4CLXA

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
267
structure length
251
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTERIDINE REDUCTASE 1
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
total genus 96
structure length 251
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4clxA00
4YRAA 3UFXA 3NT5A 3E9NA 1PJ2A 3TSCA 3ONFA 4FR5A 2C07A 3KHUA 1PJQA 5IN4A 5KJFA 4MVJF 4P4NA 1E77A 5IF3A 3TOXA 5IXYA 4W4TA 1X1EA 3TPCA 3OHSX 1B14A 3IS3A 3BHMA 5CPBA 4J9UE 2GD1O 2RIRA 2NVBA 3IP1A 3K8ZA 3H5AA 4GX1A 1P33A 1GEEA 2Y93A 3IMFA 2VWPA 4URFA 4GVLA 3ZV5A 3NKLA 1WNTA 3KLPX 4JLWA 4JXKA 4FCCA 2CDCA 4UVDA 4UVHA 4P8RA 4AJ2A 4E3ZA 1E7SA 1Q7CA 3GDFA 1E1KA 5K6AC 1WZIA 2AHRA 4BNKA 2O4UX 5T67A 1XYGA 2WM3A 4M8SA 3IKVA 3MJTA 1R66A 3ZV3A 1YBVA 4XWYA 2O3QA 3H3JA 4N7RA 1PQWA 2JL1A 4BL5A 1TT7A 1IOLA 4Y9DA 1WVGA 2WEKA 4CQLB 5TF4A 1GL3A 4GX5A 5IDQA 1V8BA 2H1SA 3V8BA 2PNFA 4DPMA 3LK7A 3MWDB 1IPEA 1EQUA 1UDCA 1BDBA 2HJRA 5JAZA 1JU9A 4GMGA 1N7GA 4OM8A 1B8PA 5T8KA 5A5EA 1VLLA 1XELA 2X22A 1FJHA 1QG6A 1NVMB 1ZSVA 1ISMA 3WNQA 3ADOA 5AVOA 4BO4A 3NT2A 3JQCA 3C1AA 4O63O 3GY0A 3R6DA 3VPFA 3OEWA 3HDQA 1BXGA 4OO3A 3WG9A 4B4WA 3CKYA 1G6KA 3GVCA 2NTVA 4DYDA 2LDXA 2OUIA 1BW9A 1V0JA 3DTTA 1MUUA 1I0ZA 3T7CA 5A3JA 3HB4X 4FGWA 3DBLA 5KCZA 1KETA 3I4FA 5BSFA 2ZTVA 3ADPA 4FFRA 4ND2A 1YBMA 3LQFA 3ZN2A 3KBOA 1BDMA 1LUAA 3ZWCA 4B4VA 3ZNNA 4L0QA 1DFHA 1IHYA 3BAZA 4GLLA 4QTZA 4JCOA 5JAIA 3ORFA 3DZKA 1R12A 4CM8B 4Z9YA 1KVUA 1YWGO 1U9JA 5IAAA 5G0UA 2B0JA 1FDVA 4YT8A 4G65A 4FOOA 5EERA 1XU7A 5U9CA 3BMOB 4QUKA 5L9AA 1XHLA 2Z5LA 3AWDA 5F5LA 1SBYA 4IM7A 1R15A 2TMGA 1N92A 3RBVA 4NQZA 1O95A 5IDWA 2ZK7A 5G2OA 5IZCA 4D3SA 3FNEA 4O1MA 5GY7A 1VJ0A 4BKRA 3NAQA 4I9UA 1YE3A 2B4RO 5ICSA 3SJ7A 1K6IA 3GQVA 4LSMA 4P4LA 6LDHA 1ENOA 3R3JA 3E8XA 2ZCVA 3EZYA 3WBFA 2FMUA 1O9BA 4KDFA 4R16A 4XRGA 1ZXLA 3EYWA 1YJQA 3C3XA 5DULA 2ILTA 5AQ1A 3OH8A 3TJRA 3F5SA 3JQBA 2ZCUA 5TT1A 2EERA 1DO8A 3V2HA 2D3TA 4ZN6A 4K6FA 3DMYA 4BO7A 3H3FA 5CEFA 3ZWPA 3BXXA 1OC4A 2IEDA 4D42A 1QLJA 1WAMA 4PZDA 4NNJA 4Y67A 1LDEA 4BNVA 2Q2QA 5CDSA 4DTIA 2CY0A 3AW9A 3MZ0A 3DR3A 1A4IA 3FBTA 1Q0HA 1YL7A 2WDZA 1M67A 3OJ0A 4FPXA 4IBOA 4XCVA 4DXHA 2Y0CA 1NR1A 3S1LA 3VC7A 2XXJA 3FHLA 3UCFA 5KIAA 1F8GA 3JQFA 4MVJG 2YDYA 4BNMA 4YB8A 3SEFA 2Y68A 5THQA 1MG0A 3DBHB 2D5CA 2E6UX 1R0LA 1LQTA 4S1VA 1EUZA 4BO8A 3AY6A 5H81A 4MJLA 3TL2A 1Z73A 4I1IA 4NDNE 3U4CA 3QQPA 5ENVA 4ID9A 5GZ6A 4HP8A 1P74A 4EUEA 4PN3A 1MLDA 1B3BA 3CXRA 3E48A 3WTCA 4BIIA 3W6ZA 2AMFA 1HZZA 2EP5A 3RFTA 1JWBB 2CVOA 3DZIA 1ONPA 3IDSA 4I8XA 3A28A 1ZFNA 4J16A 9LDTA 4N5LA 1TT5A 4BOYA 5KVCA 3QWFA 2HDHA 2P5UA 4WLUA 1HRDA 4CJXA 3PDUA 1LRLA 5JCJD 1QRRA 3KSZO 5KOIA 1NAHA 1D8AA 3GVHA 4J1QA 4R9SA 4CM7A 2AQ8A 3EGOA 4YRBA 4PG6A 3JQ8B 3DOCA 4A2CA 1ISIA 4BNWA 1BSVA 2GR9A 3BMQB 2B4TO 3NDRA 2Y1CA 4GLOA 4CMEA 2O3JA 2GYYA 2VHZA 4M55A 1LRKA 4L4XA 4K9DA 1HDCA 4WLVA 3C1OA 3KSDO 1U3WA 2E4AA 3WR5A 4KUGA 1BVUA 2BGLA 3ZV4A 1EFLA 2BI7A 1E3JA 3DHEA 3IUSA 3JD3A 3QWHA 4RF3A 3FTPA 4IJVA 4XQEA 2D4AA 4ZU3A 3KB6A 3NEPX 3WJAA 1E1NA 3ZZNA 5DP1A 1T1SA 5L53A 4J91A 3ZU4A 1DC3A 5ENDA 1GUZA 1C3VA 2X9VA 3QSGA 4UUNA 4R1UA 3TZHA 1PWZA 3WGIA 1KS9A 1LU9A 1O5IA 1C1DB 2VT2A 4D0RA 3D3WA 3IOYA 4DLBA 4R51A 1H2HA 3AM5A 5HS6A 1I3LA 4W99A 3GNQA 1GR0A 4WLEA 3JYNA 3AUTA 3MWEB 4CM9D 4J0EA 3AY3A 2FR8A 1BTOA 2YW9A 4IIVA 1QKIA 1EQ2A 2J5KA 3PGXA 2QG4A 4KDEA 3RVDA 1NQAO 4E5MA 4L73A 4TKLA 3GPDG 4K26A 4GGOA 2Y1GA 4Z9XA 3D4PA 4PLFA 1NBOA 2JAPA 2CD9A 1V3VA 2CUKA 4ZVVA 4YT2A 1SOVA 3I1JA 5KVQA 4XYGA 1UXJA 1TLTA 1YOVA 1N5DA 1IYZA 4BNTA 1XCBA 4MP3A 4RVDA 5JDIC 4MVJI 4J49A 3ZNPA 1N1GA 1GY8A 4U6SA 2V6FA 2X6TA 3KYCB 1MFZA 1X13A 4BGEA 1YH3A 2DU8A 4ZQFA 3UW3A 4IDBA 4D45A 1KEPA 5EQDA 4YAGA 4HFNA 1PEDA 3AM4A 1T4DA 3U5TA 1DRWA 1E3SA 2X4GA 5LC1A 1VKNA 1XKQA 2FSSA 3BTUA 2I65A 1WLYA 1NFFA 3GH3A 4IJUA 3QW2A 1DLJA 1PJCA 4WJZA 1GADO 4LRTB 1UAYA 1GUFA 5G4KA 2UUPA 1NYTA 1PR9A 2R2GA 5AXDA 5IXSA 5G0SA 5ILOA 4HNHA 5JNLA 4D44A 2O3SA 3I6QA 1GZ3A 3LU1A 1ZMOA 4ZQEA 1EEHA 1ISHA 4AG3A 3NX4A 3AOEC 4XA8A 1UXHA 3UF0A 5TJ9A 4E21A 1IHXA 2YHIA 3F47A 1HDZA 3B20A 2OZPA 4HADA 2HUNA 1T1RA 4W7HA 3KYBA 4ILKA 1DEHA 2HJSA 1F8FA 3DAFA 4AJLA 4GVXA 3IC5A 1P0FA 2ZQYA 3LVFO 2GN4A 3PWKA 3QJ5A 4D43A 1U3VA 3DZHA 2EG9A 4E30A 1A7KA 1RWBA 1LLDA 4EW6A 4G2NA 5IJZA 4OYRA 5DOZA 1BVRA 3V1UA 4CM4A 3AI1A 4BGVA 4RVSA 5A5FA 1YQDA 2P4HX 4O59O 2ZQZA 5COAA 3TZQA 2GZ1A 4LK3A 2EW2A 3H7AA 3GN2A 1P1JA 4BKQA 2O3RA 1Z7BA 2X0RA 4H15A 4MIYA 1U5AA 4IDEA 1PZEA 4CLEA 2FPGA 1E7QA 3GOHA 6ADHA 1P45A 1Y8QB 5FEUA 2VTEA 4ND4A 4PFJA 2Y66A 1HTBA 2RBEA 2EJWA 4YA6A 4PG8A 4OOFA 1EVJA 3VH4A 2NACA 4QQRA 2QW8A 2Y1EA 4NFSA 3W6UA 2EXXA 2WYVA 3C85A 3GNSA 4RL6A 1GFSA 4XJSA 5BSGA 1H9AA 1GV1A 4HUJA 5DCYA 1PGOA 3KZVA 1VM6A 1Q7BA 4R3WA 3KOUA 1WP4A 1LC0A 1XLTA 2VNAA 1P9LA 1M66A 1Q7GA 3BZUA 3MJEA 4EI2A 4LN1A 4J1SA 4TSKA 4GL4A 2DBVO 3CTMA 2HQ1A 2Y1DA 2NTJA 5COBA 4BB6A 1HWYA 3PJFA 1V35A 4DC1A 2O7SA 4QX6A 2ZB3A 1ZK1A 1JAXA 2VRCA 1ZH8A 2NTNA 1SB8A 4GBJA 4NHEA 4CQLA 2DTEA 4LVCA 3U4IA 1M75A 5CHEA 3LLSA 1J4AA 1NPTO 2AG5A 3LDHA 4Z9FA 5I7EA 3DBRB 3NUGA 4IQ8A 3L4SO 3SLKA 1X0XA 1HKUA 3WIDA 3K6JA 5IG2A 1LDMA 1L1FA 1F0YA 4BV9A 4EEXA 4BO0A 1ZIDA 2QHXA 2AA3A 3WGZA 2FZEA 4Y8VA 1RYDA 1Z7EA 5BNIA 3KRTA 5A02A 1U7HA 4RPLA 5TJHA 1W6UA 2CVQA 4U5QA 1SCUA 2IEBA 3RAJA 2B83A 4FD3A 1PTJA 1GZ4A 1VKOA 1EVZA 1WDKA 2FN7A 3KEOA 4L75A 3VPXA 4IS3A 1I2ZA 2BKAA 1N2SA 4IDAA 2DBZA 4E13A 3GVIA 2EEZA 3HDYA 4RQTA 1CWUA 3L6OO 1X7HA 4N5MA 1B26A 2B36A 1LJ8A 3W4KA 3P2YA 2YZ7A 4AJPA 3QVSA 2E37A 4PZCA 3BTVA 4NPCA 2J3HA 3ONDA 3JQAB 1E6WA 2GLXA 2PTGA 1U2DA 3E03A 2OO5A 4QT0A 1DC5A 4XIYA 5DOVA 4WCDA 4PG5A 1PSDA 3IKTA 3O26A 4L76A 2ZTMA 1DRVA 5FI5A 4FC6A 1TVEA 4CM8A 2PY6A 3C7CB 3H5RA 2W98A 1QXSA 3H65A 2EKQA 1AGNA 4GH5A 2C0CA 5EMHA 4CUJA 1QLHA 3KV3O 3H9EO 3RQSA 4AJNA 2Y0DA 3BMOA 3WQRA 4B4OA 5JC1A 3JQEA 3S2EA 2UUOA 1U7TA 2JAHA 3DB2A 3CUKA 4ND3A 5L4SA 2O3UA 3RWBA 5KTKA 3FF4A 4IPTA 3AUAA 1LSJA 3IIEA 3EW7A 3GZNB 4TQGA 1UDBA 3VH2A 3M2PA 2Z95A 4HWKA 5U1PA 1T2AA 3UUWA 2D0IA 1DAOA 1WXDA 5KWEA 3GLQA 3PVZA 5JDIA 4BNIA 3IL2A 2DFDA 4CMGA 3FRJA 1DAPA 1PQPA 2X0JA 3GA0A 4JBIA 3TZKA 3D0OA 3VPSA 5TT0A 4RLHA 1HETA 2IXAA 3ZWMA 2V7PA 5KKAA 3GFGA 4C7JA 4L4SA 4D7AA 3HUDA 1UDAA 3FPCA 4NK4A 4HFRA 4ND1A 1PJBA 4BNUA 1IB6A 1ULUA 3WQSB 4N54A 1R4MB 3LSYA 4LW8A 2WYUA 3VZQA 2X58A 2VHWA 4IIUA 2AE2A 4BO3A 3ZU3A 1H93A 1R4NB 3WGHA 1LXCA 1YO6A 2CNBA 2ZTLA 2OBYA 3V5NA 5A03A 2C2YA 3DBHA 4HXYA 4LMRA 3INTA 4R41A 3WTBA 4CV1A 3ZGYA 1T25A 2YDXA 3DEYX 3OQ6A 4ITUA 5TNXA 5CAEA 2NSDA 2Y1FA 2R00C 3K92A 2EGGA 2Y99A 4KQWA 1T2EA 2BH9A 4YAIA 1ONNA 3DMTA 3JQ9C 3ULKA 5ADHA 1HDXA 4Z3DA 1VJTA 3PFFA 3EVNA 4OIMA 3T7EA 3ZWBA 1AXGA 1VE9A 2NU9A 4MO2A 1OC2A 5KJ6A 1SMKA 2GPTA 1I36A 1EE9A 3BTSA 3EK2A 2Y1OA 1AHIA 3E5MA 4NJOA 1YDEA 3RC9A 4CR6A 1A5ZA 3P5SA 3PEFA 2GF2A 4MVJM 1JQBA 3NTRA 1LSUA 5L51A 2W90A 2DKNA 5JC8A 3GG2A 3G17A 3PK0A 3P2OA 2GGSA 3MOGA 3U4HA 1TA4A 4MKXA 3F6YA 3JQ8A 2AEJA 3JQ7B 1FXSA 4EYEA 1O8CA 1HL3A 2FPIA 3BMQA 1ENYA 1DDOA 5I9LA 3TQHA 3DOJA 4RGBA 2BFAA 1IUKA 4RJTA 2BLLA 1ZW1A 4PLTA 4KQXA 3GZ4A 1ID1A 2EHDA 1YKFA 5F3RA 3AY7A 1XWFA 4YJHB 5JFOA 1UXGA 1O89A 3COSA 1E0DA 2P5YA 3INRA 4JP3A 4PGFA 1SC6A 8ADHA 1H6CA 4XQGA 2DAPA 5IDYA 1SZJG 2YY7A 4G5HA 4XZ3A 4RVUA 4OQZA 3HHPA 4KOAA 3HADA 3WICA 4E12A 3HQ4O 3GMDA 4OKIA 4XEHA 1NNUA 1CF2O 4BKOA 5CDYA 4R9RA 2VUUA 4WCFB 4ZQHA 4WEQA 5T64A 4NU6A 1V9LA 1PGJA 1ORRA 4OMUA 5IN5A 1DHRA 4CM3A 2FR0A 1C1DA 4EJ0A 1GPDG 2Q46A 3DONA 1Z82A 1ISFA 3UCEA 4CQMB 4F3YA 4D79A 1JWAB 1SEPA 1NXQA 3HB5X 1JVBA 3ZWVA 4L8VA 1EE2A 3NYWA 1G0OA 1O94A 3W4JA 2NADA 2EKPA 1QYDA 1XA0A 3D64A 1I2BA 4E2XA 1EUCA 3NJ8A 4U0KA 1I10A 1G0NA 4UEJA 5T5QA 1E7WA 1RKXA 2JFHA 4BO9A 2EJVA 3HDJA 2O4CA 4BNGA 3DZJA 4ZD6A 4UAGA 1CDOA 4NBVA 4YEDA 3GGGA 2C29D 1LI4A 5U4QA 3RUDA 1LDYA 2EP7A 3Q2KA 3IJRA 4DIBA 4I08A 4IJWA 1EDZA 2YUTA 3OIDA 2EKLA 3F1LA 2D1YA 4B3HA 3LT2A 3F1KA 5EESA 3WS7A 4GPD1 1WPQA 1PX0A 4YDRA 4CMIB 1DIRA 4D46A 3KYCA 4O5OA 1ARZA 2QZ9A 4Q39A 4CPDA 2TMDA 1CRWG 4TZTA 2DBRA 3M1LA 2VUTA 1HLPA 3Q3CA 3RUFA 2CDBA 4M1QA 3W8DA 4I5FA 4YYZA 3U09A 5TS3A 2J6IA 1LBEA 1EFKA 4B3IA 1X0VA 3ZWWA 4XGKA 2X5OA 1V3UA 4WLNA 2Q49A 3PWSA 5B4VA 1MC4A 3DFUA 3I9MA 1SO8A 4EDFA 3JQ6A 1PWXA 5EL0A 4EGFA 3L9XA 2CF5A 1Y8RB 4E5PA 1KVSA 3PI7A 1Y6JA 3ENNA 4RO0A 3PJDA 4XYBA 1ML3A 3FBGA 4CM1A 4F6CA 4TWRA 2IZZA 3VPGA 4J90A 1ZNQO 4BO6A 5L7TA 4A7PA 2A9FA 3MTJA 3N7UA 4B7XA 1I3MA 4UVIA 2FSVA 3O4RA 1N9GB 2HAEA 2NM0A 4J6FA 1NM5A 3ROQA 3WSWA 3UCXA 5MDHA 1JKIA 4NBTA 5I7FA 4Z0PA 3DZBA 3CZMA 1H94A 2YQ5A 4XKJA 2UAGA 1A9YA 3DZGA 3FPLA 3IP3A 1KERA 3W8FA 3ZV6A 5K0ZA 4GKBA 2WD8A 1BXZA 4IGEA 3JYPA 3PLNA 3PHHA 2RHCA 4DIFA 1B16A 3RU7A 4BNLA 1CIVA 2P4QA 4JNKA 4BMSA 4PZEA 4FFMA 3C1TA 1E6EA 3WWYA 5L40A 3SVTA 1GQ2A 1MGOA 2Q1SA 2RH4A 4M87A 1S7CA 3DAGA 5JPIA 2EWMA 3PYXA 2IDZA 4Q3NA 4DLAA 1Y8QA 2PD3A 4EITA 2VT3A 3NJ4A 4CLRB 1CYDA 1T26A 1VL6A 3GPIA 4FQ8A 4ONEA 1H0KA 2V65A 3AOGA 1LSSA 1RYEA 3OMLA 4JROA 4NIMA 4YJDA 5JDCC 4OXYA 4EZBA 2C7VA 2I76A 4EUFA 5BR7A 1H9BA 3DXFA 3WGQA 4ZJUA 1VL8A 3CMMA 3RC1A 3G1TA 4WCFC 1ENPA 3E1KA 3B1KA 4NJMB 4CLHA 4Z6KA 3RI3A 3OEYA 1XEAA 3NGXA 2HSDA 4BNZA 1XQ1A 4JP2A 1ADCA 1PS8A 1AHHA 3TDKA 4MVJE 4GMFA 4IQGA 2NU7A 2WWRA 2HU2A 4JIGA 2XF8A 1KIFA 1D7OA 1H2BA 5KJCA 5A9TA 7MDHA 5HBRA 3VKVA 4J7XA 3JQ9A 1O0SA 1PJ4A 3QWBA 2VWGA 3U49A 1SOWA 3MTGA 4KTTE 5LDGA 3JCZA 2FHSA 2ET6A 2JCXA 1C0PA 4P38A 3JD0A 3PQEA 5F21A 4C4OA 3UAGA 1Z74A 1F17A 3DBRA 4NFYA 1DB3A 2DVMA 2WD7B 4W9NA 3HFGA 1DRUA 4EEZA 3RUHA 3INGA 1LC3A 1I3NA 2XOXA 3KM0A 1PU2A 4WLOA 2I5PO 2VRCD 3AFMA 1GAEO 4B7CA 4UEOA 2BELA 3MJCA 1U3UA 2WSBA 4NK5A 1BHSA 2HRZA 1E7MA 1TB4A 5TSDA 2HK8A 4MIEA 2G76A 4BUCA 2J3KA 1U8FO 2P9GA 5CP8A 1LLUA 4AJOA 4E2WA 3M1AA 1NR7A 2B4QA 3U0BA 5C7LO 1FK8A 5A1TA 2ZB4A 1I33A 3NTOA 4DLLA 2FP4A 5I8WA 2W4QA 1CERA 2HMWA 2PGJA 4L9RA 4ND5A 1GZ6A 2VYND 4ALNA 1A27A 4HX5A 2PH3A 4YQZA 2WYWA 5BT9A 5F1OA 1EUDA 1MFPA 1HDGO 3QY9A 3CIFA 1ISJA 3IJPA 3JQAA 1HYEA 4BKUA 5K6AA 5EJ2A 5JYDA 3QVWA 1GV0A 4UVEA 2O48X 3STHA 2C5AA 4KP7A 3V1TC 5DNAA 2QRKA 3EMKA 5KNLA 4L74A 4U8GA 3DZFA 4W82A 1MXFA 5DBIA 4BHTA 1YXMA 3HSKA 4II3A 4DBZA 5JY1A 1ADFA 1KVQA 1J6UA 3MEQA 4J4HA 3NT4A 2NVWA 3E9MA 4MKZA 3UHAA 4DQVA 4D3FA 2G1UA 3MJSA 3PTZA 1C14A 4B8WA 5AXBA 3WBBA 4FFNA 4OOEA 4BVAA 2HO5A 3QA9A 2P2SA 1JDJA 2Q1UA 1KEUA 5K9ZA 1ZSNA 3GZNA 3LT0A 4YXFA 3DO5A 1Q2XA 1EDOA 1DIGA 4JK3A 1QMGA 1E7RA 3ETGA 1I01A 4R5MA 4GKVA 2POQX 2V6GA 4I9HA 3VTZA 3SXPA 1R37A 3ZHYA 1NWCA 1IZ9A 2YQ4A 3PYLA 2C54A 1ZEJA 2DC1A 2HMTA 3PGJA 1TI7A 4JX8A 3RD5A 3EC7A 2J8ZA 1ZK2A 2WJPA 4IDGA 1M6HA 4IGFA 2I3GA 1JKFA 3A1NA 2Q4EA 3RC7A 4OXKA 2DUUA 3A06A 5EINA 3QIVA 4INAA 3WIEA 4KMSA 3ICCA 4E4YA 4J4BA 4XYMA 4NG5A 2OORA 4AJ1A 2VUSA 1Y1PA 1D1SA 2C20A 2RHRA 3B70A 3HJAA 4CLDA 2X5JO 4YVFA 4B7UA 1DHTA 2AQKA 1R4NA 2RCYA 2PKQP 3U9LA 1ZJZA 5EPOA 2XAAA 4HY3A 5CDUA 4WPGA 5DDIP 1C0IA 4F46A 3PJGA 2UYYA 4RVGA 1KEVA 2DLDA 3ROKA 3K30A 5JYEA 2GZ2A 4A26A 5I7VA 4HBGA 4NMHA 1H6AA 3C7AA 4IZIA 3Q2IA 3HDHA 1EK6A 1U4SA 5L7YA 1YVEI 5HA5A 1DC6A 4CV3A 4EBFA 4YWJA 3TL3A 3JV7A 4R1TA 4GGPA 1G1AA 4S3MA 1BWSA 3S2FA 3NGLA 3HZZA 2B5WA 3LC7O 2BI8A 2ZKLA 1UZNA 3GMSA 2ZYGA 2Z1MA 1HF3A 3NV9A 1HE3A 1NQOA 4E5KA 5THKA 1U8XX 2EV9A 4YACA 4IZHA 3IUPA 3O38A 4DWVA 2JD1A 3OA0A 3WNVA 4CLOB 1FDSA 4UULA 2W2LA 1Z6ZA 4MOWA 3WJ7A 3JQ7A 1IY8A 4MKRA 2G17A 3K2EA 2PKRA 1HDYA 5EQFA 5TIIA 3F46A 4YTEA 1PJLA 3GNTA 1ZKMA 2QQ5A 4F6LA 4HV4A 5ES3A 2I99A 1E3LA 1VL0A 4YJHA 4IINA 1L7EA 3WB9A 4A03A 2IODA 5JW6A 4OSOA 3JYQA 5B4UA 1FDUA 1T2FA 3F4LA 3HNPA 5JMPA 1ZZEA 2O7QA 5AXCA 4DUPA 4NI5A 2Q50A 4FOSA 3TNLA 4QECA 3OECA 4DGSA 4UVGA 4DPLA 2VYVA 4WCFA 1XG5A 3I52A 4YQYA 4MVJA 5A04A 1J49A 1HDRA 3OQBA 4J3FA 1E7YA 3ZHBA 2IZ0A 1P1RA 2H5LA 3DTYA 3QRWA 5C3MA 3UN1A 4CQMA 4TROA 1FDTA 4FW8A 1DC4A 3D5TA 2E82A 1U4OA 4A27A 3DFZA 4XDYA 5H83A 1UJMA 2X1HA 4OJNA 3AU9A 3GUYA 3PYMA 4AJIA 4YAEA 4RF2A 1KVRA 1MC5A 1ZO8A 4IXWA 2D2IA 4XYEA 4DMMA 1K6JA 2NNLD 1VI2A 3GHYA 4BNXA 5JXWA 1GCUA 1NHGA 3VZSA 3WXBA 3WYEA 1DFGA 1F14A 3RCBA 1CQIA 3NTQA 4E31A 4PG4A 3MCVA 3V2GA 1YL5A 3HWRA 4IS2A 4XIJA 4DRYA 3C24A 5AYVA 4TRRA 2G82A 2YYYA 4AJJA 4WGGA 4KWHA 2F00A 3Q6IA 3D4OA 5JS6A 3MJVA 2I3AA 1HYGA 4IQ0A 3JTMA 2VZ0A 4ALJA 4AFNA 1K2WA 2X7HA 3Q9NA 5FF9A 1DIHA 1VPDA 4QFCA 2C5EA 1XSEA 3ASVA 4GWGA 4OAQA 1UUFA 4FS3A 5ITVA 3ZCXA 3KYDB 4CMIA 2ZATA 3AFNA 4B3JA 1K0UA 4DL9A 3BMNB 2CSUA 3A4VA 2GN9A 3WOHA 3WYBA 1W73A 4HKTA 3ZWAA 4E2ZA 5JO9A 3U3XA 5DT9A 3RKRA 3W1VA 1NAIA 2HMUA 3NDJA 3PIIA 1E3WB 1WWKA 3BTOA 2W2KB 1ZJYA 1A4UA 2V6MA 4J2HA 9LDBA 1IPFA 1JTVA 2PZLA 3TZ6A 1C1XB 4JN6B 5T57A 1NQ5A 4M89A 3WSVA 2PD6A 4N5NA 4U7WA 4XX0A 3JD4A 3QWAA 2EW8A 3ASUA 1ADBA 3VOSA 2PLAA 4Y98A 4GQAA 5KJ1A 3CH6A 1UZLA 1Y8RA 2ZB8A 3MJ4A 2C2XA 1GYRA 3Q9UA 4CLXA 3E18A 3OIFA 5L4NA 2PK3A 3U62A 4KTVE 1VSVA 1WDMA 2C82A 1MV8A 3B1JA 3D1LA 4R1SA 2OHXA 5DBGA 2I67A 3VDRA 5IZCC 1H6BA 4TZKA 3VVCA 3KLMX 1HYHA 4FJ2A 1N9GA 2JKVA 1GYPA 1HDOA 3H5NA 3JQDA 2FWMX 3RBXA 2B35A 3HE3A 2OBNA 3KETA 2HK7A 2OOSA 3LC1O 2AEFA 2DPGA 5CFZA 5CPFA 3IAHA 3OETA 4YAKA 4PRKA 4CMHA 1UZMA 2BF7A 1KY4A 4J7CA 4JBHA 5A05A 3VDQA 3K2BA 5DP2A 2X8LA 3V2UA 1AXEA 2UV8A 3JQBC 3WMWA 3D3EA 1I30A 4II2A 5C37A 3LT4A 1SB9A 1B2LA 4BNYA 4YRDA 2UDPA 3A9WA 4MPDA 4OQYA 1NFRA 4J43A 4BO2A 3PXXA 4CLRA 3FN4A 1OOEA 3T4EA 4CLOA 2VWHA 1E3EA 3CINA 3PZBA 4LCEA 5H82A 5F1PA 2JHGA 4U6QA 3AUUA 4BNFA 3GT0A 3EZLA 4Y6PA 3FR8A 3FR7A 1WDLA 2PGLA 1A71A 3RSHA 1E6UA 2CFCA 2EIHA 4NJMA 4P22A 3PHGA 3EUWA 4A5OA 4CV0A 4DMLA 3WFIA 2GN8A 4BGUA 1A7AA 4UREA 5JMWA 1NFQA 1XQ6A 5TLSA 4PIVA 3RC2A 5JCXA 2OFPA 1U3TA 3AOEA 3QWIA 1LEHA 1JN0A 2NWQA 3S55A 4R54A 4E5NA 1ZXBA 4PVDA 1CJCA 3VZPA 1X1TA 4CMAA 3OQ1A 4ALLA 3DHYA 4WASA 3DQPA 3GUCA 3FNGA 2DUWA 3L77A 3CMCO 5EIOA 3HN2A 1P77A 3S2GA 4CV2A 4ALMA 3FCOA 4K6CA 5A4DA 3ANMA 5CG1A 1DSSG 4E2YA 2NQ8A 3LC2O 3CZRA 2VHXA 3X2EA 1I32A 1ZVMA 5IDXA 1EMDA 4AJKA 4PVCA 2J5QA 3LYLA 4MVJH 4H7PA 4IMPA 5ER6A 1P1IA 3T4XA 2DQ4A 1IULA 5FWNA 2AQHA 1U1IA 2O2YA 3ZI0A 2WD7A 2QX7A 4I5GA 4XR9A 5KKCA 3BMCB 2X9GA 5MGBA 4CL3A 1JAYA 4CMEC 3O8QB 4QEDA 4R5HA 3ETEA 1B8VA 3E5RA 4DREA 4EUHA 1E5QA 3ANNA 2FY8A 5ITWA 3FWZA 4XDZA 5TX7A 1DOHA 4EJ6A 5BNFA 3VAZA 1OMOA 3PHIA 1OI7A 2YV1A 3ZDFA 4BS9A 1DIAA 1HT0A 5JY6A 3AU8A 1YL6A 3Q11A 3RIHA 1UH5A 4HNGA 3K96A 1EZ4A 2GN6A 5IFLA 4GI2A 4LSWA 4Q3CA 3TFOA 2CF6A 5I8ZA 5C5IA 1LNQA 1KVTA 1NVGA 1MP0A 2Q4BA 1CEQA 2J3IA 1NVTA 2H6EA 4LMPA 1QP8A 1VRWA 4NBRA 4PLYA 3UH1A 1B8UA 5B12A 2WMDA 5L3ZA 4BB5A 1DPGA 3GVPA 3G79A 4FSHA 3AI3A 2O3TA 2IYPA 1M76A 5A9SB 4J0FA 2CVZA 3M6IA 4CUZA 1HE2A 1QORA 2JD2A 1I24A 2X0NA 3BA1A 4KWIA 4M54A 2PFGA 3VPHA 3ONEA 4M86A 4FGSA 2AE1A 3F9IA 1I2CA 3GC6A 4PLHA 3JQGB 3DWFA 3VZRA 1DBVO 2VWQA 4CM5A 2FR1A 2XXBA 3QVXA 4MINA 3JQAD 4OKNA 4ROSA 2HRBA 1GCOA 1PL6A 1RJWA 1SPXA 3CPSA 3H9UA 2GERA 2YFHA 3E82A 4JBGA 3R0IA 1MXHA 5JLAA 1XDWA 1GU7A 3OBBA 2LDBA 3H9JA 4WUVA 2D8AA 2VTDA 1PJSA 1M6WA 2JD0A 2D5AA 3CSDA 4E0BA 3PHLA 1Y81A 1WW8A 2QRJA 2YV3A 1YB4A 3KEQA 5G0VA 1YQXA 2PA3A 4FC7A 3UGKA 3UOGA 4C7KA 1Y9EA 4YJFB 3TWOA 5DCUA 3Q0EA 3X2FA 4YT4A 4GX2A 1ADGA 1UP6A 3AM3A 4K1LA 1M2WA 4BNHA 2AXQA 4RQUA 1D4FA 4JQCA 2AEMA 1FF9A 1ZCJA 3B1FA 5TC4A 1AN9A 3A14A 2FOIA 3KTDA 3D4NA 3RUAA 4ESOA 3H4VA 1X15A 4FB5A 3RFVA 2GDZA 1NASA 1LRJA 4OXNA 4YCAA 3IQDB 3OFSA 1VJ1A 1QV7A 4Z3KA 4DVJA 1D1TA 3TFQA 3EAGA 1NPDA 3HN7A 3ZH2A 2X9NA 1KC3A 3N58A 1P1HA 3L4BC 1RM4A 3AI2A 4FJ1A 2IZ1A 1MG5A 2GO1A 5FI3A 5BNTA 4I5EA 3OF2A 1ZK4A 2B5VA 1UXKA 4R01A 4TRMA 5I7SA 4XR4A 5A06A 1ZEMA 2Q1TA 3V1YA 3JYLA 4FFPA 3PJEA 5HRUA 5KJEA 2VOEA 1B3RA 1UXIA 3L9WA 4J9VA 4AJ4A 2O50A 1YS4A 3K73O 2D59A 2ZYAA 1P44A 3G1UA 3JYOA 3G3EA 3ABIA 4AL4A 3I9KA 4R1NA 3GRPA 4E5YA 1EBFA 2BMAA 1EVYA 3O9ZA 3GF4A 2J5RA 5IZ4A 1BMDA 3C7DB 4PLGA 2HK9A 1E3IA 4G81A 1FMCA 1QR6A 4RDHA 4KUEA 1EBUA 3EY4A 5ICMA 1GUYA 1PL7A 2YFQA 2NVUB 3RUIA 2JHFA 3DAPA 3WYCA 3ITDA 1BG6A 3I9NA 4WE3A 2NU6A 2EF1A 1KY5A 4XQCA 2FZWA 1XGKA 2OP0A 3VTFA 2JFGA 1PIWA 3ZHZA 1PJTA 3QVOA 4E33A 4KZPA 2V6BA 4RDIA 2VZ8A 2QRLA 3OICA 3OJFA 3QLJA 2O2SA 4DA9A 1QYXA 3RKUA 4BO1A 4OH1A 4WLFA 3G0OA 3OIGA 4LRSB 2VOJA 3PP8A 4E6PA 2W2LD 1YB1A 1NX6A 1DJNA 5A9RA 4TMFA 1NP3A 1OBFO 4D41A 3F5QA 1KBZA 1YONA 2VCYA 4O6VA 3I3OA 1EVIA 3GEGA 4GAEA 4GX0A 1PR3A 4RVHA 5HS4A 1GTMA 1YQGA 2OXIA 3I83A 4GSKA 2H9IA 2VZ9A 1JA9A 1JVSA 1T24A 4OGWA 2P9CA 4UUMA 3SX2A 4LISA 4AJHA 1ZK0A 2R00A 3PQFA 4J1NA 3I23A 3H9QA 3PFWO 3CE6A 2X86A 3UKOA 4RLSA 2QYSA 1GYQA 4WOJA 3SC4A 2ZJ1A 3ROMA 3LF2A 3MOIA 1GEGA 3HFSA 3NRCA 2PD4A 2Q2VA 5L95A 4XB2A 2JFFA 4QXMA 2IRWA 2VYVD 3LLVA 4YBZA 3GDGA 1CETA 4Y6RA 1F12A 2ZIZA 2I9PA 4MVJD 4R69A 4RORA 4YJGB 3QVTA 2PKQO 2PR2A 3TZCA 5GMOA 1UR5A 4BO5A 3E9QA 3GK3A 2SCUA 2DTXA 3GAZA 4CQMD 5DN9A 1AE1A 4CMKA 1V3TA 1TEHA 4ZQGA 4AICA 4R3NA 5B4TA 5ILGA 4DQUA 3DHNA 1R0KA 3WWZA 1N8KA 4OL9A 4CL8A 5B37A 4WEOA 3PZRA 4ZGWA 3VKUA 4DC0A 3CEAA 2JCYA 4GWKA 4Q3BA 4PLPA 1YBAA 3ZWYA 4HFJA 4Q3EA 1KC1A 1QV6A 1LDGA 4M49A 5LDHA 4NBUA 3KYDA 4UUPA 4J1TA 4XGIA 5G0WA 3OJOA 1ENZA 3BMNA 5GZ3A 5BQFA 2VNSA 3SLGA 4B4UA 4B79A 2X5KO 3ZU5A 5JBIA 3RU9A 3FSRA 1W4ZA 3W8EA 3H6KA 2E49A 3ZWXA 3B6ZA 4BKPA 4CUKA 2WE8A 3WLEA 3WFJA 1E3WA 4Z0HO 3PPIA 4JGBA 2W2KA 4TRJA 2BHLA 3R1IA 1UAGA 3RJ5A 4FFLA 3P19A 1PGNA 1C1XA 2CDAA 2PZKA 3QHAA 2AW5A 2X23A 4ZQBA 2DPHA 3SC6A 3TF5A 4CR7A 1J0XO 2FRDA 4K28A 3GDOA 1HE5A 1W0CA 1LSOA 3FD8A 2NUAA 3I6IA 4D0SA 5CG2A 2GSDA 3BYZA 2Q45A 1Y5MA 1YJ8A 1F06A 2CMDA 3ZU2A 5JAMA 5L45A 5GZ1A 5C7OO 4ZA2A 5CEJA 4RPJA 3KUXA 1VC2A 4PLWA 5BSEA 2A35A 1MB4A 3WQQA 3GR6A 4IJKA 4N18A 2Z1NA 1O6ZA 4XQ9A 1Y9AA 4NFHA 4NR0A 5AOVA 4CM6A 1YB5A 4WECA 4DYVA 5DBFA 5FYDA 2NU8A 2GUGA 3RUEA 3ZW9A 2Q2WA 4FDAA 4EJMA 4MP8A 1BXKA 2BFMA 3WGYA 1N1EA 4QO7A 1BXGB 1FDWA 1PGQA 4MDHA 1P3DA 4QSMA 2VHVA 1XIVA 4PG7A 1ONOA 3OP4A 3PDJA 1J5PA 4DIOA 1BW9B 4JJGA 3WX0A 1HSZA 2NLOA 3F4BA 1U28A 5C7IO 3OA2A 1I8TA 2PH5A 2YHUA 4MP6A 5DZSA 1R4MA 3QV1A 3DBLB 2ZYDA 3AK4A 5G0TA 4ZHSA 1K89A 1BGVA 3I9OA 3EDMA 4CMBA 4IDCA 3ZHXA 1HE4A 2VHYA 1UP4A 4W6ZA 5KVVA 4PLVA 1Y7TA 3L6EA 3QP9A 4XJTA 2IXBA 4W7IA 3UXYA 3WDSA 3LZ6A 1CQJA 1V6AA 2Q3EA 4MIOA 3K31A 4ALKA 3ZNQA 3G49A 1PZHA 1B7GO 1P1KA 1X14A 3JD1A 3L4BA 5BSHA 1K3TA 2BRUA 3GEDA 3DMTC 1MA0A 2PGDA 4RPGA 1QYCA 2OMEA 3DDNA 1C0KA 2O23A 3WGGA 4I9NA 1H6DA 3BIOA 3GEMA 1IZ0A 3E6AA 1GDHA 3ETDA 5F5NA 5AXAA 3R3SA 4JJFA 4RV9A 1KOLA 5JO0A 2F1KA 4H3VA 4OSPA 3W4IA 1HXHA 2QZZA 4H16A 4XGNA 2GNAA 2Y05A 4NZ9A 4X54A 3LF1A 3M2TA 1E92A 4RZHA 5T6BA 1HZJA 3VVBA 8LDHA 3S2IA 4CMCA 4ZICA 1PL8A 3OJEA 5I9MA 4DPKA 2RAFA 1NQTA 2NV6A 1T2DA 3LT1A 2Y67A 1PS9A 4JJIA 3FNFA 1GPJA 1RM3A 1WMBA 2VRBA 3F3SA 3VH3A 1E1MA 3BMCA 2BFPA 3U4DA 3O8QA 3PIDA 4E32A 4J7UA 1DXYA 3FTNA 3FI9A 4FN4A 4J4TA 3TOZA 1B15A 1A9ZA 1OFGA 1OAAA 3DBVO 4PLZA 3RFXA 1H5QA 1LX6A 1PGPA 5DF1A 1DIBA 2JJYA 1PS0A 1N7HA 2J3JA 4IXTA 1QSGA 1SEVA 5JDCA 5JSFA 1K5HA 1NPYA 1PZGA 4P4GA 3H9GA 1OZAA 3DL2A 4XD2A 1ZBQA 2YV2A 1GQYA 3WGTA 1Z45A 4BGIA 3PQDA 2DFVA 5CEEA 1ISGA 2A94A 4KUHA 5CDGA 4NU5A 2BD0A 3ON5A 5F1KA 2BGKA 3TRIA 4AVYA 2PWZA 2WTBA 2FPPA 3D5QA 3EVTA 3UICA 4IDDA 2NQTA 3ITKA 3PRJA 1Q0QA 3P7MA 4RVFA 5HM8A 1P1FA 1R16A 3GGPA 5HTOA 3KO8A 1R6DA 2B37A 5JCJA 4O0LA 2VN8A 5A9SA 3PHJA 1MX3A 4R68A 1K6XA 1YDWA 4RZIA 2A92A 3ENKA 1GD1O 4PCVA 2DM6A 3ZWNA 4ZRMA 3RJ9A 1PQUA 5J23A 2DT5A 1IE3A 1C0LA 3C8MA 1NWHA 1TT5B 1DJQA 3JQGA 1EK5A 4IUYA 4TRNA 3GAFA 2HKIA 4Q9NA 3TN7A 1P0CA 1ZMTA 3L0DA 3KXDA 5T8KC 1RM0A 2I66A 2PZJA 4FFOA 4FJ0A 4IY1A 4QO8A 4U0JA 1A72A 4WOKA 4HFMA 3L6DA 3NDIA 4WKGA 3DOOA 4UEKA 5TGDA 1YRLA 1GQQA 4Q3DA 2AG8A 4D3DA 2ZB7A 4YT5A 4J2OA 3OJLA 1LTHR 1RPNA 3BHIA 3H2SA 4RF5A 4BNNA 3GRKA 1PZFA 2P91A 2GRAA 2VYNA 4YJFA 5FFFA 1ZUD1 2RH8A 4Z0TA 5ER9A 2ZJ0A 3GHHA 3WMXA 3GN1A 4IMRA 4F45A 3GFBA 3UVEA 3GVXA 3PWZA 1JW9B 2X0IA 3VHRA 3ST7A 2PZMA 1E1LA 3OM9A 4XB1A 3O03A 1NHWA 3I9JA 2HLPA 4CM9A 2VQ3A 2OGUA 4QFDA 4DQXA 5JAQA 2P9EA 2OP1A 1LDNA 5KVSA 3L07A 2Y0EA 5TRTA 2A4KA 3RROA 3FWNA 2OL4A 3D3WB 4ZRNA 1I5RA 1HLDA 1VSUA 4BNJA 4CR8A 1SNYA 4BMNA 2Q99A 4LGVA 3I9LA 4UUOA 2JCVA 1B0AA 5TQVA 1X7DA 2R6JA 2QIOA 5HWSA 2P68A 2PV7A 3SJUA 4BQRA 1HSOA 3QE3A 1P31A 2IYOA 5L4LA 5A3VA 3GGOA 1YGYA 3SBOA 1X7GA 5B1YA 4A10A 3Q1LA 1JKJA 1ZSYA 2W8ZA 3RBZA 3BHJA 1KEWA 1XU9A 3AUSA 5DCWA 1L7DA 3ICPA 1NTOA 3ZNOA 4YPOA 1LLQA 4Q3AA 4CMJA 3RASA 7ADHA 1D3AA 1YOVB 2CZCA 2AQIA 1DFIA 3EHEA 4RCVA 4AJEA 3ZW8A 1DLIA 2GCGA 4RPHA 3HG7A 3ROPA 3PLRA 4PRLA 4IDFA 4CODB 5COQA 1ULSA 3ZWOA 1UP7A 2DTDA 3KVOA 4TKMA 2NVUA 1I3KA 3AJRA 3KSUA 1LQUA 2EGHA 4DBVO 4B8ZA 3OSUA 2ZTUA 3N74A 2XPCA 5G4LA 1KYQA 1R0SA 4TVBA 3GG9A 3WGOA 2BGMA 4LCJA 1RM5A 4FBGA 4R4JA 4MVJP 4NBWA 3FNHA 3RUCA 2HCTA 1WZEA 2UVDA 5JE8A 3JSAA 1IL0A 1WMAA 2G0TA 1PJ3A 3H8VA 3JQFC 5LCXA 4TVOA 1ZK3A 1QYVA 1HEUA 1SAYA 5G4KB 5L7WA 2GZ3A 3DC2A 3K5PA 5I9NA 1TXGA 1AUPA 2DBQA 2IE0A 4WNIA 4I5DA 1U2GA 1LLCA 3D7LA 1E5LA 2QYTA 2YJZA 4YAJA 5EN4A 3WLFA 2YHIB 4A0SA 3I5MA 4BQPA 4L4RA 1JLLA 2B69A 2GASA 4FIZA 1LA2A 1LDBA 4LVUA 1Q0LA 4RF4A 4YR9A 3VH1A 2HMVA 4WNCA 1T2CA 1XR3A 4PLCA 4XRRA 2C59A 1U5CA 4OHUA 2C7GA 3ANLA 4BMVA 2I6TA 1Z75A 4CM4B 4YJGA 2E48A 1W8DA 5CDTA 4GSLA 4RPKA 2Q1WA 3I4CA 4W9NC 1Y5RA 4WK6A 4BV8A 3H2ZA 4Y6SA 1QYWA 4XYLA 3JD2A 2WE7A 4NH4A 1BRMA 3K9QO 2BFOA 2G5CA 1T4BA 2HMSA 4A73A 4ALIA 1Q1NA 1S6YA 3S8MA 2H63A
chains in the Genus database with same CATH superfamily
3ILXA 4YRAA 4DGQA 1J8QA 1G8KA 4ZAZA 4N6GA 1DARA 3OE7D 3RSQA 4CF6A 1RRPA 5AUQA 1PWYE 1T43A 1W94A 3LH5A 2JFOA 4ZMBA 4GOKA 4UDNA 3TOXA 1XVTA 1XZNA 5IF3A 4NECA 5IXYA 3KJEA 1PK9A 1IIRA 1T6NA 2W22A 3BHMA 3DTVA 4IYJA 2P0EA 5D3MB 4UTPA 2A0UA 4I14A 1U8ZA 4EG4A 3U7HB 1QC5A 2D7DA 4P0PB 1O4WA 4R2WA 1IIBA 4B71A 3IP1A 3K8ZA 1ZVVA 1HQKA 1TRHA 3AJDA 1M1NA 3VDMA 1JHQA 1P33A 1W0KA 2G70A 4B3GA 1NLFA 4BNDB 1XVLA 5EMJA 2WVHA 4NZOA 2KX7A 5JJBA 4AJ2A 1KIMA 3HBFA 3KLPX 2CDCA 4UVDA 5GM2A 4RIGA 3UJHA 2CMGA 1E7SA 1Q7CA 2XVXA 3GDFA 1XCOA 3ZE9A 5IK2D 1E1KA 3ZWKA 5K6AC 2AHRA 4B2PA 1FFGA 1ORDA 3QSYA 5ENZA 1BVYF 1DTSA 4WI1A 3JYHA 3IKVA 1V26A 1YOBA 5AK0A 4OJYA 2I1VB 1W4CA 4YMTA 1YBVA 3RS3A 1PQWA 2GETA 4KNVA 3TD9A 2FMKA 1RW4A 1XDDA 1Z7YA 4LXXA 2WJ6A 2AXPA 1IOLA 5C5EA 1ZH2A 1QHXA 2PL1A 1LB1B 4RKEA 5TF4A 4FZJA 4NOLA 5IDQA 2JGNA 3IQFA 2H1SA 5FX2A 5E1DA 2PNFA 5FPKA 3BJRA 1YDGA 2P6MA 3R76A 3KDSE 2EBWA 2FA9A 1OFUX 1BDBA 2VPWA 5EZ5A 2PE5A 2ENWA 3BK7A 3OTHA 4BDTA 1XMXA 4HWSA 5MHTA 1N6PA 3AR7A 5A4KA 5DK6A 1O54A 3NIWA 5C8YB 1QG6A 1QVAA 4US1R 1AQYA 1ZSVA 4XFKA 3N0VA 1LZLA 3DVRX 4CEJB 4MUGA 5IWCA 4U2CA 5IBCA 3ADOA 3FPBA 3T06B 1V16A 2RHTA 4ZCLA 3V4VB 4C7MA 1H5UA 3CSSA 4WY5A 1TEVA 2W70A 3UWMA 2C8JA 3K1ZA 2D2XA 3OZGA 3K7EA 3CEJA 3OEWA 4D9IA 4OO3A 3WG9A 4QD3A 1L5RA 3BGWA 1TE2A 4L5BA 1G6KA 3GVCA 5BSMA 4UTXA 1RC0A 2XNDD 3O9VA 3PDHA 2OUIA 3A6PC 1V0JA 4B76A 4IGKA 2PXXA 3CN9A 4KGZA 4O5AA 4YUZA 5A3JA 3OX3A 2OXRA 4I55A 3AFHA 3BD9A 1X94A 4EUKA 2IXGA 3PKZA 1KZ1A 4DDMA 1KETA 5JHHB 4CIXA 2QQFA 2XNCA 1DRKA 1PG5A 3A4IA 3ADPA 3LHFA 4FZ5A 4IEIA 1USUA 1U7OA 3HL4A 1BDIA 3ZWCA 2WOOA 1O0CA 1ZC4A 3U3RA 1DFHA 1IHYA 3OESA 3ZNNA 2J6BA 3LLUA 2GB4A 2O0HA 2XMGA 1RCTE 4NCKA 1KMIY 1THZA 3B5JA 1JB9A 1UFQA 4QPJC 3RVOA 4Z9YA 2I7TA 2JI9A 2V8BA 5FOWA 2BEVA 1B43A 4MRMB 1RADA 5G3ZA 2WAMA 5HRAA 3FETA 1FDVA 2BFEB 3BZWA 3QY0A 4G8CA 4YV0A 4PIPA 4J3JA 5EERA 2R6R1 2VF5X 1GJRA 4YJ3F 1DIOB 3BMOB 1PLLA 1XZFA 1XHLA 5F5LA 4QUBA 1SBYA 2VBFA 4IM7A 2TMGA 5ERXA 1N92A 1WXXA 4ZXFA 5D8DA 1IXSB 1EYZA 5IJAA 3FNEA 5ITZA 5K8VA 3NYIA 2C4KA 1E8MA 2ZAMA 1VJ0A 4BKRA 5JASA 1L8OA 2B4RO 1IDOA 1SK9A 4LSMA 5JXJA 3L0IB 1XRPA 4LZAA 2ZCVA 2BT4A 3EZYA 3WBFA 1PWHA 5LZ2A 1KJIA 1O1YA 1C4KA 1OAOC 2EYQA 2YN2A 4LX8A 4BLQA 1PT7A 3TJZA 3I2FA 4KDFA 1WVIA 4PPGA 1BD3A 3H0EA 4R16A 2YFYA 3CV3A 3UZUA 4AF7A 4XRGA 4NZZA 4ZYUA 3EYWA 3O1IC 5DULA 3NHMA 2ILTA 4B8YA 3TJRA 1UKVY 3GELA 3O1JC 4LC1A 4Q7JB 2EERA 2IQIA 5C80A 5LQMA 5TVKA 4E4RA 3ZGVA 3SBDA 2A5YB 2BEUA 3ZWPA 1JVNA 4L27A 3BXXA 4OHWA 3AINA 3H11B 4NENB 3ROFA 4D3YA 1OC4A 2Q4RA 2JLWA 5I5GA 2IEDA 4D42A 1QLJA 4BATA 1WAMA 5AVYA 4DIDA 3NHSA 1HURA 2PXAA 4Y67A 4DTIA 3ZCSA 1R3DA 2PVPA 3AW9A 3MZ0A 1G42A 2OVBA 1OFVA 1XROA 2ZANA 1OI2A 3ICOA 3QLUC 4EPYA 1AMUA 3FBTA 5M29A 3NEYA 2IA5A 4LJSA 1U2SA 5AO9A 4M9SA 4DXHA 5C8ZA 2LCIA 4MUNA 5WRFA 1BC5A 221PA 4MZXA 3VC7A 4ZAXA 1OR8A 1AS0A 3WHPA 2FRVA 1F8GA 2I3ZA 3BIWA 4R7ZA 4UDOA 2CXUA 2YDYA 1J9ZA 1SU7A 1UC8A 3PDCA 2GLTA 4IKPA 4LK2A 3DWEX 1KI6A 3WLKX 4GOOD 1LQTA 3K1YA 1WD5A 1GG5A 5H81A 1U7XA 2AJBA 3ACBA 2P7IA 5ALTA 2CL6X 3UKJA 4U00A 1V2GA 1NC3A 4ID9A 4MR7A 4LXHA 4URZR 5GZ6A 2YWCA 4J2TA 4EUEA 1QWSA 4UPVA 5BYBA 1B3BA 3CXRA 1QV9A 5BXQC 3BSWA 3T3GA 3LOPA 1CDZA 2FUCA 1IMOA 2GJ9A 1LBSA 2OECA 2HIMA 2O0KA 4TXJA 2CVOA 3IDSA 2ONKA 1MRNA 2JGIA 3A28A 5BXYA 1XMSA 2IEAA 4RWEA 1T3ZA 1VCOA 4N5LA 3RS7A 3ZXYA 1RYBA 2A9RA 4BOYA 3QWFA 2P5UA 4N03A 4WLUA 1XZCA 2B7CA 4CJXA 3M5CA 5JCJD 3EOZA 3KSZO 5KOIA 3B1XA 3GVHA 4J1QA 6ADHA 2AQ8A 1QCDA 1DAMA 3PGVA 3JQ8B 1BCRB 1X8XA 4UEWA 3EDQA 3ZEAA 1JZSA 3DOCA 2BZSA 1QCCA 2CB0A 2ZUDA 1G63A 2ID8A 3MGGA 2B4TO 1WB6A 2IHJA 2M6SA 2Y1CA 2AOTB 3NDRA 4CMEA 4G26A 5H3LA 4I0WB 5AJZA 5J3JA 3GJ5A 1JUDA 1ZHOA 3KKQA 4IVPA 4L8LA 1M72A 3C1OA 4RK0A 1U3WA 1THGA 1MO5A 4JLKA 3A4YA 1R18A 3WR5A 3DUFB 1RE1A 5J63A 1JI0A 3JAWB 1DOAA 5BMVF 3GIWA 1E3JA 3DHEA 3IUSA 3JRNA 2V1XA 3V7UA 3FTPA 1ORHA 1ZVKA 1GNQA 3KB6A 4WESB 3WJAA 1I14A 4WFKA 3MGAA 2C03A 1A50B 2CHQA 2Q1YA 3TLCA 1GRNA 3FA2A 2ZIFA 1VYUA 1XXHE 4OV6B 3U48A 3D5EA 5HE9A 4GW3A 3EQZA 1E89A 4GDFA 1SXIA 1GUZA 4H1VA 3TZHA 4Z2YA 1PWZA 5B7NA 1U3FA 5HXAA 5CD1A 4D0RA 1YZVA 3EAFA 3L82B 4P31A 3D3WA 3UA4A 1HTWA 3IOYA 4D9EA 3O8OA 1WE2A 4B9EA 1S2DA 3KKKA 1DAGA 2OHJA 4B80A 1I3LA 4DILA 5K09A 4BASA 1LH0A 2F59A 3F97A 4L5YA 4TS1A 4WLEA 5ANRB 5CA0F 1DTWA 3O75A 4DM7A 4DSUA 2M98A 4QFBA 1EUCB 4G0YA 2Z58A 5HG0A 1VP3A 3UGQA 2D74A 4WQMA 1O97C 2FOXA 2VDWB 3OQJA 3O2QB 4IIVA 4P98A 3VI4B 3W9BA 3WWPA 2IPNA 3E2PA 3GRZA 1DE0A 5CFLA 4NRDA 4QUAA 2QG4A 5GM1A 3WKCA 4NX2A 4NATA 3SR3A 5GJBA 1YE5A 4Q3OA 5IT0A 3WWEA 1A5AB 3ZK8A 2W2XA 1GFIA 2JAPA 3P0EA 1V3VA 4ZVVA 4Y1GA 2OCKA 2C04A 3T5GA 1SOVA 1Z0IA 2UVPA 3I1JA 4MWGA 5T4HA 1PJ8A 1UXJA 2C2OA 3DHWC 4L4ZA 2YIVX 1K4YA 1UDXA 2C5GA 2QTAA 3ELDA 4HGYA 1U6JA 3TAHA 4D8WA 3EGIA 4ID3A 4MVJI 3ZNPA 2YY6A 1C80A 1UM8A 2GBLC 2ZJ5A 5BUSA 4MI6A 4PTLA 2MSLA 3CWZA 3IPAA 3RRMA 3U7QB 2ONYA 3HR4A 3CZQA 4U6SA 2V6FA 5CT4A 2JZNA 2XCLA 2WUEA 1MFZA 1Z4MA 3C2QA 2IP1A 2O0MA 4HGQA 4D6PA 2G77B 2H4XA 2F90A 1O87A 4ZQFA 1E0JA 3A6KA 3QPCA 1KEEB 4H08A 1U3DA 1XDBA 4IDBA 3UJNA 1N77A 4U63A 2RGCA 1G7RA 3U5TA 1E3SA 3CLHA 4V02A 1RXCA 1KP2A 1R64A 1VKNA 1XKQA 2WLTA 3P0FA 4U8HA 3DDSA 5JT1A 2FSSA 3GH3A 2I65A 5BURA 5KYYB 1S02A 4CCSA 1XCJA 3H4TA 3KE8A 4EGQA 4K1XA 5EWJA 1N3LA 2HR1A 4C0KA 5LLDA 4J0KA 2CXSA 1SY7A 1AZLA 1E58A 3RSFA 1EIWA 1JKXA 3CUTA 3EVDA 3R3ZA 3GJTA 1UAYA 2AS0A 4HG2A 4H1TA 4J03A 4D82A 1DT3A 2ID9A 3A37A 2E4ZA 4N47A 4FUQA 1NYTA 1PR9A 2WW8A 2DE0X 4M8LA 4DSZA 4FD2A 5IXSA 3BSFA 4N3GA 1TK3A 4HNHA 1EH5A 1E4EA 1YU6A 1G8MA 5JNLA 2P6RA 2O3SA 3I6QA 3ZLVA 2GM3A 4MRSA 1P4HA 3KWFA 2B7BA 4GXTA 4OX9B 1D03A 3NI2A 3NX4A 4IF6A 3OY7A 4XA8A 5TJ9A 2II6A 4E21A 2YHIA 3B20A 4G5SA 4ZWNA 4DQKA 5FWXA 4TUYA 2HDOA 2HUNA 4O2AA 1T1RA 3MCWA 4KO8A 4PX5A 1J7JA 1DEHA 2R85A 4O25A 4N3CA 1F8FA 1VGRA 3DAFA 3EZNA 3BEOA 4NOJA 4AJLA 3TLGA 5JNTA 2ZZMA 2N1MA 2ZQYA 2GN4A 5JZVA 4MV9A 2ZRDA 4I2NA 3JVEA 4E30A 3D2CA 3ISVA 1A7KA 2FK7A 1RWBA 3TG8A 1LLDA 1UKAA 1A9SA 3VFDA 3GX1A 3I2JA 5CX1A 3AI1A 4HVAA 1AGRA 5KOJA 5MN4A 3MJFA 5BOSB 2FU5C 2WKWA 3TUZC 1L7AA 3MCAA 5J5VA 3OCWA 3DMFA 2Z3WA 4FILA 4ZV4A 1ECJA 4QU9A 1E3TA 1S8FA 2VQFB 1U9IC 1P2TA 1K98A 4DLWA 3G2QA 2J7KA 4XUGB 3ZIUA 1Z7BA 2ZE5A 2IDKA 3S1AB 4CLEA 1U5AA 1F6WA 3B53X 5FJIA 3CTPA 4XWGA 3K16A 3UBTA 2VXBA 4XUEA 2IYLD 1FC0A 3B2NA 3F8WA 3FPAA 4H7EA 2ICAA 3LC0A 5U4XA 5LOVB 1IAVA 2FV8A 3QX8A 1IK6A 3IJEB 2HJ9A 4XWKA 2NACA 1RKQA 3W6UA 1CNFA 4KZKA 2H4HA 3G9TA 3HVUA 3W5HA 3HZOA 5D3MA 2O2XA 4KK3A 2VZEA 4NCXA 1ZCAA 4QUIA 4RFSB 3TAXA 4I1VA 5DCYA 2C9CA 1XP5A 4UZFA 3CLSC 2QUBA 2I4MA 4QYTA 3HB1A 2ARKA 3KOUA 3SC2B 1WP4A 1Y6QA 4P5EA 4W5TA 4ICIA 2QUHA 3BRCA 4QREA 5DM70 3M6FA 4CKCB 4A1OA 4KSYA 3BZUA 5JAOA 2BDUA 2JCSA 1KL7A 3F8TA 2Y92A 3ZJTA 3K0FB 3G5TA 4EI2A 2XVYA 4MMZB 3T7TA 2QZ4A 4YN3A 2A58A 4BB6A 1HWYA 2D00A 1V35A 3PJFA 4RYLA 4KAXA 3EFBA 3ELYA 1NN5A 3QBDA 5K99A 1EHIA 4RY0A 1ZK1A 4RSRA 1JAXA 2AN9A 1AU9A 1ZH8A 2QMOA 3RRZA 1SB8A 2WIJA 2ZI6A 3T99A 2X42A 3A2KA 3DHVA 5K5EA 2ID7A 3GAMA 3ZD9A 1E1DA 4B35A 5K01A 1M75A 2H4JA 3L1VA 1PR1A 2CSXA 3RAGA 5AVUA 1UQRA 4KK4A 3NUGA 3KUDA 4K9RA 2QWXA 1HKUA 3U6BA 4MPPA 1U65A 4WDQA 3CU5A 2GK7A 1EHCA 1XQ9A 4UTOA 2WY2D 4LKRA 1T9DA 1V5WA 1ZIDA 2ZUFA 5C8YA 1GAXA 5B2FA 2ENUA 3N2LA 2AA3A 4Y8VA 4CEJA 3N8NA 1G2QA 3IUNA 3OTQA 1U0HC 3DO6A 1A95A 3D8RA 4EPTA 1XZ8A 2M6RA 3KRTA 3MXOA 3E4CA 2O1SA 4KAAA 1XDSA 2F17A 2CVQA 4BMCA 1EDEA 4K03A 3KSAC 3HK2A 3ABZA 4O4JF 2FN7A 2DH6A 4RIIA 4Z4GA 3LY9A 1A77A 4UQPA 5ESXA 4E13A 3MQFA 1OB5A 1G6OA 2QYOA 3P52A 2C0QA 2EEZA 3HDYA 3WYGA 1FX1A 3EA5A 3OQPA 3IRVA 3KLNA 4LYHA 5KQSA 2B36A 4DR1B 5G40A 1Y6RA 2JDID 2YZ7A 4RHFA 2GLUA 3QVSA 2ZYWX 1MD9A 2J3HA 4B74A 1TM3E 1GPNA 1WUTA 3W5BA 4ML3A 3E03A 1M54A 1AKYA 1JG7A 1EAMA 2JRLA 3HCOA 1MO3A 3OJWA 4GI3A 3ZG6A 1DC5A 1W48A 4XIYA 5JOQA 3GRRA 3OURA 3K32A 2WP0A 4Y2HA 5AIAA 5DOVA 5JU6A 5JD3A 4PG5A 4Q6BA 2Z2XA 3G7SA 4QKQA 4L76A 2ZTMA 1HYBA 2GXAA 1TVEA 3MT0A 2ZJAA 4I66A 4C43A 1VMAA 2AOUB 3H65A 2XECA 2EKQA 1T8UA 3O93A 4MRMA 4RMJA 2PANA 4CKEB 2BFEA 3KYIB 3LRXA 1XPOA 2C0CA 4C78A 1NE7A 3KV3O 2L19A 3RQSA 3WLHA 5TPZA 1V48A 3BMOA 3WQRA 1U90A 5E0OA 3S2EA 2UUOA 4KL8S 1Y7HA 2FUG1 2ZLBA 3A3YA 4FLEA 4Q4HB 2HW8A 5ESWA 3BGVA 1N8TA 2O3UA 3RWBA 5KTKA 5HQ3A 2VIIA 1T9GS 3AUAA 1UL1X 2R25B 3AR8A 3KLBA 4OP3A 1OXTA 2P8SA 3R5FA 3QNMA 3RC3A 3PG5A 4FE3A 4AVYA 5U1PA 1EJ2A 3EXG1 1A76A 3AEKB 1QHGA 3A9CA 3EDYA 1E1RD 5DHAA 3EC1A 4NDAA 1Z2OX 4JUBA 1W1WA 1FJGB 4I19A 1W29A 4X62B 2ZWOA 5C7YA 5KWEA 3GLQA 1O95D 2A8YA 4OXXA 5HBGA 1BO6A 3QFRA 3HFJA 4Z9AA 3ACDA 3KXLA 4Q00A 3NWPA 1GPWB 5E9WA 2YMMA 2HYDA 3BFPA 2ODWA 3VPSA 5LPNA 3NIDB 2DR0A 2OAGA 3H11A 4GP7A 4NENA 1SU4A 2O07A 2PQ2A 3D3JA 3L3BA 2GS9A 3T7AA 5THXA 4PAMA 5ICGA 3DPUA 4JR2A 1ULUA 3WQSB 1TZJA 1HDEA 1THTA 4NYIR 4V3CA 5J4LA 2VHWA 1O5OA 2HWWA 3ZU3A 1OYVA 4P92A 1LXCA 1YO6A 2CNBA 2Q9CA 4JWKA 4W5JA 4BTVA 2C2YA 5B53A 1JF8A 3FGPA 3G9ZA 4HXYA 2LIPA 3INTA 3M9LA 3WTBA 4G25A 3RADC 2VS1A 3RSCA 2NSDA 1ZY2A 1GU0A 1IY9A 2R8RA 2Y1FA 2R00C 4PRZA 2BSQA 3K92A 3HMKA 2BTOA 1N0VC 2EGGA 2Y99A 2OA0A 4RTQA 3RNOA 5CB0A 2XCSB 3DMTA 3H84A 1MO6A 1ZBDA 4FBLA 3UYLA 3I42A 3S7ZA 1VJTA 4LOHA 1Q3HA 1E62A 5D51S 4Q4AB 1VE9A 2AR0A 4MO2A 3BIFA 4N8SA 3P71T 4WCVA 4YH1A 4DLSA 1GPMA 1PK8A 2Y1OA 4INOA 4ZRDA 2BMJA 3E5MA 3Q7EA 4TQUS 4AU1A 4TTPA 4CR6A 2R5WA 3M6XA 3Q9LA 2OYSA 1A5ZA 3P5SA 4GI7A 5K0GA 5J43A 3I9V6 4L16A 3MT9A 4DWOA 1XTJA 3STWA 3NTRA 1LSUA 5EP4A 3U26A 1VI6A 4KV9A 3THRA 1RQLA 2I2CA 7REQA 2GI4A 1E79D 1Q7EA 1GCGA 1TA4A 1TAHA 3WISA 5KOHB 5AICA 3OZTA 3DBIA 3UJBA 1U31A 3JQ8A 1BCRA 3BH0A 2QEQA 3EGCA 3K4PA 1FXSA 4EYEA 3SVLA 3U7EB 1O8CA 5JZBA 1HL3A 1QONA 2Y6UA 1YI0A 1DKUA 4DRXB 1T0JB 3HYCA 3I2IA 2AOTA 2DKOA 2H11A 4A6XA 4YMWA 5I9LA 4NULA 5ELMA 3TQHA 3DOJA 2NT4A 2BFAA 1W30A 4OLFA 4F7WA 1OIWA 3OP1A 4PLTA 1NNI1 2C2BA 4KQXA 2GVZC 2EHDA 4JLPA 4XUCA 1V4NA 4JP1A 1JPVA 1YKFA 3B1ZA 3V34A 4H3KB 1ESNA 3DUFA 3USES 4QOEA 2ILVA 4YJHB 5EIHA 5JFOA 5LUAA 1VB3A 3JAWA 3DCYA 3F8SA 2Q3BA 2XGJA 5JNSA 1XV5A 2QIPA 4JP3A 4PGFA 4BJ3A 3AVUA 1H6CA 1YVDA 1CCWA 4PX9A 1B4DA 3H6HA 2FVYA 1SZJG 1WDWB 2YY7A 4WESA 4EP1A 4QPDA 3JR3A 3K2QA 2QG6A 1OPRA 2ECOA 2J1LA 3HQ4O 3CUUA 4OKIA 2QTZA 2EQAA 3L7LA 4XEHA 5CDYA 2ORIA 4NKRA 4WCFB 5TQ0B 3RU3A 4FYKA 4GZLA 1OXBB 5DLPA 1D2EA 1ZGGA 2XMSA 4JJEA 1OXSC 1ORRA 4XWTA 1HUQA 2CCJA 3IP6A 3HZHA 4OMUA 2QN8A 3NPMA 4URWR 2IYNA 1JMYA 4F3YA 1ISFA 2IY8A 2A9PA 2GSWA 2JIZD 1E60A 4A0HA 3UTCA 1SBTA 3ZWVA 3TB6A 3LQ1A 4LMAA 4C6TB 1AKTA 1GG9A 4XCXA 1EE2A 2VQEB 4BE4A 2ZRLA 1O94A 5GINE 2RGGA 4G41A 1ZMRA 2GEKA 4NZNA 2KW5A 1EUCA 1Q5PA 1TYZA 4E2XA 2VDLB 2P11A 1XT6A 2VDWA 3GJ4A 4JC8A 4UEJA 4JH0A 5T5QA 4JBXA 2GWRA 1QOPB 3PXAA 4YI3A 4DV0B 1CQIB 1M0WA 4BNGA 3VHQA 1CDOA 4HTFB 2C4TA 4BZZA 5HMMA 3F2VA 3GGGA 5JZOA 4LY0A 1YVRA 2PWPA 3M7IA 3SP1A 4A0RA 1ZCZA 4PCUA 2EP7A 5F5XA 821PA 4EG6A 2I2FA 4GXNA 4KQKA 3WLOA 1KTIA 1UMKA 4IJWA 5AK3A 3CVOA 1CDEA 1EDZA 3BRSA 1Z5GA 1A9TA 4KQFA 4Y9RA 5AVSA 2WB2A 1PBTA 2KS6A 3B82A 3KQYA 4B3HA 3NUQA 5EUQB 2RI6A 4AG6A 1NY5A 2IYYA 5DNVA 5EESA 1GVHA 2A6PA 1QKKA 1QGDA 1SVSA 1OIVA 3C7KA 3FPEA 3G5UA 4LBVA 3U7QA 1PX0A 4LDPA 2L18A 3D8UA 3CS3A 4IEFB 2ZREA 4RHUA 2EF0A 3ZZ0A 4D46A 4F5ZA 3DS8A 3ROEA 4GRDA 4CPDA 5AIBA 3DYIA 4I5IA 2AWOA 3UC5A 1ZIOA 4TZTA 1M1UA 2DBRA 3H1GA 3QEMB 3M1LA 5BRAA 5AVKA 3G7NA 3GZTB 3CN7A 4CG2A 1KEEA 3HNOA 1HLPA 3AUXA 1IHUA 2B5OA 3QMVA 2OORC 3Q3CA 1Q22A 3QJYA 3U09A 4I5FA 1I0IA 4F85A 4YYZA 3C14C 1WW2A 5KYYA 1JLKA 1LBEA 2J5XA 2J6IA 4H1WA 3OZBA 2JLBA 3GAAA 1JIXA 5IJXA 3LYAA 1A96A 1DEXA 1M8JA 4IJ6A 1YKGA 3C3KA 4HQFA 4NEQA 3BRQA 4PYNA 4FHEA 1R8JA 1V7CA 1YU9A 4WLNA 4BWYA 4NCBA 1MC4A 3O9MA 3UQZA 4XFDA 1OKKD 1X42A 1Y1TA 4HL6A 1ZN9A 4XX0B 1PWXA 5A6VA 2J67A 2GUWA 3EXAA 5EL0A 1TFRA 4MA5A 1RPJA 5CM2Z 1Z4JA 1KVSA 4NICA 4Q16A 1Y6JA 3LQKA 3QBEA 2PL5A 2VQSA 3FBGA 4M9XA 4QBKA 1X3SA 1I2MA 2V1UA 3IESA 2IYTA 2IZZA 3GH1A 4LY3A 3RVRA 4BO6A 4JWTA 4CKYA 1VQ1A 1GO2A 3NVDA 1IFXA 1RQPA 3A70A 2FN3A 1E96A 5H3HA 2XRMA 3AEYA 1QFZA 4B7XA 1I3MA 3UY4A 3CF4A 1CUAA 3D59A 1LCIA 2JA2A 1N9GB 4GICA 2DB3A 3ROQA 3B12A 3CW9A 1QBGA 2QPTA 4RZ3A 5CCXA 1O9HA 2E4VA 2DYKA 2X7XA 4JQZA 3ZV6A 1KERA 5K0ZA 2WD8A 4U39A 1VTKA 4BGEA 2FJUA 3LX8A 3PLNA 3PHHA 5BOSA 5CTAA 1I2DA 1SKUA 4DIFA 1B16A 3RU7A 2RGUA 3L7BA 4UTZA 1GU1A 4JNKA 1E4OA 4NY1A 4FP9A 4Z1MA 4PZEA 3UJDA 4BMSA 1JPUA 1E6EA 3WWYA 5BQXA 3SVTA 1E9FA 2Q1SA 1MX1A 3S1AA 4UOZA 4B84A 5JPIA 2O6LA 4QYWA 4DE5A 2P9FA 2IDZA 4YRPA 3VPBA 4DLAA 2FEWB 3RSSA 4TYNA 3H05A 2GHRA 4QARA 3C3DA 1EFRA 1CYDA 1T26A 1VL6A 3GPIA 4D4JA 2XRYA 3ZHTA 4JVLA 5LOVA 3D6JA 1H0KA 1P2UA 4YJDA 4EUFA 4JROA 2LW7A 4BVBA 3COVA 2CKMA 4OXYA 3KZNA 1J97A 5BR7A 3TRHA 1T4MA 4D02A 1OH5A 1R6VA 1ZXXA 5A0TA 1Y98A 1NN0A 5DNDA 1NBMA 1Y9DA 5DWDA 1K86A 1XTTA 3E7FA 2DR2A 1ENPA 2V8OA 1P80A 1S3SA 2V97A 2WD9A 3CH4B 3E1KA 3SDZA 4RFSA 3OEYA 5BO5A 3NGXA 1TYEB 2IUEA 5ALPA 3GL9A 2FVXA 1P4AA 2LXNA 5BOVA 2BOVA 2GVDC 4YRLA 2CE7A 3SC2A 3TDKA 4MVJE 5HSGA 3BGSA 3IRUA 2RK4A 2WWRA 1ZQ1A 4WT7A 5EP1A 4YRSA 1MHTA 3SYMA 2HPZA 4KXUA 4CKCA 2GZMA 2BI4A 1KIFA 4TLBA 1EX9A 5F7ZA 3QU4A 3K0FA 1U04A 5A9TA 4JXJA 2HWKA 4YAFA 5FLEX 3SYNA 3KAQA 1R8SA 3DE1X 4LZZA 1BWPA 3WWDA 2D1QA 2DOKA 3EPJA 4GZ6A 1D6NA 4B40A 5IM4F 2ZBGA 4AP5A 4AMBA 4JHLA 1FYVA 1SOWA 3M82A 2SNIE 3RIMA 3JCZA 3DJYA 2FHSA 4FNMA 4OHYA 1SD2A 9MHTA 3OZVA 5IJ0B 2JCXA 3ZZTA 1BH2A 2XAUA 1YRYE 1FP6A 3FPGA 1VZ3A 2CVFA 3PQEA 3YASA 3CZPA 5FH9A 3IUBA 4C6RA 4NFYA 4OHOA 4FNGA 4BECA 2EP8A 1RE0A 2RAPA 1HEIA 3HFGA 5EE0A 3ZJ4A 1QO0A 2DLNA 4FGLA 5DSXA 4EEZA 1G66A 1ZU5A 3INGA 4FR0A 3H99A 3MUEA 3ERCA 3ESBA 3EG9B 1R10A 3IV6A 4WLOA 3U2QA 4CFYA 5C1PA 2I5PO 3TLZA 4AULA 3GLGE 2VNKA 3MJCA 3FKJA 1VG1A 1WMFA 4NCIA 3R0ZA 1UJ4A 2WSBA 3DH0A 1F2DA 2HRZA 3ONWA 3T3IA 3L4KA 4FDTA 1TB4A 3LBAA 5TSDA 4QBIA 4XVHA 5JISA 5IH7A 2BVNA 3F90A 4RZXA 5EE5B 3S2ZA 1I7DA 1NNLA 3AEUB 4ZTBA 1ZMXA 1LLUA 2Z57A 1LW6E 3KFLA 3TKYA 4E2WA 1W8IA 3L1JA 1CRPA 3L0BA 4BX9A 3ZVKA 1FK8A 1VLZA 1C1YA 3G2IA 2ZB4A 1II8B 3BK1A 4OYHA 5K0LA 4AS2A 4DCJA 1CFZA 3NOXA 4HRAA 1GRRA 5IJWA 5JXHA 3EVEA 1J2RA 3PGKA 1QDLB 3W77A 4ZKEA 4CG1A 3CX8A 4EVSA 1KQOA 3CVUA 1GZ6A 2XXAB 4IZ6A 4JLNA 1A27A 1Z8NA 4IFTA 2WTEA 4BC0A 3O0TA 2E7ZA 2XB6A 1VMEA 1HDGO 3QY9A 1ISJA 4LNUB 2J59A 5CURA 5K6AA 3KB1A 2BY4A 4NMLA 3QVWA 2M6LA 3IBGA 2VJOA 4UVEA 4B3FX 2XUGA 2E85A 5DNAA 3M34A 1UQUA 3ZUPA 1NP6A 3UK6A 4L74A 4ETWA 2PCLA 1XO1A 1P6QA 3OZIA 1BS9A 1DEAA 3AJ9A 3G0HA 1U98A 2AOUA 1YXMA 3ZGXA 3S4YA 4CKEA 2IPOA 1IXKA 3M3DA 2VC2B 5LP6C 1DO2A 2UZ0A 1RHKA 3BGIA 3GFRA 1ADFA 1KVQA 4J4HA 3BIXA 3NT4A 3NB0A 1V96A 4JX9A 5K8UA 1CG6A 4WFIA 2JJQA 2GOYA 2JGLA 4GOXA 4KIUA 4Q4HA 2FUNB 3PL5A 4R1LA 4RM3A 1DDIA 3T7IA 2ONZA 1OYOA 4QT4A 1I51A 1RAHA 4OOEA 1J2YA 4HH4A 4LPSA 2CLLB 4A5SA 4NE2A 4UM5A 2Q1UA 3HLTA 1NX9A 2XLCA 2NZUG 2PH1A 2VEOA 1PR6A 1I1QB 1BIFA 3LT0A 1Q2XA 4MYRA 1NDHA 3KQSA 1RAEA 1G5QA 3E7DA 3AEKA 4KACA 3TTYA 1CUSA 3ETGA 3JWEA 4FDVA 2PSDA 4I55F 3NXKA 2BWJA 4UM9D 4I9HA 2C9ZA 4P0QB 2Z43A 4CF7A 2C5BA 3PYLA 2C54A 4P2BA 1ZEJA 4UHFA 2HMTA 1PW5A 1YS6A 3PGJA 4JX8A 4EB0A 3ER8A 1LPOA 3BE8A 3BFXA 5AKYA 2WJPA 1SHTX 2RHMA 1AKUA 1JKFA 3KHKA 4NU8X 3RC7A 3W6PA 1JGTA 2XB2A 5B1SA 2H16A 2XUDA 3QKUA 4OXKA 3A6JA 3T8YA 1U0BB 2I0FA 1U0RA 4Q37A 1SVLA 3PFNA 3HJNA 5CITA 4JOQA 4L4UA 2PUFA 3UXEA 2COEA 3IKMB 3N2KB 5LZ8A 2O7VA 4NG5A 4AJ1A 3SY8A 4HJRA 1OD6A 3H17A 3IUQA 4H2DA 1YQTA 3R7LA 3UIEA 1PLKA 3B70A 2VKQA 2H7CA 2X5JO 4B7UA 1SQGA 2YH2A 2AQKA 2R7AA 3UT5B 5KHAA 4OFWA 4D9NA 3NBFA 3IPRA 2XAAA 3QYFA 2P69A 1Y37A 2AFIB 3HDGA 3OFVA 1C0IA 4KSBA 3IDAA 2IS4A 3E1SA 5BQOA 4AUEA 4WZAE 5D86A 4E1BA 2EQBA 5FBLB 1H0HA 1BH6A 4MGYR 4JV5B 4HBGA 1CY0A 1H6AA 1YZNA 5CVVA 1F0PA 1CJBA 1FLNA 1U4SA 5JJLA 2PR7A 2DGDA 1YVEI 1KAEA 3WFZA 4QVKA 4COOA 3KFXA 4Q4AA 4EBFA 2WIAA 1IATA 3D31A 4YWJA 3TL3A 4C88A 1Z0SA 3L4EA 4HT3B 2YVQA 4W5WA 3RK1A 2H52A 4DCVA 1JHPA 4Y6QA 1U2TA 4LWQA 2B5WA 3PEEA 4PO8A 4YJ2A 1JA0A 3NV9A 1HE3A 1NQOA 3F7MA 1B6GA 1I4TD 1IB0A 1OU0A 2ZI9A 4G37A 4GM1A 4YACA 1PE0A 4GR5A 4EB8A 2AZTA 1TEZA 4EA6A 3UJ3X 2JVIA 1XZKA 2C1EA 2HT6A 3HBLA 4JBNA 3OFJA 2OG2A 1KAOA 4KGXA 4XIGS 3V9PA 4DWVA 2XUHA 5KOHA 1OTHA 4YV2A 1QTRA 4U7DA 1S5PA 2QP4A 2Z6VA 4MOWA 1OBHA 2IQ5A 4J7AA 3WJ7A 5C8DA 1UM9B 4MKRA 2WC1A 3IE2A 4DRXA 1DMRA 4TT3A 1CDDA 1UF9A 2EFGA 2PKRA 4NSNA 1HDYA 3PB3A 4PZZA 1WO8A 1LNSA 2VFAA 1JDBC 1PJLA 1D6MA 4QPPA 2ZPAA 1BAPA 4HDSB 4HV4A 3VDXA 5DGHA 1E2DA 3E61A 4Z7QB 1E3LA 2V0CA 1C81A 4PZ9A 5B7PA 4DR4B 4YJHA 2RB5A 3K05A 4KQMA 3QLUA 1U1CA 1Q0UA 2I2WA 2J0SA 2RGRA 1DUSA 2WUGA 2F3RA 3WB9A 1U8TA 4A03A 3L7JA 3FHCB 4TYPA 4AY4A 4RHTA 3NQ41 1Q15A 4PHFA 2I62A 2QUJA 3F4LA 3X2SA 5P8WA 4ES6A 1WM1A 1FB5A 1T0HB 2JGJA 1UK8A 2ZE7A 1RPAA 2GDJA 1GA4A 2QRUA 2Q50A 4KQ1A 4YDSA 4CMEC 5CFRA 1KNXA 4A36A 2IIBA 2LZ0A 4UVGA 4DPLA 1VHJA 2WWFA 3BHNA 4WCFA 5TQ0A 3WYCA 1YB2A 4YQYA 4E46A 2V7XA 5A04A 4IV8A 4QYXA 1ZINA 3V32A 4IYRA 3QRWA 3VR4A 1VP9A 5J4VA 2C5SA 3UN1A 2QW0X 4TROA 4FW8A 3OPMA 1DC4A 4JJ6A 4H77A 4MAAA 1YE8A 3W3AA 3TE7A 4GEGA 3LHSA 4GMXA 1UK6A 3DFZA 3USCS 4YRTA 4C6TA 2N1BA 4DR5B 2C9OA 4UJ3A 4BWGA 3PYMA 1W75A 2AUTA 3IT1A 4XLTA 1KR5A 3KAPA 3KKZA 2RJOA 4G8JA 5JJCA 5LR6A 5GONB 1MC5A 2VO1A 4IXWA 1U0TA 4M1OA 4OI4A 2VP3A 4I1YA 3IAUA 2P3LA 3GHYA 4JC4A 3ZK7A 5IJ9B 1MX5A 1P7CA 1NHGA 2ATXA 4MV4A 3VZSA 4F04A 4W5NA 4E31A 1CQIA 3V2IA 2LUOA 4PG4A 4YAOA 3LD9A 4HTFA 4TSRA 1VCNA 1YR9A 4FONA 1TA9A 1DEOA 1T1IA 1XQWA 2XMQA 3FOCA 1V8FA 1PN3A 3JPWA 5AYVA 4TRRA 2M1ZA 5T3YA 5F4BA 2YYYA 4MJ3A 4WGGA 4KWHA 1OQAA 3T7JA 2G06A 3KEFA 3RVNA 3IT0A 4L50A 2DEUA 1TM1E 2I3AA 2PAAA 3R41A 5DW3A 4EZEA 2VZ0A 4AFNA 1TVKB 2XB4A 2QW1A 3Q9NA 3FM9A 4P5DA 1J90A 3KR0A 3VR6D 1TK2A 3ASVA 3MRXA 4Z4CA 4I81A 1ML4A 2FWIA 1UUFA 2K87A 2C4MA 2ZETA 5KWVA 3JX9A 1OJ7A 1TO6A 2PWYA 3KU4A 3R9XA 3P2MA 5I5EA 1RXWA 1TW3A 3OQIB 2VSOA 3W6OA 1P5JA 3PWTA 2JIOA 3K5IA 4O2BB 3TW6A 4DA7A 5JTTA 3A4VA 3WOHA 1JIUA 1W73A 4HKTA 4TTVA 1MEEA 1QPGA 3QEMA 4IO0A 3ZWAA 5BP7A 5I4CA 3NH6A 5BNWA 4FNOA 2PX8A 3WNZA 2VATA 4ZDJA 1EGHA 3I2KA 3UHJA 3F2IA 4LBYA 5JRZA 2FGKA 3OO0A 1I9GA 1DBRA 4QGFA 5IANA 4XPIB 3E81A 3ZDDA 4E14A 1E3WB 3BTOA 2BFDB 3LPCA 3VO2A 4DB2A 2W2KB 3E0XA 4DHWA 3ZXXA 4J2HA 5IS2A 1TPZA 4PYIA 4ODIA 4KFTA 3MSCA 2VQ6A 5HFAA 5JD6A 1EDBA 1C1XB 1IN6A 2PS3A 1Z28A 3MB8A 1JWLA 2AFHB 3SCZA 1FQOA 4U7WA 1SUBA 1RKBA 2RMKA 3QWAA 4XX0A 4LV8B 4WIAA 1ADBA 3TINA 1BE8A 1YUNA 1D2RA 2BEKA 1EVEA 2PLAA 3PT5A 3RRJA 2VEDA 1LY1A 3AGQA 4LHEA 3ZCVA 2P30A 3KXIA 5PGMA 4EYQA 4Z7NB 4L1KA 1I6WA 5AVVA 4CLXA 3E18A 3TIFA 3WIUA 2X7JA 4EPXA 2BYTA 3FLEA 1M1YE 2VT7A 4YRNA 4LBZA 3AHIA 3HXPA 4UASA 2ZR7A 3NH9A 3O83A 3GWZA 1VSVA 3AG6A 3L01A 4FZRA 1E2KA 3B7WA 1DKLA 5BSTA 4FMPA 2I67A 4OHKA 5IZCC 4TZKA 2FPOA 3VVCA 1K3FA 3ZY3A 4FJ2A 1N9GA 4AT1A 3DLHA 2FWMX 4TL8A 3HE3A 3AP2A 1G5RA 4QATA 5IDVA 2OBNA 4QGHA 3LC1O 3TTTA 1M33A 3V4SA 2P5TB 5CFZA 3SZMA 5CGQB 2DFLA 1YK1A 1JSLA 2XT0A 5LZ9A 4YAKA 3LX6A 10MHA 1V8DA 1R27A 4CMHA 2GBLA 4BMPB 5TS2A 4QAQA 1C7IA 2WJIA 1R6XA 1T91A 2I22A 3K2BA 3KQWA 5A05A 2AFVA 4X1IB 3V2UA 3LKBA 4C2AA 1AXEA 3JQBC 2REQB 3D3EA 4AF8A 3KT0A 1RQRA 2LKCA 2GCEA 1Q17A 2XV1A 1FTQA 4DSNA 1QDUA 1VRCA 2UDPA 1FU4A 3A9WA 5FUMA 3TTWA 2YIJA 4J43A 5IFKA 4QXQA 2ZTSA 2WIDA 2QQ0A 4MV8A 5FPTA 3FN4A 3T5CA 3O95A 1OOEA 1OT3A 1VBMA 3FWHA 3X1DA 4CVNA 1CU1A 5CT6A 5KYUB 3CINA 5D5HA 4KBYA 3BREA 3KSMA 5SYAA 2R4UA 4I6EA 2PXCA 2VLIA 3VOAA 2JW5A 1O57A 3E22B <