1ISMA

Crystal structure analysis of bst-1/cd157 complexed with nicotinamide
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
250
structure length
250
Chain Sequence
WRAEGTSAHLRDIFLGRCAEYRALLSPEQRNKDCTAIWEAFKVALDKDPCSVLPSDYDLFITLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMPLSDVLYGRVADFLSWCRQKADSGLDYQSCPTSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITRIEIWVMHEIGGPNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDCALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic studies on human BST-1/CD157 with ADP-ribosyl cyclase and NAD glycohydrolase activities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords bone marrow stromal cell antigen 1
total genus 82
structure length 250
sequence length 250
chains with identical sequence B
ec nomenclature ec 3.2.2.6: ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase.
pdb deposition date 2001-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02267 Rib_hydrolayse ADP-ribosyl cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.82.10 Mainly Alpha Up-down Bundle ADP Ribosyl Cyclase; Chain A, domain 1 ADP Ribosyl Cyclase; Chain A, domain 1 1ismA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1ismA02
4XZ3A 3PQDA 5B12A 1W73A 5L51A 2WE8A 2E49A 3DAPA 1QG6A 3EDMA 3AM5A 4LRTB 1NQ5A 3A28A 2EGGA 2JFFA 4WEOA 4ZVVA 4DPLA 4YCAA 3DHNA 1PU2A 4PZDA 3GGOA 4NBTA 5DT9A 3Q9NA 4RPGA 1JN0A 4PLWA 2X9GA 1VPDA 4PG4A 4RPLA 5HRUA 1UP6A 2DBZA 1K3TA 4U6QA 4Y98A 4R1TA 1ADCA 1P77A 3C1TA 1C1XB 4YEDA 3HDYA 1Y5MA 2DU8A 2ZB3A 1YE3A 4UVIA 3VVBA 3GC6A 2JHGA 1KEUA 3RJ9A 1QLJA 3WGHA 4WUVA 3UHAA 1H6BA 2CF6A 3GUCA 5BT9A 1YL7A 4YRBA 1O95A 3VH2A 4KDEA 1ISHA 1I3NA 1SZJG 2BFOA 2P4HX 5BSHA 3GZNA 4WJZA 3A1NA 1LXCA 2HRZA 4EBFA 5JBIA 2Z95A 1XWFA 3IL2A 3VH1A 1UDCA 2GZ3A 4FOOA 4B4WA 3JQBC 4XX0A 4ZD6A 5F5LA 2HQ1A 3GFGA 4X54A 4QTZA 3NUGA 1BDBA 4R54A 5C7LO 5L4LA 3PJFA 3BTSA 1IZ0A 4YJFB 1Q0LA 3H2ZA 4JBIA 3HB5X 2I3GA 5AXAA 1DHRA 4DWVA 4AJHA 1W4ZA 2QYTA 3ZWOA 4XCVA 5LCXA 1C1DB 3M1AA 2PGDA 1JA9A 1PJ3A 3KO8A 3O8QA 1ZMOA 3VOSA 2RAFA 4ILKA 5L4SA 3GZNB 5ADHA 4PCVA 3LT0A 5BR7A 1EZ4A 1U8XX 1ORRA 3KSDO 3BMOB 4Q9NA 1GCOA 1N1EA 2WEKA 3KM0A 1YB4A 2NM0A 4J7XA 1EQ2A 2C7VA 2J8ZA 3F47A 2GRAA 3KVOA 4BNLA 1ARZA 5JNLA 1B15A 3DBVO 1VJTA 1H6DA 1BXKA 2R2GA 2IE0A 2J6IA 4A5OA 1V3UA 2WD8A 4JQCA 4M55A 5DDIP 1PIWA 1LEHA 4YJGA 4CM8B 1N1GA 1XU9A 4LRSB 3WG9A 3HFGA 1UR5A 4E2YA 4FFPA 2ZQYA 2W2KB 4II3A 5JCJA 2DBRA 2V6BA 4S3MA 1ZSNA 4MP3A 3TOZA 3PDUA 5THQA 5DP1A 1M75A 2ZB4A 3JQGA 2I99A 4IPTA 5F21A 4BNHA 2PTGA 4D41A 4YT4A 2FP4A 1N5DA 2ZJ0A 5DBGA 4DIOA 2I5PO 1E5LA 4PRKA 2GLXA 1J49A 5CAEA 1QMGA 5H81A 1EUDA 3Q6IA 2X9VA 1LSOA 2V7PA 3DQPA 1VE9A 4BO9A 5C7OO 1V3VA 4FOSA 3BXXA 1VKNA 1KS9A 3QWFA 3TZHA 3VTFA 1GFSA 1XIVA 1JU9A 2RCYA 1FDUA 1UZLA 1XR3A 1LI4A 1GV0A 3UW3A 1ADGA 4EJ0A 1BRMA 3U9LA 5A06A 2RIRA 2C20A 4YJDA 2JHFA 1P9LA 1HDGO 1FK8A 2FRDA 3G0OA 2PZLA 3MJTA 3ZH2A 4U0KA 1GYRA 3EY4A 3BAZA 2UYYA 5T5QA 1T2EA 3RBVA 4RL6A 5U9CA 3B1KA 2Y0DA 5G4KA 4HNGA 3T7EA 3AM4A 3E1KA 2EERA 4CLHA 4D42A 2CF5A 1DIAA 1LSSA 3G1TA 3HWRA 2FY8A 3F4BA 1KVTA 2Y67A 5IZCC 4I08A 4PG8A 5JCJD 4NJOA 3LDHA 1FF9A 1PS8A 1YONA 3KSZO 3PYLA 3TFQA 2FPPA 2PV7A 4JX8A 5FYDA 5DZSA 2A94A 2VHWA 4QT0A 5ENDA 2EG9A 4ZRMA 1P44A 1SB9A 4MVJE 1LU9A 1PJQA 4GSLA 1VSUA 1XHLA 3LSYA 5IDXA 4HY3A 3WWYA 3ZHZA 3PHHA 2F1KA 1A7KA 4KMSA 4TRMA 3CMCO 4Z9FA 5TT1A 4FJ1A 4CM3A 3QWBA 1CERA 3HDQA 4J49A 3VHRA 3NV9A 4W7HA 1B3RA 2DFVA 2HJSA 4R16A 4AG3A 3PFWO 1PR3A 1ZUD1 4CR6A 3JYQA 3KB6A 4E30A 1LDYA 3WLFA 1XELA 5IN4A 1DB3A 2CFCA 1LDGA 3PPIA 1DXYA 2GN6A 4DLAA 3JQDA 2HMTA 4KP7A 1AXGA 4J0FA 2WSBA 4CM7A 4IQ0A 3KRTA 5KCZA 4IJWA 5KKAA 2Y1CA 1Z82A 3OECA 2LDXA 4E5KA 4UVEA 1AGNA 1MGOA 3V1YA 4W4TA 2QHXA 2UDPA 2ZKLA 4HUJA 3KHUA 2AMFA 1ENZA 1H6CA 1ISGA 2JCYA 1E0DA 1D1SA 4I8XA 1NP3A 1BG6A 3OETA 4WE3A 2GZ2A 1N9GA 1OC2A 3WIEA 1GADO 4OGWA 1K5HA 1MB4A 2EP5A 5AQ1A 5MGBA 1Q7CA 1KEWA 3GRKA 3S55A 3SLKA 5EQFA 5L53A 3D4PA 1BDMA 1XEAA 3V2GA 3X2FA 2P91A 3EVTA 4Y6SA 1HSOA 3OICA 1I3LA 3F6YA 2IODA 4ITUA 3LZ6A 5EIOA 4L9RA 1A72A 4FFOA 2AQIA 2PGLA 1UH5A 5JDCC 4R1NA 2XAAA 2CVZA 1LQUA 1SNYA 1DFHA 1LSJA 2AXQA 2D2IA 1KVUA 1U5AA 1KVSA 2OXIA 5ITVA 4K6FA 3DB2A 3GVIA 1K6XA 1RYEA 2EGHA 3W6ZA 4P38A 1WDMA 4CM6A 1WAMA 4FB5A 1O6ZA 3ZV6A 3H65A 2IYOA 3RFVA 2PD6A 4MKXA 4YB8A 4C7JA 2NVUA 1C1XA 2OO5A 4E5NA 2VRCD 4WPGA 2RH8A 4RCVA 3RKRA 4HXYA 2CUKA 1Q7BA 3MJVA 4UVHA 2VTEA 1NVGA 4EGFA 4M8SA 4Q3BA 4EZBA 4YQYA 3JQFC 4MVJG 3FNHA 4CL8A 3GVPA 4B7XA 3AI3A 4Y6PA 1MP0A 1B0AA 3GUYA 3W8DA 5JAZA 3P19A 4Q3NA 2FMUA 1Y9EA 3JQAB 3VZRA 1TA4A 1KBZA 3VDRA 2QW8A 4HFRA 1V3TA 4ZN6A 3NRCA 1C0PA 1NASA 1A71A 3NDIA 3H5RA 4YAJA 2Q1WA 3GN2A 3I23A 1QRRA 3EHEA 2FZEA 1A4IA 1EBUA 4N18A 3OQBA 1MUUA 1YKFA 4RVSA 1E7WA 5T64A 2CMDA 1WPQA 2A4KA 3FCOA 3O03A 5JFOA 2ZIZA 3ZWPA 1H2HA 4R51A 2AQHA 1CIVA 1P1KA 1XDWA 5JYEA 4NMHA 1HEUA 4S1VA 3Q3CA 1RM3A 3VZSA 1WMBA 1M2WA 3W4KA 3PQEA 2A92A 3CPSA 4NU6A 3OM9A 4RLHA 4UULA 1PGOA 3QJ5A 4EJMA 4LSMA 3RUIA 2FSSA 4HP8A 1WZIA 4R4JA 4BNUA 1J0XO 1I30A 1FDSA 4TQGA 1QYWA 4CQMA 5AOVA 4GLLA 1KY4A 4XR9A 3GG2A 4D3DA 5L7WA 2QG4A 2HUNA 3IDSA 2I3AA 5H82A 1VJ1A 5ILGA 2NVWA 4HKTA 5I7VA 2WYVA 3M1LA 4UREA 5G0SA 3WFJA 3WFIA 1XG5A 1WZEA 1BVRA 3JYPA 1ZMTA 2XOXA 4ND1A 1NYTA 3VZPA 3MEQA 5A03A 2DAPA 3QY9A 1KIFA 4E5PA 4OOEA 3KYCA 1XGKA 3PVZA 4M49A 2Y0EA 3N74A 3R6DA 4QSMA 1SCUA 1UDAA 1ZCJA 1CF2O 4LCJA 4YT5A 3GLQA 3OMLA 3Q11A 5BSGA 3DBLA 3ZNNA 2UAGA 3JQFA 1J4AA 1N92A 1C3VA 1IULA 2GN9A 2YV2A 3DEYX 4NBVA 3IUSA 3ZZNA 1A27A 3D5TA 1YOVA 2FR1A 3JYOA 3U4CA 1KEVA 4BO1A 4CR8A 2GCGA 1VC2A 5A5EA 4OKIA 1I2ZA 3H2SA 4RZHA 2BMAA 7ADHA 5BNIA 3ST7A 1PSDA 1ADFA 4D0SA 3WJ7A 3W6UA 5JAQA 2O23A 2HSDA 2G0TA 5KJ1A 1I24A 1Y8RA 3H9GA 3MTJA 4XIJA 5TF4A 4DREA 2P68A 2NU8A 1UXIA 1PZHA 1P0CA 1PL7A 1EK6A 1PGPA 3RI3A 1ZO8A 2YHIB 1KC3A 2O4UX 1FDVA 3LC7O 3I6QA 5EMHA 4JGBA 1PZEA 3I52A 2O2SA 3R1IA 4HBGA 2EJWA 4AJ2A 4UUOA 2OP1A 5CDUA 4OO3A 2BLLA 3VPHA 1PX0A 2HCTA 1RPNA 3LT2A 1XQ1A 4K6CA 1I36A 4L4XA 4BQPA 3GVCA 4N7RA 2J5QA 3RAJA 3BHJA 1V6AA 2W4QA 3F5SA 4FBGA 4QFDA 5TJHA 3KETA 1SOVA 1JDJA 2G1UA 3AY7A 4ROSA 5L95A 4FIZA 3WBFA 3CZRA 3MJSA 3GH3A 2QIOA 4XDZA 4F3YA 1LTHR 4ALMA 5EJ2A 3DBRA 4L75A 2NTNA 2AE2A 3JD0A 4Y67A 2VT2A 4PG7A 3ZHXA 1GZ3A 1MX3A 4CLDA 2I65A 1WMAA 3GG9A 5ENVA 1N8KA 1W6UA 3IOYA 3OJEA 4IDBA 4GQAA 3A06A 2UUOA 3ZDFA 2PKQP 1SO8A 1Y9AA 3KLMX 1Y7TA 1EFLA 2DT5A 1ML3A 2Z5LA 5A9RA 1YL5A 2GN4A 4Q3CA 3IJPA 5ICSA 5TIIA 3PTZA 3I6IA 3JSAA 3E48A 3PEFA 3V2UA 4CV0A 2E82A 3QWIA 3LT4A 1DFGA 3S2IA 2FOIA 4OXKA 1YOVB 2ZYGA 3QIVA 1HE3A 3L4BA 4XB2A 3A9WA 2YQ4A 3D3EA 5T57A 1E1LA 2H1SA 1UJMA 4MVJA 1QR6A 1ZEJA 3VAZA 2HU2A 1IZ9A 2HJRA 3ZI0A 5JAMA 1P3DA 3C85A 4XD2A 4XKJA 4TWRA 2B0JA 4BB5A 4CJXA 4E0BA 4RF4A 1L7DA 1E77A 2X22A 4CQMB 1SB8A 3JQ7A 5H83A 4IDGA 1U4SA 4BO6A 3S1LA 3VPXA 2V6MA 1CEQA 4GVLA 4IGFA 1R4MB 3AM3A 1VKOA 5F1PA 2BFPA 1YBAA 3ZWYA 3TZ6A 4BNMA 4UUPA 3O38A 4G2NA 4PZCA 5JC1A 5DCUA 4KUGA 1DSSG 4MO2A 4RPHA 1KVQA 3WSVA 2HLPA 4QEDA 1B8PA 4MVJH 2Q2WA 4ZQGA 1A4UA 3IUPA 1HLPA 3S2FA 2BD0A 4TRJA 5DNAA 1RKXA 3DMTC 4CM4B 4ND4A 4WNCA 4BIIA 1HRDA 1NAHA 4RO0A 3GRPA 5IF3A 4JP3A 1DLIA 1E1KA 1X14A 1U8FO 2X0RA 2YQ5A 4CMBA 3RKUA 3RUAA 3PHIA 4K9DA 1EUCA 2AEJA 5TLSA 1LNQA 1E3WB 3L4SO 4OMUA 4QECA 4LSWA 3UOGA 3K92A 3INRA 1D7OA 2OBNA 4U7WA 3UF0A 4ND2A 2YY7A 3PYXA 4MP6A 2BH9A 2G17A 4Q39A 2E4AA 2C5AA 5A5FA 2CDBA 2BFAA 3LC2O 4EDFA 3EGOA 1ENPA 2YZ7A 4IDCA 3F1LA 2JAHA 3K73O 3EVNA 1J5PA 1P1HA 1O94A 4YT8A 4AJIA 1AHHA 1ZSYA 3DO5A 4CMKA 3KOUA 2X7HA 3DTTA 1RM5A 3JQBA 4LN1A 2IZZA 3ZHBA 4I9UA 3WBBA 3JQ8B 3CE6A 3KSUA 4J2HA 5TC4A 5A3VA 2DPGA 3NGXA 2YV1A 5ICMA 1T4BA 3P7MA 3TOXA 3SLGA 3VZQA 5CDYA 2H9IA 3WGIA 1E3JA 1U7HA 3DAGA 3GVXA 3ONFA 4FFLA 4L4SA 1OI7A 4IZHA 3PHGA 4MKRA 3UCFA 1CJCA 3UH1A 4DQVA 3LF2A 2UUPA 3CXRA 4ZRNA 3HJAA 5EESA 1PJ2A 4BVAA 4YYZA 3ZHYA 5EN4A 3D3WB 2I76A 4E3ZA 3CUKA 1T24A 4YJFA 1EQUA 4CLOB 1UDBA 2DUWA 5MDHA 3O4RA 1E7MA 3Q9UA 4GMGA 9LDTA 5IG2A 1U2DA 2PZJA 1MG0A 3DXFA 3FTPA 3NTQA 4B3HA 2OOSA 1E3LA 3W1VA 3NT5A 3ZW9A 1ONOA 2Q1TA 2P9CA 3MCVA 4TVBA 1E92A 4GVXA 1M66A 2C29D 2X86A 4J2OA 4FFNA 2VYNA 5KVSA 1Y8RB 1PQPA 1P0FA 5JC8A 1SBYA 1HTBA 1IHYA 1JKFA 2A35A 3RUEA 4LISA 5I8WA 7MDHA 3NTRA 4WGGA 2JCVA 2O3RA 2FWMX 3G49A 3R3JA 1KVRA 3JQEA 3AY6A 1VLLA 4NPCA 2WDZA 3DOCA 4CQLA 3OH8A 4CV1A 3ONEA 2B5WA 1ZK3A 1JLLA 3DOJA 1SC6A 4BGUA 1HDCA 4FR5A 4DPKA 3PIDA 5L9AA 3WMWA 4WLNA 4CUKA 1UXHA 1E6EA 2GERA 3DBLB 5CDTA 3D0OA 2HK8A 2NQ8A 5IDYA 4EI2A 4WLUA 4AL4A 4ND5A 4CR7A 4BO2A 1MG5A 1NBOA 4IUYA 4JIGA 1GAEO 5TS3A 4FFRA 4IDEA 2WMDA 3BTVA 3R3SA 2DQ4A 1Y8QA 3BA1A 1D1TA 2AEMA 2B5VA 4AFNA 5HWSA 1ZK4A 3ZU5A 5JDIC 3BHMA 5FEUA 4PFJA 3KEQA 1C0LA 3C1AA 1E1NA 2HMSA 1LLUA 5A3JA 4P4NA 4HV4A 4RZIA 3FRJA 3DZFA 3FNEA 2JAPA 4TROA 2GUGA 2B69A 5DBFA 4XGIA 4EJ6A 3LVFO 1UZNA 3MOIA 5KVQA 4MP8A 1P74A 1XLTA 2GGSA 2C07A 1NR1A 5C5IA 3FSRA 4GL4A 3BMCA 5JY6A 1P45A 3O9ZA 3PJGA 2PGJA 4R01A 5IZCA 1M76A 3C3XA 4MJLA 3VTZA 5JDCA 4UVDA 4BKUA 1ULSA 1DRWA 1DOHA 1IB6A 2DBQA 3UCEA 3AOGA 3AUAA 3FF4A 4NBUA 4NNJA 1TVEA 3ITKA 3DZIA 1R6DA 4J7UA 1VI2A 2OORA 4W9NA 2CY0A 3TSCA 1JAXA 5I7EA 4XDYA 4Z0TA 4DQXA 4CUZA 3PJDA 1DLJA 3E18A 3X2EA 4EYEA 3I83A 3FD8A 4WCFA 4YWJA 2OGUA 1O8CA 5ER9A 2X58A 3EZLA 2FN7A 3INGA 4PLFA 4BGIA 1DIHA 4M87A 2NACA 4I1IA 3V5NA 1ZSVA 1QYXA 1AN9A 2BI8A 1OBFO 3LF1A 5I9NA 2JD1A 1HZJA 2VOJA 1CRWG 4H7PA 3I9KA 3I4FA 3ZU2A 1EVJA 2QRKA 5ES3A 3PP8A 2PZKA 4JK3A 4NDNE 1E3IA 1NX6A 5F1OA 5TX7A 2YHIA 4YDRA 2QZ9A 4CLEA 1H6AA 3ZN2A 4B3IA 3I9OA 3IKVA 4UEOA 2O2YA 1IHXA 5AXCA 2X23A 4II2A 1DEHA 3ASUA 2ZATA 4AJEA 4E6PA 2PFGA 4TSKA 1T2CA 4E5MA 2X0JA 3HN2A 3QVTA 3HSKA 1GUZA 5JO9A 4B8ZA 1MV8A 3GT0A 3CIFA 1BWSA 4RF5A 3MOGA 4D46A 1EBFA 1G0OA 4GMFA 1C0IA 1YB1A 4JN6B 3S2EA 3HE3A 3RSHA 2Q1UA 1LLCA 1U2GA 4I5FA 2QRJA 3CZMA 2PH3A 2AHRA 3C1OA 1IYZA 1T25A 3T7CA 1CQIA 2QZZA 1LC0A 3GDGA 4B4VA 2NUAA 1LRLA 3GN1A 5HS6A 2YW9A 2PK3A 2ZB8A 4BV9A 4BS9A 4RVUA 4MVJI 1NVMB 3OBBA 2Q2QA 4DLLA 1PGNA 1UXJA 2R6JA 3DOOA 1T1SA 1V0JA 1TT7A 1W8DA 4HFNA 4Y9DA 2ZB7A 3L9WA 3D3WA 4E31A 1M67A 3WJAA 1GQYA 3A14A 3UICA 2NU7A 3D4OA 1H2BA 4CL3A 4O63O 4R3WA 4O59O 4ALNA 1WW8A 1KEPA 1ZVMA 2ZYDA 4L0QA 3OFSA 2D59A 1ZKMA 3RUCA 1Z7EA 5DOVA 4XYMA 1R15A 5B4VA 2WM3A 1JKIA 4DL9A 1DAOA 1YL6A 1ULUA 2W90A 1P31A 1GZ6A 5AXBA 4DGSA 1GPDG 4RGBA 5G4KB 4I9NA 4E12A 5JMWA 1SAYA 4Y8VA 1A9ZA 1DC4A 1JWAB 1PZGA 3GFBA 4PGFA 5JYDA 3RUDA 2J5RA 3WB9A 4YR9A 1QORA 1NPYA 4KOAA 3P5SA 3TZQA 4L4RA 2AG5A 4IJKA 4N54A 4GX0A 3F3SA 3PGJA 1PJTA 4NK5A 3U0BA 1I33A 2I66A 2W2LA 4LW8A 1PGJA 3WYCA 5B4UA 4Z3KA 4DC0A 1SEVA 4CMEA 4WCDA 4Q3AA 4IQGA 1BXGB 1WDLA 1R4NB 3D4NA 1ZXLA 4G65A 4B8WA 4EW6A 1E5QA 1T1RA 1X7DA 4PVDA 1EUZA 3F46A 3TF5A 4BNVA 4YJHA 4HADA 1NQOA 4OIMA 4YJHB 4PN3A 3NEPX 3MWEB 4ONEA 3UXYA 5B4TA 4GGPA 4A0SA 1HDXA 5CG1A 3QA9A 3RIHA 3PHJA 3JTMA 3CKYA 2G82A 2P2SA 3GA0A 3JQGB 2J3KA 4WLFA 1I0ZA 5BNTA 3ICPA 2NV6A 4YRAA 3PXXA 2C2XA 1IPEA 3DL2A 3OQ1A 1PJBA 3ZNPA 3SVTA 3RC2A 5COQA 4BNKA 1QSGA 3WWZA 5I9LA 3INTA 5JCXA 1GU7A 4O5OA 1OZAA 1B16A 1RWBA 1EVZA 3L6EA 4CQMD 4NQZA 5T6BA 3RC7A 3U4HA 3PRJA 2EXXA 4DRYA 5T8KA 4J1SA 4R69A 3G1UA 1FJHA 1K6IA 3D7LA 3DBHB 1Z73A 2VNAA 3ADOA 3AU9A 3DTYA 1F17A 5GMOA 4Y6RA 4ZA2A 4IJUA 3AK4A 1VL0A 4AJLA 4AJ1A 4XQ9A 2X5JO 2IEDA 2NVBA 4XJTA 2ZTLA 5G4LA 4FGWA 2ILTA 3I4CA 5TJ9A 4ESOA 2QRLA 1ENOA 2O3SA 1IY8A 4UEJA 3VC7A 3ITDA 1E6UA 1DDOA 5KJ6A 4HWKA 3KV3O 2HMVA 3OIGA 3F4LA 4Z0PA 1S7CA 2GASA 2Q45A 1ZH8A 3FI9A 1WVGA 3JD2A 3R0IA 4R1UA 2P5UA 3EYWA 4B4UA 1NQAO 3AI1A 3ROPA 4OQYA 3TJRA 4AJNA 4FC6A 3LT1A 1B14A 1Q7GA 5IJZA 4C4OA 3HDHA 2VWHA 3C7AA 2DTXA 3GOHA 5HM8A 2Z1NA 3ZV4A 4EUEA 5C3MA 3UGKA 3I9NA 4BNZA 4B7CA 1NFFA 1F8GA 3L6OO 3NGLA 3N7UA 3GPDG 4Q3EA 4IGEA 1M6HA 5B1YA 3JQ8A 4XJSA 1R0KA 4OXYA 4P22A 5A04A 1MC5A 4FJ2A 2E6UX 4O6VA 1WDKA 2IZ0A 3W8EA 3T4EA 2P4QA 4LK3A 5KJEA 1U5CA 3E82A 4XYLA 1I3KA 1U3WA 3ZWXA 4K28A 1IL0A 2VOEA 4BMNA 1R37A 3I9JA 5I8ZA 3DR3A 5IXSA 1LDMA 4E21A 5F5NA 1O89A 3GHHA 3DONA 1BSVA 3T4XA 3GDFA 3IQDB 1XSEA 1U7TA 2F00A 3ETEA 2JL1A 3L6DA 2CDCA 2YJZA 2GZ1A 1IUKA 1EVIA 2FR0A 3GMSA 1NHGA 4MPDA 1ISJA 5F1KA 1A5ZA 1E3WA 2NSDA 2Z1MA 1JW9B 4F6CA 1RYDA 5L3ZA 2G76A 4OL9A 1BMDA 3KUXA 2GO1A 4N5LA 4BKPA 1HDRA 1LLQA 2C54A 4NR0A 4ZHSA 3RBZA 3GPIA 5DF1A 2V65A 3K5PA 4J4BA 3DWFA 4Q3DA 3W8FA 3AUTA 4MIOA 1YJ8A 4DMMA 2C5EA 3CSDA 3SC6A 1LLDA 1PWZA 1LDNA 3FNGA 3QQPA 1NFRA 4ALKA 1B26A 3D64A 4FDAA 4CODB 1P1RA 4Z9YA 4M1QA 5BNFA 4J0EA 4BB6A 1YQDA 3BMQA 1HF3A 3DC2A 4INAA 1YGYA 4DTIA 4CMAA 2EEZA 4AICA 3PI7A 2B36A 3QWAA 3E9QA 3ZWWA 4MKZA 3E6AA 2EKPA 2BF7A 2FR8A 3K8ZA 4R9RA 5C7IO 3RROA 3AY3A 3ROQA 4XQCA 1I2CA 1HYEA 2AG8A 4J4TA 5IFLA 3IS3A 3I5MA 4IDAA 3BMNB 3JD4A 1YS4A 2I6TA 3ZGYA 3H9JA 4HX5A 4IM7A 4GPD1 1R4NA 5CEFA 1SEPA 2VWGA 5A4DA 3OQ6A 1PJ4A 3ENKA 3L4BC 5IAAA 3F5QA 2J3JA 4XGNA 3G17A 3CMMA 4I5GA 2JFGA 4WNIA 1T4DA 5ITWA 4JJFA 3WTCA 4RORA 2YFHA 2X4GA 2PWZA 4YPOA 4EEZA 2D5AA 3FNFA 3FBGA 3WNQA 5I7FA 3GNSA 4YJGB 4TZTA 1TLTA 3UKOA 2JD0A 3GMDA 4XWYA 5KWEA 4ZICA 3IP3A 5CDSA 1GPJA 4LVCA 2W2LD 1T26A 1XA0A 3RUHA 4CQLB 2JD2A 3ANNA 4YT2A 1LJ8A 5KJCA 2Y1DA 2J3HA 1B8UA 4NG5A 5TNXA 4XQEA 1H9AA 3B70A 4IMRA 5AXDA 4YTEA 4OKNA 1X13A 3PZRA 3B1JA 3QE3A 4RPJA 5IDWA 4NU5A 2OP0A 4YACA 4UEKA 1J6UA 1YBVA 5COAA 3RUFA 4D0RA 3DBRB 1AXEA 4MVJD 2HKIA 3O8QB 5T8KC 1DO8A 1U9JA 3WXBA 1LDEA 4JLWA 4ND3A 2ZCUA 3P2YA 3K6JA 3WQSB 4PRLA 1HXHA 1KYQA 3H6KA 4PVCA 3PHLA 4IINA 4PLTA 2O4CA 2O3UA 3AOEA 5C37A 3HQ4O 2NTJA 3VPFA 5JLAA 4IIUA 1HDZA 1GL3A 5CDGA 4XYEA 1JTVA 3ROMA 2QQ5A 4CLRB 2D3TA 4H16A 4IDDA 4M54A 1U3TA 1BXZA 1FDTA 5KJFA 1RM4A 1NAIA 2FPGA 4NIMA 4TRRA 3L9XA 5G0WA 3L0DA 2DTDA 4QQRA 2VNSA 4AVYA 2ZTMA 1HETA 4YAEA 2EKQA 3RC9A 5JW6A 4FPXA 4OOFA 1YRLA 4J7CA 1NWHA 1H5QA 1C0KA 4ZJUA 5I7SA 3WGQA 2VHZA 1D3AA 1N7GA 4ALLA 1HSZA 4B7UA 2X9NA 4K26A 2X8LA 1MXFA 3LLVA 1DAPA 3Q1LA 4E4YA 2IDZA 4YA6A 4TMFA 1NNUA 1X0VA 3IAHA 3GEGA 3D1LA 4L76A 3AJRA 3ROKA 1GV1A 2Q1SA 1MXHA 2AW5A 3RFXA 1X7GA 2J5KA 3FR8A 3RU9A 4AJ4A 1PTJA 2ZTVA 3SXPA 1ID1A 4AJPA 2VN8A 3TFOA 4RVHA 4E2XA 1G0NA 3GR6A 3NAQA 4DMLA 3PWZA 3LC1O 4GGOA 4KUHA 4WLOA 3UFXA 3DZJA 5A9SA 1K89A 3OF2A 1DIBA 2FHSA 3TL2A 2Q3EA 3ZV3A 1U4OA 1XYGA 2X0NA 3E03A 1UXKA 1EK5A 2JFHA 3JV7A 4QX6A 1ISIA 4BKOA 3EC7A 5CEEA 1ZXBA 1VRWA 4CMGA 4WLVA 2RH4A 3GEMA 1BXGA 3OJLA 5LDGA 2W8ZA 1KC1A 3C8MA 1HDYA 4DPMA 4CM4A 2C7GA 1GDHA 1Q0HA 1ZNQO 3FPLA 1MLDA 4FJ0A 1EEHA 2CVOA 4HNHA 4Z9XA 2AQ8A 4IXTA 4KZPA 2Q4EA 2VRBA 3QVSA 3VH3A 1ZIDA 3BMQB 1GYQA 4OH1A 2AQKA 4Z0HO 1NHWA 3AU8A 2Y0CA 1ZZEA 4QUKA 2PA3A 5L45A 4Z3DA 2I9PA 3WSWA 4YXFA 1BVUA 5FI5A 3ZWBA 3EK2A 4TKMA 1MC4A 3PGXA 3GEDA 4BO8A 1OAAA 5EPOA 1LUAA 1QXSA 5FI3A 4J16A 2B35A 2YYYA 2Q46A 3GF4A 1LSUA 1P1FA 1DRVA 1ADBA 4CMJA 2D0IA 1C14A 4GWGA 2PH5A 1F12A 3B20A 4D7AA 4BO5A 3PK0A 4EITA 2UV8A 2OHXA 4UUMA 2HRBA 3AFMA 1I01A 3K31A 2DLDA 1OMOA 3KYCB 5JE8A 4R5MA 2TMGA 1GCUA 4IS3A 2DKNA 3JQAD 1TXGA 2WD7B 4XYBA 3UN1A 1E7SA 1HWYA 1X1TA 2Q49A 4QO7A 2EJVA 3DHYA 1I5RA 3E9MA 2OMEA 2Y93A 1ISFA 3GY0A 1QV6A 2HAEA 2O3QA 2V6GA 3JYLA 4J91A 4QFCA 1GEEA 4ZQBA 3UCXA 3ZWAA 4E2ZA 3VKUA 3RJ5A 1T2DA 1DIGA 1YVEI 2PKRA 4NFYA 2EV9A 3RU7A 4QO8A 4J9UE 2RHRA 4FD3A 2PKQO 2E37A 1U3UA 2EIHA 2XXBA 4FC7A 2B37A 3L77A 1OFGA 2PNFA 4I5DA 3HHPA 3WGZA 3VPSA 2OFPA 3BTUA 3DAFA 4N5MA 2EKLA 2Y05A 2BGLA 1PJCA 3H4VA 3RC1A 4R9SA 4L8VA 2IEBA 4BKQA 1FDWA 3AOEC 4WKGA 2VHVA 2PY6A 4XIYA 5G0UA 4XRGA 5CG2A 1S6YA 1EE2A 1T2AA 2YUTA 2WJPA 3ZU4A 2AA3A 1TI7A 3ZU3A 3NT2A 2HMUA 1K0UA 4Z6KA 3PWKA 5B37A 5K6AA 3VVCA 3OJ0A 4FFMA 3SJ7A 3H5AA 5HTOA 1QYDA 2WE7A 4OAQA 3RCBA 4DBZA 1GEGA 2FSVA 4BQRA 2VYND 3ETGA 3U4IA 4KDFA 1ZK1A 3FBTA 3WGOA 3H3FA 3WS7A 4IZIA 4OHUA 4A26A 2X6TA 4BNYA 4OSPA 3MWDB 4F45A 4UUNA 5KKCA 2OUIA 3H9UA 3AFNA 3ETDA 1YB5A 3ADPA 4MDHA 4U0JA 5F3RA 3RASA 4AJKA 2B83A 1HDOA 2D4AA 3TWOA 5KTKA 1YDWA 1Z75A 5GZ1A 4PLPA 4DYDA 1L1FA 3QVOA 1I32A 5JAIA 3PLNA 1LQTA 3PLRA 4CMIA 1DHTA 1NWCA 3KZVA 4KWHA 1E7YA 5L4NA 3HZZA 1NQTA 5HA5A 4OM8A 3U5TA 2HO5A 3OP4A 3WLEA 3HFSA 4BNFA 4M89A 3WICA 3IP1A 3IJRA 4D45A 3C24A 3HADA 1PR9A 3I3OA 4JP2A 4FQ8A 1QKIA 4U5QA 4ZQFA 4NJMA 2UVDA 4IMPA 4GBJA 2NADA 3OIFA 1GQQA 2VWPA 1LRJA 1Z6ZA 3G79A 3IMFA 3KEOA 2A9FA 4IQ8A 1ZJZA 3W4IA 1JQBA 5DP2A 3PJEA 1GYPA 3KTDA 4NH4A 3SJUA 1O0SA 4BHTA 2VHYA 3DZBA 1H0KA 4OYRA 1V9LA 3WGGA 4BNIA 3FPCA 3CH6A 1EFKA 4RQUA 5K0ZA 1CQJA 1ZFNA 4ID9A 4GAEA 4WCFC 3TQHA 5IXYA 2BHLA 5KVCA 1U3VA 1UUFA 2GD1O 1P1JA 3OIDA 3W4JA 4E2WA 3RWBA 3LQFA 2O7SA 1HYHA 2P9GA 1IOLA 2ZJ1A 3UAGA 2Y1OA 4W82A 1Q1NA 2YHUA 3H9EO 4DC1A 3WYEA 3K2EA 4JBGA 3DBHA 3C7CB 3PQFA 3RFTA 5IDQA 4D79A 2VYVA 4FSHA 1WWKA 1HE4A 3PFFA 1GUYA 3NKLA 3U62A 4BO4A 2ZTUA 3QLJA 3JQCA 3ZV5A 4LMRA 3GQVA 5TRTA 3AWDA 4GX2A 4TZKA 4WLEA 5JSFA 2YDYA 1KOLA 3OEWA 1U28A 1UAGA 4RVGA 4XRRA 1DJNA 1SMKA 4MIEA 5IZ4A 2Y1GA 1IPFA 4JJIA 3DHEA 3GHYA 5TGDA 4L74A 3M2PA 1H93A 2Q50A 3BYZA 5LDHA 1PQUA 4PLGA 2GYYA 3U09A 4O0LA 4CPDA 2Q4BA 1E7RA 2RBEA 1XKQA 3AUUA 5JS6A 4XGKA 5A1TA 3BMNA 1CYDA 1CWUA 2CVQA 4PG5A 4RLSA 1ISMA 3WGYA 4IJVA 3TNLA 4BOYA 1T2FA 1AHIA 2HK7A 4BMSA 5IN5A 3OHSX 4EUFA 1WNTA 4MOWA 4W9NC 4D43A 4MVJF 4PLVA 2H5LA 4A2CA 1D4FA 4B3JA 2W2KA 2V6FA 2C59A 1GD1O 5L40A 4RF3A 5A02A 3I9MA 2NWQA 3H9QA 4NFHA 4ZQEA 2DVMA 3DFZA 4R1SA 5GY7A 3BZUA 3RVDA 4YAGA 3AI2A 4P4LA 2VYVD 4GKVA 3NT4A 3H3JA 1JKJA 5DCYA 1R12A 5FFFA 3V1UA 2NVUB 2IYPA 3WQQA 4BNNA 1L7EA 1XU7A 5KIAA 4RJTA 1LA2A 3QRWA 4WOJA 4UAGA 5A9TA 9LDBA 1EE9A 2O50A 1KY5A 2Y1FA 4GLOA 2NU9A 1GQ2A 1MFZA 3GZ4A 1F8FA 2GN8A 5CFZA 2YFQA 2GF2A 1H9BA 1WLYA 3ZNQA 4GKBA 3VDQA 2BKAA 4GH5A 3HUDA 4XEHA 3STHA 4CUJA 3BHIA 3MZ0A 1E6WA 3OA2A 5FF9A 3TL3A 4E13A 1UAYA 3OJOA 4GX5A 4R41A 4ZQHA 2CDAA 3GK3A 1Z7BA 3KXDA 2O3JA 1E3EA 1V35A 2FPIA 2XXJA 3SBOA 1NVTA 3KBOA 1F06A 1PEDA 3SEFA 2GSDA 2OBYA 3NDRA 3ASVA 3PYMA 5G2OA 2EF1A 1NPTO 3EZYA 4A27A 2Y1EA 3Q0EA 5L7YA 1HLDA 4J43A 2DBVO 1EVYA 2LDBA 5TSDA 3JCZA 5BSFA 1N9GB 3NTOA 1Q2XA 1CDOA 4BO7A 4P4GA 4JXKA 1R0LA 5U4QA 4ZGWA 2NU6A 4LMPA 4CV3A 4A03A 4CMCA 3H7AA 2O7QA 4E33A 1DPGA 1YBMA 3BMCB 4R5HA 1R4MA 1RM0A 3TDKA 3OSUA 1Y81A 3S8MA 2WTBA 3EUWA 4NK4A 1C1DA 1E1MA 3JD1A 2PD3A 4DUPA 1LC3A 3RQSA 1PQWA 4CMHA 4P8RA 1NR7A 2TMDA 4J1QA 3Q2KA 5JXWA 4MINA 4U6SA 3WQRA 1PS0A 2POQX 6LDHA 4FS3A 4YQZA 2WD7A 2IRWA 1HKUA 2QX7A 4FN4A 4IBOA 3QV1A 5LC1A 3ULKA 4R3NA 1LRKA 3NYWA 1V8BA 2I67A 4F6LA 2BRUA 1HE5A 3FN4A 4KUEA 4MVJM 4WOKA 3KYDA 2XF8A 3BTOA 4R68A 1B2LA 1XQ6A 3OJFA 1KETA 1N7HA 1UP7A 3DMTA 2ZYAA 4DXHA 3GNTA 4W7IA 4BKRA 4XA8A 2VWQA 5EERA 4XQGA 3GNQA 4IS2A 2GPTA 5I9MA 2NQTA 2R00A 4RVFA 3SC4A 3MTGA 5AVOA 2E48A 3FHLA 4NBWA 1DC6A 2C0CA 1BTOA 1ZJYA 2PD4A 4JNKA 3ZW8A 3FTNA 4CMIB 2VZ9A 1EDOA 2FZWA 4FW8A 5KOIA 2VTDA 1SPXA 1BGVA 1LX6A 4XB1A 5JDIA 2IZ1A 2RHCA 3MJ4A 4JROA 3VKVA 5G0TA 3DMYA 5J23A 3ORFA 3VPGA 4DIBA 3QHAA 3QWHA 2ET6A 2VZ0A 5TQVA 3RD5A 1NFQA 3O26A 2VRCA 1DRUA 4KTTE 1GR0A 4RF2A 4RPKA 5HS4A 1ONNA 5CP8A 1FMCA 2Q99A 3GGGA 5A9SB 4M86A 3F1KA 3TZCA 4DVJA 4CLOA 2ZQZA 4URFA 4A10A 4BO0A 3CTMA 3SX2A 2J3IA 3U49A 4J90A 4LGVA 4ALIA 3WR5A 4BNGA 3QP9A 5CHEA 3COSA 4CM9A 4RDHA 4H3VA 3NX4A 3ZWMA 4I9HA 4YVFA 4CLXA 3LYLA 1NTOA 2OZPA 3FR7A 4IY1A 1PJLA 4JJGA 3WX0A 4TRNA 4RV9A 5JO0A 4BNTA 2D5CA 3JQ6A 3U4DA 1YQXA 4IXWA 3JD3A 4AJJA 1SOWA 3F9IA 1MA0A 4J4HA 4PLZA 4CM8A 2YDXA 1RJWA 4DQUA 2Y68A 4BUCA 3M2TA 4F46A 3NJ8A 4OXNA 3PWSA 4BV8A 1E7QA 3WNVA 1BW9B 3PDJA 3BIOA 1QYVA 2Q2VA 2EHDA 1GY8A 4W6ZA 3C7DB 3ABIA 2BELA 4A7PA 4L73A 4CM5A 2PR2A 5JPIA 2HDHA 2C82A 2WWRA 4PLYA 1AUPA 2DFDA 4MIYA 1YQGA 1KERA 4G5HA 3V8BA 5L7TA 4J9VA 3VH4A 4KQXA 4PZEA 1O5IA 2BGMA 2VUTA 4NFSA 1GZ4A 2DUUA 4GI2A 1HYGA 1UXGA 3ICCA 2PZMA 2JKVA 1LBEA 3TZKA 2ZCVA 3JQ9C 3CEAA 3QVXA 3LU1A 2CNBA 1K6JA 2AE1A 4BNJA 1ZK2A 1OOEA 1DIRA 1Y6JA 4ZU3A 5CEJA 4J1TA 4XYGA 3N58A 5DULA 4TVOA 1UP4A 4QXMA 1VL8A 4U8GA 3U3XA 5T67A 3M6IA 3IC5A 2O48X 4PLHA 3HNPA 2CZCA 4GWKA 4WECA 1X1EA 1E3SA 1R0SA 1R66A 4J1NA 3E5MA 5JMPA 1U1IA 1JAYA 4CMEC 2VHXA 1B7GO 1F14A 5THKA 3V1TC 3WIDA 3HG7A 3QW2A 4KTVE 3UVEA 1ENYA 2NLOA 1VL6A 3I9LA 2WYWA 3GVHA 4J3FA 2HMWA 3JQ7B 3ZCXA 3WGTA 5GZ3A 1JWBB 3NDJA 1A9YA 4N5NA 4NI5A 3OA0A 1B8VA 1FXSA 4LVUA 2JCXA 1GUFA 1M6WA 1X15A 1JVSA 1HE2A 2X5OA 1B3BA 1X0XA 2VUSA 2P5YA 1Z74A 4DLBA 1ONPA 1VM6A 3H8VA 4OQZA 4TKLA 4NBRA 3DZKA 5JY1A 1CETA 3K9QO 3AUSA 4MVJP 2R00C 4CM9D 5U1PA 2AEFA 4WCFB 1DC3A 1DBVO 4XR4A 5DOZA 2O3TA 4NJMB 3JQAA 4OJNA 4JCOA 1MFPA 1QV7A 1YO6A 2EP7A 8LDHA 2EW8A 1P33A 1YH3A 1JVBA 3NJ4A 4DYVA 4LCEA 1I10A 5EQDA 1DC5A 4RQTA 1W0CA 3GAZA 4GSKA 1PL8A 1NPDA 5A05A 2B4QA 3EAGA 2QYSA 4O1MA 1TT5B 3WYBA 2BGKA 2JJYA 4PG6A 1ZW1A 2DC1A 5EL0A 1P1IA 1G6KA 4CV2A 4DIFA 1Y5RA 4RVDA 5FWNA 1Y1PA 3EW7A 3FWZA 3ZNOA 1QP8A 1WXDA 4DBVO 5DN9A 6ADHA 5DBIA 3ON5A 2B4TO 4E5YA 3OEYA 1X7HA 5BSEA 2DM6A 3HN7A 4BL5A 4KWIA 1OC4A 2IXBA 2DPHA 3JYNA 3ONDA 3WOHA 2X5KO 2CD9A 5HBRA 3HDJA 1XCBA 3QSGA 4H15A 3EMKA 2H6EA 2D1YA 4FGSA 2VT3A 1TEHA 4B4OA 4K1LA 4D3SA 3MJEA 4WASA 3TRIA 3K2BA 3DZHA 1EDZA 1PS9A 4C7KA 3WTBA 2OL4A 1G1AA 2BFMA 1HZZA 3DDNA 4GX1A 2EW2A 1NM5A 2D8AA 2X1HA 2W98A 1PGQA 3GAFA 4WK6A 3ZWNA 4YAIA 3TPCA 4WEQA 1UZMA 3ZWCA 5BQFA 3DZGA 1HT0A 8ADHA 4HFMA 3LLSA 4UVGA 1I2BA 3FWNA 1QYCA 3KYBA 2P9EA 1HL3A 4I5EA 3HB4X 4BGEA 5G0VA 3K96A 2EWMA 5ER6A 1ZK0A 2VQ3A 1D8AA 3GGPA 3RBXA 3LK7A 3I1JA 5TT0A 3BMOA 3D5QA 5DCWA 3B6ZA 4YAKA 5KVVA 1R16A 4G81A 1F0YA 1N2SA 1PJSA 3PIIA 1PL6A 1BHSA 4HFJA 4OSOA 4YRDA 1AE1A 4CM1A 4CLRA 4BNXA 2Y66A 2C2YA 2Y99A 2G5CA 3UUWA 4DA9A 2ZK7A 4RDIA 1YJQA 3ANMA 4IIVA 4IDFA 5KNLA 4D44A 5K9ZA 5CPFA 3ZWVA 3H5NA 2DTEA 4ALJA 1LDBA 4KQWA 1O9BA 2PLAA 3AW9A 3S2GA 4J6FA 4E32A 4AJOA 3JQ9A 5EINA 1VJ0A 5CPBA 1K2WA 1PWXA 3Q2IA 1GTMA 2X0IA 1BW9A 2VZ8A 3CINA 3IIEA 3PZBA 1Q0QA 1TB4A 3QVWA 4EEXA 1NXQA 3ENNA 3KLPX 2BI7A 3K30A 3TN7A 4A73A 3ANLA 1VSVA 1PZFA 3IKTA 4PLCA 3P2OA 3MJCA 4JBHA 5K6AC 1ZBQA 3GDOA 4YBZA 3G3EA 4PIVA 1I8TA 2GDZA 1TT5A 2NNLD 4NHEA 2VCYA 5AYVA 1ZEMA 4NZ9A 1A7AA 1H94A 3E8XA 3WMXA 2B4RO 4EUHA 3L07A 3E9NA 2SCUA 3DFUA 2XPCA 2NTVA 4FCCA 4BO3A 4W99A 3A4VA 1EMDA 3E5RA 1DFIA 5GZ6A 3KYDB 2VUUA 1YWGO 2HK9A 1YDEA 3WDSA 1Z45A 2GNAA 5ILOA 2IXAA 3B1FA 1QLHA 2YV3A 3V2HA 2CSUA 4D3FA 1Y8QB 1IE3A 4B79A 1YXMA 2GR9A 1I3MA 4BGVA 2H63A 1DJQA 2WYUA 4BNWA 5COBA 4BMVA 1WP4A
chains in the Genus database with same CATH superfamily
2F2TA 3C6YA 2ZRGA 1W73A 2J3EA 3RT1A 2WE8A 3CNOA 5IBRA 3UBTA 3NXKA 2E49A 4J16C 3IILA 2EGGA 1I9CA 1RNLA 2N9UA 4R6XA 1NUQA 2QLBA 4PZDA 4V2UA 4OLAA 4NBTA 1IHUA 4BEBA 4AKSA 3TE6A 3I01M 4YJKA 4MVWA 3L8GA 4MQ5A 5HRUA 2X8JA 3RRBA 4NECA 4UCQA 4U6QA 1WCV1 4I50B 4CU2A 4K9QA 1RHJA 4I1OA 3LK6A 4JP8A 1P77A 5KWIA 5IM4A 4YEDA 3I8XA 3DEJA 3K9GA 1KZHA 3W1EA 4BMYA 3MTBA 1UBEA 2EBWA 3C15C 1SKUA 2IA5A 4UVIA 2XUHA 3VVBA 3ND5A 2AI1A 5K0SA 3E7WA 1RABA 1E2IA 1DG3A 1RR6A 1NVWQ 3BIWA 4WESA 3UHAA 2RE8A 1O57A 1L9XA 1P9OA 3EVCA 3GUCA 3SBDA 5AICA 5BT9A 2E89A 3WZLA 1V1JA 3FKQA 4NS1A 1EH5A 1PFQA 1Z39A 2BFOA 2GD2A 5LYYA 1KI1A 2HA0A 3GZNA 3A1NA 4N5IX 3IIMA 4HWGA 5JBIA 1Y8ZA 2Z95A 1OI3A 3COVA 5JVDB 3VH1A 1TX4B 4FLFA 2GZ3A 2XJ4A 3B51X 4JEUA 3OG9A 3BL5A 4IX1A 1OXBB 3LQ2A 5KNCA 2HQ1A 2WB4A 2WHXA 2RI0A 3OLZA 3RVJA 5H70A 4RFLA 1BDBA 4GFDA 2OEPA 2BL4A 2IWHA 1Y3AA 5C7LO 4KE6A 1BEUB 3EPJA 5J2UF 5CT8A 4YJFB 1IZ0A 3BXOA 1PDOA 3BUSA 1GA1A 3HCCA 4MTLA 1GSHA 2IP2A 2LUOA 5AXAA 3VR6A 3FVRA 1V95A 2QYTA 4GR5A 3R2JA 4PYOA 3ZWOA 1GZSA 4C07A 5K0EA 2Q3DA 1C1DB 4BBJA 2PGDA 2I2XB 1GUBA 3ESAA 1F2UB 2ZREA 2P27A 3THOA 4AZ0B 4Z7QB 5TARA 2CUNA 3N5CA 3E2MA 2RAFA 3K35A 2XSZA 1HMPA 3UUFA 1W4BA 3LKZA 1NXXA 3UWDA 1P4SA 5AESA 5IVHA 4ZO6A 1L8QA 1EB9A 3BMOB 1MEEA 3LOPA 1H85A 3MPUA 4GECA 1PO7A 3CN7A 2ERXA 3KM0A 4LGMA 4J7XA 3J7TA 1DEXA 3ZPXA 4C7OB 4EENA 1FPQA 3KUDA 3VISA 4I1SA 3KVOA 3DP9A 4OK3A 1XTVA 3LE8A 4TMVA 2WHRA 1L3BA 2YWHA 5THXA 4R2KA 5JNLA 1H6DA 1BXKA 3CYFA 4V3BA 2O1WA 2DUJA 5EIBC 4XB6B 1X92A 4RBNA 4BV3A 5B3LA 2A88A 1OLUA 4OFXA 3GJQA 1C7RA 4W5QA 3AIMA 5EJ4A 3I4LA 4YJGA 4I1YA 3FB1A 1ZP6A 4I19A 5FI1B 2H3HA 1N1GA 4AX8A 3G68A 4E2YA 3HFGA 2ERYA 3DMNA 4GLFA 4LWZA 4BBPA 2M1ZA 3R09A 1SUPA 2W2KB 1X7ZA 1C41A 4II3A 3K0KA 4XWTA 2DBRA 4MP3A 3EB9A 1M75A 2IPLA 2H4JA 3A4MA 3OU6A 1WXFA 4X00A 2PTGA 3RSGA 1KYVA 2JEOA 1K97A 4IIDA 1QGYA 2QLJA 5KOJB 4QULA 2RGRA 1TEVA 3EY9A 4L4UA 3EXHA 1PYDA 1U1EA 1J49A 3AHHA 2E4UA 4DLSA 5CAEA 1QMGA 1CQWA 1EUDA 3BQ9A 4INJA 3B5EA 5H81A 1XNQB 1BS2A 1SCJA 2JBAB 2XRFA 1FTGA 1UDXA 4KYVA 2YNMC 4HDRA 4HNUA 4IDHA 1AKNA 4BO9A 3RIMA 1UJNA 1XRMA 4YY3B 1FXUA 4BE4A 4XM1A 5AKEA 5DW3A 1KS9A 3AM1A 3F96A 1GFSA 5IWCA 2CJFA 4HDKB 1G63A 4N41A 5HMMA 4D9CA 2GZAA 3QK7A 1BHQ1 5LP6C 1BRMA 3EOZA 3D7NA 4G1MB 5AUPB 5A06A 2RIRA 2C20A 1L4LA 2A86A 3KVYA 3PB3A 1A77A 2VQ6A 3RFFA 2OHHA 4DF3A 1J7JA 1M7HA 1GA4A 1XMSA 2FRDA 3G0OA 4FZRA 3ZQKA 1OKKA 2VP2A 3ZH2A 3GBPA 1CS0A 1AUOA 3GJ6A 2QLTA 4U0KA 2O8BA 1GYRA 4K81B 5DYWA 4KYIB 3RVNA 3OZIA 2VEDA 3IOCA 2BVNA 2HXSA 1M1XB 2FSHA 3HC7A 5AW3A 3GLVA 3AFGA 5F2EA 3T7EA 3AM4A 3E1KA 4NHOA 5FBVB 2ZBEA 4C3VA 1VRCA 2PMWB 2P90A 1DIAA 4XVRA 1D6SA 1ZA1A 3CVJA 5EHNA 1PSZA 3DB1A 1UIMA 3EVEA 4K0RA 5B3JC 1KVTA 5IZCC 1HT2E 2YRWA 1JE0A 4PG8A 1GVNB 2Q3MA 1YONA 2VDRB 3KSZO 3CISA 3PYLA 3AONB 3DL4A 4FWIB 4KAAA 5ALKA 5FEMA 5MFPA 1ML4A 1G19A 3HUEA 3I2JA 3TUJC 1YTLA 1O08A 3NOXA 1LU9A 3BM5A 4EMBA 3ZVKA 1QRSA 1K06A 2BGIA 4HLUC 3WYAA 2O06A 3A1VA 3BWMA 3WWYA 4RSHA 2QY6A 3IUMA 1J00A 2FZVA 3DKVA 2F1KA 3D6JA 3W3AA 3HR7A 4TRMA 1P80A 2GM4A 4J49A 2RIPA 3PWTA 4UPEA 4CR6A 4Z2YA 1ZUD1 1UFOA 2X1MA 1LDYA 3WLFA 1XELA 1CC1S 3DYIA 3FH0A 4EG3A 1Z0UA 2F8LA 1AC5A 1UC4B 3D7MA 3M83A 4KP7A 4HJRA 1MDFA 4AP6A 3THXA 2DLNA 2WSBA 4Q4JB 1D6MA 3GQBB 4MUJA 4L5CA 2OK8A 4XWAA 4IJWA 5KKAA 2G1KA 1WMFA 1HFJA 2LDXA 4OAOA 3KVRA 3C6ZA 4OXQA 4E5KA 3N39C 1NXPA 3R8FA 1ODLA 2WKRA 2C9ZA 3KHUA 2FMFA 1T9CA 2HDNB 4IRXA 5I45A 2GH1A 4PFQA 3SQMA 2GPSA 1Z0AA 1NP3A 1L1RA 3OETA 1HUQA 4I8XA 4BRUA 4CTMA 3WIEA 5F7XA 4CCAA 4ZJPA 3CWQA 1SXPA 4OGWA 1RRKA 1MB4A 5A7FA 1MJNA 1NQWA 2XIJA 3H1TA 1Q7CA 2RGBA 4CIAA 4DARA 2CJWB 4AO7A 5KTOA 2D2EA 5EQFA 1HNWB 3IPRA 5L53A 3D4PA 1XEAA 4BPRA 4D9GA 4ZVKA 3EVTA 3HKCB 2FEOA 2H8GA 1HSOA 2ZRCA 3OICA 1E2JA 3TIFA 3T3DA 4H4CA 3ESRA 3HVIA 4ITUA 3LZ6A 2QRGA 3OU2A 5EIOA 3UT6A 3A1FA 4JUAA 2XOKA 1Z2OX 3AB3A 1E5VA 4FFOA 5T4FA 3UMYA 3GD7A 2PGLA 2XLBA 4R1NA 2CVZA 5B3KA 4IIBA 1FU8A 3ZWDA 4N7MA 3UXHA 1HLFA 4UASA 3FCUB 1KVUA 3EXEA 5EIAA 3PGLA 4JQSA 1VCNA 2P7IA 1Q15A 1A8QA 2HJWA 1SVWA 5FOUA 1UQRA 2VDVE 3U7RA 1J0CA 3KC2A 2D5IA 2MSWA 3OT4A 4N8SA 5HQJA 3RSLA 2XIQA 1GIAA 2BZ0A 2N75A 2WAMA 4IIJF 4YUXA 4G63A 4HF7A 2Q21A 1QK3A 3FLMA 1FW6A 4LYDA 1JIIA 2PD6A 3RFVA 1O6GA 4DEXA 1X8LA 2RHOA 4MR8A 3R3WA 1MPXA 1KKMA 2AWOA 3AC0A 3D3NA 4WPGA 3RKRA 4DCPA 3E3NA 5EKUA 1QFSA 1X3LA 1Q7BA 3E9YA 1JIUA 1QG2A 3K0HA 2VTEA 2PX6A 4P32A 3AIKA 2A3RA 1VE5A 1Z6AA 3LT5A 4NQRA 4TQ9A 4QWMA 4FEYA 1FUIA 4MVJG 2WTXA 2YV5A 1V45E 3BOSA 3GVPA 4PCUA 3AGQA 1RMYA 4NOLA 3OTGA 4Q16A 3BQNB 3RHZA 1FRVA 2ZUUA 2HGSA 5E2IA 3GUHA 3O82A 2ZIVB 4AU1A 1KBZA 4DUGD 3EGCA 4E7OA 4DXDA 4C08A 3WGUA 1TW3A 3C6MA 2X0DA 3DAHA 2ZSAA 1VDMA 3KK0A 2X8WA 3I5XA 1RI1A 3W79A 3H5RA 3I5AA 3PA6A 4B83A 2Q9UA 3I23A 4HWPA 4G0UA 3IVCA 1EBUA 4N18A 2IX9A 1WHSA 4DDTA 1EUCB 1OX5A 2FVXA 3CLHA 1NZJA 3DEZA 4QLOA 4Y18A 5EKSA 3WL5A 2HPVA 5JFOA 4RIHA 1H2HA 4ZOLF 4R51A 1A96A 3W7VA 2XKAA 1EK2A 1XLWA 2FR8C 2BCGY 2GNPA 5FUXA 1VGRA 3FHTA 2FU5C 2QD3A 4NMLA 2CNWD 4S0XA 4JI2B 1KI3A 2E5WA 1XDWA 5JJ5A 4B9AA 3ZGOA 4KACA 3O8LA 4N76A 1L7RA 4MW9A 1IBKB 2VJAA 4ENUA 2E1PA 1TQ6A 3IR6A 4PQFA 4WZAE 4M7OA 4HXEB 4MLPA 4YDSA 3Q3CA 4HWSA 4L3OA 1WMBA 3N6RA 3QV2A 2XUQA 2IV2X 3WGJA 2A92A 3A32A 4RLHA 1A82A 1PGOA 2R8YA 3QJ5A 5IHXA 5ALPA 1Z5VA 2YWFA 1D1QA 4IV8A 1RXYA 4NCHA 4Y9RA 3RVPA 4CQJA 5LPNA 3EVBA 1E2BA 3ELDA 4WRRA 4PXSA 4PIPA 3QXJA 5HDQA 1FDSA 2YJGA 2DERA 3OFNA 1BWRA 2VDKB 4CQMA 3ZLBA 1BZYA 2WQZA 2XDQA 4D3DA 2IYEA 1SHTX 2CNKA 3BZBA 1FYFA 4P83A 2QI9F 2R6DA 2VXOA 3H1BA 5ILGA 2C58A 2NVWA 2ZIWB 3TEJA 2J32A 4IICA 3M1LA 4L02A 4UREA 3ORYA 3RRFA 3T3IA 5K0TA 4X60A 2ORIA 1L5VA 1IN1A 4YRGA 2Z8YM 3WFIA 1UBJS 2A9KA 2QE6A 1LS6A 3G5AA 1BVRA 4X6UA 3Q0TA 5D7BA 3RLIA 3D6FA 4EBBA 1KIFA 2XUJA 4E1BA 3KPWA 2ENWA 4LXGA 1WY5A 3PDIB 4M49A 4OOEA 4RHYA 3N74A 4DM3A 3R6DA 5LQAA 1UDAA 4MR9B 1YQQA 1U9IC 4YT5A 1H1DA 1JEYA 1TW2A 4O4LF 2W6QA 3SKYA 1RHQA 4KN5A 4G56A 3NBFA 1QU2A 3DUFA 5C46F 1U6IA 2GN9A 3DEYX 4MV6A 4NBVA 3ZG6A 1A27A 2ANBA 3DEFA 3B13B 2D8MA 1E8NA 4J3NA 2FR1A 3U4CA 4CG2A 5B6PA 2AUNA 2C03A 4CR8A 4BO1A 5K3EA 1NRXA 1VC2A 5A5EA 4M1EA 2RH9B 3A9CA 4FYXA 3AEKA 1ESMA 3QLVA 4B6FA 5BUZA 4XSHA 3IHKA 3ST7A 3RRMA 2R8PA 4D0SA 1GNRA 3R9XB 2CHQA 5JAQA 5C1DA 3W3ZB 4C6TB 1OBCA 2L17A 4RD6A 1RLMA 2G0TA 2XKKA 3KKQA 4F3KA 3EXFA 3KT0A 1Y8RA 1OLXB 3MTJA 3O3OB 4XIJA 3LWNA 2FPXA 4YCNA 2KYRA 1MF7A 1PZHA 2A5GA 3LKBA 3GIWA 4ZU1X 3K09C 1TVKB 5B64A 3S2UA 3RKSA 2RKWA 1WZUA 1Q22A 2J0SA 1OUMA 3TKAA 2GTIA 4IF4A 4JQOA 2IYWA 3MLAA 5FR2A 3G2JA 1B8OA 1PZEA 2BN4A 1GTZA 2HIAA 4AN4A 1TTPB 3SWWA 3VNUA 3BFKA 4R0VA 1U2DC 1SXJB 1C7IA 2OP1A 3QKRB 4OO3A 2BLLA 3VPHA 5KOJA 2HCTA 1GPMA 3AB7A 4MWTA 4BQPA 2PL5A 1VDZA 4KN6A 3FOZA 3NB0A 1SOMA 1WKBA 4EB8A 4G86A 3VPDA 2A67A 3BS4A 2AT1A 3BHJA 1X7ZB 3ZV7A 1VPLA 1ZXXA 2G1UA 2J1LA 1VA4A 5I7AA 4FIZA 5JJCA 2A1UB 1W34A 3M3DA 4B2LA 3CZRA 3MJSA 1CY0A 4GOOD 2VBCA 2OD9A 3FWPA 3B48A 1WMDA 4KC0A 4L75A 2PCLA 1Q7RA 4EH1A 4KGVA 1RVDA 2VTBA 3F97A 1EG7A 1PR4A 2VT2A 3KELA 4ZXFA 1MX3A 2TSYB 1ZMBA 1KH3A 2Q9BA 3NTXA 4HGQA 1TJYA 4JP5A 1N8KA 5IBQA 3OJEA 3B53X 4UOEA 4C7OA 3K9HA 2PS9A 2V97A 1XTTA 2XCUA 2PKQP 1CY4A 2WWTA 4M1TA 4DNXA 3WL4A 2X77A 2ZTSA 3DYBA 4HL6A 1PF7E 5FTWA 2PNJA 5A9RA 1K86A 1NVDA 1O5TA 3IJPA 4J29A 2LPMA 1MOZA 3PTZA 3JSAA 5AJYA 5ALGA 3QYFA 3EVGA 3V2UA 4UNNA 2Q5JA 1DV2A 2XVZA 3B82A 2E82A 1CSEE 4B5LA 1DFGA 2OD7A 4YAFA 2K7FA 1ILEA 1JS1X 4H6XA 2XA9A 3RYTC 5HGXA 1YOVB 2ZYGA 2FX3A 2QRQA 3L8FA 1HE3A 4E07A 3L4BA 1UAAA 2QDKA 2HIGA 2I1LA 2YQ4A 3PHCA 4JKIA 3ZIDA 2CZQA 2XV1A 2PRYA 1EWYA 1IJFA 2ZUFA 2H1SA 3CVYA 3IV7A 1UJMA 1SBCA 2O6LA 1QR6A 1ZEJA 4IXNA 3KEMA 2YIMA 2E4WA 2YMLA 1E1CB 1CZHA 3IVRA 3K1TA 4JB3A 1IZ9A 3OJCA 3UAZA 2I7TA 1ESCA 3HU1A 3WB2A 1GKIA 3N8NA 4M2LA 4AKIA 4N5DA 3BJZA 2I4TA 2WWWA 4UTOA 3MSCA 3C85A 1S5PA 4GSYA 2OTCA 4YK7A 2WG1A 2UYOA 3OQIA 4Q4LA 1OXTA 1HKHA 3LCJA 3KXPA 4BB5A 3THWA 2AN1A 4JZYA 1FSPA 1DJMA 1QGUA 1T4CA 1X3SA 2B3DA 3VXKA 5H83A 4IDGA 3KQKA 4EM6A 4MRNA 3U6KA 3BL8A 3RV4A 3S2ZA 2O8VA 4BASA 4KWCA 2XGGA 2C00A 3RWOA 1RE0A 4C3ZA 5KYUB 3I0NA 1VKOA 5F1PA 1KZ9A 3ZWYA 3TZ6A 1I5EA 3ETJA 2OG2A 1JRLA 2PGOA 5CRIA 3W2FA 4FE7A 4KUGA 2Q1XA 3GLFE 1OGIA 1X7XA 1HOTA 1OJ7A 1XK6A 3GEBA 4PICA 4RPHA 1XTUA 3WKAA 4DCUA 4DN6A 1GRNA 4MV9A 3A3KA 2ZYWX 2G4LA 4QEDA 3VR6H 1Z4LA 3PR1A 4ZQGA 1Q84A 1V7QA 1HLPA 1C9YA 1U0EA 4GOND 3VKHA 1RKXA 4CM4B 2P1RA 4UTPA 1N78A 2F1HA 4ND4A 1IWBB 4PY2A 4WNCA 1S9HA 4BIIA 3LX8A 5F64A 3E05A 5JCZA 3HBJA 8ABPA 1OAOA 4MV7A 4NULA 1DLIA 5BSRA 1Z06A 2VCEA 5AHRA 1H0HA 4WKBA 1FZQA 4TV8F 2AX3A 4KQGA 3VC3A 5LUAA 1EXMA 2MYTA 4FW9A 2CBXA 4DCOA 4S2EA 4CL2A 3TBHA 4MPTA 1E3WB 4HZUA 3KQYA 1P0PA 4OMUA 4P4TA 4DJ5X 4LSWA 4HZIA 5CD1A 1U28C 2Q4RA 3K92A 3SC2B 1U7UA 4CW7A 3UAVA 1RC8A 3QXGA 3ZLUA 3PC8A 3PS9A 4Q34A 2P67A 4I3HA 3SS8A 3K3PA 3UF0A 2YY7A 1WD7A 2C9BA 1FXWF 1NNI1 2G6TA 2WIAA 1MX5A 1N2IA 1COWA 2BH9A 1AZWA 1I3CA 3ETHA 3JZMA 2FUEA 1BGWA 3HR4A 5BV7A 1JDVA 1QK5A 1L9KA 1TZKA 2CDBA 2P4SA 3LXXA 2XMPA 4EDFA 2NUPB 1X80A 2YZ7A 3QMPA 4QIHA 2GEFA 3WK8A 4FUQA 3CH5A 4YMGA 2ZXUA 1J5PA 1I6WA 1O94A 2I9KA 4MROA 3WK4A 4AJIA 3RRXA 1ZSYA 2O2XA 4MV4A 4LF7B 2BFNA 7GPBA 1PTJC 3EUAA 3H6HA 4UHEA 2ACKA 2UYQA 3KOUA 1G3QA 2Z2YA 3D6AA 5EHGA 1R8QA 1I2DA 2LGJA 2OAGA 5C4GB 3ZHBA 4PXAA 5F7OA 3RBAA 3WBBA 3WP1B 2AI2A 1QPZA 2HYIC 3F5DA 3KSUA 2YV1A 1YK1A 3E5NA 2HWUA 3TOXA 1YR1A 3SLGA 4A1FA 4FN5A 1KI7A 4MB0A 1U7HA 3L18A 3N2KA 4HDAA 1Q92A 2BMWA 4NARA 2FX5A 2HCBA 4L4SA 2VFAA 5LBTA 1X6VA 4DQ0A 1Y1SA 3DMRA 2C4UA 4M36A 4OK5A 4MKRA 4ZCMA 3LECA 1XEFA 2W0MA 3NORA 4DQVA 2QTHA 5LQCA 1PEKE 1QNLA 4FFBB 4ZOBA 4ZRNA 4BVAA 1PJ2A 1YB2A 4Q3KA 3TAUA 4YYZA 5JSZB 4IVNA 1JSXA 3KWFA 5ADWA 4HGYA 2G70A 1M74A 2QTZA 3N2ZB 2B4YA 5AFSA 1WKCA 5D01A 4Z4GA 1UDBA 4FDUA 3ZY6A 1F51E 3O4RA 4TTTS 4DHEA 3MOSA 4QHSA 4UDNA 4X3CA 1UBCA 3N8DA 4J76A 9LDTA 1AX9A 3OM0A 5JAHA 2WNHA 2XYPA 1TO6A 4WKCA 4ZALA 4QPPA 5DSXA 3KDSE 3EC2A 4PC7A 1LX7A 2IPAB 2P9CA 3GJRA 3MCVA 4NYJR 4TT8A 5AM1A 4CIXA 2SNIE 5JFGA 4DAEA 1L5RA 4HDNA 2QX8A 1JHRA 2ZI5A 5KVSA 3SX4A 4X1IB 5SY6A 2GOYA 2VK4A 4FYPA 5AI8A 2J4CA 1JKFA 3M6UA 4JD5A 4LISA 3ZTWA 7MDHA 1T5DX 1XEXB 4QC2A 4U7JA 4CFYA 4WGGA 4DR7B 2WNSA 2O3RA 3LOUA 2J30A 2SBTA 3B1ZA 4O2BA 2CHUA 1KVRA 1UKYA 1X1BA 3AY6A 3H75A 2PH1A 1T5SA 2V7TA 3JQEA 3O8NA 4P08A 4F9TA 5KWVA 5LM3A 1KO4A 2I6FA 5LXTA 2VSFA 4I9GA 3TZEA 1NT4A 4YIHA 4LI3X 3DE6X 4DMUB 2QENA 2O8DA 3ONEA 1Z4QA 1ZK3A 1JLLA 3PXCX 4FR0A 4GOKA 1HDCA 2IU0A 4BGUA 4AM8A 2YKGA 3PIDA 1KI2A 2Z5GA 3G9TA 5CYGA 1GTSA 2QTGA 2ID9A 2VVTA 2GERA 4E08A 1ATZA 3D0OA 3LFUA 2OV2A 5IDYA 2R9VA 4KMRA 1R0RE 4Q0MA 4BMPB 2VH5R 4W1QA 3L8ZA 1GAEO 3W5VA 5HNKA 3E23A 2WVJA 4REQB 1HEIA 5FH9A 2Q2NA 2ATCA 5FOQA 4DEVA 3T52A 3BTVA 3LDAA 4WJKB 2WZQA 2R11A 2DQ4A 3HEMA 4A82A 1QIEA 1VXOA 3BA1A 4FSXA 4MJ3A 4XWOA 1E9EA 1RWMA 3GT3A 2RK4A 1ZK4A 3ZU5A 1QHHA 2W2QA 4WK4B 3N2EA 3DXXA 3C48A 3KEQA 5EE3A 1C0LA 3D5EA 1EVEA 2HCJB 2HMSA 4O4IB 4XPIA 1ICEA 4Q1DA 1G3RA 2JAQA 1MAVA 1OXUA 4P7KA 4RZIA 3VYVA 2VP6A 4TROA 4CF4A 4Y2QA 2QTCA 2B69A 3JR7A 3HGQA 3LVFO 1UZNA 2YINC 1M1ZA 1RAHA 2I3ZA 2V54A 2GGSA 3E1SA 4UCXA 5J4VA 3OZUA 2SCUB 3KWJA 4EW1A 3QVKA 3EEIA 1GRVA 3K20A 2MMCA 3PJGA 2PGJA 5IZCA 5JDCA 4MJLA 3AEXA 4UVDA 4KODA 4BKUA 1JIVA 1TQ4A 2QRPA 2VPQA 1WXIA 2WTAA 3LJKA 2VYFA 3KZ1E 1TRHA 3OY2A 1SZCA 2QN8A 1FQJA 2FF5A 5H8WA 5B36A 1UMDB 1R6DA 1LFDB 4LHVA 4IIJA 3FDZB 2L18A 5I7EA 3TSCA 2ZAOA 4BP3A 4XDYA 1QBGA 3FDXA 3RRZA 5GV8A 4X7BA 3WK5A 2IOFA 3MT9A 3Q41A 4RA6B 4ZEMA 1CHDA 5FORA 1A4RA 3KZMA 3N6VA 4NICA 3FD8A 1AU9A 3SEQA 1L8XA 1SKQA 2RBGA 3TMYA 3ZZTA 1O8CA 5ER9A 3AGPA 3EZLA 2LBPA 5JG7A 4AY5A 3WDLA 4W8HA 4CFZA 2E9SA 1X86B 2Q9AA 2AB0A 3W77A 3OZEA 4HQRA 1GPBA 2YXNA 4BGIA 1CR2A 1JHUA 3V6MA 4EUKA 4C2UA 1NN0A 3GJ3A 4JB8A 2RKBA 4FSDA 1NOIA 1XVTA 2NACA 4JT2A 4JZKA 1PFKA 1ZSVA 4PV7A 3N8KA 2BI8A 2FGJA 5DYGA 1OBFO 3EJWA 4U7HA 2F1JA 1CFJA 1R2QA 2DJIA 3R23A 4YMWA 2RSLA 2O8FA 2JARA 4NL4H 5KNDH 1QOQB 2PZKA 4ZEXA 3T41A 4U9UA 1NX6A 2G3YA 3SFZA 1ND6A 3K0EA 1ZI8A 4X66B 1C29B 4TX1A 4AQYB 3DDZX 2XNKA 3V9PA 2I80A 2PXHA 3UMSA 1J2TA 4II2A 3H8WA 4KJZA 5A2GA 3ASUA 3P9SA 6REQB 2BBTA 1DQYA 2LKDA 5EHQA 3SHQA 1I4TD 4Z0NA 4E6PA 4F4IA 1T2CA 4IO0A 5F2OA 2VJMA 4HUTA 3QVTA 5ERGB 5KNCD 4CDNA 1X9IA 1QC5B 2WHYA 3GT0A 4RF5A 3EFHA 3MOGA 3X44A 2QQFA 1XN4A 4GMFA 4XARA 2GM9A 1K8XB 3EXIA 3WP0A 5CFOA 1YB1A 4JN6B 2DPXA 3OE1A 3S2EA 3DP7A 4JUCA 5JVDF 3LUKA 2WD9A 2Q1UA 5ALLA 2PS3A 5AKJA 4BP1A 4I5FA 3ZDEA 1UK9A 1X1RA 2Y1XA 3F2IA 3QPAA 2WJYA 3V4OA 2HBQA 4Y9UA 4FX2A 1IYZA 4XCQA 2ACEA 4BE7B 1Q17A 3RK1A 3S8YA 2JGNA 4BS9A 3R7BA 2CMGA 3BE6A 1H2ZA 4ZAGA 3FM9A 1PV2A 3UM9A 5F52A 4B3TB 4Y9SA 5AW1A 2R6JA 4LJ4A 1E2UA 1FP7A 1V0JA 1WDTA 1LV7A 3A0RB 5GPBA 1D6NA 3FYUC 3HP7A 3OOEA 2ZB7A 3D3WA 4LDRA 3ZE1B 5TPWA 1M67A 3TGLA 1GQYA 2CLHB 1ZD8A 5C3UA 2NU7A 1PK8A 3OKCA 1GRQA 1L4GA 2GPBA 1R6TA 4KQCA 5IKMA 1U31A 2JFQA 3KXKA 2MINB 4R3WA 3ANYB 3G85A 3SIXA 2BZ1A 2ZYDA 4RTKA 3UW1A 1Y42X 3M3HA 3OFSA 2H4YA 5C8XA 1YU9A 4F5DA 1Z7EA 5DOVA 1OLSA 1XCJA 3FJOA 3H5VA 3HFRA 4LY0A 4XYMA 5IJ0B 3UPUA 2AH5A 3TW8B 3RPEA 1JKIA 4ZYUA 4BQSA 4S35A 3I45A 2QP3A 2JIRA 1YL6A 2NZUG 4QU9A 2UZ0A 1ULUA 1OFUX 1DDIA 3CLVA 5G4KB 2DXIA 5G02A 2Y9MB 3DE5X 4OD0A 1JJBA 3T5DA 1JLSA 5DHSA 1DRKA 4ZCTA 1DC4A 3E58A 4H4DA 4KVFA 2FOXA 2YS6A 4BVGA 1IJBA 3BCUA 4CKWA 2J5RA 2I6UA 3DO6A 4BMCA 2CZGA 2IEGA 3Q8LA 1OD6A 1NPYA 4RH3A 4KOAA 2QTMA 3P5SA 2IXEA 1NU6A 1GN8A 1VIMA 2WK1A 4N54A 3KJGA 2VP5A 4A36A 1Q83A 3JASB 2YWDA 5HTKA 4YX9A 2C7QA 2YN2A 4O4JA 1TKBA 1F20A 1MRZA 5J2TA 1DIOB 1EAYA 4P2BA 3RU2A 3IBFA 2AK3A 1SEVA 1P2GA 4P2GA 1QKKA 4DC0A 4OHXA 2OESA 4DR3B 1BXGB 1C3OB 2OHIA 2PKWA 4MUNA 5D5QA 3F3KA 2PBRA 1ZXLA 4UBIA 4IUCS 4ID3A 4B8WA 1G6Q1 1T1RA 4EW6A 3EZ7A 4BTVA 3I73A 4CTKA 1JG1A 4BNVA 4DT1A 4G8BA 1NQOA 2TMYA 3QPCA 4DT1B 1FRNA 2R7KA 3NEPX 1YFZA 5KB3A 3UXYA 5B4TA 3T3HA 3UFXB 4NYIR 1HDXA 4A0SA 5CG1A 4W6QA 1CYEA 4EMUA 3D3QA 1MVLA 4C06A 4YWHA 4C6HA 2G82A 2H3EA 3JQGB 4QFMA 1I0ZA 1PUXA 1BVHA 3B7GA 3D8UA 1JWLA 2NP7A 1KBOA 2YMMA 2VF7A 1RYYA 1OX4B 5CFRA 2I7CA 3DHVA 5JH7F 3C0KA 4WBNB 4YRNA 2QM3A 5COQA 3ROXA 4X44A 5I9LA 4C43A 3K8OE 1VA5A 4FGZA 1N2CB 3OX2A 3WIVA 3UH0A 2XT0A 3EXG1 1S01A 2A1TR 2QY9A 2ROQA 2ZKIA 3L6EA 3LHKA 4X62B 1RCTE 5JXIA 2D6FA 3RC7A 1XZJA 3U4HA 1X7WB 2XTNA 3PRJA 2QXYA 4Q6WA 4R2WA 5TGZA 3Q5DA 5I9IA 1YZFA 2ZRIA 5C1OA 3N0VA 5HFAA 2ZUWA 5IJ0A 5H3HA 1Z73A 2VNAA 3AU9A 4LMBA 4Y6RA 2B2NA 1T29A 2G9UA 3ES9A 4ZQIA 2WNIA 3N87A 3AK4A 5SZJA 1F2VA 3TMKA 1XFAA 4BB0A 3ER9A 4L3VA 2JBHA 4XQ9A 5E6RB 2IEDA 3OPYB 3HYTA 5LLTA 5A0VA 3VR2D 1FJ2A 4QGSA 2FK7A 4GF5A 4LDPA 4BFLA 4ZZ2A 3WAKA 1Z8FA 2FXVA 4RM3A 3FUVA 4MO9A 2QRLA 1ENOA 2O3SA 4QL3A 4UEJA 4ESOA 2GO7A 3ITDA 3FIJA 1DDOA 1IPHA 2P78A 4HWKA 4EFDA 2KX7A 2HMVA 4RD1A 2NTEA 1E3QA 4EFLA 3ESQA 4Z0PA 5TPWB 4N7JA 3TG2A 2GASA 1GXSB 1Y1KE 3NIGB 2X4IA 1SG6A 4NENA 1WVGA 1TJ5A 1M10A 3R0IA 5ITZB 4KE8A 3AI1A 2O0MA 5IVKA 4UJ5A 2QQ0A 4MV8A 5ESDA 3TJZA 1D07A 3TJRA 4EPXA 4FC6A 2P6RA 1I80A 1Q7GA 1W0JA 3NWBA 4Q6BA 3HDHA 4L28A 4LYYA 3SN6A 3V4VB 2DTXA 2J9ZB 4C4OA 5HM8A 5JMTA 3ZLJA 3EN0A 3ZV4A 1HA3A 2YJNA 2WIGA 4EHAA 1GPWB 1CIJA 2C4KA 5ICFA 3CF4A 4EUEA 1W4LA 5KBYA 5LKRA 3THRA 3UGKA 2WF5A 3QYPA 1UPXA 4MAMA 2BM1A 5CVEA 1XT6A 3ZZ0A 4BNZA 4PYJA 4YMSA 4B4DA 3C98A 3L6OO 4GO1A 3REQA 1KMNA 2ZGVA 4BVBA 4IGEA 4AUNA 4HB0A 2DETA 3EIEA 1T1IA 2AFIA 3JQ8A 1R0KA 2WUFA 2K87A 2FNAA 2NO4A 3BSWA 3CLRD 1SRRA 3DDUA 3CW2A 2HIHA 4H1VA 2QTWB 3WC4A 1ETUA 4LK3A 4PQRA 4XYLA 3JZFA 4WTOA 5A4KA 2F55A 1QH1A 3HYNA 3Q72A 2W93A 1I3KA 3WGVA 2P40A 3H5WA 4YUYA 1CT9A 2ZW9A 2JEZA 3QFHA 5I8ZA 2Z4TA 1ZRMA 3KJXA 3M81A 4PTZA 4E21A 5F5NA 3W7AA 4B31A 2YFYA 1O89A 3DONA 1Y1LA 1P72A 3I0ZA 2ILVA 3FYDA 4OU5A 5CNKA 1OA1A 1XSEA 1U7TA 3IP8A 3KJNA 4I5IA 5J4KA 3GLFB 1XZLA 6YASA 4DS3A 1IUKA 2IF2A 4FKMA 2G7MC 4PAMA 1NN5A 4PZYA 2OBLA 5E8RA 3VUEA 4PYNA 4XLTA 4D4MA 1ODKA 3CUTA 2IYFA 3NBUA 2NSDA 2IWRA 1A69A 3WY9A 4EAQA 4F6CA 4QATA 2ZDQA 1RYDA 7AT1A 4LA4A 4KNYA 2WTMA 4A6XA 4N5LA 2OYSA 1R6AA 1LLQA 2C54A 2J45A 4LZZA 2LIVA 5TVGA 3M4JA 1YR2A 4KQKA 2FK8A 1IRIA 2WICA 4ZT5A 3GPIA 3K5PA 1CUYA 4Q1VA 2QGZA 3VR1A 1YJ8A 4KIUA 1XZNA 2C5EA 1QNFA 2WKPA 3LBIA 2VNJA 1CUHA 4ZI5A 1EDBA 3IERA 1RI4A 2OXFA 2PO7A 3PQCA 1D2EA 2BKUA 1T8SA 4W5HA 4P5PA 4ALKA 2H7CA 1FIUA 2NZYA 1YRQA 3AHFA 3QXHA 4G23A 2R66A 3QYAA 2PUWA 5CJ2A 4HQOA 4CODB 4KQMA 2B78A 4M1QA 5BNFA 2EYUA 1UBHS 3H16A 4J0EA 4UD6A 3RIYA 2OHFA 3ZXYA 3MNFA 2OZLB 4INAA 2XR1A 4RE6A 3W78A 3Q7QA 4R9VA 4CMAA 2EEZA 3PE6A 4AICA 3I37X 1W36D 1GZVA 4ZRDA 1ZH2A 3DPSA 4MS4B 4OEHA 1L2TA 5BQPA 1I7QB 3OQOA 2Y6UA 1I2MA 2VJCA 3OOWA 4M9ZA 1KPIA 2FQYA 2YR0A 3QA3E 4XQCA 3OQJA 1FDOA 4ZVQA 4EHNA 5AW5A 1KJWA 3BMNB 5IJ9B 3ADDA 1TM4E 3CZQA 3OKFA 4S1NA 4KR9A 1L5MA 4PRZA 3R7AA 3EFEA 4L2IA 1EX1A 2EOAA 3IVGA 4RPCA 4WZBA 2QT0A 2CYBA 4FMCB 1U8YA 1FE8A 3M8KA 1N2JA 1RBQA 2QR2A 3W3AD 1JA1A 4B46A 5I7HA 5FLKA 2VWGA 2IW1A 3GGCA 2D0PB 2FSFA 2XDYA 3ENKA 4KFSA 4Z7NB 1L5FA 5E7JA 2JFGA 4WNIA 4ZOCA 4ARAA 5BQXA 5ITWA 4OAPA 1T9KA 1VSBA 1JLLB 2FMTA 2BV3A 1LS1A 1PLLA 3FOWA 1K6EA 5IJXA 1KH1A 3FBGA 3WNQA 2RI1A 4YJGB 4M22A 2EEPA 1ETHA 1NW9B 1J22A 1D2RA 3VMFA 3COYA 4O25A 3IE1A 1HDIA 1DWPA 3FB4A 3I6YA 4ZICA 4LVCA 3RUHA 1EM8A 1XA0A 4MQEA 4QZVA 1O54A 3IAAA 3TCNA 4YCDA 5KJCA 4KO1S 4GGMX 4NG5A 3FUCA 4IMIB 3FPGA 1M1YE 2ICAA 5AXDA 4KO4S 5ULLA 4B80A 5EXTA 1P0MA 2RGEA 1OVGA 4QEKA 2V9CA 1XEXA 2ZFUA 3JATB 1L4YA 1Q16A 2AVDA 2BTQA 1JMYA 3LXUX 4NU5A 4WBXC 4ZT2A 3R7WA 3FGPA 2P9QA 2OGTA 1FFBA 1JFSA 5AI9A 4EVIA 3ACBA 3DBRB 4AW9A 3QUQA 2F67A 1ZGHA 3BERA 4GLBA 1KMCA 1DO8A 3VSEA 1E2NA 3WXBA 3P27A 5HG0A 4TLAA 3PENA 2NO0A 3QKTA 4KNVA 4Y2GA 2NT3A 3LUHA 4ENQA 2Q4TA 2CMKA 3O91A 3WQSB 5DNWA 4PRLA 3EF3A 3W7BA 1VCOA 1HTWA 2Q5LA 4DIUA 1Z6GA 1FB5A 3QU4A 4PLTA 2O3UA 1C8KA 3EIHA 3HQ4O 3PCXA 1I6LA 4LRYA 3BWDD 5JLAA 1LI7A 3FCEA 1YJ5A 2EFDB 4RS4A 2SHKA 5CDGA 1G5TA 3H0CA 1JTVA 3LAWA 4XYEA 4NYIQ 1S9DA 3RVLA 1CUFA 1SVOA 1BXZA 1FDTA 3PNKA 1RM4A 2EKZA 2OAQ1 3LQYA 5ELLA 4U2BA 1NA5A 3LW7A 4NIMA 1XZFA 5G0WA 5F4BA 4B84A 1LJLA 1OXMA 4NONA 2VNSA 4QQRA 2ZTMA 5AKIA 2ZT8A 1RC1A 1TU0A 3N0RA 1U8EA 1J9EA 1F4PA 1YSCA 2RFLA 1SCAA 3AR6A 3K9CA 2WT4A 5T6MA 1ZM2A 1H5QA 1VG9B 3QUCA 4RZUA 5ADVA 1DZIA 4KX5A 3WGQA 4U7TB 1VHDA 1N6HA 5T41A 1QX4A 2EDAA 2MYUA 2PANA 1JT9A 4UBMA 1MXFA 3QPBA 5HYVA 3L40A 3MQFA 1DAPA 3LL7A 2GZRA 4E4YA 4PBTA 2CXQA 4TMFA 1NNUA 3PUYA 2V0CA 1VKZA 3ZD9A 1KNXA 2YASA 3M33A 1CULC 2R0QC 2W6ZA 3PGVA 1TLFA 3NCHA 2GUWA 3RS3A 1HNXB 1CS4C 1GV1A 3F3YA 2EQAA 3JPWA 4R0MA 4YMIA 2RGNA 1KORA 3U7JA 4X91A 1XCLA 3TFOA 1G98A 3VYUB 4E2XA 3MWDA 3NAQA 1CUJA 4YXWD 4DMLA 1SUAA 1CFZA 3A1CA 4GGOA 2E7ZA 4C0KA 3F67A 3OF2A 2WWVD 1DIBA 3TL2A 3AXSA 1Y7HA 2ZS9A 2O1XA 3ZV3A 3X1YA 2XZTA 3FOEC 2X0NA 3NHZA 3TXAA 1EK5A 2NXCA 4OATA 3W2IA 4BKOA 4YUAA 1A5BB 2ONJA 1W52X 1MB9A 2ASEA 2CLKB 1NVXQ 2FMXA 1VRWA 4WLVA 2Z5VA 2RH4A 1WBBA 2GKGA 1HNZB 5CUQA 2I6GA 1KC1A 1PNQA 3EF1A 4LOIA 4URZR 3DTVD 4LF4B 3VNSA 4B45A 4CM4A 5A3QA 3C6BA 3IUQA 1ZNQO 1C9DB 3FPLA 1HORA 4I0WB 1YU6A 1NYLA 2XCOA 5C9ZA 2IKSA 1T4GA 3QVSA 5DBOA 2X5NA 1R5OA 1IZYA 3KQVA 3A6LA 2V6JA 2R8OA 3MJRA 3U1VA 4F3NA 4JLAA 1NHWA 2Y0CA 4XD7A 1ZZEA 3TMAA 1FSSA 3QE4A 5IHPA 1T5LA 3JVUA 4PEVA 1CZUA 3PJRA 3QBTA 2NXEA 5A0TA 1ESZA 5KYUA 2QVXX 3BJMA 3KU4A 2E55A 3UQYS 3BWBA 3X0DA 1ISPA 1K08A 4JUFA 4AROA 1RCUA 2YIJA 4HMOA 4JEIA 4OI0A 1L5QA 5KSYA 1LUAA