4CLXA

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
267
structure length
251
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
molecule keywords PTERIDINE REDUCTASE 1
total genus 96
structure length 251
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4clxA00
1EUDA 1NWCA 1R12A 4EUEA 2UUOA 2Y93A 1EDZA 3EVNA 1SCUA 4Q3EA 4AJEA 1A7KA 4INAA 1NXQA 2R2GA 4XX0A 5AXAA 5KVQA 1T2AA 5F5LA 3D5TA 1BW9A 5KKAA 4IIUA 3CXRA 1J6UA 3WYEA 4YYZA 4WNIA 1A4IA 1ZNQO 3CZRA 4FW8A 4R69A 1UDAA 4P4GA 1YH3A 1B3RA 1JVSA 2NVUA 4IJVA 1HSZA 4ALLA 3KYBA 2YFHA 4D43A 4CQMA 5L51A 4YJGB 4UUPA 4AJNA 5G0UA 3DMYA 4ND1A 1M6HA 1IHXA 3HNPA 3E8XA 4YQZA 3W6ZA 1GQQA 3CE6A 3VPFA 3QW2A 1SB9A 4GVXA 2Q99A 4NQZA 5EQFA 3C7CB 3ZNOA 4RPKA 3GPIA 1HLDA 3RFTA 3I4FA 3F9IA 1MXHA 1I2CA 2X0IA 4BKRA 2X9NA 5FI5A 4CR7A 1M67A 4FFRA 1PQWA 4NG5A 2NV6A 4CM9A 1HF3A 5TT1A 3FWZA 4LMRA 4OGWA 1SOVA 3K5PA 4YAIA 3KLMX 1U7TA 4KMSA 2EKLA 1R6DA 1P1FA 4YJFB 2RH8A 2PLAA 1PTJA 3KXDA 3D4OA 3VH3A 3NTOA 3TPCA 1MP0A 4GQAA 4QEDA 4OOFA 3WWYA 1N7GA 4XR9A 4XDYA 3DZHA 2VUUA 4J1NA 3K6JA 4XCVA 2QRKA 4PZDA 3C3XA 4D41A 4CM7A 3S2FA 2O3TA 3NT4A 3B1KA 1XIVA 3GVXA 4MVJD 1R0SA 1Q7BA 1H9AA 1B15A 1KETA 4TSKA 1DB3A 4XGIA 4YXFA 3INRA 2W2KB 3GNTA 1EQUA 1V6AA 2DU8A 1CQIA 3JD3A 3WGGA 1GV1A 1HWYA 2OUIA 4NNJA 4ILKA 1VRWA 3NYWA 3I4CA 2VYNA 1EK6A 3DQPA 3V1YA 3ZCXA 5IAAA 2QZ9A 3FNFA 4O1MA 1LLQA 5C3MA 2I67A 3RC2A 2QRLA 1DIGA 3NX4A 1I3LA 4LCJA 4LW8A 1KVQA 3DHYA 4AJHA 2PKQO 1MC4A 3W4KA 3Q9UA 1DHRA 2V6BA 2PGDA 4WLUA 3RASA 4E32A 1GV0A 2Q45A 2X4GA 5HS4A 2E82A 4RQTA 1R15A 4DC1A 4MVJI 4WUVA 3PYMA 2IZZA 1H93A 1HE3A 5CG1A 4J49A 2Q2WA 3VZPA 1AXEA 5ITVA 2GZ2A 2EERA 2VT3A 3CSDA 4R16A 4WPGA 3L6DA 3A1NA 3OJOA 4CMJA 3TWOA 1GTMA 4I8XA 5I8ZA 2GN4A 1IHYA 5KNLA 3CIFA 2E6UX 2XPCA 3JQCA 2Z95A 3BMQA 4I9HA 4DQVA 1UZMA 4M87A 2VWGA 5F21A 3VPGA 1JQBA 2Q1SA 4GKBA 2PR2A 4CL3A 3ENKA 5L53A 3MZ0A 2DBZA 1V9LA 1JKJA 3QWAA 4KUEA 2IXAA 4MDHA 2AA3A 5IFLA 1YWGO 2DQ4A 3Q0EA 4YR9A 2J5QA 1YBMA 2EG9A 2ZTMA 3KTDA 1PWXA 2TMDA 4A10A 5JDCC 3KYCB 3H9GA 3JCZA 3QE3A 1Z7BA 2X7HA 1U2DA 3DBLB 3DBRB 4GI2A 1YE3A 3GVPA 4IDCA 3ENNA 1KVSA 4OQYA 2PKQP 4KDEA 3PQDA 4RJTA 3BHIA 4PLHA 3QVXA 3OEWA 4U8GA 1I2BA 1QYVA 2C20A 3DMTC 3FBGA 3M2TA 1WMBA 1XSEA 4CR6A 1HYGA 4AL4A 3V1UA 4R9SA 1Z73A 2NVWA 5A04A 3MJ4A 1SNYA 5B1YA 4L75A 1DJQA 4J2HA 4J1SA 5L40A 4BUCA 5L45A 1MFPA 4DUPA 2WSBA 1LDYA 3I52A 3ZNQA 4CLOB 4YRBA 4DLLA 1QXSA 3OJFA 4NK4A 4JX8A 1B8VA 3WG9A 5JY1A 1PS8A 4O59O 4YRAA 2DBRA 4DQUA 2D3TA 2I66A 2PH5A 5KVCA 2CNBA 1P1KA 3O8QA 4UULA 4W82A 2P68A 1VPDA 1PL8A 5H83A 3UCFA 3UW3A 2IRWA 4CMGA 2PWZA 4D44A 2Q1UA 3K73O 3JQEA 3ZWYA 5EESA 3C7DB 4IZHA 3UN1A 4D42A 1HKUA 1DFIA 4FB5A 3CINA 4XRGA 2JHFA 4XA8A 3ZWNA 2NM0A 2QZZA 1E1KA 3JD1A 4HFJA 3ZN2A 3VPXA 4W9NA 2XXBA 1R16A 3K8ZA 3PJFA 1NYTA 1DC5A 3RVDA 4YT5A 4BB5A 2CSUA 3V2UA 4GLLA 4AJIA 3LQFA 1FDSA 4HFNA 1A4UA 1N9GB 2NU6A 2FPGA 3ADPA 1HYEA 2EW2A 3BMCB 2ZQYA 3H9EO 4XJTA 2YDYA 3IP3A 1ARZA 3OF2A 5MGBA 3HZZA 1VLLA 3WXBA 4G5HA 1WLYA 3FF4A 3H8VA 2D1YA 3I23A 2AEMA 2DFVA 4YAGA 4CM5A 3D4PA 4HFRA 1ENOA 4CM9D 2X5KO 4XRRA 3VVCA 1SC6A 4RORA 3VZQA 4OJNA 3WS7A 1X15A 1R66A 3FR7A 4LISA 4YB8A 1BSVA 1E3JA 1K6JA 1Q0QA 4JJIA 1C0KA 2JJYA 3F46A 3HDJA 3CMMA 3FHLA 1HETA 2Q46A 4R1UA 3DHNA 3DBLA 3ZV4A 1BXKA 1EUZA 4IXWA 3IC5A 4R5MA 4NFHA 4AJJA 3INGA 1XQ1A 1N1GA 2R6JA 3JD2A 1CRWG 5C37A 5AYVA 3ZWAA 5GMOA 2RAFA 4BGUA 4QQRA 4ZRMA 1TEHA 4L9RA 4TZTA 1P0FA 4MVJG 4F3YA 2C2YA 4CLOA 4Q3DA 5DP2A 1B2LA 4GLOA 4KOAA 3FNEA 3OEYA 4U0JA 2QG4A 3B70A 3CKYA 4W9NC 4CV3A 4GX1A 1ZH8A 1B14A 4IGFA 5COAA 5EN4A 3V2GA 3TZKA 2FHSA 5KJ1A 2H9IA 3ANNA 3BMNA 3H7AA 1WXDA 3RU7A 2FR1A 3K30A 1VI2A 3SX2A 4HV4A 1E0DA 1OC4A 5B4UA 3WTBA 1E3SA 3HUDA 3DL2A 1JN0A 4XZ3A 3GLQA 4DA9A 5JCJD 4CV2A 1PZGA 3PI7A 5TNXA 1BXGB 4EJMA 4DMLA 1NNUA 4YJDA 2NTNA 1YL5A 4FJ2A 1T2EA 2R00A 4FD3A 3DZBA 4ZICA 1HE4A 2OOSA 2B69A 1T2FA 1JKFA 3F4LA 1F17A 5LC1A 3PGJA 4TVBA 1ML3A 2QIOA 5ITWA 1T1RA 3GVCA 1GY8A 3AFMA 4WKGA 5EMHA 5FYDA 1ADFA 3ZGYA 3ZU2A 4IGEA 2B36A 1N5DA 2NSDA 2Q1TA 3CUKA 3DZJA 3G1UA 3QWFA 4B4OA 4L4SA 3KLPX 4EDFA 4GKVA 5DCWA 4GBJA 2HUNA 4BNHA 1LXCA 1K6XA 1YJ8A 3WYBA 5COBA 5ER9A 4FCCA 4R9RA 4DRYA 1T1SA 1LC3A 2VN8A 1UZNA 4E5YA 4TROA 2ZTVA 2E4AA 2NU9A 4NBRA 4QO8A 4CPDA 1T4DA 5HWSA 2XF8A 4PIVA 5HA5A 1EBUA 2C0CA 4LGVA 1GL3A 3TZCA 3EVTA 1DSSG 2BHLA 3AY6A 5JE8A 4E31A 2X6TA 1E6EA 3JYPA 3HB4X 2WEKA 4IS3A 2Y1CA 1LRLA 2GO1A 1PSDA 3I9KA 5EJ2A 1GQYA 1X7DA 4OOEA 1ADGA 1T4BA 1FXSA 3FI9A 3GDOA 2YHIB 3D3WA 2DTEA 1H6DA 3I9OA 1UZLA 2FSSA 3PLNA 2GF2A 3CZMA 1EVJA 3NGLA 4GMFA 4LN1A 4E2YA 4EI2A 2IDZA 4ESOA 5H81A 2A4KA 5CDGA 3SBOA 4WNCA 3UF0A 1DAOA 4WLNA 3JYOA 2CD9A 1FF9A 4DQXA 4YT4A 4J2OA 2GYYA 1NR7A 3EYWA 3C24A 3AW9A 1DRWA 3TZQA 3EZYA 1T2DA 4A5OA 3H2ZA 4HKTA 4Z0PA 4M54A 4FFOA 2EKPA 3VH1A 4AJ4A 3QV1A 1HSOA 4Q3NA 1I10A 3PIDA 4OYRA 1QV7A 3FNHA 5TF4A 1SPXA 1DRVA 1GZ4A 3ETGA 3E1KA 3GMSA 1NHGA 3HJAA 3ZV5A 4CQLA 1RKXA 4W99A 3INTA 1P0CA 5F1OA 1R4MA 3AU8A 3UCXA 3F1LA 1LJ8A 5ILGA 2VCYA 2B5VA 4CQMD 3WGYA 1MFZA 4JLWA 3P2OA 4PLVA 4CM1A 5DBGA 1GEGA 4BO4A 1CWUA 5G0VA 3DO5A 3PHLA 2EHDA 4D46A 1IYZA 1U5CA 2J5KA 2VRCD 1BW9B 3I6IA 1H2BA 3PEFA 4IDAA 2HDHA 5I9LA 2RBEA 3WBFA 3WGQA 1NVTA 4LRSB 4GGPA 2R00C 5IN4A 1XA0A 2VWPA 3TL3A 3X2FA 2XOXA 4WASA 1GDHA 2EP7A 5HBRA 3ZW8A 3VH4A 4D7AA 2O4UX 2D2IA 4MINA 3HFGA 3JYQA 5L9AA 3BYZA 3OICA 1PJCA 1ZEJA 2Q50A 4YA6A 3ZWCA 1YOVA 1NWHA 3KETA 3WGOA 2NWQA 4BNNA 2QYSA 1KVTA 1WMAA 1ID1A 2VZ8A 5JDCA 2V7PA 2W2LD 1PIWA 1Y5RA 3GMDA 4BQRA 4D0SA 4PVCA 3WSWA 1C14A 4B7CA 1BDBA 4KZPA 4JN6B 1U3WA 2BH9A 5GZ1A 1BXZA 1KVUA 3S8MA 4I5DA 3SLGA 3PQEA 4A7PA 1JVBA 1LTHR 3OA0A 3GDFA 1Y8RB 1HZZA 1PL7A 3PXXA 2EJVA 3GG2A 2NU7A 3MOIA 1V8BA 4BIIA 3Q6IA 5CAEA 1LDGA 3E6AA 5L7YA 1ONOA 4JJGA 3AFNA 4IY1A 3H4VA 2FZWA 1YDWA 1M2WA 1GAEO 1Q7GA 2V65A 2WE7A 4PG8A 3FRJA 4PGFA 4OSOA 2ZCVA 1E3WB 1PR3A 1P1IA 1VL0A 4MIEA 1KERA 2DBQA 1ZK3A 1YS4A 1HE2A 2ZYDA 3BZUA 4PLGA 1HT0A 3RC1A 3KUXA 4BNLA 5TS3A 1M76A 1D7OA 3PHIA 1QYXA 4BNKA 1Z7EA 2QRJA 3JQ9A 4GX2A 3E18A 5DT9A 4PG4A 4BMVA 4JQCA 4Q39A 3ROQA 2C5EA 2AQIA 1LNQA 3GRPA 5JXWA 3OMLA 3P7MA 4TZKA 3WMWA 2X9GA 1P31A 3GY0A 2G0TA 1GCUA 3RC9A 3EUWA 2GNAA 1YL6A 1XQ6A 4CV1A 1XU9A 4EJ6A 2JCVA 2X9VA 5K9ZA 1UDCA 5CEJA 1IL0A 1C0LA 3GC6A 3QHAA 5JAIA 2VHVA 4W4TA 4WJZA 3A14A 2PD6A 2VTEA 3JD0A 2B83A 1H6AA 4MO2A 3Q2IA 1MXFA 2QQ5A 3JQ7A 3H6KA 4I9NA 5IZCA 3M6IA 4A2CA 4ND3A 4CUJA 3DXFA 4JP3A 1OZAA 4ALJA 2O3UA 4EJ0A 4EUFA 2B4TO 3F6YA 3GVHA 3CH6A 2HK7A 1PJ3A 4TMFA 2PY6A 2Y67A 1Y5MA 4TRMA 4DWVA 2VWHA 3GNSA 1C1DB 2QYTA 4NK5A 4IQ8A 3G17A 1H6CA 3C85A 3LK7A 4NJOA 4BNWA 3RUEA 4B8WA 4M8SA 4M1QA 1LC0A 1U8FO 4HWKA 2I3GA 3DR3A 3LC7O 4BO5A 2Q4EA 3GAFA 4P8RA 4NI5A 1E7RA 3CEAA 4JBHA 4ONEA 2WD8A 4XJSA 5CG2A 1RM5A 3PHGA 4J4TA 3GN2A 4FQ8A 4RCVA 1EBFA 4OHUA 4GGOA 3JQAD 3ZU4A 4RF5A 1VJ0A 5BSGA 4R3NA 4FFMA 5G0TA 3FR8A 1DJNA 3BTUA 3HE3A 1LLCA 3FPCA 4PLFA 4XDZA 4RLSA 5BR7A 4OKIA 1GUZA 1GEEA 5F1PA 3ABIA 4YTEA 3ICPA 1V0JA 1V35A 4J0FA 1E3LA 1E6WA 1XU7A 5JLAA 4IXTA 4FFLA 3WGTA 1C1XA 1ONNA 3ZWMA 1DBVO 1ZMTA 3SC4A 4J4HA 3VPSA 4ALMA 5IZ4A 3A4VA 2PZLA 3GGGA 3JSAA 3T4EA 4BOYA 4O6VA 3WLFA 1IY8A 5ICMA 3DBHA 3JV7A 4F45A 1WDMA 4FOOA 3DOOA 1Q0LA 3GFGA 5DP1A 5L3ZA 4HUJA 4R1NA 1QKIA 3UOGA 4IQ0A 5A4DA 3FN4A 1PGPA 2P91A 4C7KA 1CEQA 3O8QB 4Y6RA 4YJFA 3VKUA 3A28A 2AEJA 3NTQA 4XQCA 4BNJA 1ZK4A 2BFOA 4IPTA 3D5QA 4ZGWA 1W0CA 4XIJA 1QV6A 1EMDA 4FC7A 3S2IA 5FI3A 3QLJA 3ITDA 3ZU5A 1FDWA 3DAFA 3UFXA 9LDBA 4ZN6A 1IB6A 2PZKA 2J8ZA 4II2A 4RPGA 1P1HA 2V6MA 1Y1PA 1XCBA 5IXSA 5ILOA 3QP9A 1WWKA 1WDLA 1NTOA 4KQWA 3N74A 1RJWA 1ZCJA 2YFQA 1GU7A 2PZMA 1D1TA 1U3UA 2I65A 5TJHA 1CDOA 4LCEA 2NVUB 1U9JA 4BO6A 4F6LA 4OMUA 1HDOA 1O5IA 3MJCA 2AXQA 1QLHA 2EEZA 3LT1A 1LUAA 4JP2A 2WJPA 3RC7A 2UV8A 4WOJA 3DAGA 1PQUA 3AM4A 3QA9A 3A9WA 1B3BA 1QORA 1B0AA 4IM7A 2VHYA 3LF2A 5TGDA 5KOIA 4UVEA 4GMGA 1HE5A 2YQ5A 3S55A 1LSUA 5DOZA 4FR5A 3I9LA 1NQ5A 2DTXA 3H2SA 2P9EA 5I7SA 4EGFA 2ZYAA 4TQGA 1MG5A 1A9ZA 1FK8A 2GCGA 1EFLA 4ID9A 3ZWBA 2DM6A 4DPMA 3NJ8A 1O0SA 4CQMB 3R3SA 1U4SA 1AHIA 1ZK0A 3OIGA 3GHHA 4D3DA 3ZW9A 4XGNA 3ZNNA 1B8PA 4Z0HO 1O95A 2B37A 2JAHA 2Q49A 1PJ2A 1KIFA 4BNGA 1ZMOA 3VC7A 2LDXA 3L4BC 1CQJA 1OFGA 3SLKA 4WGGA 5TX7A 4EEZA 3OJLA 1F12A 1HRDA 5CPFA 5G0SA 3LYLA 3ZWOA 4CMHA 2D4AA 3H5RA 1O94A 3SJ7A 4ZJUA 3JQ7B 4BKUA 3AUAA 1NPYA 5I7FA 2OL4A 1CYDA 4P4LA 2VT2A 2VZ9A 2O2YA 3ZU3A 3L9WA 4BB6A 3RSHA 1TXGA 1TT7A 3KYDA 3IKVA 1YONA 3MEQA 4BO3A 3RKUA 4BV9A 5JSFA 3DHEA 4UUMA 3C1AA 4DLAA 3V5NA 1UXGA 2IZ0A 4WLEA 3Q2KA 1KOLA 3JQBC 3D1LA 3EK2A 4XKJA 3DZIA 1WZIA 3IUPA 1PGNA 2OFPA 4RVFA 4J7XA 1KEVA 3GAZA 4NJMA 2LDBA 1PS0A 3VTZA 1L7EA 5ES3A 3PHHA 4IMPA 1UH5A 1UDBA 5C7OO 4YQYA 4Y6SA 3DFUA 1IPEA 1K3TA 2HQ1A 1V3VA 2W2LA 5ICSA 2D5CA 3PWZA 1YL7A 1V3TA 4BKOA 4XD2A 1H9BA 1ZK1A 1XGKA 4GL4A 1ENPA 5TT0A 1YBAA 4E5KA 5BNIA 5JFOA 3RUIA 2GUGA 3AI2A 2EGGA 5A3VA 1B7GO 5AVOA 3KRTA 3WQQA 1HZJA 4ZA2A 2GN8A 4XWYA 5K6AA 2JD1A 4QUKA 3BXXA 4K9DA 3UH1A 3DB2A 1E7MA 2DBVO 3PYXA 4XB1A 1TT5A 2NNLD 2Q4BA 2UAGA 2AG5A 4BHTA 2Z1MA 3DOCA 3UHAA 3LLVA 5FFFA 4N18A 2OBNA 4P38A 1K89A 3WGIA 4B7UA 3OFSA 4AJOA 1HTBA 3GNQA 4P22A 3PVZA 1GZ6A 2QX7A 5FEUA 1H5QA 4NFSA 3RU9A 4BGIA 4XYGA 4XQGA 2CVZA 2YW9A 3SEFA 1BDMA 1F0YA 5JCJA 4BO9A 5BNTA 1SEPA 2P9CA 4CR8A 1NX6A 3WX0A 2XAAA 3WIEA 2YZ7A 2C2XA 3JQ8B 3L4BA 1ZJYA 1XHLA 4JROA 5DBIA 1E3WA 4UREA 2NADA 4E2XA 3AOGA 5IZCC 4BNIA 2C54A 3E9MA 5T8KC 5A03A 2BI7A 2W2KA 2YQ4A 1SEVA 1E6UA 3VHRA 2ZCUA 1LA2A 2OGUA 3BTOA 1LQUA 5HM8A 1G0OA 3DAPA 2A92A 1LDEA 3TFQA 1ZSVA 3V8BA 3E9NA 3TOZA 1LSJA 1F8GA 4BNVA 3HADA 2D0IA 3DBVO 3DFZA 4XGKA 5K6AC 3KSDO 4J1QA 4S1VA 3KZVA 4YPOA 3N7UA 3U4HA 4R3WA 1AGNA 1K6IA 2Z5LA 3VZRA 2BGMA 2NU8A 1E92A 2P2SA 3C1TA 2NLOA 2GDZA 4G81A 4J1TA 2J3HA 3RIHA 5L95A 1ZIDA 1LLDA 2BI8A 5FWNA 1HDXA 2ZB8A 1B8UA 3ASVA 4XQ9A 4YEDA 4DXHA 3KSZO 3AI1A 1VM6A 2X5JO 1IZ0A 3S2GA 2AHRA 4I5EA 2DC1A 2VZ0A 3ANMA 1XWFA 1SOWA 1Z82A 5TSDA 1X14A 4OIMA 2C5AA 2HRZA 4AJKA 1I5RA 3N58A 4PZEA 1QMGA 2O3SA 2HJSA 3BTVA 3G0OA 4BNTA 6LDHA 1FDVA 1UAYA 2Y1GA 4OXYA 3U09A 1IUKA 1BMDA 1U5AA 4J90A 5DCYA 4BO7A 1NPDA 4IDFA 1DFGA 4LK3A 1QLJA 3LDHA 3OIDA 2AQHA 4KUHA 4Y9DA 1T25A 4J6FA 2AMFA 1D1SA 3VZSA 1IE3A 1GR0A 3JQGA 2O23A 2ZJ0A 4M49A 1EEHA 4PZCA 1IPFA 1E1LA 3NUGA 4EZBA 1IULA 4L4XA 1NVGA 4CV0A 1PGJA 4NU5A 3U49A 3GZNB 4KQXA 3UXYA 1EZ4A 3U3XA 2VYVD 3DBRA 4RPLA 4FPXA 4H3VA 3WNQA 5CPBA 4E2WA 1N8KA 4FFPA 3IL2A 2JHGA 2X23A 3NRCA 5IN5A 4D3SA 3B6ZA 5G4LA 1ISGA 2PKRA 2YV3A 4GSLA 3D0OA 2JCYA 3D64A 1I36A 4GAEA 1JTVA 3AUTA 2QHXA 1J5PA 3ETDA 1N7HA 2NUAA 3FPLA 3H5NA 4GX0A 3TZ6A 2W90A 3I5MA 3LLSA 4CLHA 3HN2A 5CDYA 5KTKA 2IE0A 2RCYA 2VNSA 5BNFA 4DIBA 5I9NA 2GERA 4RQUA 3AY3A 2CF5A 2GLXA 3FTNA 5T8KA 4A03A 5CEEA 4DYDA 2IZ1A 5A9SA 3FD8A 5EPOA 3ON5A 5JYDA 2HMTA 3RCBA 2AG8A 1E77A 4NFYA 3RFVA 4C4OA 5A9SB 5U1PA 1ISJA 2B5WA 3W4IA 2IYOA 4KUGA 2VUTA 4NZ9A 4IJWA 1NHWA 4I5GA 4BMNA 4J7CA 5A06A 3WNVA 3GT0A 3F4BA 4U6QA 3VAZA 4FS3A 1DIRA 4F6CA 3JTMA 3LVFO 1NPTO 4XR4A 1LRKA 4LVCA 1HL3A 1K2WA 1E3EA 1Z45A 3ONEA 4IINA 4BO8A 2X86A 5J23A 3JQBA 3AUUA 2EGHA 2PZJA 2HMSA 1QG6A 1DOHA 1C0IA 5JC8A 2IXBA 3GZ4A 3RROA 3JQAB 3P19A 2G76A 3PLRA 4OQZA 5CDUA 4RZHA 2WYUA 3FTPA 3IUSA 5EQDA 2UYYA 2YV1A 3DWFA 3JQGB 4W7HA 2CF6A 3MTGA 3NEPX 1KY5A 5B37A 4OAQA 3KO8A 2FR8A 4BGEA 3X2EA 1PWZA 4LRTB 4W7IA 4U0KA 3MJEA 1AXGA 2VRCA 2DLDA 3RBZA 3KYDB 2I6TA 3COSA 1ISFA 2OP0A 4ZQGA 4HADA 2EXXA 3PDUA 3WDSA 1DLIA 2EJWA 2YJZA 1ZJZA 1D4FA 3K31A 2EP5A 4IJUA 3RUAA 1PU2A 2NACA 2CDCA 4ZVVA 4MVJH 3PPIA 3SVTA 2ET6A 3OH8A 3JQFC 2X22A 4U6SA 4XYLA 5IDWA 5T64A 1LDMA 3AJRA 3GDGA 4HNGA 4R1TA 3V1TC 1BRMA 2H5LA 1R0KA 3WB9A 4DLBA 1NAIA 3H5AA 2GGSA 2JAPA 2ZTLA 2C82A 4NPCA 4P4NA 4YRDA 2HK9A 4KWIA 4R51A 1CJCA 1U28A 4J91A 4Z9YA 2GZ3A 3IMFA 2SCUA 4PLYA 2V6GA 5IXYA 4LMPA 2YHUA 1B26A 5EIOA 1ADBA 1GD1O 3NDIA 3WTCA 4QO7A 5TQVA 5B4VA 4JNKA 1ZZEA 3KV3O 4AJLA 4NIMA 2A94A 5JCXA 4RPHA 1C1DA 1YRLA 1EVZA 5KJCA 3PRJA 2GRAA 3GEGA 3L77A 2VYND 3ITKA 4Z9FA 3UGKA 2HCTA 3MWEB 2YDXA 1R4NA 3E5MA 3ZI0A 4ND5A 1BHSA 2DPGA 3PHJA 2CVQA 4D0RA 3TDKA 4CMCA 3HG7A 2YV2A 1N2SA 4FFNA 1PX0A 2BKAA 3PDJA 5I7VA 3EY4A 3H65A 1ONPA 2BGLA 5TC4A 2OORA 2I3AA 4HX5A 2VRBA 4J9VA 5LCXA 2PD4A 5I9MA 2PNFA 4UEOA 3PYLA 5K0ZA 3BTSA 2WM3A 5DDIP 1E7WA 2G82A 1JW9B 2I5PO 5ER6A 5A02A 1GYQA 3LZ6A 3OJ0A 5ADHA 1VJTA 2ZB4A 2PFGA 5L7TA 4AVYA 5HTOA 1Y6JA 3TSCA 4TWRA 3TN7A 3QVTA 1S6YA 4OO3A 1LBEA 3EHEA 1T26A 1U3VA 2VHZA 4B3HA 4CLDA 4Z6KA 1DAPA 2GN6A 4CM4A 4IDDA 4R68A 3KM0A 4M55A 1K5HA 1PJSA 5A9TA 2H63A 2P5UA 5DULA 3WGZA 4Q9NA 1ZUD1 3L07A 2G5CA 3IJPA 2PGLA 5KVVA 1SO8A 3GHYA 4N7RA 2CY0A 2BF7A 2X1HA 2ZKLA 1JAXA 2O7SA 1UXHA 5C7LO 3KEOA 4E12A 3GF4A 4J3FA 1KS9A 3LT0A 3RAJA 4CLXA 5ENVA 3P2YA 4H16A 1I0ZA 2AW5A 4LSWA 5KVSA 4UVGA 2AEFA 1F06A 1PL6A 3NDJA 3IKTA 3DC2A 1A9YA 5JO9A 5AXBA 2GN9A 3U4IA 1T2CA 2JD0A 4MOWA 1I01A 1OAAA 4WCFB 3OBBA 5HS6A 5CDTA 1YXMA 2AE1A 3M2PA 5T67A 4K28A 1XEAA 3H3JA 1E1NA 1HEUA 1BWSA 4ALIA 1ZFNA 1EE2A 1ZKMA 3ADOA 1ISIA 1J49A 4NBUA 4QFDA 4RF4A 3TOXA 3WYCA 2PK3A 1KC3A 4RF2A 3TQHA 1TI7A 5A05A 1VKOA 3IIEA 4XYBA 1XELA 5JO0A 5F3RA 2B4QA 1YBVA 3EMKA 2FSVA 2JFHA 4E33A 2A9FA 8ADHA 1UP4A 1HDZA 1O8CA 1U1IA 4RO0A 1N9GA 3LSYA 1LEHA 2C07A 1W73A 4U5QA 3UUWA 4QECA 3D4NA 1ISMA 2HU2A 4QXMA 1HXHA 4GWKA 2I99A 3NKLA 4PG6A 4PVDA 2P9GA 1GZ3A 4BKQA 4QFCA 2ZIZA 5DN9A 1U3TA 1PJLA 3HSKA 4KTTE 4L74A 4NH4A 2B4RO 1VL6A 5DOVA 5ENDA 1A72A 5JAZA 1OMOA 2C7VA 1H2HA 4BNXA 5JC1A 4MKZA 2FMUA 1Z6ZA 3JQFA 3NAQA 4YACA 1OI7A 2O7QA 2CVOA 1TB4A 3WR5A 4B4VA 3Q9NA 1F14A 3F3SA 5A3JA 1V3UA 4WECA 3JQ9C 3QWBA 1P74A 1HDCA 3GUCA 4TVOA 3D3WB 3IQDB 1SBYA 3KEQA 2DUWA 3FCOA 3HN7A 3LU1A 5IG2A 5DBFA 1YVEI 2PGJA 4DPLA 2VOJA 3WBBA 2EV9A 2FN7A 1SMKA 2UVDA 3BHJA 1P44A 3QVWA 4YT8A 4EBFA 3B20A 1LLUA 4FC6A 4ZQBA 5HRUA 2DFDA 1AUPA 2P4QA 2VHXA 3O38A 4YWJA 1VKNA 2VTDA 4MKRA 4MJLA 5THQA 1Y9AA 1PEDA 2EF1A 3H9QA 3OECA 1FDTA 4FGWA 4CQLB 4CMBA 1WDKA 1KVRA 4ALKA 4R54A 5FF9A 3WJAA 4J16A 4BNYA 1YB5A 5AXCA 4HY3A 4TKLA 3IAHA 3G3EA 1LSSA 3ZZNA 4GSKA 3EGOA 1YDEA 3PTZA 4URFA 1QRRA 3FSRA 3AM3A 1BVRA 3KYCA 3GA0A 1I8TA 1KBZA 4LVUA 1ZVMA 2HMWA 4YJGA 3ROMA 3GRKA 4B3IA 4CODB 1N92A 2OMEA 4BQPA 2X5OA 4Q3AA 3GFBA 5L4SA 3ZHZA 1ZK2A 3GUYA 4QT0A 3H3FA 3EW7A 1P1JA 1JA9A 3PQFA 4TKMA 3AUSA 3I3OA 3VDQA 3BMQB 4FN4A 2RHRA 2Y99A 2YYYA 3TNLA 3O9ZA 2OXIA 3T7EA 4I08A 4KTVE 1RWBA 3VDRA 3ZHXA 2J6IA 3DTTA 4OSPA 1DC3A 1GPJA 2V6FA 4YVFA 1XLTA 3BMOB 3TF5A 1NFRA 1SAYA 1WP4A 5A1TA 5BQFA 1HLPA 4OKNA 4CLRA 1DIBA 1ISHA 2P4HX 1GUYA 2O2SA 4I9UA 3UKOA 2JCXA 4DC0A 4PN3A 1MUUA 2Y0CA 4FJ1A 3VKVA 3L9XA 3W8FA 4UUOA 3AM5A 2EKQA 2NVBA 3MJTA 6ADHA 4ALNA 3QWHA 1ZEMA 2YY7A 2XXJA 3W6UA 4PLWA 3VTFA 2I76A 5I8WA 1PJTA 2HKIA 3QVSA 1Y8RA 3NTRA 4HNHA 2VOEA 3GEMA 3I9MA 4FGSA 4M89A 1NP3A 1QYWA 2AQ8A 4PLCA 2JKVA 4CM8A 1ORRA 1ENZA 4E3ZA 4K6CA 4BO0A 3WQRA 1I3KA 3MOGA 4ZQFA 3TJRA 2X8LA 3ST7A 1QYDA 1LDNA 1N1EA 3U9LA 4CMIA 1XR3A 2IEDA 1MG0A 4XEHA 4DMMA 4RL6A 4RLHA 5AQ1A 3A06A 2BELA 4AG3A 4I5FA 5JAMA 1KEPA 1GADO 2X0JA 4BNZA 5GZ6A 3OQ6A 2FRDA 1HDRA 4IJKA 4E5MA 4ZHSA 2P5YA 2OO5A 1X7GA 3FNGA 4WLOA 1IZ9A 3NJ4A 1F8FA 1UR5A 1VJ1A 1C0PA 2EW8A 1SZJG 3OQ1A 3W1VA 4E30A 3IOYA 4NU6A 1W4ZA 1LX6A 4NJMB 4XIYA 3C7AA 4HFMA 3DMTA 3PJGA 1QP8A 4O0LA 3QVOA 5H82A 4RVUA 9LDTA 1XG5A 1PJBA 1I3MA 3NDRA 2C59A 4RV9A 4TRRA 1EFKA 1Y7TA 5JY6A 4B4WA 4J0EA 4PG7A 3WICA 1ULSA 1Y8QB 2POQX 3D7LA 1H6BA 2WYVA 4UVIA 1U2GA 3OM9A 5IJZA 3PK0A 3ZWWA 2J5RA 3QJ5A 3GEDA 5IF3A 3ZWVA 1I2ZA 3TL2A 4UEJA 2NQTA 4UVDA 3ZNPA 1PJ4A 3ICCA 4MIOA 4CM3A 1NFFA 4R41A 1P45A 4A0SA 2FPIA 1SB8A 5THKA 3E03A 4JIGA 4XYEA 2VHWA 4RZIA 3SJUA 2IODA 5TJ9A 3JD4A 3ONFA 3QIVA 1MC5A 1O6ZA 5LDGA 2C7GA 3JQ6A 4ZD6A 1I24A 2HO5A 4Y98A 3WQSB 2IEBA 1BTOA 1UXJA 3R1IA 3DZGA 3U62A 4FSHA 5G0WA 3LT4A 4DYVA 5KWEA 2BFMA 3OP4A 2HSDA 1I33A 1YJQA 4TRJA 3W8DA 3QSGA 1DEHA 4IMRA 1NM5A 4CM6A 2ZJ1A 3KOUA 1NQAO 4BGVA 3AOEA 3HDQA 5GZ3A 5KJFA 1EK5A 2CZCA 4R5HA 3HHPA 3UAGA 3JYNA 1W8DA 2WTBA 5BT9A 5MDHA 5CEFA 3AY7A 2OZPA 3GH3A 1IOLA 2FWMX 2ZK7A 2WYWA 3UVEA 3ZWXA 4BVAA 4JBIA 5L4LA 1U4OA 2PV7A 5IDYA 2BGKA 3GPDG 3GZNA 5COQA 1BVUA 3RUCA 1AHHA 2DTDA 3QY9A 3RUDA 3HFSA 4CMEA 1MA0A 3KBOA 2EWMA 1Q1NA 1YQDA 3GOHA 4ZQHA 3MCVA 4OL9A 3OQBA 1E7SA 3HDHA 5GY7A 4TRNA 4O63O 3LC2O 3ZDFA 4KP7A 3IDSA 4OM8A 3HB5X 3S2EA 3NV9A 5KJ6A 1WZEA 4R01A 1RPNA 2JD2A 1H0KA 1YB4A 4JGBA 4YAJA 5T5QA 5BSEA 5JYEA 1EDOA 4AFNA 1QR6A 2GASA 2WDZA 2O4CA 3GR6A 3O03A 5G4KA 2ZB3A 3BMCA 3F47A 4DREA 4DGSA 5TIIA 3AU9A 1KYQA 3BAZA 3DOJA 5JMWA 3UICA 3ULKA 1P77A 4E5PA 5G2OA 3IP1A 3WFJA 4BKPA 2FY8A 8LDHA 3GVIA 3PIIA 4U7WA 1E7QA 4RPJA 4DVJA 1AN9A 3AOEC 4JBGA 4JJFA 1X1TA 1FMCA 3T7CA 3IS3A 3KSUA 2PA3A 5CDSA 4WK6A 1PZHA 4PLZA 4D45A 3L6OO 4CM8B 5BSHA 1PGOA 4JXKA 4UEKA 4XYMA 3ZV3A 4G65A 4FOSA 1CIVA 2GZ1A 4HP8A 5A5FA 1W6UA 3QWIA 3R0IA 1LU9A 1LQTA 1X7HA 1A27A 2FP4A 4CMEC 4WE3A 4CLRB 3WSVA 4ZRNA 4GVLA 4DL9A 2O3QA 3U5TA 2Y1EA 3L6EA 4MVJA 3S1LA 1ZBQA 3DZFA 3PWKA 1WVGA 4MP8A 5CP8A 5B4TA 2NQ8A 1XDWA 3LC1O 4N54A 2H6EA 4QSMA 1Z75A 4CUZA 5A9RA 3ZWPA 1TVEA 1H94A 2C29D 2GPTA 1PQPA 1I3NA 4MP3A 4BL5A 3PJDA 2D8AA 3DBHB 4NBTA 5F1KA 1P1RA 4BO2A 1NR1A 1X0VA 1YOVB 4ZQEA 1HDYA 1MX3A 3KHUA 3Q3CA 1O9BA 2Y68A 4O5OA 3E82A 4FJ0A 2FOIA 3EAGA 5JDIA 4PLPA 4J4BA 1CETA 1PZFA 1JKIA 2CDAA 3VVBA 5DF1A 2BLLA 3ROPA 4OH1A 3STHA 4CJXA 4EITA 2GSDA 4G2NA 3RBXA 7MDHA 3EZLA 4MP6A 4WEQA 3TZHA 1P9LA 3CMCO 4RVSA 2VUSA 3FWNA 1XYGA 1YQXA 3PZBA 2FPPA 5T57A 3B1JA 1ULUA 1TA4A 2J3IA 2JL1A 2O3JA 1UP6A 2X0RA 4GX5A 5TRTA 5A5EA 3QQPA 4J9UE 4B79A 3HWRA 5C5IA 2BMAA 3RD5A 1UP7A 3KVOA 4NBWA 4BNFA 4HXYA 1UJMA 2VWQA 4KDFA 1NAHA 1OC2A 4B8ZA 1Y81A 3BMNB 3EDMA 3OJEA 2O48X 1E1MA 1HDGO 3U0BA 4PCVA 3G1TA 1MV8A 2CMDA 3OSUA 2AE2A 3RUFA 5JAQA 3BHMA 5TLSA 2BFAA 1X1EA 3MTJA 4FBGA 7ADHA 1NQTA 5LDHA 1A7AA 2HJRA 1EUCA 1GYRA 3D3EA 2E37A 5CHEA 4BV8A 1T24A 2Y0EA 4RDHA 3I9JA 1O89A 4WEOA 2F1KA 3ZHBA 3RBVA 3L4SO 4J43A 2RH4A 4PRKA 2NTJA 1ENYA 2WMDA 4E13A 1GQ2A 4JCOA 4Q3CA 2D59A 2HAEA 1U7HA 2DAPA 3ROKA 4LSMA 2W8ZA 3DTYA 5KIAA 2HMVA 4AICA 4ZU3A 3DZKA 4WCFC 2W4QA 1VL8A 1BXGA 1ZXLA 3I1JA 3WGHA 4Y67A 3EC7A 1G6KA 3LT2A 4MKXA 3OETA 2E48A 3K92A 3K2EA 3RWBA 1KC1A 3ASUA 3V2HA 3GG9A 1PGQA 2EIHA 3BA1A 2DUUA 4PFJA 1I30A 3R3JA 1L1FA 1G0NA 3JQ8A 4CL8A 4XB2A 3G49A 2Q3EA 3H9JA 4A26A 4UAGA 4PLTA 3L0DA 1HYHA 4YJHB 1DXYA 5DZSA 1VSUA 1EVIA 3U4CA 4QTZA 2HLPA 4FIZA 1C3VA 3VH2A 3WMXA 1TLTA 1E3IA 2Q1WA 3KB6A 4B7XA 3PJEA 5EINA 1QYCA 3I83A 1ZXBA 3NGXA 1MB4A 3I6QA 4A73A 5G4KB 2CUKA 4B4UA 4D79A 2BFPA 4II3A 1L7DA 4GPD1 4OXKA 4PG5A 3F5SA 4NMHA 1X13A 1E7YA 3CTMA 5F5NA 5U4QA 1ZSYA 1VSVA 1LRJA 1KEWA 4Z0TA 5JPIA 3K9QO 4I1IA 4E5NA 4HBGA 4Y8VA 2JFGA 3DEYX 3RKRA 1DLJA 1PJQA 1RYDA 4L0QA 3PFWO 1B16A 1UXKA 3RQSA 3GK3A 3OHSX 1D8AA 2VYVA 3GN1A 3OIFA 2VQ3A 1DRUA 2ZATA 3C1OA 1WW8A 4FDAA 4YDRA 5C7IO 4MVJF 4R4JA 2CFCA 3WJ7A 1R4MB 1YKFA 3AWDA 3CPSA 3M1AA 2J3KA 2PD3A 4E6PA 4DIOA 4IZIA 3T4XA 4Y6PA 4H15A 3JQDA 5BSFA 2OHXA 2ZTUA 4ROSA 3JQAA 2G17A 3P5SA 2YUTA 4L4RA 2GR9A 5KJEA 2DT5A 1DC6A 1MGOA 2WE8A 4E0BA 5L4NA 3E5RA 4YAKA 1KY4A 4BS9A 4OXNA 2UDPA 4S3MA 2D5AA 4RVDA 5JMPA 4IDEA 1GCOA 2YHIA 2O50A 4GH5A 4IDBA 4DPKA 1XKQA 1E5QA 1MLDA 1NASA 3ORFA 1E5LA 1YQGA 1R4NB 2Y1FA 2G1UA 4KWHA 1P3DA 3JYLA 3R6DA 4AJ1A 4RGBA 3F1KA 2HMUA 4ND2A 4CUKA 4CM4B 2Y66A 1QSGA 2GD1O 1LDBA 4BNMA 3WFIA 4CMAA 1GFSA 3ZV6A 2WWRA 1JAYA 1UUFA 2HK8A 1Q0HA 4UUNA 4YCAA 4WLVA 4C7JA 1DHTA 1Q2XA 2Z1NA 4CMKA 1UAGA 3RJ5A 5I7EA 2JFFA 1WNTA 2OP1A 3ONDA 2HRBA 5JNLA 4NBVA 1VE9A 4A27A 2RIRA 3RI3A 2ZB7A 1WAMA 4MVJP 2ZQZA 4YAEA 4YJHA 3RUHA 1DO8A 3TRIA 4AJ2A 3O26A 2PTGA 2CDBA 3B1FA 4K6FA 2X58A 2ZYGA 5KCZA 4N5MA 1RYEA 4H7PA 4NHEA 3QRWA 4IUYA 3RJ9A 3W4JA 1ZO8A 1GYPA 1YO6A 2Y0DA 3PZRA 1EE9A 4GWGA 2WD7B 1J0XO 4M86A 5KKCA 4ITUA 4K1LA 2X0NA 1A5ZA 2BRUA 4YBZA 1NQOA 1M66A 3AI3A 5JS6A 3C8MA 4BNUA 4RDIA 1PR9A 2QW8A 2TMGA 3BIOA 4Q3BA 1A71A 1Y8QA 4X54A 5DNAA 3GGOA 1R37A 1ZSNA 4E2ZA 5IDXA 1JWBB 4RVGA 4E4YA 3WLEA 4MIYA 1BGVA 3E48A 3FBTA 3K96A 1KEUA 4J7UA 3F5QA 5CFZA 1TT5B 5B12A 2O3RA 1LI4A 1M6WA 3MJVA 2VNAA 4WOKA 1J4AA 1YB1A 1DDOA 2IYPA 4CLEA 3Q1LA 4K26A 4EYEA 4BMSA 1D3AA 3U4DA 2Y1OA 4IBOA 3G79A 1CERA 1EVYA 3IJRA 4XQEA 4B3JA 1R0LA 1VC2A 4JK3A 2OBYA 3ANLA 3ETEA 2F00A 3LF1A 1CF2O 1EQ2A 1GPDG 1JLLA 3OA2A 3PWSA 4DBVO 4D3FA 5JBIA 2NTVA 3E9QA 5AXDA 2Q2VA 3TFOA 1GUFA 1Q7CA 5EERA 1FDUA 4WCDA 2Y1DA 4PRLA 5T6BA 4EUHA 1G1AA 3PP8A 2PH3A 3HQ4O 4EW6A 1FJHA 1RM3A 3AK4A 1JWAB 4DIFA 4N5NA 1JU9A 2B35A 5JDIC 2RHCA 3GGPA 4UVHA 4R1SA 2FZEA 1M75A 4N5LA 3ZH2A 2UUPA 2AQKA 3I9NA 2B0JA 1ADCA 4YT2A 4RVHA 1K0UA 3GQVA 1X0XA 1LSOA 2DVMA 3PGXA 4IS2A 3VOSA 4DTIA 5JW6A 1JDJA 3DDNA 4IDGA 2BD0A 4MVJM 1UXIA 2Q2QA 4BO1A 4IQGA 3WIDA 4NR0A 1OOEA 4MVJE 3ZHYA 4IIVA 2E49A 4WLFA 1RM4A 2H1SA 1BG6A 4L73A 1OBFO 2J3JA 4E21A 1C1XB 1DPGA 5IDQA 3SXPA 5U9CA 4WCFA 1P33A 3DONA 4W6ZA 1I32A 1PS9A 5DCUA 3O4RA 3WWZA 1DIHA 1RM0A 1NFQA 1U8XX 5L7WA 4CMIB 3BMOA 3NT5A 4QX6A 2WD7A 3MWDB 3NT2A 3SC6A 4F46A 1ZW1A 3W8EA 4Z9XA 1AE1A 1DC4A 4Z3DA 3M1LA 1S7CA 2DKNA 2W98A 4L8VA 3UCEA 1NBOA 2DPHA 1DFHA 2A35A 1Z74A 4Z3KA 3MJSA 4MPDA 1NVMB 4ND4A 3WOHA 4L76A 1YGYA 3H9UA 1Y9EA 5EL0A 4DBZA 1WPQA 1PZEA 3K2BA 2I9PA 4NDNE 3VPHA 4EEXA 3Q11A 2ILTA 2FR0A 3HDYA 4AJPA 2Y05A 3PFFA 3RFXA 1DIAA 5AOVA 4RF3A
chains in the Genus database with same CATH superfamily
1ZNWA 1N8TA 1PEAA 1R12A 3LNTA 3OTQA 1W1UA 2OK8A 4MUKA 4WGFA 3KJGA 4PQYA 1A7KA 4INAA 3CLSD 3LVQE 4GBED 4MJ3A 3UTCA 4QU9A 1CFJA 1UOEA 2JLZA 1ZPDA 1X86B 2FP4B 3K0BA 4ZAZA 5TQ0A 2M9MA 4KIWA 1YS9A 2F1JA 1E2PA 2IEGA 2RCNA 4H6XA 4WNIA 2PL1A 4W9MC 1A4IA 1ZNQO 5FIUA 3WHLA 3MERA 4R69A 3ZI7A 4EGQA 2BKVA 2PUWA 3L7NA 1TEZA 1MHTA 4HNAB 4KWEA 1JVSA 4CQNA 1WA5A 4LNHA 4ALLA 3WAJA 1LK0A 1BNCA 4NMWA 2XZDA 1DVRA 4YJGB 1PK9A 4UUPA 4ZV7A 4K05A 4AJNA 5BUZA 2I3DA 5LYJA 1ULTA 2Y1XA 1I0LA 5DHPA 1XROA 2IHYA 1ZNZA 4CI9A 4MDFA 2CKMA 3CE6A 3B52X 2Q99A 2RAPA 3HJTA 2G1AA 4NAUA 1CUSA 4OJTA 4RPKA 3I4FA 4JJ8A 2JGDA 1K5GA 3IPXA 3KYIB 3MK31 4CF5A 3O8BA 1Q17A 1ZESA 1ICIA 4RE6A 2CHQA 2QDKA 3E9DA 4FT2A 4WH0A 1SU7A 1TZCA 3C6ZA 3ZWQA 3U19A 1IIBA 5FBQB 2YJ5A 2ZSUA 4MCIA 4ILEA 4F3RA 5ICGA 1BWPA 4FFRA 3F71A 4Q4JA 1HYQA 2H1RA 3PPWA 4DCTA 2XR1A 4DDWA 4PXYA 3A4TA 1ECPA 2ZTSA 2HA5A 2UU9B 1N2CE 3M5PA 4A15A 3ABZA 3KLMX 4KMSA 4YJFB 2EKLA 2OHFA 4X45A 4UMDA 3ZCSA 2DETA 4M9RA 4REQA 2OLEA 3FTFA 2BUBA 4D8UA 1R0ZA 5EIXA 3D4OA 3VH3A 3NTOA 1GPKA 4O5AA 4XFKA 4PGAA 4X90A 4GQAA 2PL3A 4D0NA 2WQ6A 3KOMA 3WWYA 2WSMA 4ICIA 4K3UA 2W58A 4XDYA 3DZHA 3K6JA 4XCVA 3FDFA 3DZ8A 4ZO6A 4A2WA 2BYTA 1QPZA 4ZZ0A 4D41A 4CM7A 5LQSA 3S2FA 1IN5A 3B1KA 1NY5A 5C8ZA 3EARA 3IKLA 4MVJD 1CNFA 5I7HA 2VTVA 4C7OB 1Q7BA 2G80A 3DHWC 1SHTX 3U40A 4Y2PA 4TSKA 5BRAA 1A2QA 3N6XA 4LWPA 5EZSA 1EGMB 1P60A 3FWPA 4YXFA 4WA7A 4GRDA 4MPRA 4KO3S 4N49A 1EQUA 3G0DA 3C74A 1UFOA 2NXWA 3KQYA 4QUJA 1QHHB 4ABTA 3G2KA 3MJRA 3A2MA 4MS3A 4MX8A 3WHKA 1LFDB 1AZTA 3HYTA 2X3YA 4HB3A 3TPZA 4KBYA 1N8SA 3DQPA 1USIA 2AZ4A 3A31A 1SY7A 3TCNA 3ZCXA 2NNWB 2P27A 2C5HA 4UCWA 821PA 3D3NA 1YFJA 4L5JA 5C3MA 3K7EA 2CYCA 1MB3A 1ESNA 2AN4A 4LCJA 5CLQA 2ZAGA 2GK7A 4ZO7A 2RHHA 4X63A 4AJHA 1UFVA 3N2KB 4I4NA 3RASA 3W4KA 2VJDA 2B3TA 4CF4A 1VBNA 3I6MA 2Q45A 4FYIA 4OBWA 1TJ3A 1M2FA 4KFSA 4BWGA 1R15A 4UBNA 2XKJE 2OHVA 2PZFA 1VDZA 1H93A 5KTTA 3EGIA 2UZAA 5JH7A 3ZWKA 2Q2WA 2CUZA 2VP9A 1UBHS 5FOWA 2GZ2A 2VJMB 5C4IA 1MZVA 3TLBA 3CSDA 4JASB 3QU2A 4WPGA 4KAJA 3L6DA 2YNMC 1L2TA 4FFDA 4S0ZA 2B4YA 4KGXA 3WK6A 1Q19A 3OJOA 1E2LA 1Y33E 3EG9A 4I8XA 2GN4A 1F51E 1MAUA 3RYHB 4GVPA 3TQFA 3JQCA 2HIGA 4ECEA 1OB5A 2HJ9A 5M29A 2OPHA 3UAXA 2EKBA 1K5DA 5DVZA 2NZVG 4QDJA 3V42A 3VPDA 4KGZA 1SKAA 4LSGA 3W6OA 4B44A 3VPGA 2DPMA 4G2TA 1JQBA 1K86A 3UV6A 1CUBA 1LS1A 1DCTA 1V9LA 1WZUA 4PAOA 4LI0A 1FNNA 1SZPA 1JKJA 1XHEA 2WWIA 2IXAA 4MDHA 4ZARA 5IFLA 5CT6A 3Q0EA 1KOJA 3NATA 3OQHA 4IL5A 4OP1A 4UZFA 1Z22A 3K5WA 1EP9A 1XJ5A 3PR3A 4KFTA 4IHJF 4P1ZA 1Q1GA 3SM9A 2ANBA 4NMMA 4NF2A 5JDCC 3KYCB 3UJHA 3JCZA 2PKEA 4HGOA 4C3VA 4ZAWA 5KO2A 3RADC 4D98A 3ESQA 3KYJB 4KEAA 1M5TA 3CRW1 4GD3Q 4LDPA 1CU1A 5FTWA 5TMBA 3DBRB 5EYPA 3L7CA 1JB1A 1TMYA 3H5VA 3MB8A 5U4XA 4CKBA 4QIHA 2WIFA 4IDCA 4UMVA 3CFYA 3SGLA 1M2JA 2IPAB 1NUAA 1OBHA 3PQDA 3W5VA 5EWLA 1AGXA 3KEFA 4PLHA 3QVXA 4KAXA 3AL0C 3OEWA 4MRMB 4U8GA 4PFKA 4K3VA 1JR3E 2C20A 2I8CA 2IUYA 3QJGA 4Q1BA 3S2UA 2BKLA 1FJXA 2RGYA 1CQZA 4DLVA 1T3HA 1SWWA 4DMRA 4JELA 4PGGA 2FN8A 4AY2A 1JR6A 5JSQA 1FZQA 5K3FB 2ATCA 2FDRA 3PCTA 4OHOA 4DQLA 3KKNA 2YMLA 2JA1A 3G2QA 3DVAB 4Z4CA 1QC5B 3U1VA 5KOHA 3TRDA 4BUCA 1MFPA 1HTTA 1YACA 4RY9A 2QLLA 5AW0A 3OTGA 3CA8A 1F60A 1FE8A 1RABA 2FFRA 4JX8A 3CVVA 3ROEA 4NH0A 4WBSA 2YS7A 4DQUA 2NT4A 4J3NA 5CK4A 2I66A 4PEVA 1KI6A 4UULA 2DEUA 3W3AA 5H83A 3ZY4A 4WESA 1RQPA 3BQNB 3K4HA 1YD7A 2YMMA 4D9IA 3C7DB 3ENZA 5HCIA 4H31A 3UN1A 1OILA 2QN1A 3TR5A 4K86A 5B58T 3DTVB 3DF9A 4N7JA 1DFIA 2IY9A 2EBFX 2WWYA 3F9CA 4R8SA 1B41A 3GLVA 2C9OA 3QUTA 5FA5A 3FPGA 1NVVR 1PNQA 221PA 4J0CA 1X7ZB 1E1KA 2ZBRA 3ZN2A 2O8DA 3VPXA 5AFSA 1UDWA 2N47A 2R8EA 1B00A 3G2MA 2AXNA 4BMYA 1NYTA 4L16A 2WFZA 3HKBB 4G0PA 3ZZUA 1NBWB 2CSUA 1E3DA 4AJIA 5ALWA 4HFNA 2O52A 4KACA 4NEQA 3ADPA 1KSJA 1HYEA 1T6YA 2B8NA 5JD5A 2ZSEA 3BMCB 1YFLA 1QGOA 3HKDA 3L6BA 4TL6A 5JV5A 3NS7A 1PRYA 5JD6A 4MQLA 4DB4A 4O2AB 3IHLA 1VB5A 4KAFA 4ZP1A 3DDOA 2C3YA 3DXXA 4G5HA 4AZ3B 4J75A 2D1YA 3I23A 3MXTA 3G5MA 3EQZA 3UQZA 3LOPA 4TXNA 1QAQA 3D4PA 3HZHA 5I3CA 1GAQA 4S1NA 4HFRA 2SBTA 2O8EA 4EYOA 2L18A 5F52A 1NYQA 3AEQA 3H2IA 2WAOA 1SC6A 4KN9S 3WS7A 1XEXB 5GV7A 3WYDA 1X15A 3FR7A 4LISA 5F78A 1E3JA 4LXHA 2IC5A 1QQ5A 4ZALA 4CT4B 2JJYA 3HDJA 1EVQA 1Z2EA 3CMMA 3FNBA 3FPAA 1HETA 4LJ4A 2FV8A 1Z7YA 2WTUA 4FI3C 4IKOA 1G19A 2H59A 3JRXA 3A9UA 1YRQA 1JIJA 1W8IA 1MJNA 1OIVA 4CTNA 1N1GA 3DW1X 1Y5NA 1GZVA 3D1VA 2ZE5A 5GMOA 2RAFA 4BGUA 4B3HA 2NT3A 3UPTA 2AOVA 1OFHA 3T0FA 3LCVB 1DNPA 1U2SA 2VG8A 1C2YA 4MGIR 1I4LD 1UBJS 4Q3DA 2K5UA 4EVSA 4F4JA 2CJPA 3QBVA 4FX2A 4KOAA 2QM0A 3OEYA 4U0JA 3T8YA 3TSYA 1FQOA 3B70A 3M0EA 1P5JA 3TTWA 5ICCA 5B2EA 2NXNA 4IGFA 3K0FA 4PAWA 3TM5A 5T7BA 1OLXA 4ECAA 1MX5A 4EX6A 2OZLB 6REQB 4JS0A 3BMNA 4QNRA 2D5BA 1HX7A 4L5YA 1OI2A 3PQ3A 3GFVA 4W1SA 3GLGA 1YB2A 2KB0A 3HMKA 3TF5A 1AC5A 4PFSA 3PFNA 4OB8A 3WTBA 1E3SA 5B4UA 2WPDA 3DL2A 5F7XA 3DVSX 4XZ3A 1Y3FE 1VP3A 3GLQA 2UKDA 3PUHA 2VSFA 4UHDA 4F1KA 2B1RA 1Z0UA 3M6MD 4E09A 5K8IA 2UUAB 3OUUA 1I13A 3N3AC 4FJ2A 1WSBA 1YL5A 1Z5OA 4MSUA 2R00A 3NXSA 2GCOA 5EZQA 4G5XA 1VPLA 4HWOA 2XA9A 4RFSB 1DBPA 4JLUA 3EYAA 1JKFA 2WOOA 2WZDA 1GA4A 5DHSA 3CLUC 1XXHB 4MR8A 1CY8A 5ITWA 2H65A 2XWQA 1T1RA 3GVCA 4DEXA 9GPBA 5HQ3B 3OPYI 5EMHA 2C0PA 4ARVA 1MO5A 4IGEA 4WY2A 3CUKA 3TTVA 2QTWB 4B4OA 3A1VA 4GBJA 2HUNA 3SU8A 2QQFA 1LXCA 1Z7GA 2AG6A 5ARCA 2RJNA 4PPGA 3UK2A 5ALJA 3WYBA 4F85A 4DRYA 3CISA 4OY3A 2VN8A 1UZNA 4M9SA 5CA1A 1W5AA 1ECBA 1XZPA 3FUCA 1FFWA 1JBEA 2QX4A 1RPZA 3CLRD 4X1KA 4JY7A 2TRSB 3LKVA 3P9YA 4F97A 3OKAA 3C39A 4XB6B 5HA5A 3TZCA 2H7VA 1PR4A 2ODEA 2WF7A 3ND9A 3CKMA 7ABPA 2ASEA 3AZPA 3LQ4A 2H54A 2X6TA 1EWQA 1FTYA 4YMUA 4D4IA 2Y1CA 1PQ4A 2GO1A 2CHVA 4DOMA 4GHWA 4D4HA 3I9KA 3EY9A 3NO4A 1AKYA 1W0KA 3WP0A 1OH8A 3HO1A 1MVOA 4E70A 1QV9A 1CV2A 5FNZA 3EX7C 3H1FA 2YICA 3H75A 3SC2A 1WIWA 4D9BA 1UJ6A 3PEEA 1FXSA 1MQAA 4BY9E 2E5WA 4KQ2A 3A1DA 1FFYA 1VG1A 2EGUA 4U6NA 4F5WA 4LQCA 2DTEA 1H6DA 4L3WA 3IALA 4B0OA 2GF2A 3CZMA 3NGLA 4EI2A 2P75A 3GJRA 4GXRA 2B25A 3FX2A 4U02A 3MB5A 4HAYA 3TXAA 5H3LA 3M82A 2XE4A 1K4YA 3BIJA 3KJZA 5H81A 1YQUA 2E5FA 2F3SA 1P9RA 4KFRA 4BTVA 2QAJA 3QPDA 4WNCA 1E79A 3DLPX 4Y2SA 3UF0A 4MMZB 4D9JA 4DQXA 4YT4A 1RFGE 2L82A 5F1YA 3SHOA 2SHKA 4JYZA 3BSWA 1KP3A 3S7ZA 2BBWA 3NAZA 1X2EA 3LUDA 3TZQA 4EG4A 4JHXA 3GJSA 3AV0B 2QR3A 3JZAA 5ALKA 1L4GA 4Z99A 5AI8A 3ZY6A 4B3DA 5DGCA 2PUGA 1L7PA 4Z0PA 1PVOA 2IPOA 3BH7A 1GRNA 5B30A 2ZZNA 4AJ4A 3D4IA 4GP6A 4XM2A 3SE7A 1WHTB 1VLQA 3FNHA 1LV7A 1DRVA 1GZ4A 2MSKA 3DGEC 3ETGA 4L85A 2O1WA 1JXQA 1NHGA 1S2MA 4LZOA 3TW6A 1JDTA 1MTZA 3SYKA 3CX3A 4MHSA 1BA2A 4OHZA 4C0SA 4MMXB 1R4MA 3AU8A 4RMJA 4P0TA 1WS6A 1IQRA 5HFNA 1MFZA 2JIZA 3MAGA 2YC2C 1VOTA 3P2OA 2XRZA 3WIOA 4HATA 4G37A 3AT1A 4KKVA 3A1SA 3WLSA 5CFLA 1RNLA 2XKAA 1P29A 2R8PA 2BEWA 3I6IA 4LI3X 4C0XA 4IDAA 3V97A 2HDHA 4CYMA 1EJ6A 4B3TB 4K6GA 1JA0A 2IZOA 1HKHA 3NZEA 5TVGA 3WGQA 4BC1A 4I0WB 1NVTA 1ZGGA 3GX1A 1JXOA 1NVUQ 1AD2A 5F35A 1GDHA 2FPLA 4KPGA 1YRYE 3VH4A 4MLZA 4MINA 5CUQA 3HFGA 3HLKA 1GOTA 3OICA 3D6MA 3SEAA 3O83A 3ZTTA 1SHJA 1ZEJA 2ST1A 3LQ2A 4G56A 2FI1A 4YA6A 1G9SA 2JJ1D 4GR4A 3ETHA 1NLUA 4H08A 3T41A 3KETA 3T95A 1C9NA 5CX1A 2D6FA 2YV4A 4KIGA 4EGSA 1KVTA 5JBQA 5CD9A 1NGSA 4A0HA 1PIWA 2I0FA 2OAGA 2PJZA 4U2DA 1OFIA 5EXPA 1U8EA 4AWXA 2BH9A 3GT4A 3TZLA 1BVYF 5E9JA 4YRJA 2BHNA 3PQEA 4P7FA 1JVBA 1XCOA 2C2OA 4MUXA 4KQJA 4NU8X 3V4VB 2E87A 2GPJA 2M1XA 4HLQB 1DAIA 1YJCA 1R9GA 2EJVA 3A37A 2BC9A 5CAEA 1EUQA 3MUFA 5L7YA 5MHTA 1CY1A 3MRTA 4IY1A 1F4VA 1FU4A 4KIUA 4AO8A 2FZWA 1XMPA 2TMYA 3PSHA 3QX9A 3DVAA 4BLUA 4QBTA 4OSOA 1JLSA 5K6RA 1P1IA 4M0MA 3KQUA 1FTQA 2Q1YA 1KERA 1E2BA 3L40A 4CLOA 4PO8A 3V48A 1MX9A 3T5TA 4GDFA 4N7MA 3E3OA 1M76A 1QTNA 4KO4S 1QNFA 3BGVA 4EY7A 1JU3A 4BNKA 4UTXA 4EL5A 1VPVA 2CHFA 2W6MA 1BH2A 2QZ4A 3E18A 4NZPA 5LUBA 4QU8A 3D8UA 3RHFA 3HVHA 3MGBA 2YKGA 3DOHA 2N3ZA 5DYWA 3OF3A 1JQ5A 3A26A 3P9QA 5BUCA 3CLTC 4QBKA 2CMHA 2QW1A 3P7MA 1O03A 1EU1A 1KI2A 3PNOA 3DFIA 1M73E 1RU3A 4QBFA 5P8WA 2G0TA 4A2PA 1QO7A 2OCAA 1NVAA 1YL6A 3HCBA 3PFBA 3REQA 1ZCFA 4C7MA 4CV1A 3TZEA 2Q6KA 5EIBC 2ZIFA 4S2UA 5CK5A 5K9ZA 2WPNA 4H27A 1C0LA 3QHAA 1DWPA 3KVNA 4PHGA 3M4YA 2VHVA 4JC0A 4O0MA 4WJZA 5HKLA 4PR3A 2VP4A 4RHCA 1BFKA 4Q4HA 1MAAA 2C4UA 1M72A 3PFCA 1DGQA 1KNQA 3WKEA 2Z8YM 3DAYA 1SBNE 3UPDA 4RY2A 3WLJA 3JQ7A 1P4JA 4EGJA 1ZD9A 4H35A 5IZCA 3EXFB 2EBWA 4A2QA 1JFSA 1WULS 2PA0A 4CUJA 5J59A 1E9RA 1AXRA 1RWKA 2QRMA 4JP3A 5C1DA 3MPOA 3T94A 4EJ0A 2B4TO 1NJGA 3DLBA 3IUYA 5JTTA 2ID9A 3GEBA 2OV3A 3BBLA 5E1MA 2PY6A 2Y67A 4D8WA 2KLBA 3TKYA 4Q12A 4DCNA 4IQ8A 4GRAA 4C0QC 1AQIA 1H6CA 3C85A 4HSEA 5G02A 4BNWA 4ZICA 3RUEA 4L95C 5DNVA 4B8WA 1TCBA 1ISRA 1LC0A 4M1QA 3DJFA 2CMKA 2JH8A 4HWKA 2I3GA 2ON6A 4EKIA 4BO5A 1QHYA 4D5EA 2F43B 2B6NA 5EMMA 1ODKA 3O7MA 3S1AB 1Z25A 2QLJA 2VAWA 3CEAA 2WD8A 4ONEA 2HHLA 5FR1A 3BJEA 4QQ8A 5KYUA 2O5RA 4GL2A 1E9FA 4V2UA 1ZU4A 1E2EA 5D5PA 3TINA 3VGJA 4J0HA 1E1RA 5E6SA 3BB3A 3A6HA 4Y1RB 1GG5A 3NR2A 4WQMA 2P79A 1G4HA 3OQJA 5CIYA 1YQ9A 4UXJA 2BR3A 4MV1A 3B9QA 3NM5A 1VYUA 1NURA 3SSOA 2XSZD 4UHKA 3F6EX 3HGQA 5AWFC 1HMPA 3U7GA 1NC3A 3BTUA 3UMCA 3GRFA 3HB9A 5BR7A 1U2ZA 1GEEA 1T1JA 1FFEA 4NJEB 4LFBB 2Y1KA 2I8LA 2OY0A 3HPRA 4DNFA 2XMSA 1V0JA 2NO5A 3EOZA 1E3LA 4J0FA 5BO5A 5DYNA 5JLAA 1Q7TA 1GCAA 1M5UA 1X1RA 2C9YA 1ORHA 3VZCA 4S04A 5FUXA 1C1XA 1ZLXA 3ZWMA 2BGTA 4FW9A 1RQXA 3FCYA 1U7WA 3NNDA 4LZWA 1KJYA 5AM3A 1XKXA 3OMXA 5FULA 3T5BA 4A1OA 3GGGA 3M89A 5ICEA 4BOYA 1R5NA 2NAPA 5ICMA 3DBHA 1WMSA 5AM5A 2XCRB 2AD1A 1E2UA 1Z18A 4XTCS 5D00A 3B82A 4PYKA 1T8SA 2FP3A 5AOBA 4FOOA 1RS0A 5DP1A 1I9CA 3ZHVA 4EG0A 3O4VA 4R1NA 5FPHA 3ZZTA 5A4DA 5IEJA 5CYGA 2VPWA 4OLBA 2PTHA 1WB4A 2NUPA 2WAAA 1KJNA 2Z9CA 2OTCA 1KQNA 1MNAA 3BQ9A 1OFTA 3I6BA 5AP9A 1GARA 4G5FA 1ZK4A 2ZR7A 3IBCA 5GONF 3LUCA 5DU2A 5ADWA 4ZGWA 4RKYA 1EMDA 3HUEA 5IM5A 3W3ZB 2W2NA 4TV9B 5FI3A 3QX7A 3ZU5A 2Q5FA 1FDWA 3UFXA 2CZGA 2QSYA 1IDN1 4IR7A 1CCWA 4LBWA 4MR9A 9LDBA 3ZVNA 2Q29A 1XL1A 4BFLA 1HLFA 2WDPA 1LTKA 1QH8B 2J8ZA 4II2A 3CC8A 5IW8A 5IXSA 3O4FA 5ILOA 5LBIA 3BK1A 4IEIA 1WWKA 1WDLA 3C7KA 1FX0A 3GAAA 3N74A 3SC3A 1ZD8A 1ZCJA 3TLZA 2PZMA 2Z4TA 3EW9A 1I6LA 1U3UA 3A8TA 4FWTA 3GYBA 4RIFA 1CDOA 4LCEA 2NVUB 1DAHA 3MS2A 4QASA 3BXFA 1Z47A 3O4IA 1HDOA 1O5IA 1SVLA 1ZWKA 3LCJA 1DT5A 2BDUA 2PDAA 4XUGB 1MOZA 1N7JA 2D74A 3U48A 3LT1A 4FNGA 3STUA 1B1CA 3AL3A 4V39A 3SKVA 3DHVA 4WOJA 1G59A 4YC7A 3A9WA 3LBFA 3KJIA 4NEGA 2HV8A 1QORA 1B0AA 3LL7A 3PDWA 2OGTA 4Q19A 2YL2A 1O54A 2P65A 5KOIA 4NARA 4YP9A 3MAAC 3E5HA 1I4DD 1KJIA 5DOZA 1JKJB 4AMGA 3EUFA 3I9LA 3EC1A 1F7VA 1NQ5A 5CCBA 4L51A 5CTAA 5I7SA 2G08A 4W5TA 1E89A 4H6VA 4EGFA 5BPFA 1G3MA 4NXNB 2ECKA 3HSSA 4DQ0A 3BFVA 4G0ZA 3B7WA 1RAIA 2GLTA 4Q37A 3DE5X 4YXWA 1C9DB 3A25A 4F5YA 1O0SA 4QEZA 3AXSA 4MA0A 1ZK0A 4ZEWA 3KQVA 3MN1A 1W4LA 1KZ4A 4OJQA 4WKPA 3W2FA 5L6MB 3ILHA 4BMZA 1X87A 3KKPA 5DBHX 1UBOS 3HUUA 3U4MA 1GRCA 2QN6A 5HR5A 4Z0HO 2B37A 4PAQA 4H6WA 1AQNA 3UWDA 1A95A 1FU8A 2ZBEA 2WNHA 1ZJJA 4AAYA 1JG6A 2LDXA 4S35A 4Y9RA 4B7AA 2VBGA 1O94D 1I2AA 1RI5A 2X3FA 3C3KA 3LY7A 3WL6A 3OOSA 4NCAA 1T91A 1HE8B 1EBBA 1HRDA 4N3AA 4TTQA 1GT91 2OGSA 1JG2A 3P5BA 3TO5A 4CMHA 3H5RA 4EAQA 5M04A 3N28A 1VA5A 3AC0A 3U81A 5I4BA 4PHTA 3JQ7B 2V6JA 3WE7A 2AGVA 2PT7A 3AUAA 1KOFA 2WU4A 3COVA 1THZA 2VZ9A 3ZW7A 3ZU3A 3L3BA 4I1VA 4BVFA 3ESAA 4BV9A 3IKVA 3MEQA 4BO3A 1JHXA 2H0AA 3CH7A 1IM8A 3L8DA 3DHEA 3FNRA 4UUMA 5HFAA 2PGXA 2C0QA 1WDTA 2WYHA 5ALLA 2M6KA 4CG1A 1YRWA 1YR1A 1QJ4A 2PWBA 3MWJA 4TMYA 5FL7D 3WO0A 4Z7NB 2HA2A 3D1LA 1U0SY 2X5NA 2AG1A 4XKJA 2DFKB 4FM9A 1PGNA 2H2GA 1W1WA 1J9GA 2OFPA 4QGHA 3GAZA 4DLPA 3QZUA 2LDBA 5JFGA 1Z26A 3FAKA 1U6KA 3VTZA 1QUEA 3T5MA 3QUQA 5ES3A 3M6XA 5EZYF 4IOLA 2GPWA 1UH5A 1S4QA 1D0VA 4YQYA 3MT8A 3O8NA 3ICEA 4TLDA 3ZQ6A 1K3TA 1JZQA 1Q15A 3QKSA 2D5CA 3TVTA 2D1QA 1V3TA 4BJ6A 3T9FA 1XEWX 3DQZA 5FJJA 3O7WA 3ZC3A 4YUVA 1ZK1A 5JSZB 2IUFA 1Z4IA 5GM2A 2R1ZA 3ZCQA 5JFOA 2BH2A 4W8OA 1B2RA 2QNRA 4I1RA 5FTMA 1B7GO 5A3VA 3F5MA 3KRTA 4D6XA 4D4JA 1VLMA 2CCKA 4ZA2A 5JR3A 4JUDX 2PZGA 5H80A 2QN2A 4UDNA 5T4BA 2ZSIA 3GJXC 1K8YB 1SXQA 2IHJA 3OLCX 1IATA 3LHKA 1I1QB 2D2EA 4XB1A 2ZAYA 1JE0A 1PVVA 2BL4A 1BA3A 2NNLD 1D1PA 2AG5A 1H42A 2Z1MA 3UHAA 3LLVA 5FFFA 4AROA 2GLUA 4PC3A 4P38A 1WPGA 1G55A 5WRFA 4JI4B 3L8FA 3HL4A 4AP6A 2QE7A 3GB9A 3NNNA 4IJ5A 1GZ6A 4KQ6A 2IP2A 2QX7A 4CCSA 5E9AA 5K2MA 4M37A 5EEGA 5FR2A 4NFSA 1FP2A 5KB3A 1GNTA 4MTLA 2IY7A 4N76A 4XYGA 4XQGA 2D0OB 4NVRA 1M2EA 4HAWA 2OESA 4RFVA 5B1IA 4ENUA 4L8WB 1Z8HA 4TGLA 1I51A 4NATA 4EFDA 4MYTA 3LWNA 2WKQA 5BNTA 4QPZA 1ELOA 1M2NA 4MAFA 4CR8A 1ZM4A 1PT8A 3WX0A 1VPWA 3IERA 2BHTA 3G88A 1M8FA 2GJSA 2C2XA 1K7FB 4KVFA 3JQ8B 5D3KA 3UAOA 1XHLA 3R7LA 1CR1A 1EWKA 1ODCA 5T6MA 1E3WA 2BSAA 2IYFA 3S68A 4CEIB 1A77A 2ZS7A 3CLTD 1OGJA 4MRNA 3WYGA 4W8HA 4E2XA 1XCMA 4ZREA 2W2KA 3H18A 2YQ4A 4GWLA 5DM1A 2QL9A 4PR0A 3CR3C 3W5HA 1LQUA 5AQEA 1G0OA 2WC1A 3DAPA 3EEOA 4RK1A 2VA9A 1V1RA 4E1AA 4KR6A 1TCUA 1QVVA 2WVHA 4I1YA 4RIGA 4H7IA 1ZSVA 4IIDA 1QCYA 3BPSA 1F8GA 2VT6A 5AOAA 5EQTA 5EWLB 4ZTZB 2ZU6A 4IIJB 5CBPA 1BU8A 5DEOA 3N7UA 4QEKA 1SN7A 2QX8A 1G63A 3KIPA 2XUDA 4Y1EA 2VQEB 2P2SA 4I4IA 3UMRA 2NZ2A 2GDZA 2R6DA 4G81A 4YRIA 1B8OA 2XQJA 3RIHA 2JPDA 2JRCA 3E70C 4H0CA 5AVZA 5L95A 1QRDA 4Q4HB 1MVNA 5DI3B 1Y6RA 2A0KA 2C4KA 3IESA 3BWCA 1V8OA 3AI1A 4X97A 3ZH9B 2X5JO 1IZ0A 1RHMA 4I5EA 2W6ZA 4GOND 5CGZA 5DN6D 5L8VA 2VZ0A 3ANMA 1XWFA 4Y9UA 3EIOA 5TSDA 3RBAA 4OIMA 1EX6A 2PSHA 4URHA 1WUJS 2WQ7A 4O4IB 3W3AD 3OTIA 2CCJA 3G0OA 2TMKA 3JASA 3ITEA 4Q1DA 3SFTA 4D6PA 3I1IA 3CH5A 4OXYA 3U09A 4F2HA 5LP1A 3L1IA 5DCYA 3GUVA 5ECWA 3DJYA 4NAVA 2WVAA 4X65B 2OV8A 421PA 1A5BB 1FVHA 3D3JA 2CXRA 2DG2A 4X8HA 3SQOA 5KSZA 2PUVA 3OIDA 3LA6A 3QIAA 1QIJA 3ZZ0A 4KUHA 5AVVA 1QM5A 1RCUA 4Y9DA 5K4GA 1T25A 4J6FA 4F56A 1D1SA 3BS4A 4WK2B 2PCLA 1DKUA 1V8FA 1RLTA 2OAP1 1E99A 4BP8A 4AG6A 1X8JA 2RK4A 1Q7RA 2JCBA 5EWMB 5LZ8A 2E85A 1TFRA 2R5FA 1L7AA 2XGSA 2A6PA 4KRFA 1P62B 4HXGA 2QRVB 1IWBB 3OO0A 2CDNA 2OM6A 2ZT6A 1GTJ1 2B61A 2XUAA 3MBKA 2VYVD 4WN3A 1UM9B 5IABA 1QIHA 3QW4B 2HLHA 3L7JA 2IZ7A 3D7KA 2VDOB 4H3VA 1JQAA 3Q3EA 4R7ZA 3RREA 4ASUA 2O14A 3FMIA 4L15A 2X23A 2VC2B 3NRCA 4KX3A 5IN5A 1T5LA 1M6EX 4D3SA 2NUPB 1T3TA 4DAEA 1DG3A 4JUFA 4YCSA 3U60B 1EXNA 1HL7A 3FWHA 1JAIA 2AOUA 3LXUX 3P0RA 4ZVSA 4DLSA 4CF7A 5AVYA 1WBDA 4RD0A 2YV3A 3JWHA 2ZIGA 3D0OA 1TAQA 3D64A 3RS0A 1I36A 3H5NA 4RJJA 4JVSB 1HYBA 5I7AA 1QH1B 4LJ7A 3I5MA 3T9AA 4CLHA 5KOJA 3HN2A 2PNJA 1U0HC 1NF2A 2P6MA 2X41A 3BJRA 3CSUA 3UOWA 5KTKA 4TN5A 2PMEA 1JIQA 1K7YA 1VE7A 3C6XA 2GERA 4WERA 1E6CA 2V7XA 3U4AA 5T8KA 2FX3A 3DE6X 2XNHA 2FUG6 5HE9A 2B92A 4HDKB 4ZGGA 4YV7A 5AD1A 2VJYA 3PWTA 3N0WA 3AVQA 4MQUA 4HN4B 5KOHB 5JYDA 5H68A 3VI4B 4GMXA 4IILA 4MW0A 1XRMA 3DP9A 4XH9B 2HUPA 3RIGA 1BEEA 4ZVQA 3W4IA 4E4RA 1NBAA 4YRPA 4M1EA 2XSZA 1CJUC 4IJWA 5M3BA 3LRPA 4MWZA 5ALSA 3KU1A 4GO1A 5IPFA 4XAQA 2QAGC 3I04M 3R7WB 3K4QA 3AETB 4I5GA 5CXSA 4QDZA 1GGEA 3WNVA 2X77A 5E4JA 4K03A 4C21A 1RYBA 5IH7A 3TYXA 4PV7A 4WW0A 3F4BA 1FX0B 1PW7A 3IBFA 5EE9A 2IW1A 2C95A 1UKBA 4DIUA 1HQYE 3KTFA 1DIRA 4Q00A 4UHEA 2ZIWB 4DNPA 4YI5A 4RADA 1HL3A 4NC9A 5GJVC 4ZFNA 3H1GA 5J23A 2YVUA 5BOSA 2R6ZA 3AUUA 2ZRPA 4HDSB 4B9EA 4ED9A 5K0SA 1UJCA 2H00A 2QUAA 5AJWA 1NULA 3SZUA 5A7FA 5LIRA 2G3YA 1FFCA 1KSFX 1R10A 3FVVA 2BMDA 1U81A 2QOEA 3G6KA 3H9CA 4LYHA 2ZJYA 3FG9A 3R7DA 2JKZA 5CDUA 4RZHA 3FTPA 3OESA 5EQDA 4M46A 5D7NA 4B83A 4BLPA 2UYYA 3TNLA 4RPIA 1KY5A 2X40A 5B37A 5ALMA 2EFJA 4CI0B 2O8CB 5A5GA 3VM6A 3X2EA 3TNFA 1OY1A 2IEAA 1NN5A 4LRTB 5DW3A 3UB4A 2WSSD 1ZD3A 3MJEA 5KNCA 2RI6A 5B3JA 3UZUA 1N2CA 2DLDA 3OZSA 4JSYA 4ND8A 3ROXA 4NTZA 4AZWA 2I6TA 4W6QA 1CY7A 1WABA 1OAKA 1DJPA 4ZQGA 2ONKA 5HF5A 1D5CA 1U8ZA 5AH0A 4HMPA 3PDUA 5K6TA 4TZ6A 2IP1A 1C4OA 1SOAA 2C4VA 2CNWA 2NZXA 4IJUA 1C30B 4IRMA 4OQXA 3RUAA 1MMFB 1B1AA 1PU2A 2NACA 2P9QA 3FLEA 4GYYA 3DWEX 4MVJH 4BFCA 4EG5A 2ET6A 2O2ZA 4KQCA 3R8CA 1KAMA 2DE0X 2Y3IA 2E4WA 4XJXA 5T64A 4MYHA 3T3GA 4HNGA 1NW9B 2Z58A 3V1TC 5H3HA 1R0KA 4DLBA 3QXHA 5HP4A 1SD1A 5K1ZA 3CZQA 4R51A 2JFQA 1T6XA 3R5XA 3SZMA 5IUNC 3QEKA 1XFDA 1QX3A 1YUNA 4C4AA 4PLYA 2J9FA 1COWA 1XZCA 2V6GA 3RTBA 4F38A 2BLNA 2X6RA 2Q0QA 2GMWA 4IFBA 2C1XA 2BMWA 5EIOA 2G70A 1G2QA 4QO7A 2V3WA 4KXYA 2B2XA 5B4VA 2R7KA 1KIMA 3C3PA 5THXA 4AJLA 2XTJA 1GKYA 2AMYA 3R3HA 5JLJA 4C0HA 1DUIA 3U7JA 3KCQA 1K1EA 1MA3A 2H1OA 2DB3A 4F3KA 2VYND 1D9ZA 1XAJA 2MT9A 4DXAA 3UGKA 3VTKA 2WZCA 1V4NA 3BF8A 2IHTA 3BH6A 4HPJB 3VNQA 2HCTA 1VHLA 2AFHE 3U9SA 2H1HA 4ND5A 4S24A 1YZNA 2YY5A 3IURA 2G4LA 2NO6A 3PHJA 1APBA 3TDKA 1UOPA 4GBGA 2QVGA 3UT0A 2E55A 8OHMA 1PX0A 2BGNA 4PX5A 1KQFA 3EY4A 2BMFA 4KYTA 5FOXA 1EFCA 3VR4H 2CT8A 1PWYE 1R6VA 3N2EA 4ABYA 3Q8XB 3H8JA 2OO3A 2VJNA 1Z28A 3OEED 2VRBA 1QTIA 2BJWA 3Q6MA 4HX5A 3HM9A 2Q3DA 5I9MA 4MRSA 3F74A 3I2YX 4GPAA 1IHUA 2PKYX 3PNKA 3KB8A 4HB0A 1YR2A 3BTSA 5DNEA 2WM3A 4NESA 1JKMA 3HY4A 3Q5EA 1U2GC 2I5PO 2MSNA 4MAMA 1KK1A 1GYQA 4N3CA 4PC7A 5ADHA 2QUBA 5HW0A 1WSWA 1U80A 2WIGA 2QL7A 3QPVA 3Q3JB 4GE3A 4AVYA 5HTOA 2HIHA 1DARA 2W2OA 1CC1S 1N2IA 3TL6A 4BJ3A 3IEIA 3PFHA 5JROA 2Q0XA 3MTQA 3TN7A 3QVTA 4OO3A 3VI3B 3I05A 2Z57A 5CLLA 1CHNA 4WZZA 2E1PA 4ZCRA 3FUVA 2RGEA 4UPDA 2GN6A 1TKAA 3RFXA 4FDMA 3A4MA 3WL3A 3F3KA 1J97A 1QFSA 2EYUA 5HKKD 4M55A 5A9TA 1K5HA 2FDXA 2H63A 2P5UA 2IPLA 5DULA 3WGZA 1ZUD1 3FKQA 3L07A 1VE1A 2G5CA 2R8RA 3CU5A 1OLSA 4OQPA 3QU4A 2JK1A 1FNSA 3PUVA 4R81A 1KFCB 2YWRA 1XPJA 3QEMA 1I4WA 2HMAA 1SO8A 3FZQA 3GHYA 2IH4A 1TYBE 3NMUF 2PXXA 3FTDA 5J2UA 2ES4A 2X1HA 2HLDD 1JAXA 2O7SA 1PL0A 3IOBA 5C7LO 4H4DA 5ULLA 3UA3A 4N0PA 3FSGD 4JR0A 5D5HA 4KLZA 3P2YA 2EQAA 1I0ZA 1SM4A 2FF7A 2JGRA 3ASZA 1SC3A 4REOA 1EFVB 2AEFA 1F06A 2H4ZA 1LWNA 3H2HA 1A9YA 5JO9A 4UHFA 5KPDA 1A69A 2JD0A 3NQ41 2CUNA 1Z2PX 3TEFA 1N2BA 2YWHA 3LDGA 1DBRA 1VJDA 1LLFA 1YXMA 4RESA 3RSZA 3U7QA 1EVEA 1KO4A 1XEAA 1STOA 5E7QA 1CQIB 3G82C 1R6AA 1KKLA 4OH7A 3HZOA 2WFAA 4ALIA 1ZFNA 4IMJB 4P5DA 1XRRA 3ADOA 2GRUA 2P2NA 3HCRA 4I3FA 2OCDA 2X0DA 3UAWA 2HT6A 4AKEA 3M49A 4HXEB 1JEAA 3ZDQA 4HNVA 2F8MA 3ABOB 5HUQA 1C41A 3QTTA 1KC3A 1P81A 4QHYA 3TQHA 3LFTA 2D1RA 4BMXA 2R4UA 1VKOA 1CUVA 5BRNA 2J67A 3CNQS 5ES4B 4BMCA 4LF4B 3OZCA 3UK6A 3TNYA 13PKA 5CFPA 1WXIA 1T4CB 1TEXA 2IKSA 2B4QA 4F2WA 2PS0A 1QONA 1I1NA 1ATIA 3A9TA 3VTAA 1Q84A 3R8FA 3GD5A 4D0GA 4YNBA 1O95D 4BVBA 5KTNA 5KMGB 2P2LA 5LXTF 4OBBA 1HDZA 2WHRA 1OZHA 3I72A 3CJTA 1N9GA 3EPJA 3BX1A 1LEHA 1OLUA 1THMA 3EZ6A 3UUWA 4CWAA 1E1CA 5TPZD 4AG5A 1MEJA 5EKTA 1NXXA 1V48A 2AN3A 4GWKA 3ILYA 3U9TA 4KDRA 2VLIA 4AF8A 4GPTA 2DSNA 1G291 1YRBA 3DKPA 4HYTA 4Z53A 1M2GA 2MR6A 2WJ6A 4KR2A 5JWHA 4LDNA 3V1LA 2ZIZA 5BR4A 3JALB 2ZOSA 4LF8B 1PJLA 4NH4A 4UE2A 2B4RO 2A59A 3OZTA 4MLCA 5ENDA 5IMBA 5HZGA 2A0XA 4BNXA 2PGIA 4J03A 3W6PA 1K2VN 1S02A 2HR1A 3IRVA 3TEMA 2HJVA 4LMAA 3SQDA 4AM8A 2C3OA 2Q0HA 2VAMA 3FHJA 5INTA 3OQVA 5A3JA 2CFTA 3EVCA 1YHZA 4QFMA 4WECA 2XE6A 4CTMA 3QWBA 1MC8A 3U80A 1FLVA 3WZLA 4M53A 3GUCA 1HDCA 1SCQA 3PUIA 1J00A 1AKQA 5I9SA 3B1VA 3TNJA 1SBYA 4RK7A 5LP6A 2FSIA 3LBNA 3INNA 3MQ4A 3RV4A 3FCOA 2CLIB 1BOOA 3HN7A 4IP0A 3SSMA 1JR3D 3TAHA 5F4ZA 3D4BA 2WIDA 1KI8A 3ROFA 5IG2A 5IKPA 4WKBA 1IAVA 1E4YA 2J32A 1DKOA 2WSIA 4LDQA 3WBBA 4B6JA 2A5DA 4FSDA 2PSJA 4KPEC 1VPTA 2O57A 3LW8A 3ZVRA 4CCYA 1XZAA 2ZWMA 3QVWA 3B20A 5EEHA 1JJAA 1QFZA 1YK0A 4Q3KA 2E7ZA 3QMVA 3ENQA 4LPSA 2K4MA 1AUPA 3BXEA 5KX5B 1F5NA 1YIDA 4RK6A 3KR1A 3ZHTA 1K8QA 3JQRA