5CT4A

Wild-type bacillus subtilis lipase a with 5% [bmim][cl]
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
179
structure length
179
Chain Sequence
HNPVVMVHGIGGASFNFAGIKSYLVSQGWSRDKLYAVDFWDKTGTNYNNGPVLSRFVQKVLDETGAKKVDIVAHSMGGANTLYYIKNLDGGNKVANVVTLGGANRLTTGKALPGTDPNQKILYTSIYSSADMIVMNYLSRLDGARNVQIHGVGHIGLLYSSQVNSLIKEGLNGGGQNTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Esterase
publication title Crystallographic Investigation of Imidazolium Ionic Liquid Effects on Enzyme Structure.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 68
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2015-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5ct4A00
1U65A 4FNGA 1E66A 1IZ8A 4J0DA 3ED1A 2GYUA 4BVLA 3H1AA 3AZQA 2ACEA 1CUXA 1K6EA 4Z49A 1Q83A 5EIEA 4IH1A 4CIBA 1DTEA 4UHDA 4PV7A 4Y9SA 2ORYA 5AIAA 1THGA 5AKIA 5HQ3B 5AKXA 3WWCA 2OXEA 1GXSA 4G8DA 1YB6A 2C0QA 4HRXA 4BCDA 4W1SA 2WIKA 3H1BA 1CV2A 4K6HA 1SC9A 5CT4A 1VE6A 3DLTA 1Y7IA 2HA3A 4M0FA 1W6RA 2VJCA 5AM3A 4FLEA 4KAJA 2JGKA 3R3UA 2Y6VA 2ZYHA 4I4CA 5AKKA 1WPRA 2C5GA 4JYPA 3AIKA 3FSGA 5LLSA 2CUTA 4W9RA 2H7CA 2HADA 2VAVA 3OTQA 4CG2A 1HPLA 1LZLA 4FLFA 3JWEA 5JANA 3H18A 4PSCA 1HBJA 1MN6A 2EDCA 3C6ZA 5T4EA 1EDEA 4AQDA 2VJAA 2XQFA 2ZYSA 4G4JA 3QMMA 2DQZA 2BAGA 5AK6A 5SYMA 1JFRA 1H2XA 4CCWA 1GKLA 4HRYA 4WCVA 4FWBA 5AI8A 5C8ZA 1GQRA 4K6KA 5BWCA 5ALJA 4INZA 4JH0A 4OUKX 2QR5A 3A2LA 4QA9A 3QPAA 1FFCA 4X00A 1PFQA 1QFSA 5ALHA 5T4BA 4ZRDA 3LIIA 2VT6A 4LYDA 3RKSA 1DWQA 4CG3A 5D7BA 1K4YA 3QZUA 3NGMA 4HZGA 2GZSA 1XKLA 2ZJ6A 4H0CA 2O2HA 2PX6A 2RHTA 5C8XA 3LLCA 2QRUA 3DKKA 5FKJA 4K6GA 2WJ3A 3IUMA 3M3DA 3I2IA 4ZGBA 3I2FA 5AOBA 3B3QA 4JYMA 2JGMA 3FWHA 1XZHA 5A7GA 1LZKA 1NX9A 3RK4A 2R8BA 3STUA 4QDZA 1H2YA 5JD5A 1YSCA 2PBLA 4W1RA 5AP9A 5KREA 1EVEA 4UFOA 1JJFA 3DQZA 4X95A 4G1FA 4ZREA 2EDAA 3O4GA 4H7EA 3HEAA 4OB8A 3I1IA 4M0EA 1A8QA 1VOTA 3FYTA 1MJ5A 1SOMA 2Z3WA 4PW0A 3CN7A 2GYVA 1LBTA 2WUEA 1GGVA 1GQSA 3HI4A 2DHEA 3IB3A 3ESDA 3F67A 1GPNA 3QPCA 5FOQA 1WCYA 1CFJA 2JIDA 4DMFA 7YASA 1YS2X 4RE6A 1USWA 4OCZA 2PSFA 2XMDA 1L7AA 5C8VA 4BYMA 1ZOIA 3ZLUA 4A16A 5T4HA 4L0CA 2OCLA 4Y2VA 5K3FB 1IVYA 3AINA 4EY6A 2FJPA 4BE4A 1U2EA 3GUUA 4H7FA 5HF9A 2XUPA 1MX1A 1GZ7A 3V1KA 3DOIA 3KD2A 5CT8A 3E4DA 3KSRA 4E11A 3D2BA 5EHQA 5D3KA 4LKOA 4N5IX 4AO8A 1CEXA 4FKBA 1TCAA 3W06A 3R3YA 5FP0A 3PUIA 3PF8A 2J3QA 4UHEA 5ALZA 1XQYA 2JEYA 4Y2UA 3ILSA 3JYHA 5CT6A 4G4GA 1EH5A 5DNUA 1UK6A 1TRHA 1OXMA 1B41A 3KWJA 1DINA 2I3DA 1JMKC 5LKAA 4FBLA 5AJHA 2QT9A 4LIPD 5ALWA 3M81A 3WYDA 4O08A 4AX4A 1D07A 2WTMA 2XQGA 2HA0A 3LP5A 2WUGA 4UHHA 4DMCA 1DQYA 1JI3A 1FFDA 2WILA 3ICVA 3G8YA 5JARA 3ZLVA 4HAIA 5AICA 1QGED 1UOOA 2I03A 3RARA 3ZI7A 3V9AA 2XB6A 3QH4A 5A62A 1EINA 1RP1A 2XQIA 4FOLA 4G8BA 2I78A 4HTAA 5JADA 4MQMA 2HL6A 5AM1A 5BOVA 1CQZA 3QBJA 5I8PA 4AZ0A 4QNNA 1U8EA 5EHZA 3QMWA 4UFNA 5AK3A 1YR2A 4J0HA 3HXKA 5JALA 1FFEA 1MO2A 3G7NA 3STWA 3ESCA 4MEAA 5I9IA 4MEBA 4BBZA 1G66A 4ITVA 2D5LA 3DL4A 1BEEA 2AJBA 4J7AA 1XLVA 1JJBA 1CUWA 1XQWA 3EBLA 4TVKA 5DYTA 4RPCA 2RI6A 5FDFA 1ZI8A 3DEAA 5K3EA 2V9ZA 4J3JA 1IUPA 5J3JA 3FYUA 4XIIA 2ECFA 3DKRA 5JAOA 1DX4A 1T2NA 5ALYA 2PSEA 3N0TA 4E46A 3AZOA 4QDOA 2WFLA 5JAUA 2OGTA 5AOCA 1A8SA 3STYA 4AN1A 2G5PA 4BDSA 3D7RA 1EK2A 1F6WA 1Q0ZA 5IVKA 1QIFA 5HK8A 4IQ4A 4NS4A 4DNQA 4PO3X 4H18A 3FLEA 3I6MA 1XZDA 5K3DA 2GBCA 3OM8A 4KRXA 3O9MA 1W52X 2ONCA 2WHQA 2AJLI 3G0GA 1F0PA 4GBGA 4P93A 4BTLA 3C6BA 4BC1A 3LIPA 4HXGA 1LLFA 2RGUA 1W76A 1LNSA 2BUBA 5DJ5A 3ANTA 2QS9A 3C8DA 1T4MA 1QJ4A 1CUJA 2WJ6A 5ALGA 4BAUA 3FYUC 3HJUA 3T52A 4BRZA 1MNAA 4WDRA 4KE9A 2XI4A 2LIPA 2B20A 4Q82A 3WIOA 2OCIA 2CKMA 1XZAA 5YASA 4ZWNA 1BROA 1VZ3A 3SWWA 4KR0A 1FFBA 4TGLA 4CI9A 2GBGA 5HF6A 1YAHA 4J0CA 5EFZA 2XMBA 1YCDA 4F5ZA 3HACA 3JW8A 1QTIA 4AMYA 1JMYA 1P0QA 1BCSA 3WK8A 3Q0TA 5LZ8A 4UBNA 4ZV7A 1JU4A 3G0IA 5CW2A 2XMCA 4EY4A 3WI7A 1ISPA 2XMRA 1ACLA 4FLMA 4QEKA 5ALIA 4X71A 2DFPA 3ZV7A 1XZFA 4Y2PA 2I3ZA 1MX5A 3PICA 3Q8WA 1EDBA 1WB5A 4YX9A 1TCBA 5C7YA 3AILA 4EB0A 2QJRA 4GI1A 1EDDA 5ALVA 4X90A 5ESRA 1CUGA 3C5VA 4GECA 5ISMA 3YASA 2CEKA 2UZ0A 2WG0A 2WUDA 4DSZA 4GEGA 4AMZA 2WHRA 5ALSA 4BC0A 1BCRA 3IUQA 4KAAA 1QFMA 4AO7A 2X8BA 4BATA 1CVLA 3DOHA 1LBSA 1R50A 2FJ0A 2JGLA 2BGNA 2PM8A 4LYEA 2BUAA 5D6OA 4RGYA 3C70A 2J3DA 3EF3A 4UBMA 5E4YA 3HRHA 4QDXA 3WJ1A 2DSNA 2HIHA 3A2MA 4U2DA 5HF8A 2ZYIA 3WKAA 2C5FA 1XZLA 1XZGA 4BAZA 1ZJ4A 1ZJ5A 3W2TA 3ZLTA 3V1MA 3H0CA 5CRIA 1R88A 3PI6A 5AIBA 2QJWA 2JGEA 3HLKA 2FX5A 3R0VA 3CXUA 5CXUA 4OB6A 3IURA 2XUOA 1ODTC 2C0PA 2DR0A 1UT6A 2PU5A 1L7QA 1AURA 4KAFA 5HK9A 5A7HA 2VATA 4C6HA 4L9AA 4D9JA 4QLAA 3BXPA 4UBJA 1EB8A 1GT6A 5BWBA 3KOOA 4A5SA 2NW6A 1KU0A 2QTBA 4UBIA 2XUQA 3S2ZA 4BDTA 5JAHA 5CH8A 2Z3ZA 3GBSA 2PPLA 3F98A 3C43A 4F60A 1CUBA 1G42A 2G63A 1ZI6A 1HDEA 3K9BA 2VEOA 2OG1A 4C4XA 3CN9A 5ALXA 3H2JA 1TK3A 3DCNA 1CUHA 4CCYB 4B83A 1Q84A 4QDUA 4EY7A 3OG9A 3GA7A 2OLEA 1CQWA 1QIIA 2AXEA 4DNFA 2G5TA 2QKYA 4I3FA 4PNZA 4TPKA 1XRRA 4DIUA 4LXHA 4J0JA 1A8UA 3H2IA 2VSQA 5AK4A 1GKKA 1ODCA 4QLOA 1MPXA 3OOSA 4Y2XA 2JGIA 1F8UA 1G5FA 3WWPA 3DDUA 2IITA 2PSHA 3QITA 1CUFA 1YS1X 2RAUA 4EBBA 1ZIXA 3TRDA 1R1DA 5ALKA 4U2BA 3I1YA 2WHPA 1E8NA 5AKZA 1ZICA 3W9UA 4L72A 1NU8A 1CR6A 3WL6A 1PV1A 1B6GA 1C7IA 1ZD5A 2O2GA 5AI5A 1LPOA 5CTAA 3WIBA 4B84A 1JKMA 3WKCA 1YA4A 2E3JA 3FSGD 1UOQA 4UBLA 2QUAA 1XZIA 4BRSA 3VISA 4M0MA 1N1MA 3WWEA 4X94A 3IULA 3R3XA 5LZ4A 1EVQA 1VXOA 5AM5A 2VQ6A 4UBKA 2WFMA 1CUEA 1QIGA 3I2KA 1H23A 2HA2A 4B82A 4MXDA 1HLGA 4IO0A 4WY8A 5ALUA 3QVMA 3H04A 3WL5A 3AIMA 4KRYA 2YXPX 5CH5A 1XRNA 3D4LA 1YB7A 4BCCA 1R3DA 4FDMA 2HRRA 3E0XA 1P0IA 5AKYA 4DTCA 3T4UA 4E14A 3BIWA 5CH3A 3D0KA 4Q3OA 5EIAA 5EHXA 1MAAA 3GROA 4GDMA 4U2CA 1Y37A 5LZ2A 2HU7A 1ODSA 2HA6A 3I6YA 4H7KA 5ALOA 5FRDA 1QE3A 1QLWA 2YYSA 5AI4A 3L1IA 4MYDA 2YH2A 3WK6A 4L3WA 5FLKA 4DGQA 4X93A 1VJ5A 4X97A 2V96A 3I6ZA 4E15A 1LPMA 3F96A 5F4ZA 2H9YA 3D2AA 3BF7A 5AI6A 1THTA 1ACJA 4A23A 5A6VA 3FYUB 3G0BA 4IH9A 3C45A 1EI9A 1UK8A 1GPKA 1AKNA 3UMJA 3G02A 2XUJA 4B80A 3F97A 3NOXA 2WFLB 2WKWA 2HHAA 4CG1A 3NWOA 3V48A 1IMJA 1XZMA 4UHFA 4W1PA 5SYNA 3N2ZB 1Q0RA 4GWLA 1LPSA 1WHTA 4NMWA 4X6UA 4DNPA 4B9EA 4RNCA 2VT7A 5D3ZA 3BJMA 4C4YA 3FOBA 4AZ3A 1VE7A 1CRLA 3IDAA 3VJKA 1YASA 4U2GA 3FVTA 1XLUA 2HU8A 1K63A 2RIPA 2OGSA 5AKJA 1BS9A 2ZSHA 4JEIA 1QONA 3HABA 3GZJA 5K3CA 2K2QB 4B7ZA 2XUGA 2QXUA 3WL8A 4U2EA 3QPDA 3W9BA 4W1QA 3WK5A 2XDWA 5LYYA 5AM4A 2Q0XA 2QUBA 5DNVA 1CIJA 4X85A 6YASA 5DTJA 1DT5A 5IVDA 1HKHA 1ZD2P 2CBGA 2B9VA 1MT3A 3R41A 1AX9A 1CUIA 2V98A 3STXA 1K8QA 4UHCA 3IUNA 1DU4A 5HFAA 4WFIA 2XMGA 4H35A 2FUKA 5KBYA 2BKLA 1E8MA 2WIGA 3SK0A 2ACKA 3H19A 4KEAA 4N8DA 4MWSA 1AMNA 4RE5A 1XLWA 1QIEA 2XMSA 1QIMA 4BP8A 1ZGCA 3HYSA 1BN7A 3VDXA 4DM7A 1CUZA 3B5EA 3DJYA 3LCRA 1QO7A 5LIPA 2Z8ZA 4J0GA 1NU6A 1CUVA 5AKHA 3L1HA 3IA2A 3AUKA 3GELA 1N5RA 1UKBA 2HA7A 3VKFA 4UHBA 4X6YA 3IIIA 5LZ9A 5K3FA 3A70A 1KEZA 1AQLA 2GYWA 4J03A 2Y1KA 1RWQA 4B0PA 4OU4A 3ZPXA 1XQXA 2QZPA 4ZV9A 1WB6A 1WM1A 5AOAA 4UPDA 1BN6A 3QMVA 2B61A 3KDAA 3A2NA 2WIFA 5JASA 5CXXA 2OGZA 3BDVA 4V2IA 2ES4A 3ESAA 2XE4A 4BCBA 2DHDA 4AXBA 5CMLA 5DYWA 2H7XA 2XUHA 3WZMA 2QOEA 4J0KA 1N8SA 1LPPA 2H7YA 1FSSA 5CURA 4WDQA 5JATA 4QE3A 2OAEA 5ALMA 5DYYA 3M83A 4YK7A 2Y2UA 1SCKA 3OURA 1E5TA 4W63A 3W05A 5FV4A 3TGLA 1XZBA 3X3HA 5HKAA 1DWOA 2IIVA 1X70A 4WFJA 3WKBA 1SFRA 4HVTA 5CT9A 2OPHA 1EB9A 2XUDA 3QYJA 2XQKA 4UUQA 5E4TA 5A7FA 3V1LA 4N5HX 1UKAA 4OYLA 4IH4A 4K5QA 3K2IA 2JF0A 3IVMA 3WL7A 3G0DA 4Q3KA 4B0OA 4C01A 2C4HA 4HS9A 4PQEA 5FUMA 2WSLA 4LXIA 1P0PA 2WG2A 3PDCA 1H2ZA 3BDIA 3R3ZA 2WU3A 4Q34A 2PUHA 3SX4A 3IBTA 1DT3A 4KE8A 5JD6A 5H3HA 3BL8A 4DNOA 5EGNA 2V97A 3AFIA 1CUAA 1UWCA 1AC5A 4OD0A 5AHXA 3L1JA 4UFPA 3O95A 5KWIA 3E1GA 1W75A 4H7HA 5CT5A 1DQZA 5HZGA 5LKRA 1HL7A 3RM3A 4B81A 4EUSA 1CUUA 1CPYA 5BV7A 2ZVDA 4NZZA 2BUCA 4EA6A 2QXTA 4I19A 1DWPA 3O0DA 3TEJA 3WWOA 5AO9A 1G4HA 4GXNA 4C89A 1XQVA 1UZAA 4QWMA 4H7JA 2ZJFA 1XFDA 1X2EA 1J2EA 1ETHA 2AJCA 1O6GA 3QM1A 4EZIA 3IUJA 3I2HA 4OU5A 4Q1VA 3HSSA 4C87A 1J1IA 2OAGA 4PF1A 1UK7A 2WG1A 3V1NA 3STVA 4BAGA 3BJRA 2Y6UA 2HU5A 1OCEA 2G4LA 3G0CA 4IHAA 1H22A 4Q3LA 5I7UA 3WA6A 1FJ2A 2WHPB 3FAKA 4P08A 1XRPA 3KWFA 3G9ZA 3HZOA 4S0XA 5AM0A 3DS8A 2QVBA 1A7UA 3FLAA 1O6FA 5AM2A 2JEZA 3AZPA 1R9NA 5C81A 4X92A 3FCXA 1CUSA 2Y2VA 1CUYA 2WIDA 1U4NA 2XLBA 3WQHA 3MUNA 3WMRA 2HFJA 4BZZA 1PJAA 2B4KA 3I2GA 2RONA 1YA8A 2WUFA 2JGFA 1X2BA 4Y2QA 3FNBA 4C88A 4CFSA 1MU0A 2AJDA 4F21A 1QIJA 1VA4A 4FFVA 2CJPA 5T4FA 2O7VA 4C4ZA 3C6XA 4FHZA 3C87A 4AB1A 3E3AA 3P2MA 5A71A 3WJ2A 1KU6A 3WK4A 3BIXA 3OPMA 3WZLA 1IUNA 4BTVA 1IUOA 2X76A 2XMQA 3DYIA 4GLBA 3D3NA 2RHWA 5FPPA 5AI0A 5JAPA 2DHCA 3O4JA 4ZI5A 5AKGA 4K2AA 1W4LA 4JUIA 5DWDA 1TAHA 3VVMA 1CUCA 3A6ZA 3GFFA 1JT2A 4ZXFA 4DSAA 4G5XA 1MX9A 1ZIYA 2XUAA 2ZYRA 4BP9A 5ALTA 1QOZA 5HQ3A 4DMKA 1LPAB 4WJLA 2Z8XA 2BGRA 2PVSA 1I6WA 2CZQA 2J4CA 5ALFA 3F9CA 1WOMA 3W04A 4Y2RA 5ALLA 2R11A 4CIAA 3D59A 1R9MA 5JD4A 1TIBA 2CB9A 1XRLA 2XMZA 1ZD4A 5AKEA 4AN0A 3C6YA 5IH7A 4Q05A 4Y2SA 4N8EA 4KJXA 2XUFA 2QMQA 5AK5A 3ESBA 1GPLA 3FVRA 3R40A 5EIHA 2WQZA 1K5PA 3D5EA 4KE6A 4ROTA 2OCGA 5CBKA 3PFBA 4BVKA 3NUZA 4KE7A 3VJMA 1HQDA 1CLEA 2OQIA 5EI5A 1Z68A 4FBMA 5IVIA 4FTWA 3D2CA 4CCYA 2DQYA 3O4HA 1UFOA 1QTRA 1AZWA 4B6GA 5DNWA 1QO9A 2ZJ7A 3PE6A 4NVRA 3VJLA 1P0MA 4FNMA 3F8SA 3ICWA 3DL7A 5E2IA 3R3VA 3OC0A 1JU3A 1VLQA 2ROQA 3U0VA 4BZWA 2GZRA 4DYHA 4B85A 1TQHA 3I28A 2WJ4A 3CCBA 3EQ9A 2XQJA 2GBFA 3PUHA 2PSJA 5DLPA 2AJ8A 2WLSA 2PL5A 3MUOA 5FPQA 3C8HA 1AUOA 3WK9A 1MNQA 4PSDA 1VKHA 1ZI9A 1BU8A 3VVLA 1XRMA 1UOPA 4F0JA 3ZWQA 1A88A 4DMHA 1RYYA 2H1IA 3WA7A 1EA5A 5ALQA 1M33A 5HKBA 4XX1A 2JBWA 4U2FA 4EHBA 2HFKA 4H7IA 4Y7DA 1WPXA 3FBWA 1EXWA 3CCCA 2D0DA 3LS2A 3EQ8A 1VA5A 2C7BA 1H2WA 2VJDA 3B12A 3WKEA 4BE9A 2HA5A 5IKXA 1TKRA 3DNMA 3I2JA 4P92A 2WTNA 2PSDA 3BWXA 5EHNA 4OB7A 4EY8A 1WB4A 3H2GA 1SCIA 4H7DA 3U1TA 4Y2TA 1BEZA 1EHYA 1WHSA 5LZ7A 1E89A 2EEPA 2XT0A 3H17A 3R3WA 4X91A 4BVJA 2VTVA 1TCCA 4JNCA 4XVCA 4MJ3A 3O4IA 5ALDA 1SCQA 2W22A 1UK9A 1LPBB 3EQ7A 1VXRA 1OILA 3M82A 3DYVA 4UBOA 3TJMA 4HXFB 4XJVA 4X6XA 2VA9A 1JJIA 5K3BA 2QM0A 1L7RA 4WFKA 4H77A 2X5XA 4OPMA 1QIKA 4X7BA 1ORVA 2BCEA 3KXPA 4FMPA 2PUJA 2W6CX 4P9NA 5KWJA 2YASA 1XZCA 4QDTA 1W1IA 2PKYX 2JGJA 5HF5A 4MWTA 1IZ7A 2VF2A 4ETWA 3HC7A 1XROA 5AKLA 2OCKA 3WLAA 1C7JA 4QWWA 4AO6A 4G4IA 2CMFA 1LPNA 4G9EA 2PU7A 3G9XA 1QIHA 3FLBA 1F0NA 1UXOA 1XZEA 4Y2JA 2XUIA 2O2IA 4ARAA 5JZSA 2WU4A 2IX9A 4YASA 1ZGBA 4LXGA 4KYVA 1LGYA 5FXMA 2HA4A 5ALPA 3WWDA 1XZJA 2WIJA 2BJHA 3STTA 2XUKA 2WM2A 3O9VA 5K5EA 4KACA 3UUEA 2HRQA 3BE8A 1MTZA 1ORWA 1QIDA 4QZVA 2P8SA 3C5WP 4J0IA 1R4ZA 3MVEA 4GHWA 5AI9A 3ANSA 1E3QA 1EX9A 1J07A 1QZ3A 2J4FA 3RLIA 1EK1A 3FCYA 5JZ9A 1AGYA 2O7RA 4WY5A 5DTIA 3AJAA 2C58A 1BRTA 2BFNA 1S8OA 4FFWA 2DCMA 2GBIA 1CUDA 3DD5A 4G8CA 4LHEA 5ALRA 4BB0A 3UUFA 1YAJA 2VAXA 3H2KA 4G9GA 1N5MA 1XKTA 4Y2YA 5HCUA 4MQLA 2OQVA 4EY5A 3G9TA 4YPVA 3VXKA 1E8DA 5A2GA 5IVHA 1FFAA 5JIBA 4OSEA 3BF8A 3H2HA 3MGAA 4DLNA 5JZBA 1MAHA 4X3CA 4ARBA 1J06A 3G9UA 3K6KA 4PSUA 3PF9A 3WK7A 5LP1A 5AH0A 1ZD3A 5K3AA 3AIOA 2Z5GA 2VJBA 4XWGA 5HFNA 4N8SA 2XLCA 5E4JA 4MYSA 5LZ5A 5JYCA 1Y7HA 3SC2A 1C4XA 1XRQA 1BE0A 1DX6A 1VZ2A 3WYNA 2WFZA 5ALEA 2ZSIA 3PFCA 4B9AA 1XZKA 4GW3A 2HDWA 3WKDA 4OYYA 4HXEB 5ALNA 2HM7A 1UKCA 3S8YA 3EIOA
chains in the Genus database with same CATH superfamily
4LRXA 1E98A 5A6SA 2Y0CA 1GG2A 1DG1G 3BULA 3H9GA 1MDBA 2Q0QA 2JRLA 3FPLA 3G9QA 3HGQA 4GR5A 4Q1FA 3ZWNA 3A9WA 4WK4B 3M70A 4KX5A 3NHPA 2ZI6A 3UJ9A 2WF7A 1EUZA 4A73A 3WYBA 5IFLA 4G0WA 1E3WA 1P31A 1V35A 1E1MA 5T67A 4C21A 1NZJA 6PFKA 1FPMA 2OE2A 4JA0A 2HXSA 1G63A 3H1AA 3AZQA 4R1MA 4WCFB 3OE5A 5IXJA 3USCS 2DYKA 2YN4A 4Z49A 4DLBA 5J2TB 2XOXA 4HDRB 2QX4A 1Q83A 1N0UA 4H6PA 3C7CB 4TTIA 1EWRA 4OTZA 1W49A 3IBSA 4UHDA 5LMCA 2AG5A 4GWKA 4PV7A 2D5CA 5EZQA 4Y9SA 1IEVA 3PQ4A 3QOYA 1YS6A 1ZWLA 3ORYA 2WYUA 2V1UA 2GETA 2OCXA 4GPZA 4KAXA 2I9PA 4GKJB 4KLRA 3KKKA 2JFYA 1TM5E 2YVUA 3OBBA 3FHLA 2A4KA 3P9NA 1RQLA 1CY2A 2D8AA 3UMBA 4J3NA 3D1LA 3L8EA 4ZVPA 4G8DA 4MRNA 4OAOA 2BKEA 1O96A 1OXBB 2C0QA 4NZMA 4BCDA 3H1BA 4QG3A 5FLEX 2WJIA 3VC2A 1CV2A 2BFFB 5HZGA 2R0QC 5B1YA 2GF9A 4MAAA 4ZGGA 5DBOA 1EWVA 3TR5A 1VE6A 4ZO6A 1SVIA 3ZZ0A 1Y7IA 4KKXB 4BO7A 5P8WA 1T36B 3VAZA 1NSYA 1OSNA 2IZOA 4E2XA 5B57C 3GD5A 3DCJA 1W6RA 5DM2A 5EJ8A 1EHCA 4QBFA 4PC2A 1EJ0A 1FJGB 2XAUA 2RH9B 2FPGB 3QIAA 2CLMB 2KQUA 1ZMBA 1YQQA 4UM5A 5AM3A 4F11A 4ACBA 4KQKA 2NVWA 3NGLA 5JS6A 4KAJA 1V95A 4P32A 2K6GA 4Y18A 3DWIA 4UTVA 5H9WA 1A7AA 4Q6BA 4KREA 3I37X 3OHMA 2JC3A 4V2UA 4WESB 5E0KB 3QU7A 3C6MA 1FP7A 4IGIA 2IOFA 3JYOA 4HFNA 3RTBA 5CW1A 1U0NA 5AKKA 1Z0UA 3MAJA 4RVDA 5A5EA 4IMRA 2P2DA 1IN4A 1EUDB 1HRKA 4DIFA 1E2PA 3A7EA 3HKBB 3FSGA 5LLSA 5FH9A 5L6MB 4EPXA 4RZ2A 2HADA 2VAVA 4OA8A 5JISA 2YFQA 5KOIA 2B69A 4QOEA 2ZM6B 1EM6A 3LYHA 2QLBA 1H4VB 4Y6GB 1HBJA 5TLSA 3NYQA 1NBOA 3BEDA 4GNKA 3Q9NA 1J0EA 2AFIE 3S5UA 3VU8A 1KVQA 2WWGA 3JRNA 1KAEA 1PJRA 4W7SA 4ZT7A 1QUFA 3NUGA 3QX9A 3IIJA 4GUDA 2R25B 2ZYSA 1IULA 3IALA 4QGSA 1QCCA 4L2IB 3N2KA 3QMMA 5AYVA 4KG7A 1SQGA 1F1BA 1BWRA 1DQPA 5HKLA 2ZTMA 1I13A 2AHOA 4AJ1A 3P52A 4ZN6A 4FM9A 3LGAA 1YQGA 4CPDA 3NV9A 3A32A 4IFBA 4N7RA 3IIMA 2D13A 2ZEJA 1ZGGA 2P5SA 5F1YA 3SEAA 1V9SA 3AVPA 4HRYA 2JCBA 4PYOA 5DGXA 5IU6A 3WO1A 5J4VA 3OM9A 2O8FA 4LE0A 2IXBA 4JLJA 3R7NA 1KFKB 3IBFA 2ZIWB 3BGIA 3CUYA 3ECSA 3P27A 4INZA 1H6CA 2Q9AA 4NJEB 2CXRA 2RGGA 2I3AA 3CH5A 2ZCUA 1W35A 2HJWA 1CJTC 3QJGA 4KZKA 1AQIA 3W79A 5J23A 2OCPA 3SHVA 3MBKA 3VPHA 1F4VA 5ED0A 4ZVUA 4B75A 2PXAA 2HREA 4ZOQI 5TR9A 2BGMA 4JK3A 5CHYA 3MTJA 3O1LA 4X00A 3JQFC 1KZ9A 4RIEA 1QHNA 4EUFA 1NVVR 2ZWMA 4RK6A 3UM9A 1R6DA 2QT0A 4I5DA 4L57A 1EAMA 1ZN8A 2QPAA 3VOSA 2W6ZA 3PK0A 2JD1A 1NY6A 2HNKA 4IXDA 5D7BA 1JP7A 3NJRA 2O6LA 2ZRMA 5CDTA 1DNPA 2B83A 4HDKA 2I99A 1SAYA 4J0EA 2AG8A 2QROA 3G89A 1J97A 4LY6A 4DUGA 1QHYA 5WRFA 2IWHA 1WBBA 3DEIA 3LGSA 4BMDA 4QIHA 1Y6FA 1J9GA 2PX6A 3LKBA 1SBHA 2R85A 5C8XA 2BHRA 3N53A 2QRUA 2Z2YA 5FKJA 3GFVA 1TZJA 2I6GA 3RIGA 4HQOA 1GN8A 3LQ4A 2ZCJA 4A8JC 3QG1A 1LWOA 4J9UE 2NIPA 1C3OA 3GH3A 3JS5A 3MGKA 4HDAA 3PQFA 3TL6A 4FMBB 5AOBA 3ZHSA 4JIGA 1TTPB 4ZVTA 2VEDA 1X7XB 5HZHA 1VP9A 1XZHA 3ER6A 1JQBA 3R76A 5A7GA 3NMUF 3SXUB 3CZAA 4JITA 1CQJA 1ADGA 1P1FA 5E1DA 4XPIB 2VRCD 2QTFA 1HH4A 1NX9A 2COKA 1PX0A 2A0XA 4M98A 2QQFA 3FBGA 1N5OX 1UIRA 3OPYA 4Q39A 1VCNA 4DPMA 4D6XA 2XCQA 3STUA 4QDZA 1LLUA 3MMZA 3WAKA 4IDPA 5J4LA 2JL1A 4X1YB 1AKUA 4ON9A 4E2YA 1WXXA 3CH4B 2GZDA 3UMMA 4FYPA 1IEXA 4FW9A 2FFAA 2I66A 2ZWAA 5H3CA 4DBLC 5AVWA 3MWEB 4RX1A 2H6EA 2DLCX 3C74A 3UMYA 3R0JA 4G0ZA 3KQNA 2SCUB 2D0PB 4BN5A 3WGQA 4AICA 4NDZA 3DQZA 4HC4A 3H6GA 1GPBA 1M2HA 3BCHA 3U4IA 4ZREA 3VA7A 1W36C 4DR1B 4H7EA 1U3GA 1HOTA 2OBMA 3MB8A 3GLGB 3VZSA 1P9LA 3I1IA 2QLMA 3N1UA 2FWJA 2HB6A 4I1RA 4XLZA 3QFCA 3TBHA 3WAJA 1Q50A 4ZQFA 6GPBA 2BR5A 2VCHA 2JAQA 4A1FA 3LY5A 4RBNA 3U3RA 4TT3D 1T0HB 1YS4A 2ZG6A 1LBTA 1DC7A 4F2WA 2WUEA 3JY6A 5F1KA 3UANA 3IAS1 1F2TB 1GGVA 2C5LA 1GQSA 3NWBA 3RVRA 3U9SA 1FW8A 1XDBA 4E5YA 3CLHA 4JX8A 4OI4A 4CETA 3JQ7B 2ZRHA 4S1OA 2R2GA 3VKHA 2JPDA 1DEOA 3QPCA 2H16A 4URVR 1IOLA 5FOQA 1WCYA 2I71A 4JAVC 1N5LA 2WP0A 5FA5A 4DMFA 5EFOA 3AUSA 4EJSA 5IAOA 1W1WA 2O57A 4L5CA 2I7TA 3O03A 3RC3A 2G7ZA 2QL5A 2RK4A 2W2KB 4BV3A 3AJ8A 2QV0A 1RHRA 4OHFA 4DXHA 3KL4A 1TUBB 1ZH4A 3Q7IA 2A3NA 4TQ9A 2WINI 3BBPA 5C8VA 4RDIA 1IHUA 2I7XA 1GRVA 4BYMA 1P7WA 5DB4A 2QDXA 5CA0A 2MU1A 3PUYA 4IJWA 4JENA 1KL7A 2P75A 3N7TA 1S02A 3BERA 3IOCA 3RFCA 2Z5VA 4RVCA 4U7JA 4A03A 5A3JA 3MRVA 5JR3A 2QTCA 1AKYA 2NXWA 4JI1B 1L5ZA 4PS0A 1GO2A 5DGIA 1SG6A 5K3FB 2FG7C 3TNLA 2C54A 2IXAA 3KVRA 4V0MA 3O9ZA 2G8LA 3L1UA 3JVDA 3TB6A 4XWWA 3I39X 4XJSA 4C0LA 3WGIA 3B85A 5LU9A 3IIEA 1RHJA 1UODA 2OENG 3AR3A 1YZLA 3GUUA 3R44A 5HF9A 1OAOA 3FF4A 2EOAA 2EP5A 5HUQA 1PG5A 3THWA 1TT5A 5HQTA 1J9EA 4QGBA 1KDPA 3E4DA 1Q1AA 1XK7A 3KSRA 3A37A 4K1XA 1QS0B 2CW5A 4ZDIA 3FUCA 3L7IA 2VDLB 4IWYA 4OQPA 2XJ9A 1OV6A 4XASA 5C7OO 4H6WA 1PT9A 1ZA2A 1VIMA 1ZGHA 5KINB 3CVOA 3ST7A 4LZPA 4Y9TA 1QQ6A 1I10A 1CEXA 1P5RA 4FKBA 2G3YA 4L07A 3ZGXA 4D8TA 5DRYA 1JHVA 4QFDA 4EO4A 3KTAA 2AYXA 3VC3A 2IKQA 4W82A 2RHLA 1JECA 2WYVA 4JL5A 3MW8A 3BXGA 4J6EA 3QE9Y 3DBRB 3PFFA 1A76A 1G9TA 5BSVA 4Y1GA 5MN4A 1FPQA 2BI8A 3RU7A 2FK7A 2PZFA 1UXKA 2BGIA 3DUFA 2IUYA 3UV7A 2G40A 4N0EA 4Z7OB 2O2JA 3ILSA 5J4KA 4G4GA 4JBLA 4MPDA 4D8XA 2HPAA 5GIPE 4ZJZA 2W2TA 4Z9FA 1A50B 1UK6A 3DM5A 1PQUA 1OXMA 2P9BA 2ZXFA 3GLKA 2VFAA 4MS3B 1SA0A 4KXLA 1DXHA 4EGAA 1OKKA 2H5IA 1BVUA 1DINA 4I36A 4S2EA 4GR4A 1N9GA 1R5JA 3KKNA 3RVMA 2WYHA 1ZZEA 3LBHA 4RVOA 3CSSA 5B3AA 1Y7LA 4LIPD 3GV0A 3EXFB 3D5TA 4RQBA 4O08A 2NU9A 2GHTA 3N9IA 1Y4ZA 3ZW9A 4C7OA 5K0CA 2WTMA 1T5TA 5L3QA 4Y30A 2GXAA 4ZZ3A 1K2VN 2I7VA 2H08A 4TKUA 4JJ8A 4JB0A 3DB2A 4QQKA 1MB2A 5FTJA 5CNMA 4ZT6A 3WFIA 3NIFB 3EMBA 4WFQA 1ZVVA 1P60A 4Q6WA 1DQYA 4N0PA 5FBRB 1JI3A 4PZ0A 5CVEA 3F1LA 2OL4A 2QSJA 5JPIA 2QTHA 1EXVA 2PG3A 1NE2A 4DFDA 3ICVA 5JARA 5IRCD 1GG9A 1WG8A 4HAIA 5A3VA 1DIAA 4CL3A 1QGED 3N6VA 3KB6A 2I03A 4NZOA 1W4AA 2R6GA 2M1ZA 2H18A 3EFOB 4JUFA 5L4NA 2CHGA 1L5HA 1Y6GA 1LDMA 4HNGA 3QH4A 3VR2A 3AL0C 4FQ7A 1N32B 1XJQA 2BZ1A 1RP1A 1AK9A 2EW1A 3N39C 2Q5HA 3QKUA 4W5TA 3C3XA 5EJEA 4JY7A 5JSKA 2PH3A 2AV6A 2CCKA 1W4CA 4II7A 5AM1A 1H2AS 4MYRA 1VM6A 5DIZA 5C5IA 2AFRA 1RT9A 1QYVA 3K1YA 1AKEA 1X15A 2GT1A 2YWBA 3P9CA 4AZ0A 1IOWA 4NBTA 4A0SA 2O8EB 1P73A 3I9MA 5KOJB 5F2KA 1UP4A 3TX6A 1VL6A 5JRDS 5TV2A 3KKQA 5AFSA 1QP0A 2YWRA 4J0HA 3EGWA 4WH0A 5JALA 3O94A 3RE1A 1L5RA 1QDLB 1VG1A 4ZT4A 5JVDF 4EQZA 2WNSA 3G7NA 5CGZA 1Z7GA 2HBRA 4MEBA 5GAJA 3OOWA 4CFYA 2C2KA 4HUQA 2ZUDA 1IG0A 4RU1A 4CRWB 1QV6A 3HBLA 3OLCX 5E6RA 1QK5A 4ITVA 3LVRE 4RPKA 4AUEA 3DOUA 2PMEA 2VCYA 3IOEA 4J7AA 3V32A 2HWXA 4LXTA 5BRJA 1XLVA 2ZYAA 1M6NA 4NOLA 3M5PA 3FOEC 3PKZA 4BLTA 1XQWA 1C8VB 1HTWA 3EBLA 1YBHA 1EG2A 1MENA 4HYQA 4KQCA 4TVKA 1QQBA 3TNYA 4PPNA 1IE3A 3T3DA 2HEGA 2A9KA 3O3NB 1PW5A 3OUTA 4MMXB 3V7FA 4YV1A 2DHRA 2FVXA 1ZI8A 5FDFA 2R4QA 1T3LA 1O0CA 3JYPA 2GRJA 1E3LA 2V9ZA 3JYQA 5K0SA 3CS3A 3LCCA 1THMA 3M3HA 3ND7A 3NALA 1TJ5A 3THYB 1XPUA 3WLNA 3THXB 3P96A 5KOYA 1C9EA 1ESCA 3LCUA 4I9NA 1Z2OX 2FW7A 1SULA 3BJEA 3P2EA 3OP1A 3CSUA 3QKSB 2DFKB 3ROZA 3IT1A 3AZOA 4QDOA 4E46A 1QGUA 2O14A 1JPNA 1XALA 3ROQA 3F5MA 5AOCA 4AG5A 2HY7A 3STYA 3LVBA 3GGJA 4GOND 4HEA1 2IYTA 2G5PA 2XB9A 4IV8A 2FG5A 4L4ZA 2E48A 2DRIA 1E7MA 4HGNA 3HNPA 3NPAA 1L5MA 1N2HA 3Q98A 3TI9A 2VOEA 5IVKA 2ZQYA 1XUOA 1P2BA 3WQQA 5HK8A 4IQ4A 3LW7A 1L8LA 2ZIAA 3BK2A 2EJVA 4Y1RA 4F46A 1Q0HA 4FUTA 4O2BB 2XE8A 4NMHA 1XZDA 4II2A 5K3DA 4HN2A 3RRFA 4YCMA 4TL8A 1XKXA 1T2VA 4OHBA 1XR3A 2ZUFA 3OM8A 2COUA 2AMFA 4KRXA 5HJEA 3FD8A 2BV3A 3H5NA 4BB6A 4FYYA 1KBOA 3B36A 2WJHA 4TMFA 2HW8A 1MG5A 4YR9A 1DIHA 1BDMA 2F2TA 1H2RS 3CBGA 1HXHA 3L4KA 5E1MA 1XTJA 4TLAA 2Y0BA 1RKBA 3LWBA 4FDUA 3SXJA 3ZDBA 1NFFA 4MVCA 1N6IA 1W76A 1N6HA 3KQTA 4Q9HA 2W6PA 3Q4GA 2B82A 3H86A 3IQEA 4IO1A 1JALA 5DJ5A 3ZHOA 3EOZA 4AJIA 3D2LA 1VECA 5JYDA 3AVYA 2FW6A 2KI5A 2AT1A 2IYWA 2NUAB 3UPDA 4BNHA 3E7DA 1PS8A 4OP2A 1EE1A 5EZYF 2LWIA 1NJGA 4QQFA 4HDSB 4IHJB 3QVUA 4EA7A 5KOHB 2DCUA 3H42B 1V11B 4H1VA 5BNWA 4RM2A 3OAAA 4PZPA 3VR4D 1XDDA 3MF4A 4ND2A 3W4IA 2NUTA 1MNAA 4IJKA 5A4MS 4LTNA 5M5BA 4HGOA 1BEUB 4KE9A 5FUYA 3V8BA 5EKXA 4QTYA 1KTIA 3KXIA 2B20A 2ZIZA 4MQ4A 3VO9A 4PXSA 3WIOA 1Q2UA 1QORA 4XFJA 2ZI5A 2JBAA 4ZU3A 1NUQA 1IN7A 3HM9A 4PSKA 4AKGA 4L5YA 4LWQA 3U9TA 4ZWNA 3HR7A 4Q3CA 1BROA 3OECA 1N4DA 4US0R 1P7YA 2NU7A 3D0RA 3LC1O 3W6PA 1DXQA 2VQEB 4K8RB 2EFYA 5JMTA 3AR4A 4RKEA 5LWHA 2YHIB 3W6UA 2F1KA 5I51A 2R8YA 4Q00A 4GM4A 3ZDEA 3S55A 1I94B 2XNCA 3LHIA 1YAHA 5HF6A 4F5ZA 1B42A 2P67A 3B78A 1EFVB 5AWFC 2ZRFA 4BVBA 2QE7A 1PQWA 1RVDA 4ENWA 4B1FA 2JJMA 2N1BA 4DOMA 2ODWA 2FQWA 3MM4A 1X7WB 4I14A 4RWEA 4AMYA 5JJLA 1J2YA 1WMBA 1GNPA 5JTTA 3HXPA 2QL7A 4NFHA 3Q0TA 5HE9A 3OF5A 2NYAA 1OXKB 4I6EA 3IPYA 3LBAA 3BHMA 2Z6AA 2O0HA 3JARA 5CXSA 1ZXLA 4ZV7A 1VGQA 4PHCA 1FP2A 1TB4A 2E55A 4P4UA 1FIUA 1AV6A 3QLUA 3L41A 5DN6D 2CD7A 1OLUB 2XB4A 1FEZA 1W0JD 1D1QA 4DDMA 2AQIA 1U7TA 4IGKA 4MQ6A 4Q03A 4WEQA 2NUPB 1JQ5A 1OHHA 3C6QA 4UE6A 1ACLA 3REFA 1NG9A 1EKXA 3QVKA 4FLMA 1J1UA 1KIFA 1PNOA 3CM0A 3VKWA 2IX3A 3G5UA 3PUXA 2Q5JA 4K6FA 4RSRA 3ZV7A 4BKUA 1Y3CE 3BTOA 3DDCA 3Q8WA 2FG6C 1RM5A 2J59A 1P3DA 2P6NA 5LNK1 4D0LB 5C0OE 3RJMA 4M53A 3EPJA 1NDHA 1MVNA 1XDWA 3CPJB 4GE3A 3AILA 4EB0A 4RJTA 4ZEMA 2CJFA 4WK0B 2QW1A 1EFPB 3RFFA 1EDDA 1EMDA 1LW7A 1QNFA 1Y6QA 2FRVA 2P1RA 4BKRA 5ESRA 1VIAA 1SH7A 4RAQA 3REOA 4W6ZA 3KV1A 3SIRA 1TIPA 1FU4A 1UXIA 5CVTA 1S4MA 3M5WA 3NFRA 5JUWA 4B8ZA 4MIOA 3ZHXA 3OD5A 2I4NA 4DKXA 1RJDA 3UBMA 1ONSA 1EFKA 1QDUA 2UKDA 1OWLA 2WUDA 3AEKA 3NHMA 2X5JO 3TLZA 4GMFA 3ZV6A 4DYDA 4EGFA 4GEGA 1M66A 2WR8A 4QT4A 4FEAA 2EFDB 5ALSA 4CQMB 4F7WA 3ZJTA 3I34X 4GGMX 3I64A 2DETA 2CVQA 3QHQA 3W3AD 4EF5A 4B6FA 4IRUB 2C8VA 2R7KA 1Z47A 1V43A 1PW7A 2HCTA 2G1UA 3ZQUA 1U8ZA 4L4RA 1NJ2A 2ENUA 4PVDA 4LKRA 3SQWA 1NPTO 5H9VA 3KOZA 3E5NA 1D4OA 1CVLA 1T6BY 2VPTA 1PGPA 4ZAFA 4ZARA 4JBIA 5I9BA 4QAQA 3RUFA 1R50A 3PPVA 2FJ0A 1AHHA 1VFPA 2K7ZA 3FUVA 3H4VA 2BGNA 1XHLA 1SUAA 1ECBA 2PM8A 5JJKA 4Z1MA 3OLZA 4ER0A 2QPTA 2GILA 5ILQA 3SS8A 1XWIA 3IQHX 2PS0A 2QTLA 4LYEA 4QOJA 2BUAA 5D6OA 1ZOPA 5EHGA 4AMGA 3RBZA 3C70A 1B1AA 3HXMA 1Q74A 5FT9A 2CLCX 3S29A 1RWNA 4TSFD 5JBQA 4R9SA 1SUIA 1KK2A 4HWKA 3U4GA 1IHDA 3FCSB 1BVHA 4EIWA 2VK1A 1LF0A 1PT6A 3A27A 3U40A 3GLIB 2F9MA 1QH1B 5KNBH 1ZJ4A 2P79A 5JLJA 3BXXA 5HYVA 4J43A 4ILEA 3ZLTA 5CRIA 1U3WA 1X1RA 1H3EA 5K8JB 3GRYA 5GJWC 2AQHA 2P2SA 4QQRA 3HLKA 4IBOA 3NNSA 4Q0MA 2FX5A 3VR5A 1BS2A 4TSRA 1OJLA 5DHSA 4L5BA 5JY1A 5E8RA 4O2AF 4W8GA 2RGNA 1YACA 2CLLB 3O4FA 2CDCA 1OZFA 4FOTA 4CLHA 4HPJB 1N2CA 3DD1A 1P7CA 4OHKA 1DGQA 3ABIA 3RTGA 1DKNA 2DR0A 4RIFA 4JI3B 4MV8A 2NZWA 1L7QA 2IDZA 2PZKA 3IEIA 2BDEA 2PKEA 4KAFA 4W8HA 3WGKA 3IA7A 1VYVA 5ECWA 3S2IA 4JI8B 1J99A 2YHUA 1CDOA 2QGNA 3UWPA 2VATA 3NX4A 4XKJA 3V5NA 4C6HA 3AVTA 2OK7A 4UVGA 5IBQA 4ESEA 1E60A 3AB8A 5EMLA 4NCIA 1T2FA 1I51A 2H5EA 2R79A 1C3XA 3F5QA 5BN4A 5EWLA 1F3LA 2DKOA 9ABPA 1FLVA 3LMKA 2HSDA 1EFUA 2QQGA 1Y3IA 2FFJA 4L28A 5DGTA 1XNHA 2BFPA 3TNDA 2GBPA 1FQJA 4YQZA 3X1MA 2CFSA 3K0KA 3NATA 1YIDA 3L1KA 3NTXA 4RS4A 2QTBA 2R97A 4JI2B 3RCBA 3N2NA 4LOAA 2LCIA 4J07A 4DE5A 4KLCA 2XUQA 2HU2A 4QBHA 3S2ZA 5DMXA 4BMCA 1H2FA 2VTEA 3SPXA 1R4NB 1RWWA 2Z3ZA 1JA0A 5B4UA 3FETA 3MQ2A 1T3HA 1KI8A 5IXYA 4W99A 3GO4A 1CY6A 4Y67A 2XYVA 3OLQA 4IOKA 2G63A 1VLZA 3RK1A 2C4NA 1KFEB 3GQVA 1CD5A 2YWXA 3AETA 3ONDA 4FFPA 1Y5NA 1X7GA 4HKTA 3JASB 5CLQA 3UHJA 2ZS8A 3UJDA 1LQUA 4V24A 1S3IA 3U6KA 3NT4A 4TUYF 5JSFA 1PBNA 4WGFA 4OL0A 3W4JA 4M99A 4XGIA 1XXLA 1AHPA 1RRVA 3DCNA 1C8LA 2GNAA 4J7CA 2LP4Y 3D8HA 4QARA 5B37A 1Q84A 4OMCA 4UU8A 5KCZA 1TEVA 1QZZA 3N70A 4GZ3A 3EJWA 4EY7A 5H16A 1ZNZA 5EMNA 3U60B 2FPPB 3AHHA 1CQWA 2AXEA 1N2JA 4CMBA 2FKAA 2WMYA 4PNZA 4NEQA 4YROA 2EF0A 3TWOA 2FEPA 2Q4DA 1JG1A 1XRRA 3F7MA 3QELA 1NBWB 3AMVA 2Q0SA 2ZP1A 2YMMA 2ZUUA 3GBVA 3L0OA 4DMLA 4HNSA 1D7AA 2XCLA 4MV6A 4LGVA 3T99A 5E3IA 3NHFA 1V16B 4FGSA 4IINA 3H2IA 4JLSA 1LI4A 1GKKA 1KEKA 1MPXA 3PFIA 1JHMA 1ZRMA 4RH1A 3L4JA 1R0BA 1G5FA 4JR1A 3TBKA 2G36A 3REGA 3O8RA 3DDUA 3O2SB 1LSSA 4I50B 2VJNA 1K5HA 4JBWA 8AT1A 2IITA 3FN4A 4HB3A 2EFEB 3TI7A 3ZZTA 4GBED 1JR2A 1P9NA 2OXFA 4PTLA 4RF3A 3D6MA 1CUFA 1YS1X 1KF0A 2ADOA 3DNFA 4YDHB 3UGQA 4IX9A 4ETMA 5BMVF 1W5AA 1SC1A 2I22A 1QH8A 2GK6A 4YUYA 1SUEA 2XA1A 4LDZA 3V6MA 4L8VA 2ZDGA 3UHOA 5ALKA 1KAOA 1J21A 2ZJAA 1E8NA 3EA4A 4GBMA 4UHJA 5AKZA 2Z4SA 2H5JA 4YP9A 3UG6A 1JVNA 1QM5A 1B6GA 5FOUA 3AYZB 5AI5A 4F5YA 1DC4A 3ADKA 3M9LA 3MIZA 3QFFA 4KTTE 4YFVA 2QRPA 5EQDA 4E88A 4J2OA 3WKCA 3HO6A 1YZVA 2I62A 4Q7MB 2ZBDA 2QD3A 1CW2B 4HVCA 3N2LA 4A9AA 3V3KA 1XNRB 1Z5OA 2GCEA 5D8DA 1GU7A 3NT5A 5H83A 4YIHA 2QUAA 5KMGA 1RRKA 3P20A 1U7ZA 4G9BA 4MR9A 3SBEA 3ZKWB 4BRSA 2JLYA 3VISA 3I83A 4YECA 2IA5A 2JRCA 1Q0TA 1X38A 3AWIA 5DOVA 2GYYA 4AU1A 4Q19A 5T5QA 3QXHA 3GLQA 1BA2A 3S7TA 2JFBA 3F71A 3R3XA 3WGMA 1GLNA 4LISA 5JQGF 1ZESA 5K9ZA 3U7FB 2VQ6A 3AM4A 2QLTA 4MO9A 4UBKA 2WFMA 3KTDA 4UULA 5JCOC 1JSLA 1BTOA 1YK0A 1H23A 1HE5A 1CXZA 3WRYC 4ABTA 3SR4A 3H2BA 2HJSA 3JX9A 5BRNA 2FQXA 3WDKA 3I1JA 1PJQA 3FCCA 3WLMA 2PZEA 4WY8A 3QVMA 4BQEA 1UBSB 3QOWA 3RGWS 4P7GA 3T4EA 4ZCRA 1JQLB 1SBCA 3LT2A 4IIBA 4BVHA 1A7KA 2B7CA 3JPWA 3Q0IA 4KQ2A 1UQTA 5CH5A 3CX8A 3O47A 4EW2A 1RPZA 4N0DA 3T7EA 3GVIA 3K94A 1BHSA 4QUEA 4NDAA 5EA2A 3Q9SA 3VBCA 3CNLA 2OUIA 2IZ6A 1MJGM 2HRRA 4RLSA 5DTRA 5KTYA 1GGMA 3A1SA 2C42A 3OQOA 4A10A 4XLLA 1P0IA 3SDSA 3TR0A 5LFAA 4HP8A 4JLUA 2WB2A 1P44A 2OYSA 4BQQA 4AWAA 3DXXA 2BYTA 1EBBA 2QRHA 3DV0A 1WV1A 1TYZA 3D0KA 5FTLA 3D7MA 4OQLA 3KQLA 4POAA 3FNRA 1X80A 2FNAA 3A11A 3NKLA 4HEJA 2ZUEA 4A4DA 3ICEA 4GQAA 4IF6A 2FZEA 3IMGA 1CR0A 3RT9A 4GDMA 4YV7A 1Q14A 4U2CA 1BFKA 1DEKA 3LQKA 4QPCA 1S1MA 4CLOA 1AJEA 1XO1A 2Z6UA 3DE5X 4L7QA 3HV2A 3PZBA 1HYHA 4MSUA 3LL4A 4A0GA 2WZQA 5FNVA 1CZKA 1NVWQ 1ODSA 1RHKA 2J0UA 2WPDD 3KWLA 2HA6A 4AECA 4C0XA 1J5EB 4NU6A 5ALOA 2NP7A 1F2UB 1KY5A 1J8DA 3LECA 1BMTA 2IZ7A 4D9KA 3PEWA 4EFNA 3WK6A 4L3WA 5BVGB 2BFCA 1FQOA 3QPWA 5C4MA 4DA6A 3NANA 1G0OA 2PGXA 3LNCA 4PLHA 1U99A 2JFNA 1A71A 1A5BB 1KK0A 1XEWX 4X97A 2B30A 1V8PA 4YTEA 1GEEA 1JZSA 2R00A 2PA0A 4J90A 4PNPA 3SZRA 3KYJB 4B87A 4MZDA 3SE0A 3DOEA 1ZSVA 4B2IA 5ADHA 1YHZA 5BN3A 2CE2X 1NXWA 5F4ZA 2H9YA 3N8KA 4IQFA 1I7NA 1WVIA 5EESA 4YYEA 4C4SA 3OZWA 1THTA 1ACJA 1UC8A 2YVQA 3OCYA 3QXSA 4LK3A 3U4DA 3OPVA 4D3FA 5LQAA 3BD7A 4A23A 5A9SA 1COWA 3BZWA 4XPZA 4INPA 3G0BA 2VJPA 5M04A 1P7VA 4IH9A 5HRAA 3MJCA 5JDCC 4ZOEA 1XEAA 5EMMA 4E5DA 2FGKA 1IOVA 5BQ3A 1ENPA 1GPKA 4MUHA 1A2QA 1PSWA 1UKYA 1CRZA 2GK7A 2N75A 4BIMA 3U62A 2QBYA 1KZYC 3A14A 4AS3A 4ER3A 1PGNA 4Q1BA 2WFLB 1Y1PA 2HHAA 2IV3A 2ATCA 1S8NA 1AHNA 3QBEA 1JE1A 3D02A 1GNVA 3V48A 1I2MA 4NDNE 1XTKA 1XZMA 4JA2A 4UHFA 5SYNA 3FR7A 5BN5B 1L4HA 2ZYUX 3ZWDA 1SUWA 4OSPA 1IM8A 4DABA 1G6OA 3QHAA 1WXQA 3P9QA 1DCMA 1XMJA 4YAFA 5JECA 2CV2A 2DERA 4N40A 1SOWA 2F55A 1US8B 2ZWOA 2XYPA 4X6UA 3TFWA 4B9EA 3U7JA 3K0BA 5AHKA 2R8OA 2OO5C 3FOAA 1W5TA 1GSAA 1QHHA 4IV0A 2VT7A 3HPRA 5CJPA 4HLCA 5D3ZA 4C4YA 4CJXA 3PPWA 4AZ3A 3G2KA 4EDFA 4EHFA 1CRLA 1PX2A 1VSTA 3H11A 2X6RA 1WZEA 4YJGA 2OT3B 1T9GS 3WMFA 1YASA 4U2GA 3PT9A 3SIXA 1UPFA 2A5FA 3FVTA 3KEQA 4PN7A 2XYGA 2BGWA 3ZIUA 1Y81A 4RVGA 2BKUA 4LTDA 2OGSA 3QLVA 3PC8A 5E95A 3KLMX 1QONA 1XMSA 3EUFA 1KTVA 3F9IA 2IGTA 5DHRA 2W6JD 1V26A 5LN1A 2EG5A 1XFAA 2J5RA 5K3CA 2NN3C 5EEHA 2QXUA 3C41J 2ILVA 2WIBA 2Y4OA 4L27A 1O6ZA 1B0AA 3QPDA 1NI5A 1P7PA 2XKAA 3I5UA 5SICE 3LW8A 2B98A 4PYQA 4UMDA 1BW9A 4X8HA 1CB0A 4XE5A 5LYYA 4CV1A 4S0ZA 2QUBA 3ZXYA 3CE9A 1AQNA 2KLHA 3FUWA 1CIJA 4X85A 2X14A 4H59A 4N4AA 4BWYA 1B8UA 1M1NB 1ZSNA 3OP4A 2GKGA 1L5LA 3K9FC 5TT0A 1Z4OA 1I3MA 1XMXA 2CBGA 2IYEA 1Y7TA 2R2AA 1CNEA 1GUZA 3A1TA 3CLUC 4FI3C 3SQMA 2Q3MA 4CM4B 4RACA 2JB9A 1C29B 3KDPA 3RSOA 3MWDB 3EIXA 4PR0A 5TPWA 3KEFA 3HO1A 5F3DA 4DCNA 2HMVA 4Q1CA 1K7FB 1O9GA 1VSVA 3R41A 3M6LA 4JB2A 3TFQA 5H70A 4ZEXA 1I1HA 1R27A 1E3DA 1C0EA 3EDMA 4KR9A 1E0DA 1WMDA 4M8IA 3EK2A 1EP9A 3L6EA 3O73A 3QKTA 4K03A 3STXA 3Q7PA 4BHTA 1SHKA 2NXJA 4RM3A 1RYNA 1WQ3A 3TZQA 3GG9A 3H7AA 2XMGA 1CJKC 2PIAA 2FUKA 1M34B 2ZR7A 1JDNA 3OT5A 3PRKE 4IRXA 4IMPA 4LFAB 2YV3A 2BKLA 3DLIA 5JS1A 4OM8A 3TD2A 4BNKA 4H0FA 2C92A 1XD9A 5KI6A 3QU9A 4P3OA 2PWAA 4N8DA 1BE8A 3CEPB 3D3WB 5G1PA 4S24A 1AMNA 3V8VA 2AMLA 5EJ2A 1PNTA 2CYAA 4IDHA 1Z39A 4ALKA 5FX2A 2PL3A 1T0IA 1QIMA 3O31A 4BP8A 5LXTA 2W2OA 4KV7A 3A7DA 4TLEA 1ZK0A 3AJDA 3T1HB 2RDMA 2DFDA 1PNQA 1EXNA 1DIGA 2VT3A 2X3FA 3G2IA 4OHMA 1WOYA 1C9DB 1YU9A 3W5BA 3O74A 4UNNA 5IARA 2V9PA 3E2IA 5DT2A 1CUZA 4DM7A 4KOAA 2JS7A 2P5YA 3D4BA 5HA5A 1OA1A 3LF2A 1AZSC 1P4HA 3LUBA 2VOJA 3ICPA 1SC4A 1U6JA 3LCRA 3AR5A 2Q5FA 3LCVB 5LIPA 1P39A 1U2QA 2NO5A 3R7DA 2ZDQA 3ZWPA 2Z8ZA 4BGIA 1CUVA 1TNDA 1GR1A 2I3GA 3F7NA 5AKHA 3DO5A 3EXAA 3TJRA 3KJHA 2XNDA 4YJHA 3JQAA 3CUUA 5KTRA 2B4AA 1JE0A 1N5RA 1UPAA 1T8YA 3CEAA 5IANA 2Q5IA 2HA7A 4BVEA 1QKJA 1E2GA 1PBTA 4EQ6B 4FB5A 5AVRA 1BGXT 2ZT7A 1EGQA 4KI0A 3D9QX 3SR3A 5L40A 3LKDA 3PFGA 4PINA 1NQ5A 4X3OA 2I2XB 2EKPA 4DWWA 3VVBA 1T1IA 2E49A 2IYLD 3CVVA 2J3JA 4J03A 3TD6A 1NF2A 3R20A 1G60A 1KDRA 1D4FA 1UL1X 4XUGB 1JEYA 3HSKA 1FCJA 1U0BB 2E0IA 3BKXA 5CD9A 4JN6B 3HM2A 2UZ3A 4IHKA 1XQXA 1Z88A 1XNGA 2Y27A 1TVKA 3GARA 3WDSA 3VNUA 3J80A 2YWGA 2JVIA 3EIWA 3ACDA 3W7AA 3ZU6A 1GPH1 1V41E 1Y9DA 4CQJA 4H15A 3Q85A 5EUCA 5B2FA 4P3XA 1WM1A 3RYFB 5C2JB 1Y48E 1JHDA 4UPDA 3T3HA 3M6FA 2JAUA 3NG1A 4FCCA 5DHAA 4G63A 8OHMA 3AERA 2E21A 2C2GA 1DEXA 3A2NA 3KDAA 1XDUA 2WIFA 2IVZA 3CX3A 1G18A 1Z18A 4K46A 2EFJA 4IOLA 4MCAA 2O05A 4CM4A 6Q21A 2LV8A 3FKQA 4V2IA 1P8JA 1P91A 1R3UA 4FI3F 4B3BA 4M60A 4WKPA 5EWJB 1KH2A 5JS7A 3N2IA 4GGPA 2ZRNA 3QFTA 3FKSA 2WZDA 5D3MA 1G3UA 4AJPA 2E5LB 1ZINA 2JBHA 2Q4OA 2XE4A 3MTBA 2DHDA 3GCDA 4BCBA 5THKA 2V7PA 5IAEA 2FI1A 2I2BA 2RGBA 1F4PA 5CMLA 1IJKA 1EX6A 4ZANA 2H7XA 2RD2A 2PD4A 1CHDA 1YFJA 2GDZA 1N8SA 3EUEA 4EHDA 1Q1ZA 2H7YA 2CJYA 4C7KA 5JS8A 4WDQA 3KHTA 4XR4A 4Q93A 5BRAA 1B2RA 1B4DA 4O4HA 4QE3A 2BFDA 3M83A 3H1FA 1JG6A 3I05A 4Z99A 4J76A 3WGHA 2BMJA 3PX7A 2Q6IA 1XSEA 4I4TA 4EEKA 2ZI3A 1Z08A 3PD7A 2EWVA 3AR7A 3G8CA 1GUYA 4TWRA 5KAMA 2KMLA 3COPA 1EYZA 3ECCA 4FMCF 4W9NC 5IAJA 3UQYS 4OAPA 2O19A 4FCTA 5FV4A 4I7EA 3ZDYB 4BBPA 2UYOA 1L5KA 5JXHA 2ZAYA 4YACA 2Q2OA 5HKAA 5K45A 1DWOA 1EP1B 1O96B 1UAAA 5GGXA 1NW4A 1SVMA 4N65A 4BGEA 4D4KA 4BLPA 3P5BA 3TUIC 2CLHB 2I0FA 3GB9A 4BUCA 1O94C 1SFRA 3L05A 2A9JA 4HVTA 4QICA 3CRRA 4UHKA 5CT9A 2HSEA 4QASA 1JFVA 4OXQA 3VPGA 2B1QA 3KT0A 5FUXA 3WB2A 5EHIA 1D03A 1I24A 2C31A 2F3SA 3JAKB 4QTZA 1UT8A 3IAUA 5FLYA 3QE3A 1W4ZA 4BNFA 3E9CA 1GYQA 3EZFA 4DCGA 3BDAA 2Q5OA 1I5EA 4QM7A 3QYJA 2RARA 5EXSA 3A9UA 5IH3A 2AOUA 2CJWB 2OV8A 1S0UA 2OHOA 3KYDB 2X0DA 5E7QA 3FHTA 1UKAA 3F5SA 4OYLA 5IP5A 3ZN2A 2VDPB 5A3QA 3ZGOA 4X65B 5B6PA 4QAJA 4TKZA 2QMZA 3LLSA 4YUAA 4EVQA 1KS2A 3GX1A 2H9IA 4LZZA 4G2TA 1VPDA 3DKIA 4URHA 3OQHA 4NCXA 1SVOA 4AWXA 3G0DA 5JD3A 4M2LA 4Q3KA 5B2EA 1JDBB 3ZX4A 2C4HA 4C4OA 4DDUA 1ZM9A 1P0FA 1Y5RA 1OE0A 3UW3A 1KKLA 1FSZA 1KAMA 1UKZA 2QVCA 2B9EA 2WG2A 1H2ZA 3E1SA 1FP4B 4GMXA 3T41A 4C5BA 4D7AA 5JAIA 3A05A 4Q34A 1RI3A 1X1TA 2KB0A 2RAVA 4M1ZA 1SB9A 1R4AA 4B3SB 4DBZA 1Y4AE 5JD6A 4HWTA 3ZIAD 1PJBA 1J8FA 1XXHB 2JLRA 4DNOA 3U5TA 2R62A 4LVCA 2RJNA 5DGHA 5LM3A 1M2VA 4TTAA 2J9FB 1D7OA 2BMFA 2JD0A 3AFIA 1UBOS 4NCKA 1NC1A 1UWCA 3NNNA 2EZTA 2NO0A 3WWYA 5JNRA 1S8AA 2CXHA 3BXOA 5BV8A 5HKKD 3R6LA 4FOPA 3CEHA 5IK2D 4Q3AA 1TC2A 4MMYB 1WUTA 3L1JA 4KBGA 4AN4A 5CIWA 3UJ6A 1B8VA 2GM4A 5LDGA 4O4LA 3GLHE 2AFHB 3E1GA 5D84A 1G291 1V3UA 1W75A 2DUNA 3OUUA 5CT5A 4KU4A 3P2OA 3R9WA 1HL7A 1USVA 4B81A 2ZT5A 1KBZA 1Y80A 1MXHA 4YRLA 2PD3A 3WY9A 4C0AC 2P2YA 4IOMA 2YVKA 4V0NA 1CUUA 3GZNB 2XVYA 2ZVDA 3M49A 1QGDA 3KO8A 4I1UA 4NZZA 1R5OA 4QNRA 3SFVA 3VO8A 4AZWA 5JBIA 4BPBA 3T7SA 3VSAA 1RLUA 4JFAA 4G36A 3V55A 1G4HA 2IE8A 1XTTA 3ROEA 1OBVA 2CVPA 3KKPA 1XQVA 3AKDA 3HFJA 1UZAA 1YMVA 4QGFA 3QVLA 5JCZA 4ICIA 2HWYA 3NP9A 4BECA 1ECFA 1UBUS 4NR0A 2FVYA 4K05A 3F7TA 2ZJFA 3IVAA 4J1QA 2V7QD 3UPTA 4HL6A 3TLAA 1PUXA 1RJWA 4MNTA 2JLXA 2AJCA 3EBOA 4MDEA 4FDVA 2CMGA 3ENVA 3U49A 3EPPA 2UXCB 2IS6A 1NMQA 1SXHA 2OCAA 4MKFA 1ZIOA 2C9BA 1JSZA 3GJ3A 5KVAA 4E0BA 5K01A 1SIUA 2C00A 5TF0A 3HDJA 3KTOA 1SOUA 1TU0A 3HSSA 5E7JA 5AXBA 4TYWA 1J1IA 2GTPA 3B3GA 1UK7A 2WG1A 4ZICA 4WXMA 1FNDA 3ZE7A 1OZHA 2ZE6A 3BJRA 4Y2HA 1MFZA 4BAGA 4DA4A 2HU5A 3OJWA 2WKSA 1P4AA 1QCZA 1G20A 1Q3HA 3RDPA 3K73O 1OREA 2Y1GA 4CF5A 4LF9B 2NNWB 1LLCA 2WP8J 3EC7A 3EA5A 3LA6A 2ZUBA 3L6CA 3UJAA 3BILA 1UP7A 1FJ2A 3MFQA 2LIVA 2P0YA 2ZTLA 3FMVA 3T9FA 1Q0PA 1XRPA 2OZKA 3MB5A 2J3KA 1QVRA 2XVZA 1G8JA 1LDNA 1CQPA 1WUHS 4P7BA 3SZLA 4BASA 1O57A 2I1VB 2O0MA 3R6WA 3SEFA 3ZZ1A 1C3OB 1K7SN 2FPXA 4JSYA 4O33A 2W2XA 5TQJA 4DBVO 4G25A 4X3PA 4LJ5A 1M10A 4ZQIA 1M6HA 2BDUA 5KJEA 3TRKA 4CNQA 3IQXA 3IKJA 2YW2A 3KC2A 1YDGA 1VI2A 3NHKA 4YNBA 5KDDA 4FC6A 4D1YA 4N6GA 1WXIA 2ZT8A 2EX1A 4P4TA 4C6SA 1PJLA 4AULA 5T7BA 1BQ4A 1UH5A 4Q4AA 5EXTA 1CZUA 3K0CC 4FZ3A 3LYUA 4GOMD 3A9TA 1E1DA 4MI1A 4MJXA 4RD1A 3DT6A 3DHEA 1G8FA 2W2QA 3H5WA 2NWQA 1WWKA 3ENZA 4KQJA 4X92A 3JAWA 1SXJB 1QB7A 3A3OA 4TRMA 5K4HA 1G16A 3IEKA 5BQOA 1CUYA 2WIDA 1J5PA 5EINA 4NESA 1P2UA 5DLEA 1MAUA 1P9RA 3R24A 1J56A 4UEOA 5GV7A 3FVVA 4OHVA 4JOCA 2Q6KA 2R60A 3L9XA 1GHTA 4E4RA 3CRMA 2E5WA 1SK8A 3OOJA 2CNDA 1V1MA 3IV6A 3MN1A 3R77A 3AVXA 1RM3A 1MKYA 1YTLA 3N5CA 1WUYA 3H65A 3KU1A 2NO6A 2B4KA 2ZSJA 4N7BA 2Q9BA 1QRSA 3GYBA 4QRDA 3ZV4A 4HI0E 1ZJJA 2H51A 1HV8A 2V1XA 2Q8QA 4KVFA 3JD4A 1G3MA 4WOBA 1NW6A 3L7JA 1X2BA 5TQVA 4BPRA 4F56A 1RWOA 2WF8A 1XCOA 1AIPA 3TS1A 5IM5A 4AF6A 1SELA 1ZH8A 1RM0A 1ZH2A 2QQ0A 5K6TA 4ES6A 3GA5A 3MTAA 3Q5DA 4D4GA 4KIWA 1KY3A 1J00A 1L7VC 2NV0A 1XAJA 2XD4A 3QTBA 4FX5A 4RELA 4ZEVA 3K0HA 4ARIA 1WEHA 1Z25A 3O7MA 3ZHUA 1N8TA 1LNQA 1P2VA 1PAUA 1VLJA 2PKWA 4XWTA 4F21A 3ML1A 3DC7A 1DELA 1GUDA 2D1RA 5THQA 3IMEA 3SEZA 3GUCA 1O58A 4MUGA 4TVBA 3CC8A 1P5JA 2X9NA 1SKQA 3L7OA 3VTZA 4JMPA 1N9ZA 2G82A 1L8XA 3D3QA 3IE0A 1H42A 4C4ZA 4F38A 4HWGA 2PYZA 2WOOA 3FPBA 1UBJS 5U4QA 4GL2A 3UATA 1A4IA 2QIPA 1G21E 5KYNA 3D5QA 4I99A 4D3DA 5F4BA 5CAEA 3AY3A 3MCUA 3RB8A 3WLHA 1NBMD 2BCJQ 2WNHA 4HX9A 1UBFA 4XGNA 4WVFA 1WD7A 3VU0A 2BM0A 1JEJA 3VKUA 1T6YA 3NM4A 4MULA 4FKMA 5LP6A 3BWMA 5G0TA 1P77A 1T6NA 3WOVA 2EKZA 1RJ9B 3PFHA 1N33B 3WJ2A 1UOEA 2GARA 2QZSA 3HKDA 3QUAA 2XT9A 5K8IA 2W11A 3GL9A 4G07A 2ARKA 4O02B 4R2HA 5K7SA 3DVSX 2YWDA 1VPTA 4BFUA 1JBKA 3BIXA 4E7PA 1IUOA 2YDXA 2PLRA 3Q9UA 3OICA 3QEJA 3A2KA 2V7WA 2G9UA 1BSVA 1VRWA 4UDYX 1QHFA 1GA1A 2B7LA 2EF1A 3G5TA 1GG8A 1E4VA 4JIMA 1JDUA 1GQQA 4MB6A 3SDZA 4BJHB 1DBQA 4O4IB 3KT3A 3BWBA 3HP7A 4R5MA 4RIIA 5LDHA 3THWB 1TT5B 1VBFA 3P1JA 3QJYA 3GMDA 5DOZA 3AI2A 2C7OA 1C7EA 4JUIA 2A0WA 1HETA 3L43A 1O97D 3VI4B 5JCXA 4F3TA 1L7EA 3T7IA 1Q1BA 5KYKA 1YJAA 3QEBZ 4N3CA 1OX5A 4YQFA 4M55A 3PJRA 3P2IA 1U2SA 2ZT6A 3PNPA 3ADCA 2V7VA 5HHTA 4RVHA 4WKNA 4R1SA 1I6LA 4WUVA 1NF8A 3IE1A 1SQ5A 1Z2PX 2YFHA 1E6MA 4ZQBA 2H4WA 3E8XA 3V4RA 4WOJA 3JQRA 2IYZA 2JJ1A 2P6MA 4ZXFA 1CT9A 1RQ2A 3TSZA 4E3ZA 1HDZA 2BOVA 1JU9A 4G5XA 3MLBA 2W98A 4JP8A 3SHOA 2QRKA 2C2BA 2X13A 5A5GA 1E3EA 4DLRA 3AI3A 4N49A 3Q41A 1RJEA 1D8TA 1ZHFA 4P86A 3DDHA 3RWBA 1USIA 3VI3B 3LPLA 2WJZB 5HQ3A 3D4NA 2EJBA 1W5EA 5ABPA 1NJ8A 2FPIB 1YZNA 3CR3C 3O21A 4HDQB 2FRDA 3AF0A 3R5KA 1I6WA 1N9GB 3AVQA 1LI5A 3RSSA 1EVZA 2R5FA 2J4DA 1D2MA 1S2NA 3OJEA 2WWTA 5ALFA 3F9CA 4F9EA 2BSQA 1CE8A 5E3JA 2IEBA 2ODAA 4L8YA 1ISMA 1RWMA 5FBZA 3MCZA 2D4AA 3R2JA 4CIAA 1U7XA 3T7KA 1P8AA 2O2XA 2MIIA 3UJCA 4YRBA 1TIBA 3B48A 1MZVA 5CA1F 4TKUB 1N5KA 5E9AA 3IVRA 3W1VA 3IP7A 2OB2A 4IDOA 1N3YA 1O87A 1EWYA 1MT0A 4MZXA 4MLPA 5CNJA 1JQEA 1FFYA 4RKYA 3UC5A 3L8FA 2NTVA 1SCUB 1SWWA 2QRVA 1SZDA 4YB8A 5GM1A 4DMMA 5JC8A 1EQAA 4TROA 4JI6B 2XUFA 3T4PA 2QMQA 2IV7A 3PC2A 4PSVA 2QD1A 3A9VA 3R40A 2BCGY 1TE2A 3FYCA 2QI9F 4RJIA 4AX8A 2ZZMA 5A0TA 3UMRA 2WQZA 1B2LA 1FFSA 1K5PA 2ZITA 3VYWA 4E6PA 4GOKA 4RZIA 1ZMTA 4NCAA 1GTJ1 1KMHA 1XCPA 2PH1A 4K3UA 4MQEA 5CP8A 4QLBA 4PEVA 3C8MA 5KNDA 3BB3A 2A0FA 5KHAA 3HVRA 1J23A 3H97A 2YZMA 5EXEA 4R0MA 1K1EA 2ZRKA 3BS4A 3R0XA 1MIOB 5A5VA 3AF4A 4FU0A 4DSUA 1A2BA 4BJ1A 4DHWA 1YZGA 1P45A 3DDNA 4QU8A 4ZAVA 1PK9A 2B5VA 3EVAA 5BSFA 3PFBA 5BPHA 1XDZA 4MLZA 4XQEA 1ZU4A 2PZMA 3BJZA 3MWFA 3M4YA 4OQZA 4IILA 5LA6B 2NAPA 4HWSA 4KI7A 3ELDA 4FFRA 1RAEA 5T6BA 3URMA 4V39A 4IJ6A 4RH0A 3E1KA 1QO0D 4QUKA 3TOVA 4Z1OA 4IGEA 4B6QA 4D46A 1DHRA 3CTMA 3R7LA 2I34A 1BNCA 3T1OA 5KAPA 1K7EB 4XYGA 1X7YA 3NBUA 4ZVVA 3TXAA 1JYFA 4LV5B 3IO5A 1Z68A 4GPBA 2H0AA 4XSGA 5AHOA 3VOBA 1UM8A 4FTWA 4UKDA 5DBEX 5J63A 4I8IA 5A3RA 3LY8A 1ABBA 4LA4A 4OM7A 4KFCA 3MJEA 2H1HA 5F1PA 4G0UA 2ID8A 1AZWA 1D2GA 4MV4A 1NURA 4D3YA 4FDLA 4OOFA 2C7GA 3AEQA 2GZ3A 3HN2A 3FLMA 2AZXA 2V4ZA 1L6IA 3TTXA 3ZE2B 1ISRA 3BGDA 1LRJA 2RHHA 3QVSA 5BSEA 5JWRA 3VJLA 1P0MA 3F8SA 3TE7A 4P1ZA 5BY2A 1I7DA 2F1RA 3LQ1A 3VU9A 3MIIA 3R3VA 2AN9A 1ZEJA 4B9AA 1EUQA 5I47A 1E4EA 3CLRD 3U4MA 4J29A 1E9SA 3TAXA 1SXJD 4HZUA 1NRWA 2O5RA 1S7CA 1VC2A 5CITA 3HZZA 1NULA 4RZ3A 5HDQA 2EJTA 3GVXA 4KO4S 3HU3A 3NC0C 1FU8A 2G9VA 2OY0A 2AG6A 2ZIXA 4K9LA 1JDJA 5EYPB 4WN9A 9ATCA 5KYXA 3C3WA 4FB4A 3FCOA 2WJ4A 1WDMA 4MJ7A 3EQ9A 1DC3A 3GRFA 3EW9A 2AZ4A 3N2EA 5DTQA 1RBQA 2CLDX 1TJPB 3HYRA 4RQUA 3PUHA 2KX7A 4M0DA 3K20A 5HS4A 2FGJA 4P3KA 3ER8A 2W2LA 2KLBA 2NLOA 4HLUA 2VVTA 2QAGB 3F0TA 4MUMA 3WV5A 2NZVG 2FDRA 4ZTBA 2WLSA 4F4JA 5I45A 4N03A 4NCBA 4K9KA 4PE5B 1A98A 4TVOA 3J7TA 2A5YB 1YRBA 2PL5A 4WLFA 2H4JA 4MGEA 1OGYA 2DBRA 1ISFA 1SRRA 2KW5A 1AUOA 5AVVA 2PE5A 4V1CB 4CM6A 1O95D 5K51A 4RTNA 2C99A 2Z2ZA 3D31A 3OCZA 1VKHA 1Y4UA 4X41A 5DZSA 2J0EA 5FOTA 5IM4F 1M1YA 2B8JA 2A94A 2V7TA 2J31A 3MYRA 1UADA 2BP7B 5B64A 4FMDB 1I4LD 4YA6A 2H54A 5JDIC 1XRMA 3PNKA 3O26A 4HGYA 5JI2E 1A88A 1C14A 2O7SA 4TUYB 3JQCA 4EKDA 4H17A 5IAKA 4EJSC 2FN8A 1C1HA 2NMVA 2HAEA 4FGUA 4UXHA 1SJ9A 2BEWA 4RY0A 1Z4JA 4ND4A 5C4GB 1BJTA 1M8GA 4KWEA 1XJ5A 1YI0A 1ZOLA 3S1AA 3P2KA 3I04M 5AVQA 3I8XA 4M1KA 4RDXA 2XSZD 1N78A 4XSHA 3IJPA 1PWEA 1RWVA 2CUKA 2Q0HA 1NV8A 1W6UA 3DLPX 3KNZA 3QU4A 5ALQA 1QU3A 3GDGA 5TX7A 1YUMA 3CXRA 5HIAA 1A77A 3FMIA 3QJ5A 1FLDA 3ZD6A 1JIXA 1E0SA 2X5NA 3NHSA 3FUTA 1V2GA 1EDOA 2HQ1A 2CDRA 4YDRA 5EQTA 1H94A 2C7VA 3RQSA 2DPHA 1J2UA 2CC2A 2PAFA 2ZJOA 5B1DA 3E0QA 1EXWA 3FBWA 4TKVB 5AW7A 3HY4A 5CYFA 3BT7A 2XGOA 3CCCA 1Q0QA 2JBAB 1DG3A 1E5XA 2JIZA 2ZTSA 3EQ8A 4HAYA 4A6EA 1KYXA 2P7IA 4WBNF 5AW3A 4RGQA 2B5WA 3CB4A 5G4LA 3W5CA 2XKBA 1E5VA 1IB0A 1OAOC 1WS6A 5A4IS 2HA5A 4MUJA 1VIYA 3GFOA 2NU7B 1T8PA 3B8EA 4NBRA 4JT2A 3DEYX 3I2JA 2BT4A 4LY9A 4B73A 5IZCC 3PNYA 5EHNA 5FPSA 2WKQA 4OB7A 3KE8A 3WXBA 4EY8A 4C6TB 4YRKA 5LD2B 2A5LA 4EOGA 1WB4A 2OWDA 3EULA 1YHYA 3HVHA 1SCIA 4M9SA 2NU6B 2B0JA 2ZAMA 1HE4A 1CZNA 2GN0A 5KZMB 4J49A 4HTFB 3K0FA 5CU7A 1ZUNB 4JL8A 4HWOA 3VNQA 1GPJA 1KP3A 1WHSA 1X92A 2PS3A 3F90A 5EP3A 3NC1C 2PH5A 1E89A 5LUAA 3F5DA 1AGNA 2PEZA 2XT0A 3H17A 3VU3A 1IQPA 2DUUA 3R3WA 3T8YA 4BVJA 3QVVA 1OU0A 2PGOA 2BFMA 1TCCA 1LD3A 1TUIA 4DREA 1RXWA 4KX3A 2W8BB 5F1OA 3QHPA 4MJ3A 3T15A 1T1EA 1VP3A 3RVSA 4DMRA 2JLSA 5EQFA 4MV9A 3A6LA 1V7PC 2QU7A 1JB9A 2VN8A 4AIRA 2PUFA 3ZE9A 1KORA 2EJWA 4LG1A 3UAZA 5AMXA 4AG6A 3CLVA 4K6CA 3DB1A 3IYLW 3KM0A 1HQKA 1VL5A 4PZAA 1DJQA 4A27A 3T9BA 4CMHA 1GP2A 4X6XA 4UM8B 3W5UA 4CTJA 4CDRA 1JJIA 3WZ2A 2I55A 4D81A 1XBTA 4D8WA 3H2ZA 1YVUA 5DCYA 5K0BA 4WFKA 4OPMA 4RD6A 3F8WA 3HJBA 2IYPA 1QIKA 2HSZA 3GMIA 1JIJA 4FMPA 5ARBA 2YJ6A 1NR5A 3ZCVA 1IN1A 1LJLA 4N48A 4RGBA 2ZZKA 3FPJA 4TYYA 5KTTA 4UD2A 2PKYX 5HF5A 4TXLA 2XH8A 3LJKA 4UDOA 2UVPA 1RLTA 4JLWA 4CT5A 2VF2A 2EQBA 4F4UA 1XROA 3VDRA 4IZIA 3JQ8B 1F5NA 1GQFA 3LZCA 3RS7A 3H4TA 4Q21A 1ZK1A 4DQDA 4QWWA 1IY2A 1HORA 4LJRA 1YDFA 1F6DA 4HRVA 5ADWA 2ODQA 3HCEA 1BVYF 2CNNA 5CA0F 2XCIA 4C7MA 4IIJB 2XGSA 1Y98A 1JJ7A 3EZ7A 1V8ZA 3DFFA 5DCUA 4C3OB 3CT6A 4ZRNA 1F7VA 2D06A 4RSMA 3K92A 2OPBA 1X8KA 3OT4A 2IK8A 4RV9A 1QIHA 3AFNA 2JAHA 1VFNA 4TQGA 3USZA 2PGLA 2UYCA 2QMHA 5CR9A 4G1BA 5K3OA 4KBYA 3CBQA 1ORHA 4X8OA 3AONB 1RI4A 2H4XA 3JD0A 2WOJA 1XIVA 4L15A 4MUYA 4FFBA 2VXOA 2PJDA 4LJLA 4UNIA 5B3JA 3WYCA 4PO1A 5K0ZA 5KVSA 2HA4A 2PPVA 4QOSA 1AS3A 3O6VA 3K2QA 2BHSA 4MKXA 1M5RA 1U2TA 2EU8A 5G3YA 1PF7E 2WIJA 3T9AA 1G6Q1 3ZWKA 1T15A 4ZAXA 2VG8A 1I9CA 3MCAA 2PBZA 3V4ZA 2XUKA 3GEGA 4KACA 1BG6A 4NENA 2A58A 4AY3A 1I2CA 5D86A 4EHNA 1LRKA 3LK6A 4QATA 1XGKA 1OLSA 4V0LA 3WLQA 3CRVA 5CFLA 3GPIA 5CCXA 2X2OA 2R47A 3I6BA 1W73A 4N5NA 5HS6A 4J94A 1JEEA 1ORWA 1W25A 2ZYWX 1P2SA 4C0QC 4HV4A 5CG1A 5A4FS 2HLNA 5F33A 5AJTA 5MF6A 1R4ZA 3DO6A 4YQYA 4IFEA 3V8EA 4BVGA 3NEPX 3G23A 1LNZA 2J3LA 3I0NA 3ANSA 3IVXA 4JXKA 4WOCA 4RKQA 5BNTA 2IHNA 2ERYA 1R10A 3PJGA 4EFKA 3G68A 1E3QA 1WDKA 2Q3JA 3KK0A 1E1QA 3FPGA 3KYCA 1J09A 1VCMA 4H08A 4NYJQ 5EJFA 3ZCQA 4R2LA 3W2IA 3EMKA 1E79D 2IHUA 2J4FA 3RLIA 5D5QA 4P5PA 1EK1A 2VXYA 4BFVA 4BWFB 1WVGA 3PRHA 2PMKA 1LTKA 1T2AA 1SXIA 1FZQA 4NH4A 2RAFA 4ZCSA 4CLOB 1IN8A 3I45A 3Q6MA 4LX0A 4NJMA 1PYOA 4I6JA 2C58A 1LQTA 2AR0A 4CLRB 1BRTA 4IIFA 4A26A 4UNRA 2LVBA 2NXCA 4R83A 3WVNA 4OLBA 1NXQA 5BN4B 4JLOA 1CUDA 4CKXA 1L7OA 4M83A 2J45A 3RTEA 3BKWA 4A6DA 2VAXA 3H2KA 2UAGA 4UUAA 1I8TA 3RK0A 3M3PA 1ZJWA 2VJLA 1RP7A 4NV1A 5IC5A 3ZEAA 3ER9A 2XF2A 3HB5X 1JWLA 3DLHA 2W43A 4MQLA 2WTBA 4K1LA 4QUIA 4EATA 1PDWA 3VXKA 2JI9A 2Q2VA 3BGVA 4E94A 5A2GA 5BQXA 4DA7A 1DLJA 4YMHA 2E89A 1PTJA 4OQNA 3OZSA 4EFLA 3IXQA 1KE1A 3UWDA 3U3MA 1NW8A 4RMHA 4ARSA 1SHUX 1H8ED 1V6SA 1TCVA 3A26A 5KC8A 3T61A 2Q6VA 3IR7A 4ZYWA 3K7EA 1RBYA 3MGAA 5EY5B 4DLNA 3LPDA 1CF2O 4TMVA 4XEUA 1H9AA 1T4BA 1PK7A 1GDHA 4ARBA 3QEOA 1GCOA 3MPUA 3C14C 4BNMA 2ONYA 1FU7A 4QU5A 3W2EA 1NW7A 3OCXA 3LUGA 1TKCA 1MW9X 4KSCA 3RAJA 3WK7A 1PLLA 2C2WA 4PSUA 2R65A 2ISCA 1L7BA 3HJAA 4D0SA 4OXIA 4TRRA 4UUNA 5BWOA 3TN7A 5K3AA 5FTWA 1GZHB 1F38A 1WUIS 1ULZA 4FHFA 1OTHA 2Z5GA 3WBKA 1Q11A 1ZIDA 2Q4BA 2IU6A 4DA0A 3G2OA 3HDVA 2IYFA 1E9EA 3W6OA 3GT0A 4KLZA 1EFRD 1I2AA 5F7XA 3QYAA 1JVBA 4KKVA 2IPLA 2JATA 4PCUA 1OAKA 5DI3A 4CTOA 4RA6B 2PX2A 4WBSA 3T5GA 3T3PB 1NA5A 4J0QA 3SC2A 1EJ6A 4F2GA 3O8NA 3QK7A 4Y6QA 1KH1A 3VR5H 1TOAA 1BD4A 1RXVA 2ZWPA 5DGDA 4JB3A 4PVCA 1U9JA 3MOS