1ISMA

Crystal structure analysis of bst-1/cd157 complexed with nicotinamide
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
250
structure length
250
Chain Sequence
WRAEGTSAHLRDIFLGRCAEYRALLSPEQRNKDCTAIWEAFKVALDKDPCSVLPSDYDLFITLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMPLSDVLYGRVADFLSWCRQKADSGLDYQSCPTSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITRIEIWVMHEIGGPNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDCALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic studies on human BST-1/CD157 with ADP-ribosyl cyclase and NAD glycohydrolase activities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords bone marrow stromal cell antigen 1
total genus 82
structure length 250
sequence length 250
chains with identical sequence B
ec nomenclature ec 3.2.2.6: ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase.
pdb deposition date 2001-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02267 Rib_hydrolayse ADP-ribosyl cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.82.10 Mainly Alpha Up-down Bundle ADP Ribosyl Cyclase; Chain A, domain 1 ADP Ribosyl Cyclase; Chain A, domain 1 1ismA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1ismA02
3ROKA 4CUKA 4CUJA 3AOEC 4GKBA 1BVUA 1I30A 4OXKA 5I9LA 5L7TA 2CDBA 1ZCJA 3ZDFA 4J1TA 4D46A 3U5TA 5I9MA 1H93A 2WYWA 5CPBA 2HLPA 4AJEA 2X6TA 3FCOA 4TRMA 2PH3A 2DFDA 3KO8A 1EDOA 1Q7BA 1JN0A 1LDGA 5JO9A 2OORA 3DZBA 4LISA 1F8FA 3KYDB 1EZ4A 2Q46A 4BO3A 3I6IA 3JQBA 4LSWA 5HS4A 4LVUA 1Q0QA 1BTOA 2BLLA 4JJIA 4XB1A 1QP8A 1WMBA 1JW9B 4PG8A 1A72A 1NQAO 2FZEA 2NWQA 3WYEA 1E1LA 3TFOA 1LDYA 3S1LA 4YJFB 1UH5A 2VHYA 5EQDA 1BHSA 2NU6A 4Q3DA 5DP2A 4Y6RA 3K96A 5JNLA 1A71A 1L7DA 3NKLA 1VJTA 2EV9A 2DM6A 2JD1A 3AK4A 1XR3A 1U2GA 2VHZA 3KSUA 2EGGA 5CDYA 4QX6A 1F0YA 3NTOA 4XGIA 4W9NC 4BNWA 4UUPA 2YJZA 2AQIA 2VQ3A 3E1KA 2YV3A 1I3LA 3MJTA 1KEPA 1MXFA 1H2BA 1HYGA 4WKGA 2GO1A 4BNHA 4Y98A 5G4LA 2Y1GA 4ND1A 4ONEA 3HG7A 3UCFA 3PHIA 3JQ9A 4DIOA 3I4CA 1U3WA 2CVZA 3JD1A 1Y6JA 3WICA 1VC2A 3RFTA 4ZU3A 1P45A 3HZZA 4R01A 4YCAA 1AGNA 1P1RA 2PZMA 3D5TA 5JAIA 4N18A 1R37A 3RC9A 2C59A 3JYOA 4EUFA 4D45A 1C0KA 1KVSA 2GDZA 3DMYA 1XYGA 1VL0A 2H6EA 3QWIA 3SEFA 1N7GA 3DOCA 3F5QA 4WE3A 1I3MA 4P4NA 4TZKA 3UUWA 4EJ0A 1FF9A 1E7MA 3B1JA 4K26A 4P38A 5EIOA 4DPMA 2PD6A 1F14A 2PGDA 3GK3A 3OJ0A 3UCXA 1U5AA 1J6UA 5CEJA 2WE7A 3WG9A 2CVOA 1NQTA 3L9WA 3LQFA 1DEHA 3A28A 2FR1A 4TKMA 3EK2A 3WYCA 1ZIDA 1E1MA 1P74A 1T25A 2XXBA 3MWDB 3LT0A 1TT5B 2GN4A 3PWZA 3OETA 3GAZA 1YB5A 5AXCA 4FFNA 1E7WA 1K6IA 3PFFA 1RM5A 4FFMA 4GLOA 4BIIA 2VZ0A 4I8XA 4N5MA 1ZK0A 3PPIA 4AL4A 4WLNA 1I3KA 3AU9A 3DBHB 1M66A 2W2LA 3UHAA 4YAIA 4PG4A 2B69A 1DC5A 1QKIA 5L40A 2AE2A 4MVJP 5F5NA 3T4EA 3VVBA 5TLSA 1E6WA 4AJJA 5IFLA 5A5FA 2NVBA 3ROPA 3QP9A 1CJCA 1EE2A 4E2ZA 5A06A 1PJTA 4MVJE 1SC6A 2GRAA 3N58A 2J3JA 1R0KA 1PQPA 3ZNPA 5LC1A 1M75A 3CUKA 1GFSA 3L6DA 4R1TA 4UVHA 4BNLA 4DIBA 1X7GA 4UVDA 5F1PA 1T2EA 4XZ3A 4HNHA 3FNHA 3PXXA 1C1DA 1DC3A 1KVUA 4LCJA 1IZ9A 1H2HA 5KCZA 3NAQA 1H5QA 1Q7CA 3IDSA 3AM3A 4JBHA 3DHEA 2C0CA 5EESA 5BSHA 2PD4A 4MP8A 4YTEA 1QV7A 1MC4A 1XWFA 4DBVO 1PZGA 3VPFA 2IZ0A 3TSCA 1I2ZA 4R3WA 5CPFA 1IUKA 1SPXA 1KOLA 5A9SB 4ID9A 5FYDA 5AQ1A 2HMWA 4WUVA 5IJZA 1HETA 1GCOA 4Q39A 5EERA 4MVJG 4MINA 1PGPA 4OH1A 3RROA 3LSYA 2ZYAA 3NT2A 5MGBA 3DOJA 1YOVB 5IN4A 2O3TA 3QRWA 4CLDA 1I0ZA 3DAPA 1UDCA 3OJOA 4CM3A 3WX0A 1ENPA 3GMDA 2XXJA 1JDJA 2A9FA 4II2A 4IDAA 3DL2A 1NFRA 4ZRMA 3QA9A 3K31A 3COSA 3AU8A 2FMUA 2GD1O 2BELA 3JQAB 1WP4A 2GF2A 2I76A 3OJLA 4OL9A 4Q9NA 3UICA 3WXBA 1GEGA 4IJWA 2I65A 5ITVA 1VL8A 1GQQA 1I2BA 4K6CA 2QW8A 2AHRA 3ZZNA 3AY6A 3AOEA 4BNIA 4BNYA 5ITWA 2OOSA 2AE1A 3WGQA 4CM8B 2PWZA 2R00A 2H9IA 2QHXA 2Y1CA 4R41A 3CE6A 3RWBA 4I5EA 1QYCA 5DT9A 1ML3A 1HDCA 3L0DA 3SLKA 2GZ2A 3E82A 4RF3A 4KWHA 1ZMOA 5KJ6A 1RYEA 4CL3A 4BNZA 1YB4A 4FPXA 1T1SA 2VNSA 3WGHA 3OIDA 4XRGA 5B1YA 3KHUA 1EEHA 3S2GA 4CLRB 3GGPA 1YL6A 4UEOA 3B1KA 2I9PA 3DTTA 3DZJA 4R51A 1RJWA 1ISJA 4C7KA 2J5RA 1KC1A 3H9GA 4RF4A 2JCVA 2D2IA 2ZYGA 2AA3A 5HBRA 2Q1TA 2Y0DA 2J8ZA 3WTCA 5A4DA 4FGWA 4IXWA 3Q3CA 2ZYDA 4DPKA 4CMBA 4W4TA 1YL5A 3QVXA 1GPJA 3VPSA 1NFQA 4AICA 1ARZA 1D1TA 2Y68A 1I01A 4MP6A 2NVUA 1GEEA 3V2GA 2JFGA 2EF1A 4RVHA 4UREA 1HLDA 3EW7A 1O5IA 4CMIA 2EKPA 3VPXA 4PZDA 4WOJA 4E0BA 2C20A 3T7CA 5EL0A 1ULSA 4PLGA 3NX4A 1P0FA 3H9EO 2C2XA 5DBIA 1NBOA 1CRWG 4J7CA 4J4TA 4Q3NA 4XWYA 4IDEA 5DOVA 1Y8QB 4S3MA 1VLLA 3GQVA 2ZCVA 3JQ7B 5C3MA 2G82A 1G0OA 3FRJA 2POQX 3ZI0A 2NU9A 3NEPX 4XIJA 3FWNA 4E4YA 1LBEA 2Q2VA 4F3YA 1YH3A 3TL3A 2C5AA 2O2YA 1ZUD1 1UP6A 2BI7A 4QFCA 5IDQA 2B0JA 3RIHA 4BHTA 5JYEA 3IUPA 3FN4A 5KTKA 2ZKLA 4OGWA 2EG9A 2HKIA 1P31A 3M2TA 4FN4A 5LDHA 1QYVA 2GASA 4UAGA 1E77A 2IEDA 4XB2A 2IZ1A 2A94A 1EUDA 3PI7A 1UZNA 4H3VA 4I5GA 4OM8A 3GDGA 2VUTA 3IOYA 2D3TA 1TLTA 1XHLA 3AI1A 4J2OA 4OYRA 3GH3A 1VE9A 3NT5A 3HB5X 1CIVA 3NRCA 5G4KB 4E33A 1KVTA 2ZTUA 5G0VA 1DC4A 4FSHA 1B3RA 3H3JA 3JD3A 4UEJA 4Z0PA 4OQZA 3V2HA 1OI7A 5L7WA 3ZW8A 3UN1A 1UDAA 1UP4A 1H9AA 1NX6A 4CM4B 1QV6A 1GL3A 4UVEA 3WMWA 2FOIA 5TC4A 1ISMA 3DHNA 4CMAA 2J3HA 4WLEA 3B20A 2P4HX 2HU2A 1LLQA 3OJEA 3AY3A 3ZHBA 1M67A 1R66A 4GI2A 5K0ZA 3DXFA 1HDRA 2B37A 2WMDA 1DJNA 3F4LA 1SZJG 4NK4A 3RASA 1YBAA 2UYYA 4R1UA 4B3IA 1PL6A 2C7GA 3U0BA 2PKQO 1DLIA 3RCBA 4HFNA 4DGSA 5AOVA 1VJ0A 3WJAA 3E18A 1OC4A 5JC8A 1DOHA 1AHHA 4CV3A 3BTSA 5DF1A 2RH8A 4RVFA 4NDNE 2ZTMA 2YHUA 2NVUB 5DBGA 3OQ1A 3AUUA 2EWMA 1ZSVA 4BKOA 3L4BC 3U3XA 2WWRA 2DTEA 4L75A 2PA3A 3E9NA 3EHEA 1NVGA 2CF5A 4EZBA 4CQMA 3DZIA 1HDOA 4K28A 1HYEA 3GEMA 3EYWA 4GWGA 4R9RA 1VKNA 1Y5MA 2X1HA 4S1VA 4FFRA 4BNMA 1SBYA 4I9HA 1MFPA 3UAGA 3W4JA 4BNXA 4J1QA 1E3IA 3JCZA 4GWKA 4QT0A 2UDPA 2WTBA 1ORRA 2Q1WA 4QXMA 3JQEA 4Y6PA 4BNTA 4KWIA 3GHHA 5JO0A 3F6YA 4B4WA 1ZXLA 2V6MA 1GPDG 2VWGA 3F1LA 2HMUA 5KIAA 2O4UX 2AEJA 4PLWA 2HK9A 4II3A 1RPNA 4A27A 3BAZA 2R00C 3G1TA 5EINA 3ENKA 4JXKA 5JDCC 4BQRA 4ZICA 2PGJA 1PGOA 2BFPA 4E2XA 1W0CA 3CXRA 1ZJYA 2I67A 3JSAA 3IC5A 1TEHA 1TVEA 2HAEA 3R3JA 5JMWA 2DBVO 3D5QA 5FEUA 1RYDA 3BZUA 2CD9A 2JCYA 5JY1A 1BXKA 5J23A 2HQ1A 5KVCA 3C7CB 5ICMA 3OA2A 2VWPA 3H5NA 3AY7A 1B8UA 4CMIB 3GVIA 2DBZA 3DAFA 3H5RA 5JAMA 4D79A 2RBEA 1IHXA 1TXGA 3ON5A 3CKYA 1OMOA 1RWBA 2WJPA 3WSVA 3HE3A 5DP1A 1GR0A 2JL1A 5H82A 4EUHA 2ZQYA 5FWNA 1PZFA 3WBBA 4XRRA 1Y7TA 3ANMA 3AUTA 4CLOB 3TZCA 4BKQA 1IB6A 2OP1A 5DULA 3GGOA 2B4RO 3ASUA 5L7YA 2DVMA 2GERA 1C1XA 3HN2A 3ITDA 3PIIA 5JBIA 1GYPA 5AVOA 3VDQA 2VT3A 1FDSA 4B4OA 1ONPA 4U6SA 3RAJA 3FBTA 3WJ7A 4B79A 3H2ZA 4IDFA 3TWOA 3GRKA 4CM6A 5KKCA 4YAGA 1XCBA 2D0IA 2ILTA 1O9BA 1Z45A 4WCFB 3Q2IA 3TRIA 5IAAA 4OXNA 5EQFA 3AOGA 3GNSA 5L4LA 1BXGA 5U9CA 1AN9A 1GQ2A 1E0DA 2G76A 5EN4A 4LCEA 3TQHA 1LDMA 4RF2A 3VC7A 4ALJA 4FFPA 4DC1A 4RPGA 1ZK1A 5TJ9A 4NHEA 4I5DA 3PGXA 1U4SA 1GV0A 4BO4A 1PWZA 4M8SA 1HSZA 4XYBA 1CERA 5L45A 4RO0A 1GTMA 3ROQA 2DUWA 5CAEA 2ZIZA 1AXEA 5KNLA 3GGGA 1T2DA 5BQFA 1UXIA 1GV1A 4TVBA 2W4QA 2X7HA 3R6DA 3ADOA 3C7DB 1HZZA 2W2KA 1P1JA 1DAPA 3PDUA 4DL9A 4R68A 4R1NA 4IMPA 2BHLA 4DUPA 4XCVA 4WLOA 4BQPA 4WGGA 1TT5A 1NHGA 2GZ1A 4YT2A 1WNTA 4YQYA 3EC7A 2NV6A 3NGXA 2I3AA 4JIGA 3CH6A 2PD3A 3ETGA 3VPHA 3P2YA 4I9UA 4JBIA 3HN7A 3DONA 4IDBA 3K9QO 5COAA 3WOHA 3ZNOA 2I3GA 1U4OA 3JQGA 3C1TA 1CF2O 3ADPA 4RCVA 4KDEA 4QFDA 4ILKA 3ZWAA 4XQCA 2DQ4A 1DRUA 2O2SA 1I32A 4GX0A 3KRTA 4PLFA 1CETA 1LLUA 1P77A 4BO5A 3VH1A 4ZHSA 3HDYA 1OFGA 2HK7A 1E6UA 1N8KA 3I9JA 1O94A 2WD8A 3JQCA 3ZWMA 4K1LA 1ZMTA 3E48A 3LT1A 5THKA 1I3NA 2CF6A 4NJMB 4YJHA 1C1DB 1TB4A 4LVCA 3RUFA 4JK3A 3H4VA 3HJAA 4M1QA 5C37A 1LTHR 3TFQA 1C1XB 1Y9AA 4MKZA 3WGZA 4CMEA 4O6VA 2YUTA 2Q50A 4XX0A 1NVTA 2NTVA 2HUNA 3D4PA 3FF4A 4NK5A 2HMTA 3IP3A 2AXQA 2E6UX 1NWCA 3INTA 5HA5A 4RPHA 5JDCA 3I4FA 4GBJA 2EEZA 2P9CA 1YB1A 3GG2A 3E5MA 2QQ5A 3C8MA 3ZWXA 2OL4A 3BMQA 5AXBA 1EDZA 3LLSA 3MJEA 3EDMA 4U5QA 9LDBA 4HX5A 5KVVA 4IDCA 1BW9B 4JJGA 1QYDA 1V3VA 2IODA 5T6BA 1SEVA 1R15A 1DBVO 3D3WB 1BXGB 4BL5A 2BMAA 2NADA 5LCXA 3OJFA 4XYLA 3IL2A 4FJ1A 3DZGA 1S6YA 1ZFNA 4GVXA 2HSDA 3MOIA 5IZCA 3JYPA 4XQGA 2GUGA 2O4CA 3RUEA 5T67A 3X2EA 1YONA 4MVJD 2H63A 1F12A 1DAOA 2BRUA 1NAHA 1IY8A 4E30A 4OXYA 4YJGB 4NJOA 1U1IA 1ENYA 4TVOA 3OQBA 2FY8A 3QW2A 4Z3DA 1YOVA 5A03A 1NVMB 3SJUA 4E6PA 2XF8A 3RJ9A 1DB3A 3GN2A 3SC4A 3CSDA 3TZ6A 3PJEA 3VH3A 4U8GA 2EXXA 2HO5A 1I24A 4WJZA 1KETA 3GEGA 3QWFA 2Z5LA 2EW2A 4U0JA 1PS8A 2P9GA 5T5QA 3NYWA 4XD2A 4WLVA 4B8ZA 3H9UA 5T57A 3UFXA 2O3SA 4H15A 5EPOA 2VUSA 1BMDA 4BNJA 4J9UE 4QECA 3WLEA 1Y81A 3BMNB 2ZB7A 3G1UA 3ZHZA 2HJRA 4RLSA 4WEQA 1T2AA 1G0NA 2X8LA 3ZV4A 2Y1FA 1YWGO 4CM8A 3OEYA 2D5CA 1WLYA 1VJ1A 2YYYA 4A03A 3PHJA 4R4JA 5JYDA 1DO8A 4FR5A 3CPSA 2VZ9A 2DPGA 4RL6A 4PLHA 3OBBA 4L9RA 4RPJA 1SMKA 1LSSA 4IBOA 3ZW9A 4FFLA 3QVTA 4C4OA 1Q1NA 2OXIA 4DRYA 4KMSA 5IXSA 1VSVA 2QX7A 3U4IA 3RD5A 1ZBQA 3QWHA 3GMSA 3INRA 3D64A 1IL0A 1ZSYA 4J7UA 3HWRA 3GVXA 3I23A 5GY7A 3W8EA 4IZIA 1PQUA 1MUUA 5G0UA 2Q99A 3UF0A 3FPLA 5L53A 2X5OA 1JKFA 5CHEA 4FOSA 1LX6A 4IUYA 3TDKA 4ZA2A 5KJEA 4ZQEA 2P5UA 3JQDA 5K9ZA 2RIRA 1HXHA 3UOGA 2WYVA 3MCVA 4OKIA 1HE3A 4CUZA 4HWKA 1O89A 1PJ2A 2O48X 4E5KA 4Q3AA 4CLHA 1YQGA 1ENOA 3WTBA 4CL8A 4HFRA 1M2WA 1PGQA 1O0SA 4BO8A 2VNAA 3F9IA 1Z7EA 3GHYA 5IN5A 3QVSA 3AFNA 1DFGA 3BTOA 1NR1A 1E7YA 5TS3A 4D3FA 4NQZA 1AUPA 1PTJA 1HDYA 2B4TO 4DREA 4YAJA 2NM0A 3E9MA 4EEZA 1BRMA 5I9NA 2VYNA 3LF1A 4GX1A 3RBVA 2YFHA 1EQUA 3DWFA 1W4ZA 4O59O 3MJSA 1K5HA 2XPCA 3TOZA 1YRLA 1X7HA 4GGPA 3WQRA 2JD2A 4IJKA 3VZPA 4YA6A 1PZHA 2WD7B 4HNGA 5DCUA 5B37A 2VHVA 4CM4A 3W8FA 3R1IA 3ZWVA 2NU8A 4IS3A 3VHRA 3RC1A 4MKXA 4IQGA 3AJRA 3DFZA 3ZWBA 4IZHA 4WECA 1YBVA 4GAEA 5A04A 1LI4A 2PR2A 4F45A 1ULUA 4P4GA 1GYRA 1X7DA 4M54A 3C1AA 1G1AA 5JE8A 3SBOA 2XAAA 4BV9A 1J0XO 1YS4A 1ISHA 3VTFA 3TN7A 2WEKA 1DXYA 1WW8A 1SCUA 3NDRA 1ONOA 4FS3A 2OBNA 3RJ5A 4EJ6A 2X0IA 4D0RA 3PJGA 4XIYA 1WDLA 2J3IA 1GCUA 4A5OA 5EMHA 1E5QA 3G0OA 2JCXA 1U3TA 1DRWA 1LSOA 1QR6A 3GVPA 1AXGA 1JLLA 1QYWA 4ND5A 4UUOA 1NFFA 2WSBA 3JQ9C 1BSVA 1ZK3A 4NR0A 1E3JA 3WYBA 1O6ZA 2GN9A 4Z0TA 2X58A 4IGEA 4XR4A 4Z3KA 2E82A 4XDYA 4DTIA 2Q1UA 3GAFA 5TSDA 3DBLB 4RZIA 1LRJA 2VTDA 3RFVA 4J1SA 3GPIA 1ADCA 3IUSA 5COBA 1UAYA 3I52A 3KV3O 3DTYA 4PIVA 1T1RA 1E5LA 2QRJA 1LXCA 4FQ8A 5GZ1A 5BR7A 2EGHA 3LT2A 4ND3A 4PZEA 4W9NA 4O63O 1KS9A 3CMMA 3RUCA 2AG5A 3OF2A 3RUIA 3S2IA 4FC7A 1EFLA 1ID1A 4WNIA 1N1GA 3ZCXA 3DBRB 3WFJA 1U3UA 4FDAA 3BMCB 1XGKA 4K6FA 4OKNA 1M6HA 4BKUA 1A9YA 2VCYA 2EJWA 2PGLA 3HDJA 3LK7A 2BGMA 4L76A 4URFA 1B15A 1LUAA 4CQMB 1V6AA 4DMLA 7MDHA 5IXYA 5KVQA 1U3VA 3I3OA 2GN6A 2D8AA 2O23A 2ZTLA 2Q2WA 1A27A 1GYQA 2JHFA 3G3EA 5HM8A 4OOFA 1QG6A 5JCJD 1XELA 4QUKA 3AI3A 3L07A 1IYZA 4KUHA 4QO7A 1TT7A 4NBWA 5KKAA 4GKVA 3OH8A 3D3EA 4JN6B 4FCCA 3WIDA 1R0SA 4ITUA 4WLUA 5JAZA 1LQUA 2ZJ0A 3K6JA 4L4RA 4UUMA 1Z75A 1WVGA 4YT4A 1E6EA 3QVOA 1EBUA 1E3WB 1KIFA 4OJNA 3U9LA 1N1EA 3D7LA 3JQAD 1BWSA 4J7XA 3ONDA 1H6CA 4UVIA 3WGOA 1C14A 2C82A 3D0OA 2VTEA 4G81A 4MIOA 2C07A 1DIAA 5F1OA 1MG0A 3I9NA 1MG5A 4BO1A 1PJ4A 4DXHA 3QIVA 4UULA 3F4BA 1XDWA 1B14A 3ICPA 3KETA 1NYTA 1I36A 3CZRA 2PK3A 4NG5A 5L4NA 2GLXA 3PYMA 3O4RA 2V65A 2I5PO 3AM4A 4CJXA 1D7OA 1R4MB 1LSJA 4M89A 1KVQA 4KQXA 4XYGA 4CQLB 1YVEI 4NBRA 2A35A 3UKOA 1R12A 2DBQA 4RORA 4M86A 4DYVA 2I66A 3RUDA 3F5SA 1FDUA 1YDEA 3PP8A 3MJCA 1HEUA 4A73A 5A3JA 4J91A 3S2FA 5JC1A 4AJIA 1TI7A 3GVCA 5T8KA 3U49A 3HQ4O 3ZV6A 1X0VA 3QY9A 3PWKA 4ESOA 4TRJA 2GR9A 3DQPA 4ND2A 2W8ZA 4YXFA 3DC2A 3WMXA 1QORA 3GR6A 1AE1A 1KY5A 2C7VA 1X1EA 2HJSA 4AJHA 3D4OA 1QXSA 4DLLA 4M87A 2VYND 4P8RA 3V8BA 4CV1A 1B16A 3H6KA 3K2EA 3WS7A 2O3QA 2F00A 4HV4A 4TRNA 2EKQA 1EBFA 3KLPX 4O1MA 1Q0HA 3OSUA 4DA9A 4M55A 5JDIA 1XU7A 4ZRNA 5CDGA 4ALIA 2G5CA 4WCFA 2JAPA 3P2OA 4U6QA 2VRBA 4IS2A 2X0JA 2JKVA 2O50A 4BGIA 4E32A 2GZ3A 1BVRA 3DBRA 4CMEC 4ZGWA 1WXDA 3GT0A 4UVGA 2DTXA 2HK8A 4RQUA 4J43A 3BMCA 3K8ZA 4TRRA 5G0WA 2JHGA 3R0IA 4PVDA 3RFXA 4EUEA 2GN8A 2IE0A 5HS6A 4WASA 4LMRA 1NNUA 1FJHA 3O03A 3JQFC 1P0CA 2YW9A 1I8TA 1SAYA 1P3DA 1D3AA 2Y1DA 4Z9XA 3W6ZA 5TNXA 2WDZA 5THQA 1NAIA 2ZQZA 1UAGA 3QLJA 4MVJI 2W2KB 1DIRA 1MLDA 1YQXA 4GX2A 2G17A 1YKFA 4D0SA 3ETEA 2BH9A 2OBYA 3OQ6A 2VN8A 3A4VA 3JQFA 3I9LA 4J9VA 3ORFA 4YJDA 4CMCA 5BT9A 2RHCA 3Q11A 4CLXA 1ADBA 2X9NA 1UJMA 3S2EA 5DN9A 3NUGA 4PRLA 1U28A 3X2FA 1RM0A 2FPIA 4RPLA 2J5KA 2QIOA 2B35A 3IIEA 1A7AA 5K6AA 4D41A 4D3SA 1NPTO 3L6OO 5BSFA 3QJ5A 5F5LA 4CM5A 2A4KA 2YHIB 4YJHB 3ZV3A 4BB6A 1DRVA 2RCYA 3ONFA 3PZBA 4Q3BA 4MVJF 3BXXA 4WCDA 1E7QA 3HDHA 1L7EA 4INAA 4U7WA 4XR9A 1FDTA 3P19A 1UXKA 1YQDA 3GFGA 4MIEA 5GZ6A 5JAQA 3SLGA 1R4MA 1UUFA 1HLPA 1M6WA 3PEFA 3KOUA 4BO9A 1VI2A 5IZ4A 4PG6A 2X0NA 1W73A 1N5DA 1LSUA 2OFPA 1NTOA 3BMQB 1K2WA 3MEQA 4CR7A 4IDGA 3C24A 5L95A 5BNIA 3BHMA 4ZD6A 4BNUA 5BSGA 3DMTC 3UXYA 4BNNA 3GEDA 2OUIA 2Z1MA 4UEKA 4CM9A 1JQBA 5COQA 4YT8A 1DHRA 4BGEA 3ZWPA 2Y1EA 3FTPA 3PIDA 1HDZA 3NDJA 1LRKA 5I7SA 3DZHA 4AJOA 4CLOA 2DPHA 1V3TA 5JW6A 5KVSA 3HFSA 4XGKA 5KJFA 4B8WA 2B36A 1ZKMA 1SEPA 1E3WA 3FD8A 3OFSA 3OM9A 4IPTA 3OHSX 3KSDO 1FDWA 4NU6A 2CDCA 3UW3A 2FPPA 4G65A 3FPCA 4G2NA 3GNTA 4RDIA 1XKQA 1U8FO 6ADHA 1X1TA 4BO6A 4YAEA 5JPIA 3LC1O 1PIWA 4LN1A 3GFBA 4HXYA 2CDAA 1MA0A 3D4NA 2QYSA 1CYDA 3EGOA 1PJSA 4RGBA 3KXDA 2ZTVA 3MZ0A 4ZQBA 2O7SA 1EK6A 4R5MA 4EITA 2HRBA 1C0LA 4FGSA 4I08A 3JQ6A 2Y0CA 3JYNA 3WNVA 1PS9A 2DKNA 2EIHA 2FHSA 4JX8A 1ONNA 1GADO 2YDXA 3BMNA 2ZB4A 3BHJA 4PCVA 1QYXA 4WCFC 4ALLA 4YBZA 4JLWA 2LDXA 3OA0A 2IZZA 3LLVA 5A9RA 1ZK4A 4B7UA 1DIGA 1XG5A 4YACA 5T64A 4L0QA 2G0TA 1XLTA 3GN1A 4IQ8A 5ER9A 1UXGA 3AI2A 4FD3A 2YQ5A 3FSRA 4OOEA 4YR9A 2BF7A 5HWSA 2Y93A 3GG9A 3PQDA 1S7CA 2SCUA 3AUSA 3BHIA 3LDHA 3R3SA 1ZVMA 3H65A 2J3KA 3SX2A 3BMOA 3JD4A 4XGNA 2PLAA 2GPTA 3N74A 4GGOA 4NBTA 4K9DA 5C5IA 4PGFA 5BNTA 1UR5A 3H5AA 2DU8A 3FR8A 1PJ3A 3LZ6A 4GMGA 1HDGO 3NV9A 3OICA 3PVZA 3SC6A 3BA1A 3H9QA 1FXSA 3H7AA 1GZ3A 3RKUA 3WSWA 1Z6ZA 2AQKA 1WAMA 2X9GA 3PZRA 4PLYA 1YBMA 4W99A 3TZHA 1NPYA 1ZEJA 1AHIA 3HFGA 1EVJA 2NSDA 1CEQA 5ADHA 3HNPA 3KYBA 4R69A 3L4BA 3GZ4A 5CEEA 1J5PA 1DSSG 3GVHA 2AQ8A 3B1FA 1EVIA 2IRWA 3MTGA 1K3TA 4E5PA 1LDEA 1EK5A 1Z73A 2D59A 3KEQA 1OBFO 3BTVA 3DB2A 1JAXA 2O3UA 5MDHA 4DLBA 4J3FA 1KYQA 4J4BA 4PLPA 3LVFO 1N7HA 4YPOA 4GVLA 2YDYA 2GGSA 3FNEA 1H6DA 4DIFA 3AW9A 2BKAA 3PYLA 3ZWNA 4AJ4A 3OIGA 4HUJA 5AYVA 3C85A 1LLCA 2OZPA 3F46A 2H5LA 1PX0A 4NZ9A 5LDGA 3JQ8A 3Q9UA 2NTNA 3F1KA 1R16A 3NGLA 4MPDA 2P5YA 3GDFA 1P1HA 3PYXA 2GNAA 3K73O 4FB5A 5HRUA 5G4KA 1ZW1A 3D1LA 4YJFA 1QMGA 5ILOA 3CZMA 4U0KA 3EAGA 1GAEO 3EY4A 4PLTA 4AJNA 5A3VA 2PTGA 4WNCA 3FTNA 4RDHA 3I9MA 5JS6A 1PZEA 2RHRA 4Y9DA 3L4SO 1PQWA 3UCEA 3O38A 1V35A 2NQTA 2E4AA 2CZCA 2FPGA 4IDDA 3VKUA 4GPD1 5JXWA 1BDMA 1I5RA 1D1SA 2Q3EA 2OMEA 4QSMA 3V1TC 3IQDB 4CLEA 3ICCA 2EP7A 4NI5A 3WDSA 2BFMA 5TT0A 3TOXA 5A1TA 3C1OA 1SB9A 1N9GB 3GLQA 2X5JO 4QQRA 2UVDA 1JKJA 3SJ7A 1ENZA 3PRJA 3QE3A 5F21A 4P22A 3RU9A 1PL8A 3JV7A 3ANNA 1T26A 5F1KA 1JKIA 4CLRA 2IYPA 4OQYA 4JROA 4E2YA 2OGUA 1MXHA 2Q49A 2VRCD 3GUYA 3INGA 4W82A 3PJFA 1E3EA 1KC3A 1XQ6A 4RVUA 2IDZA 4GH5A 3OEWA 3WLFA 1K6XA 2YZ7A 2GCGA 4R9SA 3ULKA 4O0LA 1K6JA 4BB5A 1PS0A 4ALNA 1PJCA 4E5NA 3HHPA 2C2YA 3B6ZA 1BG6A 4PLZA 2NACA 3KB6A 3PWSA 2BGKA 3ZNNA 3KVOA 4MJLA 5TT1A 3I5MA 2CNBA 3O8QA 5I8WA 4XJTA 3DEYX 2W98A 1DFHA 4PVCA 1WZIA 1XQ1A 4NIMA 4ROSA 1P1FA 3ANLA 3WQSB 4E5YA 4DWVA 4FFOA 1MFZA 2P9EA 3GPDG 3VVCA 1LA2A 4KUEA 3Q1LA 3C7AA 4GL4A 1PU2A 3DBVO 3GUCA 3IKVA 1WMAA 2D5AA 3H9JA 1WWKA 4CR8A 3QQPA 1X14A 2AEFA 1X15A 1Y8QA 4J4HA 4LW8A 1QSGA 1A7KA 2QRLA 2NU7A 3CINA 2NLOA 4E31A 5ILGA 1IOLA 4M49A 1IPEA 4YDRA 1VM6A 3E8XA 1VL6A 3BYZA 3WQQA 4BO2A 4F6LA 1X13A 3JTMA 1V8BA 4YRDA 3U4CA 1E7RA 2JFFA 4CV2A 4CMJA 2CMDA 4PRKA 2AQHA 1QLHA 4DVJA 5ICSA 2C5EA 3OIFA 4L4XA 2B83A 3RC7A 1PGJA 4L4SA 4CQMD 1B8PA 4CV0A 3SVTA 2B5WA 3EVTA 2E49A 1JU9A 4BNFA 3H3FA 4F6CA 2EKLA 3G17A 4W7HA 4I1IA 3L9XA 4R5HA 3WGIA 5DDIP 2DAPA 1EQ2A 4C7JA 5FF9A 3EVNA 1FDVA 4TKLA 3PHHA 4EI2A 5B4TA 5KOIA 3IS3A 5FFFA 4WK6A 5JSFA 1A9ZA 4RVSA 5A9SA 2Q4EA 3BIOA 1EVZA 1EMDA 1CDOA 4D44A 7ADHA 1HE4A 1ISIA 2LDBA 2ZCUA 4PG7A 4BMVA 5JFOA 4B7CA 1OOEA 4D3DA 5EJ2A 4DQXA 2V6BA 1DIHA 3F3SA 4CMKA 1GU7A 5IG2A 4IQ0A 1R4NB 5ER6A 5CDTA 1IE3A 2PZLA 4QEDA 4DBZA 5JCXA 1MGOA 4BNKA 3CMCO 1QRRA 3FR7A 4YRAA 4Q3EA 4BKPA 3JQAA 1HSOA 2IEBA 1JTVA 4FIZA 3SXPA 4DYDA 3NDIA 1MX3A 4XJSA 2E37A 1CQIA 1ZK2A 1Z82A 2FSVA 3JD0A 3KLMX 3UH1A 4PG5A 3IMFA 4CODB 2OO5A 3LT4A 3O8QB 1ZZEA 1Q2XA 3ROMA 2TMDA 4XEHA 2ZATA 3DDNA 5I7FA 2YFQA 4FW8A 4JQCA 4JJFA 1GZ6A 3ITKA 3L77A 8ADHA 2DBRA 1DJQA 3QHAA 1P44A 3RUHA 1Q7GA 2GYYA 2NTJA 3ZH2A 3ZU4A 3IJPA 1J49A 3ZN2A 3KYCB 4NMHA 4ZJUA 5TX7A 4R1SA 2AW5A 2ZK7A 3OP4A 4DC0A 5ENDA 1B2LA 5A05A 5CFZA 3G49A 3VTZA 1DFIA 3KSZO 5G0TA 3PQEA 1T4BA 3V2UA 3RSHA 1EFKA 4YT5A 1DLJA 2CFCA 1U7HA 3FBGA 2GSDA 5DNAA 2RH4A 3ZWYA 3M6IA 4CMGA 4WPGA 3WR5A 1DPGA 4GLLA 3TF5A 1LDBA 2PZKA 3B70A 5AXDA 3UVEA 4OHUA 5H81A 1HTBA 2VOEA 3RU7A 1H6AA 1DDOA 3JQ7A 3RBXA 4MO2A 3HSKA 4GSLA 4EW6A 3PK0A 3JQGB 5K6AC 2W2LD 3ST7A 4Y8VA 3HDQA 4EGFA 3ENNA 1LRLA 2UAGA 4KOAA 2BI8A 1NASA 5C7IO 1UDBA 1H6BA 3DOOA 2HDHA 2I6TA 2HCTA 4ZVVA 5KJCA 3VKVA 3KYDA 5BSEA 3GOHA 4LGVA 3WIEA 3IP1A 3AWDA 1DC6A 1KBZA 1M76A 1QLJA 1T24A 1HT0A 2HMSA 1JWBB 3TNLA 4D7AA 5KWEA 1WZEA 4XQ9A 3KM0A 3QV1A 4MP3A 2JFHA 3GZNB 1JVBA 4XDZA 2FWMX 4PZCA 4TSKA 3PHLA 4JNKA 1BDBA 1R0LA 4KZPA 4OMUA 2VYVA 4B4UA 1ISGA 1SOVA 1JAYA 3K5PA 2R2GA 5TGDA 1MV8A 2PV7A 4EDFA 1UXJA 4B7XA 4YYZA 1UZLA 3FHLA 1ZXBA 4J49A 2EERA 4L73A 4BO7A 2TMGA 4J0EA 5CP8A 2F1KA 3LC2O 3PLRA 2QYTA 5BNFA 3JQBC 4IIUA 2X4GA 2X9VA 2D4AA 1C3VA 1UZMA 3LC7O 4JP2A 4AJPA 3T7EA 2V7PA 4MIYA 2EHDA 3W8DA 1KERA 3FNGA 1VPDA 3H8VA 2YV1A 3M2PA 4BVAA 1BXZA 1HE2A 2PKQP 2OP0A 1HL3A 3GA0A 2B4QA 3FI9A 3OMLA 4AFNA 1H9BA 4IJVA 2P4QA 3DZFA 1KEVA 2PNFA 4CM9D 4DMMA 5IZCC 3NTRA 2EP5A 1DIBA 4NPCA 4Y67A 2Z95A 2IXBA 3ZWWA 2JJYA 4P4LA 3ZGYA 5GZ3A 5TF4A 1OC2A 2Q4BA 4RJTA 4GX5A 1GUZA 1Y5RA 3W4KA 4IXTA 2Z1NA 3M1AA 2WD7A 4XA8A 2CVQA 4DQVA 4F46A 3KYCA 4A0SA 5DCWA 3E9QA 3RI3A 4NBUA 5C7LO 4BMNA 2I99A 2VHWA 2R6JA 3KTDA 1H94A 4Z0HO 5ENVA 2EJVA 1B8VA 4FBGA 1EUZA 1E1KA 1ZEMA 3PDJA 2O3RA 5CDSA 1YDWA 4CMHA 5JCJA 1B7GO 3U4DA 1ADGA 1HZJA 3PFWO 2FN7A 1ZO8A 1SOWA 1XSEA 3O9ZA 2QRKA 3Q6IA 3DFUA 3NJ4A 1HWYA 3LYLA 1NQ5A 5DOZA 4A26A 5CDUA 2V6GA 2Y05A 1Z7BA 4WOKA 4NFHA 2VOJA 1B26A 3G79A 1NWHA 3DBHA 2AEMA 2X23A 2Q1SA 2JD0A 4LMPA 4G5HA 2DLDA 3DAGA 5FI3A 2XOXA 1DHTA 1JWAB 4IINA 1OZAA 1E1NA 3GNQA 3HB4X 1E3LA 2CSUA 4MKRA 2NQ8A 3TZKA 3VZQA 3PTZA 2FSSA 3DMTA 4E5MA 5U1PA 3ZHXA 2Q2QA 2BGLA 4AJ2A 1EVYA 4YQZA 3LU1A 1WDMA 1PSDA 3AM5A 3GDOA 3ZNQA 5A9TA 2P68A 1D8AA 3RC2A 4NU5A 4BMSA 3NJ8A 3DBLA 5F3RA 4ALKA 5TIIA 1U5CA 3MJ4A 4TQGA 2DFVA 1HKUA 3DZKA 3W1VA 4DPLA 3VZSA 4RPKA 4E13A 1HRDA 2A92A 5TQVA 2RAFA 2FR8A 1KVRA 4OAQA 1GD1O 4N5LA 2E48A 4NH4A 3WGGA 2B5VA 4FJ0A 2ZB3A 4NJMA 4RV9A 4E2WA 5IDYA 2P91A 2VWHA 3VZRA 3QSGA 5I7VA 1Q0LA 1FK8A 4RF5A 1WDKA 1LU9A 3ABIA 3S55A 1LC0A 2HRZA 3PQFA 1RKXA 2AMFA 2X86A 1V3UA 1YXMA 1HE5A 1ZSNA 3GC6A 2VUUA 1MB4A 3GRPA 3JYQA 1ZH8A 3MWEB 4KQWA 1NHWA 4OSPA 1Y8RA 4W6ZA 2WM3A 3EUWA 1ZJZA 4IM7A 2NVWA 4ND4A 4RLHA 2W90A 5ES3A 6LDHA 4Z6KA 4JCOA 2C54A 2VT2A 3RUAA 4A7PA 4EJMA 1U9JA 1T2CA 3I9KA 3RBZA 2QZZA 1VRWA 1NP3A 3K92A 4I5FA 4B4VA 4J6FA 1KEWA 3ZU5A 3K30A 4I9NA 2X0RA 3EZYA 1E7SA 3M1LA 2UV8A 4L74A 2P2SA 3I9OA 1YJQA 4TMFA 2IXAA 4JGBA 2H1SA 1GUFA 4YWJA 3GZNA 4RVGA 3HADA 3VH2A 4AJLA 1U2DA 4HFJA 3V5NA 3U62A 1C0IA 5AXAA 1JVSA 1VSUA 1EUCA 1PR3A 5C7OO 1P9LA 2O3JA 2VZ8A 3F47A 4MVJA 2DC1A 5CG2A 4HKTA 4EEXA 1XIVA 4E3ZA 4DQUA 4NBVA 2BFAA 4IJUA 4BNGA 4EYEA 1YO6A 3A14A 4KP7A 3P7MA 4HBGA 4TWRA 4AG3A 3A06A 2X22A 1N9GA 4XYMA 3GF4A 4FOOA 2DTDA 3WWZA 5DZSA 3IAHA 3U4HA 2D1YA 4GMFA 3WNQA 4BGVA 3VDRA 5T8KC 1KEUA 1NPDA 1LQTA 4BV8A 4XQEA 5JDIC 2Y66A 4KTTE 1N2SA 3Q9NA 4LSMA 5IDWA 3KBOA 4PN3A 1O95A 4RZHA 5B4VA 3FNFA 1Y1PA 3DR3A 4XKJA 3MJVA 3GY0A 5JLAA 3CEAA 1WPQA 1YGYA 4RVDA 3TJRA 4IY1A 2DUUA 4Y6SA 1NXQA 1XEAA 4A10A 2Y99A 3H2SA 2V6FA 1HF3A 3L6EA 1LDNA 1W6UA 2EW8A 2QG4A 1IULA 3RKRA 3PHGA 4XYEA 4PLVA 2VRCA 1P1KA 3CTMA 2PFGA 5L9AA 1K0UA 4OIMA 4KUGA 2PZJA 2Y67A 4BS9A 1F8GA 1GUYA 4GSKA 2UUPA 1YL7A 4MDHA 2BD0A 5L4SA 4BO0A 3MTJA 1P1IA 3Q0EA 1GDHA 3WWYA 4ZQHA 5IDXA 3KEOA 3BMOB 5A02A 1KY4A 9LDTA 1SB8A 2Q45A 1Y8RB 4ZQFA 2YHIA 1LEHA 1P33A 5IF3A 5B4UA 4H7PA 1XU9A 2Y1OA 3E6AA 1PEDA 3TL2A 4CM7A 3N7UA 1U7TA 3A1NA 1NM5A 5CG1A 4WEOA 3VPGA 4YRBA 3I6QA 4Z9FA 1HYHA 4HY3A 4N7RA 4BNVA 4B3JA 4FC6A 1PGNA 4R3NA 4E21A 2DT5A 1I2CA 1O8CA 2IYOA 3E5RA 3ASVA 3JD2A 4IGFA 4J90A 1NQOA 1BW9A 1OAAA 1T4DA 2ET6A 2YY7A 3BTUA 3LF2A 1CWUA 1CQJA 1LLDA 1MP0A 3D3WA 4EBFA 4O5OA 1YE3A 4W7IA 3PGJA 3ZU2A 3WFIA 3VOSA 1T2FA 4J1NA 2YQ4A 4QTZA 2QZ9A 2VWQA 1HDXA 2FR0A 3W4IA 3ZWOA 4AJ1A 3NT4A 1I33A 1UP7A 4YVFA 4BGUA 4CPDA 3UGKA 3C3XA 4AVYA 4HP8A 3HUDA 4L8VA 1U8XX 4HFMA 1Y9EA 3KUXA 2X5KO 1BGVA 5JY6A 2ZJ1A 4YJGA 4YAKA 1NR7A 1PJLA 3P5SA 4NNJA 5JMPA 5U4QA 3EZLA 3RQSA 4LK3A 4ALMA 1PJBA 4JP3A 3ZV5A 4AJKA 3VAZA 1MC5A 1A5ZA 1R4NA 3PLNA 3TZQA 1TA4A 1RM3A 5B12A 4R16A 1LJ8A 5GMOA 3A9WA 4YB8A 3IJRA 4Z9YA 4D43A 3JQ8B 2AG8A 5L3ZA 4CQLA 1A4UA 5L51A 3OECA 3EMKA 2OHXA 4N5NA 1ZNQO 4NFSA 4IMRA 3U09A 2FZWA 2J6IA 1IZ0A 5I8ZA 3RVDA 3DHYA 1V0JA 4D42A 4FJ2A 4TZTA 2VHXA 3WGTA 1F17A 4MVJM 4E12A 3IKTA 3WGYA 5KJ1A 1L1FA 4GQAA 4YEDA 1X0XA 1D4FA 5TJHA 5G2OA 1W8DA 1C0PA 1GQYA 1K89A 3W6UA 4DLAA 3KZVA 3ETDA 4TROA 4H16A 4HADA 1IHYA 3ZWCA 4NFYA 3O26A 1E3SA 5I7EA 2CY0A 4JBGA 4PLCA 1XA0A 5DBFA 3AUAA 1I10A 5FI5A 2ZB8A 4IIVA 1Z74A 4A2CA 2NUAA 4BUCA 3VH4A 4BKRA 1YJ8A 2PY6A 2WYUA 4B3HA 5H83A 1LC3A 5CEFA 3E03A 2JAHA 4PFJA 2WE8A 2HMVA 2J5QA 3K2BA 4LRSB 4ZN6A 1B3BA 1J4AA 1PR9A 1SO8A 4LRTB 3ONEA 2FP4A 2YV2A 4CR6A 3QWAA 1IPFA 2O7QA 3I1JA 3FWZA 4J2HA 3WB9A 4X54A 3I83A 1E92A 5HTOA 1VKOA 3WBFA 2UUOA 1H0KA 1F06A 2FRDA 2Y0EA 1GZ4A 4KTVE 3PJDA 4QO8A 1JA9A 1FMCA 1V9LA 3QWBA 3AFMA 3V1UA 5G0SA 1ISFA 3V1YA 4R54A 4ZQGA 2G1UA 3DO5A 1G6KA 4Q3CA 1RM4A 4J0FA 1LNQA 1UXHA 4RQTA 5A5EA 3CIFA 4KDFA 3ZU3A 2VYVD 1A4IA 1R6DA 1SNYA 4N54A 4CM1A 4OSOA 1B0AA 2C29D 3TPCA 4BOYA 4MOWA 4MVJH 2PH5A 3Q2KA 3NTQA 3S8MA 1N92A 2NNLD 4OO3A 1GY8A 1ADFA 1EE9A 3T4XA 3ZHYA 8LDHA 1PJQA 5TRTA 2BFOA 2CUKA 2PKRA 3QVWA 3MOGA 4J16A 4WLFA 1PL7A 4UUNA 3JYLA 5DCYA 3STHA 1PWXA
chains in the Genus database with same CATH superfamily
4CUKA 4HPXB 3BL8A 3AOEC 3W3AD 1BVUA 1I30A 5L7TA 3UHPA 5JXJA 1Q1AA 1LKZA 1ZCJA 5HCIA 2AYYA 2CVPA 4MI1A 4UPVA 3LTNC 3R7LA 2HLPA 2X6TA 1T15A 4TRMA 1QIDA 3FDZA 1O77A 1BCRB 1PWEA 2XDWA 3KKZA 1UQRA 5TR9A 4DT1A 1JHRA 1JN0A 2PMWB 1ZH6A 2V55B 2OORA 3MJFA 3FPJA 2F9LA 3E1SA 1QCCA 3IAEA 1XCLA 4HAWA 4K6HA 1E79A 1Y3HA 1XXHE 3DDHA 3JQBA 1ZMRA 3MIZA 2YHBA 4HHEA 4M9XA 2XWPA 2JJ1D 2X40A 5CCDA 3K5HA 4C3OB 1QP8A 4NS1A 5CT4A 1Z5WA 4CEJA 3T5DA 1JFTA 2EFCB 3N2LA 2WT9A 3KUKA 1LDYA 3GL9A 5IWCA 1OFIA 3BJEA 4I1SA 5LPNA 4YJFB 1PJRA 2V1XA 2F4NA 2VHYA 4BLSA 4EPXA 5LNK6 2NU6A 4H4CA 4Q3DA 3U6BA 4UTXA 3B12A 3R4CA 4QUDA 2FSFA 1A71A 3K0CA 1PNQA 1IN6A 2IYFA 4AURA 4EJSA 1R9MA 1W0JD 2JGJA 3EIHA 3ODGA 4RLFA 3VSDA 1PDOA 3HR4A 3B6KA 1RQLA 3ENQA 4IF6A 1APBA 2B7LA 3K0BA 2PJUA 3VOTA 4QX6A 4JLDA 4TT3A 3TTWA 4W9NC 2A9PA 2FPPB 3F7MA 2X41A 4BNWA 3EA4A 1U4NA 3W2HA 1AO0A 3DO6A 3WWPA 3HBNA 2WWFA 3MJTA 3IE0A 3IIMA 1H2BA 3LBNA 4BLVA 1J20A 2A1TS 1PO7A 4JI5B 2PMFA 4Y98A 3QNWA 2A7XA 5K2OA 3HG7A 3PHIA 1JG4A 2BGRA 3I4CA 5EIHA 1XLWA 1RAHA 4FFDA 4MLCA 5BMVA 1XTTA 2ZRAA 1Y5LA 5DTMA 2I2WA 4BTLA 3Q3JB 3TGPA 1VC2A 4RZ3A 2CN1A 4X63A 4ZU3A 1P45A 4DIEA 2NZUG 1C7QA 4QUGA 2EFJA 1KH2A 3P0RA 3AVTA 4I2NA 4YCAA 4G9BA 3IAXA 1E1YA 2OBFA 3FWPA 1BD3A 1M7BA 2FPRA 3D5TA 2JHPA 4XLZA 3DDUA 4IWXA 4IO1A 2R8PA 1Z7YA 3K1ZA 1BWRA 2ANCA 3DMYA 1AS2A 1XYGA 1VL0A 3NS7A 4NZOA 4ZC8A 3RREA 5GIPE 3SEFA 5GADl 4FKMA 4TXMA 1SBNE 1KJIA 4Q1CA 4P4NA 2O8CA 4GEKA 2XA2A 1NXWA 3UUWA 4C78A 3NHLA 2FSGA 4HAOA 4P38A 5EIOA 3UMFA 4DZRA 4UMEA 2PD6A 3ER9A 2FFJA 4HQOA 4WFJA 3PHBE 3UCXA 5EPEA 1K5GA 3IT1A 4Y2UA 3NR2A 2XKKA 3AR3A 3L9WA 4FKBA 2H7YA 1DBQA 3GRYA 2FR1A 3F96A 3EK2A 3KKLA 3SQMA 3SZLA 4A36A 1E1MA 2DF8A 2VFAA 2FK7A 4QLBA 1NATA 1JG3A 3FMIA 3IEPA 3IPLA 4MITA 1YB5A 3VAYA 1LW6E 5GV8A 4FFMA 2WNIA 3ZHUA 3OCJA 2GKSA 1CSEE 2Y92A 4GXRA 2VQSA 3AX6A 1QWOA 1Z13A 3UEOA 4AL4A 1JIIA 3DBHB 1N0IA 5I7AA 5L3SB 2YZKA 1HNNA 1M66A 2B99A 5JT1A 4LQCA 5HUHA 1FCJA 2AE2A 3EVAA 4P3PA 1NQVA 2HIMA 4HAZA 5I9IA 4MMZB 4F60A 3VO9A 2FI1A 2J30A 2FMXA 4Q4HB 4AJJA 3ROPA 1JQKA 2N75A 4MKGA 2E6KA 1EE2A 1OCEA 2ATIA 3E9ZA 3EBLA 4MEAA 3SBEA 1Y63A 3FVRA 3QE4A 4EUSA 1JIKA 4QUIA 1L6RA 5JR3A 5AESA 1TZJA 2GRAA 3N58A 2CW5A 4G5GA 2FEOA 3H5IA 3RV3A 3TQFA 3ZNPA 3CUKA 1GFSA 3L6DA 1PT7A 4R1TA 4JUAA 4UVHA 1YR2A 2AD1A 2JC3A 2P5TB 3CRW1 3IESA 2YOHA 3H17A 2P1DA 1XK6A 1US8B 5C4GB 2PUJA 1E2GA 4BEBA 4ZEVA 3ZGVA 2ZUUA 4TYNA 1IZ9A 3ZW7A 1YS2X 3C15C 3O1LA 3QUCA 2NXNA 4XVHA 1IG0A 2GAJA 4B4DA 3IDSA 2EZTA 3WY9A 4B6PA 3ZHSA 2EFHB 1D2CA 1O6GA 1T0HB 2L19A 1QV7A 1EXMA 1WUKS 3AESB 3HCDA 1JPUA 1MC4A 2YIVX 3GJ7A 4DBVO 4LKRA 4DJTA 3TSCA 1OLSA 1PFUA 4IXDA 4R3WA 1SPXA 2OXCA 4U9IS 4H7FA 4MV6A 3RRMA 1QP4A 1BX3A 2AK2A 4ID9A 2K7FA 3R0XA 2VQDA 5KYVA 5EHZA 5IJZA 3I04A 3RF7A 3QV2A 4CF3A 4YT8A 4Q39A 4BVKA 1EFVA 1X1CA 4MVJG 4C07A 1UAAA 1QTQA 3IHKA 2H16A 1W36C 3NT2A 3FIUA 4CHGA 1U65A 2O3TA 1V7PC 3C6BA 3ZZTA 5JV5A 1LBHA 1VCMA 2QTFA 2G8NA 2ODQA 3I42A 4TTSA 3E0XA 3TTSA 4OX9B 1I0ZA 3DAPA 3KKKA 1UDCA 4C2AA 1A8IA 3M6MD 5CVDA 5FT9A 5G1PA 3ZXIA 4C0AC 2OPBA 3OJOA 3L8CA 2DWCA 2PU7A 4HBZA 3TQIA 4S12A 3GMDA 3O92A 5IKMA 1AHPA 3JATB 4II2A 3DL2A 4ZRMA 2VSQA 3NANA 3SCZA 3C7KA 2VH2A 1TAGA 1CIJA 2CV0A 3OJLA 2CHGA 2GD1O 4OL9A 1D6MA 2I76A 3NC4A 1O8BA 4DSAA 1R4ZA 3LUBA 4P7JA 3WXBA 4MKHA 2WV7A 2Z9BA 3M6UA 3V8EA 3VR6A 1GQQA 4X85A 4ZYWA 2QW8A 3ZZNA 1K68A 1OBHA 1CPYA 5CD9A 2V54A 4BNIA 1QR2A 3FGPA 2BUAA 1VLMA 4MGHA 1WUJS 1K98A 2OOSA 2H1WA 4NF2A 2AKEA 3O83A 5JPDA 3C3BA 4Z1MD 3C3YA 4QREA 1VL1A 3QE2A 4MMXB 4R41A 3CE6A 3LCVB 3RWBA 3F6BX 1GGHA 1Z33A 3C5CA 2GBFA 4L5YA 3KD3A 4TZ6A 5GWXA 3SLKA 2ZI6A 4DKJA 1OZGA 4AIRA 1ES9A 4CL3A 5K3EA 3RAFC 2AT1A 1CQXA 3OVMA 1YB4A 3WIVA 2W9XA 2X42A 3I9V6 1RADA 4B17A 4G0PA 1TVKB 1ST3A 1Z0AA 3KHUA 1XX6A 2CMGA 2IHTA 5SY4A 3LZDA 3S2GA 3SX4A 4CLRB 4ZOEA 3OQOA 1YL6A 4FDTA 2Z83A 2VH5R 2I9PA 4MGIR 2G08A 3DZJA 3MGBA 2GA9A 4GLBA 5AVZA 2WG1A 5ECDA 4X44A 4RF4A 3O8CA 2D2IA 3P9QA 2HWUA 4RK0A 1KH3A 3GJTA 1E1RA 1HRKA 1SN7A 2AA3A 2AUTA 2YV4A 4U5XA 3MAAC 3WTCA 5JWHA 2B9VA 4IXWA 4P7FA 3KALA 3HXOA 4R1MA 4U7DA 1XAJA 1R3UA 3TXXA 1NV8A 4HDNB 3PRYA 1MZPA 4ZU1X 3LQYA 1M9NA 3MAGA 5TVKA 3J80A 1FFCA 1GPJA 3OG9A 4PICA 3VPSA 4AICA 1F0PA 2ZIXB 1PWHA 2H0QA 4KRFA 3L6RA 2GTPA 4IIJB 2J6HA 2RBGA 2A33A 3A1SA 1CUDA 3C43A 4UMVA 3V2GA 3DWGA 2JFGA 4RVHA 1GTRA 5AVUA 1NMSA 2ISSD 1OT3A 1HLDA 1O5IA 4CMIA 2JBWA 2BISA 4G5YA 4E0BA 1KR5A 4TMXA 2VBCA 2AV6A 3IVAA 1G3UA 4ZO4A 3RRJA 1XP5A 1D2AA 1XRQA 1FE8A 1AG9A 1RIIA 2AN9A 3HBLA 4Q3NA 2QU7A 3WYFA 2Q5JA 1MA3A 1Y8QB 1C9MA 2X5XA 3BRSA 2VJPA 2C4HA 4BAZA 4DLTA 2Q0HA 4NBKA 4EEKA 2C8VA 3LFUA 4M83A 1WKCA 4A8JB 1FNCA 2WHEA 3JQ7B 5C3MA 3B1WA 2PUEA 3TTXA 2VF4X 2KPOA 4Q7MB 3WB2A 1G16A 2NU9A 3FXAA 3FWNA 4XIJA 1LBEA 2Q2VA 1ZL0A 1T9ZA 2PGAA 2PLWA 1YH3A 4J8PA 5CT5A 4OX9Y 2J9FB 3KJXA 3SIXA 2O2YA 3D0KA 2TS1A 1ZUD1 3BWEA 3WI7A 3C3EA 4IVNA 4QOIA 3RIHA 4EMBA 3IUPA 2PPVA 1L4UA 2IKQA 3D7NA 2ZKLA 3FN4A 3AL3A 4RIHA 3SYMA 2WLSA 2WSMA 2EG9A 2JLSA 3FWHA 3T15A 3UAVA 4IEFB 4A6EA 4EI8A 1BFDA 3M2TA 1MVNA 4ERXA 4UAGA 5CLHA 4B7AA 4LZOA 3HH8A 3QUAA 2ERYA 5FOVA 4XB2A 4Q9IA 3SSMA 3KDPA 1EUDA 2QT9A 4HNUA 4YQZA 1UT5A 3I09A 4OM8A 2VUTA 2Z2ZA 1DKPA 5A4KA 3FIJA 2GKOA 1VE9A 1Y3CE 3LDFA 3OZFA 4HDQB 4MDFA 3EH2A 1W8IA 3ZE9A 3SYLA 1W48A 4FSHA 4BBPA 3B3JA 2HF9A 3GZTB 2B8TA 2PWPA 3BXGA 3NH6A 5L7WA 1ZL2A 2XMQA 1OX6A 5M29A 5DTIA 3LP6A 2QVCA 1UP4A 2FW7A 1H9AA 1NX6A 5IC5A 1NLYA 1GL3A 2IXDA 3FGZA 4WZAA 3U0VA 3LJKA 1JALA 3WMWA 5TC4A 1IJBA 4TMZA 3G9ZA 1O7JA 3HPQA 4LF9B 5JD5A 4WLEA 4CCSA 1EUCB 1K7FB 1XJCA 1GA4A 2P4HX 4XX1A 4JJ8A 1WU8A 4OI4A 2VBIA 2M1ZA 5IVKA 3E9EA 4NZPA 5CNKA 3ZWQA 4Q82A 3AY3A 3ZHBA 1K27A 1R66A 5DGTA 5K0ZA 3DXFA 4YV7A 3QVLA 4L57A 1QQTA 4WXMA 1CR1A 5JWOA 4HUQA 1W36D 1EVKA 2A1UB 3TBFA 3TOVA 4LF7B 1UPAA 2YWRA 4B3IA 4N3CA 1NVFA 2BWJA 2C7GA 4BCCA 1Y33E 2AZXA 2HSEA 4DEXA 3RSZA 4DGSA 3WJAA 4CKWB 3RAPR 3E18A 4QXQA 2B6NA 3H0EA 3M6VA 3C4QA 3UJ7A 3ZHQA 3U4QA 4DNOA 3TLXA 5IN4A 2L2QA 2P3QA 2RH8A 3KQTA 3I1FA 4RVFA 1NLUA 3SEAA 1L5NA 2NVUB 2O57A 3Q6NA 2PCJA 3CA8A 3B85A 1KKLA 3QBEA 1UWKA 4P6VF 4BKOA 4DR6B 2MSEB 3DE1X 3L4BC 3LUPA 1I0IA 2DTEA 4MVYA 5SV2A 3LWNA 1Q3HA 3E9NA 4N7MA 4FYHA 2ERCA 1U0EA 4EZBA 2DPLA 3BS4A 4MCHA 3ANXA 5DK4A 3OT1A 5E6RA 3THOA 2AH5A 1NF3A 4CQMA 4Z4CA 3GEMA 4KLZA 2X1HA 4RV4A 4X65B 2W6MA 4WIAA 2B1QA 2XODA 4I9HA 3PUKA 4BNXA 3DSRA 1CVLA 1OYWA 1WD7A 4EW3A 4LJAA 1D1QA 3OLQA 4GWKA 4QT0A 4M7RA 3QNUA 2OMKA 3JQEA 4Y6PA 3STWA 4LGYA 4W5WA 4ACBA 4ZHQA 4JWTA 4Q9KA 3ZPXA 2HPHA 3F6YA 2JGIA 4G0QA 1NLFA 4PR3A 4YRQA 1KY2A 2HMUA 2P90A 3F1LA 5KIAA 2J9GA 1KRWA 2BZ1A 2O4UX 2UKDA 2W6CX 4IUCS 2HK9A 4PLWA 2G77B 2XUQA 3WMRA 4A27A 3P2MA 1CNMA 4Q01A 3G1TA 3PDIA 3ZZUA 4BJHB 4I1VA 1XD2A 4NCNA 1PGOA 2GO7A 4HDNA 2VATA 1N1DA 1ZJYA 3ZIUA 1QAMA 2JH3A 5JMWA 1A95A 5KKNB 1HT2E 2A57A 3BK2A 4MPTA 4NZMA 5D01A 3TLJA 5JY1A 1JJAA 2W11A 1YAJA 4PHFA 5J23A 3HUTA 3ICEA 3WAKA 1WVIA 5FLEX 3HCEA 4OQEA 1YACA 1QMPA 4LXUA 1ZYUA 5DYNA 3L05A 4KQ1A 2FDCA 1YAHA 1XZDA 4GR9A 1TXGA 4JYZA 3CKYA 3N6VA 3FPBA 3WP0A 1T9CA 2IYVA 4M2LA 1D0VA 3ZQJA 5HF8A 1GR0A 5LDDC 3AHCA 2X0KA 1OFVA 2VPTA 2ZJ5A 1UFVA 4XFDA 4CLOB 3H1GA 2OHFA 3NKVA 5FH9A 2H17A 3PNPA 4BNDA 5BV0A 3ZJVA 3LQQA 3KOYA 2OP1A 1C3EA 3OWOA 4COKA 4RS3A 2I78A 3A9SA 3IUNA 1NXVA 4LF6B 3AEKA 2QTRA 4S1NA 3ITDA 1OYOA 3RHZA 3S8EA 1AV6A 1ECBA 3TO5A 2NUPB 1P9OA 1QX3A 3UUGA 1DCMA 2VHCA 3K72B 4LSZA 2VT3A 3VDQA 3LCUA 4QPDA 1S8NA 4C4SA 3NP9A 2WT4A 4B4OA 4G9EA 3WJ7A 1L8OA 2O8EB 1RS0A 3K70B 1QFJA 4OATA 3WV5A 3PXDA 1PN3A 1OA1A 1GNRA 2QD3A 5D3MA 5FOWA 1KZ6A 3WZMA 5K0FA 1EFHA 2R6GA 3H2ZA 4F5DA 3ICOA 3NWJA 3UFBA 4CT5A 1VL2A 4YAGA 1MJNA 2D0IA 4PW0A 1XHFA 2ILTA 4ZO7A 3ZY6A 1UK9A 1NN5A 2P1RA 1EA7A 1PR1A 5EQFA 3TRIA 2ECFA 5A7HA 5L4LA 4EY4A 3DW1X 3HCPA 3DV0B 4LOAA 4AO8A 1V41E 2E1PA 2R11A 3OIYA 4M0PA 4D57A 1IXKA 1DNPA 1Z07A 4RF2A 4US1R 5JSKA 4FFPA 4ALJA 1UBUS 4AUNA 3K94A 4RPGA 5EXSA 3VC2A 1XZAA 4I5DA 3PGXA 4M8SA 4D9JA 2IYSA 1FFGA 1HSZA 2CHVA 2H4JA 2X8JA 2ZR8A 3ONVA 2HZ7A 4FYWA 4RO0A 3SAJA 3U7JA 2ZXEA 2JGDA 4O4HF 3CIOA 4YP6A 3OQVA 4D3XA 5CAEA 1AXEA 5KNLA 1KMNA 2DFTA 2EL7A 4C20A 4BP3A 3MTAA 3KTOA 3AJ9A 4B1FA 2XXAB 1UM8A 2X7HA 3VR6H 3D7SA 3R6DA 4E7PA 1FYDA 1X80B 2R68A 3WL3A 4YUYA 1FP7A 5AMXA 1NLMA 1P1JA 2PEZA 2HTFA 4Q12A 1F38A 2RHHA 4INJA 1QO0A 2R1TB 4GD3Q 1SUCA 5IMBA 5IEBA 4XCVA 4BQPA 4HZUA 2CCKA 2A1UA 4HYYA 4MXDA 2XLCA 3ZDBA 4RD3A 2MCFA 1NHGA 4YFYA 3ZGLA 5CLLA 4AYTA 4YQYA 3L4EA 5BWMA 1ETHA 2NV6A 3MINB 4ZYLA 4JIGA 4HWSA 2NU7B 3ZBPA 1O4VA 1F1JA 3T4UA 3ZEAA 2B3TA 2BGJA 4YRRA 4EYSA 3PEYA 3MWFA 3HN7A 4EI7A 2Q8QA 1DBPA 3DONA 2YUIA 3K9QO 5COAA 4IIGA 3TLCA 4ZZ1A 2WQ7A 3QSYA 1RCFA 2I87A 3SVZA 3C1TA 1EH5A 1KTVA 2HF7A 4QXAA 4KDEA 1EE1A 2GDJA 5CD1A 3ZWAA 5FAXA 5KMGA 1TEXA 4HO1X 4JY7A 3WGJA 1CFZA 1XMSA 2DQ4A 4X61A 2F17A 5TQ0B 2AFIB 4KZKA 1ZJWA 4TKUB 4OL0A 2QTLA 5K05A 1LLUA 3OKPA 1GG5A 3VH1A 4LIPD 4OB7A 5IC4A 3IX7A 4DB2A 4GPIB 2JJ1A 3GLVA 4MVWA 3BWDD 1QH0A 3TM5A 3PTAA 1DQZA 2PUDA 5IUJC 1RAIA 4ZHQF 4JENA 4Y1RA 3ZWMA 1P0PA 4U9HS 3NVKI 1ZMTA 1RSZA 2IU4A 1R27A 5THKA 1H66A 3T9AA 2JHAA 4V1CA 5JVDA 1MDFA 1MDBA 4Y6OA 2B4YA 3HVUA 1TB4A 4HYTA 2PKEA 2PSFA 3QU5A 1RWOA 1XMIA 2WUWE 2XUIA 1K97A 3HJAA 5FI0B 2F3UA 1LTHR 3UMSA 4QOJA 1Y9AA 3HKBA 5B1SA 2IS1A 4N8SA 4O6VA 4YP7A 2YUTA 4UM9B 4GMDA 3I2KA 3RK0A 1NVTA 2PA0A 1VLVA 2NTVA 3OT4A 3D4PA 1Z0FA 2PUBA 3FF4A 3O8LA 4OJMX 2RK6A 1M6EX 1IXRC 2G4CA 2P9FA 2HMTA 3LY5A 3D0QA 3AI7A 3NPAA 2LCFA 3R3YA 4NK5A 4FHCA 4UMDA 2AXQA 2RJOA 2O0HA 2UXCB 3INTA 4RPHA 1M1NB 1V8ZA 4PWZA 1GFWA 3ELWA 1USIA 4UD6A 1SIUA 4LYAA 4B6QA 3H2GA 3I6YA 3E9RA 3LLSA 3FSEA 9LDBA 2O2DA 1MMFB 1PFYA 4U4AA 3G7SA 1U7OA 1BW9B 1VHLA 2JLVA 3SJBA 3P0HA 1SEVA 5DI9A 5FWYA 2ZJ3A 3D3WB 3PGA1 1Q1EA 1S2NA 4L0MA 4BL5A 1HM5A 1ZIYA 1PEYA 3DD5A 5BOVA 3OJFA 4FJ1A 2ASEA 2CXQA 2RGXA 1P18A 1ZFNA 2ZT8A 1E2EA 3MOIA 4G0YA 1T2NA 3JYPA 1JR3E 1L3IA 3G6KA 4AYWA 4D8TA 3HZRA 3RUEA 1CUCA 1XYVA 3AVPA 3M49A 4MR8B 3ZDQA 3CUSA 4C1BA 1YONA 4OKSA 4D82A 1X70A 2HRQA 1JB1A 1F12A 4NC9A 4PYKA 3KLBA 3VVMA 3UGJA 2EDCA 1FFXA 1U0FA 4H18A 1W5SA 1IC6A 2XADA 1NC1A 5K7SA 1JLLB 1CP2A 4YJGB 3HNRA 4DNXA 5M34A 1DT5A 2VHJA 1HG1A 2XTMA 1TPZA 4E3WA 4I46A 1CV2A 1I3CA 4TVOA 2IYLD 1SK8A 1DXOA 2IP2A 5F4BA 3K6SB 2F1JA 1NBIA 3TZ6A 3T94A 1D2EA 4PIMA 2I4NA 1FNMA 2EXXA 2EZ9A 1O2DA 1DWOA 2CD7A 3IUQA 3JW8A 3VOAA 4Q7JB 2Z5LA 3HL4A 3ID6C 4CW7A 5T5QA 2ZM5A 4XD2A 4WLVA 3QVJA 1BCSA 5JQWA 2QPAA 1YRHA 4HVTA 3WL7A 3H9UA 5T57A 4MV4A 1IXZA 3UFXA 5EPOA 4JP1A 2J67A 5T4EA 1BMDA 3LPAA 1K5DA 1QZTA 4QECA 5E8RA 4PYLA 3C3AA 4Y30A 4YPFA 4FHZA 5F7JA 1U2EA 3PG5A 1Z6PA 4UCFA 4EATA 2R8EA 3DV0A 5CCBA 1A2KC 1SGWA 3RNOA 4BVLA 1N2ZA 2C88A 2Y1FA 1YWGO 4CM8A 1IVNA 1WLYA 1PFWA 3U7QB 1VJ1A 4CVNA 1NZFA 1OB2A 4GYJA 1WETA 1X8JA 2YVUA 5KC8A 5J4HA 2R79A 3CPSA 4FR0A 5FNVF 4RL6A 1G7TA 4KPYA 2ZP1A 1GZVA 1JFVA 4RPJA 1SMKA 1LSSA 4IBOA 1YCDA 2A58A 3FCSB 3ZW9A 1FSPA 2QNRA 1VMAA 2C57A 1V45E 2BR5A 2NG1A 1Z5ZA 1E2BA 4KMSA 2KB0A 2QX7A 5FHRA 2XCSB 3K0SA 1Z7GA 3QWHA 3LI2A 3M33A 1CLUA 1RLIA 3SOZA 3R6WA 2CUNA 1IL0A 1ZSYA 1YE5A 2B20A 2BUBA 1GA6A 3LECA 4YJ3A 1JR3D 3W2EA 1PSWA 3GVXA 1NW3A 1VZ3A 4IZIA 4XI9A 5G0UA 5K2MA 4KJXA 3HRKA 2FZ4A 3F5DA 4FLFA 4ER3A 3BE8A 3J81k 1LX6A 3BA6A 1ZHHA 4RK7A 5DM0A 4ZQEA 5K9ZA 3JQDA 2PE5A 5CA1B 1KJQA 1EDEA 2Q3LA 3CF0A 3O8NA 5H4HA 2ONKA 3RS2A 3WJ2A 1XDDA 4OKIA 1HE3A 1M2VB 4CUZA 3GIDA 5IWAB 3ZI4A 1O89A 2QY6A 2O48X 4E5KA 1ZOIA 3EQ6A 4C29A 2SBTA 3C5VA 1ENOA 1E8MA 2CLIB 4ZO9A 3MCWA 3H1TA 2C9BA 5ALLA 3EUFA 4CL8A 3NCHA 2QRMA 3AVUA 4BO8A 2VNAA 2VZLA 1CUAA 5ECYA 1KIAA 4AQDA 4CKBB 4AQ7A 1E2MA 2DSTA 3F9IA 3GHYA 3LBIA 1JFFA 2SKDA 3DAOA 2W6NA 3GUUA 4EG4A 3QVSA 2CC2A 2EJUA 1L8XA 3AFNA 3IJ5A 1E2LA 3OC0A 2NPOA 4BVGA 1DFGA 3BTOA 2WUDA 3PNYA 1IN7A 4MWBA 4QD3A 1Z2DA 4MW0A 3ZGNA 5JJCA 5CFNA 1POWA 2B4TO 2GTHA 2NM0A 3E9MA 4EEZA 5EE1A 3FLEA 2C4VA 3TCNA 5I9NA 3EGDA 4IDQA 4JLNA 3E27A 3DCJA 5LUBA 4DJDC 1DG1G 2QUIA 1NMEA 3MJSA 3WNCA 3TNJA 3AW8A 3TNYA 1MB9A 1JV2B 1IXSB 1DDGA 2LE0A 4Y1GA 2QN7A 3TOZA 4ABYA 3WQRA 4EVSA 4MV5A 3K1AA 4YA6A 3VNVA 4J0IA 3I5YA 1W4BA 3EXG2 5BW6B 1QRSA 3JAMA 5CNJA 1MX1A 3U6KA 2Q28A 3MJRA 3I76A 4M8IA 5DCUA 2C84A 2C8JA 4CM4A 4P0QB 4EHAA 3NBXX 3KWJA 3ZWVA 4WBNA 1N1MA 3ZKWA 4FX2A 3DYVA 4CDMA 3FNRA 4KLRA 3RC1A 3UK2A 2WTAA 3AIIA 4PR0A 1ZRMA 3W34A 5ISMA 3ORRA 1SVIA 3ZWBA 1FA9A 2FRVA 1JR4A 1PD0A 2ZU6A 4WECA 4LXGA 2P30A 1VMKA 4UU0A 2PR2A 3OCWA 4LOJA 1BXRB 1G60A 1ULUA 4P4GA 4A1FA 2J9XB 3R3WA 4M54A 4DF3A 4Q9HA 2PSJA 3SBOA 1R0CA 1P3JA 1XZIA 3UA3A 1KNXA 1ISHA 4C0HA 1ZG3A 3D2CA 3L5KA 1IZYA 3NDRA 1H5UA 1SCUA 4FS3A 3GLHA 5ERGB 2G1KA 3D7MA 1EAYA 4Y3UA 5FULA 1QNLA 5F3WB 5A6SA 1GCUA 2G5GX 5EMHA 2ODPA 5HQTA 5TS2A 2JCXA 2F43B 1DRWA 1LSOA 1TAHA 2XTJA 4J94A 4ZTBA 2D8MA 1JLLA 3QI2A 2V4MA 2WSBA 2KYRA 1BSVA 4G37A 4NR0A 3QVMA 4TN1A 3UMCA 4Z0TA 5IYZA 3EFOA 4LRYA 1S2IA 2B0CA 4DTIA 1QVRA 2IUUA 2NTYC 3DBLB 2H57A 5LXTF 6YASA 4U7TB 3RFVA 4NQRA 2HXSA 5PGMA 1KIMA 1N2BA 4J1SA 3R0JA 2CXSA 2ODNA 2FYTA 2QUHA 4FMPA 5FPQA 1GQOA 2PS0A 3KV3O 4N5DA 4D9EA 3QITA 4HATA 4QDZA 4NCXA 1T1RA 3FBWA 3ZDRA 1G9XA 1E5LA 3I37X 4IH1A 1LXCA 4FQ8A 1WE2A 2DH5A 4N3AA 3T54A 5GZ1A 4PZEA 2NPIA 5FQNA 5CFOA 1CUBA 1F6DA 1M1YB 2GN0A 1OUMA 4X97A 3N6RA 3OF2A 4PO3X 2M1XA 3S2IA 4KW7A 4WNIA 1J1UA 3N0RA 5HZHA 1NG9A 1J22A 1U3UA 3DW3X 1M2EA 1XEWX 1Y6RA 3DT6A 4IVQA 5BORA 3BMCB 1XGKA 3MA0A 1P19A 1M6HA 1SHJA 4BKUA 3KR1A 4ZV4A 3HDJA 2GSWA 2JEOA 2ZUSA 2CJXA 4JA2A 2BGMA 5DGXA 4URFA 3KJFA 1LUAA 8AT1A 3OFNA 1V6AA 1SCKA 5HF6A 4DMLA 1QH9A 2AN1A 4ZT4A 5MF6A 2GN6A 3RS8A 1KQ3A 3VYTB 1LTQA 1S2DA 3ZD7A 1GYQA 3BOSA 2JLBA 4Y2RA 3WRXA 5KUTA 1EDDA 5JH7B 2BM9A 4ZZ2A 4QUKA 3KEFA 3O7MA 4EAAA 3AI3A 1OY1A 3L07A 1AZSC 4HJRA 4AZ0A 2ZWOA 1R0WA 2I3BA 3IHTA 2PIAA 4OHCA 5AUPB 4GKVA 3OH8A 2PUAA 1OLXB 4Z4QA 3D3EA 3RAGA 16PKA 2P0AA 5JAZA 2LBPA 1XQVA 3Q4GA 5IFKA 4H7DA 1V9CA 1X7ZB 4LI3X 1H4QA 3HY3A 4JQYA 4BC1A 1GLVA 3ZIDA 1QQBA 3QVOA 3MRTA 1RXVA 1KIFA 4OJNA 3D7LA 3CSUA 3KVNA 4MCAA 2FE4A 3ONDA 3AQ4A 1TQHA 1KARA 2XQGA 3D0OA 2QPTA 1G38A 4XOUA 4MIOA 1MG5A 2IXEA 4IRXA 4L0DA 4LOLA 4UHDA 1XDWA 1B14A 3ICPA 1T0UA 3GFSA 4RNDB 4YMUA 3ZGOA 2D7JA 5KYXB 2Q62A 4MPPA 2ZUCA 2PK3A 1H2EA 1SUAA 5L4NA 3PYMA 1J0BA 4A1OA 1T4GA 2V65A 3AM4A 1US8A 1STOA 2DPYA 5CYGA 4KFTA 1KVQA 1P62B 2VA8A 3V4ZA 2C99A 3B3QA 2WWHA 4R0MA 4B84A 3ZG6A 2XYQA 4NBRA 1XTPA 1RP1A 1TCBA 1WBJB 2ODBA 4RORA 4DYVA 3FSJX 1G59A 3K2IA 1OKKD 2XB2A 1CUUA 3MXTA 3PP8A 3RSQA 2GKGA 3RWMB 3DLCA 4KCGA 4GMXA 4J91A 1UC8A 3LRTA 4A73A 2JFXA 2N1MA 1JDPA 1OLSB 4IGKA 3VSEA 4F6RA 5JC1A 4W5JA 2HA6A 2CLKB 4PV7A 3HJCA 3OE5A 4X3CA 3IRVA 3U49A 1KPIA 3MELA 1SXIA 1NI4B 1WCWA 4JP8A 4M36A 2BL4A 1LV8A 2I33A 5FPYA 3OSZA 5HQ3B 3DQPA 2VLBA 1Z4PX 1UL1X 3LX8A 4M88A 1ZD8A 2NUTB 5HIIA 4YXFA 1TAUA 1JLRA 3ILVA 2JJ2A 5KC9A 3WMXA 2EQAA 1QORA 1KY5A 2DWQA 4LY9A 4XD7A 4ENUA 2AFIE 2HJSA 2B30A 2FRDC 3NAZA 4BQEA 2JG3A 1ETUA 3CLRD 2HCRA 3KWLA 5B6JA 1JJVA 1K6EA 1RKQA 1U99A 3MGCA 4PTYA 1K7SN 4C87A 4FEEA 4C9BA 3NEYA 2PLFA 4TRNA 4A91A 2JGEA 2OV6A 2IQIA 2IF2A 2ONZA 3V46A 3WWOA 1C7IA 3KQQA 3V34A 4Z8YA 1U7UA 2IC5A 4O1MA 1NI5A 1XN4A 4F96A 4M55A 3JZAA 5ARBA 1SRQA 1Z6GA 4ZRNA 3SJZA 2ZYHA 5JSQA 5BW5A 2ZI5A 1QANA 2Q5CA 3FMPB 3P8ZA 4IS2A 1ATIA 2JKVA 2PQ6A 3C3MA 3SYRA 4QUEA 4Y9TA 5CURA 3B89A 2CXNA 5AK6A 4BGIA 1MH1A 4E32A 1EWKA 3DBRA 4JOQA 4Z3OA 3E5NA 2G1AA 3GT0A 5BSMA 4BEJA 1E58A 4GOXA 4UVGA 1M6NA 2QLNA 1M34A 1SKYE 3K8ZA 4AKGA 2GRUA 2GHQA 4RM2A 2XXAA 4PSUA 4TGLA 2Z8YM 3S1SA 1FJHA 2ZSDA 3VYWA 3O03A 2AB0A 3JQFC 2YN0A 2Z2XA 2Z5VA 4B2IA 5LU8A 5ITZB 2LVBA 4UUAA 1P3DA 3CLTD 1HC7A 2QN3A 1RI3A 1USGA 2Y6VA 4M1MA 3AR4A 4Y6GB 1M1XB 2W6QA 1F4LA 4KJZA 1QGYA 4I3HA 4G0UA 5DHRA 1QO9A 4TLDA 3LKZA 5CMLA 4IW3B 2CFOA 4MW6A 3IV9A 2ZQZA 2GBIA 1SXGA 3QFHA 3QLJA 4KV7A 4CT0A 2DERA 2W2KB 1WPRA 1KAGA 4JT8A 2OXEA 4YCCA 1MLDA 1TVKA 1YQXA 2G17A 1LB1B 2WAOA 3FCXA 1XAHA 2OBYA 2VYQA 1NW6A 3JQFA 3I9LA 1EA5A 3GLHE 1UBLS 5BT9A 2OAQ1 3Q11A 3LOQA 1A77A 1MNQA 2OUKA 4X93A 3UTCA 4DLXA 5FD8A 4ZVRA 4PRLA 1DO2A 1U28A 2FUEA 1N7JA 1RM0A 2WSSD 3R6GA 4GP7A 4OF4A 4RW0A 4DLYA 2ACWA 2C31A 4IEEA 5KNDA 5L3QA 3AB7A 1E4EB 1L5MA 3L6OO 4OUKX 4P84A 4XWAA 5BN4B 4QJ3A 5BSFA 3IEMA 1KDOA 2EATA 2F1RA 2G9VA 4YJHB 4BB6A 521PA 3FETA 3WYNA 3BXFA 4MVJF 5MGBA 4BB0A 3N2YA 5KU7A 2M6RA 3G0GA 4WCDA 3FPGA 3HDHA 4GI3A 5CYOA 5AOCA 3BUSA 1AC5A 1P8AA 1FDTA 2PQ2A 1GQFA 3G88A 3H2IA 3OCCA 2VTVA 2QI9C 3GFGA 5FFMA 2IDMA 2AG0A 4C0KA 3AKZA 3R3XA 4N0EA 1A8SA 5JAQA 1Y9JA 6REQB 3AVXA 1U5BB 2VP9A 3BE4A 4MH0R 3SC2A 1M6WA 4M1YA 4BO9A 1YE8A 3G89A 3NHUA 1JXAA 1NYRA 3V00A 2UU9B 2MSKA 2NP6A 3ORSA 3EXHA 1FU8A 3MC1A 4FHFA 2D74A 1NJ2A 2HGZA 5JALA 4IDGA 1G8GA 5L95A 4J76A 1G42A 1SH7A 1WZCA 4ZD6A 4BNUA 5BSGA 1RXSA 2C3OA 4GUAA 2PMCA 1T0PA 5F2NA 2QV0A 3OQIB 4WDQA 3QPUA 5E8JA 1CZRA 4KX3A 1NBAA 4UEKA 5LMCA 1RYFA 1UWCA 2FMFA 3KD2A 4INPA 4RHEA 2M6KA 4MUYA 4AS1A 2WQ6A 3VBEA 2XVMA 5JS1A 1LRKA 3U81A 1JXOA 1KQOA 2QM0A 2QRQA 1FEZA 2VF2A 1KORA 4QARA 4AJOA 3O75A 1KU6A 3HFSA 5KJFA 3B3FA 3OFSA 4NU6A 2H9AA 3CN7A 2IBSA 1FYXA 3UW3A 5AR1A 3PF9A 1B42A 1GZ7A 4Q02A 4A0QA 1U8FO 2OOKA 1T9GS 3V6LA 1VLZA 3ZVLA 2ID8A 2XCRB 5JPIA 5KDOA 4LZJA 3UC5A 3ZX4A 2J08A 5I48A 3MOSA 3LPLA 4ZCIA 5KYXA 4N9WA 4QBFA 1L4FA 3UJNA 2OWEA 3EG5A 2NW6A 3VO8A 3DKKA 1YFZA 3IDZA 4K9NA 3KQVA 4MB6A 5AP9A 2WJAA 4B2LA 4L95C 1FRNA 4E1AA 2P69A 3V55A 4CN9A 1VCOA 1JQDA 3C98A 3WLHA 3MZ0A 4CIAA 2B61A 3KZMA 3G2KA 4EITA 4FGSA 3EULA 3EH1A 1U2SA 3R9XA 1RIFA 3QTTA 1W5FA 4P0TA 3THWB 2ATEA 4UE2A 5DXJA 4KRXA 3I05A 4M21A 4TLLB 3KS9A 1NJ1A 1U1GA 3GPCA 3G8YA 2FHSA 4JX8A 1BA2A 2YBEA 1RQRA 5CDFA 3WO0A 2IHVA 4B83A 2QNIA 1FLDA 3D59A 8GPBA 4UOEA 3BMNA 1EGVB 3GWZA 4FNOA 5AHRA 3PSAA 3H8WA 2C00A 2GLTA 2DX7A 4QBGB 2Q7DA 4B3TB 1JH8A 4KYVA 4ALLA 4ZI7A 2IVFA 1QX4A 2O7NA 1E32A 3OA0A 4WOCA 3LLVA 2BZ0A 2H2HA 5G41A 3GCDA 1ZK4A 4MI3A 1CR4A 4CCWA 1K9VF 1DIGA 1XG5A 2Q29A 4ZEWA 2PMEA 4B85A 3NU1A 4L0QA 2QL9A 4ENSA 1S5PA 2KMLA 3ZD6A 4OHXA 4UTPA 1G5RA 4YR9A 2OSVA 2PSSA 5H9VA 5F9FA 1S7CA 2P2CA 4X94A 1YR8A 2CFIA 1PKEA 3AHIA 3DXXA 4N82A 4B3MB 1KRHA 1PL0A 2HA7A 2HH9A 3OESA 3UV7A 4AU1A 1SKQA 5TPWA 3LDHA 2Q4DA 2ZT7A 1HMPA 5E9QA 2JEZA 2VDWA 3SX2A 4PGGA 1C9DB 5LYJA 1OW3B 3V3KA 2PLAA 2VXYA 3N74A 4AMBA 2ZWAA 2OYRA 1X39A 1WZ2A 1W47A 4YUVA 1U94A 3RIXA 3VNSA 3ND5A 5I9LA 4PQEA 4PGFA 5BNTA 4OAOA 5B5SA 1DTWA 3IAS1 4D4GA 2RGCA 1EINA 1PJ3A 2CLLB 3IOCA 3LZ6A 3OICA 4GMGA 4ASUA 3KSAC 3SC6A 3C45A 1UCFA 3BWBA 1FXSA 1IPHA 4KQGA 1YMQA 5KWVA 3R09A 5K1ZA 3ZX5A 1BU8A 1H8HD 1X9IA 2RI6A 4GXTA 3T38A 3FLMA 5KQMA 3GP5A 2H48A 4LJ6A 3RKUA 1UMBA 5KNCH 3IQXA 1Z6ZA 2AQKA 2ZIVB 2OBBA 2EG5A 2KX7A 1LPAB 1FRZA 2QG9A 1YBMA 1M5TA 4MQ6A 3NWBA 4MW2A 4URYR 2X6RA 3ROZA 2CNLA 5IULC 1I6WA 3OE1A 3HNPA 2DR0A 1Y4UA 1CHNA 1WHSA 3KYBA 4HNAB 2QD1A 1W46A 1KHHA 2QJOA 1T6BY 1JIXA 2WHPB 1FFYA 4KC0A 1QB7A 1DSSG 2AQ8A 5C46F 1ITZA 3OOYA 4RJIA 2O7RA 4X0EA 3RJMA 4LRUA 3FTQA 1SCBA 4EB3A 2OCIA 3DB2A 3FZYA 5JMTA 2BAGA 2O3UA 2MSNA 4MUBA 4U7JA 4J3FA 1S8OA 3T9CA 1N3LA 1KYQA 4PLPA 2RCNA 1Z4NA 1N7HA 2EU8A 3IEUA 1Q5PA 1PQYA 3PD0A 4KXXA 2L42A 2NO0A 2RJNA 5FJIA 4DM7A 4EFDA 4G4GA 3DUFA 1FUUA 3PYLA 2BC9A 3KE8A 4AJ4A 1G6OA 3CX4A 1MH9A 2CV1A 3JVIA 1T5HX 5FUYA 2FOLA 4R2JA 3JQ8A 1K6MA 1ODTC 2VDVE 3FYUA 3K8OE 4EECA 1LF0A 5CDUA 3EQ7A 1NXPA 1U8AA 1WEKA 5KSWB 1TA9A 1Q7RA 1UPCA 4PSAA 1UFKA 4Q4DA 1ZW1A 3EGEA 4OFBA 5ESWA 4DJFC 1V47A 3L4JA 5DKFA 3IA2A