1R10A

Cystic fibrosis transmembrane conductance regulator (cftr) nucleotide-binding domain one (nbd1) with atp, i4122 space group
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
280
structure length
264
Chain Sequence
b'GIIMENVTAFWEEGFGELLEKVSFSHLCLVGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGRVSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSELQSLRPDFSSKLMGYDTFDQFTEERRSSILTETLRRFS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cystic fibrosis transmembrane conductance regulator
publication title Structure of nucleotide-binding domain 1 of the cystic fibrosis transmembrane conductance regulator.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 90
structure length 264
sequence length 280
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1r10A00
3AVOA 2D74A 4F7WA 1ZP6A 3U3KA 4IEEA 2FFQA 3GP8A 4G1UC 4XIGS 3FTQA 4PC1A 1RKBA 1ZNYA 1O3YA 3FMIA 2N1BA 1T0HB 3TUZC 1OH5A 1NLFA 3L8ZA 4UJ3A 4AC9A 3B85A 2W83A 1KI8A 4JJZA 1U81A 4H1UA 1UBGA 5KYKA 3O47A 1W2GA 2OZEA 4OK5A 1PUJA 5AK0A 3U2QA 4CEIA 2IHBA 1YR6A 4RKFA 4GFDA 1P9RA 4NL4H 1E9CA 3NC0C 3EZ6A 4AI6A 2Q0HA 4B35A 1KO8A 3AF0A 4KVGA 1DO2A 2FWRA 5KPJA 1FUUA 3LVQE 4HAVA 5EE9A 5FFMA 3BC1A 5FTMA 1MV5A 1X8KA 4NCKA 4DLTA 4F93B 2R62A 3C16C 1NY6A 1UBCA 5FBLB 2O8BB 3HDTA 2B6HA 4YONB 1J8YF 4DLXA 3CLVA 1MO3A 4DIDA 4ESHA 1WBDA 1OXTA 2AR7A 1XD2A 2ZI6A 3I72A 3EW9A 4YMUA 2YC2C 4DHEA 1XPOA 2GCOB 1KI2A 1UBEA 2XNDD 1E2LA 2PL3A 1NNEA 5CJ2A 1R5OA 2WKQA 4B34A 3V9PA 1KK2A 4F4IA 3DOFA 1SULA 4R98A 4DCVA 2IS4A 4N3NA 2PEZA 2FEOA 3U3OA 1V43A 2RGEA 5DHAA 3LX5A 1KDRA 2IYSA 2BHRA 1DS6A 2IBMA 1OW3B 2VP4A 1KHTA 4Q7MB 1TTTA 4Q21A 3IEUA 1NLYA 1EWRA 3TNFA 4BRUA 3ICEA 1W0KA 4Q47A 5A0FA 1CULC 4YMSA 3CRRA 3Q85A 2J0UA 5B58C 3ZVRA 1G3UA 3CONA 2DBYA 2BWJA 3PEUA 3H2YA 4Q1AA 5FL7D 1KO5A 2CE7A 2GZDA 5FBVB 1ZD1A 2D2FA 3OZXA 5AUQA 2QQ0A 1EESA 3OEEA 3TE6A 1XU4A 3K0AB 1LB1B 4YQFA 1U8YA 2DFTA 5IF9A 421PA 1GNRA 1I4LD 4CZ2A 4PHHA 2F1IA 2F7SA 3TK1A 4XWKA 4D81A 3FPAA 1VECA 4DC9A 2ZTSA 3BS4A 2HJGA 4CYMA 1GNPA 3B82A 1KAOA 2A5DA 4WAUA 4DZZA 2AX4A 1XTJA 2CL6X 1OV4A 5LDDC 4MRNA 2QU8A 2J9RA 3IDQA 1WMSA 4J0QA 2LWIA 2VP5A 1KIMA 3A36A 2EYQA 2ZIAA 3CF0A 1FX0B 1A2BA 1FNNA 4HZUB 1ZNWA 1GILA 2WOOA 3K0CC 2D2EA 1F5NA 1E0JA 2WJYA 3ECCA 4G5GA 1NKTA 3E2IA 2XTZA 2YINC 5TARA 3AKDA 2D7DA 2F9LA 1M1YE 3CX7A 3LXRA 3RNLA 3CRW1 5L3RA 3AF2A 2J0SA 5KSOA 5BXQC 3U3MA 1U90A 3AF1A 1KGDA 4M2LA 3VMFA 3PVSA 3U7HB 3QXHA 1OHHA 3U60B 2F3TA 1IQPA 4A0FA 4C9BA 1NBMD 2GETA 2C98A 1BMFA 1DEKA 1MKYA 1AS2A 1R7RA 2A5FA 3DOEA 3NHBA 2EU8A 1M7GA 5HTKA 3AVQA 2W00A 1CJMA 5EP4A 2ZYUX 4JIMA 4DB2A 1MRSA 2OXCA 3LQQA 1TEVA 1MT0A 1U98A 1S4QA 1KK3A 3T1TA 1KI9A 2CL7X 4IVRA 1MO5A 2CXXA 2H8KA 3B9PA 3GD7A 4D4JA 3M0EA 4OJKA 1TQDA 3C14C 2YJTD 1B23P 2VHQA 2GXQA 2Z4RA 3BD9A 4F4JA 2IF0A 4RY2A 3REFA 3PUVA 1W49A 3R9XA 1SXJB 4M9QA 3RS7A 1II8B 1H65A 2GJAA 1QHXA 3I4LA 4LBZA 4UJ5A 2ODBA 2ZRCA 2WWXA 1E2PA 1YZKA 4EPTA 4FXPA 4Y0VA 4DSOA 1GFIA 4GP6A 1SKYB 3U4QB 1IN4A 4M53A 5KTYA 2GEUA 1RW4A 3UMRA 4ZI3A 4NBSA 4CDGA 1L8QA 2JCSA 3ZZUA 1LF5A 1CJTC 2YC4C 3FKSD 1YJ5A 2ZYVX 1KI6A 1SKQA 4PTLA 2EFDB 3WRYC 4DLYA 1E9RA 2RGNC 3NDPA 4PXAA 4NYJR 1XP8A 3KJEA 1G8FA 4RKEA 3QOFA 2IS2A 2BMJA 3BXZA 5FUYA 2GVDC 3EC1A 5L3QA 3X1DA 2Q3HA 3CH5A 1AK2A 1R4AA 2H1LA 1GG2A 3KKQA 2ZRDA 4BLSA 4BECA 1MR3F 1M74A 5FTLA 2GF9A 3K53A 5KHOC 1JR3A 2CLCX 2H92A 3P26A 4MUBA 4QHSA 1FP7A 2BIFA 3BE4A 3PENA 4Q1DA 1XTRA 2QM7A 1DAFA 2VEDA 4OK3A 2EFHB 2ZSBA 3CNNA 2ZJBA 4OHYA 2ZRPA 1RJ9A 721PA 3VTKA 4E22A 2NIPA 3PUYA 3B6EA 4AWXA 5JJIA 1CKEA 5AUNB 1JR3E 3I3SR 2QAJA 4N0DA 3ZLJA 3ZIAD 1YZGA 4HUQB 3FHOA 4AKHA 1GDDA 2HJVA 3LFUA 4RFSB 1KDTA 4TLAA 3GLHB 1K5GA 3BB4A 2R44A 4EDHA 2BVNA 2YWFA 4A2PA 2O8CA 1KYIA 1SVOA 3B1VA 5CB6A 2PX0A 1D2MA 3WXMA 3FOZA 3VKGA 3T5DA 4XJXA 5IK2D 5DISB 1AN0A 1HA3A 4DUGA 3SBEA 2XB4A 1U8AA 3QNUA 1XMIA 2AD1A 2FE4A 1PJRA 2QI9C 3B5JA 3WYFA 4C0LA 3C41J 3SBDA 4C0SA 3Q8XB 5B2ZA 2YKGA 2SHKA 4LHXA 3NDBB 5E7JA 4CW7A 2IW3A 1FZQA 3PCRB 3LY5A 1YZQA 2OM2A 2H16A 3A8TA 4PHFA 4W7SA 3UPUA 2CCJA 1U2RA 4TLEA 4L5BA 3K9HA 1N6IA 1ZU4A 2XJ4A 1J2JA 1G3RA 1NJGA 2GESA 5FR2A 4URZR 1XJCA 4A15A 2J87A 3R7WA 2IS1A 2O8FA 4OQXA 1UKEA 4DT1A 2ZAMA 3LBHA 2QL6A 1Z83A 4O0MA 1T3SA 2CE2X 5JCZA 3PITA 2GWHA 2HLDA 3A58B 1NN1A 4EJSA 2GZAA 1U9IA 4EPVA 5BW8A 4HZIA 2BDTA 3BH6A 4AYXA 4LPSA 1W4AA 2ATVA 2AWNA 2V7QD 1SXJC 5JRJA 1QHNA 4DLUA 5DYIA 5A4JA 1VG9B 3CF2A 4A0RA 4C3ZA 3CUEF 4DEYA 4M9XA 2C8VA 2GTPA 2I3BA 3EPJA 5GJVC 2AHOA 3BRWD 1HTWA 1OFTA 1ZIPA 3AP2A 5AWFC 1BOFA 2WWIA 4CT5A 4JSYA 3H1TA 5DNYB 1IN6A 2JLSA 1KOFA 1RZ3A 1QHHB 4H9GA 4XSGA 1CR4A 4V0MA 2ODEA 5CLQA 4NH0A 1F2UA 2ZE5A 1Z08A 4LCBA 4FD2A 2WZQA 4PANA 2F1JA 3T35A 2MSCB 1P2UA 2IS6A 3W3ZB 4PPGA 1G5TA 1M8PA 3LAWA 4V0ME 5J47A 4MKGA 5JS8A 1DG1G 2VHCA 5F9HA 3RLFA 1JECA 3QXXA 4MGIR 3QQ5A 2JLWA 1IM2A 4Q4HB 1QVAA 1NIJA 4YLGA 1U99A 4B71A 2ERXA 1G17A 6Q21A 1DARA 4E07A 2JJ1A 1DG3A 1XJQA 3QEJA 1MO6A 2YHSA 3BIFA 2WIBA 4W5HA 5F9FA 4B2PA 3KJIA 4EPXA 2WKPA 3VHXA 2NZ8A 2OCPA 4TTQA 5HPYB 3FE2A 4JJKA 5D3MA 4A6XA 3PUXA 3KL4A 1OFUX 4EQ6B 1EXMA 1XEFA 2GJSA 3Q7QA 2AK2A 4IRUB 3WP1B 3NKVA 1COWA 3SU8A 1DADA 1MRNA 3LBNA 4C7OA 3LDAA 1HT1E 1G5PA 1Q1EA 4CEHB 1VYUA 3U7EB 1Z07A 4URWR 4DLWA 1ZU5A 4MRRA 4C0JA 1L7VC 5FL3A 1N6KA 4OHZA 3ZGXA 4I1UA 4PZZA 4LHVA 3Q5EA 4B47A 1NG9A 3W6OA 1S3SA 1G8YA 4ZIRB 4Z1MD 621PA 1B0UA 1KZGB 4D4LA 2GKSA 1M34E 2R8RA 4HYYA 1XTQA 2ZRIA 4PR0A 4M1KA 2ZUDA 4XWAA 3TUIC 4LV6A 3SOPA 4Q7LA 5KSZA 5BN5A 1IN5A 3B78A 5CDFA 4B3GA 4YXWA 5EP1A 2A30A 4BFYA 1UEJA 3FVQA 1OHHD 5CK4A 5C4GB 2GNOA 1NIPA 3EIEA 4I81A 5GVSA 4R2IA 4RVCA 2DFNA 3T15A 2FFAA 2CCGA 1X3SA 3LW7A 1DBSA 1RFLA 3B13B 3M1IA 4AG5A 2J7PD 5CDFE 3K0FB 4XVUA 3IPXA 3MWJA 3CPHA 3CRQA 2MSDB 3T12A 4US2R 3X1WA 4DB4A 1N5LA 1TUIA 2EFCB 4FCVA 2VP6A 1HT2E 3VU9B 1VIAA 1T5IA 3EWAA 1ZD8A 4G5QA 4KJZA 4TLCA 1Q1QA 1DTSA 4LI0A 4TT3D 2A7QA 3I73A 4MGZR 2OFWA 2V1XA 3DEFA 4TL6A 4F4CA 1RVDA 2ZI3A 2B21A 2X2FA 1VMAA 3LLUA 2VP0A 2YWEA 5TXGA 121PA 2BM1A 4MKHA 4QGAA 1GM5A 1JJ7A 1YZTA 1RRCA 1D9XA 3OE7A 2NOAA 2YZ2A 3QUSA 4HDCA 3RSOA 3A4LA 5DN6D 5AUPB 1E0SA 1KSHA 3Q7PA 4KAXA 4DDUA 4RD3A 1QG2A 3R9IA 2ZPTX 1P75A 2EWVA 4JKYA 1JALA 1SVKA 4KHZA 1XMVA 1SQ5A 4A2QA 5UKDA 1JPNA 4MRPA 3T06B 2VH5R 4NMMA 2GJ8A 2FV8A 3GFOA 3M4YA 3U7GA 2F9MA 2XZOA 1US8B 2E1RA 4U02A 4WBSA 4ARZA 2ZYWX 1E69A 3EC2A 4AKGA 2BBTA 1Z2CA 4C2TA 5GJCA 3RYTC 3THYB 1RRFA 3PFIA 3NH6A 1E3MA 3MCAA 2J0VA 1FMLA 1AGRA 3QI2A 4HAYA 1OIVA 1MABA 1E1QD 3NBZC 4N0EA 2X2EA 2VL7A 1J70A 2R9VA 5TDHA 3ASYA 1XB2A 1TQ2A 5JBQA 2CJWB 2FPMA 5GVRA 4DKXA 3MWKA 2Z4SA 2RGGA 1R6BX 1IN8A 3LNCA 4KCGA 4NONA 4KFRA 3CWZA 2PLFA 2G0TA 1CF4A 1R10A 5JI2E 5JECA 1TF5A 4TLBA 4F38A 1GP2A 3ZDQA 2W6IA 4HDOB 5KDOA 4Y0AA 2BMEA 2JJ2D 4NCJA 3GLGB 5SZKB 2IL1A 2PLRA 2OXRA 3L43A 1Z3IX 3UANA 3U5ZB 4DCSA 1WB9A 4A92A 1XPUA 3RC8A 1AIPA 1E9FA 3AM1A 4Q9KA 3N70A 4P32A 4E03A 4KYUA 2OCYC 4QNMA 4R9UC 1TUEA 1M6NA 1J99A 2QP4A 3AF4A 3EA0A 2BKUA 1KSJA 4TYPA 1OKKA 5DI3B 2QMOA 1F2TB 1L2TA 2P5TB 3R8FA 2WTUA 3EIHA 3TQCA 2FJUA 1VPLA 2N46A 1JEDA 3GLIA 1NN3A 4M9ZA 3W90A 4ZCLA 4XOIA 1Z63A 3EA5A 2GRJA 1QHGA 3MMPA 5FOWA 2ZS8A 3AVWA 3ZZTA 5CJPA 5HE9A 2FA9A 3TW4A 1J7KA 4WVFA 2CVFA 2IWHA 5BN3A 3K0SA 3IPYA 3FFAA 4HAXA 5EE0A 3GLIE 1HYQA 2UVQA 5FPHA 3NEJA 1VG1A 2REBA 1AKEA 4JS0A 3L2OB 1TQ6A 2QRZA 3K0CA 2ZU0C 1OH8A 3CRVA 2RB4A 3KFXA 4MYHA 4WA7A 5HR5A 1KJWA 2FFHA 2IYTA 4NKRA 2KE5A 2Q9CA 4CEJB 1XCGB 1U94A 2ZRMA 2XX3A 3IQWA 1Q22A 4LY6A 2P6NA 2WJGA 4NYMQ 4BZXA 2WKRA 3K9NA 1PV4A 1XWIA 2F1RA 1AQYA 1E0KA 3KKPA 3THOA 2ONKA 3AKCA 1S8FA 1E2QA 3OF5A 3AF3A 5DSZA 3KQUA 3AGPA 3SYKA 4JL5A 3SYNA 1VDZA 3RS5A 2AN9A 5EZ5A 1C9KA 4CVNA 3IHLA 3U44A 3LLMA 4NP6A 2FSGA 2NTYC 2Q6TA 5CK5A 1VCOA 1IJFA 1YVDA 2DFKB 3VR3A 4I1VA 4TMXA 5M04A 2QROA 4Q66C 3A1SA 3PIRA 4JYBA 3LO5A 1KDPA 4DLZA 2WPDD 1EFRD 5FTNA 4MKIA 1G3QA 2AKYA 4A36A 4UNRA 2O8BA 3CX8A 2OSBA 3SE0A 4OHVA 1D5CA 4HAUA 4KV9A 1LW7A 1ZVQA 3AGQA 2ORWA 4WXRA 3RWMB 1VTKA 3CH4B 2ZU6A 4P33A 5DH9A 3ZD6A 1KZ7B 1IY0A 1H8HD 3MFYA 5IHPA 3H0KA 2JGNA 4D0LB 2QSYA 2XEXA 1E9SA 3JZAA 2OAP1 3F5FA 5SZHB 3SJAA 1NI3A 3U3RA 1YRBA 4ESVA 1CP2A 1P2SA 3TJZA 3S1AA 4X8HA 2QAGB 1N5IA 5C4MA 2BEKA 2IYRA 2DPXA 2CK3D 2QE7A 5SZJA 4KO8A 4U7DA 3TRFA 4KVAA 5FPTA 5GJBA 1II9A 1DAGA 1FUKA 3BJIC 4LSGA 3KUDA 2RGNA 3WMGA 3KX2A 2O8DA 2V8OA 3CRMA 4UNPA 3AVUA 1IAQA 3ADBA 2ZM5A 2WWHA 3D8BA 1CRPA 1FQKA 3T5GA 1E96A 1YE8A 2PT5A 3K0EA 3TLXA 1Z6TA 3EPKA 1UKVY 4HATA 3ZS8A 3LBIA 4US1R 1P9WA 2OBMA 3ZZ0A 1D8TA 4IDPA 1ZUIA 2VO1A 3LH5A 1T3LA 4URXR 3KQNA 4FMDF 1FL9A 3A1UA 4TMVA 2VSOA 3IHWA 4FI3C 2F43A 1GRQA 3X1XA 5DIFA 4KXFB 5FBQB 3SJZA 2WVJA 5G3YA 5K8UA 4KLZA 2YYZA 1CBUA 3AH8A 3GFTA 4HZUA 4TSFD 3OEHD 3QPWA 4FINA 4PSVA 1Q1BA 4URVR 4FMCB 2WWFA 1E2KA 2L0XA 5EXPA 5JEEA 1E0AA 3FGNA 1ZM3A 4JT2A 1EG7A 4WIAA 4PO1A 5EUQB 4DSUA 3GJ0A 1IXRC 2GILA 4P0TA 1IY2A 1G6HA 2ZJZA 2ZJOA 3NG1A 1FPMA 3BFXA 4P4UA 2ZE8A 4F92B 4M1SA 3KTAA 3GJ4A 1KSGA 3HU3A 2BEJA 2BJVA 4EPWA 2UKDA 1VHLA 1NMXA 3P32A 3DO6A 2JDID 4Z54A 3L0PA 3TR0A 3ZH9B 1A4RA 1X86B 1HH4A 4IDQA 1E9EA 2ASEA 3ZJYA 4BQSA 4BRWA 4D82A 1DAEA 3OFND 4KSBA 3IILA 4YC7A 3NBFA 5KDLA 1XEXB 4TQ9A 3QEOA 2DR3A 2ZRKA 3BK7A 4RSGA 4KYIB 4YMWA 1PZNA 4KFTA 2D62A 5AJYA 4ACBA 2F55A 3C8UA 5KNBA 2ANCA 2XXAA 4WZ6A 2JIZA 2GBLC 3RS4A 1JJVA 1E2IA 3PUWA 3IEVA 2G3YA 4MGKR 2P0EA 3BOSA 4XVQA 3BFVA 5KO2A 2VTKA 1GKYA 3AVVA 2OILA 2YWGA 1T8TA 4GDFA 3RDPA 3ICQB 1WCV1 2IYLD 4LOAA 1Z47A 4LJ5A 1R8QA 3A1TA 1SXJA 4B33A 2HV8A 4ZKDA 1XEWY 2FDCA 5EP2A 1II8A 1G3IA 2CNWD 2FH5B 1AA9A 4JLVA 4JYCA 5CITA 1DAIA 4DLRA 3SR0A 3GJ8A 3AKYA 4ZCIA 1TEXA 3N2EA 5FOSA 3CZQA 4JKIA 1F6BA 3GMTA 4BFZA 2QAGC 2D06A 1VG0B 3PEYA 4B6FA 3OAAA 4YDHB 2C2HA 1DPFA 1OH6A 2QP3A 4XH9B 1ZNXA 2R6DA 1MO4A 2PZGA 4PZLA 3QKSB 4D6PA 2FNAA 2EWWA 3RRMA 1W4BA 1Z29A 2QA5A 2OFOA 2V3CC 1KO1A 3DM5A 4A9AA 1ZD9A 4OI2A 4C4PA 3A37A 1ZM2A 4JVMA 1CEEA 5LD2B 1DO0A 2J1LA 3G5UA 4M4SA 3WRXC 1P9NA 4TZ0A 3TMKA 4RCYA 1FNMA 1W0JA 1P6XA 4OYHA 4PSAA 4TL9A 5IDVA 3HWSA 3R8CA 1UPTA 1GL6A 1N5KA 2EFGA 2HEIA 5FPYA 4Q7KA 1LV7A 2W0SA 4JL8A 1U0JA 4GZLA 1XZPA 1OPXA 2BV3A 4PQFA 3BB3A 2BOVA 1JQLB 3OESA 3W8NA 5FBWB 2B7BA 4FCTA 4I1OA 4URUR 3DL0A 1BS1A 4C2UA 4QXAA 2F3RA 3PR1A 2A5GA 2QM8A 1Q57A 2ZI9A 2W2VA 5FOUA 2ATXA 3T61A 3CM0A 5H70A 1KTVA 3C5HA 2VHUA 2Z6VA 4EUNA 4QBHA 1G64A 4QGHA 4NZYA 3PJRA 2PT7A 1OSNA 2RMKA 4UNNA 2WV9A 2A2ZA 2KSQA 1NMZA 2KBFA 2A9KA 3P4XA 5BYKA 1ZCAA 2DFLA 1ESMA 5EE3A 4BGDA 1E1RA 2PJZA 5EE5B 1GRNA 3J81k 1S9DA 3ZQ6A 2C04A 1BH2A 1G3MA 1Q3HA 1R5NA 2CLSA 5AJXA 4AIIA 3MJRA 2HXSA 4XTRA 4MDEA 1M2OB 4BLOA 4M21A 2HYIC 2IEZA 5JRZA 4D4KA 4FMBB 3QKRB 2VSXA 2ZETA 2A5JA 2WWWA 1Q20A 2VHTA 1E4VA 4OK6A 1GWNA 3VR4A 2FMXA 2JLVA 1GNQA 1UBFA 4LPKA 1WRBA 1T6NA 2V6IA 4N1AA 4TMKA 3U7FB 1W1WA 2WJHA 1P60A 2WM9B 3RRNA 2DHRA 5H8WA 4IOKA 3NVAA 3OIVA 1KKMA 4PC2A 3WBKA 4BFVA 2QSZA 2UZ3A 4M8NE 5A5GA 2O8EA 5BWMA 4LJ7A 1MOZA 2ZRNA 3TR5A 4EIWA 2NO0A 1P3JA 3MG9A 3DDCA 4MYTA 3GJ6A 4Q4AB 5FOVA 3MWLA 2XSZD 2Y8EA 4E09A 3BFKA 4ABYA 2R6AA 3FWYA 5LPNA 2QGZA 8OHMA 2WSSD 4QRHA 3RSLA 1XNJA 4OI1A 1R2QA 2IYYA 2WOJA 1XCPA 4L4UA 1KNXA 5JFGA 3EX7C 3VHLB 5TVKA 3GLFA 1OXUA 1UJ2A 2E9SA 4LV8B 3HU1A 3KQKA 3F8TA 5KSPA 1XXHB 2QBYB 2WICA 5LD2C 4Q9IA 2PEYA 3P20A 2LKDA 4HAWA 1A2KC 3CPJB 1Q44A 3OIYA 3VR1A 3I8XA 3GLFE 3EPLA 1W2HA 2W6JA 4DSTA 3RC3A 3H86A 4UXHA 1WE2A 1R0YA 2OLJA 4R71A 2XB2A 4MGYR 2ZJ5A 1XDBA 5BN4A 1KI6B 2CL0X 2JAQA 1Z6GA 2GJ9A 1G1MA 5AR1A 4BEJA 3HR8A 1KMQA 5FTJA 3ZVNA 4GNKA 3M6AA 2J7KA 1GSIA 1BO6A 2QMEA 2VHJA 4MDFA 3UWOA 4MA4A 5HKKA 5L3QB 4NYIQ 3CPEA 2PJRA 1NKSA 4M22A 1I4TD 3RVBA 1UKYA 4BLPA 2MMCA 2WAXA 4EQ6A 2H7VA 1OT3A 1WF3A 4K81B 4OL0A 4PC7A 4QBIA 4JBXA 1G6OA 3O8CA 4Q4JB 4MRSA 2AXNA 2IF2A 4LZZA 1F48A 2JJ8A 2ZI4A 3VAAA 3W5IA 5KPDA 1YR9A 1G7CA 4PQRA 4JMPA 3B60A 3TH5A 1Z0IA 1RJ9B 4OI4A 4RZ2A 1H8EA 1QRAA 2PMDA 5CM9C 2J45A 2ZVPX 4WZBE 2GXSA 2C78A 1J8MF 4I4LA 4Q03A 3QXJA 5J4LA 2HUPA 2CMKA 1ZRHA 2ZR9A 1CR1A 3MRSA 1F3OA 4A8JB 4R2HA 3MD0A 5DO9A 1W5SA 3CB4A 4G0NA 4PZYA 4BLTA 2O8CB 1JR6A 3AUXA 1ZM7A 2ZRFA 5AJZA 2DWOA 3UXMA 1W0KD 2YOFA 3IBYA 1RC8A 2O52A 4ERNA 3F3YA 1OE0A 3GEEA 2NO9A 1DE0A 2QGNA 2RCNA 2G77B 1ZW6A 4L9WA 4Q18A 3GJ3A 1VYTA 4XD7A 4EKDA 4NYIR 5AUOB 1DVRA 1E2MA 3OEED 4D26A 4TYQA 3K0FA 4QJ3A 2CLDX 2ZANA 4LYHA 2WMOB 2P65A 2V9PA 4QNRA 3L82B 1E9AA 1QF9A 3VU9A 2QPTA 3IO3A 1RE0A 2ZITA 3OIUA 3GFPA 3UMSA 3VNVA 4KU4A 3FHCB 2AKAB 2GCPA 3O8DA 5JZVA 1CJKC 3RRYA 3WY9A 2YOHA 3MUFA 3NEYA 4OJQA 5E95A 1G7RA 4UNQA 3R7WB 5FPSA 4DT1B 1PLKA 1SHKA 1BKDR 4DDTA 4O3MA 4HAZA 4TTPA 1PLLA 5E7IA 5JCPA 5CM8B 3K09C 1NN5A 4QHTA 3EARA 4Q5IA 2FG5A 4C30A 3DKPA 4EJSB 1E79A 4LC1A 4LJYA 4FMDB 4RJLA 3TW8B 3MJHA 3U61B 4A4DA 2GF0A 5JS7A 1AQUA 2ZJYA 4LYAA 3KXIA 4DJTA 5FBRB 1E4YA 3LA6A 1LY1A 2FF7A 2RHDA 2ZSEA 2WJIA 4B3BA 5JSZA 3HPQA 1TNDA 3DVLA 4O2LA 2R6CA 1KI4A 2PMKA 1OYWA 5CIWA 1AGPA 1S2MA 1ZM9A 2KJQA 1T9HA 3EZ7A 4DDWA 1US8A 4TZ6A 3V4FA 2CHVA 4JVLA 3ND8A 1UAAA 2NPIA 3CW2A 1LS1A 2IWRA 4TYNA 5JJLA 3W34A 1A82A 4IDHA 1EFHA 1QZXA 1BMFD 3SS8A 3UG6A 2ZJ2A 2EW1A 3LX8A 3KQLA 5ELXA 1JBKA 1DAKA 1FFHA 4IDOA 1S9HA 2LCFA 3T1VA 3SJCA 4B75A 5K8TA 1IOZA 1NVUQ 4OHXA 2ORIA 1OXXK 4O2RA 3ZS9A 1SVLA 2CJWA 5B30A 2GK7A 1FTSA 4LJ4A 1PVOA 1TL7C 4ILEA 3THXB 2XNDA 2W2TA 5HCIA 3B7GA 1G41A 4GP7A 4OQMA 2JLRA 4GI7A 2Z43A 1LS6A 3LVRE 4FW9A 5CB8A 5TMPA 3G0HA 5HCNA 5G40A 1ZMXA 1AJEA 1XRJA 5LB4A 4IOLA 3W6NA 4WOPA 4D2IA 2OHFA 5KNDA 3GLGA 3TQFA 1KI7A 1W46A 2F1HA 4A8JC 1XF9A 2RKOA 3Q9LA 4MQBA 5D3MB 2H57A 4LYJA 1BYUA 4RD2A 3KXLA 4Q1BA 1KK1A 3VX4A 1GTVA 3SZRA 2XTNA 1TQ4A 5TB5A 1ZNZA 2D4HA 1J90A 1FMJA 1G8GA 3MAAC 3CO5A 3CNLA 4GT1A 5CYOA 1W48A 2J3EA 2VYFA 1Y3AA 2QP9X 3REGA 3AV0B 3ADDA 1IXSB 4HLDA 5FL7A 1GUAA 1YR7A 1NJFA 2GEVA 1EGAA 1P5ZB 1F2TA 1HURA 1U0HC 4M1MA 1SVIA 5FUXA 3C5CA 2QZ4A 3BGWA 5JHGB 3CX6A 2J59A 4IOJA 4A0HA 1R5BA 1L4UA 1LVGA 1QBKC 2FSHA 3WYAA 2ZREA 3CR7A 4JLOA 5EE1A 4DEXA 5K8IA 1JR3D 2FZ4A 3A6PC 1S1CA 4II7A 5F98A 1N6LA 5JWRA 4EAQA 5HZHA 4KI0A 2A3RA 4GOXA 1TMKA 3ASZA 3CZPA 3WHKA 2VP2A 1K5DA 4LV5B 4DLSA 5HE8A 3EAQA 2KBEA 5H68A 1N0WA 2R6GA 3QG5A 1Y63A 1UFQA 4CEJA 3SQWA 4UKDA 2WWGA 1U9IC 4Q1EA 2ZEJA 2E87A 1Z0AA 3VNUA 2OFXA 4LHYA 4C0KA 3W6PA 1I2MA 1G4UR 2FN4A 4LBWA 2IYWA 4MYCA 4ZV4A 2ZJ8A 4JL6A 1FP6A 4RZXA 5EP3A 3TVTA 4QOSA 5J4VA 2ZSFA 4M1OA 1TAGA 4URYR 2GCNA 2ZS7A 4I99A 3BH7A 5HZKA 4DUGD 2B7CA 4C0QC 3B2EA 1W36B 5J4KA 2VRWA 2HDNB 3FB4A 1G20E 1NBMA 4LJ9A 3U3JA 5GADl 5FPKA 3T34A 1W36D 3KFVA 2DYKA 3PXGA 2W0MA 4KSCA 1OH7A 1T91A 2GBLA 1QHSA 821PA 2ZAOA 2NPFA 3ZVMA 5CLLA 2RAPA 4HSEA 3JVVA 1NBME 2GEDA 4ZDKA 2WJVA 4JLKA 4EFLA 2EYUA 4B3CA 1HV8A 1P2TA 2QT0A 5CIQA 1WBBA 4ACAA 5EUMA 1W5TA 3SYLA 3R9WA 2ZI5A 1JAIA 4PAQA 1ONBA 5L8VA 4NCHA 2HLDD 4Q9JA 4K8OA 2FPLA 4M1YA 4ARZB 4JLNA 3IO5A 5L3SB 1Q3TA 2HXYA 4W5JA 1GVNB 2DB3A 1OFHA 1RYHA 3SEAA 4C0HA 2OG2A 2G0NA 3IIKA 4KLNA 1ZINA 2O0KA 4YMTA 4Q9HA 3DZDA 1XX6A 1MABB 4ZCMA 3V4RA 2OEPA 4LBVA 3W3AA 1CXZA 3D3QA 5P21A 3TVDA 1R0WA 2JATA 3QF4B 5IT5A 3NHAA 1IJEA 4AYWA 2DWQA 1E6CA 3FKSA 2FGKA 5FI1B 3CBQA 3IUYA 2XGJA 3MLEA 1T4GA 3I32A 1NSTA 4M0LA 2OLKA 2IYUA 2KI5A 3D6TB 1NVXQ 3AKEA 2ZRGA 2ZUCA 1GITA 3PEVA 2P3SA 2ZRBA 3QXSA 2BMDA 2ZJAA 3K9GA 3R20A 1GKUB 2ZYTX 1ODFA 1S96A 2J46A 2H18A 4AG6A 1CR2A 1YZNA 3WNDA 4BFUA 2FEMA 2X8AA 1YU9A 4BWYA 3UG7A 1F60A 3TAUA 2GCOA 3AQ4A 4V0LA 5C1BA 2RGCA 2F6RA 1N6RA 2C9YA 3I92A 3VKWA 2JA1A 4L8GA 5TV2A 2NZJA 3UWKA 2JJ1D 2OAQ1 3I8SA 2C96A 3ZIAA 4NU0A 4B2IA 4RZ3A 2JLUA 1GRRA 4NYMR 3K8YA 1LFDB 4OBEA 4MUAA 3AVXA 4G5SA 1VYVA 4PAMA 4TWZA 3PQCA 4JBYA 2BCGY 4LJ6A 4POAA 3GLIB 3B1ZA 1EX7A 3EG5A 3I62A 2JASA 4P31A 1OB2A 5C46F 1XD8A 1GZSA 3N2IA 4JBWA 1NY5A 3IIJA 1P62B 2JEOA 2PX3A 4HI0E 5J40A 4A1FA 5DYGA 4IFBA 1COWD 1YRAA 4IW3B 5FUVA 5IK2A 4BFWA 1O87A 3THWB 2OCBA 4NCNA 5GJWC 2D3WA 1HUQA 2QRNA 4JLJA 2I1VB 1W36C 4ASUA 4JSTA 1IN7A 3K0AA 1XFAA 1XZQA 2BM0A 3EXAA 2YVUA 3WYGA 3T1OA 4B74A 1RRPA 2NGRA 1G21E 521PA 5H1YA 4GMDA 2ZRAA 2J5XA 4TMZA 3K1JA 2C9OA 2Z83A 1QHIA 4PHTA 5FI0B 1KAGA 4BZQA 1OFIA 1V5WA 2FSIA 2YWHA 4IXMA 1DOAA 4LDJA 1YQTA 4JLPA 2B92A 2ZRJA 1KJYA 4YXWD 1KI3A 3TUJC 3U44B 2OBNA 1HE8B 4IKEA 5LB2A 3VQTA 1KMHB 4U00A 4F91B 1FX0A 5JLJA 1VCNA 3I1FA 1OXVA 1S1MA 2V7QA 2WIAA 1TF2A 1S3GA 2WHXA 4IOMA 4E5UA 2XITA 3BH0A 4QHYA 5J4YA 3FMFA 3FDIA 1OYYA 1ZUHA 3RS0A 3X1ZA 4C0AC 4OQNA 2YNMA 3FMPB 2ZVQX 4O25A 3RRZA 1X1SA 1VIYA 1AKYA 2V4ZA 1CS4C 1YZUA 2BBSA 4PC6A 4B32A 2O5VA 4Q1CA 3MSXA 3QKSA 2HCJB 4LBYA 2QT1A 3UMFA 3O8RA 4BLRA 2IXEA 4GSYA 4P4SB 4US0R 5J4HA 1XTIA 4GRAA 2O0JA 3LV8A 4Q7JB 1KO7A 1Z0JA 1ELOA 2BKEA 2J41A 1G19A 4PPNA 4LJ8A 3WMFA 2FSFA 4QKQA 1BIFA 2FFBA 3RS3A 4OQFA 1N6OA 2IHYA 1QVRA 3OE7D 4TL7A 1N0VC 2XTMA 4PFSA 3HYTA 3S1AB 4D0NA 1FW6A 4NE2A 2BBOA 4FIDA 2QPAA 3TAHA 3B1XA 5IRCD 4G3XA 1G7TA 2QNRA 2G6BA 2JLYA 3JVUA 3E1SA 1KDOA 1IBRA 4L16A 3AB3A 3SHWA 4MYUA 1G18A 1UADA 3H84A 2O8DB 4FWTA 1XMJA 2GVZC 2OO7A 1A5TA 1P72A 1XTSA 4GPTA 4B44A 2RGBA 1Z5ZA 3B1YA 1Q21A 4CEIB 4NPHA 1YR8A 4CIDA 1VCMA 1GAJA 3RABA 1KI1A 3VKHA 2XOKA 3TSZA 2AXPA 4XVRA 3QENA 5ANRB 2GXAA 3UKDA 5JEDA 1HQCA 3ZD7A 1LNZA 3HPRA 4V0OA 4B76A 3U4QA 1TX4B 1SXJE 1Z8FA 1ZIOA 2V54A 2P67A 3W9YA 3NTUA 1XD2B 3CIOA 2AWOA 4K46A 3LD9A 2QG6A 4JVSB 2F43B 4QG7A 2ZSAA 4M1WA 1SKYE 1NRJB 2AL7A 2FU5C 2RHMA 3L0OA 3CF6R 4ZPXA 4EPYA 4ZDJA 1T0JB 2W6ID 4QL3A 3QXCA 1EFUA 3P4YA 5EXTA 1TPZA 2NO1A 3UK6A 2FX3A 3G82C 3NC1C 3QKRA 4Z1MA 3W5JA 1EWQA 1NG1A 2GAAA 1G8PA 1AS0A 1E2GA 4QC2A 1VHTA 1EX6A 1RIFA 2AK3A 2ZI7A 4IVQA 4BEBA 4LHWA 3OIWA 3GPLA 3CNOA 3KTAB 1G291 4NTZA 1OF1A 2ZUBA 2J0UB 1CR0A 4G5OA 4XWOA 3PG5A 2HYDA 5DI9A 3KKMA 2X1VA 3NBYC 1C4OA 3FMOB 5L3VA 4B48A 3W8RA 4X8LA 4B3FX 1OKKD 5FOXA 4HUQA 1RPZA 5AJWA 4RFSA 3WHLA 4NYJQ 2J7PA 4B73A 3GLHA 4XTCS 2C99A 2C03A 4DSNA 3QIAA 4IJMA 1NF3A 4HLUC 1P7CA 3GQBA 2BBWA 2XXAB 1GL7A 4Q4AA 2DCUA 5KSYA 4IHQA 2IA5A 3SNHA 1JXMA 3SFVA 4TT3A 3N5CA 1KNQA 3PV0A 3GLHE 4G5RA 5C18A 2G1KA 3HU2A 1EK0A 1IHUA 3K09A 3D31A 2BJWA 2XAUA 1Q1ZA 2PZFA 2HCBA 4PO9A 1CIPA 1KY3A 4JT4A 4H1VA 2QY9A 1KKLA 1Z6XA 3L0SA 3PEWA 3B8HA 1N6PA 3DM9B 1S0UA 1XXHA 4LJAA 5DHFA 2QBYA 2CHGA 4OHWA 5DN6A 2W2XA 2IUTA 2Q3MA 1QG4A 1JPJA 2IX3A 5G3ZA 1JAHA 3D7MA 3ZQJA 3TGPA 2HT1A 1OB5A 3EWSA 4DWJA 3T1QA 1ZBDA 3EIQA 3LQRA 4Q02A 2K5UA 2P5SA 4LUCA 1XXHE 5FR1A 2REXB 3QKUA 5LBIA 3C4JA 5KUTA 5KOYA 2ZSDA 3NBXX 3ZVLA 3B9QA 1CTQA 1JQJC 1R0XA 4CGZA 1P73A 1YKSA 2C9CA 2IEYA 3AP3A 1Z22A 2IC5A 1UKZA 2R2AA 1KY2A 2CEAA 3FFBA 3GJ7A 2O0HA 1P4SA 1YZLA 2X19A 1SVWA 1ZC3A 4Q01A 4B6EA 2AFIE 2WMNB 3A1VA 5CYPA 3HR7A 5FH9A 1E1QA 4Q4JA 1X1RA 1SZPA 1Z6AA 5E3HA 1HE1C 3GCGA 4G01B 3DMDA 2BCJQ 221PA 4CT4B 4FN5A 4QGGA 1K6MA 1G8HA 3SQXA 1KJZA 1PUIA 3H4MA 2CHQA 4HB3A 4X8MA 2VA8A 2VF7A 4OI0A 1QHHA 1T8UA 4A8JA 1NVVQ 2ANBA 2JJ2A 3RWOA 4WXPA 1P2VA 3A4MA 1C1YA 4I1SA 3TBKA 3ZYCA 4ITRC 4IXNA 2R6FA 3LWNA 4AD8A 2KB0A 4Q19A 1AZSC 2XJ9A 1G4AE 4QM6A 3KKNA 2ECKA 2B8TA 2QE7D 4A2WA 4BFSA 4Q4HA 2V6JA 1W4RA 3KB1A 3SJBA 1W44A 1MH1A 1XEWX 4ON9A 1ETUA 2NG1A 5BQ5A 5TY0A 2VQSA 2ZRLA 2ZE6A 4ASUD 4LRWA 2GXUA 4ZI2A 2Z0MA 3ETLA 1DAHA 1E2FA 4EFMA 1X8LA 2FGJA 3KUCA 3TIFA 3EZ2A 3AUYA 5E7MA 4RCZA 3EZFA 1ANKA 2G88A 2GA8A 1Z06A 2YOGA 4MH0R 1YHNA 4C0BA 2RGXA 5D3QA 4KFSA 1R0ZA 2IUUA 4LC0A 3NXSA 4RD6A 3RANA 2PCLA 2C95A 4Q9LA 3SI7A 5EJEA 4BFXA 3KQHA 1CJVC 3TKLA 5KDDA 1A7JA 2GAOA 1U0LA 5DE3A 4DBLC 1N5JA 2VIIA 4CEHA 1AS3A 4W9MC 1D9ZA 1NVVR 4NHOA 3I61A 2CDNA 2MSEB 5B57C 4TTRA 4TN1A 3QBTA 2I4IA 1ZCBA 3KJHA 2TMKA 1NP6A 4KBFA 3SHFA 5JMTA 2VSFA 1XBTA 1NMYA 2CVHA 1JEEA 1JXOA 5KNCA 3P1JA 4LYFA 2V55B 1E32A 3MWYW 4Z51A 4ZIRA 2O8EB 3K70B 1KSFX 2QUZA 2WJJA 3I5XA 4GBMA 4Z8YA 4KFUA 4TQAA 1WXQA 5SZIA 1JB1A 3ND9A 3UIEA 2EVWX 5JJKA 4Q00A 3AP1A 2Q9AA 4FCWA 2IXGA 2EQBA 2CBZA 3X1YA 3NWJA 3QVVA 2Q3FA 1NLZA 4QBGB 3EPHA 3PUZA 1SVMA 3GJ5A 4DDVA 5JWOA 3KDSE 2BMFA 4AKEA 3GLFB 4RD1A 1E2NA 4HDQB 4L15A 4PQYA 2WPDA 1EFRA 4MITA 1N2CE 5B64A 1I4DD 3C7KA 1GKIA 1D2EA 4IEIA 1SVSA 4AK9A 4LWZA 5EXSA 4FMCF 3IKJA 4IFEA 2JIZD 3AVPA 4IDNA 1OJLA 2GHIA 2IYXA 3O8BA 3QPUA 4WZAE 1HQYE 3THXA 3BWDD 2O8FB 1CJUC 4OQLA 2AD5A 1H8HA 2P6RA 1FQJA 1LTQA 2IYZA 4FWIB 3OHMA 5EXXA 2WAYA 1UDWA 1XPRA 3IBGA 2WWYA 1JI0A 3ADCA 2A78A 1SXJD 2IT1A 3RS2A 5G53C 3E5HA 1G9XA 2XOKD 4YMVA 3HJNA 2H17A 5K8LA 3VR6A 4D25A 1UDXA 1XJ0A 4TQUS 4XSHA 4TYYA 2ZROA 1OLOA 1TU4A 1ZYUA 3U6BA 2QMHA 1Z0FA 1DAMA 4HLCA 1Z0DA 2CK3A 4TMTA 3VR5A 1EFTA 3OAAD 5C2JB 1ZUNB 1FTNA 2ODNA 1WA5A 2PCJA 5E4FA 2IXFA 4KITB 3I5YA 2D7CA 2OE2A 4DRZA 5EQTA 3IIMA 1G5RA 4QBFA 4RD0A 2VBCA 4JLMA 2V1UA 4EPRA 3QVUA 3THYA 2AFHE 3ADKA 1F2UB 3AEZA 1VG8A 4PC3A 2P2LA 3IQXA 4PPQA 3EZ9A 1IY1A 1VCIA 4DLVA 2QQEA 3GEHA 4OKSA 1E9DA 3KB2A 1W0JD 4D80A 4V0KA 1WQ1R 2QTHA 2JLZA 4V03A 2UZIR 3Q5DA 4L9SA 1UM8A 4NCIA 3V00A 4NDZA 2BC9A 2ODWA 2NO7A 4A0GA 5JI3E 2C5LA 2Q9BA 4PX9A 4PHGA 2R65A 3OEHA 1XMSA 4S35A 4TSFA 4GOJA 4PPFA 3BAFA 1ZAKA 1Z0KA 1SHZA 1DELA 3KZ1E 1WP9A 1X6VA 2Q21A 5JHHB 1XTKA 1ZM4A 4D0GA 4LHZA 3UATA 3K70C 4D4MA 1P61B 3DPUA 5F2EA 4UXJA 1JNYA 2XZLA 1HEIA 2G9NA 2OESA 1UF9A 3IGFA 4GZMA 5FTKA 3KJGA 4BASA 4BZPA 1Q0UA 3GLGE 3BBPA 4AYTA 4PO8A 4C7OB 2JDIA 4HUTA 4GL2A 2RGDA 3GEIA 3QE0A 2A5YB 4TLDA 5DI3A 2ZS9A 1D6JA 2IUSA 4HEJA 1E1RD 3OFNA 1A1VA 4Q4LA 1OIWA 3Q3JB 3QJYA 2OBLA 2DWPA 3BB1A 4PSKA 1G16A 1II0A 2HF9A 4KODA 3P27A 2MMGA 1E2DA 2REOA 2RH5A 4BE7B 1E94E 5FUWA 3WBJA 5J5CA 4UXIA 2HF8A 4W5WA 2ZRHA 4AURA 3LW8A 2Z5FA 2QTVB 1ZC4A 5JSZB 3A4NA 4JLBA 4B43A 2ZR7A 1I2DA 3NH9A 1N3BA 3RAPR 3SC3A 5G41A 2ZQ5A 1CLUA 2NQ2C 2QTFA 3QG1A 4TMWA 3BORA 3QBVA 2OT3B 5L3SA 2ORVA 4MRVA 3E70C 2CNWA 2GDJA 3DKVA 4P4TA 1BYIA 4EJSC 4WW0A 2XNSA 3B1WA 3L8YA 3QY0A 1RRGA 3K70D 3GJXC 3DZ8A 1Q12A 2HT6A 4MKFA 2VPPA 1IXZA 2OUKA 2ERYA 2PBRA 3QF4A 5FOTA 2OV2A 4M9SA 3L0IB 3EASA 4PAOA 3DHWC 3AVTA 4QGFA 2G83A 3KXKA 4ZKEA 2NO6A 1VKJA 1SGWA 4BUJA 1M7BA 4DCUA 1R8SA 3AVYA 4DVGA 2ONJA 4JZKA 4QFMA 2W58A 4DCTA 4LK2A 4V02A 3SN6A 2PZEA 1KK0A 1HY3A 1E2EA 2GJKA 2XZPA 3CWQA 2FZLA 2JLQA 3A1WA 4DIEA 4HB0A 1TU3A 4HB4A 2NMVA 1E9BA 4YDSA 3MGCA 4LGMA 3ONWA 4M1TA 2DY1A 2W6JD 1OIXA 4IVPA 4Q1FA 2C77A 5EZ6B 2VLIA 4BFTA 1N6HA 1RYFA 2IK8A 2CCKA 4ZDWA 3NIBA 1G7SA 1NVWQ 2B8WA 4A82A 2JLXA 1L4YA 1N6NA 1NN0A 4KBGA 4BLQA 1EFCA 4R7ZA 5DLQC 1UEIA 1OXSC 1W47A 5HKKD 5KU1A 1FOEB 4HLQB 4Z8XA 2QAGA 1E2HA 3SDZA 3WNCA 2QEQA 3HYRA 1T5LA 2PH1A 4RFVA 1Z28A 4Q48A 2RGAA 1N25A 2IYVA 1D2NA 1NSFA 2QN6A 4ZO4A 4AY2A 1CU1A 1GOTA 1LF0A 1W7AA 1Z2AA 3THWA 2QENA 3Q72A 4AKIA 2GK6A 4ZDIA 2N42A 1Z6YA 1GL9B 2FPKA 4TYWA 1H8ED 1X8JA 3FHTA 3LRPA 3RHFA 5JWHA 4CF7A 1AM4D 4CRWB 2J0QA 3BERA 2QPOA 4JVNA 4P3YA 4UNSA 3TSWA 3JZMA 4RD4A 3WMEA 5F3WB 1CRQA 1PLJA 1E98A 3K9LA 3CR8A 2WBLC 2OCAA 3TSOA 4EFNA 2X77A 3QPVA 2VF8A 3FYHA 3C15C 1NL3A 5BYJA 1KO4A 1ZJ6A 3U6KA 2QMUA 2ZR0A 3HP1A 3WNBA 4B3XA 1E99A 2KWIA 3LXXA 1KMHA 4B2LA 2YV5A 4BPBA 2EFEB 3QSYA 4GMXA 4XD7D 4QJ4A 4B3DA 3CKLA 4A6PA 2WSMA 3VR2A 2FOLA 3KKOA 4X8OA 4HLUA 1QDEA 1AZTA 3SFZA 1TF7A 1M7HA 1WDTA 4JLAA 1TADA 5DGXA 1N0UA 2LKCA 3QKTA 2ZE7A 3QF7A 2QORA 1XCMA 2VP9A 4UQOA 1K8RA 1QHYA 3VFDA 2XSZA 1XD9A 1E2JA 4S2EA 3F0TA 4QM7A 4HB2A 4TL8A 1GIAA 4DCNA 1ESNA 3VX3A 4LX0A 2GZHA 2P6UA 2WSSA 3FKQA 4GOKA 1W4CA 1U8ZA 4V0NA 2G1JA 2IYQA 1T3HA 4P4SA 4QJ5A 1IONA 2ZXUA 2H5EA 4JLDA 4RZUA 5AJVB 1E79D 1XEXA 3DMNA 3WP0A 4DXAA 4U5XA 3X2SA 2I1QA
chains in the Genus database with same CATH superfamily
1EWTA 3AVOA 5JJBA 4IIBA 3GDFA 1T25A 3VGJA 3SVLA 1IH8A 4MQLA 2FFQA 3NR2A 1KYYA 2IW1A 4LQ4A 4Q3CA 5DM1A 5IAOA 4IHAA 1MH9A 2D00A 2FUEA 3ETEA 3F4KA 3G5LA 3NGLA 4B09A 2PL9A 2WJ3A 4O4IB 3CEHA 5AOVA 2EX4A 2RK4A 1NLFA 3Q88A 2FK7A 1Z7EA 3B85A 2QLBA 1DXHA 2W83A 3AZOA 3B7WA 1KI8A 4JJZA 5KYKA 4H1UA 5COBA 4XPIA 1FRQA 2Y68A 3ZYZA 2WUEA 3RKSA 4CEIA 1RR6A 1LA2A 5HHTA 4GFDA 5DTEA 1WMFA 3KP1A 4WASA 4KMRA 3RODA 2Q0HA 4QICA 4B35A 4IIEA 2AN1A 3AF0A 4TVOA 2FWRA 1IIBA 5KPJA 1P91A 3FCXA 3LVQE 4UU1A 1ZK0A 4HAVA 1AURA 3BC1A 5EE9A 3J7TA 4NCKA 5FFMA 5FTMA 2EZ8A 2QTRA 5CT9A 3W7BA 1DU4A 1DKRA 1RWWA 1ZK3A 2HLNA 1A69A 4JLSA 5DHPA 4BYMA 3GEPA 4YONB 4KTVE 4DLXA 3CLVA 4DIDA 2ZI6A 1C3OB 2ZIVB 3BXOA 3I72A 3OZFA 4P53A 1Y0BA 4K3UA 4PU0A 5FULA 4DHEA 4BN5A 4GKKB 3DHEA 1KI2A 4HQNA 4ZYZA 5FFNA 2XD4A 2GZ3A 1XZIA 1E2LA 2N0SA 1LPNA 5CJ2A 2WKQA 5DGIA 1V25A 2JIBA 2ZT6A 3H3XA 1QRUA 3GIWA 3SOZA 1EGHA 5LSAA 1MRZA 1SULA 4R98A 1P9OA 5U4XA 3SBXA 4N3NA 5CAEB 3TOVA 3ZWYA 2IS4A 3RVOA 3U3OA 1JN0A 2RGEA 3CSSA 2HJ9A 3ND5A 4BVLA 4HNAB 4CR7A 5LOVB 1XSEA 1CIVA 1OW3B 3RS9A 1FW8A 1OU4A 1ZCFA 1KHTA 4JUFA 2PKQP 4BRUA 1EWRA 4KAAA 1QE5A 2RHTA 1TIKA 4O59O 4Q3DA 2M6SA 4DV5B 2J0UA 2DHDA 3WR5A 2R2GA 3C48A 1RM0A 1UPFA 1NPDA 2O3TA 3OTWA 5GWXA 4CMEA 4CCAA 2BFBA 3PEUA 2XF8A 5JZ9A 2VK1A 4IIJF 3N2GB 3KUUA 1ZD1A 1JIQA 2CMHA 3OZXA 4JUIA 1EESA 3I12A 4YHBA 3UJ3X 3VYRB 3K0AB 1LB1B 3WK9A 3V7FA 1YVPA 1H4TA 421PA 4HR7A 1GNRA 1JXAA 1I4LD 1NM5C 1T5TA 2XDQB 3AWIA 3F7MA 3KAKA 4JLWA 3O31A 4PHHA 2J0EA 3HVKA 3EXG2 1A50B 4BAZA 1TK3A 4MK4A 1KAOA 4OUDB 4WAUA 3FBTA 2IIQA 1YV9A 1J1ZA 4RLFA 2CL6X 1DFIA 5B4TA 4V3BA 1OV4A 3S5JA 1J2TA 2GBGA 2UUAB 3HBMA 2AF4C 3PDUA 1JU4A 4MRNA 2QU8A 3FPGA 3VZQA 3P9YA 1WMSA 2XMGA 2HOQA 4J0QA 3FVVA 3OLVA 3A7EA 2LWIA 2VP5A 4FLMA 3O3NB 1KIMA 4G4SO 1P5HA 2EYQA 4QA9A 4RZQA 3WNQA 4CV0A 3WLHA 4DBLE 5KYNA 3U0BA 4FC7A 1SIUA 4KIUA 3H4VA 4IEFB 4JXJA 4RC9A 1L3BA 1F5NA 1U9ZA 1I7DA 1E0JA 2EFJA 3FHLA 5F5NA 4DLBA 2J67A 4K86A 1FRFS 2ZUVA 1NKTA 4OHCA 5DFAA 4WBNF 4QVIA 4H3HB 4GVPA 4JGIA 1CB0A 2O7QA 1ULBA 1BAPA 2J09A 4G07A 2D7DA 3COJA 3L02A 4R6XA 3RNLA 5JISA 3KSBC 1QG6A 1QSGA 1SCNE 2XB9A 3DHVA 4AY3A 1ZFNA 5BXQC 1VSUA 2H2WA 1D2CA 2EX0A 1QPGA 3QXHA 1FE8A 3QLUC 4Q6WA 1IQPA 13PKA 3H6GA 4A0FA 4C29A 2GETA 2X2OA 4P93A 1QE0A 1AS2A 2HA5A 1RWOA 3OJOA 4H16A 1R7RA 4J2HA 5TPWA 4C6SA 3GLFE 3X1KA 1B2LA 3BXGA 1VOTA 2WJPA 4XM1A 1M7GA 4WFKA 3G9QA 4LOHA 5EIAA 2MDTA 3W8EA 4DGSA 4D0NA 5JAPA 3AVQA 5KX5F 5EP4A 3RH0A 4BCDA 1Q7RA 2C2ZA 3UZUA 5K3EA 5FNVA 4JIMA 3QU2A 2PRIA 4H1TA 5E4YA 5EI5A 1MT0A 3BTUA 1U98A 2SBTA 5T64A 3UMBA 1D0SA 1KK3A 5IM4F 3T1TA 1MO5A 1K5HA 1T8YA 3CGWA 4I1PA 1DQRA 1A76A 1ZA2A 5BYAA 1P0IA 2YJTD 4GBED 2VHQA 2CVOA 2GXQA 2OZVA 3E7FA 3AB7A 3REFA 1L8AA 4ZJPA 3ADPA 3R9XA 4WCFC 1JDJA 3HI6A 4JHXA 4WNAB 2BY4A 3RS7A 5ICSA 1KZ9A 1II8B 1WUTA 4OHOA 1H65A 1MB3A 1TTPB 2IHJA 4X91A 3P4UA 2JJQA 5A4IS 1QHXA 3PGLA 3PQDA 1AK9A 4FXOA 2P9FA 5K6AA 1XNRB 4U2KA 1E2PA 4DSOA 1W581 2OK7A 5CVJA 3NWPA 3LPCA 2WD8A 4CDGA 2JCSA 1LF5A 8ADHA 1CJTC 2YC4C 5IJAA 4IHJB 3E7WA 1ND6A 1SKQA 3HFJA 1YB1A 4PTLA 4DLYA 1B1AA 1DC8A 2RGNC 4PXAA 2EZ4A 3EBPA 3BDIA 3QPBA 4TS3A 3I6IA 4HGOA 2WFAA 4ZEXA 3QOFA 3C4QA 3ZQ4A 1LSSA 1UK6A 3C3MA 1UOOA 4RKWA 5FUYA 1SKAA 1OC4A 2OV1A 1G38A 5KC8A 2IOFA 3X1DA 2Q3HA 2VOEA 2QVXX 3DD5A 3QVOA 4Z2YA 1R4AA 2H1LA 3S70A 3UPDA 2ZRDA 4TV9A 2JS7A 1UCFA 2PNFA 4BCCA 4BECA 2WYIA 4KDRA 3QMMA 5IMSA 5KHOC 2VNSA 4IDAA 4BQNA 1U6KA 2H92A 2PIAA 3F6YA 4MUBA 1GPBA 1KIFA 2PSSA 1J9ZA 1PL0A 3PHGA 4ZOLF 3C8HA 4HDRB 3PENA 4OK3A 1I2BA 3CNNA 1R0CA 1RHMA 1VJGA 3FPBA 721PA 1LDNA 2P3OA 2CUKA 1XVIA 1DHTA 3PUYA 5CPFA 2OCDA 5KCMA 4AWXA 4E22A 5JJIA 2QAJA 3PD0A 4DPKA 2F17A 1X7YB 3AM4A 3FHOA 1FFWA 2X7JA 1DPGA 1J97A 1UQTA 3OOHA 2PV7A 2OORC 3UAGA 2Q99A 1RTTA 5GZ1A 3STWA 4AKTA 3M1AA 3VOAA 1ZY2A 3BB4A 1NE7A 4XIJA 1RWPA 4EDHA 3L7AA 2WEKA 3G1UA 4OB8A 3D64A 2YWFA 1VSQA 1YT5A 3HDVA 3NIWA 1OYVA 4QTTB 3V2GA 3LI2A 4P4GA 1RADA 5KOJB 2VJYA 3OD1A 4N9WA 5A2QA 3B1VA 1M9NA 3K4HA 5CB6A 4IO1A 1D2MA 1JL3A 3PC8A 3FOZA 3T5DA 3LGXA 3V2IA 3LVBA 1XYVA 4MZDA 4YCLA 4V0RA 4PFKA 1Y4UA 1FP1D 1U8AA 2PBFA 3AFIA 1XMIA 1MAWA 2FE4A 3QNUA 5I8ZA 3VRHA 4C0LA 1GRCA 1Y8RB 3C41J 3SBDA 3ZE0B 2YWDA 5AH0A 4MV6A 3NDBB 1NMEA 1O95D 3KB8A 2IW3A 1T4CA 3PCRB 3HB9A 1R16A 2JGKA 2PQ6A 1JPVA 3DV9A 4XX0A 5I4IA 1NBAA 1PJ2A 3ILXA 4DCOA 2X0NA 3EW7A 1ETHA 2H59A 4TLEA 4QDTA 1XZDA 1PJTA 3IV7A 2GESA 3KUXA 3MINB 1UT8A 3VPAA 5LUAA 4FDUA 1XJCA 4M9RA 3TQTA 4A15A 1P29A 2IS1A 3CNQS 4QQKA 1XOIA 3W5AA 4I8DA 1VFPA 2JCBA 2PZLA 1Z83A 2QL6A 1IAVA 3W2FA 1Z5GA 4CM9A 3GRKA 2DH6A 1RU3A 1JEAA 2GWHA 4NNPA 4X1IB 2HLDA 2Q8NA 3AR2A 1D6NA 1NN1A 3I2FA 1E62A 4QFDA 4EJSA 3HBLA 4OG2A 3TW8A 3PJFA 4AYXA 2GYVA 1QPBA 4MP3A 1SXJC 2IEIA 1GZ4A 2GHQA 2XQKA 1CE8B 4DLUA 2B61A 1GQSA 2OAEA 3CF2A 2DQSA 4FEYA 1C41A 3GG9A 4Q24A 1JMKC 3IRUA 4WT7A 3ZY3A 1VJ1A 1JIIA 2I3BA 3GJTA 3TDNA 3LQFA 4C4SA 4A26A 2GERA 2COEA 3WYBA 4BVEA 2GHTA 2XLBA 3BRWD 1OFTA 1OPRA 4RTOA 4QPNA 3I4CA 3TZQA 2VSNA 3JATA 1RYMA 4ZJYA 5DNYB 5DOVA 1K75A 4OGWA 3ZLTA 1E7QA 3GLVA 3CH6A 1QHHB 1YS9A 4H9GA 3VTFA 2APJA 1E5QA 4GLFA 4AMVA 3ZV6A 5A4DA 5B6JA 3F96A 1ISHA 2VCHA 1F2UA 4MYDA 4MW1A 4EF5A 1KFEB 1Z08A 4ZO8A 3EFEA 3D6VA 2GQ0A 1RYZA 4PANA 2F1JA 4KJXA 3DOJA 2GMWA 4QQ8A 5A2GA 4GVLA 1CZHA 2WU1A 1M5RA 1G5TA 2X9LA 3OD5A 4P2GA 1DG1G 4NIMA 1JA9A 2VHCA 3MT9A 4RKYA 3SXUB 1A5BB 4EVRA 1JECA 4POOA 2HA2A 4Q4HB 4E30A 3M6LA 1NIJA 1XLTA 3EQ8A 1GGNA 3VH2A 1QGZA 1EVKA 1XQ6A 1PS0A 1Y37A 3CG0A 3VOTA 1OAOC 6Q21A 3IKVA 2JJ1A 1XELA 3S2IA 1JLHA 2H1OA 1AKWA 2OBBA 2Q5OA 3QEJA 4KN8A 4W5HA 4BKUA 2CFOA 1MJ5A 2QRGA 4ND8A 4WRRA 3W06A 5F9FA 1QIEA 3ABSB 4TZTA 2NZ8A 1T8SA 5HPYB 1QIIA 1Y6QA 4WEQA 5DYNA 5KYYB 3PXBA 3HFGA 2C4VA 3UH0A 1AMNA 5GZ6A 4HWKA 5HG0A 1EXMA 1XEFA 4KV7A 1IHOA 3ANTA 2ID7A 5EPOA 3ZCPA 3WZLA 1XZJA 3SU8A 5EZYA 1C8BA 1DADA 3LBNA 2QW8A 4ZQGA 5BT8A 4KREA 1JTEA 4MUYA 1CVRA 1HT1E 1Q1EA 2HWXA 5BQ3A 2ZUWA 4CEHB 1LLQA 3K1AB 3BKXA 3FOEC 1BN7A 2YDXA 4K6FA 1BE8A 4YCAA 3AXSA 3TOXA 1REQA 1L7VC 1TJYA 2FW6A 1N6KA 1R9NA 2CDBA 1AX9A 3H11B 4MR9B 5CA0A 5IJ0B 3OPMA 2FX2A 4I1UA 4LHVA 2JLBA 2F1OA 5JCOA 1BKSB 2B98A 2P4UA 4G4GA 3W6OA 4IH1A 3W9SA 4ECEA 2G4VA 2Q50A 5CUQA 2QE6A 1KBZA 3QP9A 1K0UA 2VG8A 3VDXA 1VPTA 4D4IA 2ZRIA 5D6OA 4ARBA 3P5BA 2PH3A 4M1KA 4EGQA 1UOQA 4NU8X 1EPUA 4ZVKA 3HXMA 5HQTA 4ZOQI 1GJRA 3V8NA 5BN5A 3B78A 3CZRA 4JXKA 4B79A 1QLJA 5EP1A 4YXWA 2BGKA 3RYFB 2HBRA 3EFBA 3I2KA 1JHAA 4D8TA 2OGTA 4XGRA 5CK4A 5C4GB 2GNOA 5E8RA 3VI3B 4I81A 4DJAA 3A3KA 5EL0A 3QI7A 5JO9A 4OHPA 4JYAB 4RVCA 3EGVA 4UEJA 2PL1A 3ZK7A 2C83A 1V8DA 5IAGA 3B13B 2J7PD 5ETJA 5H4GA 3K0FB 4CTKA 1XTTA 4WZAB 1NTOA 3QU5A 1H4SA 4ZQEA 1D09A 3IDZA 4WECA 2YFYA 2MSNA 4F3KA 1N5LA 1TUIA 4FCVA 1NVDA 1VIAA 3MN1A 3F5SA 4G5QA 3WFJA 1R12A 2R66A 1F4VA 2ODQA 3PJEA 4LI0A 1GG9A 2A7QA 4JKOA 4OYLA 3IL2A 4AY6A 3Q7EA 1VLZA 4G1BA 4F4CA 5ALOA 3C6MA 3DDSA 2B21A 1M2VA 4I19A 3FY4A 4L9AA 5CU7A 4ZQHA 1P0QA 3W1VA 2HR1A 5EEHA 2BM1A 3PYXA 4MKHA 1UMBB 1JJ7A 3FIJA 3M82A 4WK0B 4PQEA 1ZGJA 2CLMB 3CHYA 3E23A 3ED1A 1S8OA 1CHNA 4C4TA 4DZRA 2NOAA 3DZHA 1JDNA 1GARA 1NJ2A 3NI2A 3OX2A 5GMOA 3MCWA 1E0SA 1KSHA 4KXWA 3G9TA 3CZAA 2XA9A 4HFJA 3ABQB 1T9GS 3FCOA 3Q0TA 3V7YA 2RHOA 1SVKA 4FR5A 4QSMA 3T0GA 1XMVA 3BDVA 4YJDA 5UKDA 3T06B 2XCRB 3WGQA 2ADOA 3WQRA 3N0WA 1ENPA 3IQIX 3RTGA 4D9BA 5JALA 3A14A 2GJ8A 2E5FA 3IAEA 3GA7A 3JAWA 4BNDB 3S8MA 1UBRS 4QBTA 4JUCA 4C3VA 4RVSA 1US8B 4WBSA 2HQOA 4ARZA 2XZOA 3EC2A 1HWYA 3PDIA 3AY6A 1F3LA 2LIVA 5TQ2B 3GEMA 2AMYA 3KR2A 3I53A 3NT5A 5E38A 4NV0A 1E18A 2WJZB 3NH6A 5BR4A 4YMLA 3RE1A 1E3MA 2YIDA 3QI2A 4S1NA 1AK1A 1BHQ1 4HAYA 4EW2A 3OX4A 4F3NA 4BUCA 3PE3A 2EEZA 1PR4A 3VV2A 3HCNA 1XDWA 3R0IA 1JLRA 4PINA 4Y6QA 1PJAA 5BV1A 5JOQA 2FMFA 2Z4SA 1IPFA 1Z62A 5AK3A 3EQ7A 2IH2A 1SUCA 3TRKA 1IN8A 4FTWA 4MYSA 1ZXXA 4YUXA 4ZTZB 4YUZA 5L45A 3CWZA 5A3SA 1NYQA 2PLFA 5F9MA 3SX0A 1R10A 1JX6A 3WIUA 4EJFA 5JECA 5JI2E 4GICA 2EFYA 4MIOA 3V48A 2F3PA 4HDOB 2CNOA 1JLKA 2BTQB 3PI7A 2JJ2D 1NW4A 1TJ4A 4X65B 3CH7A 3EVZA 3L8MA 5J63A 5BWLA 3GN1A 1KU6A 3GUYA 4JD5A 3OLXA 2PLRA 1X87A 2OXRA 2XBLA 1I5OA 1OTYA 1Z3IX 2CUTA 3L43A 3UANA 3UGJA 3RC8A 1UEXC 1UM9B 4PICA 1FSSA 1G6Q1 2I4OA 3MWFA 4MV5A 2A1UA 4E03A 2QZPA 1N2HA 3I5UA 4QNMA 1TUEA 4L08A 4R9UC 1M6NA 5L95A 2PUAA 1KS9A 3CMCO 3Q10A 1CUUA 4TYPA 4HO1X 1KSJA 3K9FC 3TSYA 3HVJA 3LX4A 5FNVF 4NMLA 1UKBA 3CUYA 1J06A 4YACA 4P92A 1K7YA 3RQSA 2QMOA 1NM5A 4WI1A 1V4NA 4JC0A 1PKEA 1VE3A 3I2HA 1RJFA 1DX9A 2VSQA 3TQCA 3D2AA 1JEDA 3GLIA 4CM8B 4ENUA 2XKKA 2WABA 4M9ZA 3NWBA 2YVLA 5KYXA 5DBOA 4IJWA 2AE1A 1T2AA 3WWCA 2DUWA 1XTUA 3H2ZA 3F4BA 2B94A 3AETB 4WESA 4A3SA 1KJNA 1TTQB 4TRMA 4AC9A 3OU7A 1LSJA 3NUGA 4IF4A 3FPCA 5CR9A 3WADA 4EYQA 1ZSNA 5BN3A 4DY4A 2F62A 4O6VA 3K0SA 1JLMA 3GLIE 5EE0A 5CDGA 1HYQA 3TI9A 3NEJA 1VG1A 1MP0A 3R3YA 2CLKB 4DC1A 1BFUA 2WZCA 3F6SA 1SBNE 3L2OB 4JS0A 4DR7B 1VHQA 1AD2A 3CLTC 1OH8A 3FOBA 2NXNA 4YRIA 4IDDA 1KJWA 2FFHA 2IYTA 1YDEA 2ZTHA 3HEAA 4CEJB 2ZRMA 4LZAA 3R3SA 2XX3A 1RYEA 3KV3O 2P6NA 1QKKA 2IITA 2WKRA 3K9NA 3OH8A 1M5UA 1PV4A 1G98A 3OMLA 2F1RA 3L1KA 1E0KA 1LRJA 1T8PA 3KKPA 2E82A 3A6HA 4GMHA 5I5EA 1JTVA 1FX1A 3UQYS 4HNGA 2WMDA 3RHZA 4IG4A 1E5TA 5CLIA 2BEVA 1G20B 2CXQA 2I7VA 3RS5A 5IDWA 1A77A 2DBZA 3KYIB 4MVCA 5FWYB 1JJIA 2GKGA 1I51A 1UDCA 2A67A 3NGMA 3QLUA 1XDSA 4TV9F 1H94A 4R3WA 2JI9A 1WVMA 5A7HA 4GQAA 5CK5A 2QD2A 2Q6IA 1IJFA 2XE6A 3E22B 2GRAA 4KVFA 4OB7A 1QGAA 1N0HA 3U3XA 2W4IA 3NOQA 1YCFA 4QREA 2AG0A 4TMXA 5AHKA 1A8PA 3UK0A 3PIRA 1U8UA 3KSDO 1SBQA 4FJ1A 4HRAA 1XTBA 4JYBA 3VNRA 4DLZA 4YRQA 1O6ZA 5JW6A 4OM7A 2R4UA 1TUBA 2W4MA 4M87A 3IUQA 4E5NA 4OX9B 2ZIXA 2O8BA 3VV3A 2NZXA 4J75A 3VYVA 4JYPA 2N3ZA 2VTVA 2GD6A 1EYZA 3C3AA 1QHEA 1Z0UA 5EIFA 3TZHA 4QOFA 4BV2A 3JWGA 4RIIA 5J58A 9MHTA 4EY4A 4FBMA 4M9CA 5DH9A 3T4PA 1JKMA 4B80A 5HOQA 1N4AA 1IY0A 1H8HD 1LLFA 1X1QA 4BJ5A 2HD4A 3D3EA 3H0KA 2JGNA 5HM6A 1Y1KE 4WCFA 1YWGO 3GGPA 3DL7A 2QSYA 4MGHA 2XEXA 2OAP1 3QOWA 2DRIA 2XBUA 4P54A 3FUUA 4C2BA 2KLBA 4EX6A 3DKRA 3HNRA 3RV4A 1YRBA 3U3RA 3DZCA 4IUDS 3V97A 1CP2A 1SOWA 9ABPA 4ESVA 3I6ZA 3AEKA 4QYMA 3BGDA 4X8HA 1ADBA 3EYAA 4Q82A 5C4MA 2BEKA 1FYDA 2FQWA 2P0YA 3CC8A 3FUXA 4UEWA 4QUDA 3ZWMA 4U7DA 3CEMA 1YMQA 2Q4EA 1D2AA 3MTQA 1X15A 2WIJA 3DWEX 4KO8A 5FPTA 1WLSA 3BJIC 3RUAA 1U3WA 4WHMA 2RGNA 3DE0X 3KX2A 4HMQA 4Q3EA 4WMLA 3AVUA 3OX1A 4UNPA 2O8DA 3ADBA 1RLTA 3ROQA 3SF8A 3M9XA 3UWSA 4DYVA 5K9ZA 1W19A 3FPSA 5E2BA 1K4KA 1H6BA 2XNKA 1E96A 1YE8A 1RLMA 4LE1A 2Y92A 4FEGA 4DA9A 4KQHA 2XWBF 1P5RA 3ZNOA 4O29A 3ZS8A 1DCKA 2E37A 2V7PA 3EIXA 2G36A 3ZK9A 1Z13A 1XHLA 5AJTA 3ZZ0A 1Y6FA 4AZ3B 1ZUIA 4BX9A 2AT1A 1X1DA 1MB0A 4FMDF 3KC2A 1V35A 3A1UA 1ZMBA 2VSOA 1DXOA 5ARDA 5C5DA 2BUCA 2WD7A 2NO4A 2E7ZA 2F43A 3E8SA 3P52A 4DUZB 3C1AA 2WVJA 3WLFA 1ILWA 1DXQA 2NVWA 2XUPA 3CT6A 4KLZA 4PLPA 3HTXA 2FZ5A 2OORA 4O3FA 3QPWA 4KWTA 2UZ1A 4PSVA 1Q1BA 4JSRA 4YBRA 1JRLA 4L74A 1ECCA 4H0CA 2AEJA 4RK6A 5AVOA 2PXCA 1UXOA 3M34A 2G9VA 5AM0A 4B4UA 2OC9A 4G5FA 3KYDA 3D5TA 5T6MA 4FFPA 3DCJA 3RVDA 5LQJA 4KR7A 3UVEA 1IXRC 2JIRA 3I1YA 4RVUA 2GILA 1Z2PX 3I9V6 1M6VA 4NAUA 2R8OA 3PWTA 3BFXA 4JJ6A 2V8BA 1JAZA 3PT5A 4QDOA 4NFLA 2CV1A 3D7LA 3DZIA 2UZ4A 2NT3A 2R60A 3GJ4A 4OHUA 3DVSX 3HU3A 5F52A 2IYAA 1LBEA 2BJVA 2NZYA 2UKDA 5AI0A 2NU6A 1ZZEA 3NX4A 2PM8A 4FFVA 4CE6A 4CG2A 3DO6A 2XUDA 3ICOA 3S2FA 3TPCA 4Z54A 3TR0A 2ZXEA 1W36D 1X86B 5JSYA 4BQSA 3OZIA 4BRWA 3FUCA 3KQWA 1DAEA 1ZN2A 1YB5A 2EWMA 1UJ6A 1XT6A 2CLEB 2E49A 1IMJA 2AUMA 3IILA 3OFND 4YC7A 3PE4A 2C2BA 3UUFA 3QEOA 4QE3A 1J9GA 2DR3A 3BK7A 4IIFA 4OP2A 3UJNA 4W5TA 1PZNA 4KFTA 2FEPA 3GP3A 4L5YA 2BGIA 1NW8A 2C92A 1IVYA 2ZZKA 3C8UA 3CKYA 4WZ6A 5K3CA 5KNBA 2XXAA 4FB4A 2GFHA 3NNSA 2JIZA 5BOVA 2GBLC 4BGEA 2YFHA 3PUWA 3IEVA 3O8OB 4MGKR 2MCFA 3BOSA 3IQDB 3M8KA 1DDIA 3RSGA 3TZCA 4DNPA 1DX6A 4OU5A 1WXDA 2M9MA 1W93A 3HL4A 1K2VN 3HN7A 3WLQA 3K0HA 1H85A 5DNDA 3OI7A 4GDFA 3LCVB 3RDPA 3TLZA 3N86A 2GCIA 3OTHA 2BMWA 3DE7X 4LOAA 1E6LA 2OXTA 4AF8A 2PLWA 3HA3A 3KQQA 4NDNE 4P22A 4YT8A 3A1TA 3ASVA 1SXJA 3DUFB 2HV8A 3JTMA 3R3VA 3OP4A 4K9QA 5FO0A 4D8XA 1HO3A 3IKTA 5EP2A 5EZYF 1FU4A 1ZGGA 4JLVA 4JYCA 4FBLA 4BMZA 1O6GA 4PWYA 2HJWA 2YY7A 1THMA 4K9RA 4AU1A 3PA8A 3TOCA 3N3BC 4JKIA 2D8MA 3GMTA 1DWQA 1XDDA 4FC6A 4I6EA 4B6FA 4XQ0A 5CA0F 4J0JA 1MZVA 1HDOA 4QLOA 2N75A 3PDHA 4XH9B 3VSAA 5JPCA 5G1PA 2OHGA 3OT1A 4F2WA 1JDVA 4MDYA 2O2HA 3PCTA 2C5SA 4CIYA 2I2BA 4GBGA 5F2KA 2PWBA 5LYYA 2DH5A 4IGEA 2FQQA 2ZSHA 3L6UA 2XI4A 3GRZA 1MF7A 3MBKA 1TO1E 1MHTA 1JFLA 1Z29A 2OFOA 4B3JA 1WDWB 1CEXA 2EARA 2HWYA 1IUPA 1EVLA 1YUNA 4HDKB 4C4XA 1BOOA 2M6KA 1XNGA 3SZLA 3SXJA 3VSDA 4EUEA 3QYJA 3RSHA 3BMCB 5LD2B 3G5UA 2X8LA 4TZ0A 5HIIA 2VDNB 1FNMA 1W0JA 4TL9A 4UBKA 3W5HA 1J2YA 2YWRA 3QEMB 4UCXA 4K9SA 1UPTA 5AHWA 5HRCA 1L5GB 3VJRA 1E5XA 3WMWA 5FPYA 1OAOA 4TPKA 1C7RA 5KNBH 4BMOB 3I0MA 1NRXA 4H27A 4R1NA 1PZMA 3NUQA 3NFRA 4JUAA 3ROKA 4RCVA 3AIKA 4FN4A 2PBZA 2VS1A 3NBAA 1OPXA 2QYOA 3QUQA 4QDZA 4S1WA 5GONB 4N4AA 1E3TA 3O03A 4G1EB 2LXNA 1XMQB 3M3DA 2QD3A 3HKBB 1PT8A 3PFNA 3LL7A 5FBWB 4FCTA 4I1OA 4URUR 1IOVA 2IHZA 4DS3A 3UK1A 4DDMA 3FPFA 5BRJA 2LCIA 1IUNA 3PR1A 2BR5A 3FNGA 2C2WA 4BTLA 1Q57A 2HW8A 2WMYA 4ALKA 2E1PA 3DTYA 5FOUA 5K01A 3CM0A 4QGSA 3NOXA 5H70A 3PXDA 4HXYA 1ZJZA 2LDXA 3C5HA 3VPFA 3SHTA 2DXIA 4QQFA 1B74A 2FPPB 2XUKA 3KLNA 3PHIA 4QWWA 4RDIA 4TWBA 5I7AA 2RMKA 2HF7A 2PA0A 1ZK4A 2Q2OA 5KYVA 1AQNA 2DPGA 2O23A 2KBFA 3GFVA 3P4XA 5HTOA 5HFAA 1H2WA 3KBOA 3GJYA 3R7FA 2PJZA 1GRNA 4F5WA 1S9DA 4WD3A 2CLSA 1BH2A 1SKUA 2A9PA 2X9NA 3WKCA 3UMMA 5A0VA 5AJXA 3MJRA 2HXSA 4DR3B 4H3SA 1M1YB 4EWLA 4ZZIA 1G5QA 1YR3A 4JEMA 1F1BA 1JVNA 1M2OB 3FSGD 1IQUA 5CLGA 1KORA 1QRDA 1K66A 1VP9A 1XAJA 2VSXA 1E5LA 2ZETA 4FILA 4OHKA 4PRKA 2CHFA 2G72A 3I09A 5HFJA 3DHYA 3OCXA 4P36A 1U7TA 3ZW8A 1OR8A 3ZU4A 1CZKA 2HMSA 1OLUA 3VR4A 1NVGA 4YY3B 1Q3KA 1GNQA 1PD1A 4OXQA 3WZMA 4YAJA 1WRBA 4N1AA 1N57A 4X6LA 3RPEA 4GAEA 5CEJA 2GYUA 1X14A 1P60A 3OPVA 4LQCA 2DHRA 3ESBA 1JFFA 1ICEA 1JQBA 3M3HA 3NTXA 1ECLA 4G4JA 1KKMA 3ZDZB 2FRDA 3ROXA 3WBKA 1AHPA 2UZ3A 2B8JA 1GPLA 5AESA 2XCLA 1YRWA 2O8EA 1LJUA 4P1ZA 3BFPA 4Y6GB 3O83A 2JFFA 4DR5B 1MOZA 1PT9A 3FZEA 4PRYA 4PZCA 4LGCA 1P3JA 3LP6A 3OU2A 4YJHB 3CFYA 5FV7A 3MWLA 3V1TC 4NV3A 1CY7A 3OEYA 1W88A 5JANA 1MB9A 2R6AA 2HHJA 2QGZA 1OBCA 3FVTA 2WSSD 3BQ9A 3VNSA 2GUWA 1XNJA 4OI1A 2IYYA 3H5VA 2OFFA 3B3FA 4LWQA 3EG9A 3ZNQA 4J2OA 5L9AA 5LLTA 4LX8A 3VC3A 3G8CA 4P3OA 3VU0A 2E9SA 4XCVA 4LV8B 2WC1A 3MJEA 1T10A 3OBIA 4Q3NA 2JEZA 1K63A 3VVLA 3VJMA 2WICA 3S2UA 3WL4A 1VBNA 1B6SA 1KC3A 2IEAA 2JFOA 2I2CA 1E8MA 4I1IA 1A2KC 1DRWA 4R5HA 1J42A 5AIAA 4EPWA 4IQ8A 5G0UA 4X44A 5F1PA 4BXOB 1M75A 1Q0LA 1IOWA 2JLCA 3UK7A 3DDUA 1AKNA 3DHNA 2R0QC 4UXHA 4XM2A 2OLJA 1HYGA 1BXRA 1P1CA 3DDOA 5ECYA 4AJ9A 4DWOA 3UAOA 2W4QA 4LFAB 3K1YA 3JCZA 3RI3A 1KEZA 1MAVA 2GTHA 3IVAA 2JAQA 1G1MA 4CQMB 2V4MA 3HR8A 2R8XA 1APBA 2JIMA 3PR2B 3M6AA 3VR4H 5F7XA 2FDXA 4DREA 5HKKA 3L7NA 3PWZA 4DY6A 1NKSA 3SLGA 3VO2A 2RH9B 5F1YA 3WL8A 3B8EA 5AW9A 2VZ9A 4QBIA 4RPHA 4REQB 1R6UA 1ZICA 1TW2A 2I8CA 3DV0B 3JQGA 3OF3A 2HWKA 1F48A 4MRSA 2ZI4A 1FY2A 2I3GA 4RZSA 2FSVC 1IL0A 3QLEA 1YR9A 4UDXX 1F8FA 2MINB 3GNLA 1RAEA 4HGQA 1FTQA 5G0VA 1SZDA 1ZVJA 1H1DA 1RJ9B 3HYSA 4OI4A 4YJ2A 2I22A 1DKMA 3HRHA 5CM9C 1JUDA 2GXSA 2C0CA 4F5EA 4DR6B 4Q03A 1X80B 3NHLA 2CMKA 1ZRHA 3RBZA 3TLBA 5LP1A 2QVZX 1V11A 1PJLA 1VE5A 4ZVMA 1TA9A 4JLUA 1TAUA 3BBLA 2I66A 1MX3A 1RBMA 2RHBA 4AN1A 4BLTA 3BIJA 1X74A 4D56A 4HN2A 3V8BA 2GPJA 2ZRFA 2GN2A 3RSCA 3VPDA 1FJGB 4DMHA 3D6AA 4OREX 2YOFA 1KQPA 2O52A 1S2IA 4ERNA 3ZH2A 1F12A 1OE0A 1N2CA 1Y3IA 2QHXA 4DW8A 1DE0A 3I1JA 2C5BA 4E5KA 4KDCA 4OQEA 1Z25A 1DAOA 1I6MA 4Q18A 4WK2B 2ZJ3A 2WVHA 1JFTA 2I62A 1E2MA 1L1EA 3VPBA 5LVAA 2V5VA 3GFQA 4BQQA 2KX7A 2AI3A 4D0RA 5LBUA 2P65A 4RFLA 3NBUA 6NULA 4PZ0A 4MLCA 3HL0A 1XVVA 1PW5A 5ARBA 2QLTA 3R0XA 3R6LA 4KU4A 1JFRA 3FHCB 2FCAA 5B53A 2GCPA 3GNSA 4QT4A 3VAYA 4FYYA 4UUMA 5JZVA 1GTSA 3LCCA 3QUBA 2O59A 3K6SB 2Q46A 2PX5A 4F04A 5IJ9B 3TFOA 4DT1B 5EJ6A 2YH2A 3F5MA 3UJBA 1UXIA 3WA6A 5E7IA 4G5YA 4BMXA 3F7NA 1ZJ4A 2UYGA 2Z2XA 2GNAA 3VUFA 4H4CA 2FG5A 2P2GA 1WW2A 3HH8A 4ZAWA 3BJZA 2YN0A 1SCUB 3HE3A 3TRJA 5GZ3A 4LC1A 4RJLA 1L8OA 1H93A 5KQLA 1D1SA 4TWIA 3MJHA 3U61B 1EDBA 1YS1X 5JS7A 4GOMD 2ZJYA 1PNOA 1AZLA 4PCAA 5FBRB 4AJ2A 1E4YA 1KA9H 4M0EA 4OLAA 3DQZA 5FDFA 1LY1A 2RHDA 3EGDA 3GEGA 3MMSA 5JSZA 1PBTA 1XHFA 4GS5A 1GV1A 2G71A 4O2LA 3LCRA 4TUYA 4TV8A 3KT0A 5COAA 1OC2A 3QX8A 1AGPA 3KU4A 4EHJA 4ETNA 5AM4A 2KJQA 1T9HA 2JBHA 1EGVB 1IRIA 1BVYF 2A9QA 2FW7A 3N8KA 1PZXA 3ND8A 1UAAA 3P7MA 4AS2A 5SY6A 5C53B 3A11A 2F64A 1FBTA 2ISQA 3CF4A 3L8CA 3TL6A 1NLMA 1QZXA 5EMHA 3UG6A 2ZJ2A 2AMLA 1UK8A 1PL6A 4DAEA 1Y3BE 2NACA 4IDOA 1S9HA 2LCFA 2P2SA 4HJXA 4NH4A 2W22A 2Z04A 4R83A 3TBHA 2HNBA 4Z7QB 3BXEA 2VH2A 2I4RA 3L46A 3D43A 1HFWA 4F72A 2ORIA 4KPEC 1IBKB 4O2RA 2C5HA 3OPQA 1U8FO 3T7EA 3M6UA 3TSAA 3LT4A 2VAPA 3N2YA 1VM6A 1EUYA 1BWSA 1DV2A 1U2EA 2WHPB 4RETA 3GA0A 3KEMA 4GKAA 3I01M 3FFXA 1IHYA 2FPIB 1EVZA 3THXB 1NMQA 3B7GA 4I66A 4XUGB 1K9SA 3S7TA 4OQMA 3SIRA 5C1PA 2Z43A 1CUIA 1MW9X 3L1UA 3STXA 3LVRE 4FW9A 4RPJA 2EQ5A 4ER3A 5HCNA 1BC5A 3ECAA 3WGHA 1GA1A 4RA9B 1RP1A 3ES9A 4KOAA 1XRJA 2KMLA 3HN6A 3ZV5A 1KFKB 4LRXA 3W6NA 1W85B 2X4IA 4GWLA 3D3NA 3GI1A 4HCJA 4HRVA 4NFHA 3TQFA 3WL3A 2NVBA 1OI4A 1SWWA 1XF9A 3PF9A 4PG7A 5EESA 4A5SA 4RD2A 4G09A 1KK1A 2KYRA 1GTVA 4Q1BA 3TLJA 1VBKA 2XCUA 4DLPA 1P5FA 1QGYA 1XK6A 1B15A 1SUWA 1WZIA 4HN9A 4RORA 2Z58A 5K3OA 4LSMA 2Z3WA 1N9GA 4YAFA 3PIDA 2ZW9A 3HNOA 4H7DA 5C8YF 3RVSA 3CVXA 3ENNA 4X63A 4YJ3A 3UC5A 3OZSA 2GEVA 1K08A 2VC2B 1VMIA 3MTJA 4L78A 4CQMD 5E6SB 1F2TA 3EEFA 4RJJA 1L7AA 3C5CA 5A9SB 4R6WA 1ZVMA 3BGWA 3GRFA 1R5BA 2FEKA 2A8YA 2BFAA 2YS7A 3U26A 3TW6A 2X5KO 1WL8A 2E6UX 4UAVA 1VRVA 1S89A 5K8IA 3WIOA 1NJ5A 4FYXA 1TZMA 2WQ7A 3H4TA 5F98A 1SG6A 3GO4A 3BL8A 4KI0A 5CMLA 5ALSA 5AXBA 5I7EA 1TMKA 3ASZA 3G0OA 4IZ6A 2VP2A 3EAQA 3HB1A 1SXHA 3C8DA 4MP8A 2O6HA 2O2ZA 3ZX4A 1UZLA 2W7TA 1UFQA 5KX5B 2Y1WA 4H77A 1E1CA