5CT4A

Wild-type bacillus subtilis lipase a with 5% [bmim][cl]
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
179
structure length
179
Chain Sequence
b'HNPVVMVHGIGGASFNFAGIKSYLVSQGWSRDKLYAVDFWDKTGTNYNNGPVLSRFVQKVLDETGAKKVDIVAHSMGGANTLYYIKNLDGGNKVANVVTLGGANRLTTGKALPGTDPNQKILYTSIYSSADMIVMNYLSRLDGARNVQIHGVGHIGLLYSSQVNSLIKEGLNGGGQNTN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Esterase
publication title Crystallographic Investigation of Imidazolium Ionic Liquid Effects on Enzyme Structure.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 68
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2015-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5ct4A00
4YASA 5DTJA 1QJ4A 4OB8A 5C8VA 1N5MA 1JJIA 3QMMA 1CPYA 4JH0A 1HBJA 4OU5A 5IVKA 3B12A 5IVHA 3WK6A 4BAZA 1H23A 5J3JA 1C7IA 4UPDA 2AXEA 3PDCA 2WJ4A 4UHHA 1GKKA 3WQHA 2C58A 3QPCA 5JZBA 1SCKA 4EHBA 3C6YA 1G42A 4G4JA 4OPMA 1TK3A 2OAGA 1W76A 1IUOA 5A6VA 1VLQA 1VKHA 5AM5A 1W75A 4M0FA 1J1IA 2DHEA 1YR2A 4K2AA 1E8DA 4BRZA 1SFRA 3HRHA 3BF8A 1VA4A 5LKRA 3I6ZA 2ONCA 1DT3A 2AJLI 2I78A 1QIJA 2XUHA 5K3EA 3IUQA 2VTVA 2BAGA 3QPDA 3CXUA 1DX6A 5CT6A 5DJ5A 1XQYA 5AIAA 1DT5A 3C6BA 2XLBA 4Y2SA 1ZD5A 3AIMA 4W1QA 3RLIA 1HPLA 3H2KA 3O4JA 1GKLA 4MQMA 2QT9A 1DTEA 1AGYA 3STUA 3U0VA 3F98A 2Y6UA 4X92A 3ICWA 2PU7A 4OSEA 1H22A 2XUKA 2PUHA 1ZICA 3HYSA 4X71A 3T52A 4LHEA 1UOOA 3VJKA 2RHTA 1QTIA 2XUGA 5FPPA 1UK8A 2JGMA 2H9YA 5EHZA 1WB6A 3STXA 1QONA 4C4YA 4GECA 4BP9A 2GYUA 2XMSA 5FPQA 4UFOA 3G9ZA 5CURA 3B3QA 5CH8A 3GBSA 5EHQA 4X00A 3TJMA 5E4TA 3FOBA 3R3XA 3G0BA 4E14A 4Q3KA 3D0KA 1VE7A 2UZ0A 2JEZA 4G4GA 3WKAA 1JI3A 4F60A 4CIAA 2OPHA 2WSLA 4UHEA 1CUJA 3HJUA 4AO6A 4Y2UA 4W1RA 2C5GA 2JBWA 4JEIA 2ACKA 3QBJA 3EIOA 4ZGBA 5ALZA 3C5VA 1MNQA 3W04A 1XFDA 1XZDA 1UOPA 5T4BA 1CUYA 3PI6A 2WTMA 1YAJA 4MQLA 4CG1A 4LXIA 2WQZA 5ALTA 2QRUA 4B83A 4KAAA 2FJ0A 3S2ZA 5DNVA 2QKYA 4W63A 4MWTA 4KJXA 4B85A 1EI9A 3H1AA 1DX4A 2JGIA 1GT6A 4E11A 3QVMA 4GLBA 3ILSA 3H0CA 2WFZA 2XMCA 4KRYA 4CCYB 3BWXA 2IITA 4KR0A 4ROTA 2QZPA 4J0JA 2QOEA 2BUBA 3AJAA 3WKBA 1ISPA 4DYHA 1GPNA 2WFMA 1VZ3A 3M82A 2OQIA 4KE8A 3HABA 1KU0A 3EQ8A 1L7AA 5YASA 5LLSA 5A7HA 5AK4A 3DDUA 2BUAA 2ZSIA 4A23A 5ALDA 1DQZA 2I03A 3O4HA 4YPVA 4B0OA 3SK0A 1Z68A 5LZ7A 5BWCA 3V9AA 1FFAA 4B9EA 3IUJA 4X93A 4FFVA 3BDVA 1QE3A 5C7YA 5CT5A 2PPLA 1EVQA 3FSGD 5H3HA 4BZWA 4FBMA 3R41A 1WB4A 2G5PA 3D59A 4FNGA 3C45A 1THTA 2GBIA 4U2EA 3WWPA 1C7JA 5T4FA 2X76A 1WCYA 1FSSA 2C0QA 3WK4A 2XB6A 2HA0A 4KAFA 3DLTA 4BE4A 2B20A 2XQGA 4JUIA 5C8XA 4DGQA 2VF2A 2XQFA 3D4LA 3OM8A 5FUMA 1CR6A 2WIKA 4YX9A 3ESBA 5AI0A 4XVCA 3WZMA 1O6GA 3DOIA 5JALA 3R3UA 3PICA 1T2NA 3FSGA 4W1SA 1Q0ZA 2OCKA 1EINA 4HRXA 4V2IA 4HZGA 5AHXA 5AM4A 1RWQA 4L0CA 4GDMA 4QLAA 4AZ0A 1ZOIA 4EY4A 3WK8A 5KWIA 4BVJA 1MJ5A 2C5FA 5KREA 3E0XA 1IUNA 5A71A 2CZQA 1GQRA 3H17A 3RARA 1MPXA 2RGUA 3V1LA 3ZWQA 3KDAA 5CT9A 1UOQA 2PSFA 4AMYA 1H2ZA 1CIJA 3KWFA 4WCVA 4DTCA 1XZKA 4Z49A 1YSCA 1ACLA 2LIPA 3I2JA 3C8DA 3V48A 3E3AA 1QIIA 5HCUA 3G9UA 1Q84A 1UZAA 4Y2QA 3EBLA 3I6MA 2WUFA 5HQ3B 3LIPA 2X5XA 3AIKA 2Z8ZA 5AI5A 1LPBB 2XMDA 4IO0A 4UHFA 2HFKA 3LCRA 2XUDA 4J03A 4B80A 5AM3A 4QDTA 4WY8A 2GYWA 5AM1A 3PFBA 3WK7A 4RE5A 5K3FA 5A7GA 3D2CA 2VATA 1WPRA 1VXOA 3OURA 1QIKA 4AQDA 1P0PA 2WG0A 2OCLA 2WIDA 1A88A 3WKCA 3EQ7A 5LIPA 2GBFA 2WUEA 3VJLA 1ZI8A 5JAOA 4KEAA 3WWDA 1HKHA 3AZPA 4H7KA 3WI7A 4N8EA 4X97A 1CVLA 1ODCA 2PL5A 2OCIA 3IB3A 4H35A 3O95A 4J0IA 1HDEA 2BFNA 4U2CA 1EDEA 4EY5A 3Q0TA 2QM0A 1XLUA 2FX5A 3G0CA 1JT2A 4FWBA 2ZSHA 2V96A 5ALWA 1MNAA 3G7NA 1YCDA 4GW3A 2QJRA 4X91A 1YS2X 2JF0A 4HVTA 3ZI7A 1YAHA 2IX9A 4QNNA 5ALVA 1OXMA 3F97A 3ANSA 1QIMA 4UBOA 3A2NA 1IZ8A 2VT7A 3BIXA 3D3NA 1WOMA 2XMRA 3BJMA 1LPAB 4RGYA 4Y2XA 3C70A 4M0MA 3IURA 3LIIA 5ALUA 1KU6A 4EUSA 1AZWA 3G8YA 4WJLA 3FLBA 1ZD3A 3WJ2A 4KACA 1K8QA 3AFIA 4PQEA 5DYWA 1WPXA 5T4EA 2ECFA 4HS9A 3D2BA 2WU4A 2RAUA 2VT6A 2V97A 1B41A 5ALYA 2HFJA 4X7BA 3R3WA 4ITVA 4ZI5A 2JGEA 1D07A 3STTA 3N0TA 4X6XA 3WA7A 5JYCA 2AJCA 4WDRA 1TCCA 1Q0RA 1G5FA 4H7FA 2CUTA 1XROA 1ORWA 1HQDA 1XKLA 2OXEA 5K3DA 1IMJA 1AMNA 5HK9A 2WIJA 4KE7A 4DMCA 3I2FA 3FCYA 2NW6A 4FLFA 3Q8WA 4RNCA 3I2HA 3OC0A 3PFCA 4ARAA 1CUEA 1W1IA 2HL6A 2G5TA 4CI9A 1UKAA 2GZSA 1AC5A 2PSDA 1XQVA 3BL8A 4FMPA 2XQIA 3AUKA 1QIEA 4MYDA 1SC9A 3JW8A 1N8SA 2HU5A 1B6GA 1L7QA 3WK5A 3ICVA 4L72A 1ACJA 2P8SA 1VJ5A 4DNQA 1VZ2A 1EVEA 2OG1A 1H2WA 5EI5A 3A6ZA 1PJAA 1TRHA 1GQSA 3FYUA 4MJ3A 2GYVA 3WIBA 1CRLA 2J3QA 3H2JA 3L1JA 1MAHA 4WFJA 1LNSA 1F0PA 1L7RA 1TAHA 3I1IA 3LP5A 5AICA 1SCQA 1A8UA 4L3WA 2WU3A 1EX9A 2PBLA 4GWLA 4W1PA 2JGJA 5A62A 3AILA 1HL7A 3FLEA 3K2IA 4X95A 2D0DA 1QIHA 3VKFA 2XUAA 1J2EA 4UHCA 1K63A 4H0CA 1LPNA 5CRIA 2HDWA 1K6EA 1E5TA 5K3BA 2EEPA 5KBYA 3W9UA 3W05A 4OYYA 3L1HA 5CW2A 2BKLA 5HZGA 2ACEA 4U2DA 1WM1A 3HEAA 3IVMA 3KXPA 4J0KA 2Y2VA 3I2KA 2ES4A 2WJ6A 5LZ8A 4BVKA 3YASA 5FKJA 3QMWA 4JNCA 2QXTA 4EA6A 3G0DA 1IUPA 3STYA 1DWOA 1W52X 3I6YA 3G9XA 4Q3OA 1XZGA 2EDCA 4MEAA 4PW0A 5JZ9A 1EDDA 4BAUA 1I6WA 5KWJA 4B9AA 3A70A 3KOOA 1U8EA 3O4GA 4OUKX 1HLGA 1THGA 3WKDA 5EGNA 1LPSA 1U65A 5EHXA 1EXWA 1YS1X 2WG2A 1XRPA 3H2IA 7YASA 1XZBA 1F6WA 4XJVA 3DJYA 2O2IA 1R3DA 1XQXA 5CMLA 1CUIA 1UK6A 3OOSA 1JFRA 4LXHA 1WB5A 4N5HX 5E4JA 5ALXA 1MX1A 3PUHA 1K5PA 1VE6A 3GROA 2HIHA 2BGNA 5AK3A 3FCXA 4JYPA 3WA6A 4Q3LA 4B0PA 2Z5GA 5ISMA 4DNOA 3WK9A 3FNBA 2VAVA 2H7YA 2V9ZA 1PFQA 3DCNA 1YASA 5DYTA 2WFLA 1X2BA 4BCDA 2ZJ7A 1XRRA 4AZ3A 3H04A 3AZQA 1P0MA 4FTWA 1EH5A 3DL4A 2AJDA 3RKSA 1W4LA 3ESAA 5IVIA 5K5EA 2WHPA 5EIHA 4A16A 4BCCA 2GBCA 3H1BA 4L9AA 5LKAA 1CQWA 3N2ZB 4UBLA 3KSRA 3GFFA 4AXBA 4H7EA 5C8ZA 3IIIA 4DNFA 1MAAA 5A7FA 2BCEA 5FRDA 1LBTA 3H2GA 5C81A 1BS9A 1TCAA 2GZRA 5ALKA 3R0VA 4DSAA 5BOVA 2VJAA 3DD5A 3R3ZA 3UUFA 2OLEA 5E2IA 1DWQA 3ZLUA 1GPLA 3C6XA 4MXDA 4Y9SA 4G8BA 5HKAA 3D5EA 1UWCA 4UBKA 1JJBA 2ZVDA 1TKRA 5CH3A 1NU6A 4BVLA 2E3JA 1XRLA 4Y2PA 4EB0A 1XZIA 1DU4A 4BDTA 3PF9A 4MEBA 1A8QA 4OD0A 5IVDA 1RYYA 2XT0A 3E4DA 2HHAA 2JEYA 3AZOA 5AP9A 5SYNA 4LKOA 3BE8A 1WHSA 1QIFA 2HU8A 4J0DA 4XIIA 4BP8A 4IH4A 2WKWA 1G4HA 2RHWA 3VISA 1ZGBA 2J4CA 5D3KA 2HRRA 3NUZA 3QZUA 2IIVA 4AO7A 2JGFA 4CIBA 2GBGA 5ALIA 1CV2A 1A7UA 1GZ7A 3DKKA 4BTVA 4ZV7A 4FHZA 5AKHA 5LYYA 4NZZA 4Q1VA 5A2GA 1ETHA 4UHDA 4EZIA 2ZYIA 1CUWA 5AKZA 1E3QA 4MYSA 3BIWA 3VXKA 3FBWA 4QDUA 5FV4A 5IH7A 4FKBA 5T4HA 3V1MA 3OTQA 4BZZA 1YA8A 4AMZA 5FP0A 2DHCA 2HADA 1GXSA 1BRTA 3QITA 3O0DA 4HTAA 3G9TA 3WYDA 4P93A 3HZOA 1IZ7A 2VEOA 2ZYSA 1TIBA 2JGLA 2VJCA 1EB9A 2CB9A 4BB0A 2FJPA 1CUSA 5JD5A 1U2EA 3TRDA 2QR5A 1H2XA 4ZV9A 1AX9A 5AIBA 2XMBA 1LZKA 1BEEA 1XRMA 2ZYHA 5FOQA 5EIEA 4P08A 4PO3X 5I9IA 5EIAA 2OQVA 2WM2A 3M3DA 2DCMA 2WUDA 1JJFA 2XMGA 1S8OA 3M81A 1LPMA 3ZLVA 4G5XA 3RK4A 3WYNA 1SCIA 1DWPA 3I2GA 3C6ZA 4Y2JA 3GZJA 4Y7DA 4ZXFA 4CCWA 4IH1A 1JMYA 3HLKA 5K3CA 1XZEA 2R8BA 3F67A 3R3YA 4EY6A 5HFNA 5LP1A 3ESDA 2ZYRA 4KE9A 5AOCA 1ZD2P 2BGRA 3DOHA 1DINA 3D2AA 4G9EA 4NS4A 4N8SA 5DWDA 1J06A 4Y2YA 4Y2VA 4ZRDA 1F0NA 1Y37A 2VA9A 3BXPA 4BATA 1PV1A 5AK6A 4J0CA 3QM1A 4HRYA 3O4IA 1E66A 4QA9A 3SC2A 5BWBA 4NMWA 1JU3A 4UBIA 1UT6A 2RONA 4BC0A 4C88A 4DSZA 5HF8A 2R11A 4GHWA 3I28A 3C5WP 5AKYA 4OYLA 3F8SA 5ALSA 1XLWA 4WDQA 3STVA 1BCRA 2J4FA 3MUOA 2XUPA 4XWGA 4YK7A 3CCBA 1SOMA 2VAXA 5FXMA 3B5EA 1CUAA 4PSCA 5AOAA 2J3DA 1E8MA 3IDAA 4UFPA 1NU8A 3FYTA 2QTBA 1MO2A 1ZGCA 4BC1A 3EQ9A 5FLKA 1UK7A 3V1NA 2WIFA 2K2QB 3CN7A 4E15A 4X94A 2Z3WA 5ALEA 5K3FB 2WG1A 1USWA 5ALJA 4BAGA 3NWOA 4H7JA 4GBGA 1G66A 1FJ2A 5EHNA 4OU4A 2DSNA 2PKYX 4A5SA 2XUOA 4GI1A 4BYMA 4C89A 5F4ZA 4QDZA 4QE3A 5ALNA 4EY7A 5FDFA 5ALHA 2O7VA 5CXUA 4F5ZA 4KRXA 1ORVA 4ZREA 2XUJA 2JGKA 6YASA 3WWOA 2BUCA 3U1TA 1XZJA 4KYVA 4PNZA 4UBMA 1QIDA 4QWMA 1CUCA 1Q83A 3OG9A 1LBSA 2B9VA 4DMFA 4DMKA 4Q82A 1YB7A 2WHRA 1ZIXA 3WWCA 2VJBA 4J0GA 4J0HA 1GPKA 5AI8A 5JADA 4WFKA 2VQ6A 1AQLA 3G0IA 2W6CX 4IQ4A 2XUFA 2AJBA 1LLFA 3PE6A 5CBKA 3DEAA 1QOZA 3FVTA 1X70A 3ZV7A 3G02A 1QO9A 1CUUA 4W9RA 1ZJ4A 4I19A 5I7UA 1BCSA 1K4YA 1AKNA 2G4LA 2HA5A 4M0EA 4K6KA 2HA6A 3PUIA 3W9BA 4BE9A 4QDOA 2CEKA 4QWWA 4QLOA 1QZ3A 3WIOA 4KAJA 1QFSA 5AKLA 1WHTA 5JASA 5ALFA 5DTIA 4J3JA 2B61A 3FYUC 1UKCA 3JWEA 3V1KA 4OB7A 2WJ3A 1OILA 4CG2A 1EA5A 1KEZA 1EK2A 2PSJA 4CFSA 5D6OA 5LZ9A 1BROA 2XLCA 3L1IA 3A2LA 2OCGA 5CH5A 1ZIYA 4UFNA 3VDXA 2BJHA 4P92A 4C6HA 2WUGA 4O08A 3WJ1A 4G8DA 3QYJA 2RIPA 2PM8A 3DNMA 1JU4A 2Y6VA 4CCYA 1FFEA 4I3FA 1ZI9A 4BDSA 4X3CA 5AKKA 5AH0A 4HXEB 3WLAA 1E89A 2HM7A 2HRQA 3VVLA 2OGZA 3A2MA 4J7AA 4U2BA 4JYMA 3DL7A 3UUEA 2JIDA 1QFMA 3GA7A 1CQZA 3LS2A 4HXFB 1P0IA 5LZ4A 1FFDA 4RE6A 2OGTA 3DQZA 1UKBA 1OCEA 3CCCA 3FWHA 4PF1A 3HACA 4K6HA 4QZVA 1F8UA 3K9BA 1R88A 4DIUA 5JARA 4GXNA 1XZLA 3MVEA 3IA2A 2QMQA 2HA4A 5AOBA 3ZPXA 1AURA 2XI4A 5DNWA 4D9JA 1MU0A 1XZFA 4NVRA 5D7BA 2PVSA 2PU5A 3F9CA 4X85A 2WILA 2Z3ZA 4Y2TA 5AI6A 4X6UA 5JIBA 1VA5A 4BBZA 1FFCA 3IUMA 4WFIA 4AO8A 3EF3A 1MN6A 1BN7A 1MTZA 4Q34A 4KE6A 1XZHA 1UXOA 2QS9A 4PV7A 4F21A 4ARBA 3FLAA 1W6RA 1BE0A 2WHQA 1QGED 3FYUB 2XQJA 2YXPX 1E8NA 4P9NA 1LZLA 1TCBA 1BEZA 4N8DA 3M83A 1JKMA 4AN0A 4F0JA 5I8PA 4C4XA 2OAEA 1J07A 2YYSA 4B7ZA 1M33A 2HA2A 3P2MA 5ALQA 4X90A 5EFZA 3X3HA 4C4ZA 3KD2A 1C4XA 3SX4A 2DHDA 1CUVA 1U4NA 3UMJA 2XMZA 1T4MA 1VXRA 3MGAA 2EDAA 3W06A 3I2IA 4GEGA 2ROQA 3HXKA 3WZLA 4C87A 1ODSA 3E1GA 5HFAA 4LYDA 3C43A 2QVBA 2XE4A 4H77A 3QPAA 1XZAA 3IULA 5HF6A 2QJWA 4G8CA 1IVYA 3BDIA 4DM7A 5ALLA 3ESCA 1XRQA 5AKXA 5DLPA 1P0QA 4UBJA 2PUJA 2O2GA 5HQ3A 3AINA 2CMFA 2H1IA 5JAPA 5ALGA 4H7HA 5IKXA 5CT4A 5AKEA 2WLSA 3F96A 4K6GA 5JANA 3WL8A 2HU7A 4FLEA 1VOTA 2B4KA 4S0XA 1XKTA 4TPKA 2O2HA 5K3AA 2C4HA 3O9VA 5AO9A 5AM2A 1CUZA 2DQZA 5LZ5A 1EB8A 2XUQA 5AJHA 2X8BA 3R3VA 1GGVA 3CN9A 4LIPD 1EHYA 2RI6A 4MWSA 4FFWA 4K5QA 3ZLTA 4AB1A 3JYHA 4UHBA 2OGSA 2C7BA 2WTNA 4QDXA 3C87A 4EBBA 3HSSA 4FLMA 5AK5A 3NOXA 5JAHA 4G1FA 3SWWA 1A8SA 2PX6A 1BU8A 3STWA 5CTAA 3WWEA 4H7DA 2V98A 1RP1A 1FFBA 1R4ZA 4PSUA 4OCZA 2Q0XA 3WL5A 3O9MA 3RM3A 2PSEA 5AKJA 3QMVA 2YASA 4U2FA 3AIOA 3VJMA 5JD4A 2WFLB 3K6KA 1TQHA 4N5IX 4UBNA 5HF5A 3W2TA 1R50A 4WY5A 1XZCA 4EY8A 3VVMA 4LYEA 3ANTA 4CG3A 1YB6A 4HXGA 2WHPB 2PSHA 5JATA 2CJPA 5SYMA 4FOLA 4PSDA 4LXGA 5JZSA 1MX9A 3TEJA 5HK8A 3WKEA 1R1DA 3KWJA 1XZMA 1ZD4A 3DYIA 2XMQA 4C01A 5E4YA 5AKIA 3HC7A 3NGMA 4B6GA 1DQYA 1H2YA 1NX9A 3IBTA 2H7XA 1XLVA 2CBGA 5JD6A 3BJRA 2I3ZA 4BRSA 2ORYA 3GELA 4OB6A 5CT8A 5AM0A 2HA3A 4IH9A 3D7RA 3LLCA 2ZJ6A 5ALMA 5LZ2A 1Y7HA 1QO7A 5ESRA 2H7CA 2Y2UA 3R40A 2XDWA 5BV7A 2VJDA 2C0PA 1JMKC 3H2HA 1YA4A 4B81A 2XQKA 5HKBA 1CUHA 4AN1A 1CUXA 4INZA 1CFJA 4AX4A 5D3ZA 1R9NA 3WMRA 1EDBA 4B84A 4FNMA 3MUNA 1EK1A 4I4CA 3H19A 1MT3A 4FDMA 4B82A 1ZI6A 4ETWA 3ED1A 2HA7A 3DS8A 4ZWNA 1ODTC 2I3DA 2AJ8A 2O7RA 1Y7IA 2CKMA 5AI4A 1XRNA 5ALRA 4HAIA 4DMHA 1AUOA 3QH4A 1X2EA 2DQYA 4X6YA 5AKGA 4Q05A 4IHAA 2QUAA 1CUFA 4U2GA 3HI4A 4DNPA 3C8HA 4FBLA 2XUIA 5DNUA 3FAKA 1BN6A 3FVRA 4H7IA 5ALPA 2D5LA 2Z8XA 2WIGA 2FUKA 3WL6A 5JAUA 1LPPA 5DYYA 4H18A 2YH2A 2VSQA 3DYVA 2ZJFA 4BCBA 5HF9A 4TVKA 3I1YA 3S8YA 1CUBA 3TGLA 3BF7A 3H18A 1UFOA 1CEXA 4E46A 4XX1A 1CLEA 4G4IA 3GUUA 5ALOA 3WL7A 4G9GA 1XQWA 3OPMA 1QLWA 1MX5A 3PF8A 3IUNA 5CXXA 3G0GA 4Y2RA 1N5RA 4QEKA 4UUQA 1QIGA 2G63A 3T4UA 1R9MA 2DFPA 4TGLA 4DLNA 1QTRA 1LGYA 3DKRA 1CUDA 4RPCA 1ZJ5A 2W22A 2Y1KA 1UK9A 2DR0A 5AI9A 2QXUA 2QUBA 4BTLA 1O6FA 1CUGA 1N1MA 1LPOA
chains in the Genus database with same CATH superfamily
5DTJA 1Y6JA 5I48A 1G7SA 1N5MA 2NXJA 1KS9A 5LXTF 1Z3IX 3ZE6A 1I10A 1YUBA 3HPRA 3G7UA 3DVSX 3A9RA 3W2HA 1T2CA 3B12A 2CVPA 2AUMA 4GH5A 4GKVA 4W5NA 2QU8A 4BAZA 3HA3A 3HVUA 1FJXA 3FUUA 2VYND 4MPRA 3PYLA 1U0FA 4M60A 1H23A 4GG1A 4F9TA 4WJKB 5J3JA 4C7XA 3B6IA 4U7JA 3E27A 1H9BA 4G86A 3DFKA 4K6OA 4MDHA 2AXEA 1I1NA 2F3UA 4UARA 1RTKA 5AJWA 3U56A 1DRUA 4UHHA 1UH5A 1U8AA 3K9CA 2YXDA 3WQHA 5NLLA 3QPCA 4DDHA 1OAAA 5HE9A 5DGIA 1JBQA 4QYIA 2QM8A 3C6YA 4H31A 4G4JA 3ZGVA 1FX1A 2JI6A 3LOQA 1QH1A 5D87A 4NFLA 3OM0A 1LUAA 3R7NA 1VLQA 4FT4A 4RWZA 2JDID 3LBAA 1CJTC 3ZWKA 5MGBA 1EAYA 4CW7A 1AK1A 1T4BA 2EWVA 5DBGA 1LFAA 1X0XA 1DJOA 1YR2A 4K2AA 4ND5A 3QWIA 1UQUA 3HRHA 1JZTA 2KLHA 3C1AA 1QTNA 4LZAA 5TT0A 3KB2A 1NVTA 3IKVA 3O1HB 4JMLA 1VA4A 4ZAXA 2NO7A 1XAJA 3ZU6A 9LDBA 4L16A 5KC8A 1IBMB 1X80B 2EGHA 3CWCA 3KWMA 1WQ1R 1J6UA 2XEXA 2Q27A 2ONCA 2I99A 1Y9JA 1VP9A 1KVSA 1J8FA 1QIJA 2F64A 2Z0MA 3ESXA 3HP4A 3R9IA 2R1TA 4AJEA 2MINB 1C3LA 2VTVA 2BYTA 4HTFB 3X1DA 2G40A 1QAQA 3OIGA 1V25A 3QPDA 3MCTA 3GLHE 2ET6A 1DX6A 5CT6A 3DZGA 3ELBA 5DMXA 5DXFA 3GJ3A 5B6PA 5AIAA 3L06A 4CEHA 4DFDA 1NM5A 4JBLA 1ECPA 3GJ7A 4UNPA 1E3JA 4XRGA 3AVUA 3VR4D 5DU2A 2BHTA 2JGAA 2XLBA 1Y1TA 1ZNZA 5JBIA 2XT9A 4RFSA 2BLNA 1YBFA 2VHUA 2Q5QA 2CDBA 4I55A 2JRCA 3BFXA 4JP1A 4QT0A 2G1AA 5TMDA 2OV2A 4JB2A 1PDOA 5TRTA 3RLIA 3O4JA 1W581 5CDHA 3U60B 1GKLA 2B83A 4BLWA 5I47A 2H0AA 5AVYA 4IDHA 2D6FA 3AFOA 3NGLA 3CC8A 4F12A 4KN9S 4C2BA 5BMVA 1QF9A 1CS0B 1OX5A 3QLUA 1GNTA 2HSEA 3G5UA 4CG0A 3F98A 5I7HA 5FIUA 2L2QA 2P9CA 4FYXA 1H2RS 3FOWA 3PL1A 1A9PA 1L5RA 3R5TA 3DL0A 5K05A 1JYEA 3ZDYB 2WF5A 3PT5A 4A0RA 4MA4A 5JWHA 4DXHA 3RD5A 4HDMA 4MHSA 1FW8A 1O94D 4B17A 2FEAA 3F9IA 1L1QA 1E9CA 3LP8A 1G8HA 2QTGA 3ORQA 3NTVA 3OQJA 2VPQA 1RE1A 4GMDA 2M6SA 1UOOA 2VDWB 3E1KA 5BRJA 2N42A 4G67A 1O03A 3V1TC 1M2WA 3BQNB 5D1NA 3GLVA 2FCAA 2PS0A 4JFAA 3M33A 3MRVA 1UK8A 3EGVA 3GQBA 3M6XA 2JGMA 3SFVA 4MA5A 4U00A 3ECAA 2DPYA 2EP7A 4EHLA 1B8PA 1ID1A 1U5CA 2FWJA 1N3IA 1TMKA 1XEWY 4K88A 5FWNA 1V5GA 5LLDA 1QQ7A 2HRZA 1QONA 2FSVA 2X5JO 2CXHA 3BWBA 1XVAA 2HJSA 3D8RA 4PO9A 4C4YA 2BKUA 4P7FA 2J3MA 3UW3A 1KRXA 4TTJA 1O9BA 2B21A 4FHDA 5C4GB 2EF1A 2RB5A 3G9ZA 4NCNA 4F5DA 5CX1A 1DMSA 4GOJA 4E32A 4L15A 3WLLA 1M6WA 3B3QA 3EZ2A 5K0GA 3NR2A 1Z0IA 3O74A 3ROGA 4R05A 4BN4A 3G0BA 2V3VA 1HM5A 3HCBA 2E5FA 5D3MA 4CKXA 3ZI4A 4RK4A 4BUCA 2QL6A 1PQWA 1N57A 2ZJYA 2VPWA 3K0CC 1YJXA 1R27A 3FX2A 5CDUA 2BEJA 1WE2A 2HLNA 2HSZA 2WICA 1Y5NA 4I1YA 2XY4A 4HP8A 4UMDA 1T5TA 2VFAA 1B8UA 5F3DA 3SBEA 3TNYA 1WBBA 3WKAA 4N41A 1JI3A 4LNAA 3K8ZA 4EAQA 4F60A 2OFWA 1IBSA 1W29A 4MVJH 1QC5A 1E2FA 3AR2A 3KJNA 3Q3CA 4H9GA 4U9UA 1SUIA 3TE7A 4D97A 1MHTA 1DNPA 1RRMA 4Y2UA 1ICEA 4W1RA 5HEKA 5HBGA 3NHPA 3LBYA 2LZ0A 3UKOA 5BV1A 5L6LB 1OWLA 2C00A 3M3PA 3O6VA 3PPIA 4FMBB 1FNMA 2EFGA 2REBA 4DHWA 4IZOA 4JJ7A 1JLMA 1MNQA 3W04A 2F1HA 4QPCA 1C3EA 3ENWA 5JZ9A 2O7SA 4PG8A 2RHRA 3EASA 5HIMA 1UMDB 1XJQA 3ZJYA 4CTJA 2XECA 3UJHA 5JQGF 1W5EA 1SC3A 4JX8A 4BRWA 4LRQA 1I2ZA 3R3HA 1VSQA 4L8FA 1GTL1 1MEOA 2FTKE 3LBFA 1QP8A 2W70A 4NC9A 2WF8A 5ALTA 3VR2D 4I99A 3DBHB 4B83A 1CX9B 1Z6GA 3C98A 3VR4A 4PIVA 4B4DA 4GOOD 1DBSA 4D3YA 5AW7A 4MQ5A 2QSJA 2DBZA 4II2A 3MAAC 2ZXUA 4TLCA 5DNVA 2QZZA 2OYRA 2B4QA 4KPFC 2QRQA 4MWTA 2EW1A 4KVZA 3DOEA 3TQSA 5DK4A 3AVYA 1WXQA 1SCNE 1RADA 2J85A 5EE9A 1KO5A 4B85A 4D9IA 1IB6A 5F2EA 1HGXA 1W94A 2PN1A 2QUIA 2WAYA 1NJFA 3A4IA 3HB9A 3QYAA 1N2OA 2QN1A 3L7JA 4JAVC 4PRLA 1KFJB 4UULA 1NW4A 3TVYA 3ROTA 3ZHOA 2EKBA 1NFRA 2EWMA 3GUHA 3OZXA 4ZOAA 3LXRA 5JAMA 4LRXA 5JCZA 4N5NA 3ILSA 3H0CA 3RADC 2WJPA 4WY2A 5REQB 4F6CA 4BX0A 4KRYA 4PZ9A 3EVEA 1CY7A 3UBTA 1SCJA 1ZXXA 1X9GA 1BX1A 1KWGA 3BWXA 2VJOA 2ZUSA 3OO1A 1JQDA 1Z5GA 2G82A 4AROA 1X39A 4HPJB 2QZPA 3PFHA 5CLJA 4J0JA 4EUEA 1S8AA 1R5JA 2OB1A 2GESA 1S2IA 1M0WA 1X74A 3D8TA 1ISPA 4BNYA 2IPLA 4QXRA 1X7WA 4IM7A 2PJUA 4FEYA 2QUJA 4DLRA 2I6XA 1VYUA 5FD8A 3W8RA 4BNUA 3A3OA 5HOQA 1Y63A 3M82A 3T3GA 2D1FA 2H18A 2UVDA 2JFHA 4MVXA 1HYEA 3TBKA 2Q3BA 4LZNA 3D3QA 3MRSA 5TJ9A 3LDFA 1R0CA 2YV2A 1TLTA 3EQ8A 4Q12A 3RVKA 1DBVO 1YI1A 2FCRA 1HX7A 4LAFA 4FDTA 1OZHA 2YXLA 5LLSA 1E77A 3DZFA 3HWWA 4TWZA 4LJYA 3BREA 3TS1A 4A23A 4BNHA 3PPXA 1R66A 4UEJA 2P2GA 2IP1A 3O4HA 1EBBA 4BS9A 3SK0A 1Q2UA 3TW6A 4PHHA 4WGFA 3KX2A 1OKKD 4JU9A 3E1SA 1FFAA 2Q0QA 3ISJA 4X93A 3EVDA 5BYKA 3COPA 1FF9A 3CF0A 4NULA 3RFUA 1HDIA 1ESDA 1EESA 1G0NA 5EQFA 2BONA 3W7BA 5HGXA 1EVQA 4NBTA 4ZALA 3ZWWA 1AS2A 1UJMA 3OFND 3SHTA 3C1UA 4EFLA 4DA4A 4FBMA 2J0SA 4LRYA 5EL0A 4A9AA 3M8KA 4GNKA 4N9QA 4P5DA 1XYGA 1NBWB 4IG9A 3FI0A 2QL5A 3D59A 2ZCVA 5H3LA 1JMVA 1EPUA 2CB0A 4YMWA 3C45A 8GPBA 2V59A 4PR3A 4MR7A 4MW4A 1Y6ZA 4LOHA 3OZAA 3RSLA 5JPIA 1IN8A 2O07A 4O5OA 2P2SA 3WWPA 1XWFA 4MCAA 5T4FA 4OGLA 2H1HA 3SKYA 2Q4BA 8MHTA 1FNNA 1TXGA 2P2CA 2BGGA 2CLFB 1H5UA 2GN8A 4M8NE 3TI7A 3N2GB 4PNEA 1FSSA 5ADUS 4MR8A 1NSTA 4IYJA 1BH6A 5GJVC 4KAFA 3RR2A 2W2KB 1VL0A 4YXWD 4DQXA 4QLBA 4JI2B 5AHRA 2ZYGA 4G0QA 2HWXA 1QBGA 4REQB 2GTPA 3URMA 4C6SA 4F1KA 5C18A 2BC9A 3QV1A 1UBSB 4WA7A 4H16A 1BHQ1 2OEPA 3L1VA 4PLPA 3TG2A 5KVCA 3LUKA 2DGDA 2W48A 4Q19A 3F5DA 5JY6A 4WACA 3NQ41 1E3MA 4DJJA 5FWXA 1AT1A 4E88A 1B0ZA 2XQFA 4EEKA 2IUFA 3UPUA 1G2OA 2C4VA 3OM8A 4ZAYA 3OZFA 4G1MB 1AKEA 4JLNA 3UWKA 4IEEA 3ZE2B 2J6BA 3A11A 2PMBA 5L8VA 3ESBA 1MABA 4INPA 4CODB 2OD2A 4N76A 3Q2KA 4K6CA 4IAOA 4PC2A 1FQKA 1KK3A 4E09A 3D3EA 1ZN9A 4EQ6A 4CCAA 5ELXA 2ZPAA 3EWIA 3R3UA 1SQ0A 4G5HA 4IZ6A 5GM1A 3PICA 2PFSA 2ZBEA 2V74B 4RTPA 1W6UA 1VRVA 3I09A 1NRIA 2A33A 4LI3X 4W1SA 5JZVA 4E1BA 4HRXA 4W5WA 1B6SA 3L6EA 2IYPA 1I5RA 2HMVA 2OECA 4B48A 3FOEC 1SR8A 4LYFA 2NX2A 2P2NA 2P68A 1I3MA 2XVMA 2Y27A 4QLAA 3TLBA 1ZOIA 2DPGA 4KO3S 3WK8A 2FP4B 3VH1A 3WDKA 1IXYA 5JS7A 1VG0B 1SO8A 3GF4A 5KREA 3E0XA 1GUAA 2O3UA 5IJXA 2BBSA 5DM70 4IV8A 2VOJA 3CHYA 2QW1A 4IY1A 3U3MA 2FK8A 3FMOB 3GJSA 1T15A 1EVIA 3RG2A 3VVBA 1NUUA 2I4RA 3G23A 2G7ZA 3H17A 4EJFA 1OBFO 1GSIA 5F2NA 2GN2A 2FQ1A 1TTPB 1XXHE 4NBWA 4QYMA 4RVUA 2BEWA 1IPHA 2PYZA 4GBED 4MS1A 2P0AA 3KDAA 4UVIA 2GN4A 2PSFA 4NICA 5TDHA 3E7XA 4AMYA 5ICGA 1X19A 3L8HA 2QRLA 3KWFA 4KUHA 4RPIA 4BJ1A 1TADA 1Z62A 3ADOA 3GVIA 1XZKA 1R5BA 4Z9FA 2IHVA 4Z49A 2ONKA 3KZVA 4RKWA 2ZIXA 4IWYA 3HZZA 1ZW1A 2FPLA 2R4QA 4B8WA 5K6AC 1TLLA 3GT7A 1Y0BA 3IEKA 1AHPA 1AJEA 1Y1QA 4HS4A 3EGDA 5CYFA 3DF7A 2J07A 4S0ZA 2H4HA 4AULA 2C4KA 2AW3A 1JH8A 5BSUA 5JWRA 5CA0F 3E3AA 4HBZA 3NEJA 5HA5A 3JATA 5KAMA 4AZVA 4ZOLB 4KN5A 4GI7A 5E0OA 1UPXA 3V9PA 1OGYA 5B7QA 1G9TA 2P3SA 1JBKA 4X54A 4GZMA 5CLIA 3VPAA 1Q84A 3L0PA 3PUVA 4ERXA 2ODNA 3I52A 1EVKA 3DPUA 1ONNA 3FSJX 2QQ5A 3OIFA 1A9OA 2H1LA 3SU8A 1LFDB 5MFPA 2H5IA 3CLVA 1Y4SA 3GRPA 3M5PA 4R16A 1RACA 1ORHA 5HQ3B 4MHOA 4WADA 3CZ5A 2NZ8A 4EHIA 4FDAA 5K9ZA 3IUEA 5INTA 2B37A 4O4JA 1LPBB 2XMDA 4UHFA 4L50A 1F2VA 3C41J 1FNCA 2ILVA 3IDFA 4RL4A 4LC9A 2HFKA 3LCRA 2ECPA 5DTQA 2DFLA 4D74A 4FI3C 3LY7A 4EA8A 3K1ZA 1GV1A 1EXNA 3HEBA 4IKOA 2PWBA 3HDVA 1PN3A 4WY8A 3WRXC 1N1EA 3PFBA 2HXGA 1QRDA 1EQ2A 2C9CA 3WK7A 2FZVA 3GLIB 1WBJB 2MSEB 4G5GA 2VJMB 3B9QA 4MV8A 3W77A 5JMPA 1U7OA 2VZ9A 4YRGA 2QRZA 3CXRA 5I4KA 1NPYA 3VR5D 4KVAA 2QY9A 2W2TA 4GVLA 2HT1A 2R85A 2PCJA 2WG0A 3EVGA 3LT5A 1K08A 5ECGC 4W5TA 1J25A 4ZT5A 1A82A 1BH2A 4NFYA 3H5WA 3V8RA 1E5XA 3OJEA 5FTLA 2QG9A 1FSGA 1JKIA 5LWQA 3MERA 3OPYB 2IS2A 4Q01A 3SXPA 4B76A 3VOAA 5C51B 1BXZA 1SBHA 2J9ZB 4URZR 4J1QA 3SEAA 1PBNA 4MYUA 2LVBA 4L9WA 1CR2A 4D80A 3FYDA 2Q3MA 1KRWA 1APBA 1TUGA 5DTEA 1DQNA 3O0TA 3LZCA 4KEAA 2IGBA 3DB1A 3EYWA 3HFRA 3TLAA 4F5EA 4DDMA 3ZHBA 2FOLA 5EQTA 3I05A 5HP4A 2OD9A 1ILWA 3EJWA 4Y2HA 3ROMA 5L3SA 1KA9H 1I2BA 3AZPA 4L08A 1BXKA 3IAAA 4M76B 3WI7A 5MHTA 3A4YA 1BW9A 4I6EA 4IW3B 2HD4A 5IBRA 2OCIA 1PX2A 2SKDA 2WDPA 3O95A 4GP9A 2VTDA 4XGRA 3RODA 2BFNA 1VBKA 4D43A 1ULZA 5JE8A 1OGIA 4RIEA 3C5HA 4U2CA 1CY2A 3UCEA 3Q8MA 2CDAA 1G291 1Z0ZA 2BR3A 4HNUA 1Z2AA 1I0ZA 4CMCA 5LNK6 4C4OA 4Z2YA 3THXB 4QYXA 1YQWA 1F2TA 1WY7A 4BQQA 4E4RA 1YCFA 3QTBA 1U5AA 2Q6TA 3OCUA 4FWBA 4A1FA 2W5UA 4N47A 3VOTA 4CQLA 2BDUA 2XGMA 5IJ0B 1ZP6A 5ALWA 4QVGA 1ABBA 1B42A 1ZRMA 4DMRA 4Q3AA 3K4PA 4LSMA 2BFFB 2V4ZA 4UEKA 3WBFA 3EMBA 5JSZA 3FKQA 1YUMA 3OZGA 4XGIA 5CIQA 2QJRA 4R9SA 4BFXA 3H87A 4PS0A 3GT4A 2W93A 3JWJA 3G1WA 5H80A 2EJWA 2WUVA 4IOMA 4MV4A 1URPA 1ZJ6A 2ECKA 4B40A 4PX2A 1R4NB 3UKDA 4I9UA 4XH9B 2G9ZA 3A1FA 3WGOA 1JB1A 3E9NA 2BI4A 4FJ2A 1GG8A 1IZ8A 2GAAA 2OZVA 1E6UA 1JTFA 3NT2A 3QLEA 1GGEA 1C4WA 2I7DA 1T2FA 3WQQA 4DPKA 3BIXA 3D3NA 3KXDA 1WOMA 4KK4A 4PANA 3SR3A 1BXRB 3LLSA 2D2VA 4EYGA 4ESHA 3BHNA 4BQOA 1DADA 2YIDA 1V1MB 1RPAA 2Y92A 3EDRA 1X80A 2H57A 3IURA 2GD0A 4JLAA 1E20A 1T3ZA 3HWRA 1VKNA 5A3JA 4B3TB 3LV8A 5ALUA 3ROXA 4OI4A 1H4SA 3I1JA 4Q48A 1YBMA 1B4DA 1DEHA 1DJQA 1NVWQ 1NWCA 1ZHHA 3AUAA 4HQ0A 1O7JA 3LUBA 2PIAA 2FPRA 2OA0A 1OASA 2M1ZA 1OH6A 5H0IA 1G41A 2JGDA 4RNDB 1MOZA 2G36A 3H86A 3IPLA 1TT7A 2E9SA 1JIXA 4WXPA 3C1TA 2OGUA 5C34B 3IEXA 3L0OA 4PQEA 3EXAA 2X13A 4RKFA 4YDSA 3RRXA 3VYVA 4AJ2A 4CDRA 5K45A 3AUTA 1KZGB 2AT1A 3ES9A 1C29B 2P4SA 3QI7A 4RS3A 1XAGA 4U63A 3SD7A 3SJBA 1DKRA 1KP2A 1RXIA 3P71T 4HKTA 4MKZA 1N8TA 3NC4A 1IY2A 2RAFA 1GTSA 2OO7A 2RAUA 3BE4A 2V97A 3WAJA 5JSYA 1NTOA 3DV0B 4CRWB 2D3TA 5FNVF 1EBUA 6NULA 3W3AD 5B6IA 3DVRX 4MUGA 2ISQA 3WOVA 4EF5A 2PH5A 4PG7A 4FILA 4FD3A 1SXQA 2JW5A 1I8TA 4FE3A 1Q19A 1D07A 1V8ZA 4DCGA 2ETVA 1KO7A 5I9SA 4OK6A 4HO1X 3SSOA 1IAQA 5DI3A 3AR9A 1HWYA 4I1IA 2B98A 4WXHA 1EK6A 2AJCA 1XL0A 1Z6TA 5LJLA 1G21E 3PWSA 4I36A 4ED9A 1TCCA 4NZNA 3DE7X 1DKQA 1SCUB 1Q0RA 3GJQA 4P38A 1TECE 5HRCA 2YWBA 5JXGA 3L6DA 4O63O 1M2GA 1XG5A 4MVJP 2EKQA 3BRCA 3CCFA 4LRSB 5FUYA 5T5QA 1CJMA 3EH2A 1HQDA 4TTTS 5HBRA 2YMQA 2OXEA 1DCTA 3ZDEA 5B37A 4UTVA 2H5LA 4P53A 1YO6A 1II8B 1KBOA 4BX9A 1OV6A 3M4ZA 1ABFA 2ZXFA 3L8CA 4KI0A 3VAAA 4OMCA 1YV9A 4GPAA 2JIPA 4UJ5A 4O2BB 3FCYA 3OMWA 4D4LA 3KIPA 3HXLA 4FC7A 4R2KA 2CV1A 1RIIA 5ILGA 1MJHA 2IW3A 2DPHA 3EWNA 4JGBA 4KSCA 3SOZA 4BXOA 4YALA 3TEMA 2PD3A 2G6BA 3OIWA 3WDLA 2ZUFA 2BZGA 3PFWO 5JOQA 1L5MA 2VDPB 2G5TA 1T8PA 3OE1A 1XP5A 2E21A 3I9OA 1G8SA 1L7MA 4QM6A 5IDQA 5IDXA 1AC5A 1JPNA 2DZDA 2IEIA 1JG6A 2RKBA 3WTBA 4B3SB 1EWTA 1K7YA 3SLGA 3W3ZB 5HX7A 4UOZA 1NZJA 4AUMA 2YIJA 2XQIA 3H1FA 4TMXA 1QIEA 2AZTA 3PDJA 4LPKA 4LQLA 5CJ2A 2VTEA 5TR9A 1U8YA 3SI7A 1SC9A 1TT5A 1FXWF 3D7MA 1GYRA 2HU5A 2B1RA 4AJ4A 4W9NC 3DKVA 5CJPA 4RDCA 4BVFA 1DG1G 1HT2E 5KUTA 1FQWA 3MHPA 3O82A 4NCHA 5JS2A 2P69A 4US2R 2O5CA 3ANLA 3QWFA 1JJVA 1W0KD 2O2XA 3IJRA 5BYBA 2IEAA 3CW9A 721PA 1NQUA 2GNOA 2J6IA 4NG5A 1EVYA 1RSZA 2EBHX 4K9RA 3Q3IA 1HT3A 1RPNA 3B1VA 3LA6A 3QXGA 2BMVA 3AP2A 1YRLA 1NVVQ 1ACJA 2P8SA 4FYMA 1P9RA 5HWSA 1P7PA 1Y8QA 3GVPA 3DAYA 1EVEA 3UV6A 5GTDA 3RSSA 1HDOA 3KLOA 4IRXA 4QXAA 4TLLB 4U39A 3KSUA 1EVLA 5FLEX 3DP9A 1D7OA 1XNHA 4QUDA 1KI4A 4HUJA 4KZPA 2I76A 4IIGA 4UPVA 4L4ZA 4RF2A 1KZ6A 3ICOA 2YWDA 4CWAA 1L3CA 4P4LA 1NOJA 3QKSA 1RQ2A 1VMDA 1JDPA 3SIPA 2ZXEA 2FW1A 3C14C 4MJ3A 4R5HA 3A6FA 4TRJA 2VNAA 3H2JA 3N39C 4TS1A 4XWKA 1XDGA 3L1JA 3OUTA 4DR7B 4LF9B 3OOHA 2JJ1D 1V4NA 3NTXA 1NYLA 3T4EA 1GPBA 3QX7A 2CJFA 4JD5A 1F0PA 2IYXA 3TTXA 3GMTA 1L9KA 1SPBS 2C4NA 2YJZA 1YH3A 4Q24A 1QZZA 3FTNA 2PDAA 1NQTA 3I1IA 4GRDA 4RHYA 3LP5A 4Z4HA 3I58A 3WLEA 1E3DA 4Z7OB 1EKXA 3R0XA 5EZYB 1PL7A 1GEGA 3QEKA 1MTOA 3A7EA 4RSRA 4LXUA 4D8TA 4ZFNA 2JGJA 3P19A 1OC2A 2VP6A 5A62A 1GJRA 1ELOA 1MC8A 2OXCA 1YJAA 3FLEA 4M49A 4DHEA 1GUFA 3CUKA 4B71A 1PFGA 4TM8A 5REQA 5ITZB 4ND8B 4QGAA 5DH9A 1Q74A 4GBMA 2PV7A 3WSWA 3PHLA 5JI3E 5K0JA 4LISA 4B33A 3GZ4A 3VYSB 3MJEA 3ZCSA 1GFWA 1IG0A 1J2EA 1M8KA 4TMVA 1PTJC 4WEQA 1K63A 1LPNA 3EFEA 2BFCA 4RVGA 3AJRA 3WGTA 3PQ6A 4G63A 2EZ9A 3TFOA 4WLNA 3FOCA 1QH0A 4FU0A 5K3BA 4PLTA 4EVQA 2QE7D 2Y66A 4G85A 3G59A 3UT5A 3L1HA 4YJGA 5CW2A 3GFPA 4XKJA 4V0MA 5AESA 5D01A 5DM0A 1CBUA 2ENUA 2RGXA 4GM4A 2WV7A 4DV4B 4O3MA 1ZFNA 1NUTA 3KXPA 1M76A 4HB4A 2VP5A 5JQGB 2G5CA 2Y2VA 3DZJA 1FC0A 5NULA 3I2KA 1FFYA 1Z34A 3RBVA 2YDXA 1RXYA 2RSLA 4NDNE 3JQ8B 4NLLA 2G77B 5HILA 1TL7C 1S9HA 4N7RA 3PRYA 3GEBA 4OH1A 3VSEA 4LE2A 1JPJA 2W2NA 4KUEA 2F4NA 2Z9CA 3S2YA 3VKHA 2PGLA 1WP9A 3YASA 3KG2A 1PYGA 2CW5A 3JZMA 3QMWA 1EE2A 3CNHA 1PQPA 4FNOA 3OKPA 3G0DA 3I04A 2G9NA 1GZVA 1AZTA 1N34B 3STYA 1Z22A 4RA6A 3LBHA 2WOJA 4HLNA 4OX9B 1W52X 3UK7A 3FHLA 1QH9A 5JCOA 3VGJA 5E9QA 4DLAA 2Q9CA 4IDCA 4B6OA 4PQRA 4EFDA 3G79A 2FRDC 1XZGA 2B1JA 4QUAA 3UTCA 1GRNA 1P91A 4ZAVA 3DHNA 1UFVA 3OJLA 3PENA 4M8KA 4EW3A 4YP9A 4ACBA 1SU7A 1XWWA 2QPTA 3BXOA 3H11B 1EDDA 5EWLB 4E07A 1VLZA 1FLNA 1L8XA 1MGOA 3MILA 2X9VA 2YHBA 3QBVA 1QZUA 2HGSA 3A70A 3GPBA 3M4NA 3KOOA 3BFKA 4P0TA 5CDTA 2ZB4A 1U8EA 4C76A 3NI2A 3EZ6A 3SAJA 4XLLA 4KQWA 2FMUA 5A06A 1BHO1 2G72A 1E3EA 4KQCA 3GJ0A 2F9LA 4MKIA 5AVRA 1A9XB 1IH8A 3PQ8A 5BR4A 4O4HA 4YRCA 3UJ9A 4CHGA 4XYEA 1N2CA 1U65A 3RSZA 2CV2A 4K8OA 4ZDIA 1NXVA 2W2KA 3W6UA 4B87A 2IEGA 4QVIA 3B60A 2XTMA 2JAHA 2G04A 4HSEA 2WG2A 1BMFD 3LVRE 4JOBA 1XCGB 1WKBA 1ZIDA 4JT4A 1F6WA 2P5SA 2Q99A 3WLMA 4H6VA 1KTVA 2DUWA 4DTIA 4DJTA 1WMSA 1UKZA 2Y3IA 2O2IA 4OREX 3EC1A 2AC2A 1R3DA 3WL4A 4CIDA 4ZCLA 1RM0A 1GPWB 1UBKS 4US1R 2IZ1A 1FZQA 4U8HA 3A1CA 1UK6A 2JJQA 5LQMA 2I34A 3PE3A 3SYLA 1D2EA 2AFHE 4R6WA 4TT3D 5CXQA 1NW3A 3CNQS 3WGHA 4DV1B 1ORIA 4JYCA 4LXHA 3ZCVA 4N5HX 3ROKA 2WVHA 5LUAA 2DULA 3RS2A 2I6TA 4YC7A 3DTTA 5KSWB 4BJ3A 5DW0A 5HHTA 1E1CA 4PVCA 1Z6PA 2IDJA 2O2SA 3IELA 3FBTA 3NUQA 4DJDC 3PUHA 5BV2P 1K5PA 1VE6A 4PY2A 3L7OA 4KMOA 5GOZA 5JVDA 4DV7B 1TKCA 2Z2ZA 3WLPA 5DV9A 2X7XA 2HIHA 3T9EA 3QVKA 2QROA 4EYQA 3DONA 2WAAA 1W8DA 3DAHA 3V7YA 1QG6A 2YFYA 1Q6YA 3B85A 3SNHA 4TRNA 3G2JA 4RA9B 2WFAA 2RHDA 3PD0A 4YI3A 5FOSA 5F78A 4BLPA 1G5IA 2Z5GA 1U7TA 2Z1MA 2ZVJA 3PNQA 1UBCA 2H16A 2IK8A 3BD6A 1JKJA 5CVUA 5DBHX 1E7RA 1T5BA 3ADKA 4P4SB 3QPWA 2HMUA 3GJ6A 3LCCA 5CNIA 4UOQA 1C3VA 3W2EA 2H7YA 2V9ZA 4R84A 5J43A 4HI0E 5BSRA 1NVMB 1TTQB 3TLXA 3ZW9A 2ZWPA 1P2TA 1ZL0A 3KVNA 4RH0A 5E9AA 3ZHSA 2EL9A 1S96A 1X2BA 4JUBA 3RJTA 1CZUA 3NB0A 2X4DA 1YWGO 4IIUA 2IDMA 2CC2A 1HMPA 1U3TA 4KLNA 4WNAA 1XRRA 4JP8A 3H04A 1OV4A 1EUDB 2DVMA 1DELA 3I8OA 4GI3A 3F73A 5CAEB 1CXZA 1DKLA 1KQ3A 2LP4Y 4FTWA 4R0MA 3OU7A 4G1CA 2BEKA 3DL4A 5HJ7A 2AJDA 4BO9A 3EISA 3NGXA 5IVIA 4PZEA 4I14A 2WHPA 3RNOA 1C7ZA 2BGUA 1M34B 3OA0A 5DCUA 4G0ZA 4UDXX 3BMQB 2JPDA 2W6IA 2QL9A 2OAP1 3JS5A 3OEHD 4IXWA 3OCWA 4R7TA 4HYYA 1FYWA 1K98A 2NWQA 5SY9A 4TXNA 1A9SA 3EZGA 5DSXA 4KVFA 1YD7A 1XL1A 4L7VA 5KYXA 3UA3A 3FR7A 3GR6A 4MI1A 5C8ZA 4DR4B 3K1AB 1FUIA 2Z6UA 3AI7A 2ZTVA 4IDEA 1FS5A 3H97A 2CNBA 4NPAA 4DNFA 3GJRA 4HEJA 3NTOA 2W6JD 3BRSA 3W5HA 4E5DA 4KQHA 3NT4A 2ONYA 1VB5A 1OZ0A 3IKLA 5IH3A 4HK4A 3H2GA 4MI6A 1ZVVA 4KTTE 3T1HB 2WD7A 1XK6A 4CNBA 2XAUA 1A8PA 1QDUA 1OAOA 1WEKA 5ALKA 5FBHA 1GFIA 3R0VA 5EJ2A 5BOVA 5LP6C 4KWEA 5DZSA 3IEMA 1E58A 4C4SA 3I3SR 4D92A 3S6JA 1JLRA 1G64A 4X7PA 3WQRA 3GZTB 3TQFA 2BR4A 1NMEA 4AIIA 1AUVA 4O4IB 1ZU5A 4K03A 2I71A 2BGLA 3C6XA 4Y9SA 1N36B 2V03A 1SXJD 1VG9B 2VJLA 3LRPA 2PMEA 3T4PA 3T3NA 2P41A 3D5EA 3WMXA 1MBZA 3QVGB 3DUFA 3PNVA 1IIBA 3NKLA 2FPGB 3GUYA 3QA9A 4BEJA 4AQYB 3RT7A 4DE5A 5CYPA 2R7NA 2PUAA 5CH3A 2F48A 1NU6A 4XCVA 3ZUGA 3HB0A 1XRLA 4V0LA 1WY5A 3A9VA 2Z4TA 4GYWA 4LOLA 1OD6A 4AN4A 3GGGA 4CM8B 1EYZA 4NCBA 1U9ZA 3TEFA 2NV6A 2NU6A 3IRUA 4PZLA 2EOAA 4JJ6A 4QULA 4QYWA 1W5TA 2J31A 3TLGB 5HYVA 1SNYA 2JJ2D 2W2LD 5H1YA 2VHTA 1V3VA 1UBLS 1UL1X 3L05A 5THXA 4GC9A 1H8ED 2XRZA 4OD0A 1CFZA 3MJRA 4OIFA 2CLSA 1ZOPA 3GFQA 1E1QA 2YV4A 4HLUA 5DISB 3U4GA 2RH5A 3ORFA 3V4FA 2OSBA 1AG9A 1MW9X 3NP7A 4XIYA 5L7TA 4WESA 4MP3A 1V9CA 4UNNA 1OFVA 3C3CA 5ER6A 3AFMA 3IQIX 3L6UA 2YMPA 1Q0QA 5EVCA 2HCFA 4XQCA 4G24A 3DULA 3WOHA 4V0SA 2PKXA 4O8CA 3SZMA 1KMIY 3L07A 4IH4A 5BN3A 2RHWA 3SG0A 2J4CA 1SUPA 3F5FA 3RVNA 1Y1SA 5IKEA 3ZDAA 2HRRA 1SHZA 1CD5A 2IY9A 5KNBD 3DE2X 3KQNA 3QZUA 1M1ZA 1DAKA 1W0CA 2Q7XA 3FYSA 4HDNA 4ND2A 4QBIA 4QJ3A 3C7KA 2ERYA 3AF3A 3K0EA 1PYOA 1RI4A 3OI7A 2JGFA 1F6BA 3PC8C 4AO7A 1XFAA 3ANXA 3BMCB 4Q7EA 2VXBA 4US0R 3TMAA 4B6SA 3AVVA 3I73A 3WMGA 1UWKA 3HXQA 3AL0C 2WYOA 2YFQA 3AKYA 4HMOA 2NXWA 2GHQA 3T5GA 16PKA 1ADCA 2G0AA 1GZ7A 3DR3A 3TYXA 2FWBA 1XWIA 1ZH0A 2JFUA 3EXFB 2YVKA 1SXJC 1FMTA 1X86B 1GSOA 2BD0A 1LKZA 3UMSA 3UV7A 3HCFA 5AKHA 1E1RA 1KFEB 3KQUA 2OBMA 3L93A 1UJ6A 3OZDA 3PT9A 3FOZA 2A5LA 1FVHA 1V37A 5KJ1A 4Q1VA 1HQKA 4MP6A 1V6SA 1BGVA 1XTBA 2CL5A 1HXHA 3DLBA 2MYUA 1CUWA 2A4KA 5AKZA 2G9VA 3W2TA 2RG1A 5EESA 4DVGA 3QFSA 4GDFA 1VKOA 3GEHA 1S2OA 4BUJA 3OLVA 2QUKA 3BIWA 2QVLA 4WLFA 1AS3A 4BQIA 2GTIA 3AUSA 3K5PA 3GPLA 1SELA 3I83A 4IFTA 3I8SA 4II3A 4EPVA 4QFCA 3ZWDA 1U02A 3BC1A 2FETA 4ABYA 3U6BA 1UMBA 2DG2A 3O2JA 3SEFA 4BZPA 1JWBB 2BIFA 3SHFA 3QHQA 3VR6D 2ZCUA 3N8DA 1QQBA 4XIFA 2ONJA 3OQVA 1SQGA 2HADA 1QPGA 1H94A 1Q2XA 2XSZD 2HU2A 3RYIB 2CDCA 5EP4A 2GVNA 4Q4JB 3OT1A 2I65A 3PJGA 1Q91A 5EKUA 5CG2A 2ZITA 5KYVA 4QGFA 1ESMA 1R6BX 2BE9A 3G9TA 3T9FA 2HEGA 2RJOA 1E69A 2HNKA 4YCLA 3HZOA 5COQA 1UPTA 2JFVA 1CIPA 3V2UA 4C1BA 2NXNA 1QM5A 2Z9DA 3U4AA 2JGLA 2GR9A 5AXAA 3V33A 1WL8A 2VJCA 1NFQA 1EB9A 2CB9A 4YIHA 2A84A 3QX3A 2ETXA 1R18A 1Z25A 1PU2A 4BB0A 3CVXA 3OU6A 3RYFA 5EWJB 3JU3A 4HVAA 5LOVF 1VHJA 3DFFA 3WLRA 1XMJA 3UAGA 5JLJA 2CXXA 1ADYA 3NT5A 5HZHA 3NHKA 4FFBB 1KZ1A 5LP6B 4DV0B 2GDZA 2DFTA 3RBAA 5LXTA 1J8VA 3UIEA 3VYRB 1IDOA 2ZYHA 4I1RA 4TL8A 3EGIA 4NHEA 1KQPA 1UBMS 1CLUA 1YJ5A 2P75A 2VT2A 5I4BA 3VU8A 1K3TA 1ZH6A 1L4GA 2XVXA 2ZRDA 3BMNB 4KDRA 3AY6A 4LZZA 2Z4SA 4AP9A 2W6NA 2X0DA 1UJ2A 3TD6A 2WM2A 2NZWA 1J8DA 3N2KB 3NTRA 4LOIA 2DCMA 3IP8A 4AS2A 3R8FA 2WUDA 3B51X 4K0KB 2CF5A 3OPNA 2DC1A 1FSFA 3F4LA 3KOMA 4KGDA 4M55A 1TAGA 4BO4A 1I32A 5FFFA 4M54A 4PBSA 4ZYVA 4FPXA 1DC8A 2ZRBA 2CHEA 2XQVA 4G5XA 2BJVA 2KJQA 3RK4A 3QKRB 5LL6P 2TRSB 3LX4A 1LSUA 1DWPA 3VPSA 3FTFA 5L3QA 2ZQYA 3OY7A 1TYAE 1YZ3A 2P1RA 4D56A 4IUCS 1TUEA 3O8RA 3GZJA 1X1SA 4CCWA 3N2EA 1K97A 1TW3A 3FZYA 3TQRA 1JHYA 1DJPA 3UVEA 3WISA 4DW8A 1JDVA 3KYIB 1YL7A 2P9YA 3ETJA 4H15A 1PR2A 3D64A 2Q0SA 1CJSA 1WCIA 3PJFA 3F67A 2VRCA 5TMEA 5C1PA 5HIKA 4D0NA 2GB4A 1FTWA 5H81A 3R3YA 1EU1A 4K86A 2YR0A 2BP7A 4ONEA 5L7WA 1ZK3A 3A6DA 4RJ2A 2WTBA 4NOJA 1GZUA 1ZCBA 2R8RA 3B78A 4OQFA 3DTNA 5AOCA 1CYEA 4IQ8A 5I9MA 4DJEC 3IQGX 4EGFA 1TGVA 5GPBA 3V4LA 5CYGA 2O8FA 1ESEA 1N2HA 3B6KA 2NIPA 3DLAA 3EY4A 1IM8A 2DBYA 4B35A 5KYWA 2IS4A 2Q2NA 1UWVA 3AHCA 1SHUX 4N8SA 3GIWA 2EZ4A 2XIJA 3IVAA 4G26A 1DEOA 2ZAGA 4Y2VA 3AUXA 4I50F 3ABZA 2JLBA 4ZRDA 1LLCA 1SXGA 4O2AF 3E23A 4UTOA 2B5VA 3HSYA 3LXMA 4AJ1A 4BATA 4N12A 2WUWE 5C80A 2D8AA 3GUCA 1YRHA 1X0VA 4AAYA 4HDOB 2WZDA 4HR7A 4RKQA 3GV0A 1E66A 1I0IA 3EIHA 3M6VA 3IS3A 4QA9A 3SC2A 3SHVA 3HBNA 2CJWA 2BRUA 5TF4A 1Z0UA 1EGVB 3N3BC 2RBGA 3EEQA 5FADA 1P5RA 2RONA 4C88A 4NL4H 2WHEA 2Z57A 3AR6A 3WBKA 4Y9DA 5EJ5A 3I61A 4N0EA 1V11B 3RC3A 3BK7A 5LNK1 1Y98A 2BHRA 2VHZA 2F8SA 1UC5B 3G2PA 4DA8A 3KVVA 2IF2A 4CV2A 1OBHA 4ZVUA 1UC9A 4OYLA 4FGJA 1EM8A 1KP9A 1XLWA 1XPJA 1YQEA 4UC0A 4WDQA 2YIMA 3NHRA 4IVPA 1FLAA 1GPUA 3VH2A 2JIZD 3G2OA 4DLLA 3ND7A 1C1HA 3EZNA 4RHTA 4JN6B 5K3OA 2IH2A 3RS7A 4CF3A 2O8EB 2ORIA 1UXKA 2Y1XA 4UMFA 1T29A 2GZ3A 1HURA 2BKVA 3OCXA 5HMLA 4G5OA 3QFTA 1I13A 3GJ8A 1PFUA 1YRAA 3TPZA 4YQFA 2EERA 2NSDA 4WBNB 3H75A 1S3FA 5IBQA 2ZYVX 1EX7A 3ZC3A 4EABA 3HYRA 1R6DA 4X20A 3PX7A 5TVGA 4QX6A 4X5OA 4DGSA 2I2CA 4F6RA 3X1WA 3O73A 5LB4A 1QYXA 1I5EA 2ZJOA 4E2ZA 3L8FA 2ODPA 1J8YF 3D43A 3Q8LA 2C9OA 3P2OA 1HUQA 4N03A 1MO2A 3H5OA 4Q03A 1ZGCA 1Y7TA 2JRLA 1ZC3A 2AS0A 4HH0A 4OY3A 5K6TA 1S89A 3EIFA 2K2QB 4JLPA 3PKJA 4D3ZA 4BZXA 4X94A 2Z3WA 1NBME 3KAQA 4EKGA 5GIPE 2DY0A 1K8ZB 4LE1A 1QE0A 3FROA 2C59A 3G85A 1X9HA 1JVBA 2FFRA 2IE0A 2EW8A 2VUHB 3BEDA 3NWOA 1QQTA 4EBFA 3ENQA 4YV1A 1T6BY 4L9SA 5B53A 2R9VA 4BV2A 3B7PA 1YZGA 4QREA 4XDZA 2VAWA 1USGA 4XUGB 4HWKA 4JVNA 3ID6C 1IHUA 2J3HA 2XUOA 4GI1A 4MV5A 1IZ9A 1QS0A 4RJJA 1JBEA 1RPJA 2HHJA 3HDYA 4BYMA 1E79A 1QXSA 2AF3C 3NYRA 4C89A 5ADVA 2WM3A 1B8NA 1SBZA 4QDZA 1AKTA 5CIYA 1H8HD 5IW8A 1BX0A 1B73A 3X1MA 4Z3KA 4EY7A 2HQSA 3SQDA 2C0CA 1EP1B 5FDFA 1NVDA 2IZ6A 4AP6A 2I6UA 2DWPA 2M98A 2ODEA 5CXUA 2BGMA 4RY0A 4QBGB 3TNFA 4F5ZA 1YOBA 4KRXA 1ORVA 3FHJA 4IMPA 2PXAA 1A97A 3WWOA 4C6TB 1U9IA 2JD0A 5CDFE 3RJ5A 2G1JA 1TM2A 3U1TA 5AVZA 5HR5A 4N3NA 1XZJA 5KVQA 1ZRSA 5FBZA 1WUYA 4PNZA 1ULTA 1T3LA 5BQ5A 2FUEA 3GX1A 4QWMA 1CUCA 5TGTA 1ECBA 2RBEA 2B9VA 3O3OB 1LSSA 2GZMA 3OEEA 1LCIA 2QMZA 3I53A 4DMFA 4FFLA 3QU5A 4YRPA 1GCOA 4OFWA 3COZA 2WHRA 1ZIXA 3F74A 3AB8A 2C07A 2G1PA 5FL7D 1NBOA 4LZWA 5GV8A 2FDRA 3UENA 2EP8A 1GPKA 3CEJA 1IOVA 5JADA 4AICA 3JQGA 2GPNA 3W5CA 3UWSA 2A88A 3PC2A 4CGZA 5F77A 3H42B 1QZTA 2XB9A 3B5JA 3MM4A 2F3SA 1LK0A 3PE6A 2Q7DA 1X7YB 4E6PA 4EI8A 5ITVA 2ESRA 1QOZA 5DLQC 1VYHA 4L0DA 4LDNA 4ALNA 1QO9A 3QTTA 3K0BA 3IOEA 3QIVA 1ZJ4A 3HY3A 4H6PA 4I19A 4Q9IA 1YI0A 5I7UA 3DC7A 1D4OA 1BCSA 1JDBC 1V5WA 1K4YA 2DP4E 2HA5A 3HADA 1JQJC 1Q1AA 3MQFA 4LX8A 3K4QA 4L4YA 2X77A 1GZHB 4TS3A 3N70A 2K4MA 3O91A 2JCXA 2QTWB 1AUXA 3R3SA 3X2SA 6ADHA 3CF4A 3UFXB 3W9BA 4KNVA 4R8VA 1E2QA 1S3SA 1L2TA 2KQUA 3GEIA 4BE9A 4ARVA 1TMGE 4QLOA 2XOKA 3VQTA 1QZ3A 2Q28A 1JR3E 1M2NA 4ZVSA 3GCZA 4EARA 1JIJA 3NBAA 1GGJA 1T3TA 1KOFA 2FAXA 4MARA 5DT9A 1E0JA 1PK8A 5DTIA 4LNUA 5BW6B 3AY0A 3UBMA 4AMGA 4ZDWA 2IF0A 3FYUC 4P1ZA 4M2LA 2FPKA 3ZR4B 1A9RA 3JWEA 4EJ0A 3V1KA 4OB7A 5FBQB 3RPEA 1I2CA 2WSSA 3C2QA 3H1PA 4IUDS 1OWPA 1OILA 2Y1GA 2ODWA 3FMGA 4CG2A 4GZLA 1GLNA 2EJUA 3ZU2A 1IUKA 2DECA 2PAFA 2PS9A 4HWOA 5JPCA 3GLQA 1KEZA 4MVJE 1EK2A 4XQ9A 3TOSA 4WCFC 3VA7A 1KO8A 4CFSA 3G0HA 2WF9A 1QPZA 3SDSA 4CM7A 2QAJA 1J1ZA 1DUSA 1XV5A 3Q2IA 3I01A 3JAKA 3ZW7A 1NLFA 4K9PA 3TZHA 2NSJA 1KSHA 2QP3A 4L8GA 2EHJA 4OI2A 4PYLA 5F3WB 2XCTB 2RARA 5E7MA 1D0SA 3PUJA 2CDNA 2G06A 3B38A 1TE2A 3VDXA 4UU7A 1N2CE 3NALA 1TTTA 5J4KA 2O8VA 1PDVA 3OQIB 5EZQA 3WJ1A 4EOGA 3NTLA 2RIPA 5F7OA 4UM9D 4BBAA 3IR5A 3VR1A 2HJWA 3RC8A 1D6MA 1I3NA 3ZVLA 4C3VA 5BNZA 1ZK1A 4RXTA 5ECYA 5FHQA 3TRFA 3VYWA 2OXRA 1XZNA 1JU4A 4PCLA 3RS5A 3ZZUA 1PVOA 1Y7LA 2ZROA 4DSOA 2FZLA 2ZUVA 3JZDA 4ID3A 3SCZA 1U90A 4RA9A 2QZSA 2W43A 3KQWA 2IV3A 2G76A 4BDSA 5GINE 2W42A 2GSDA 3Q40A 3HFJA 4PPQA 2C04A 4W82A 2X0KA 1ATIA 3U9SA 1ODJA 2IYFA 5T57A 4D57A 4LHWA 4GRAA 2CEAA 2BE7A 5BWLA 4E5KA 4NFHA 4BMNA 4Q7LA 3RUPA 1EFKA 3A2MA 3CUTA 2VTKA 3GDWA 2O0KA 2RAVA 2Q50A 5AJXA 4JYMA 4LWQA 4D42A 1TF2A 2OZKA 3DW1X 2G83A 3KQPA 2ZKLA 3UUEA 2JIDA 1JLHA 3LOUA 1CQZA 2FW0A 4CV3A 2H9AA 3OA2A 2HQRA 2HUPA 1LW6E 4Z99A 2EX1A 2ZTSA 3MMZA 4PHCA 3PEWA 2R751 3CY6A 4JBWA 5A2QA 4CHTA 4RE6A 3OLZA 1LTQA 2OGTA 2W6ZA 3HV0A 4EG4A 5CCXA 1G20E 1DC7A 4Z0PA 3WGNA 2H5JA 2R1ZA 3SDZA 2AA3A 4QUIA 1SOUA 3FWHA 1AU9A 4MPJA 2IXTA 1NYRA 1B26A 3DAOA 4QZVA 2E4XA 4M9RA 3QUBA 4DIUA 4RULA 2OWDA 5JSQA 3PR2B 1LF0A 1XN1A 4JLOA 4F2GA 3IC5A 3MVEA 1C1DB 4NX2A 2PMFA 5JRZA 2GKOA 3K1AA 3CR3C 3OE7D 1W4CA 2O2JA 1RYBA 2C2XA 4Y6SA 3BYZA 3ZV5A 1U0TA 2ZEJA 3L7KA 5AUNB 2OQ2A 4J9VA 1JIQA 4YYEA 4UCQA 2CCKA 3CUSA 4I9GA 5ILQA 5DNWA 5IFLA 3KL2A 2QTFA 1MDFA 2PA0A 2Z56A 4MLDA 2R2AA 1GTVA 2LRHA 2PU5A 2PVSA 4DIOA 4J1TC 5H4GA 3IQDB 3SFZA 4P5EA 3F9CA 3IQHX 3BH0A 2QYSA 3QVWA 1EXVA 5C52B 4RXMA 4LS3A 1DV1A 2H1WA 4KNWA 5AI6A 2I8AA 4QJ5A 1H1TA 4UEQA 1DC4A 3B7GA 3K8YA 1KS2A 2X1MA 2FZ4A 4BBZA 2DLNA 1O5IA 3IHKA 4JXXA 2WU8A 3F71A 3NETA 1YS4A 2C98A 4IFBA 4ZVTA 2QTTA 2O48X 3IUMA 2Y0PA 3QE9Y 2OO5C 3BTUA 3EF3A 1UT8A 1NE2A 3F6RA 1L8AA 2KI5A 4OP1A 4D4GA 5JQWA 1BN7A 1AZLA 1NSFA 1PS0A 2WT8A 1O9HA 1MTZA 3KD3A 3W8NA 4CLHA 4I5GA 1G6Q1 2LKDA 1OTYA 4LXTA 3I42A 1QV6A 2X8AA 1FXSA 4JBNA 4B47A 4F92B 5JS1A 3EQ2A 1VL6A 1MB0A 1E9DA 1VPEA 4ZO8A 3TMKA 4MLPA 3O8QA 5ESWA 3FFXA 2IWHA 4F21A 3TLGA 1TLFA 1Z74A 1IWPB 3NJRA 1ZOOA 4A2CA 5KNDA 1SXPA 1UP7A 1YGYA 3CRQA 4KYUA 4KV7A 3OZ7A 5HJ2A 3RGGA 6REQB 3FLAA 3ZDZB 1QGED 3HE3A 2KYRA 3FYUB 3ZDDA 4L6CA 1SKUA 4YNBA 1GTMA 3D8SA 2C2GA 2VZEA 4YQYA 3HCNA 2ID9A 1TD1A 1OXSC 2VNHA 2BSQA 1TCBA 4ER3A 5CA0A 1GPMA 5B7GA 1NLZA 2ALJA 2CF6A 1NR5A 1RJDA 1K8XB 2R47A 3SJZA 4WCFB 4HGNA 5LYJA 4A1OA 4D82A 2O19A 3TQOA 8ABPA 5D84A 2P30A 2WU1A 2P6OA 3B3GA 1SBQA 3D3KA 3PVSA 5EMLA 3QVVA 2M1XA 2XA1A 3GMIA 4F0JA 5I8PA 1D6JA 1G16A 2OAEA 3N9IA 4ZU1X 4DABA 1J07A 5C1DA 2DUNA 2YYSA 4L9RA 1CT9A 3HJGA 3U39A 4EG8A 5I01A 4ZOEA 4HNAA 3ABQB 4ALMA 1RMYA 2PUTA 5ALQA 3OJ0A 1JEQA 1NBEA 5I8WA 3FPAA 3G2IA 4AKIA 3QFFA 3A26A 1G0OA 1R2QA 3DOOA 5SY4A 4L74A 1Y34E 3THSA 4CNQA 1JQ3A 2QTRA 2FKNA 4F8EA 1CEYA 1PD1A 2AR9A 2W83A 3OLQA 3A04A 3UMJA 3HDQA 1C41A 2DTXA 5EP3A 2BTQB 2XMZA 3NBUA 1T4MA 3B3AA 2XKAA 1TZCA 3C5EA 3NHZA 4B4UA 3I2IA 5L3VA 4XJTA 4L85A 5DYIA 4BKOA 4P83A 5IT4A 3GG2A 1A98A 1RXUA 3HL0A 4K9KA 4UDOA 1ODSA 2AWOA 5HFAA 4LFAB 4WKOA 3RJ9A 1DKPA 1VHDA 3B82A 3C43A 2Q46A 1EMDA 4HPWA 1T0IA 4N3CA 1WMDA 2JAOA 4M1TA 4XFKA 4WW0A 3VNVA 1C1XA 2HMWA 1VCMA 4H77A 5GQSA 1N6KA 3WGIA 4HC4A 4TQGA 5EKXA 1TZBA 3QPAA 2ZBFA 3TIIA 5CITA 5EJEA 1Z13A 3P9RA 5I6DA 3DMTA 4KPUA 1OLXB 1KK1A 3RROA 5TLSA 2VTBB 2UVPA 4YP5A 3N6XA 1TPZA 2O8BB 4RPHA 1XEAA 1XVVA 1M0TA 2A86A 2CLKB 1GNVA 3BRQA 2WABA 1HMYA 1V0JA 2BFEB 5A0FA 3DM9B 5DT2A 4FYYA 1NW9B 2CVOA 5AKXA 1P2DA 1P0QA 2A9KA 1NI4A 4GL4A 4AKSA 2AHRA 2AMYA 3E4CA 4E0BA 4AQ7A 2AE2A 3PQ2A 3RYIA 5JECA 5ILOA 4QEDA 5GZ1A 1W0JA 2IXFA 1OFTA 1FS4A 2Z98A 1QWOA 1UMCB 2CMFA 3MGKA 4DOMA 1EBFA 5JAPA 3R9WA 2QPAA 4IDOA 1IRXA 4JMPA 2WJIA 5ALGA 1XZQA 3LPLA 1HTWA 5AKEA 3E22B 2WLSA 4G25A 1D3AA 2HRBA 1IC6A 1T1SA 4WOPA 4LF6B 2GAIA 4QSHA 1M1YA 3SQLA 4FLEA 3UJBA 1FMFA 5TPZD 1U3DA 1NYTA 2HHLA 2ZUCA 3F6BX 2NO5A 4TMYA 4OP2A 2J7PA 1N0UA 1D0IA 1RQ7A 2O1EA 2QVYX 3AETB 4GLOA 3JPWA 3HGQA 4KOAA 1I36A 2M6KA 2C7PA 2A9FA 3RVQA 1B0AA 3HJFA 2P9HA 1EFVA 3T9AA 2DWQA 2G1UA 2RGNC 4YMSA 5AO9A 4MKRA 1MOPA 4MDFA 5BUZA 1NJ5A 2X0JA 4YMHA 3UK2A 5K2MA 3SKVA 2YWGA 1LV8A 3ICQB 5AJHA 4NYIQ 1RWPA 4PNHA 3LT4A 2OC9A 1ZUD1 3EXHA 2UYOA 3OSUA 5L3ZA 3MWLA 2PL9A 5HTOA 4LIPD 3S2IA 5J2UF 3GLFB 1LI5A 4RY2A 2RI6A 5DHRA 2QRVA 3EPKA 1DQPA 2B0CA 5F98A 3UCXA 4RBNA 4AB1A 2WMYA 3I1FA 3AV0B 2PQMA 3RC9A 5F7ZA 4DKXA 3KYCB 2OESA 3QU2A 4M3NA 4O2LA 1DZIA 2GK4A 3TE6A 3SHWA 1JDJA 1NW6A 1P19A 4QD3A 4O5AA 3C87A 2QN8A 3EUWA 1GZ4A 3PPVA 4HXYA 2YZNA 2AGVA 3ZD6A 3GC6A 4JV5B 5KNLA 2FKAA 4U3JB 1U8XX 5IX8A 5H3CA 2QX4A 1JHZA 3HR7A 3KE9A 2OL4A 3ND5A 4ETNA 2X6QA 3VPCA 4EB6B 1KBQA 2O05A 3DT9A 4MW2A 1PK7A 3UH1A 1NXTA 1N9GA 1YDHA 4PAMA 1BU8A 1JSZA 4D9CA 4IYRA 3WWEA 3OOWA 5DHAA 4O0MA 4U5QA 2LW7A 3G5LA 4U9HS 3CF4G 3ZWBA 2FWAA 3MWEA 3R4VA 4C2TA 1V7CA 2P6RA 4RCYA 1PP4A 1HORA 1SUAA 1R4ZA 2AWNA 2X4IA 3LUDA 2F59A 3HJAA 1I9GA 4V1CB 2A92A 2J5RA 2V5VA 1KPGA 1JQKA 4P7BA 2HH9A 5AKJA 4BN5A 3J7TA 2D4AA 5H9VA 1JHRA 1KE1A 1RWVA 5DYNA 4TXHA 2Q5FA 1JWLA 3VJMA 1P73A 2I4OA 1MG5A 1U7DA 2QRKA 4PLFA 1RZUA 4QO7A 3ROQA 3SXJA 4B2YA 5JD4A 4N5IX 1OOEA 4QUHA 2JVKA 1OPRA 1G98A 3IP5A 3EIXA 4OJYA 4RU1A 5DX8A 4AZ3B 2B1GA 2QENA 5AJUA 4AUKA 1DXOA 1S1CA 5FNVA 3PXEA 3V6LA 3VC2A 1U0EA 1KEKA 3QEMA 4YREA 2WZCA 1YB6A 2Y77A 1YZLA 4H6WA 3REFA 4GX1A 1GNPA 3PDUA 4HB0A 2ACVA 4KIJA 4YDHB 5IMBA 4JLKA 4JJZA 3MRXA 4ZAGA 1OJ7A 2VUTA 4XARA 3INYA 1XK7A 1G8PA 1XTSA 3ZBQA 2V3WA 3O3MB 5EA2A 2FNAA 5JSKA 4DANA 3O1LA 4H08A 4O3FA 2ZR7A 2AXPA 4ARZA 3H9EO 2NACA 1RI1A 1PWYE 1VI2A 3R5JA 1JHQA 1YHYA 3G8CA 4DCCA 3BGVA 4XGNA 3NYQA 3Q12A 3LQQA 3R9XA 4DT1B 4C4PA 1RZVA 1ZIPA 1WDWB 2JL1A 2WNHA 4XWTA 2O8CA 4RZ3A 4RF5A 4YY3B 3OX2A 1RHUA 4YT2A 1EHCA 1YB5A 1G5RA 2NTEA 3DYIA 2B4AA 3DSRA 4Z4EA 2R66A 3CB2A 1BKSB 1HTTA 1E1DA 5AKIA 5D5HA 3IL2A 1H66A 2V6FA 4FYIA 4QQ8A 3KLMX 2C31A 3FKSD 5LIRA 2CYCA 4RLQA 4B6GA 5DHQA 5BURA 5TMPA 3IBTA 2ECQA 2PBRA 1C9NA 4PU0A 5K03A 3ETDA 3L0YA 1B6TA 2IFTA 4XIGS 2I3BA 1SEPA 1KYZA 2FPIB 3O4RA 2XYRA 4HQRA 2PQ6A 4LRWA 1VI6A 2BBWA 3GLGE 4I50B 4YMIA 1BE8A 3GDHA 2EQAA 3EG9B 4JKIA 5K51A 2GZ1A 3K0SA 2JGNA 4FGUA 2NNLD 4PEVA 4PSVA 4O2AB 3K72B 4ARUA 5DN6D 2V7WA 5ENZA 4EA9A 1DRJA 3BJRA 4X45A 5BVGB 2V0GA 3H4IA 2TMYA 3CO5A 3HLYA 1TF5A 4RLFA 2DF8A 3NUGA 3OHSX 3BCSA 1R4MB 4Q00A 2A9PA 3W79A 4CIWA 4DDUA 2CN1A 2OP1A 5CT8A 3MWFA 5FBVB 4IH9A 3LUJA 4AMVA 2R1VA 2HZBA 3UC5A 1DRVA 3LE8A 4G5YA 1FXWA 1DQRA 5ALMA 4C0QC 5J23A 1HLDA 1OE0A 3MBOA 4MV0A 4TZTA 3NHLA 3K9FC 5DGHA 5DRYA 5M7EA 5IXJA 2UYHA 5JXHA 2AUNA 3R0ZA 2DJ5A 1I6KA 3RVPA 2RGCA 4HB3A 3R40A 5HRAA 3RG8A 1UXJA 1KJ8A 4NYMQ 3O1JC 2XDWA 3FHCB 1WVIA 5EJAA 4BU0A 1P6XA 3ZHCA 4YCBA 3KCQA 2B94A 5GP1A 5ICCA 3I62A 3D3JA 2JHAA 2VJDA 1XMVA 1IE3A 4NONA 1JMKC 2BPOA 3H2HA 2ZRIA 4INAA 2Z30A 1M6EX 4WN9B 4Z5XA 3TZEA 3O83A 1TYEB 2XQKA 3V4ZA 1QTQA 5DGCA 1P60A 2JK0A 4INZA 1I7PA 5DNAA 2JFZA 1TC2A 2ZBRA 4AX4A 4BLRA 1ZKMA 2V45A 3JD1A 1M8JA 3SYMA 1AUPA 5AUOB 5CA1B 2ZI7A 2Y0CA 5KYUA 3VKVA 4M0UA 2W9XA 3OIUA 5BQXA 1EDBA 4FNMA 2OZEA 1TNDA 4FDMA 4D25A 2AKAB 3ZE1B 5LN1A 1QP7A 2HN9A 4B82A 4HX2A 2O5EA 3N8GA 3VX4A 2Q9BA 5DNYB 3AOEC 3KOYA 3GN2A 1J8MF 1E2MA 1PR6A 2HA7A 3DS8A 3HP1A 4XYLA 1MH9A 2CLLB 4EMSA 4XLZA 5E6SA 4UAGA 2YL2A 2YJ6A 1ADFA 1OX6A 5BP7A 2AJ8A 1YU6A 1DFGA 3BWEA 5E2BA 1OFGA 3D4PA 4OMDA 1PNTA 2Y05A 2QVCA 3FTEA 2FR8A 4R1LA 1VKJA 5GJCA 4BMCA 2REQA 2AFIA 1KQOA 4QHTA 1VMEA 3OQNA 2VH2A 5K0ZA 1EFHA 1E6MA 2WZQA 3O31A 2BOVA 1H5NA 3PUXA 4FOPA 3T5TA 4D0GA 4DMHA 3ITNA 1Z47A 3ZCUA 3QEOA 1U3VA 3A6LA 3OQ6A 3WX0A 3ZXIA 4F2PA 4QG7A 5HOEA 3OO0A 1SUCA 1VSBA 1OWMA 4OHPA 1IHOA 2AOWA 1EM6A 1ZCFA 1Z3CA 2RG7A 3DXXA 3O90A 2G17A 3HU5A 3IB6A 4YV0A 1FPMA 3HB7A 1Q0LA 2A2ZA 2QJTA 2VP2A 4U2GA 3L8EA 3MWGA 1CZNA 1QMPA 2XRYA 3E0QA 4OBBA 4R8LA 4TXLA 5FTNA 4ZVLA 3CWZA 4LDZA 4BVAA 5KYYA 5IT5A 1NN0A 3FA2A 4FBLA 3KLPX 3VHXA 1T4CB 1N5DA 3E7WA 4UUBA 2C5LA 5F1YA 1U1EA 1T91A 1VQ1A 4RDHA 4H7IA 3IQXA 5FOWA 4BP3A 5FB3A 1Y6FA 4FFSA 3R7WA 1JHVA 3WLTA 1IM5A 3UCFA 4B3HA 2P77A 3MW8A 4CMJA 2B8NA 4J1NA 4QDKA 4IIJF 1PEYA 2GO1A 1SIBE 3H8VA 1IULA 1R8QA 4GOXA 3LRXA 4L4UA 2YCLA 3OMLA 3HYLA 4PPNA 1GQYA 3KVRA 4XWWA 3MLBA 1GRCA 1G6HA 2H2IA 2Q2OA 4W7SA 2IBMA 1I2MA 1DZ3A 1DV2A 2PVPA 4BCBA 3U5TA 3I1YA 2HSWA 3BPSA 3FPEA 4FGLA 4NEQA 3WB9A 4F2HA 3TGLA 2O1WA 1UFOA 1RM3A 2X0EA 1PJ4A 1XD2B 1OJLA 5EC8A