5CT4A

Wild-type bacillus subtilis lipase a with 5% [bmim][cl]
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
179
structure length
179
Chain Sequence
HNPVVMVHGIGGASFNFAGIKSYLVSQGWSRDKLYAVDFWDKTGTNYNNGPVLSRFVQKVLDETGAKKVDIVAHSMGGANTLYYIKNLDGGNKVANVVTLGGANRLTTGKALPGTDPNQKILYTSIYSSADMIVMNYLSRLDGARNVQIHGVGHIGLLYSSQVNSLIKEGLNGGGQNTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Esterase
publication title Crystallographic Investigation of Imidazolium Ionic Liquid Effects on Enzyme Structure.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 68
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2015-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5ct4A00
4K6GA 1TKRA 3SX4A 2JGKA 3AIMA 4G1FA 3DL7A 5E2IA 2ZYRA 3MVEA 2WHRA 1GPNA 2VA9A 3WKDA 2XQGA 2ORYA 3DOIA 4LKOA 5ALOA 2IX9A 1UFOA 2ZJ7A 4C4XA 4U2DA 5EIEA 1EX9A 4B85A 3IURA 2HA5A 1EA5A 3IA2A 1IUPA 3BJRA 5A6VA 1L7QA 2G5TA 4ZWNA 1CQZA 1FSSA 4K5QA 2AJLI 4I4CA 1J06A 2CEKA 4G8CA 2VQ6A 1P0IA 1H23A 1GPLA 3H2IA 2ONCA 5JANA 1EK2A 4LYDA 1WCYA 3S2ZA 1ORVA 4L0CA 5D7BA 4AN1A 1THGA 5JAPA 3WL8A 3BDVA 5BOVA 3WJ1A 3C6YA 4Q1VA 3FAKA 1ZI8A 1JU4A 2RAUA 1LLFA 4J0DA 3DKKA 2GBFA 3STWA 3WA7A 3ED1A 4Y9SA 2PUHA 4IH4A 2GYUA 1FFEA 3HACA 4LHEA 3BL8A 5AKJA 3DCNA 3V48A 3W9BA 1UOPA 3M82A 4WCVA 1CUCA 3P2MA 2I3ZA 1JJFA 5IVKA 3JWEA 2WU3A 2HRQA 5DLPA 2PPLA 2WUFA 1IUOA 3EQ8A 3LIIA 5DWDA 1DT5A 2J3QA 1FFBA 3H1AA 1U4NA 2JGJA 3I6MA 2WFLB 4KAFA 4FBMA 4PSUA 1DTEA 1XZLA 5DTJA 4C01A 5HF9A 4BVJA 1OILA 5DYWA 1QIEA 4OU5A 2HU8A 3I6ZA 1XRLA 5JIBA 1ODTC 3WIBA 2PSHA 5LZ5A 1THTA 1Y37A 3ZLTA 3AZOA 2HDWA 1QE3A 4YK7A 3R3VA 1F6WA 2B61A 5D3KA 1XKLA 1XRQA 3RARA 4X90A 4BCCA 2OXEA 4B84A 5AK5A 1IVYA 3CXUA 5CT4A 2W22A 4J03A 1QO9A 5ALGA 5HKBA 1VE7A 4P92A 3G0CA 5KWJA 2WIJA 1HKHA 1X2EA 1QIHA 2XUHA 3IVMA 3FVRA 5LZ2A 2CMFA 4DMHA 3UUFA 2XMGA 3NUZA 3WA6A 4Q3KA 4ZREA 4DNOA 2WIGA 4AQDA 1AUOA 1BCSA 2AJ8A 1JKMA 4PW0A 2E3JA 5CXXA 2X8BA 3C6XA 5HQ3B 4H18A 1A8QA 2DQZA 2WG1A 2WTMA 4DSAA 4DMFA 2QUBA 2G63A 4N8SA 5AIBA 1EHYA 2O2GA 3O4HA 1Z68A 1N8SA 4W1SA 5ALZA 5EHZA 2R8BA 4DNFA 3H17A 3YASA 1ZD5A 3F98A 4B9AA 1BE0A 2XMRA 3PE6A 2ZYHA 1TQHA 4MYDA 1VLQA 4A23A 5LIPA 1E8DA 1R3DA 3WI7A 1MT3A 1LPBB 3VVMA 5I8PA 1PV1A 3STTA 5ESRA 1JFRA 3WJ2A 4DMCA 2D5LA 1LPSA 5HFNA 3WK5A 4J0IA 1CUBA 4KYVA 3NOXA 2FUKA 1YAJA 2CKMA 5C8VA 5AKYA 3FSGA 1YB7A 1QGED 4GHWA 3G0IA 3VJKA 3AZQA 2QVBA 1K8QA 3C6ZA 3C8HA 2VF2A 2BUCA 3AINA 1FJ2A 3ESBA 4X91A 1T4MA 1E89A 4KAJA 4FNMA 4XIIA 3PUHA 5H3HA 1WOMA 4L72A 2XUJA 2H1IA 1L7RA 1EVEA 1MNQA 1USWA 5AP9A 2RHWA 5ALXA 3QZUA 1DWPA 5ALIA 2VJDA 3ESDA 3GUUA 4BAZA 2WIFA 3WQHA 2PSJA 5C8ZA 1EB8A 4H7EA 2YASA 1H2YA 3MGAA 2IITA 1ETHA 2PSEA 2VTVA 2HA7A 4QDUA 1R4ZA 4OCZA 3FYUC 1ZJ5A 2XMCA 4GWLA 4QDZA 4TPKA 2ACKA 1N5MA 1NU6A 2PM8A 5FOQA 4BDSA 3W06A 1BN6A 4Y2UA 1QIMA 4EUSA 5AKLA 3WWPA 2XQFA 5HF5A 1CUXA 3D59A 1VXRA 4B9EA 5SYNA 3SC2A 4DNQA 3N2ZB 2HU7A 3F8SA 5FPPA 4ZV7A 1ISPA 3WKAA 3FWHA 3JYHA 2Z8ZA 4FFVA 3F9CA 4WY5A 3WKCA 3WWCA 2V97A 2D0DA 3BJMA 1CUGA 4B6GA 4IHAA 4FLEA 2XUOA 4X71A 4MWSA 4NVRA 4J3JA 5IH7A 1UKBA 3X3HA 1XLUA 3FNBA 2B9VA 3WLAA 2XQKA 5D3ZA 3VXKA 1T2NA 5HCUA 4BCDA 5ALEA 5T4EA 4FNGA 2GYWA 1YCDA 5HFAA 2GBCA 2V96A 2HU5A 4UHEA 4UPDA 1VJ5A 1XROA 5AM3A 2ZYSA 4RE5A 4F60A 5KWIA 1CR6A 1XZKA 5FV4A 3A2LA 2PSDA 5C8XA 3W2TA 3C43A 4EZIA 1CUIA 1R88A 4QWMA 3FYUA 4LYEA 4HRXA 4CIAA 1E8NA 3QITA 4CG2A 1ZIYA 5DNUA 1DQZA 1QO7A 4GXNA 4UHBA 3T52A 5AI8A 3RM3A 3TEJA 1X70A 4UBIA 3HI4A 4J0CA 4ZGBA 5C7YA 4M0EA 4YPVA 5A7GA 2WG2A 1LBTA 3KWFA 5CT9A 5CT5A 2OGZA 5YASA 4XWGA 4Y2PA 5LZ8A 5HK9A 5AICA 5JADA 3HC7A 2PVSA 3FCYA 2PBLA 1DX4A 5ALJA 1MN6A 4NZZA 1YB6A 4MXDA 3Q8WA 4U2FA 3V1MA 1ZD3A 2WKWA 4AN0A 3HSSA 2EDAA 1CUWA 2WIDA 3ESAA 3E4DA 4QZVA 2H7CA 2RI6A 3G7NA 1AKNA 2OAEA 2FX5A 2WJ3A 5CT6A 3OOSA 1CFJA 2OCLA 3GZJA 3FOBA 5FUMA 2ZSIA 4P93A 1SCIA 1UXOA 1MU0A 1XZMA 2ZSHA 2AXEA 2WTNA 1AQLA 1UK7A 3QM1A 4A16A 1B41A 5HK8A 1VA5A 1LPOA 3KD2A 1JJIA 3QMWA 1ZI6A 1ODSA 1AX9A 3WWDA 3BF7A 1JJBA 2OGTA 3Q0TA 4U2EA 4B81A 1G66A 1DT3A 1YA4A 5LKAA 3G9UA 4FBLA 3PICA 5FP0A 2HFKA 3UMJA 3BF8A 2CB9A 2YYSA 4OPMA 3B12A 4BATA 1PFQA 5CBKA 4CFSA 2H9YA 3PI6A 2GZSA 3WL7A 2BFNA 4M0MA 1WHSA 2XUDA 1P0MA 3WKBA 5DJ5A 4FHZA 5LYYA 4ARAA 1AC5A 5T4HA 1CUDA 4E46A 4L3WA 3EQ7A 3JW8A 4V2IA 3CCBA 3V1NA 3A2MA 5AKKA 4J7AA 4DMKA 3HYSA 5AM4A 4GW3A 3O95A 4X85A 3WYDA 3G8YA 2DHDA 4Q3OA 3I2HA 5EIAA 2FJ0A 1QIJA 3QH4A 4UBNA 5HKAA 3DLTA 5EI5A 4DYHA 1F0PA 1QIKA 4UHHA 1MX1A 4LIPD 2ACEA 4CCWA 6YASA 3KWJA 3M3DA 2XE4A 2JF0A 1ZIXA 1CUYA 3QMMA 5EHQA 5AK3A 1Y7HA 4G4IA 1N5RA 1RWQA 2BCEA 2R11A 2AJBA 5LP1A 5DTIA 4FOLA 1KU0A 1Q0RA 1MX9A 3K6KA 4I19A 1DWQA 3FBWA 4BZZA 2WJ6A 1FFDA 4UFNA 1XZGA 1E3QA 3VISA 1TIBA 4AB1A 2WSLA 1TAHA 1CUZA 3FLEA 4UFOA 1VOTA 3B5EA 5EHNA 3G0GA 5IVDA 3WK6A 2QR5A 4GBGA 1VZ2A 3I2IA 4K2AA 5ALWA 3HLKA 3IDAA 2JIDA 5FKJA 1ORWA 2QM0A 3DQZA 3W04A 4O08A 3SK0A 3G9TA 4CG1A 1XRNA 1ZJ4A 1IZ8A 1XQYA 5AI4A 1N1MA 2H7XA 5BV7A 1UT6A 1CIJA 4H7JA 5AH0A 5HZGA 1C7IA 1UK8A 3DKRA 3TJMA 4W1PA 4KEAA 4J0HA 4H0CA 2CJPA 2GBGA 3FYUB 1K4YA 5AJHA 2VAVA 2DQYA 1Q0ZA 1KEZA 2AJDA 4AXBA 2XUIA 3TRDA 4YX9A 1WB4A 3R3XA 2G5PA 1QIIA 5A62A 1QFMA 4AZ0A 1A7UA 4WDRA 3DJYA 5BWBA 3UUEA 1XQWA 1MX5A 1ZI9A 4KE6A 4K6HA 4H35A 3BDIA 5T4FA 3LIPA 2OCKA 4G8BA 5ALHA 3GELA 3M83A 3NGMA 4EY5A 1QTRA 5CXUA 1VE6A 4GDMA 4LXIA 4KR0A 4X6XA 4DLNA 5JD6A 2PKYX 4FLFA 1EXWA 4ZXFA 3HEAA 4Z49A 5EIHA 4RPCA 5ALPA 3IUQA 4GI1A 4Q3LA 5KBYA 5ALMA 4UBJA 5CTAA 1VA4A 1A8UA 3DNMA 5CT8A 4MWTA 1MAAA 4B80A 3VJLA 5ALFA 3QPAA 4UHFA 1BEZA 1XLVA 3V1LA 4HVTA 1QLWA 4EA6A 1W1IA 3G0BA 4Y7DA 2JGEA 1ZGBA 2XMZA 3BXPA 3C5WP 2J4FA 4OYLA 3R3WA 3AUKA 3ICVA 4DSZA 5DYYA 5CH8A 3I1IA 3WYNA 5AK4A 3HZOA 2Y6UA 4RGYA 3ICWA 1XLWA 2DR0A 5DNWA 4WFIA 1E8MA 3HJUA 4TGLA 2HADA 4B0OA 4H7KA 2HM7A 3DS8A 3WK4A 2VSQA 4OB8A 2JEZA 3GFFA 4BC1A 4HRYA 1QTIA 3AZPA 4PNZA 4OYYA 5AI9A 1EDBA 4AMZA 1AZWA 1E5TA 5JD5A 1S8OA 2LIPA 4EBBA 2XMSA 2OPHA 3K2IA 2OCGA 4FLMA 3IIIA 4G9EA 1XRMA 1W4LA 4WDQA 1QOZA 4UBOA 2XMBA 3OM8A 1AMNA 4X93A 1EI9A 5CRIA 2IIVA 2VJCA 4S0XA 2HRRA 3D2AA 4E11A 4W9RA 4JUIA 1GXSA 4QDXA 5LZ4A 1C4XA 5K3FA 3O4GA 3ZV7A 4UBMA 4L9AA 5AI0A 4X97A 3H0CA 1NX9A 1XZHA 4KACA 1EK1A 3EIOA 3ZI7A 3R41A 2QOEA 3G02A 3C45A 2WUEA 3I2GA 4LXGA 5IVHA 1EH5A 2XUAA 5CURA 5A7FA 3G9ZA 4C4YA 5JATA 5ALVA 1J2EA 3DEAA 5ALQA 3E3AA 1MTZA 3WKEA 4J0JA 3WWOA 1WM1A 2V9ZA 3DDUA 2XLBA 2ZJFA 2G4LA 2ZVDA 5JAUA 5JAHA 5FRDA 4HXGA 4DNPA 2BGNA 2C7BA 1CUEA 4Y2XA 1CRLA 1ZD4A 5HF8A 4H7DA 1GZ7A 5ALNA 3MUNA 4TVKA 1BN7A 2C5FA 4HZGA 2WHQA 1W76A 2P8SA 4BYMA 4C6HA 5EGNA 4BZWA 1BU8A 4MQMA 4BRZA 4X6UA 1GGVA 2XUQA 1YAHA 5K3CA 2HFJA 5AI6A 4WFKA 3LS2A 3BE8A 1XQVA 2EDCA 5JZSA 3PF9A 2WFZA 3E0XA 4WFJA 2JGIA 4MJ3A 1SFRA 4PV7A 1P0PA 4C87A 1YR2A 2GYVA 4LXHA 1O6FA 2QTBA 3LCRA 5SYMA 5ALTA 4BCBA 5AKEA 2OAGA 1K63A 5F4ZA 2ZJ6A 3D2CA 4BE9A 4F0JA 3VDXA 1XZJA 2WM2A 2ES4A 1CUFA 4P9NA 4E15A 4B7ZA 1MNAA 3ANTA 4BE4A 1H22A 1Q83A 1MJ5A 2C0PA 3EQ9A 3GROA 2DFPA 3U0VA 4EHBA 5KREA 3DYIA 1U8EA 1CQWA 3WK7A 4OU4A 5FLKA 5A2GA 1YA8A 5EHXA 4KE9A 3STXA 4N8EA 3M81A 4BTLA 1TRHA 2WUDA 2BGRA 5A71A 3U1TA 1TCCA 2AJCA 3CN9A 1G42A 1CUVA 2PSFA 2OQIA 4UHDA 3W9UA 5ALYA 2QUAA 1WPRA 1XQXA 4N5HX 5ALRA 3I2FA 5ALKA 2QT9A 1M33A 4NMWA 5LZ7A 3IUMA 3C87A 2I78A 2PX6A 4XJVA 4GEGA 3ANSA 4QLAA 1BROA 3V1KA 4BTVA 4DIUA 5K5EA 1RYYA 1LGYA 2Z8XA 3AJAA 3GA7A 5AOBA 4HXFB 4ZV9A 1UKCA 5C81A 4I3FA 3STVA 1XZCA 3W05A 2XUKA 3CN7A 2WU4A 3S8YA 1F8UA 3O4IA 4FFWA 1GPKA 4OUKX 2RIPA 3WZMA 4AO6A 4EY7A 4YASA 2QJWA 3OURA 3F67A 1JI3A 1MPXA 1U65A 4IH9A 3TGLA 4G9GA 2C4HA 2Y1KA 4PQEA 2Z5GA 3IUJA 1TCAA 2Y6VA 4B0PA 2DHEA 3DOHA 3H2JA 5HF6A 2O7RA 4AX4A 4WY8A 1K6EA 4KAAA 4H7HA 5FPQA 4PSCA 5AI5A 5AK6A 4QNNA 1YS1X 3ILSA 5JZ9A 3WZLA 5D6OA 4NS4A 2B4KA 5AKZA 1HBJA 3KOOA 4UBKA 4DM7A 2XT0A 3QYJA 4AO8A 4X7BA 2CUTA 3DYVA 4UUQA 2WHPA 3BWXA 4IO0A 1BCRA 1QIGA 1UZAA 4BRSA 3NWOA 1CLEA 2OQVA 1DX6A 4X94A 3A2NA 1MAHA 3WL5A 4AO7A 5AM0A 1GKKA 4QDTA 1F0NA 5I9IA 5JAOA 1HQDA 4C89A 1XRRA 3OC0A 3DL4A 4OD0A 4F5ZA 3FVTA 2WFMA 5AM5A 3PF8A 5K3FB 4CCYA 5FDFA 3STYA 4F21A 1A8SA 1J07A 1OXMA 3OG9A 5AM2A 2VAXA 3L1JA 2HA6A 1EDDA 2WILA 3A70A 1X2BA 1R50A 3PFBA 1W75A 3QPCA 4DGQA 2Q0XA 4JH0A 4PSDA 4UBLA 4BC0A 4BVLA 5J3JA 1ACLA 2Y2UA 1WHTA 3H2GA 2PU7A 1ODCA 3O4JA 4Y2YA 2JGMA 1A88A 1RP1A 4EB0A 4G8DA 1D07A 4AZ3A 1SOMA 4FWBA 3H04A 1ZD2P 4G5XA 3FCXA 3RLIA 1UWCA 3I6YA 5ALSA 3KSRA 5E4JA 5K3EA 1JMKC 3IBTA 3QPDA 3BIWA 5LKRA 2VT6A 1K5PA 2JGFA 5FXMA 3ZLUA 1CEXA 3G9XA 1CUUA 2XB6A 1XKTA 3BIXA 3KDAA 4XVCA 1JT2A 2HIHA 1HLGA 1VZ3A 3I28A 5K3DA 3H19A 3O0DA 3FLAA 1ZICA 4ZI5A 2HA4A 1PJAA 1MO2A 2Y2VA 1BS9A 4QE3A 4BDTA 4IQ4A 4Y2SA 2GBIA 4G4GA 1JU3A 5CH3A 4RNCA 4K6KA 4OB6A 1HDEA 5LLSA 4BVKA 3AIOA 2V98A 1UOQA 3LLCA 4G4JA 2JGLA 3O9MA 4HAIA 3K9BA 2RGUA 1ZOIA 5AOAA 1XZBA 2C58A 2QZPA 4PF1A 1SCQA 2EEPA 1XZAA 5AM1A 5JYCA 5E4YA 3SWWA 2HA3A 2J4CA 2O2HA 2ZYIA 2VJAA 1QZ3A 1CUSA 4RE6A 1J1IA 5ALUA 2WQZA 2QS9A 1GQRA 2DSNA 5LZ9A 1BRTA 4FDMA 1WPXA 4OB7A 3AFIA 4EY8A 4J0KA 1XZEA 2OGSA 4D9JA 4U2CA 1LPNA 2O7VA 5BWCA 3RKSA 5K3BA 1XRPA 2VJBA 4QEKA 1HPLA 5AKXA 3OTQA 2XQIA 2BKLA 1GKLA 1AURA 1AGYA 5JD4A 2WG0A 1YASA 3R3UA 4JNCA 2HA2A 2VATA 1XFDA 4CIBA 3F97A 4BBZA 4IH1A 2WUGA 4PO3X 2XLCA 4QWWA 1CUJA 4QLOA 5DYTA 5AOCA 4BAGA 5AHXA 4BP9A 5K3AA 4U2BA 2W6CX 2NW6A 2QXUA 4INZA 3B3QA 4Q05A 4Y2RA 1KU6A 4X6YA 1P0QA 2HHAA 3WWEA 2FJPA 1IMJA 1OCEA 4GECA 2X5XA 3I1YA 4MEAA 1I6WA 4MEBA 3QMVA 4KE8A 4ITVA 3R3ZA 1IUNA 4X00A 1CV2A 4U2GA 4UFPA 4EY6A 2WIKA 3V9AA 3R0VA 1CPYA 5AO9A 2I03A 2HL6A 4KJXA 4JEIA 4AMYA 1UK9A 2I3DA 2XUPA 5ALDA 1R9NA 2X76A 1YS2X 5CMLA 5JALA 2GZRA 3C6BA 1LNSA 2OCIA 1DWOA 4H77A 2XMQA 4HTAA 2J3DA 4N8DA 3O9VA 2BAGA 1QFSA 2WHPB 3I2KA 1UOOA 1TK3A 2PUJA 2QKYA 2ROQA 5JARA 3MUOA 3FSGD 1UK6A 4QA9A 7YASA 2CZQA 4ROTA 2UZ0A 1ZGCA 3PUIA 1W52X 1R1DA 1XZFA 1CUHA 1E66A 1UKAA 1B6GA 1EB9A 2B20A 2WLSA 1LPMA 5IVIA 2O2IA 4HXEB 5I7UA 1Q84A 3R3YA 4C4ZA 3WMRA 5T4BA 2C5GA 4XX1A 4FTWA 4X92A 3AILA 4CCYB 2XI4A 5CW2A 2OG1A 3VVLA 5ISMA 4BB0A 3CCCA 3H18A 1H2XA 1YSCA 4KRYA 1EVQA 4C88A 2WJ4A 2C0QA 3A6ZA 3HRHA 2Z3WA 1O6GA 2XMDA 4QDOA 5ALLA 1XZDA 2VT7A 4Q82A 3GBSA 4N5IX 2QRUA 2QJRA 4X3CA 4WJLA 1NU8A 1EINA 1WB5A 5CH5A 1SC9A 4JYPA 2CBGA 2BUAA 2BJHA 3HABA 5JZBA 1ACJA 4HS9A 4JYMA 4CI9A 3PDCA 2QXTA 3H2KA 4FMPA 3VKFA 1FFCA 2XDWA 2WFLA 4Y2QA 1QONA 3WK8A 5AIAA 3ZWQA 1QIDA 3WIOA 1W6RA 3DD5A 3F96A 2QMQA 1DQYA 3IUNA 3QBJA 3OPMA 3C8DA 4KRXA 4DTCA 2DCMA 3N0TA 4H7FA 1GQSA 1LZKA 3WK9A 1LBSA 1R9MA 5JASA 4Q34A 3IULA 4W1QA 4GLBA 5AKGA 1XZIA 3FYTA 3D4LA 3D3NA 2RHTA 3I2JA 2ECFA 3D5EA 1WB6A 3E1GA 3PFCA 3ZPXA 5AKHA 3VJMA 2H7YA 4ARBA 1IZ7A 3L1HA 4EY4A 1TCBA 5EFZA 4M0FA 4H7IA 2K2QB 1GT6A 5IKXA 4E14A 2RONA 3LP5A 2OLEA 2HA0A 4MQLA 1LPPA 3T4UA 4ETWA 1G5FA 3EF3A 4W1RA 4Y2TA 3D7RA 3RK4A 1QIFA 1HL7A 4B82A 1VXOA 1FFAA 3H2HA 4UHCA 1L7AA 3EBLA 4P08A 5HQ3A 1SCKA 3C5VA 5AKIA 1DU4A 2YH2A 4BAUA 3FLBA 1QJ4A 3ZLVA 5A7HA 1CUAA 2PU5A 4W63A 3IB3A 2PL5A 1VKHA 3WL6A 1C7JA 1G4HA 3G0DA 3D2BA 1CVLA 1U2EA 2VEOA 4ZRDA 4FKBA 3D0KA 4MYSA 4KE7A 1LPAB 4J0GA 2BUBA 1H2WA 2XUGA 3L1IA 4X95A 2XQJA 5DNVA 1Y7IA 2Z3ZA 1DINA 4A5SA 1EDEA 3HXKA 2JBWA 4BP8A 4Y2JA 3AIKA 4OSEA 1BEEA 3H1BA 3C70A 2JEYA 4CG3A 3STUA 5E4TA 2XUFA 3QVMA 2YXPX 1LZLA 4B83A 4Y2VA 3R40A 3KXPA 1JMYA 1H2ZA 3ESCA 2DHCA
chains in the Genus database with same CATH superfamily
1PJTA 4GBED 5CYOA 5GM1A 3W8FA 2JFOA 4Z7NB 4U63A 1E58A 3JS5A 3SX4A 4OF4A 4L51A 1IQPA 3LF2A 4FC7A 2QJTA 1Q1EA 4ARCA 1S01A 3AY7A 2ZYRA 5T7BA 2ZTHA 3RSOA 1JPJA 1ELOA 2VA9A 3SFTA 3CNNA 1ZW6A 3VR4H 5JS2A 2IYUA 1MZVA 3F9RA 1CZRA 3EH1A 1VG8A 3HKEA 4LKOA 5ALOA 4CMGA 5EMLA 3LDFA 3A3OA 3NXKA 2ZVQX 4L6CA 4EENA 2X3UA 2ZDQA 1UFOA 4MGKR 4PICA 4RO0A 2UYOA 5JE8A 2DUUA 1M3SA 3A1VA 1L8OA 1NAIA 3VH2A 2JIPA 5DTRA 2HRZA 5FPSA 1R5OA 4PG7A 2PG3A 3ULKA 2ZPTX 4Q4DA 1UMBA 2V5UA 2FZCA 3ABZA 5K0ZA 4MAAA 1KDOA 2R00C 1UBOS 4PO8A 1V26A 4K6MA 9LDTA 4E09A 4U7FA 5ER6A 5JPDA 4ZWNA 4XCQA 5EIWA 4FW8A 2BR4A 2O8VA 2OP0A 4WKGA 5TNXA 1X1TA 2PUTA 4P53A 3S55A 1VLMA 4KDFA 1E9BA 1LQUA 4NKRA 4RABA 3BD9A 3SDSA 3K16A 3O8DA 3EE6A 5DBFA 3R5KA 1GPLA 2AMFA 3H2IA 2QLMA 3ROGA 2JGDA 4HDCA 1N32B 3RNLA 2IE8A 1FX0B 1WDLA 2C2XA 1DNPA 3ONFA 1GU7A 2Q1UA 3KXKA 4MUFA 1OVGA 2QAGC 5F78A 4LI0A 3I83A 3IR7A 1RJEA 4MVJI 5KI6A 1B1CA 1TF5A 1C30B 3LFTA 4R05A 1G5IA 3EZ7A 3HXTA 2C4UA 2CDCA 1TM2A 3WJ1A 2VXBA 4QSHA 3WICA 1QYRA 2WJGA 5BW6B 1ZI8A 1Y33E 2R44A 1JU4A 1T1EA 1T9CA 2RAUA 3EYAA 4GP6A 4LQDA 4QBIA 5IDVA 3R6WA 5ICCA 5KSZA 1CQPA 3OSZA 1UR5A 1KSFX 4PZLA 1YJ8A 5AXCA 4IIEA 3COZA 3PD0A 4QBGB 4E2YA 3TBKA 1VFNA 2ZB3A 3ED1A 3WLIA 2WD8A 3AERB 4EGFA 3CKMA 1MBZA 1BGVA 2NYUA 4X1KB 1PFKA 2VHEA 1T0PA 1NP6A 3PZRA 1NW8A 4LQCA 1TZBA 3ZVNA 3BSFA 3K0HA 3RSCA 1OWLA 1OXTA 1ZRSA 1V16B 2EP5A 2W43A 2EFHB 3B51X 2FEAA 1BJRE 3OKAA 4J94A 4ZFNA 4TROA 4NICA 2CK3A 3WGUA 2C42A 1EIWA 4JI6B 3QLUA 1MVLA 4UAGA 2AIRA 4UEOA 4MDHA 5LDGA 1JJFA 1EDOA 1M5RA 1NURA 1GZ5A 5IVKA 1E1RD 3SJBA 1OF1A 1E20A 2GN0A 2YCBA 5EJ9A 1V7ZA 2QD1A 3CNLA 2DU8A 2HZBA 1BMFD 4CM1A 1W1UA 2PPLA 3VR3D 4G0UA 1W30A 2JIMA 4PX2A 5C7LO 1GGMA 1OT5A 3KEOA 5SICE 4FFOA 2VHVA 4DB4A 4Z2AA 4JN6B 4KITB 4NOJA 3R75A 3EQ8A 1YR7A 3P52A 4BHTA 4EPTA 2ZRNA 3X1DA 4CM9A 1L4EA 1RAHA 2IEAA 5FI5A 3CKYA 5DDIP 5IX8A 5IYZB 1DJMA 3X2FA 2R6JA 3P9RA 3ZHQA 2HJVA 3EXEB 3F3MA 3B1KA 2DUJA 5JCXA 1A8HA 3B36A 2WFLB 5A9SB 3UY4A 3R3HA 4S1TA 5K8JB 2JZOA 1JNXX 3ASVA 2GD2A 2P6OA 3EWAA 1O95A 4FKMA 2DUWA 1KWGA 1DTEA 1I0ZA 2F43A 4NHOA 3PXCX 1FTWA 1ICIA 2ZYGA 4I9NA 4PINA 4NPHA 2AQ8A 3JQ8A 4RHCA 5HF9A 1NNEA 1FDIA 1SQ0A 1LFDB 2DY0A 4FM9A 3KQSA 3SNKA 1OILA 4BVJA 4OU5A 2G4VA 1YDFA 4AG5A 2P2SA 4OXQA 3S7ZA 4PYRA 4WVFA 1XRLA 5IF9A 1KK3A 1SBCA 4DIMA 2BP7B 1RM3A 2XOEA 2ZAYA 5JIBA 4D4KA 1UJ6A 2V5AA 4TS1A 4YJDA 4GBJA 2VF7A 3FBGA 4BVGA 2HI0A 1CJMA 1THTA 1IM5A 3Q5GA 1CY6A 1Y8QB 3NEYA 1GNPA 1UJCA 2QD4A 3A4NA 3O2QB 3KVRA 1B7GO 3O94A 4F3YA 3P4XA 1N0VC 5BUSA 2Z9BA 2F17A 4YK7A 1T6ZA 5L53A 3JD2A 3C4JA 2JD2A 1KKMA 2X5JO 3IEIA 4OP1A 4KYTA 1ZONA 3ZY4A 1LBHA 4JUAA 2Z5LA 3GLHA 3PXXA 3RDPA 3UHJA 3I8XA 1P17A 2X13A 5D3KA 5H16A 1YL7A 4P3XA 4ANFA 4C0XA 1XRQA 3RARA 5ELMA 1Y42X 4YQEA 4B84A 5AK5A 4FMBB 1RC1A 3PTZA 1L5LA 1CG6A 1GL7A 1IBRA 1QAQA 3HB7A 3OEYA 2R6AA 4JVSB 5TF0A 1N92A 1Z83A 1UAGA 3ZU4A 4QGAA 3S28A 2W93A 1GGKA 1Y3DE 1LW6E 2PAAA 3LK6A 2DOKA 4M6WA 3UNXA 1P2VA 4PSKA 4GOJA 3FTPA 1BU5A 1HOXA 3QEMA 4ODIA 3S3TA 5HKBA 4HQLA 4AYWA 4JOSA 1DJLA 3OCCA 4EPWA 3CO0S 3QHPA 3DAYA 2YIMA 1FUKA 2VDLB 3HA2A 3H9CA 3SKXA 1QIHA 1YCFA 4BNUA 1VL2A 1HDXA 3DC7A 3QOFA 4TX1A 5H1YA 1EZ4A 1R0XA 2ZWOA 3C3YA 5D87A 3QI7A 2XWJI 4GZMA 1P6XA 3BFVA 2YFYA 5ENZA 3ZOKA 4V0OA 1ABEA 2F3PA 3BXFA 2XMGA 4KRFA 3QIAA 1V6AA 3V9PA 2ZR9A 2EFCB 3V5NA 3MAJA 2WJPA 4O33A 2QPOA 3GH3A 4ZK6A 2DPXA 4F3TA 3DAFA 2G28A 3PC7A 2I62A 2ZYTX 2RGNC 4EA7A 3PFHA 4ZI3A 2AOWA 1SCJA 3A6PC 1WLSA 4RTMA 4IG9A 1ECCA 1E0JA 1DADA 1M2JA 1W73A 2IYEA 2WIAA 4HJRA 4QPNA 4YROA 3H84A 1IXZA 5IZ4A 2AJ8A 4URZR 1K6IA 2CLIB 1V7CA 4QNMA 5AR1A 5TQJA 1T1JA 1ZGJA 1TRKA 4RF5A 2Q2WA 1CKEA 5LM3A 4KMRA 1XTTA 1ZHHA 3OE7A 1QQ6A 3MOIA 3MYRA 4J1TC 4N3NA 4EHLA 5DP1A 4RLQA 2Q9UA 3U1BA 5HQJA 1IRIA 2JLSA 1SD2A 4UHJA 1HNNA 1N2IA 3G85A 1TGYA 4AW9A 5I7RA 1M8KA 4N6NA 3OLQA 2WTMA 4M60A 1GG9A 4U7GA 5EJGA 2FCRA 4L78A 2QUBA 2OUIA 3ZZ1A 1T9KA 1TIKA 2G63A 2XTMA 4DMFA 4F4CA 4N8SA 4DE5A 5AIBA 3JQBA 3O2JA 1ZG3A 1GU1A 4FOSA 3GYBA 3O4HA 1G16A 1Z68A 4ZV4A 4B7AA 1HEIA 1M8PA 3N2KA 1BXGB 3VU9B 1ZGZA 2R6FA 5IRCD 3SSNA 2UXBB 3W34A 2L69A 2J41A 2IXDA 4RA6A 4EWLA 4CLDA 3EXG1 3G2IA 2QRNA 2X42A 4DLAA 2TS1A 2AX3A 3I64A 1R66A 4K6OA 1Y4AE 3ADDA 4BZPA 1M0WA 3HVJA 2CL6X 4AMBA 1BE0A 3N2IA 3GQVA 2XMRA 3HG7A 3NX4A 2HXYA 4RMNA 4RSRA 4GOOD 5CA0F 3LW7A 2WJWA 1UOEA 3ZG6A 4DWWA 2BOVA 3A1WA 1ULHA 2BLNA 3CZ9A 3PE6A 4B4VA 5IUJC 4H1UA 4JT9A 4CEIB 4HH0A 5E6SA 2CXPA 1EE9A 1GFWA 3O8BA 4KL8S 3V3TA 1AUVA 1R3DA 1SXGA 1ZNWA 2EF0A 3VR6D 1MT3A 1VLZA 2IYAA 3EDYA 2J0VA 5KOHB 2GBLC 1VPVA 3CB4A 1NASA 3W1EA 5CA0B 3CVXA 4D74A 3HP1A 4JP3A 1E3JA 1MC1A 3HYNA 2HRDA 3B9PA 1QYXA 2KW5A 1KSGA 1EFAA 1KO8A 2EQAA 3A1UA 1PV1A 2YOGA 4MVJD 2AFIB 4DA0A 4I55F 2YIVX 2F8TA 1UT5A 5ESRA 3G82C 4WVLA 5GY7A 1Q16A 2IH5A 2ZU6A 4OXXA 3Q5DA 1LEHA 4K9PA 3UB4A 4FMDF 3QPVA 4OOFA 2Q6OA 3UM9A 1PDVA 3AG5A 4BQIA 3UCEA 5J4YA 4DMCA 4MRAA 2D5LA 2Q1TA 2HQOA 3NH9A 2DMRA 1LPSA 2OHJA 3IQWA 4IWNA 4WECA 1J00A 1VLVA 3I39X 4BMNA 3RSFA 4YCSA 2ZREA 4BV2A 2Q07A 4RPIA 4EI7A 2AZDA 3TECE 3QTTA 4EPRA 3KK0A 2P9ZA 1Q20A 2B2CA 4ZU3A 3N0VA 4D0NA 1K8RA 3H2YA 3GPBA 4LOLA 4NBVA 2IOFK 1DARA 1SXHA 3V8PA 1C8VB 2ZRIA 2QL7A 2Z6UA 1KYTA 2HSDA 1JS1X 5JS1A 1GEGA 5CGZA 1R0WA 1G3QA 2HN9A 3WGIA 3BEOA 2E49A 3VZBA 4UTPA 3VR5H 5ADHA 3L4BA 3AF6A 4DJFC 1FEZA 5F1KA 3HKEB 3E7PA 1QK4A 1P1KA 3GXOA 1TM7E 3MZ0A 5IJ9A 3DV0A 3V4LA 1NXQA 1U94A 2QVBA 4BJ3A 5BWLA 1T2CA 3C8HA 1G41A 3CZQA 2OSVA 1XVLA 1Q91A 1FS6A 2DWUA 4G0YA 2QLBA 4QECA 3DOEA 3D5TA 1L7NA 1X1BA 2DECA 4PWZA 5KVAA 5LCXA 4EBFA 2JLQA 4HAZA 1UMBB 3C3EA 1T4MA 1WIWA 1EAYA 1E7QA 1E89A 5LBUA 1VPLA 1DOZA 4QFBA 4PLGA 5DTQA 4CUKA 1JEAA 3F7OA 3IVRA 4YY3B 1FSPA 5LUAA 4ER7A 3U4GA 7MDHA 1NAHA 5ECGC 1WXDA 3AVVA 4XUCA 2A1IA 4BPBA 4KFSA 4FP9A 3LUKA 3PUHA 4LYFA 4XIIA 5CBPA 5H3HA 1RS0A 1WOMA 4TV9F 4EGQA 1COZA 3FDZA 3PENA 4L72A 3GNLA 4YRCA 1OSNA 2JGDB 2IC5A 3JZDA 4OI0A 2DBRA 4X7PA 2CF5A 1HYBA 5MGBA 1H6AA 3S8EA 1M8FA 1L7RA 4TMWA 1N7GA 1Z4NA 1J0BA 2WWVD 3U13A 4D5GA 2E5LB 1MNQA 1U1FA 1U6KA 4LY9A 2QDKA 3KKPA 5HKLA 3SY8A 3ESQA 2JLWA 4I46A 2RHWA 2M1XA 1BX0A 1DIRA 2B21A 3TRIA 3QZUA 3EWNA 3IBYA 3UOWA 3CPEA 2ORWA 3DWEX 4RANA 4B6JA 1K86A 721PA 2LGJA 3UMCA 3V8QA 2VJDA 3ESDA 3GUUA 3NKLA 3OQBA 3TTTA 1GV0A 3WQHA 3WFZA 4D8VA 1Z7GA 4XRGA 1R8XA 1DZIA 1JBKA 2FXIA 1FC0A 4INOA 4QKQA 2VRCD 3MGAA 5GPBA 1ZCJA 2IITA 1BXKA 4NZMA 2A0XA 1ETHA 2XEDA 4YRBA 4G0QA 1Z4QA 3RADC 1T6NA 3UCFA 1G7CA 4X63A 1P1FA 3LX5A 3TIGA 3K71B 1OC2A 4Y6GB 4AIRA 2HA7A 2FF7A 3FBTA 1UP7A 2GCIA 1R4ZA 5DXJA 2VOJA 2P9EA 1Y81A 1ZJ5A 4ZJUA 1QAMA 4IJKA 4RPJA 2J3LA 3TKYA 3IESA 1JHXA 1TUIA 2FPLA 2J0EA 2Z5FA 2QQGA 2OV4A 4KN9S 5FOQA 5HJEA 1TM3E 3EOZA 4JXKA 1Q6ZA 4Y2UA 2VG8A 4PGAA 4RV5A 3KYDA 9GPBA 4EUSA 5M04A 3FR8A 3AJDA 1E1MA 2O1EA 3EZLA 3FB1A 3MGBA 4KB5A 5HF5A 1CUXA 1UM8A 1D4AA 2Q29A 3MHPA 4KQEA 4K8RB 2AMJA 2OZKA 3OX4A 1F17A 1NW3A 4OMUA 3IQXA 4IS2A 2DB3A 4B9EA 1RXIA 2JI9A 4HQNA 1WY7A 3B9QA 5B3AA 5JDCA 1TTTA 5D3QA 1NIPA 2O6LA 3O7WA 3G8BA 4L0QA 2XODA 2HU7A 1BGXT 4HMPA 4J9VA 1NA5A 3T1YB 2CJWB 2Y67A 4ZV7A 1RKXA 2HMYB 3EZNA 3K9CA 1A5BB 1ISPA 5KSYA 2AC2A 2MSLA 3WKAA 4Q7LA 5EZYA 3B8HA 1X7YA 3R4VA 3G5TA 1AKTA 3EQZA 3DHEA 3CVYA 3F9CA 2F43B 3NV7A 1XAGA 4FYYA 2IT1A 3WWCA 2QN2A 3U37A 1K5HA 2V97A 3JQ8B 5AVTA 3HDTA 4DCSA 1B00A 1OA0A 2CVPA 3A9RA 3GJ3A 3V1TC 4ZRMA 3I04A 3D2LA 5B12A 3FOWA 2HKIA 4KQWA 3E1KA 4NMXB 2RD2A 3C1TA 5AK0A 3BCHA 3H8VA 3M4XA 5B1SA 3OLWA 3ES9A 3L84A 4NVRA 4PLFA 4BGEA 1L5VA 2CJXA 1E2PA 4XW2A 1J5XA 3PIIA 5AT1A 4FC6A 2A7QA 3FNBA 1TNDA 1IXYA 5HR5A 3L02A 5F23A 2QX4A 3IELA 4WUTA 2AD1A 2IZ5A 3IMKA 4G09A 4FHDA 4CMHA 2XQKA 1N6HA 3N8KA 1JAZA 4JZKA 5FI1B 1T2NA 3A3PA 4ZO7A 5IWCA 1S8FA 4YJ3F 3LC7O 3NCHA 5ALEA 4DV7B 2GUWA 3FNGA 5LQMA 3H8WA 3LOQA 2X9GA 3GLHB 4OQ4A 2GYWA 2O2CA 3IX7A 4ZT7A 3OTGA 1SBNE 5CB4F 1JPVA 1FZTA 2NTJA 2BL4A 1Z5VA 4Z0PA 5HFAA 1BE8A 2GBCA 2HU5A 2PCJA 5BNFA 3DBHA 3RQIA 1OI4A 1RT9A 4L9RA 2VJOA 3LLUA 1XROA 4C04A 5AM3A 1X0VA 2Z2JA 3CQ9A 1SGWA 3LQQA 1HQYE 1UZUA 2VFAA 4M6WB 4V02A 2ODPA 1DEAA 3MLBA 1GGFA 4PGMA 1J2RA 3QEMB 2O2ZA 2AQIA 1JLKA 3MWYW 4WGFA 5AVXA 5KWIA 1XZKA 2RSLA 2XMPA 3WB1A 5C8XA 2PSDA 5JYEA 2BM8A 3MT0A 1HTWA 2ZTVA 3ILVA 3W2TA 4EZIA 5F1YA 4ZHQA 2ETVA 1YVPA 3E27A 3T95A 3FG9A 1F1JA 4TRJA 3FLBA 1Z16A 2V6GA 3FYUA 1RHRA 3G2QA 4HAYA 3SHFA 3BGVA 3Q7PA 3RC9A 1MPTA 2H1SA 2NPIA 1ZIYA 1ENPA 1H85A 1WKVA 1DQZA 1GPUA 2IEZA 2ZATA 1VIMA 2L42A 1E2HA 3FVWA 3LX8A 2LW7A 4U7JA 4UHBA 3T52A 1H65A 2O0JA 2J7PA 4HGRA 4DDVA 5BP7A 2LDXA 1O8CA 2ZYVX 5E3IA 4BNJA 2PS3A 2WWIA 1O89A 2IVZA 3E7FA 3AETA 3ZZ0A 3GR6A 1Y8ZA 3ORRA 1Z5WA 2D06A 3M34A 3H83A 4JB8A 4INAA 3O74A 3NZEA 3ZH2A 2ZAIA 1N1EA 3EXAA 2VO1A 1ATIA 1SHTX 1T3SA 2WG2A 3KL2A 3OLXA 5CDHA 2QRLA 3KWFA 2VBGA 5EP2A 4GZ3A 1QNFA 1KJNA 5G53C 2N9UA 4B3XA 4YECA 5CT9A 4DKJA 4NG5A 2OGZA 4L7QA 2R0QC 4Q3CA 4Z4IA 3K53A 1SHZA 5YASA 1CF4A 4BIMA 3H4IA 5MGNA 2LZ0A 1JHAA 1Y3BE 4XWGA 4AZ0B 3VPCA 4YMWA 1AMOA 5AVVA 4MTLA 2C8KA 5LIRA 5HK9A 2VQEB 4HATA 4N5MA 3QU5A 1CR1A 3KFVA 5C2JB 3IAM1 3KSUA 1BXRA 5JADA 4B6QA 4B3IA 4XIFA 1T9BA 3F2IA 4MKIA 4CF7A 1C8BA 3GJ4A 2YMPA 1RRGA 1GZSA 3K70D 4F3NA 3RIHA 1F12A 5LKRA 2ZS9A 1NJSA 3N2KB 3VM6A 3EX7C 1N3IA 1Z3CA 3ZDXB 3WGVA 1DJQA 3QSYA 4RA6B 1YB6A 5DGIA 1DAKA 5ADUS 1QRRA 1R37A 3P26A 8GPBA 3ZW7A 2HBZA 1XNJA 1CULC 3GNTA 1GUZA 1JHMA 3IQHX 4B3RB 4II7A 1ZD3A 4GLLA 2R1TA 3O4VA 1XMVA 2B82A 1IZ9A 3OKPA 3RNOA 1JR3D 4RMJA 4X3PA 3ROMA 3GDWA 1JALA 5DM0A 3BZUA 4INJA 3MCAA 4FB4A 1ORTA 4JJ8A 2HIAA 1ODIA 1K3UB 3KVOA 5DT9A 4E2FA 1EE2A 1KP3A 1T9GS 5E6SB 2R751 3LLMA 3VMMA 3E4DA 3QUQA 1IC6A 4QZVA 4AKHA 1F48A 4K9OA 3ZDFA 4CNBA 3CLTC 3QWFA 3LH5A 5ICMA 2IDMA 4QGHA 4OO3A 2P3OA 4Y6QA 5KNCA 2FX5A 4MWEA 5CEEA 3PEEA 3M4NA 1LBEA 2XRYA 2IPXA 3BHJA 3J7TA 3NOVA 3PC2A 4FGWA 2VDRB 2ID8A 4JBWA 4EHJA 3EK2A 2J09A 5LWHA 2IHNA 1Z22A 2H92A 3MWGA 3QWHA 3ZHZA 1KZGB 3CX8A 3FOBA 1VKZA 1DO8A 2G77B 4OAPA 4UUMA 5CXQA 2LRHA 4G3XA 1JKXA 4P93A 1NI3A 1UXOA 4X20A 5JAMA 1PQ4A 4CL3A 2FZGA 1DAIA 2BEJA 2ZSHA 4LHZA 2RGWA 4NX2A 2V3CC 2JAQA 5D5QA 4O25A 3T5PA 1S0UA 1L4KA 3T3IA 2BTQA 2YVAA 3JASA 4C0AC 3NOQA 1TQ2A 1PR9A 1YB4A 4TKZA 4BQRA 4MW5A 3EPKA 1KQFA 2QZ9A 3B13B 3FZEA 1RBQA 2AMVA 2ZJBA 3GT3A 1R0KA 1LPOA 5DFAA 1JJIA 1TO1E 3UV6A 3ACBA 3QHQA 1MB0A 3S0JA 4CFZA 1XK7A 4JJGA 1DBWA 2IP4A 3ELUA 3OJXA 4ZO8A 1B8NA 1USKA 1ODSA 1LSSA 3QE3A 2OMEA 2G1JA 3BF7A 1NR1A 1VCOA 3HSYA 1E2DA 3IJRA 1OLOA 5IWAB 2B92A 4RH3A 4ZPJA 2WVHA 4HUTA 5E4FA 1ZK4A 3T5DA 3CF4G 3ESYA 5A0FA 5IJ9B 2HJWA 2VTEA 2OQ2A 2G5CA 2SKEA 1EFLA 1OZFA 1YCGA 2C8VA 3DV0B 3HA7A 4HDSA 1P9WA 1GL3A 4G97A 3T5CA 3UMJA 2CB9A 3M5CA 4ZQFA 5IC5A 1SR8A 3EVCA 4I1RA 1TZ2A 5ANRB 3NHAA 1FPQA 4ZU6X 4UDXX 1V5WA 5K8TA 1I3CA 1X7DA 2IYFA 1I4EB 3ONNA 5CPBA 3WRWA 3PI6A 3BT7A 1J4AA 1U9ZA 4B46A 1FQJA 1I7NA 2G40A 2FFRA 2R6CA 3A37A 3OZEA 1GTRA 1I36A 2YN0A 2VK1A 4TMYA 5CLGA 1H5QA 3ZWXA 5CBPB 4RU1A 2GJSA 4GD3Q 1P0MA 1PW7A 2YJ3A 5T3UA 2FVXA 3FDZB 5K99A 3L05A 2R8YA 4OGFA 4P4SA 5DJ5A 5LYYA 4E07A 2QX6A 2ZQ5A 2QLJA 4G0NA 1PT5A 1WCWA 4WN3A 1XMPA 4D3XA 1AC5A 2BWJA 2JVKA 5LLTA 1L7BA 1CUDA 4TYYA 1E96A 4IFEA 2SHKA 3I5UA 2YQ5A 4M8KA 1TO6A 1Z7EA 5L95A 2HLPA 4JT4A 1AUQA 5ENDA 9LDBA 1VFPA 3GZTB 1MV5A 3KPWA 1IE3A 1S3IA 4LZAA 3LPDA 3V1NA 1FF9A 3CH4B 3DUWA 4IF6A 5FTMA 2VYCA 5JNWA 2GR9A 2ICAA 3WAGA 3WLRA 2JIZD 4QXMA 3ZC3A 1SVKA 4HNRA 4EKGA 4GW3A 1ULTA 3SIPA 4CZ2A 1IXRC 3I37X 5BN3A 3GJSA 2ZYDA 3A7DA 2OOKA 3N6XA 3R6TA 1LQTA 2XCOA 2XQVA 4JWTA 1N78A 1YI0A 3AO0B 1V35A 3G8YA 2NG1A 1XJ0A 1YHZA 2BMVA 4D57A 3THYA 1XXHA 4DQKA 1J24A 2XAUA 1O9HA 3A36A 4D4HA 1P7WA 3R9IA 5B4VA 3QH4A 5EJ2A 2H1OA 2HTEA 5HMLA 1ONPA 1Q3TA 2P9QA 5TY0A 5HKAA 3AY3A 1QBGA 3UWMA 2GK7A 1JBEA 3BN3A 1F0PA 2BRUA 1S3GA 2PK3A 5KWVA 2CXOA 2VJPA 3VPHA 2V7BA 3AF4A 4OIFA 2H1CA 5TEWA 1K8XB 1MX1A 1NGSA 2ACEA 2VXOA 1LDEA 3M3DA 1T15A 3ZE2B 2JF0A 1KYQA 1ZIXA 4IDDA 4Q9AA 4JY7A 4HVCA 621PA 1WMDA 3KYDB 4BMPB 4JVLA 4C7JA 1MT0A 3TZCA 2ZUFA 1MEOA 1YTUA 2BCEA 2FTKE 3HO6A 4A2CA 2HF9A 1O5TA 4IXWA 2O7QA 5EIXA 1UZNA 1HL3A 3RPEA 2BCJQ 1OAAA 4W7SA 1YACA 1KU0A 2WDPA 5PGMA 3NM6B 1RQRA 3II6X 3LECA 2REQA 3LCJA 3LXXA 1VJTA 2EKZA 2ZITA 4YAFA 3GCDA 2OC4A 1YRQA 3G17A 3MTDA 4GPEA 1JEYA 4HPJB 4BE7B 1L3BA 4R40A 1SVUA 4XUEA 5EZYB 4EHAA 1L1QA 5J4LA 4Y30A 1X7YB 3WADA 1MO6A 3GVPA 3FVVA 3T3EA 1YOBA 2GN2A 2PX4A 3FTDA 4MYUA 2FPSA 3KUUA 2RDMA 2AN3A 4YRIA 1B6RA 1YQ9A 3RS7A 3U3XA 2DE0X 2YDXA 3QEAZ 1E2GA 3HN6A 1V3UA 4B6EA 2QR5A 4A36A 2IW3A 5F3RA 2PXCA 3VSBA 4RY9A 3WIDA 4CM6A 4AJKA 4MRMA 4GSLA 1GPYA 1Z07A 4N4AA 2FRVA 3H6KA 5JJLA 4XGKA 4M1KA 2ZUSA 4W5RA 2FSVC 3DQZA 3TJZA 3A6JA 5HQTA 3UPDA 2HK7A 1GN9A 3WGYA 2HPHA 3SK0A 4C0KA 5FBVB 1JR6A 3DGEC 1IZ8A 3WYCA 3GLFE 1JIUA 2R8PA 2FEWB 3T94A 4D6PA 3JARA 2WYWA 4OHBA 4TT3D 1YNOA 4UMDA 1BDHA 2FN7A 4RY8A 1ZOSA 2B37A 3DBHB 3MT9A 4S12A 4ZHQF 5BV7A 4IM7A 4PC2A 5IF3A 4OI1A 4IMRA 3FTEA 1MLDA 4HQOA 3KQNA 2X1HA 1W8DA 1X7HA 2D2EA 1CIJA 1LU9A 5M34A 5AH0A 5B3JA 2ATCA 2DUNA 3HV0A 3T35A 2F64A 2ZJ2A 1T0HB 2VHJA 3Q0IA 4PPNA 2ECQA 1G8PA 1H8HA 2A5DA 4LHSA 5JWHA 3WB0A 1MQAA 4C07A 1ZM3A 2B7LA 3INYA 3HBAA 4HYYA 4I1OA 4I4NA 1TCUA 1R9GA 4ZHQB 3AJRA 1NNI1 2NQTA 4R1OA 2OCBA 5C1IA 3B6IA 4LF8B 2RBKA 3FWNA 1YI8A 3FYUB 1NVVQ 4NECA 1YIAA 2EP7A 4IUYA 1SVLA 1VIAA 2DQYA 2QEQA 5LN1A 1Z4KA 3ZVKA 2XGJA 5J47A 1KEZA 3CTPA 4R9VA 2J5BA 1U7HA 2AJDA 3A6LA 2XOKD 2XUIA 4B3SB 1I30A 2V54A 1UBUS 5K20A 1N75A 1PK9A 3REQA 3ZS8A 1DDOA 2W6ID 1X38A 4PG8A 4ZOLA 5WRFA 4IIHA 1NQUA 5KHAA 1MIOA 4NAVA 3TQCA 2W71A 3ITNA 3FTCA 4PFJA 3W5CA 2Q7DA 3AETB 5CVCA 1QO0A 5TXGA 1BQ4A 2Z04A 3JYQA 1JG4A 2GAAA 1ZH6A 1QYDA 4MIOA 3ZHOA 5KMGA 4B79A 2WKSA 4UEWA 1I6KA 1W46A 2W2PA 1KXZA 2YJ5A 2IPMA 2XCTB 2LIVA 2X7HA 3F4KA 1NV9A 1MG0A 3SXUA 1NRJB 4UQLA 1KC3A 4BO5A 1NVFA 1ZI9A 1U90A 3ZU3A 4CU5A 3VV2A 4BGUA 4H35A 4E31A 3BDIA 4C0BA 1ISJA 1OXSC 1NVDA 1LKZA 4OHCA 2C7RA 4G8BA 5ALHA 4BO6A 3GELA 3M83A 3A28A 5H80A 5LJLA 4EY5A 4LF6B 1EGVB 1BXRB 5TF4A 3BMOA 3L06A 1U0GA 4KR0A 4G23A 1NY5A 4X6XA 1PR6A 2Q8NA 5EPUA 1YFZA 3RABA 2P9YA 4JUBA 2C7QA 3UJ9A 3GU3A 1ADFA 1S9DA 1T3LA 2ZULA 2XF8A 4LHYA 3A4MA 5CFMA 2C59A 3VC3A 4RVGA 1GDDA 4Q5IA 3S70A 1N36B 1N3BA 4CGYA 2BI8A 4NNPA 1RHUA 5C35A 3JVIA 4RPCA 1O6CA 4GVPA 4DLYA 2HCFA 1SC3A 2JDIA 3DT9A 1QHYA 4CHTA 1SG6A 1LF0A 2ISQA 2R1TB 4RK6A 5A02A 2UYCA 4ENSA 2R96A 2JLYA 2CVQA 2HNAA 3QELA 1P91A 1WG8A 2REXB 3F5SA 4UZSA 4OREX 3HFJA 3T3HA 1A50B 4MGZR 3ZXUB 5KBYA 3JATA 3I1JA 5C5DA 2EW8A 4CTOA 4DG9A 3ECCA 2OVBA 1V8FA 2WTBA 4FYPA 5CT8A 1U28C 5KINB 4G56A 2I6SA 3HCOA 5C7IO 2O8NA 2WYVA 4JC0A 4YO8A 4EA9A 3HWSA 2UZ3A 1PS8A 4YACA 1V4VA 1XLVA 3V1LA 5SZJA 5C4MA 4HVTA 1BWSA 1PGQA 8LDHA 4WW0A 2PJZA 2ZCVA 1U2PA 3S27A 3TOSA 1IAQA 1IJBA 1W1IA 3LWZA 4LXQA 3ITDA 4P4LA 2DWCA 2YYYA 2M98A 4Y7DA 4MP8A 2JGEA 4P33A 4Q1DA 2CFTA 1QKJA 4X20B 1JQAA 5CCBA 1J39A 4BPRA 3L79A 2YHSA 3GRFA 4MQBA 5J5AA 3C5WP 1JHYA 1WEHA 3ICOA 1DIHA 2BTQB 3AUKA 3ICVA 3G6WA 3JASB 3E2MA 3GMSA 3IJEB 3VTKA 4DSZA 2G25A 5DYYA 4FSXA 4QX6A 3W7BA 3U81A 3PWSA 4LBZA 3PQ3A 2XUZA 1RWXA 4JBHA 5F77A 4H4EA 2NMVA 3BXZA 2NZ2A 2VPTA 1V48A 4GO1A 4P3YA 3SEFA 4EITA 3ABSB 4JI0B 3F4BA 5KO2A 4QGFA 3RRNA 1FBNA 3AX6A 4Z3KA 3CVUA 3GJ5A 2MYTA 2IGTA 4NCIA 3NONA 5J59A 4RGYA 2XVYA 5AHKA 2NZ8A 3A06A 1WDMA 4Q1AA 1ESEA 1TLFA 1PYGA 5CVVA 5F4BA 1E8MA 1Q0UA 2P9GA 3HJUA 3RUHA 1IU9A 5D86A 4HWTA 4L74A 4DS3A 3GZNA 1DC5A 1RM4A 1CC1S 3OHMA 2RH8A 5CB6A 3S29A 2IZ0A 2JAWA 1LA2A 1KOLA 4M46A 3BORA 1DSSG 4B0OA 4HDSB 2GZ3A 1OH6A 2IRWA 3FYSA 5JZMA 4URUR 3VAZA 1II0A 5KZMB 4QARA 5EOVA 2AN1A 1OROA 1XFAA 3JYNA 2VSQA 1BA3A 3U60B 4EJ2A 2IWHA 3UHPA 4YA6A 1CY4A 4JHXA 1PJSA 4EVSA 1A98A 1Z5OA 3O1LA 4PNZA 1EDBA 5GONF 5FL7A 3GDOA 3RIXA 3BWBA 3TLCA 4E5YA 5IASA 1M8GA 1RIFA 3ITKA 1KI2A 2QTHA 4KU4A 3SYMA 5JD5A 1KZYC 4ZVUA 1CIVA 3D0QA 1XJWA 2XMSA 2G6TA 3B7WA 3R9KA 3NC1C 3DM9B 2OCGA 1GA6A 4Q9NA 2C4VA 3GFTA 3KKQA 4KIJA 3TUIC 1P2SA 2C1ZA 1U4OA 4P4SB 4TLBA 4H6VA 3UUGA 3PGKA 4G9EA 2IHTA 4CN9A 5E7JA 2GAFA 4F45A 3BRWA 2O07A 1G9XA 2YZKA 4WDQA 1NW9B 3ODPA 5EE5B 1DRKA 1GZDA 5JT1A 1JNYA 4FZVA 1J9EA 3OM8A 1GAEO 1KNQA 2PWPA 3EGDA 3MSCA 5CRIA 5EEHA 1U0RA 1GL9B 2FOXA 2NO5A 3BZWA 2C98A 3AI7A 1XVAA 3AHCA 3CLSC 3E35A 3OPYI 4W9RA 2IIPA 2WW8A 2BMEA 1YQUA 2G1KA 2X0KA 5F2EA 2BIFA 3WLQA 3KU4A 2DH6A 2ZYAA 4FHFA 4QDXA 1NFRA 4TQ9A 4WCFA 5CVUA 2JFXA 3O4GA 4Q0MA 5K3FA 4S1VA 3NYQA 4L9AA 4JI5B 3LUJA 2WAYA 3C8UA 2OD2A 4X97A 3VPXA 2QXYA 3H0CA 4YRPA 4P6VF 4BBPA 5BN3B 1KOGA 4ENVA 2PANA 4TLCA 3UWOA 1GAQA 2O0LA 2WK1A 1G291 3T7DA 4ZVMA 4DM3A 3E15A 4MHSA 5DLQC 3RSSA 3ZI7A 1OFIA 2AUNA 3NT2A 3IR6A 1W4RA 1XDZA 2PL3A 1XXHB 2FPRA 4KWTA 4Z1MA 4DB2A 4LBWA 5CB0A 1KPHA 2A9KA 2QROA 3ZGZA 4MV7A 4QG3A 3I2GA 3VDMA 3RAGA 5B2FA 5C32A 1EH5A 4N3CA 5IVHA 3G9ZA 1GNVA 4KK3A 1G8SA 3VNVA 1AQNA 1LBIA 1GAWA 3DEAA 3JVVA 4PLZA 1JYFA 4UVEA 1Q1GA 1GYQA 3HB1A 1EM6A 3DA8A 4J0JA 2OE2A 4C7BA 2UVQA 2JCVA 3D4BA 2W9XA 4M8NE 4OHZA 3DULA 2OORA 4NEHB 4YCLA 1M67A 4QXRA 3RG2A 1OVMA 1S89A 3P8ZA 1S96A 3VSCA 3OU2A 4QHSA 5ALWA 2V6MA 4QDKA 4X62B 2WWFA 3TB4A 4KLNA 4B74A 2HMUA 4MQ6A 5JMTA 4QOJA 4KQ2A 2OB1A 4R8KA 1GVNB 4E7OA 2ZRMA 2IYTA 3PNVA 1ZD4A 5EIBC 1MENA 1G7SA 2OLKA 2VZ8A 1NKTA 2D5CA 2P6MA 2REQB 4PGHA 3CLUC 3KC2A 5AOVA 4M1WA 3AU8A 4OQEA 1E6KA 4MYHA 4HGOA 4PG6A 4XWAA 5DN6D 4KBGA 2WHQA 1RQ2A 4C21A 1JEYB 4JJAA 1E1LA 4WK2B 1RLIA 3HM9A 2QDXA 3ZUGA 4RH0A 4BYMA 3A31A 2EW1A 3PDUA 1L5QA 4MQ5A 2O8BA 1HDIA 4RJKA 2PJDA 1KE1A 4QBTA 1UBHS 3G79A 3A7EA 1ISIA 4II3A 3DDOA 4EF6A 5FCDA 1TF2A 1K2VN 2OQRA 5I9BA 3CFYA 2D2VA 2XUQA 3BZBA 3K2BA 3IAXA 1CJSA 2NPFA 4I7EA 1QFZA 1FUYB 2QTTA 3SZLA 3UUWA 1QF6A 1G0OA 5K3CA 3JWGA 3HCEA 4MCHA 4P4GA 5AI6A 1ST3A 1VJ1A 4QOFA 1GQ2A 5TQ0A 3ZQ6A 5DIZA 4NYMR 3LBIA 4PPQA 1JW9B 1K06A 1RJFA 1YR1A 2GK3A 2I67A 1U1EA 2CCGA 2XVAA 3BE8A 3GLRA 3N8IA 3RYHA 4MRMB 5L3SA 2BKEA 3CZRA 3PF9A 2W6NA 4PPGA 4U0KA 1IH8A 2BELA 2EX0A 2N42A 4JL6A 3TR5A 5EXEA 3FFAA 3OJFA 2JGIA 2UZIR 3GUZA 4OAOA 1SCDA 1EFUA 1WMSA 4FWIB 1P0PA 3BHIA 3WS7A 1WD5A 4C87A 4EG5A 2ZAGA 2IOYA 3A3KA 3Q40A 2F90A 2IV3A 1JA9A 3ZJ4A 2C7OA 4C7OA 1VL1A 1GPAA 1X87A 1JXMA 4PYKA 3JARB 3K3PA 3TOCA 2CEAA 1J8YF 1QE5A 2OC9A 4ZYYA 2XD9A 3LCRA 2PMEA 4BCBA 2AWOA 5AKEA 1T5HX 4ZYVA 4R1UA 3Q15C 4KVAA 5DEIA 1T5TA 3OCYA 4ASUA 1ZD8A 5TGZA 4Q3AA 4R81A 2ZJ6A 5CIQA 4K0RA 1DAOA 4MV1A 4E5KA 1UDXA 2X4GA 4B44A 1X1RA 2WB2A 2GN9A 3JZIA 2ES4A 3TVYA 4E15A 5DZSA 2CXUA 4DLBA 2JA1A 2X40A 1Z18A 1Q0SA 4RTRA 3PHIA 4R3UC 4TWJA 1C0IA 2EFJA 1MNAA 3G68A 2WJYA 3HHEA 4TYMA 4ZOLF 1HTTA 3ANTA 3G23A 1MEEA 2MSKA 4GEKA 1Q83A 1VMIA 4I5GA 3ZXXA 5HJ5A 1BYUA 3IAS6 2WYUA 1M0EA 3EQ9A 1E9EA 4HZIA 2PIAA 3GT7A 2ECKA 3V3KA 1T4GA 5EUQB 3ICEA 5D6NA 4AAYA 3IOCA 3AQIA 1LW7A 1QGUA 3DV2A 2BGIA 1SELA 3OHSX 4WOJA 1CR2A 2PRJA 3REQB 3RRYA 5JEDA 4RTJA 4Z4QA 5E9AA 1V4NA 2YWBA 2EZ9A 4ZOLB 5A2GA 1HNWB 3AVYA 2PNFA 4O0LA 1MIOB 3TXAA 1SHLA 1V41E 3DGFC 3WRYC 3QLVC 5JVDB 3BFXA 3NI2A 3ZWPA 4OHOA 4IV5A 3PQ6A 3QVVA 2GHIA 4HWKA 4NCXA 4BJ5A 1I2CA 1E6CA 4LCJA 1G5QA 3TSOA 4MUEA 3U1TA 1II8A 2VUHB 2D0PB 4YUYA 3CN9A 3IQIX 5KMGB 3AVWA 5LDHA 1E6MA 4TUYA 3PRHA 1Z9BA 3KWLA 4M9RA 3AV0B 2J0SA 3I9KA 3KHTA 1QGYA 1D8TA 3CIOA 4M99A 2AL7A 4UHDA 2OSBA 2GLUA 2WMOB 4ZQIA 1H6BA 4D2IA 3JAMA 1M2GA 3RC8A 4RQUA 3L49A 2R6R1 4JDPA 5JVDA 4RLHA 4XB2A 4IKEA 1XQXA 5G0WA 1L1EA 2D2FA 1AKUA 3PKJA 4PHCA 4QUKA 4MW2A 3GHHA 1FP2A 4TRRA 1PSDA 3IVXA 2YRXA 3NBXX 1J22A 3S5UA 5A03A 1SU4A 5IARA 1OX6A 4XE5A 4YUAA 2AEEA 3I12A 3BMOB 4LXTA 5LZ7A 3OZ7A 4MUGA 3IUMA 3SAJA 3EA0A 2C95A 3KV3O 1D0VA 3SS7X 4GRIA 2DKFA 2ASVA 4KQMA 1FUIA 1Z6YA 1OFHA 1P77A 2JJ1A 1XEFA 1M34A 1QYWA 1MJNA 2E4YA 1OLUA 2O0HA 2PLAA 3AB7A 4YCAA 5LNK6 1ZH0A 2AMYA 4RJIA 1L5FA 3ORYA 1AY0A 1H2EA 4FW9A 2ZM6B 2PX6A 1M6YA 1ZA2A 2AYYA 2RAPA 2YL2A 3ANSA 3RTAA 3WJAA 2Q1WA 3P0JA 4BTVA 2GUGA 5G1OA 1O94A 4MROA 1D0SA 3ZYCA 2Z8XA 3ML1A 3QELB 5BT9A 3AJAA 4R31A 5K4GA 1QORA 1NTRA 1V11A 3EUFA 1ND6A 3JATB 4Z3DA 1ZESA 1M2EA 1EWVA 3M89A 4FYHA 5AJXA 5DHFA 2XWPA 4KN6A 4U7PB 4B2PA 2ZIVB 3I4LA 3C3AA 1XZCA 3STVA 3W05A 3VR4A 2XUKA 3LVRE 1DXOA 2IYLD 2Y0BA 2Y1FA 3OIFA 2WU4A 3S8YA 1WEKA 3QFTA 4HAXA 4TQGA 3WNDA 3F6PA 2A0YA 3N8HA 1OV4A 1QHSA 1HT0A 5THQA 1QHFA 2NTVA 3QVOA 4RVUA 3ZCPA 4YASA 2W98A 3H3FA 1TVKA 3F0TA 4MUIA 4YAEA 4ENUA 5A5GA 2BMDA 3F67A 5LR6A 1A77A 3DR3A 4D3SA 1EJ0A 1R15A 1IPFA 2Y1GA 3L43A 1CRWG 4G1UC 1TI7A 3TGLA 3ER9A 4ZOAA 3GMIA 3KTDA 2E87A 2PHZA 2FPIA 2GRJA 1FMTA 1VL5A 4N18A 4YV7A 1Q11A 1K7FB 1VHJA 2VSXA 3IKMB 3LRTA 5CD9A 1LI5A 2PQMA 2F2TA 2Y8EA 3FPEA 3H2JA 5HF6A 1SKYB 1O6BA 1XE3A 4H3VA 4B2IA 1FRNA 2GKSA 4DREA 1TM4E 4CEHA 3QP9A 1YVDA 3RE1A 2GAOA 1T0UA 4FMCF 1JILA 4TZKA 5I48A 2GX6A 4CTNA 3OSUA 3B5JA 1JUDA 4MZXA 5G4LA 4KREA 4MI6A 4KYUA 1ML3A 1YS1X 3ILSA 4ZEOA 1Y8AA 1M2OA 2QUJA 3WZLA 4A6XA 4LZPA 1WSBA 2VC2B 2Q2QA 4HMQA 4N6GA 4KQ1A 4OHKA 3RLFA 2IXEA 3GZNB 3X1ZA 1GUYA 4BFXA 1FYDA 3IAEA 2XZPA 2RG7A 1GAJA 4FMCB 4Q3BA 5AKZA 2O3JA 1HBJA 1E0SA 2YWJA 4MLDA 4PR3A 4UMVA 1V1RA 1RLTA 2A1UA 4LJSA 4DM7A 1YJCA 4E33A 3CSDA 3AEKA 4IGIA 3TI7A 2JH9A 3MQ4A 3Q7QA 2ZI9A 4RPHA 5B30A 2ZIWB 4X7BA 2RCYA 1I24A 2CUTA 2Q6VA 3DYVA 1PL0A 2XNKA 2YJGA 4G07A 5EJMA 3ZXSA 3EY4A 3H87A 3N5KA 3MS7A 3KB1A 4D8YA 1R74A 1BCRA 2D1FA 4OAQA 3JQFA 1ZVMA 1RJGA 1WMEA 4BRSA 4C0JA 3NAQA 1CLEA 2WM9B 3W1VA 3EZFA 1E7MA 4EKIA 1U0LA 3FPLA 1MQ9A 1DX6A 3C3CA 3E8XA 4I8DA 5CVJA 2V7EA 4ISCA 1MAHA 5TJ9A 1AN0A 3WL5A 4PIPA 3ASZA 4PLTA 4ZEWA 2K5UA 4RV4A 2MU1A 3KJZA 3N70A 3RK0A 5H9VA 2WHXA 3LO5A 4QDTA 5LBIA 4ADSG 5I9IA 4GM4A 4MO9A 4M1MA 3VBCA 3IODA 4HT3B 5IUKC 3UC9A 4NCJA 2D0IA 1HQDA 1CU1A 4KGZA 1NVBA 3ROXA 4C0QC 4WNYA 5EJIA 1TMOA 2MMGA 3IAS1 4D0RA 3ETDA 4IQGA 3E7XA 5CIWA 3EGDB 4BLSA 4QREA 5I8WA 2BBOA 4FCCA 4F5ZA 5U1PA 3PZBA 1COWA 3HUEA 1FBTA 1E5DA 1NJ5A 2ADFA 2HWKA 3D4PA 4JJ7A 4WLFA 2WNHA 2I7DA 4YAIA 2EC5A 3DD1A 1FY2A 3I9JA 3COPA 3ER6A 2UZ1A 1BWRA 3DOOA 3FYCA 3KOYA 5K3FB 4CCYA 4MNTA 5EERA 1L7XA 5G02A 1A95A 3TD6A 4M8IA 2HIGA 2B1GA 3CRMA 2NXCA 3E82A 1OH7A 1DQPA 1IQ0A 1GJRA 4EDHA 5J9FA 5JQGF 2A14A 2QORA 2BKVA 4QYWA 4XSVA 1MJHA 1AO0A 3L8HA 4KDEA 1EA7A 3WGMA 3HCBA 3IEVA 3GFPA 2HA6A 2YJ6A 3BX1A 4JLVA 3A70A 3TQRA 3EAGA 3PFBA 4UPEA 2ZIAA 5C0OE 3TL6A 4PSDA 1O6ZA 2BTOA 1XZPA 4Y6RA 4BVLA 2ALJA 5IT4A 2P65A 2XXBA 4FB5A 1DB3A 1IEVA 2NUBA 2Y2UA 1I7SB 1Z06A 3THWA 4OQNA 2YQZA 2ZRBA 1KIAA 2GEDA 1GL6A 3EVNA 3JQAD 2BC9A 5A05A 1RAFA 5KDDA 3O4JA 1T2VA 3JRWA 1SQ6A 5B1HA 4QYTA 2JGMA 2H1RA 4EW3A 4WMLA 3NTRA 1J99A 1A88A 2A57A 1KY2A 2AEFA 3PC3A 3UMVA 2ZVPX 2YICA 3KUKA 3R7SA 2BZSA 2YHIA 4QASA 5DT2A 4NSNA 4B1FA 4Z1OA 5BN4A 4A4DA 2GF2A 2QQ0A 4FWBA 4HMOA 3K9LA 1NXOA 3N8GA 1A2OA 1OWMA 2B5OA 1N8TA 1CTQA 2V7GA 1PZXA 4LRWA 4GSKA 4ZALA 3V2GA 4DHEA 2IS1A 1G1MA 4H6WA 1I2MA 1D2NA 3I6YA 4X8MA 3KSRA 4ZPXA 1JMKC 2OM6A 3LBYA 3OFSA 4HB4A 5EKSA 4ZVRA 1ULAA 1YMQA 3NDBB 3FCEA 2CKDA 4M0DA 1PGPA 3NYRA 5I45A 5DRTA 2O8BB 5FXMA 3QV1A 5CNJA 3AVQA 1OZ0A 2R3SA 4QEDA 4UXHA 3FUUA 5EKUA 1J0XO 4C78A 3Q72A 3SQWA 4GR9A 1J1UA 2B2XA 1VE1A 3BIXA 3QFHA 1NDHA 2O06A 4XVCA 1HE2A 1QLJA 1O1YA 3KG2A 4BUZA 1VZ3A 3TTUA 4LDPA 3GFSA 3V8VA 4CKEB 4LXYA 5FWNA 2OAQ1 3D7SA 3O0DA 5AXDA 1YJXA 1ZICA 3RVQA 1VCNA 4S24A 1Y8CA 2B8TA 5TQ0B 3F5MA 4H3SA 1SB9A 3RYHB 3ZEAA 4K9KA 1MO2A 1G21A 2XKJE 3CVJA 5L3SB 4RVOA 1G64A 2A8YA 4V0QA 3B52X 4WD3A 2PX0A 4F5WA 4ZAFA 5INTA 3ME5A 3OTHA 4Y2SA 4J76A 2R4TA 4G4GA 1C3XA 3ZDQA 3ZWKA 3D1VA 1DGQA 4GT1A 1IATA 5HDBB 2KWIA 3DSRA 5LL6P 3D3QA 4OB6A 5LLSA 1QGDA 3AIOA 1Q57A 2ZIFA 4ZVNA 4MUAA 4KOEC 4C7OB 4U1RA 4D6YA 3T3NA 3DF9A 4HFJA 4ISBA 3RKUA 1EIZA 3QG1A 3GRCA 3QQ5A 2B0CA 3ID6C 3S2FA 3WRXC 4KSBA 1ORIA 1ZRMA 3LLCA 5EXTA 4G4JA 3OIVA 4KO1S 3F73A 3ZJTA 3ORQA 2R68A 3MAAC 2QZZA 3KZ1E 4G86A 4PG5A 5KHLB 5LQCA 2RGUA 2WRZA 2J87A 3OP1A 4J0QA 3I01A 3EW7A 5B36A 5K8LA 4DCNA 2QZPA 3QWAA 2CLLB 1G55A 5G2OA 1ECJA 2VUSA 3NHSA 4R84A 4I2NA 5E4YA 2LKCA 2PGLA 3SWWA 1TW3A 2GDZA 4FYVA 2Q1XA 3JTEA 1KYYA 4NI5A 5DNYB 3N87A 4PZCA 1EFVA 2ZBDA 2DR3A 2GHRA 1H4VB 1DIGA 1QGUB 2J3KA 1LLCA 1E3LA 1HRKA 1LUAA 4MA5A 5IJXA 2AS0A 4RENA 5JMWA 1AKEA 1QCYA 1M2NA 1WMAA 4TUYF 1VMKA 3ZBUA 3HDGA 1R6UA 5B7NA 1ZHOA 1YRYE 3FXAA 1QG0A 4GQIA 3ETHA 1SEPA 1BRTA 2VWQA 2EV9A 4FDMA 2PGXA 4OUDA 3TOZA 5JVDF 1TAGA 3GUHA 1WVIA 3K1YA 5B53A 1U8ZA 1II8B 3GB9A 4D9MA 4ALNA 4J0KA 1SURA 3DW3X 2OGSA 1QB8A 4QQ8A 1HLDA 1OMOA 4TUYB 4U2CA 1EX6A 3T1OA 5KQSA 1HMYA 5TGTA 1AZSC 1Q7TA 5FB3A 3WBKA 3IIEA 3RKSA 4QRDA 1RLJA 1XRPA 3FFBA 3IEPA 4IVRA 4K40A 4M49A 1DUVG 4QODA 2VJBA 3FHJA 2WVJA 4QEKA 5JCOA 2UZ4A 1OGYA 3UAOA 4CDMA 1U9CA 2BW0A 3ZBPA 4UUPA 1DLJA 1ZVJA 3OCVA 5F1OA 4NE9A 1VYTA 2XYGA 3D6HA 4S1WA 4DJDC 5IUNC 2Q8PA 3TD2A 4R2IA 4WK6A 3COYA 1R0YA 2CDRA 1AGYA 5BQXA 1NOIA 3PQ5A 3RWBA 2CNBA 4JOQA 3B9RA 4AF8A 4ZJYA 2O2JA 2VF5X 2J6CA 4B7UA 4JNCA 4BQQA 2C4KA 3CZ4A 1M34B 1ZS9A 4IEEA 1OLUB 4EY3A 2QSYA 3PEVA 5DNAA 4O2BA 4NFSA 4PRZA 2H0QA 1K1EA 3GIDA 4BBZA 1AGRA 2Q9BA 3GFOA 1R4AA 4GAEA 3D1LA 1U9IC 2WUGA 4OQQA 2JNWA 1NXTA 5G40A 5D1HA 2QPAA 4Q7JB 1Y9ZA 5DYTA 2D5AA 4EDFA 1IN4A 1NN1A 3NFRA 1W29A 5K3OA 1V11B 4RHTA 2GPBA 4ARZA 4R3WA 3LY8A 5AHXA 5H3LA 2O1WA 3IIJA 5F33A 1R0CA 4LC0A 4KZKA 2W6CX 5A5FA 5A06A 1U0BB 4YJHA 3NRBA 2BN4A 3X1JA 3AFOA 4Y2RA 4IWYA 1B2LA 4MYRA 1TKBA 3L7KA 4X6YA 3UN1A 2V59A 3D6VA 1NF9A 5JSKA 5I7AA 3ZYZA 3W3AH 4IGKA 4GECA 2W0MA 5AYVA 4YRQA 2EWWA 2F3TA 4MEAA 3ZWYA 2JLVA 4C4AA 1TVKB 3CLKA 1IPEA 4EKDA 2UYYA 1CHNA 2RGRA 1XDSA 3OIWA 2OYSA 3B6KA 3NHMA 4FS8A 4GH5A 3RRMA 3QMVA 1X7WA 2PQ6A 2CLOB 4KE8A 4CVNA 4WBSA 1E69A 3C41J 4DLZA 4CKWA 5BSGA 3BRQA 2FPIB 4MVJH 2VCYA 4ZEVA 1T8TA 1T9AA 3KTAA 1BNCA 3RFVA 4CEIA 2GHQA 3N2GA 4EABA 1P2UA 1QOPB 1TA0A 2ONYA 5BW4A 5IBPA 1PR3A 2H7VA 4U2GA 4UFPA 3JAKA 1ZGAA 2OTCA 4LJ5A 4EB3A 3A05A 5AO9A 4CEHB 3WMXA 2E4VA 1FVFA 3RW9A 1JHPA 1NMSA 3L6CA 3Q12A 4JEIA 5K0SA 2HHHB 1C9MA 1N4DA 1UWKA 1K4KA 4RJLA 4V03A 3PLAE 1NXSA 1PHRA 1M7GA 4LWOA 1PEAA 2ZW9A 4HL6A 2P2YA 1RRKA 4NJMA 1R9NA 2Y92A 1M2OB 1WB9A 5LQNA 3NBZC 1AZLA 4HLQB 1SCAA 1SPXA 2V7VA 2YIDA 4XASA 3C6BA 2W90A 1M2HA 1PN3A 4BN5A 1AV6A 1DWOA 1Z0KA 4HX5A 1QHHA 1W34A 4S05A 3C15C 1V1RB 3MFQA 2A1UB 2XDAA 1ESMA 2EKQA 1QYIA 3AUJB 4FUQA 2FN3A 3AEKB 4KQIA 3W78A 5BV1A 5JJIA 3A1DA 3BWYA 5L3VA 4J16A 2O54A 2DP4E 2C5AA 3QI2A 1NE7A 2C99A 2UV8A 3FAZA 4FFLA 1AF4A 1UOOA 4KFTA 4M9SA 3OO1A 1FP4A 4KIWA 3IRUA 1BCRB 2VP5A 3W90A 1W8IA 2ROQA 3R24A 3NJ4A 1OXXK 2PS0A 3HRIA 4GYYA 4IVQA 5IH3A 3WHLA 1DBRA 1QF9A 4QULA 4PPFA 4UKDA 4AUMA 4MUJA 1IWBB 2HK9A 4X8OA 4ZAVA 4QU5A 3H1PA 2B0JA 3NHWA 2CZQA 1I13A 3MMXA 4X3OA 1E6UA 1GTG1 1W581 1NLMA 3L8MA 1QOQB 3WYEA 3GGPA 1D1TA 3FRHA 3KSAC 4R1LA 3V4ZA 2BE9A 2O3TA 4F5DA 1UC8A 5HJ2A 1CUHA 1SRRA 4NZ9A 3CO5A 5ESDA 1KDYA 3TMYA 1EB9A 3FOZA 3LBHA 2E5WA 4J75A 4I8XA 5CFLA 5JU6A 2Y77A 1A2KC 2NIPA 4R54A 5BVHA 4Z3OA 1PLJA 3FCAA 4V0LA 4P0TA 1NBHA 3LKVA 3KU1A 5I7UA 3D6NB 3ZBTA 4C4ZA 2A9OA 1UC4B 2BY4A 4DV4B 4P7GA 5T4BA 1N2ZA 2Q9CA 4CPDA 5M29A 1U0FA 3HH8A 5K6AC 3F78A 2X2OA 2Y05A 4FTWA 4L5CA 1IY9A 2UZ1B 2AH5A 4X92A 3RV3A 4CCYB 1MH1A 1CYDA 1PAUA 4J4TA 2JFBA 2OG1A 4LSZA 5G4KA 4TWIA 2HYDA 3FSRA 1XNQB 2FWBA 1M83A 3VVLA 1JDSA 5I6DA 2I34A 2PYIA 1K89A 2ZQZA 3CNHA 3CWQA 4BB0A 2XADA 1YSCA 5LA6A 4I6JA 4C05A 4YXFA 2EP8A 2JAOA 3DFMA 4JJFA 4KRYA 4WA7A 4RTKA 3TSYA 2WJ4A 4M21A 1R64A 3Q9NA 3COVA 5AW8A 4V39A 3CA8A 1FRZA 5K45A 5IEJA 5ALLA 2Q7XA 1BO6A 3KJFA 3SS8A 5LQSA 4JENA 1H42A 4Q3NA 5HW0A 1TEHA 2DQKA 5DV9A 4F92B 1GA1A 1HE3A 2RBGA 3ZK9A 5JAZA 1B8VA 4NBKA 2FWJA 1EP1B 3PV0A 5CW1A 5FL3A 5IW8A 4ZI7F 2GO1A 1GUAA 5B64A 3THWB 2XGGA 4N5IX 1TMYA 4D3YA 3T7KA 1AS3A 2JRLA 2VHQA 2GXUA 4OBEA 1NU8A 1Z12A 1KYWA 3OUZA 4GMFA 5ERXA 1DBPA 5H7XA 1R6XA 4CT5A 3R7BA 4M2LA 1V95A 2CXNA 2NZUG 5HHTA 2CBGA 2D2IA 1P7ZA 1UDBA 3LTEA 2FWRA 3OAAA 2YHIB 4TLMB 1QYCA 5EXPA 3L92A 5BN4B 3W3ZB 5CYGA 3Q0EA 3IP9A 3HABA 4WASA 1D9ZA 3AFHA 4AZWA 1W0KD 2QXTA 3O8LA 4FMPA 4L1KA 1CRZA 1SKBA 3K9GA 2OGWA 1PWHA 5TE9A 1FFCA 2YMLA 4FNOA 4NFLA 4CDNA 1JDBB 3T61A 1HETA 3P2EA 3VPGA 1RXYA 1M74A 3IHKA 1HORA 1ZSNA 4R3NA 4BLRA 2I6UA 4F5YA 5FNVA 4IJ6A 2NNWB 4GLFA 2BSAA 1P80A 3F49S 1UAAA 3KSDO 3ONWA 3P0HA 3WIOA 1MIHA 1AN9A 2QL5A 3F96A 3OF3A 4BNNA 1ECBA 4WSOA 2DAPA 5K01A 5ICFA 1EX1A 2V7QD 3KFLA 10MHA 1GZ4A 1SRQA 2E0IA 2RGBA 2G06A 4AKSA 5T3YA 3UJ7A 3IUNA 4YP9A 4P3OA 3H5OA 3QBJA 3KX2A 2HRBA 3ORHA 3UW3A 4M7RA 1D2CA 1B3RA 1AHIA 4GXTA 5F5LA 2N3ZA 1PR0A 1QZXA 4Z8YA 4L5BA 4LJAA 3ZTWA 3OZXA 4PHGA 2JLZA 3I32A 4CUJA 2VDNB 4LBVA 4YPFA 3B2EA 2VKQA 4XDZA 1G21B 3TIFA 1I6MA 1TW2A 4QO7A 5KJ1A 4AZVA 4R6XA 4H7FA 1S5PA 3ND9A 2DQSA 4H17A 4MGEA 4UE2A 2E21A 4PSVA 1NVXQ 1PFUA 1YUNA 1D2GA 4Q34A 1J20A 4QOGA 1RYNA 2AI3A 2HBRA 2FWIA 1WVGA 5EE9A 4G26A 2G4CA 3H9GA 3B2NA 3DE1X 2QMHA 1FRVA 2OUKA 3EOBI 4UU8A 1KY4A 1U2ZA 4QAQA 3B9BA 4WOBA 5AKGA 4EHIA 5LQAA 4NYJR 3AHGA 3L0CA 1U1CA 2VAPA 4MKGA 2HCRA 2NO9A 2X2EA 3I2JA 2ECFA 2LDBA 2PRZA 4JIGA 3TKAA 2X6RA 1G5PA 2IP1A 3PNYA 3VJMA 4G63A 2H7YA 1J90A 3LP6A 1HDOA 4DCTA 1AUPA 4JFRA 2DBQA 5E9QA 2L2QA 2WNSA 1OXBB 2CFCA 3RGGA 3DKPA 1Y4UA 3CW8X 3NHBA 4MIKA 2QSZA 4R2KA 5KYWA 5FH9A 4IIGA 4O1HA 2RHCA 4RSHA 3LW8A 4OHWA 5EFZA 1PG5A 1KO7A 2QA5A 1RHQA 1VDMA 2MSDB 3OD5A 5C8YF 2J33A 3EW9A 1V8PA 4WH0A 5ARDA 4UAJA 2OCDA 1FP6A 3FIUA 4KP7A 2ZM5A 1PV2A 1VG9B 1EFVB 4MUYA 2HNBA 4RIFA 4RJTA 4MQLA 4UTZA 2JFVA 3FUWA 4XM1A 1DRJA 3UJAA 2A0UA 2G71A 3ASUA 1BEUB 4PZ9A 1MFPA 3R0ZA 3K8ZA 1QDEA 4HAVA 3EF3A 4L8GA 3K72B 1YZLA 4O4HA 5TRTA 5JC1A 4MYCA 3D7RA 3EF1A 3RK4A 1YFKA 2FVYA 4XQGA 2PR2A 4RHUA 2PZJA 4UE3S 2WJHA 4OUDB 4FYWA 3Q10A 3G5MA 2Q3EA 1PZFA 2OBMA 3VKUA 4CKBA 2CLCX 1W59A 1Q5PA 1W87A 1Y7PA 4B82A 4BRUA 3H2HA 1BHQ1 1T2AA 1DAPA 4IRUB 3RVNA 4B33A 1L7AA 2F9FA 2ZBRA 5H5JA 3HPQA 4EIWA 3EBLA 4BJ1A 3GXBA 5I4CA 2C2ZA 2JI4A 3OWOA 1M7HA 2ZB7A 3C5VA 5AKIA 5DU2A 5B3KA 2ONKA 2V4UA 3SEZA 1EQ2A 4H3KB 1SQ5A 4L22A 1MOZA 4BAUA 3L8YA 3ZLVA 4UQOA 2DTXA 3N2LA 2JAHA 1YFLA 4W63A 3OT4A 4O2BF 3NHKA 2AOTA 3MCUA 2TMKA 1QRSA 3HK2A 1CJBA 3AJ9A