1ISMA

Crystal structure analysis of bst-1/cd157 complexed with nicotinamide
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
250
structure length
250
Chain Sequence
WRAEGTSAHLRDIFLGRCAEYRALLSPEQRNKDCTAIWEAFKVALDKDPCSVLPSDYDLFITLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMPLSDVLYGRVADFLSWCRQKADSGLDYQSCPTSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITRIEIWVMHEIGGPNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDCALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords bone marrow stromal cell antigen 1
publication title Crystallographic studies on human BST-1/CD157 with ADP-ribosyl cyclase and NAD glycohydrolase activities.
pubmed doi rcsb
source organism Homo sapiens
total genus 82
structure length 250
sequence length 250
chains with identical sequence B
ec nomenclature ec 3.2.2.6: ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase.
pdb deposition date 2001-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02267 Rib_hydrolayse ADP-ribosyl cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.82.10 Mainly Alpha Up-down Bundle ADP Ribosyl Cyclase; Chain A, domain 1 ADP Ribosyl Cyclase; Chain A, domain 1 1ismA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1ismA02
1HYGA 2PNFA 2UVDA 1LRLA 1CEQA 5JDCC 4WASA 3B1JA 4KWHA 4RVGA 1HT0A 2AW5A 2YZ7A 3IKTA 1HL3A 3L6OO 1V8BA 3I6QA 6LDHA 2HDHA 1LSUA 4ZD6A 3GGPA 4FR5A 1M2WA 1YH3A 2Z1NA 4CLOA 1YBAA 4J16A 5KVSA 2DAPA 2RH8A 3SEFA 1UZMA 2HSDA 3WX0A 4Q3NA 4OQYA 3NT5A 4GGPA 3S2GA 4LMRA 4BNVA 4DPKA 5LDHA 1FK8A 5ER6A 2AEJA 1DFHA 3K2EA 3RROA 4RV9A 4CQMB 1Y1PA 1W73A 1A4UA 2VT3A 3KEOA 4EGFA 1HE5A 5CG2A 1VLLA 2VHXA 2ZB8A 4WE3A 3V8BA 4NFSA 1DB3A 4MVJM 5FEUA 1NVMB 2FOIA 1V3VA 2Q45A 3RASA 4CQLA 4DRYA 3QV1A 5IG2A 3GVHA 3BHJA 1BDMA 4FJ0A 4NMHA 4OIMA 2VUSA 3G1TA 4CV0A 1C14A 2BD0A 5BT9A 3H2ZA 4B7CA 5TT1A 4D7AA 1YOVA 4FB5A 4NU5A 4JLWA 4WECA 3I4CA 1O0SA 3RC2A 1GQYA 1U3VA 3GT0A 3I83A 3WNVA 1QXSA 2D8AA 4A26A 1ZW1A 3SLKA 4UEKA 3WQQA 2F1KA 1EUDA 3OJOA 2O3TA 1PGOA 2GO1A 3RWBA 4MVJP 2VWHA 2EHDA 2YHIA 5MDHA 3C1TA 1V35A 4Z3DA 4HWKA 2B83A 2DQ4A 4DREA 4D3DA 1IZ9A 1EE9A 4RPKA 2D3TA 4IGFA 3Q11A 1WVGA 2YW9A 3AI3A 3C1AA 1L1FA 3ANLA 3WQSB 2P5UA 4JIGA 2C29D 3E9QA 3QQPA 4J7XA 3KYCB 2J3JA 3QWIA 1BTOA 1N1GA 1BHSA 4RF5A 1A71A 3ZV5A 4WKGA 1EBFA 4BO4A 5EL0A 1NVTA 1PGPA 3JQ9C 4OXNA 2NUAA 4DIOA 2I67A 4I5FA 5GZ3A 1AE1A 3DBLA 4I5GA 3FPCA 4RQUA 3W6ZA 3H5AA 2CZCA 4CUJA 2HMUA 3E1KA 1LLUA 4L73A 1JVBA 4EEXA 8LDHA 2O3JA 3EGOA 5U4QA 3JQAB 5ER9A 5IZ4A 2HJRA 2AEFA 4CMAA 1BXKA 3ZWVA 1F06A 2EGHA 2UDPA 3PXXA 3W8EA 1GV0A 3RKUA 1S6YA 1Q1NA 4J4BA 3GPIA 1SBYA 3PQDA 5G2OA 1KBZA 4RCVA 6ADHA 3SX2A 2QYSA 2DT5A 2I76A 1BRMA 4JN6B 1MGOA 4TRMA 5F21A 2Q49A 4A2CA 1NR1A 2Q4BA 3W1VA 3WTBA 1DIHA 3DAGA 4C4OA 2LDBA 1E6UA 1DAPA 1YBMA 1YB4A 3BTOA 3U0BA 1KYQA 5L7TA 4B7XA 4XYMA 1GAEO 2EW8A 4S3MA 3NEPX 3OQBA 4O59O 4MVJE 2E6UX 3VPSA 1DHTA 5HTOA 4BQPA 4TWRA 3R3JA 5LCXA 2HK8A 3IJRA 3TPCA 2E37A 3JQGB 3NGLA 4BNXA 3QW2A 2OP1A 3D64A 1T24A 3W8DA 2P68A 3TSCA 4QUKA 2WYVA 1NBOA 2EIHA 1FDTA 2QZ9A 2Y1GA 3QWFA 4OOFA 1YQGA 3E8XA 3OIDA 4R01A 4AL4A 4HV4A 4ZN6A 4YT5A 2PZJA 3ZZNA 2IZZA 3RCBA 3IC5A 3KYCA 1GYQA 1ZBQA 4W9NA 3Q1LA 2RHCA 5K6AA 1PX0A 1O95A 2QRKA 3PYLA 5DCWA 3DZFA 1LLCA 3MEQA 2WEKA 1NM5A 3KHUA 3PI7A 4RQTA 3MCVA 5HM8A 2QRLA 2NVWA 4XD2A 1FDUA 1D1SA 2W2LD 1VC2A 1SMKA 4TVBA 3STHA 1VE9A 2YDYA 4E4YA 1P31A 3L4BA 5AVOA 1IY8A 3PWKA 4BNZA 1TT5B 3IP3A 1LDMA 2C20A 1H5QA 2DFVA 3DZJA 3GDGA 3CUKA 3JQAA 5JSFA 4G2NA 1FXSA 1OFGA 1I3LA 5IXSA 2VOEA 3M2PA 3HUDA 4BNTA 1IUKA 4DUPA 4D41A 3OEYA 1NTOA 2EJVA 2G0TA 4R3NA 2VRCA 2YY7A 4PLYA 3KRTA 3MWDB 2Y1CA 4ALNA 3RBZA 4DC1A 1I3KA 1EBUA 2GGSA 1DJQA 1QG6A 3PGXA 1QYCA 3WLEA 2J5RA 2YJZA 3ZWOA 1K2WA 3ICPA 3DQPA 3RUEA 3TN7A 1U7HA 3QRWA 4MVJG 4RZHA 3ZU3A 4CM6A 1IYZA 2PGLA 3WGGA 2V6FA 3ZWMA 4Q3BA 3H9JA 1C3VA 1BXGB 3JQGA 4GI2A 4DYVA 3VVCA 2VN8A 5IDQA 2JD1A 1VPDA 5CDYA 3DZGA 4FC6A 1V3TA 4GLOA 3S2IA 1NQAO 2CF6A 4I8XA 1LI4A 1MC5A 3VTZA 2UYYA 1A7AA 4YRBA 3I9LA 3ZWWA 3JD1A 4Q3EA 5A05A 1DBVO 2EP7A 3PK0A 4KWIA 4J1NA 3U5TA 3U4CA 1N2SA 2CVQA 4AJ2A 1QLJA 4JROA 1A7KA 1QYWA 1TI7A 4UUMA 1KEVA 1Y5MA 1YRLA 2FZWA 2Q1UA 3UH1A 4FIZA 2G5CA 4NJOA 4E2YA 5KVCA 3W4KA 4IM7A 4BO3A 3LU1A 1XQ6A 2J5QA 3ZW8A 1X1EA 1UXJA 1TT5A 2JCYA 3ROPA 1NQ5A 1N8KA 3EVNA 4WGGA 1F17A 4A27A 4RPHA 4J2HA 3X2FA 4WLEA 3QIVA 2VRBA 3TF5A 1PTJA 5CFZA 3W4IA 4E5YA 4BL5A 4CMGA 5CPFA 1P1JA 1R66A 2BELA 5TRTA 1DOHA 1VSUA 3WGOA 2BFOA 2JAPA 4PLTA 3GUCA 4BO2A 2VWQA 2PKQP 5DULA 4BMVA 3RUIA 1U3WA 1MFZA 3D4PA 3A28A 3EK2A 1T2CA 3LZ6A 4YQZA 1J0XO 3P2YA 4IPTA 4N54A 4EITA 3PIIA 3UF0A 3DONA 3WSVA 2CDBA 5G0VA 2BFMA 4TKMA 4IQ8A 3NT4A 1Y7TA 1R15A 1DEHA 2AG5A 4MVJF 2J5KA 4TKLA 2DFDA 4G81A 3N58A 1U2GA 3F1LA 2DTDA 4F46A 2X86A 1E6WA 1PWZA 2UUPA 2GNAA 1NYTA 1RM0A 1UUFA 3D4NA 2PH3A 4J6FA 3FNGA 4O0LA 1P3DA 5DZSA 3ZV6A 5IJZA 2RH4A 4JP3A 4NI5A 3SJ7A 3JQDA 4M89A 4YAEA 2HCTA 4AJNA 1DRUA 4B79A 3EHEA 3DR3A 5EESA 4BGUA 4IIVA 3Q6IA 4DMMA 4IXWA 5F1PA 3QVTA 1B2LA 4LRSB 5TLSA 3HB5X 4N7RA 1Y81A 4BNUA 2WE7A 4E21A 1UP4A 1FDWA 3PDUA 2GN6A 3F5QA 4E32A 1Q2XA 1YB1A 2GDZA 3V1YA 3BHMA 3I1JA 2OO5A 2YQ4A 2ZATA 1C0KA 3GLQA 4BNJA 2AEMA 3AUTA 4R68A 4Z0HO 3AI2A 3OICA 4PLGA 3S8MA 2P4QA 4CM9A 5DCYA 1R37A 4CM5A 1W0CA 1ENPA 1PGNA 3H6KA 1VSVA 3GFBA 1T4DA 1Y5RA 2E49A 1MG0A 2C82A 1GTMA 4NG5A 3NTRA 5I7EA 2PWZA 4KUEA 2PV7A 4E2ZA 1DIAA 3U4HA 3UXYA 1QRRA 1UZLA 1JAYA 2FPIA 4QFCA 1T2FA 1ZH8A 3ICCA 3BMOB 4YT4A 2XXJA 1B3RA 3LLVA 4IDDA 4WOJA 5ICMA 3DZBA 2GUGA 1Z82A 4DQUA 4BS9A 4F45A 2XPCA 4CM9D 2D2IA 3GR6A 5A3VA 3WICA 4MVJH 3MTJA 4ZICA 1T26A 1C1XB 3DBVO 2UV8A 3VZPA 4PG6A 3C7DB 4XB1A 4TMFA 1LDYA 1T1SA 4XDZA 5T57A 9LDBA 3IAHA 3IQDB 1LC3A 3CPSA 4O5OA 4XYEA 2CFCA 4AJEA 3QVWA 2JD2A 4RPJA 3AY3A 5G0TA 1RJWA 4H7PA 1Q7CA 4JXKA 3AU9A 4IIUA 3RJ5A 3OM9A 3VAZA 3ZHZA 2UAGA 1W8DA 5L9AA 4WEOA 1XU9A 2VT2A 1I2ZA 2WYWA 3DZHA 2B0JA 1EK5A 2NQ8A 1IHXA 3AUAA 3FHLA 1I8TA 2G76A 1T4BA 3VH2A 5IZCA 2VWGA 1E7WA 3FBGA 3WXBA 4JJIA 3H3FA 3O38A 2Y1DA 3P2OA 3H65A 2X1HA 1ZIDA 4BQRA 4B8ZA 8ADHA 1U28A 2FR8A 5FYDA 3X2EA 3GF4A 5CDGA 2Z1MA 4DYDA 5CPBA 4S1VA 1PIWA 1CYDA 2YFHA 4RDHA 1NASA 1NP3A 4DVJA 2X9GA 4U8GA 1JTVA 3CXRA 3ZHYA 1GUFA 1BSVA 2ZB7A 5F5LA 4FDAA 1E77A 1UR5A 2O2YA 4LGVA 2JFHA 4MIOA 3RQSA 4U5QA 1MXFA 2I99A 2G1UA 3CZMA 4GSKA 2AMFA 3WGHA 1T25A 3BMOA 4AJJA 5JFOA 2IZ0A 1HRDA 1QYDA 4P8RA 4D3FA 4W82A 4J1SA 4LN1A 1D8AA 2I3AA 2Q99A 3G79A 4HFJA 1G1AA 1ULUA 3D3WA 4CJXA 3I9KA 2C59A 2ET6A 3C24A 1JKJA 4U6SA 4EUEA 1ZEMA 1YL7A 4BO6A 1PGQA 2FMUA 4JQCA 4PIVA 5JYDA 3UFXA 4BNWA 3TWOA 4UAGA 2EKPA 3VOSA 3RU7A 1XSEA 3PWZA 3V2UA 4ZRMA 1A9ZA 1IULA 3DHEA 3K31A 5A9TA 1EVIA 4DWVA 3H7AA 3D1LA 3JV7A 4AJLA 1KOLA 1W6UA 1CETA 4KOAA 4D79A 1HE3A 3CINA 1LXCA 2DM6A 4RF2A 1GDHA 3ZNPA 4GL4A 4BMSA 1RYEA 2YFQA 2VYVD 5DP1A 3VZSA 5DF1A 3S1LA 3PHLA 3PHIA 3RU9A 4MOWA 3ONDA 4NBUA 2C5EA 1EUCA 5CEJA 2EW2A 2CUKA 4Z0TA 3ZGYA 1X0VA 3WMWA 5TIIA 4GX0A 5CG1A 1NXQA 4TQGA 4XDYA 3AU8A 3PHJA 3PLNA 1ZJYA 4L9RA 5ENDA 1NHGA 3HB4X 2HKIA 1ZK4A 1K0UA 2AHRA 4ILKA 3I9NA 1FDSA 1LBEA 1YJ8A 3UCXA 3DXFA 3WG9A 1CF2O 1O5IA 5TF4A 3LLSA 3AW9A 4F6LA 4HY3A 2X9NA 1M75A 4IDAA 5DOVA 5ENVA 5COAA 3VPXA 2C5AA 4CMHA 3EDMA 1P44A 1P74A 3JQCA 4CMJA 2PLAA 4BGVA 5BR7A 5H82A 4PG5A 1H9AA 2JFGA 1GU7A 1VL8A 1VI2A 3JQ8B 3ANNA 3E48A 1GYPA 3OQ1A 1ZNQO 5KTKA 4BB5A 4JBHA 3LC7O 2PD6A 4CR7A 3EYWA 1I30A 4FD3A 1D7OA 3LC1O 4YBZA 1VM6A 4N5LA 1MFPA 4II2A 1AXEA 3RI3A 3MOGA 4RO0A 2V6GA 2EF1A 2ZTUA 3EZYA 1F0YA 3QA9A 3V2GA 5DBGA 1EFKA 4CV2A 3U4IA 1MB4A 2Y93A 4L4SA 4R1TA 3L4SO 4AVYA 5TJ9A 1HDOA 3PZRA 4CMEC 3ZNOA 4AJ1A 1N92A 4E13A 1SCUA 4PVDA 1HDYA 3RKRA 1Z74A 2YUTA 1CQJA 3GOHA 1ISHA 2O48X 2ZYDA 1AXGA 4DLBA 3E6AA 1E7QA 1RYDA 2AE1A 4YDRA 2BMAA 1P1KA 5AXCA 1H6DA 1HSZA 4GVLA 4DLAA 3KOUA 1H2BA 4UREA 4WOKA 4B3HA 1I2CA 1SAYA 4DPMA 2TMDA 5JDIA 3OBBA 4H16A 3IP1A 2GZ3A 4Y98A 1Y9EA 2OZPA 3G49A 3MJEA 3Q2IA 3AI1A 3HFGA 3V2HA 2AQHA 4PZEA 1BXZA 3VDRA 3F9IA 4IS3A 5T67A 2B5VA 4AJ4A 4P38A 4YRDA 1K6XA 2EGGA 2Y1OA 4NR0A 1QMGA 2EWMA 2JL1A 2NU6A 3PJEA 1KVSA 4HNGA 3JQBC 4O63O 4Z6KA 5KOIA 2DBQA 4FS3A 1JWBB 1N7GA 3BHIA 3BMCB 3H9EO 2DBVO 3JQ8A 3FSRA 4IINA 2BH9A 4MIYA 3ZU5A 1BDBA 1KVTA 4EEZA 3DHNA 5IAAA 2Q1SA 4GLLA 4LVUA 4I9UA 1E1KA 1LEHA 4J2OA 3T7EA 2RHRA 4GWKA 4OGWA 2D59A 3BTSA 5L3ZA 4F6CA 1H94A 1PZHA 4AJPA 1V9LA 3NJ4A 1EK6A 2ZIZA 2I5PO 1ZK0A 1B26A 1PL7A 1RPNA 1MC4A 3WJAA 2DBRA 2NVBA 4ND1A 3L77A 3BYZA 3A4VA 3A9WA 4BGEA 3DMYA 1R0LA 2ZKLA 4G65A 4J1TA 2PKRA 2E4AA 4HBGA 1ZXBA 3FRJA 4RLHA 4CLRB 4E6PA 1A27A 5A9RA 3OIFA 3O03A 1SEPA 4IMRA 2OL4A 3K6JA 2PZMA 1U5CA 5I9LA 5C37A 1JQBA 1RM4A 1JWAB 4CPDA 5EQDA 1DXYA 1E3IA 4BNMA 2W8ZA 4XJTA 1X1TA 1C0PA 2IXAA 2R6JA 4YR9A 2JAHA 3NRCA 3NJ8A 3RBVA 3B1KA 3GK3A 4PRKA 1F8GA 4CM3A 3DOOA 1OOEA 1ZEJA 3WS7A 2SCUA 3PWSA 3WGYA 4GSLA 4WLVA 4A73A 1DFGA 3MJCA 1PJ4A 2VZ0A 1LQUA 5MGBA 1K3TA 1DC5A 4LK3A 1UDCA 2DPGA 1R0KA 4XR4A 3U3XA 3ROKA 1EQUA 4KP7A 1KY4A 1NQOA 3BMCA 4R41A 4Y67A 3E9MA 2IE0A 1MV8A 2WDZA 4JX8A 5B4VA 3ETEA 2X9VA 3FI9A 2RAFA 4BNYA 1VJ1A 3L6EA 5ES3A 4KUHA 2RBEA 4OMUA 4JBGA 4YAKA 2J3KA 4BNLA 1IL0A 1GQ2A 4ND4A 2VYNA 4XQ9A 1PR3A 2R2GA 3EMKA 2Q2QA 1PL6A 3KYDB 5KIAA 2X4GA 3TL2A 2QW8A 3AUUA 3JQFA 4CQMA 2OBNA 4E5MA 3RFTA 4M87A 3RD5A 1ZUD1 4PZDA 4OYRA 2C54A 1M6HA 1MP0A 2B36A 3K96A 2NQTA 3MJSA 4IS2A 2EXXA 3QWAA 4M8SA 1ADFA 3Q0EA 1K5HA 1WAMA 2X58A 3KVOA 4CLRA 3B1FA 3AOEC 4ROSA 3H2SA 2ZCVA 3GDFA 3SXPA 3ZCXA 4FJ2A 3H5NA 5JXWA 3PP8A 3NX4A 2X8LA 3HNPA 5JO0A 1H9BA 4GVXA 3UOGA 3JQEA 1Q0HA 2CD9A 3PJDA 5C5IA 1PGJA 1Y6JA 2ZJ0A 4R69A 3RVDA 4CQMD 4ND3A 4CLEA 5I8ZA 3PDJA 4OOEA 4CM4B 2QX7A 3ZI0A 4AJOA 1LSSA 2O3RA 1HDRA 1U4SA 5JW6A 1K6JA 1I3NA 3K9QO 3PJGA 4KUGA 4YJHB 5JS6A 1AGNA 4FOOA 3WFIA 2BRUA 4CMIB 2ZYAA 1ADGA 4M1QA 2O4UX 4C7KA 2G82A 4HNHA 4RLSA 3ZHBA 4QQRA 4R54A 5JAQA 3AUSA 3DL2A 3B20A 2YYYA 3Q9UA 4R5MA 3OFSA 4YRAA 1HLDA 4FFNA 2H5LA 1BWSA 5AXBA 5TQVA 4A5OA 4E31A 1FJHA 3PYXA 4KQWA 4D42A 1X7DA 3ORFA 2PTGA 3PIDA 1SNYA 4L76A 4Y8VA 4YTEA 4J49A 3FN4A 2VHYA 1PJBA 2ZTLA 3WSWA 3VPFA 2I65A 1HETA 4A10A 1EZ4A 3KYDA 3WOHA 3ZV4A 3VPGA 3W6UA 1SEVA 2NNLD 1B8VA 3U49A 2PY6A 2WTBA 1ZSVA 3VH3A 1HDXA 4YJFB 1A4IA 3H8VA 2YQ5A 5EIOA 4P4LA 1E92A 1H6CA 1Y8RB 5A1TA 3DC2A 3I9JA 1X15A 4W7HA 1YJQA 3GAZA 3DO5A 5C3MA 1RKXA 4L74A 1PS9A 4XKJA 3KSUA 1ENZA 1B16A 3G3EA 5C7IO 4CM1A 1QP8A 3ZWPA 3HE3A 3JD4A 3GRPA 2JFFA 4XWYA 3PFWO 3BAZA 3VPHA 3NUGA 1AN9A 4K6FA 5DBFA 5GZ6A 4DTIA 4R1NA 5HS6A 3TZQA 2CVOA 5DDIP 1EEHA 3FPLA 4D45A 5GMOA 2W98A 5I9NA 4CM4A 3ETDA 4NDNE 3JQAD 2O23A 4NZ9A 4XEHA 3IDSA 1X7GA 1P1FA 4ONEA 1ISFA 3RSHA 1GR0A 2Y1FA 2DBZA 4BO7A 2VNSA 1DIRA 1NPDA 3NGXA 4CMIA 1KC1A 4J7CA 3F47A 3QVXA 4Y9DA 2B69A 4BOYA 1XWFA 3D5TA 3GGGA 1IZ0A 2HQ1A 2VRCD 3GNQA 3JCZA 3VHRA 1L7DA 4XB2A 5KJCA 4KDFA 4Q39A 3DOCA 3DFUA 5A9SB 1Z75A 1GEGA 1LTHR 5JDCA 1EVJA 1XDWA 3NDRA 1HYEA 2X5OA 3W4JA 1LA2A 1NHWA 1JLLA 3WGZA 1KC3A 4MVJI 2DUWA 4ZQGA 1YXMA 2JD0A 4PG4A 1XR3A 1VL6A 1XLTA 3RUFA 1PJLA 1P9LA 3TZHA 2CF5A 3NDIA 5F3RA 5TSDA 4EYEA 1D1TA 3WIDA 4IQGA 2XXBA 4D44A 2HK7A 4ZGWA 4RVUA 3IIEA 4C7JA 2ZYGA 4YJFA 2OBYA 1PZGA 3GZ4A 1UXGA 1A72A 2ZK7A 2X22A 3LF2A 4P4GA 4MP8A 1YS4A 2VZ8A 1Y8RA 3IJPA 3ZNNA 5JY6A 4MPDA 4RF4A 3S55A 4N18A 1NWCA 2I9PA 3DBHB 4I5EA 5B4UA 3HFSA 1B14A 3PZBA 2ILTA 1DC6A 5BSEA 3O26A 1XEAA 5ICSA 4QFDA 4BNFA 3ZDFA 3ROQA 5A5EA 4TROA 4NBRA 1ZSYA 4U0KA 5KKCA 3EC7A 1DC3A 1CDOA 1NX6A 4IMPA 3AOGA 4KTTE 3OH8A 4YJGB 2HUNA 1DAOA 4KZPA 4OH1A 3CMCO 4BO5A 3BMNB 3GVXA 2O7QA 4Y6SA 4R1UA 7ADHA 3GC6A 1XYGA 4EUFA 1PJCA 1BXGA 2C2YA 4JJGA 1LDBA 2QZZA 5KNLA 1GL3A 1HDGO 3BIOA 1DPGA 4FOSA 4WUVA 2A4KA 3WBFA 5DBIA 3FR8A 3RAJA 3GRKA 3KV3O 4X54A 1Y8QB 1GV1A 4W4TA 1UP7A 2AQIA 4IZIA 5A9SA 3GZNB 1ORRA 3DFZA 1F14A 4LSWA 5IF3A 2WWRA 2D1YA 1U3TA 4URFA 5DCUA 4AJIA 2G17A 1EVZA 1UAYA 5TX7A 4TRJA 3GHHA 1X7HA 1U8XX 4ZRNA 4YAIA 1PZEA 1LQTA 3D4OA 1GUYA 4IDFA 4Z9FA 5JMPA 2IZ1A 4Q3AA 3M2TA 1WNTA 1EFLA 3ITDA 2JHGA 3JQ9A 1Z6ZA 4GX1A 5FI5A 2X7HA 3VKUA 4IJWA 1QR6A 4BNNA 3TJRA 1GCUA 4GX2A 3WGTA 1K6IA 2CSUA 3CE6A 4R16A 2IODA 4PZCA 2D5CA 1Z7BA 3KBOA 3KLMX 2PFGA 4DC0A 3DBHA 4NNJA 4E33A 3DZIA 2OGUA 4ZJUA 4K1LA 4RJTA 5L45A 1E3SA 1WZIA 3ZWXA 3AOEA 3BTUA 4YVFA 1I24A 4FSHA 2QYTA 5AQ1A 1HE4A 4XIYA 1Z7EA 2VQ3A 4LISA 2VUUA 4R3WA 1H93A 2Y0EA 3GA0A 1GCOA 4R5HA 3EUWA 4ZQEA 4GWGA 5EMHA 2Y67A 5A02A 2VZ9A 4TZTA 2O3QA 1VL0A 3AM5A 3BMNA 3TFQA 4CV1A 2Q2WA 3UCEA 3OA2A 3B70A 1ID1A 4BHTA 4DMLA 1ML3A 4W99A 1PJ3A 2A94A 2PR2A 4BO8A 2Z5LA 5JNLA 4Y6RA 4MIEA 4TRNA 1Y8QA 1KEUA 3D7LA 3MOIA 4J7UA 4P22A 5L53A 5L95A 3W8FA 4XGNA 2BGKA 1E1NA 4ALIA 4NIMA 2PD4A 4J9UE 5L51A 4MJLA 5C7OO 4NBWA 1Q7BA 2AQKA 4OO3A 3PQFA 5ITWA 2GLXA 3G0OA 3K5PA 5DOZA 3AWDA 4WLOA 1V0JA 4EDFA 5IXYA 1UXIA 1P1IA 4NPCA 3UW3A 2VUTA 3KETA 4ZVVA 4Z3KA 3F1KA 3T4EA 2QRJA 1AHIA 3OJFA 1I3MA 1KVQA 4N5MA 3RFVA 1JVSA 3M6IA 4YA6A 2HK9A 4M49A 3KYBA 2YV3A 3LVFO 3ON5A 1YL6A 1KS9A 1UXHA 2OFPA 4RF3A 4BNGA 3KB6A 4IJKA 1WXDA 4GX5A 1ONOA 5JLAA 4CLDA 2EERA 3JD2A 2V6MA 3GGOA 3K30A 4ND5A 3E18A 4PG7A 3JD0A 4R1SA 1B8UA 4K6CA 3VZQA 2JCVA 2O3SA 3K2BA 4LCEA 2P9CA 1BGVA 5F1KA 2GASA 2BHLA 2OXIA 1HSOA 4DIFA 2P9EA 1PQWA 1ZFNA 2QG4A 1K89A 3ONFA 2DPHA 3QHAA 2PKQO 2IRWA 4PN3A 1P33A 4PRLA 3JYLA 3I9MA 2GF2A 1PZFA 1PU2A 4D46A 5KVQA 4EI2A 5ILOA 3ASVA 2AA3A 4PLCA 1TXGA 5KJ1A 4LW8A 1JKIA 3P5SA 2Y68A 3DBRB 1BVRA 2B4QA 2ZCUA 3FD8A 3ADPA 3EVTA 1B7GO 3PJFA 5KJEA 2NV6A 4IGEA 1J49A 5JC8A 1QKIA 1C1XA 2J3IA 1U7TA 1T2EA 3CZRA 5F1OA 1NNUA 2ZQYA 3MZ0A 4GMGA 4JBIA 3WQRA 4BKRA 3HJAA 3EAGA 4R4JA 4NH4A 1EMDA 5BNTA 4YCAA 5EERA 1M66A 1XIVA 1XHLA 2JCXA 5KJ6A 2JJYA 3NDJA 1UH5A 1J4AA 1TVEA 5EPOA 4BMNA 4R9RA 2BLLA 4OQZA 1Q0QA 3I4FA 1J6UA 4OXYA 5JPIA 3WDSA 1EQ2A 3I9OA 3ITKA 3WIEA 3L6DA 4K28A 3JD3A 3LQFA 4LSMA 4DQVA 4FFOA 1CERA 2ZB3A 1A9YA 2FWMX 1SB9A 1XGKA 3WLFA 1UDBA 3MTGA 3DZKA 2Q4EA 3N74A 5IN5A 1PS8A 4TVOA 1LRKA 1YDEA 3HDQA 3FTNA 1VKOA 5FF9A 3PYMA 2ZB4A 1D4FA 1NAIA 4J3FA 4TSKA 1LDEA 3C3XA 2A9FA 4CM7A 4NJMB 4UEJA 4MINA 1WZEA 4WCFC 2PH5A 1BW9B 3WGQA 1A5ZA 2VHWA 3ZN2A 3K73O 1DO8A 4XGKA 3P19A 5IFLA 4NK5A 3OSUA 4XZ3A 4FFPA 1TLTA 3OETA 3PEFA 3C85A 4BO0A 2HRZA 4FFRA 3MJVA 2WE8A 4LRTB 3JYPA 4IDEA 3WFJA 1LDNA 4BV9A 4FQ8A 3EW7A 4QSMA 2I6TA 2BKAA 1M67A 3NTQA 5IDWA 3JYQA 5JCJA 1UJMA 5B37A 1G0OA 4BGIA 4J4HA 5DNAA 1N1EA 3DBRA 3BZUA 3WB9A 4QO7A 1JW9B 3PHHA 4B4OA 5IDYA 3ONEA 5A3JA 1KVUA 4E0BA 4QO8A 1B15A 4W9NC 5TC4A 2FY8A 1GPJA 4YACA 4CMCA 5K6AC 4BV8A 3KTDA 4M54A 2X0NA 3KSDO 2Y1EA 3KSZO 1PS0A 2C2XA 3RBXA 1VKNA 3CTMA 1J5PA 4Z0PA 1T2DA 1R16A 1CIVA 1YE3A 3H9QA 3H5RA 3L9WA 1E3WB 2NADA 4FGWA 4CLOB 3AFMA 1WMAA 3GAFA 1BG6A 4J9VA 4L4XA 2Q50A 3IUSA 4I1IA 3L4BC 4E12A 4HX5A 3WWYA 3IL2A 1O6ZA 1DLIA 3PTZA 4U7WA 4OKNA 3VH4A 1GEEA 4XCVA 3BXXA 1QYXA 4AFNA 4EUHA 5H81A 5U9CA 3GEMA 4L0QA 2DUUA 4QT0A 2I66A 4QTZA 2HJSA 1UZNA 4ZQFA 1KEWA 2Q2VA 4CODB 4FBGA 3LDHA 3KZVA 3V1TC 1NFQA 2A92A 3NYWA 2BGLA 2DKNA 4GKVA 4NJMA 4PGFA 5I9MA 3ZNQA 3M1AA 1NAHA 5CDUA 3E5RA 4DXHA 5EJ2A 3LF1A 1BW9A 4ALMA 4RVHA 5EINA 2FHSA 3GNTA 1I01A 2EV9A 3NAQA 1UDAA 4KTVE 3JQ7B 2PGJA 3GEGA 2Q1WA 3MJ4A 3ZU4A 3QSGA 4XQEA 1HWYA 4J1QA 3ZWAA 4CR6A 5L4LA 1P1RA 4D0SA 4RVFA 1BMDA 1NQTA 4CR8A 1DRWA 1WDKA 1VJ0A 3GDOA 1ISIA 3OJEA 1PJTA 5ADHA 5IN4A 3L9XA 1H6BA 2I3GA 4KDEA 4YT8A 4CMKA 1SOWA 3GG9A 4CLHA 3INTA 5BSGA 1HYHA 1I33A 2HMSA 4CL8A 1MLDA 3HDJA 1HKUA 3RC1A 4IBOA 4AG3A 1F8FA 2YV1A 3F4BA 1MA0A 4IQ0A 4RPLA 1E7YA 2NSDA 4XGIA 3UICA 1IPFA 1F12A 2XAAA 3HN2A 4NBTA 4WPGA 1E3WA 2ZJ1A 1V6AA 1ULSA 1ZMOA 1OI7A 4WCDA 4Y6PA 5DT9A 5TT0A 1GD1O 2C0CA 1OC4A 2GRAA 3DBLB 2Y99A 4IDGA 4OAQA 4RGBA 4UULA 1LDGA 1WDMA 1DIGA 2A35A 4WLFA 1KVRA 5L4SA 1ONPA 2HMVA 1QSGA 4H3VA 3ZU2A 2R00C 4YPOA 5CDSA 3Q9NA 4HFNA 2H63A 4GKBA 2X5JO 3C7CB 4ALLA 1E3LA 4DL9A 1U4OA 3CIFA 3BA1A 1PJ2A 4Q3DA 5GZ1A 4PLPA 4LVCA 3JYOA 4BNHA 1PQPA 3INGA 3JTMA 1TA4A 3GN2A 4RL6A 4WCFB 2D5AA 2B4TO 4QECA 5BSFA 3JQ7A 4ID9A 2E48A 1V3UA 3KLPX 2HU2A 1D3AA 1AHHA 3O9ZA 3R3SA 4GQAA 2AQ8A 4D43A 1YVEI 2NTNA 2P2SA 3HG7A 1IB6A 3OECA 3FWZA 3AFNA 4BKQA 1DJNA 3TZ6A 2VTDA 2QHXA 3AM4A 4MVJA 1ISGA 1Z73A 3KM0A 3EZLA 1IE3A 1GUZA 5IDXA 5JMWA 3ANMA 3GN1A 1Y9AA 5THKA 1DFIA 1LUAA 3C8MA 1NFRA 4RPGA 4E5PA 1PJSA 1YBVA 2WSBA 3RC9A 3DTTA 4IXTA 2YDXA 1ZKMA 4OKIA 3I3OA 4U6QA 3R1IA 5CEFA 4GH5A 4BKPA 1XG5A 1NPTO 1X0XA 5C7LO 4AJKA 3GMSA 2GR9A 1DSSG 3EY4A 3TNLA 3Q3CA 2FPGA 1AUPA 5A06A 1ADBA 4M86A 1GY8A 5FI3A 3R0IA 2AXQA 3ZWNA 4MVJD 5G4KB 4DLLA 4EJ0A 1ZK3A 3ETGA 4IDBA 2VYND 4I08A 4P4NA 4PCVA 4UVEA 2GERA 4WEQA 4GMFA 3DAFA 3WGIA 4WNIA 1EE2A 4ITUA 5GY7A 4A0SA 2GZ2A 4E2XA 4IJVA 4YT2A 3GG2A 1M76A 1BVUA 3S2EA 3UGKA 2JKVA 3D0OA 3FF4A 2CVZA 2DLDA 4ALKA 2GCGA 3I5MA 1E7SA 2DU8A 1DC4A 3GEDA 1U2DA 3UVEA 4L75A 3DTYA 1HZJA 1PL8A 1UXKA 3A14A 1PEDA 3ROMA 1JDJA 3LC2O 3KEQA 4U0JA 4YJDA 4WCFA 4XR9A 2NU8A 1O89A 3VZRA 5K9ZA 3VH1A 1YDWA 4CL3A 4XYBA 1R4NB 1LSJA 4J0EA 3F46A 4E5NA 3OA0A 5DN9A 1E5LA 4PLZA 1P0CA 4L4RA 4XRRA 5L4NA 3RUDA 4TRRA 4ZA2A 4FC7A 4CMBA 3RC7A 4XYLA 2C7GA 3IS3A 3MJTA 3FTPA 2BI8A 1MX3A 1EUZA 1DRVA 1VRWA 4L8VA 4ND2A 5HRUA 2W2LA 1CWUA 2QIOA 1O94A 2IXBA 3TFOA 2IEBA 3D5QA 2QQ5A 2VHVA 5L7YA 3QWHA 1FMCA 4MP3A 2P91A 2V7PA 1RM5A 3PRJA 2CY0A 4HKTA 2Y05A 4DQXA 4W7IA 4I9NA 1NWHA 3E82A 4HXYA 4OSOA 4YAJA 1YKFA 3OJ0A 2BF7A 4UVGA 4I5DA 4ZHSA 4Q9NA 2NTVA 2X5KO 1ZO8A 5JBIA 2NWQA 5T8KC 4CMEA 3H4VA 1GYRA 3T4XA 1YONA 1OC2A 5TJHA 4EZBA 5G4KA 4OHUA 1O8CA 5TNXA 2OMEA 3F4LA 1R4MB 1IPEA 4XIJA 5K0ZA 3OIGA 5IZCC 1HTBA 2CDCA 3QJ5A 5AYVA 3SVTA 4AICA 3FBTA 5I7FA 3UUWA 5FFFA 1NFFA 2FZEA 2NVUB 5A04A 4RVDA 3PVZA 5KKAA 1ZJZA 1R12A 4UUNA 9LDTA 3NV9A 3PGJA 3U4DA 4HFMA 2PZLA 1B0AA 4XYGA 4Z9XA 3VC7A 4YJHA 1KETA 4PLFA 3KO8A 5ILGA 4A7PA 3DB2A 1I10A 3PLRA 3PFFA 2TMGA 2FSSA 1P77A 1QV7A 1O9BA 1N5DA 3GHYA 1R4NA 2EJWA 2O7SA 2NLOA 5BNFA 3E5MA 2CNBA 2PGDA 2WMDA 5BNIA 2Q46A 4LCJA 3HWRA 3U09A 1E7RA 1ZK1A 3LK7A 2NACA 1WLYA 4JP2A 2W90A 3HZZA 1P0FA 1H0KA 4IZHA 3U9LA 3OJLA 1SZJG 3H3JA 4FGSA 3JQBA 4K26A 3QP9A 3TL3A 4DIBA 3RJ9A 3QWBA 3L07A 4ESOA 3QE3A 3F6YA 5COQA 5HWSA 4NK4A 3IOYA 2V6BA 4E30A 2B5WA 2IYPA 1HDCA 1GZ6A 1SB8A 5A03A 5EN4A 4YAGA 2GN9A 2J6IA 1CQIA 3O8QB 1ZK2A 5T64A 1IOLA 1E1MA 1LRJA 1XQ1A 2BFPA 3FNEA 3ADOA 3K92A 1C1DB 1JKFA 4EJMA 4NBVA 4QX6A 1TT7A 4PLVA 1JAXA 3CSDA 3I23A 4CUZA 3JSAA 1H2HA 3WNQA 3ENNA 2AE2A 5B12A 4MP6A 1HLPA 3HSKA 1LLDA 2H9IA 5B1YA 4UUOA 2P9GA 3DDNA 4PLHA 3ASUA 4JJFA 4HP8A 4CV3A 2PK3A 1R4MA 3FR7A 2HAEA 3LT2A 4FCCA 4FJ1A 5COBA 4O6VA 2Q3EA 1YO6A 3RIHA 4I9HA 3TQHA 3ULKA 4R51A 4O1MA 3R6DA 1E1LA 2IYOA 4YWJA 3WR5A 3ZWYA 2NVUA 2PZKA 1GZ3A 1SC6A 2R00A 2V65A 4FFLA 4EJ6A 2GD1O 5H83A 2B4RO 4QEDA 4EW6A 1E6EA 1ONNA 1SOVA 1LLQA 2IDZA 2RIRA 4XRGA 3SC6A 4YYZA 3VKVA 5JAMA 5JAIA 4WLUA 3HADA 1EVYA 3NTOA 2WD8A 5CAEA 1YQXA 2POQX 3RFXA 1JN0A 3ZWCA 5L7WA 2CMDA 1U9JA 5B4TA 2O2SA 4BO1A 2Y0DA 1CJCA 2W2KB 2H6EA 4PFJA 2WJPA 3CKYA 3RUAA 5JCXA 2NU7A 2FRDA 3UHAA 1LNQA 2X0RA 5AXDA 3NKLA 4B7UA 1PSDA 4N5NA 1UAGA 5DP2A 3LSYA 2VWPA 2Y0CA 1KERA 3HHPA 1I32A 5HBRA 1QORA 2FR1A 2GYYA 4OJNA 4MKZA 4II3A 1P45A 4XX0A 4J43A 3BTVA 1G0NA 4QXMA 3UKOA 1PR9A 4EBFA 3O8QA 2BFAA 2NM0A 3OP4A 1QYVA 3PHGA 3TOXA 1H6AA 3OMLA 4YB8A 1C1DA 1E0DA 3CMMA 3LT0A 1E5QA 3I6IA 1RWBA 1DHRA 1PQUA 2VOJA 4RORA 3GPDG 4WJZA 5F5NA 3C1OA 3COSA 3DMTC 4H15A 1WMBA 2C07A 3VDQA 4FPXA 2YV2A 3E03A 4MKRA 5A5FA 3INRA 2BGMA 3D3EA 1KIFA 4DBZA 5HA5A 5G4LA 1U3UA 2Q1TA 2OHXA 4INAA 3AM3A 3B6ZA 1YWGO 5JDIC 1T2AA 3E9NA 1HE2A 4A03A 3PQEA 5KWEA 3FNHA 4GGOA 1PWXA 3H9UA 3CEAA 4G5HA 3ZW9A 4YXFA 1VJTA 3DWFA 1ZSNA 4NFYA 4YJGA 3UCFA 2WM3A 3OHSX 4ZU3A 2GPTA 3HDYA 3V5NA 2CDAA 4IUYA 4BB6A 5CHEA 5TS3A 1YGYA 2GN4A 2WYUA 3I52A 3WWZA 3LT1A 4KQXA 4BKOA 3VTFA 2DVMA 1UP6A 4W6ZA 2H1SA 1XU7A 3VVBA 1MUUA 3QVOA 3QVSA 1XKQA 4OL9A 3GZNA 2J8ZA 1WDLA 5JYEA 2W2KA 5G0SA 4BNKA 1QV6A 1QLHA 2C7VA 4GPD1 3ZWBA 1T1RA 3DOJA 4FW8A 1W4ZA 5BSHA 4B4UA 3F5SA 4RDIA 1P1HA 3GFGA 3D3WB 3TDKA 3GNSA 1ADCA 2HRBA 4Z9YA 1X13A 1HF3A 1HDZA 1LX6A 2X6TA 5CP8A 1NPYA 3GUYA 5CDTA 1EDOA 3P7MA 4JK3A 4RVSA 3WTCA 1FF9A 5BQFA 3ENKA 3LT4A 3WMXA 3GQVA 4DBVO 3QLJA 2UUOA 1JA9A 1JU9A 2PD3A 4MDHA 3WBBA 3N7UA 1X14A 2FR0A 1ZVMA 1U8FO 3IKVA 3LYLA 4RZIA 3GY0A 3FWNA 4AJHA 2FP4A 4XQGA 5T8KA 2ZQZA 2GSDA 4YQYA 3RUHA 1G6KA 1WW8A 4IY1A 2DTEA 4UUPA 1I2BA 4UVDA 3UN1A 4B4WA 1RM3A 4BIIA 1KEPA 2EG9A 1B3BA 3FNFA 2NTJA 3A06A 3KXDA 2J3HA 3PPIA 3CH6A 3WYEA 4J4TA 2E82A 2FN7A 2X0IA 4CUKA 2X0JA 4B4VA 3WYBA 1C0IA 2EKLA 3GVIA 4F3YA 1XELA 1HZZA 1R0SA 3KUXA 1IHYA 4FN4A 1OMOA 4BNIA 1M6WA 1HEUA 3DAPA 4XJSA 5G0UA 1OBFO 3AJRA 4J0FA 5LC1A 2O50A 1LU9A 3HN7A 2O4CA 4NFHA 4XQCA 4WK6A 4R9SA 2VYVA 4OSPA 4B8WA 1N9GB 3AY7A 3H9GA 3QY9A 5T5QA 3FCOA 3HDHA 3JQFC 4HFRA 4DPLA 3IUPA 5JAZA 3K8ZA 3BMQB 2VNAA 1ISMA 1ZMTA 5LDGA 4DA9A 5I8WA 4WLNA 5EQFA 2F00A 4Q3CA 1C0LA 1U5AA 2LDXA 3A1NA 1OAAA 3ABIA 3U62A 4BO9A 4CM8B 2VTEA 4E2WA 1GZ4A 2OOSA 1ENYA 2IEDA 1R6DA 1YQDA 4WNCA 3TZKA 2W4QA 3O4RA 1NR7A 1WWKA 4ALJA 1E3EA 3SC4A 4ZQHA 2X23A 4IJUA 4PVCA 1CRWG 2Z95A 1Z45A 2XF8A 5I7SA 1WP4A 1ZZEA 4J91A 3DEYX 1EDZA 1GFSA 1LJ8A 1FDVA 4HADA 5U1PA 5CEEA 4FFMA 3SBOA 4IDCA 4ZQBA 2OUIA 4J90A 2YHUA 4XA8A 4M55A 4PLWA 2XOXA 4OXKA 3IMFA 5I7VA 5J23A 1I36A 2FSVA 3JQ6A 3L0DA 4JGBA 3G1UA 2P5YA 4MKXA 1ISJA 3V1UA 2HMTA 5KVVA 2WD7B 3HQ4O 3UAGA 2DC1A 1SPXA 4NU6A 2Y66A 3SLGA 2P4HX 2VCYA 1S7CA 1OZAA 4KMSA 3DHYA 4MO2A 1E3JA 4D3SA 5JC1A 1XCBA 1U1IA 4GAEA 4UEOA 1MXHA 1N7HA 1E7MA 3GMDA 5AXAA 4D0RA 2ZTMA 3GVCA 5A4DA 5HS4A 4LMPA 5JO9A 3NT2A 4B3JA 2EP5A 5JY1A 3MWEB 1GPDG 2D4AA 3ZH2A 7MDHA 2ZTVA 3OEWA 2NU9A 5KJFA 2OORA 1LSOA 5JCJD 4PG8A 1N9GA 3OF2A 3OQ6A 4BUCA 1SO8A 2O3UA 1ZXLA 4K9DA 2EEZA 4BVAA 3BMQA 3TZCA 3AK4A 2D0IA 2JHFA 1KY5A 2BI7A 5TGDA 5THQA 2VHZA 3AY6A 3S2FA 4CLXA 4CM8A 4NHEA 4CQLB 1YL5A 4UVHA 3SJUA 1I5RA 1L7EA 2RCYA 3C7AA 4BKUA 1NVGA 1B8PA 1WPQA 3ST7A 4DGSA 4E5KA 3TOZA 2B37A 2GZ1A 1TEHA 4UVIA 1ARZA 5T6BA 2EKQA 5AOVA 2B35A 2HO5A 1YOVB 2GN8A 2AG8A 3DMTA 4JNKA 3ZHXA 4HUJA 3ZV3A 4NQZA 1ENOA 3GVPA 2OP0A 3JYNA 1PJQA 4GBJA 1GADO 3WJ7A 1TB4A 2DTXA 3T7CA 1DIBA 5FWNA 5KCZA 1GQQA 3RUCA 1Q0LA 1DDOA 2HMWA 1LC0A 5ITVA 2PA3A 4E3ZA 3TRIA 1MG5A 5L40A 1YB5A 5G0WA 3Q2KA 3WYCA 2YHIB 4TZKA 2HLPA 2WD7A 3M1LA 1XA0A 4JCOA 1ZCJA 1I0ZA 4YEDA 3GH3A 5JE8A 4B3IA 3F3SA 1Q7GA 1HXHA 1DLJA 3G17A 2FPPA 4OM8A
chains in the Genus database with same CATH superfamily
2AI1A 1J23A 1HYGA 2UVDA 3NETA 4A6EA 5U4XA 1XZEA 2H29A 3O84A 1SCAA 2VBGA 2ZEJA 3NHRA 3ZLVA 3IKTA 5DBOA 3MWEA 4N7MA 1RPTA 6LDHA 3IFSA 1V2GA 4TS9A 3OC6A 4U39A 3IEKA 4E5DA 4G1BA 4IMIB 1RT9A 2Z1NA 4J16A 1YHZA 3GOQA 1XD9A 3K09C 4UBJA 1NU6A 4YJ3A 2GJSA 2RH8A 4Q7MB 2AH5A 5TPZA 5JV5A 2YINC 1K4KA 3Q88A 4PE5B 3SEFA 1UDRA 2ZJ3A 3O1HB 4A0GA 1LVUA 1U63A 4GGPA 2R3SA 6ABPA 2Z0MA 3TLEA 4DPKA 4NLLA 5LDHA 1TYCA 1CQPA 3C70A 1DFHA 3K2EA 3RHZA 5CVCA 1SXQA 2ZUWA 4OL0A 1FP1D 1RRPA 2V4UA 4ZPJA 4OJMX 1M2KA 1OZGA 1W73A 1NKVA 4JEHA 4JLMA 2VHXA 1TQ8A 4IOMA 5FEUA 1SQ0A 2YBEA 1RBYA 1EVEA 2WWIA 1YASA 1ZCBA 4M21A 3QV1A 4BTVA 1P18A 1BDMA 2FZKA 3BHJA 3CISA 1Z2EA 4LDQA 4NMHA 4N3CA 4WT7A 4JGGA 1N1DA 5EZYF 3LPAA 2CV2A 1XHFA 4XTCS 1RRVA 3HM9A 1GNVA 3AFHA 3M70A 3HGMA 4NU5A 3EIOA 3SMQA 4BEVA 1VCHA 1CF4A 4WECA 1T1EA 1JR3A 2ZSJA 4RH0A 1Z29A 1FE8A 3P0IA 1XJ5A 3DDZX 1AMUA 3LTEA 5KQMA 3KZKA 3THWA 1SG0A 1ZM9A 1FP2A 1O54A 2ESRA 1FP7A 3D3KA 2WMNB 3WGMA 4A0FA 1FFEA 2Z83A 3RYIB 3SQNA 1K92A 3QLVC 3G8BA 3SLKA 3K32A 3WQQA 2F1KA 3PEUA 3QW4B 4H31A 1EUDA 2IA5A 4JENA 4WZAB 3OJOA 2EZTA 2GO1A 2MSEB 4UE2A 3SM9A 4M37A 3UBTA 4MVJP 3GUVA 1FQOA 3WB2A 2WA1A 3NNSA 3THYA 3HCRA 3TTXA 4GYYA 5FQNA 4EKYA 2D3TA 5LJLA 5CHYA 3H6GA 2ZJYA 4YCMA 3WQSB 4ZHQB 1UMDA 2QRPA 2OBFA 4B2PA 4V02A 3VU9A 1LKZA 3UUGA 5JQGF 2WI8A 5PGMA 2NO0A 3OFKA 2H4YA 5JBQA 2J3JA 3QWIA 3STXA 3CG0A 3UJ7A 1BD4A 1LY1A 3VHXB 5BQXA 1BTOA 3EFHA 4Q18A 3ZY4A 4OV6B 1A71A 3LXXA 2EBHX 2WBLC 4WKGA 1TQ2A 2ZPAA 3HCNA 1EBFA 2J3DA 4Y2HA 3ZV5A 3UK6A 3UJDA 4OXNA 3JQ9C 2UU9B 2NUAA 1W2GA 2I67A 3KBBA 2XB9A 3BB4A 2IW3A 4I5FA 4PXYA 5CVDA 2D1QA 4BCDA 3U4QA 2F3RA 5E6RA 4GXRA 3K0CC 1THGA 1NC1A 1SQFA 1GT91 5LD2B 2PIAA 3N3BC 2AXNA 3D7KA 2HMUA 1QFYA 1G4AE 4Z4FA 2JZOA 4PONA 1BJTA 1ORVA 4Y3UA 3GLGA 2A5FA 2R48A 4Z5XA 2F64A 1EGHA 3KELA 2RKWA 1Y0BA 1FNSA 2AI2A 3D4BA 5IZ4A 4ABTA 1T9GS 4UBOA 1XRSB 3ZWVA 2GN1A 4HO1X 3TVYA 2JGDA 3CLTD 3G9TA 3PXXA 3UY4A 2O14A 3RKUA 4ZKDA 2DR0A 3C0KA 1JE0A 2Q3HA 2XRYA 2GDJA 4J4BA 5TMBA 3SKYA 1J2JA 3ZGOA 4H3KB 3D8HA 5G2OA 2HF8A 1Z8FA 2DT5A 3E22B 2C9MA 3I2YX 4C4TA 1BRMA 3WA7A 4FEAA 2ODPA 1M0SA 3CC8A 4IEFB 4LZOA 1EA7A 3NAMA 4PC7A 4TRMA 3TIVA 3TEJA 1JXMA 3AEQB 2QT9A 1X80B 3QF4A 1DNPA 3RVMA 4TXLA 1E6UA 1YBMA 1YB4A 3BTOA 4UW9A 3U0BA 1H65A 5T41A 2EW8A 4S3MA 3M6XA 4O59O 1FFDA 3SJZA 2ZSKA 2QPAA 3KQTA 3QE0A 4OK3A 4WKNA 3I58A 5LYYA 2OAQ1 3ZHTA 4BQPA 5IYZA 1IZZA 3C16C 4I6JA 4QU0A 4KDRA 1M6YA 2FW7A 3P5BA 1JT2A 3SGLA 1V25A 3TPCA 3JQGB 2P2ZA 3NGLA 4OHCA 4GP9A 2JLRA 3G6KA 3OZXA 3D64A 1S0UA 2GFIA 2R85A 1JIXA 2F8TA 1UDWA 1Z47A 3HBFA 1TU0A 1W5AA 4AF7A 2WYVA 3Q8KA 1FDTA 4C89A 1UFKA 4MV6A 3K0EA 3MQFA 2BFBA 2OWDA 4MUEA 3F6SA 4YT5A 4PC6A 3ZHCA 3BX1A 3C41J 3T0IA 2D5LA 1L4HA 2Q6VA 1AG9A 3ZKWB 3ZZNA 4TMVA 3N6XA 1WLSA 1UBSB 4M1EA 4CDMA 3PHBE 3R23A 4EIWA 1NXWA 3PYLA 5YASA 3D7MA 1WW3A 3A04A 4JI4B 2XXAA 3MEQA 3EF1A 3WKAA 2QP9X 2QPLA 3KR0A 1QF7A 3TIFA 3PI7A 1KOJA 4RMGA 3MCVA 2JDID 3AHHA 5FNVA 4U02A 4DJTA 3JWHA 1HQYE 3WLOA 5KX5A 1H8HA 1D1SA 1B0PA 3IGFA 3Q7TA 5E4JA 1SHJA 1G21E 2EX1A 4ARBA 2RC6A 1IVYA 1P31A 2ORIA 2WAYA 2JKZA 2WVGA 3LUDA 5JNSA 1CFZA 1TT5B 2C20A 1H5QA 3K1AA 2YZGA 2DFVA 1QIIA 1PWHA 1U11A 3TLYA 4HGOA 4BMOB 3LY9A 2RAPA 3D0KA 4MKIA 1I5EA 2YMQA 1B43A 1G8YA 2HQBA 3DA8A 1YZ3A 3QK7A 1L8LA 4FDTA 3HXPA 4FYMA 3PCRB 2CE2X 3FPSA 5AKJA 1FXSA 2ONJA 2UUBB 5AJZA 5KNCH 1QR2A 4BNTA 3BCSA 5PNTA 4D41A 4DUPA 1JGTA 4K9QA 5K3BA 1EX7A 4QRDA 1W0KD 2WV9A 3KL2A 4R3NA 1IJEA 3PF9A 1G9SA 2OV2A 2Q6LA 4ZAXA 4ZAZA 4PLYA 4ALNA 2Y1CA 4HWOA 3E53A 2BV3A 4HAYA 3I3SR 2R4TA 4XARA 1NF2A 4AXBA 2GGSA 3CS3A 3LDUA 5LWHA 1OHHD 4DB2A 2YC4C 5CB8A 2YJZA 3NEYA 5HE9A 3ICPA 1TKRA 3FMVA 3Q3GE 3TQFA 3B3AA 5AIAA 3KDPA 4TSRA 1W581 4M53A 3DB1A 3O7MA 1S3SA 2EGUA 3DVLA 3PPYA 3I2GA 4GI2A 4PO9A 3S2YA 4DYVA 2AJLI 2YYSA 1UJBA 4G1VA 2JD1A 5TQ2A 5IDQA 2Z58A 2RHHA 1OGYA 4FC6A 1U7OA 4GLOA 4F2PA 1NQAO 2IHJA 2CF6A 3M6FA 2B8WA 1LI4A 3VTZA 1A7AA 4YRBA 2PAFA 1R8QA 3PXDA 5IVPA 1YBFA 2QMUA 3JD1A 2M1ZA 4X1KB 4ZAVA 5LFAA 3AH8A 5CA1A 1DBVO 1LI5A 2R0QC 2CVHA 4KWIA 4JYAB 4IUCS 5DLDA 5E6UB 3R0ZA 1NJ8A 3DVAB 3HYCA 5HKKA 2CVQA 4H4CA 4JROA 1A7KA 1QYWA 1KEVA 4B6SA 1YRLA 2FZWA 2Q1UA 2FMTA 3U56A 5IAJA 3T99A 2ZDQA 1W2WB 1JH9A 3K09A 3E7PA 4RYLA 4P0QB 4IM7A 2YV5A 5DM0A 3EODA 4LRUA 1XQ6A 3F8WA 2J5QA 4ZVPA 5BN1A 2ZSBA 1X1EA 4RTLA 3COWA 3LHFA 1BKYA 3ROPA 1RCFA 4R81A 4HWPA 3G59A 1X7YB 5AUQA 2JLXA 4EAAA 4KWEA 3MTAA 1CEYA 1I4EB 2AW3A 4J2HA 5CLJA 4WLEA 2F55A 2VRBA 3RYFB 3RK4A 1IQRA 3FZEA 2P78A 2ZI7A 4F6RA 3KT3A 4B74A 3EBPA 4Y2TA 4U7FA 4CMGA 4MZXA 1IZ8A 2WIJA 3CTPA 3EZFA 4EQZA 3FROA 5TRTA 3AZPA 2XVAA 1AZSC 1Y1RA 2EP8A 3E0QA 3ECSA 4Y0VA 4C29A 3KXPA 3LQQA 3GUCA 2Z4SA 4GOXA 5D01A 4QUIA 4BO2A 2W6QA 2G06A 2VK1A 1UAAA 3MWDA 5AVUA 2EQAA 1QGZA 1JJVA 2HCFA 5KTPA 2WJGA 4EFMA 4BLTA 1O96B 4JC8A 1U8CB 4KR2A 1C0EA 3II6X 4QQKA 4WN9B 3DONA 3BFVA 4JB8A 2CDBA 4N48A 4UMVA 4KWCA 4TKMA 4LXHA 3NT4A 3COYA 3LX6A 3CVOA 1WJGA 3RTCA 1R15A 1TM4E 3WGKA 5K7SA 5LKRA 2HSWA 4G37A 3GA7A 2OZLA 1YRQA 3M49A 2AUMA 1XPJA 2QY9A 2XCLA 3L7MA 1U2GA 2DTDA 1AUOA 3EVEA 4L51A 2X86A 3RVLA 2XNCA 4CCYA 1YNSA 1Z5UA 2UUPA 2GNAA 3UB4A 3M33A 4RD3A 3GO4A 1YI1A 5JVDA 1P4RA 3BE8A 1XVLA 5E95A 3LUBA 4KW7A 2O2EA 5CTJA 4MR9B 3O3NB 4IDOA 3CNNA 5LXTA 3DF7A 2Q7DA 1OGJA 5CA0F 1G9XA 4QC2A 1DRUA 1M8FA 2RC5A 5AKHA 4N12A 4B79A 1NP7A 5GVSA 3TKLA 1ID8A 4F9TA 4MGYR 2OC9A 3TLBA 3TO5A 3PT9A 2G4LA 2AC4A 3V6LA 1GP2A 5CX1B 3QVTA 5FOSA 4B2YA 3CCBA 5BSKA 4OLBA 3K8OE 3A32A 1A8QA 2V5AA 3AB7A 4QSHA 1BVHA 4GI3A 1OXTA 3CG4A 4DR5B 3PEVA 1ZD3A 2GDZA 5E7MA 1O0CA 4MDYA 4PNHA 2J4DA 4JLDA 3MB8A 3LXMA 4QHSA 1FCJA 3MUEA 3PPVA 4PNEA 3GLFA 4Z7JA 3O93A 2YQ4A 3R2JA 4HRVA 4TL9A 4FYIA 3GLQA 4D80A 1OASA 5HF9A 3P8ZA 2I62A 2P6PA 5EMNA 1T2UA 3EIFA 4QQNA 3TX2A 2NMVA 2QJWA 2XKAA 4CM9A 3FYHA 3E9EA 1CY7A 1BCRA 4QU8A 1R37A 3AEKB 4L85A 4PWYA 1Z0ZA 1ENPA 4L9WA 4PR3A 4V1CB 4KJXA 4MULA 3U5ZB 4GT1A 3SIPA 3OURA 4LZLA 1Y5RA 3CEPB 3GJYA 2C82A 4KXXA 4QDJA 1OF1A 4N9WA 2IHVA 3NTRA 1O57A 4KL8S 1HUQA 1XV5A 2FWPA 2GPNA 3PQCA 4PRYA 4K9OA 4ZCIA 4EGAA 1WUKS 5C35A 1XTIA 4QFCA 1KP2A 4I4IA 3ICCA 4IRMA 4YT4A 2XXJA 4TWIA 1KARA 3LLVA 4LVOA 3CE9A 2RAVA 4EYOA 4BBZA 1Q44A 2HD4A 2P69A 4BS9A 2QORA 2O5RA 3HCDA 4CM9D 5I8PA 5IXJA 1A8PA 1NT4A 5A3VA 3MTJA 2G28A 1E9AA 1JKJB 3ND5A 3VZPA 3NDPA 1KBQA 2QDXA 4XB1A 4TMFA 1QZXA 3NPAA 1U0FA 5HZGA 1NV8A 1V95A 5E6SB 1ZC4A 3DCIA 1LC3A 4O5OA 1JEQA 2I2DA 3LZCA 3KKZA 2QJFA 1C50A 2RH5A 4TTAA 3CHYA 3MRTA 3AY3A 2QTMA 4LJ4A 1RJWA 4A8PA 2BFFA 1Q7CA 2QG9A 4X24A 4JXKA 5KHLB 2ZDGA 2HU7A 2Z2XA 4IIUA 3RJ5A 3VAZA 2JEYA 5HNKA 2BL4A 2XUDA 1B8OA 1A69A 1H4VB 4Y0NA 4WZBA 1N3IA 5F2OA 3TRDA 3H11B 1XU9A 2VT2A 4KFRA 2WYWA 3Q7PA 1ECGA 3AX6A 3GT3A 4OHPA 1JEDA 2BR3A 2QGZA 2WTXA 2NO4A 3PGKA 4MCHA 2VXCA 4F4JA 3SQWA 1UKAA 2XCQA 2QB5A 3ESAA 1E7WA 2OT3B 2V8BA 4IWXA 4YAOA 5A5GA 4F4IA 4JJIA 3W79A 3GJZA 3O38A 1AQNA 2RONA 1FU8A 1UFRA 1QYRA 3AR9A 1ZNXA 2PUGA 2J33A 8ADHA 3HBJA 2FR8A 4Q3OA 2OG2A 2MYNA 4D96A 3CLRD 3TUIC 1E9FA 3GF4A 1N2CB 4QLBA 4P2GA 1Y9ZA 5EIEA 1PIWA 4DVJA 1XMQB 2B30A 2X9GA 3FCUB 2B8JA 3CXRA 4U8GA 1BHQ1 3G2LA 3ZHYA 2AZ4A 4EENA 2DUJA 5JJIA 2ZB7A 2DGDA 5F5LA 3N2KA 4G5YA 1E77A 1PP4A 2OLJA 3LQ1A 5EYPA 3M3DA 3L84A 3P26A 1DVRA 4LGCA 5FBZA 2JFHA 1LPMA 4R2LA 1NF3A 3PEEA 2DPXA 4FYVA 4JVSB 5D84A 3NBYC 1AZLA 4AZTA 1T8TA 3K6RA 3JRWA 1Z0FA 2AMFA 2C5FA 2V6IA 5DRTA 4F5EA 2V58A 1GFZA 4C7OB 1YDFA 5HRCA 1HRDA 3N5KA 4D3FA 2R7LA 3F49S 1JHPA 1D2NA 5K5EA 2I3AA 2H0RA 3G79A 2FPXA 4HFJA 4WGFA 3OQVA 4FGKA 5KVAA 3B3FA 4M1ZA 3VI4B 2ET6A 3QIAA 4EUEA 3AESA 4BO6A 1J25A 1WCIA 1ZUWA 2FLKA 3BRSA 3F5DA 3NBQA 3NM6B 1KJWA 3OT4A 4JQCA 3UFXA 3OO0A 4CEHB 1GQSA 1SXGA 1UFQA 5HFAA 2OXTA 4HQRA 3UZUA 4HQKA 3I5XA 2VQDA 3UMVA 4Z4GA 1IY1A 3DVSX 3WRVA 2HWKA 4DC9A 1NQVA 3K31A 4LYEA 3RLFA 4C4AA 4D9MA 4PBSA 2JIOA 2N0SA 3I2IA 1UJ4A 2D00A 2F3QA 3QPCA 3H7AA 4W1QA 4AJLA 4XVQA 4DWVA 1W6UA 2MMCA 4KOAA 4D79A 4AKTA 3QNUA 1HE3A 5JWOA 4RF2A 1TK9A 2BBWA 1GDHA 3ZNPA 4MUBA 5F23A 1RWPA 3AEZA 3T3EA 5JHHB 2OXRA 1X7WB 3PHLA 4RNCA 3RU9A 2XUZA 5CM9C 4NBUA 5CEJA 3VO8A 2EW2A 2JGNA 4Z0TA 2OGTA 3WKEA 4BNDA 2CMFA 4GX0A 3KWFA 5CG1A 1NXQA 2FEMA 621PA 2NVOA 3P9ZA 2IYNA 3W06A 1ZCFA 3GJXC 4EO7A 4LOKA 5B58C 4RMJA 3HB4X 2Y2UA 3VSCA 1P2UA 5KAPA 5TMEA 2BGRA 4M1MA 3FNQA 4ILKA 2WHXA 5F9HA 3S5UA 2MYPA 4JD5A 4G0NA 4OLAA 3JS5A 4JR2A 3VXKA 2OBBA 1CF2O 3H05A 3L40A 3G2NA 4F6LA 2XSZA 3C2QA 2HT1A 2W0SA 4RHFA 5DOVA 3TSZA 4W1PA 5COAA 3VPXA 2C5AA 3IUJA 3QA3E 1JNXX 1P44A 1P74A 4CMJA 2PPVA 1JIQA 4HB4A 4JU9A 4BGVA 4GS5A 1K68A 4F7DA 4DQKA 5L3SA 4XVRA 1IAVA 3IAUA 1V11A 4U7TB 2P30A 1GU7A 1VI2A 3JQ8B 1FC0A 3DUFB 3EUEA 4FMPA 1Z5VA 1EDBA 2IHUA 1GYPA 2J30A 4QD3A 5AI4A 4X66B 5KTKA 5FTJA 1JLKA 1RVV1 4JQSA 2PD6A 4XW2A 3E23A 4X1YA 3WP1B 4DSUA 1I30A 4G5GA 1NVAA 2IU6A 3OIWA 5IAOA 4KC0A 4P84A 5FT9A 1AXEA 1NJGA 3ABRB 3GLVA 3JAWB 3DEZA 4MW9A 4RO0A 4B8YA 1KTVA 1YRHA 2ZUVA 3DDHA 4IVPA 5HF8A 3RYHA 1IN1A 3E7FA 2PDAA 3B6JA 1U0SY 3WIBA 1SFRA 4DNOA 1EFKA 4CV2A 1GSHA 3C98A 1PJRA 3AINA 3O1IC 3AVVA 2CYCA 3AUKA 1BXRB 1QDEA 4DQDA 4LHYA 3PZRA 5AVQA 4AMVA 4MCIA 3HJUA 1PDWA 3E70C 3EEIA 3PNQA 5CITA 1W36B 1ZD8A 2FF5A 1ACLA 3VAYA 1L8OA 2ZJBA 4BN4A 1CRQA 4A3SA 3MJHA 1VBNA 5DNUA 1ZVJA 3EXHB 2O48X 2AIRA 4KXYA 1AXRA 2YUIA 1I4DD 3I1FA 3G0CA 2QRZA 1XHEA 3VISA 4M38A 2VR1A 3SS8A 4AD8A 2VP0A 1MZVA 2IF2A 2J9RA 3KOUA 3PQ7A 4UREA 5J2UB 5AVYA 3S8YA 2TMDA 4KO2S 5JDIA 3S4YA 3CN9A 2GZ3A 4Y98A 4RE6A 4KSBA 2FG5A 1B74A 4C0JA 3MJEA 2BMEA 4LXIA 4IXDA 3S2UA 3UXHA 3V2HA 1NMEA 5IW8A 1UBCA 1FP6A 3NC1C 4B09A 1RW4A 4Q48A 4HVLA 5FUWA 1ORDA 3F9IA 3HXKA 3VO1A 3MHTA 1NYRA 1B2RA 4DUGD 1U81A 2B5VA 2O2CA 1UEJA 3CLKA 5ALTA 4YRDA 1SHUX 4IO1A 1QRAA 4PWZA 4BDTA 4M8LA 1K6XA 1J5EB 3ZPXA 1WX1A 4WKCA 3QPBA 3JWGA 1E2LA 1TM3E 1UBNA 1QCYA 3F8TA 4MR8B 4HNGA 5ECYA 1KVSA 1QH8B 4IIDA 2F8SA 3DJYA 4NYMR 1N7GA 4LNAA 5LU8A 3TAHA 1G38A 1QG2A 3ZDAA 2XQGA 2UZ1A 4MV9A 4BX2A 1NXVA 2MU1A 3ZU5A 3DHNA 3ZI7A 1N2OA 3MWKA 4LJKA 3LW7A 4AMBA 1SCIA 4A6DA 1EJ0A 2J31A 1TJNA 2QE6A 2EJBA 2CBGA 3IMKA 3O74A 1VLVA 5BNZA 5KU1A 3EDCA 5LIPA 4XI9A 2ZS7A 3NPMA 2JFNA 3VGJA 2CFSA 4F6CA 2I4IA 3FFWA 4AJPA 2QA5A 2QLBA 3LL7A 2XCRB 2WWYA 1ZBDA 3SSMA 3A7EA 3MMZA 1YZQA 4JHXA 1M3SA 2WHQA 4MYRA 1PHPA 4TYNA 3B6KA 3THOA 3UAWA 1E4EA 1NBAA 1TMKA 2NVBA 2GA9A 5DM70 1QQBA 2FPGB 3QX7A 4NCJA 3T1QA 2NUBA 2C58A 2XJ9A 3PNPA 5D8DA 4RLHA 3WK8A 3WMFA 3CF2A 5SY4A 4DIEA 1DX4A 2O7RA 2FUCA 5A9RA 1WZCA 1Y1QA 3HR7A 4CEIB 3OIFA 3B51X 2G1KA 3R9XA 2PZMA 4ADSG 1NYLA 1YRBA 2DJIA 1USGA 3MGBA 3OTGA 4OI2A 3NP9A 4FZ3A 3W3AD 3SZOA 4U00A 3DEKA 2E18A 4CPDA 1DXYA 4EB0A 3BFJA 3H84A 3FGOA 4UE3S 3G9XA 3RF7A 3HDVA 1SQ6A 3ZJTA 1C0PA 1NW6A 1KU0A 1Z0AA 3PDWA 3ND6A 2N3ZA 4TKZA 3UWMA 4YR9A 3M89A 3T7DA 3NRCA 1G8HA 2YHAA 5ED4A 3KVYA 3UBMA 3KHKA 1F2UA 1PFQA 2ORVA 2DH5A 2FSGA 2ZIXA 4JGBA 3ZLTA 1VLQA 4ZU6X 3EGCA 2NU8B 4CW7A 5IBRA 2JJ8A 3MJCA 1GNTA 4CKYA 1W5SA 2VZ0A 2MHCA 4DV4B 1H69A 5CT4A 4IFEA 2DPGA 1R0KA 4C0KA 3DEFA 4I50F 2IKSA 2RI0A 3R5HA 4XR4A 1QWSA 3L0ZA 4ZAYA 2A9QA 3U3DA 3Q41A 2HBRA 4Y67A 7REQB 1TRKA 4FD2A 2DEUA 2IE0A 3H16A 5BW4A 4JX8A 3ETEA 4O3FA 3IDFA 3UAYA 4BNYA 4HVTA 5IF9A 1OXBB 4AK9A 1CDDA 3KPYA 4OMUA 1DAEA 1MRZA 4UM8B 4JBGA 4WKPA 4BNLA 1XCGB 2QE7A 3D3QA 3IR5A 1WKBA 2K6GA 3BZWA 4HEA1 3VKFA 1KDPA 4XQ9A 5K0GA 2VUIB 1RJFA 4P0PB 5HQTA 2Q2QA 4UHFA 3VNBA 3OPNA 4HG2A 2HMAA 5LP6F 2GM5A 4FYYA 2X4GA 2VKQA 2FPMA 3AFIA 2FI1A 3GLTA 3L02A 3OZCA 4KYIB 3TL2A 3REQB 4A0HA 3IIMA 3DLIA 1SCQA 1ZUD1 3IMGA 1CY4A 2FYTA 2KLBA 4FGJA 2C54A 4X1IB 5ALUA 1QOQB 4R7GA 1ACMA 1BMTA 3G2KA 2B36A 1UJ5A 4Z4HA 2CN1A 4IS2A 1RYBA 1R6VA 3G88A 3MGGA 2X58A 2Q29A 3I04M 3KVOA 1T9CA 3I53A 3KQNA 3P9CA 3GEPA 1ZMBA 2LV8A 4ROSA 1TVMA 2ZCVA 3CB4A 3GDFA 4FFWA 3SXPA 4IIYA 3V4ZA 3ZCXA 4HPWA 4GE0A 4MUAA 5B2FA 1T8PA 2UZIR 2X8LA 5SZIA 4GVXA 1A8UA 4M1TA 2WIDA 4K2HA 4DJAA 2DBYA 5C5IA 1PGJA 1Y6JA 3NHWA 3RVPA 3UK1A 4OUKX 1CY2A 1FDIA 3DFKA 3DMPA 2VP4A 4NCAA 2NOAA 1U9YA 5ESWA 3OM1A 3T12A 4ND3A 4OQDA 1V8OA 4PYJA 4UCQA 1S4QA 3MWYW 4OOEA 1C2TA 2J9GA 3ZI0A 4B2IA 1U4SA 1HDRA 1WZUA 3PFHA 1AT1A 5C8ZA 2Q4TA 5JW6A 1T9AA 2HRDA 3FTCA 4KQIA 1RZUA 2XKKA 2H7YA 3RWOA 4PHFA 1IG3A 2RFLA 1ZM2A 1AGNA 1QANA 2WZBA 1YFLA 2XZLA 1HYQA 4BB9A 1T0BA 1ZKDA 1FTWA 3KWMA 3WFIA 4CMIB 5L3VA 1XLUA 2Q3DA 3C45A 1X7ZB 3FUCA 4JJEA 3QKWA 1VKJA 1VG0B 2GFQA 4NV1A 4QQRA 3ZLJA 5ARCA 3AUSA 3K0FA 3ORYA 4RSGA 4YRAA 1V4VA 2IDJA 4W6QA 3PC3A 4LWOA 1DAIA 2FFQA 3U31A 4KQWA 3V8NA 3KPJA 1PEAA 1X7DA 2F48A 1TAQA 3QLTA 2I7CA 1YACA 4L76A 4Y8VA 4YTEA 3D81A 3FN4A 2WF8A 3OWXA 2Q1XA 3QX8A 2IU0A 3WSWA 2ZXUA 3QFTA 2ISQA 5ANRB 1YK1A 4Z1MD 2XGMA 4NOJA 5IH3A 2J9FA 2ZUFA 3U6BA 1VB3A 3CUSA 3A36A 3BIWA 4K05A 1PT9A 3C5EA 2ZWPA 1TF2A 2NNLD 3LS2A 4PX9A 3U49A 3W1WA 2AI3A 2I2CA 4C3VA 3I73A 4JL5A 1KEKA 2OCGA 3AFOA 1XJWA 1XX6A 3F4KA 5EIOA 5IJWA 3B85A 4P4LA 5E2AA 1MABA 3CVWA 1Y8RB 2Q4DA 2WIKA 2I2WA 3X1JA 5C46F 1W85B 3I9JA 3GUHA 1SUWA 3ZVNA 4NEHB 1EHCA 2UKDA 5AOCA 1FYXA 1Y5LA 1ENZA 1B16A 1QFZA 1Z22A 3BM5A 1JDPA 3FUWA 3IAFA 4FVTA 4NY1A 2IYSA 3WNZA 3SHOA 4CBVA 3QBDA 4CM1A 5AUPB 4L15A 5C7IO 5C1BA 3FETA 4HZUA 3FBWA 3AEXA 4NBKA 3GRPA 3PFWO 3FI0A 1LTKA 4E4RA 2VHJA 1AN9A 1O4WA 4K6FA 5GZ6A 3KVNA 4UTNA 4RTNA 2PMBA 3TZQA 4F93B 1EEHA 1E8MA 1Y5NA 4X9XA 4PX3A 4WZAE 1K8XB 3D59A 4KG7A 3C6KA 1AK2A 1KYVA 4UFOA 2MSCB 5DGIA 3ETDA 4NDNE 3JQAD 2O23A 4PFKA 2W5UA 3RBAA 1R3UA 3VMFA 1RMQA 3RWMB 4PHHA 3WL5A 2XQIA 4DNPA 3AVTA 3PDIB 4M9QA 4FOLA 1NW8A 4PYQA 1G6Q1 2ZPUA 1ECFA 3PNOA 3U80A 4ZZ3A 3B2QA 3EPLA 4JBWA 1HZZC 1NPDA 3VX4A 4EKGA 3BD6A 4BOYA 1TFRA 2FSFA 3F47A 2B69A 1L5HA 4BY9E 4BWYA 1K7FB 4HAOA 4V2IA 4E70A 2HQ1A 2VRCD 3JCZA 4XB2A 4HB0A 5IUNC 3ZR4B 1WABA 2NV0A 3I8OA 1Y42X 3N5CA 3EFEA 4MLDA 1CNEA 5JDCA 3H83A 1EVJA 1YUMA 1JDSA 4AMZA 1B41A 2I6GA 2QSJA 4TT8A 1FQJA 1ORHA 2GZDA 3W4JA 3TW0A 121PA 4AZWA 1FYEA 1LA2A 1Y4SA 1L5LA 3GJQA 4N1AA 4DN6A 1SCJA 4HAUA 1A77A 2IZ5A 1RZ3A 1NI5A 3BGIA 3CXUA 3HC7A 2R4QA 3PVSA 4YBRA 2JD0A 4OBEA 4BRSA 2XNSA 5CU7A 1FNBA 1YB6A 1J8DA 2CC2A 1CT9A 1G8PA 4S0XA 2XV1A 5F3RA 4PZYA 2GT1A 1RI3A 2XXBA 2BFEB 2HK7A 4HUTA 4L0MA 2I6FA 3T54A 2MIIA 4YX9A 2ZITA 3ZWQA 3CVXA 4M9SA 2ZYGA 2WIFA 5EUMA 4YJFA 1QB8A 1VI6A 2OBYA 3LA6A 3N8NA 3R74A 4BN5A 4MHTA 6YASA 4MWEA 1T6YA 1XQYA 1EE1A 2ZVQX 2Q0SA 3ZGLA 4A15A 1YS4A 1KQOA 3IJPA 2IOYA 4FINA 4RF4A 5EXEA 1MAAA 4AP9A 5CIWA 4N6GA 4YY3B 1PSWA 3HFSA 4NCXA 3QEOA 4ZJPA 5LQMA 3LTNC 3B5EA 3QLUC 2WYOA 4AUMA 2PSJA 1JG2A 3IAEA 1EFVB 5D5QA 3RGWS 1T9ZA 3IUQA 3ZDFA 3ROQA 4LQLA 5A5EA 2FSVC 1T9DA 2NSHA 2VUHB 4TROA 2JCBA 3GGSA 4NBRA 4WA7A 4B6QA 2V3VA 2YZNA 3EC7A 4XPIA 5HFNA 1CDOA 2H1FA 2G67A 2GCEA 1NX6A 1L0BA 3ODGA 3Q9SA 2H4JA 2W4MA 4EOGA 1SM4A 3IKJA 4NECA 4YJGB 3E81A 2HUNA 1DAOA 2Y27A 3K05A 5D1HA 4KZPA 4AT1A 3SJAA 3EULA 5AK4A 2VCHA 2A1UB 4DR2B 1IBKB 2ODTX 4IIJA 4R1UA 3ESXA 3TLJA 4BLPA 3GC6A 4LBYA 1XYGA 2DX7A 1PJCA 1XTZA 2RK4A 5KNLA 1ABEA 5HKOA 2WTAA 4FU0A 4GXNA 3PBKA 2VATA 4FOSA 3L5KA 1PDVA 2A4KA 3T6KA 1WF6A 4EP1A 4GRDA 4HNTA 4X54A 5EHGA 4DLXA 3A2LA 3AJ8A 1Y8QB 3IVGA 3O75A 5AVXA 2RGDA 1UP7A 1X1CA 2AQIA 4R1PA 5EJ5A 1W88B 5A9SA 2CUNA 1OPXA 1OI3A 5LN1A 1CQZA 4ENSA 1DKLA 5K4AA 5HOQA 4OUDA 2D1YA 2Q5CA 1GITA 1JYFA 4URFA 4YLYA 1SIWA 2GEFA 5JNWA 3OUZA 3QU9A 2JB9A 5DNCA 1YMVA 1KZYC 2QL5A 1KXZA 4PU0A 1DUVG 2PMCA 2VPXA 2G77B 1NQXA 3CJRA 3D4OA 3NTLA 2ZYIA 1LFAA 3O82A 3PKZA 4O2BF 1ZVKA 4QUDA 5EEGA 4K9NA 2IVZA 5JMPA 5LQNA 3I62A 5JRZA 4H3HB 1GZHB 3ITDA 1MQAA 2H8GA 3SI7A 4ENUA 4XX1A 5FI5A 2X7HA 2PV0A 1WU7A 4QNNA 5J5CA 3VNRA 5JIBA 4KH1A 3VKUA 4AP5A 3H2YA 1R0ZA 3CJQA 4QELA 2ZAOA 4Z2AA 4RK6A 1WBBA 1MX5A 2V7TA 4GX2A 3EDRA 4RTKA 2WUGA 4WK4B 2X42A 2CSUA 2ZI5A 4I1YA 2IODA 1FTNA 1VHJA 1FNCA 3HWX1 3QG5A 4O25A 4TLLB 3VX3A 1M1YA 4NEQA 1BCSB 3DAHA 3TAUA 4DC0A 1TE2A 2I34A 3U44A 4DHWA 3DZIA 2QKYA 4J29A 1OAOC 2B25A 1AZTA 2FW6A 2OGUA 2OZEA 2P3LA 4K1LA 5E1OA 4ZJUA 1WBJB 4UNSA 3KUKA 1KH2A 4QGFA 1NUQA 2A8YA 4YVFA 5I3ZA 1I24A 2QYTA 1V8ZA 5GPBA 1U0JA 4OYYA 1HE4A 4XIYA 3WDLA 5AQ1A 5K8VA 4LISA 4X3CA 4EG6A 3KT0A 5BVHB 2AMVA 4GWGA 4CF5A 4I36A 1OYOA 2VZ9A 3UHOA 1R6XA 4TZTA 1Z17A 5F7JA 2VK8A 3HK2A 3OPYB 4DCPA 1G8SA 3TFQA 5L6LB 2OQVA 1KK2A 3B1WA 2H11A 5AKIA 1CUVA 2AMLA 1FZTA 1A76A 5LNK1 1OBOA 3EC2A 1C80A 2F3SA 3L7KA 4UU8A 4F1KA 3AR2A 2R8PA 5JNLA 1PJ3A 1O03A 2A94A 2LIVA 2Z5LA 1QQAA 3E3LA 2P5TB 1VPVA 1Q1ZA 2B1IA 4MIEA 1JALA 4Y6RA 5J4HA 4IQFA 4P22A 5BVGB 1FJXA 1P7ZA 3KQYA 4P93A 2VO1A 1X38A 4ALIA 3IEMA 4NIMA 1UADA 4JLPA 4DJJA 1VDMA 2XUIA 1FEZA 3FOCA 4QYXA 3RANA 1QHFA 4MJLA 3RVBA 4I4TA 3TRHA 5C7OO 1AMOA 2IH2A 5ITWA 1CIJA 3PQFA 3N2IA 1LPOA 1OW3B 2GLXA 3IA2A 5FBWB 2JG3A 5LBIA 1O6FA 4WLOA 1ZRNA 1MIOB 3LCRA 3QGMA 4GICA 1UXIA 4JI5B 3SVLA 2UYCA 4U2FA 2VCEA 3HFRA 4LDRA 4F2WA 3KETA 3DNPA 1ZD2P 2GZMA 1Q0RA 4YAFA 3ROEA 3AB8A 5EE0A 3WLRA 4Z4CA 3RFVA 1V5EA 1DKNA 1P2GA 3JVVA 3SYLA 3ZZUA 3TMKA 4M49A 3KKPA 3EEBA 2K2QB 1TD9A 1YL6A 5LL6P 4RF3A 1P7PA 3KB6A 1Q19A 4NSNA 3GGOA 4Z51A 3IOBA 5EZQA 1I1NA 4AC9A 1GFWA 5CXXA 3ZE1B 2I1WA 3CO0S 2XX3A 4K6CA 4R2KA 1WVIA 2RG7A 3EOZA 2O3SA 2W00A 1P80A 4LCEA 3V4SA 1F38A 4Q1VA 5F1KA 1ZJJA 2GNPA 2P2DA 3OCVA 4DIFA 5GINE 5A7GA 1EJ2A 2IGBA 3SLRA 1Z28A 3MJFA 4RAOA 3VR5A 5AI0A 1KAGA 3LVBA 4R8LA 2X9LA 4AKSA 3N2GB 3OE7D 1A4RA 2PSDA 4QEDA 3EZ7A 1KZHA 1TOAA 2ILVA 4MV5A 3KQKA 1Z12A 1FSGA 2YC2C 4JT8A 1F0PA 3E7DA 5DEIA 2UVPA 2ZI3A 3JYLA 2I1QA 3K53A 3RO7A 4ZDWA 1PU2A 4EI2A 1PD0A 5ILOA 3DMNA 4JVOA 4M7WA 3A9CA 4P2BA 3PJRA 3CSSA 1NBIA 1TXGA 3EMVA 4AB1A 3R24A 4KLRA 4PQRA 4X60A 3SYTA 4WOCA 3KSAC 2NX2A 1TZMA 4AN4A 3OCJA 1ZRHA 3ADPA 1GGFA 1LBHA 2ATVA 3EVTA 3H2HA 1O2DA 1DQZA 2R1TB 3IBYA 4FEYA 4IGEA 4RFSB 4YO8A 5CTAA 5EP1A 3S2SA 1OX4A 5F1OA 1OYVA 3HJAA 3EAGA 1D4ZA 1TPZA 4PR0A 1EMDA 5BNTA 4YCAA 1PFWA 1XIVA 2NSLA 5AH0A 2QN3A 3SWWA 2FMHA 5BYJA 2BC9A 4F84A 1NNLA 1UKVY 2AN3A 2JJYA 3IAM1 5ENZA 1RZRA 2HSZA 3IHWA 5L3QA 1UH5A 4R2HA 1RC0A 2RARA 4UPVA 1R5OA 4CF6A 1JQAA 5C4MA 1JIVA 4NAVA 4OXYA 3QMMA 1ZD4A 3WIEA 2NZXA 3L6DA 1F9EA 2YIMA 3JD3A 2ZE7A 3LQFA 4LJ7A 3SM3A 4DQVA 1C8KA 4X44A 2FWMX 3KJXA 4DUYB 2A3NA 1UDBA 1E69A 5EP2A 2Q4EA 3K2QA 4D26A 1ZH0A 4B75A 2EG5A 5M34A 8AT1A 3BK1A 3FTNA 5KNCA 1QU3A 1KFBB 3EA0A 4MHSA 3HU1A 5AI5A 2QU7A 5EJGA 3I01M 1FP4A 2P7IA 4LZZA 5FHRA 4D9NA 3IAM6 2DZDA 4HAWA 1G5TA 4ES6A 4NJMB 1ZJ5A 2QMHA 3ENVA 3L41A 3MWLA 4MRVA 3V33A 1U3CA 2MSLA 1EGMB 2QRUA 3PXBA 1QZUA 2JHCA 4UNNA 1BW9B 4KGZA 3VA7A 2GM9A 2C83A 3KR9A 5EXPA 1JHRA 2VHWA 2OHVA 1HL7A 3W0LB 4F3RA 3TXXA 1DO8A 3RW9A 3P19A 2Q5FA 4PO1A 2JHPA 4I81A 1TLTA 4DJFC 2HR1A 2Q28A 3MRSA 3NC4A 3WLIA 5B7PA 1KNXA 3CZ5A 4KE6A 1KAHA 2V7WA 3HXTA 4KYTA 4BJ5A 2P4SA 1UWLA 3TQSA 1P5RA 2C3OA 1M67A 5IDWA 4GO1A 2F4VB 4W5HA 3VZBA 1XQ9A 5B37A 5IH7A 1VSTA 4KXVA 1FLVA 2DHQA 2IPOA 1ODSA 1RHMA 1M2OA 2QUJA 2XA9A 4YUXA 2BEVA 3HB1A 3T35A 4XEUA 3KB8A 4ZEVA 4B4OA 2CVPA 3DKVA 5KOHB 5TMDA 5FPKA 1MU0A 4BWVA 3K72B 1B15A 3NIFB 4QO8A 5KQLA 4OFZA 5K6AC 3WAKA 3HEAA 5SZKB 3NGMA 4RTMA 1OWPA 2HWXA 1SUFA 2X0NA 1QGYA 3FYSA 1VMIA 4M54A 5DIZA 5ILQA 5BV0A 1QAOA 4DCTA 2Y1EA 4CFSA 3RVJA 3KSZO 4KMMA 4YIHA 1O9GA 1PS0A 2C2XA 3U9SA 4QBTA 4UHKA 4AO7A 3EZ6A 2YXEA 2QP4A 4AIRA 5ADUS 2OKCA 4CLOB 2F1IA 1IC6A 2GEJA 4PO8A 3VSAA 1R6BX 2V6JA 4LMAA 2QAGB 3RVSA 2R25B 4RACA 1R9MA 3L4BC 1BS1A 3H86A 4HX5A 5EJIA 2HREA 4D5EA 1NT2A 1C3OA 4OBWA 3PTZA 1D07A 1ZM3A 4XCVA 1QYXA 3A9UA 4KNWA 3AXSA 4EUHA 2RJNA 5H81A 1VGRA 4LG1A 2HEIA 1J90A 4YCLA 2DUUA 2Q0QA 4TYMA 1RPJA <