0A 4ARBA 1WV1A 3N3BC 5B58T 2NOAA 5C1IA 1XKQA 3QA3E 4JBWA 4B40A 2AR7A 1UMCB 3C3MA 1RWKA 3D2AA 3BIXA 4RMGA 3VHLB 3HPRA 3T7CA 1PEAA 1ZJ5A 2N1BA 3WWEA 5JS8A 2PJUA 1WX1A 3QW4B 2JRLA 1PNOA 4OMFG 1NW9B 5DMHA 2ATVA 1DCTA 4I4CA 4KI0A 4RPGA 2OCLA 1CZKA 1UMDA 4ILKA 1K8RA 2IVZA 3IAM6 4WCFC 3KEOA 4CV1A 4E6PA 1MPXA 1ZD5A 4RYDA 4BVKA 1Y8CA 5FRDA 3WK8A 6REQB 4E5PA 1FA9A 1IAQA 1UPCA 4GW3A 4Y0VA 5C8YA 5AO9A 3ROXA 2HK7A 2COEA 2X58A 2IYXA 1MFZA 1DKRA 3FDZA 3FYCA 3GUYA 3K92A 1R8XA 1IBMB 2NO9A 1BE1A 3KXPA 4GZMA 4YALA 2IUFA 4NZMA 4MI6A 4PINA 1CETA 1MC8A 4LK2A 4RHUA 2M6SA 5EXTA 2NAFA 4ASUD 2WIBA 1NX9A 3C1AA 2VPPA 3IEKA 2D1YA 2WPNA 4ACAA 1GRCA 4EB8A 3G9QA 2M98A 3CEHA 3EULA 5A06A 1KI4A 2XUIA 1PR9A 3EMVA 4K26A 3SLRA 4DIMA 5BV7A 5BSWA 4BY9E 2BFCA 1FUEA 1D8AA 4P4SB 1X7YA 2PFKA 2DPXA 4G5RA 1LBQA 2XGOA 3IMGA 4E4RA 4JOSA 3DOIA 5IM4F 2HGSA 3SS9X 1ODKA 2C4TA 5ENVA 3AUKA 3GJ0A 4DG9A 1K0FA 1AM4D 2KW5A 3QMWA 2P1RA 1E3MA 3ICEA 3P97A 4CE6A 2QI9C 3KJZA 4OBWA 1JKMA 1XZAA 4X45A 5EMMA 1JHAA 5IEJA 2PZAA 3DEAA 4Q4AA 2OV8A 4FONA 1N57A 5FTMA 5JS1A 2PH1A 1Z38A 2PVPA 4JR1A 4D99A 2ZRJA 2B4AA 5CJ2A 4U02A 1AQNA 4YREA 4ED9A 3DYIA 1OV4A 4XQ0A 2Q99A 1DG9A 2BFWA 5JNLA 3Q3GE 2BI8A 3IUJA 4TKMA 4S2EA 2FZWA 3WNCA 2E9SA 2X2OA 1P8JA 2EP5A 5ED4A 2COUA 1D2GA 3HJFA 1L6RA 4X0EA 3K0AB 4UULA 1EM8A 4PX3A 3CUUA 4AZ0A 3WHIA 1H2XA 2LCQA 2QYOA 5FWYA 2P2NA 1W29A 4IJ6A 1RYBA 4BLPA 2VPWA 4R7TA 2ASVA 3W8DA 1WCIB 1RQNA 3HCNA 3IPXA 3TUJC 1UC4B 1E18A 2YWGA 3INYA 1HEYA 1JQ3A 4OXYA 5I4CA 3AR5A 1YKGA 4F1JA 1KOGA 4BLQA 2DTEA 4QQ8A 1IATA 1L5FA 4KWCA 2H2DA 1GGFA 2ZBDA 2AQKA 3RSFA 1ZM2A 3JQCA 4K87A 3THSA 1KI6A 2WILA 4ENQA 4OHUA 3ZTTA 2HWYA 2VF5X 4FP9A 1NR1A 4RM2A 3L7KA 4OHZA 3BFXA 2ZSKA 2JFVA 4X61A 4RKFA 2Q7DA 1CY6A 1ORTA 4CG2A 2EKPA 4Y1GA 1G0OA 4GX1A 2AG1A 4H6VA 2GCOA 1U0HC 2WF6A 3OHSX 4HATA 3PGKA 4DY6A 4H1WA 3JYOA 2ZCVA 4YRZA 1LBSA 3JVDA 3R6LA 4BEBA 1NXXA 2MYPA 2ANCA 2ZB7A 5T8KA 5E7QA 1ONOA 1UZNA 3H2GA 3PDUA 1KIFA 5K6AC 3ORFA 2BSXA 1ULSA 1MO4A 5LQCA 1M8GA 4G65A 1TYBE 1LWOA 3B1XA 3LKBA 1JEJA 2UZ1A 3HUEA 3PGVA 4P4TA 3TLMA 3RSQA 4DPLA 3BH0A 2NSHA 1SURA 3EOAI 2GAOA 4TKZA 2P9EA 1SRQA 2XA1A 1N0WA 1CF2O 5JSHA 3BJIC 5ALZA 3GLTA 4AO7A 1XAJA 3HJBA 3EZ9A 3K8QA 3UAYA 1YIDA 2VJYA 1V96A 1SPXA 4RJLA 4BP1A 1ZM3A 1YR1A 2KS6A 1O96A 2W2TA 2C1XA 1P73A 3ZW7A 4OYLA 3FGPA 1CJSA 3TNFA