4CLXA

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
267
structure length
251
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
molecule keywords PTERIDINE REDUCTASE 1
total genus 96
structure length 251
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4clxA00
1MGOA 4JBHA 2W4QA 3LZ6A 3ZHBA 3KEOA 3O4RA 1B3RA 2EW8A 1LBEA 2V6GA 3QWAA 4URFA 3OP4A 4XKJA 3K73O 4O63O 1Z7EA 4XCVA 3WGTA 1SZJG 1JW9B 1LRKA 1X0XA 1Y5RA 1K0UA 4QEDA 1HE3A 2GDZA 3L6DA 1KVQA 3KB6A 4UVIA 1PEDA 2JHGA 4N5LA 2D5CA 3GMSA 3RIHA 1EVYA 3JYNA 4TWRA 4NBVA 1KC3A 2YDYA 3ZNNA 3WGZA 5CHEA 1IPFA 3BMOA 4OQZA 4FW8A 4OSOA 4JROA 5CPBA 2VTEA 2W2LA 1YDWA 1QKIA 3ICPA 3QRWA 1LLDA 3P2OA 1GCOA 1SMKA 3JQCA 4WCFB 3TNLA 1QMGA 2EW2A 3WGQA 1Y1PA 3LF2A 5TNXA 4AJIA 4G81A 4KP7A 3RU7A 1P1HA 2GGSA 4NBTA 2VWHA 2W8ZA 2ZQYA 1PSDA 2R00C 3ZV6A 5I7FA 4FFMA 3L6EA 1U8XX 1I3MA 3PVZA 5L4LA 4AJNA 3K9QO 1LX6A 1ZH8A 1B0AA 1Y81A 1EDZA 3OF2A 5IJZA 4TROA 1EVJA 3MJCA 1BRMA 5U4QA 3PJGA 1BG6A 5JCJA 1A5ZA 5A9SB 4II2A 1ZFNA 4AJOA 3JV7A 3TFQA 5BSGA 1XU7A 4E5KA 2B0JA 3F1KA 3QSGA 5DBGA 2C54A 4H3VA 2G17A 2V65A 3H3FA 1EQ2A 2POQX 5F3RA 1PR3A 2CDBA 4DLLA 1T1RA 1SEVA 3JQAD 3FI9A 2FSVA 4UUMA 4MIYA 2VYND 1WDMA 2FN7A 3EDMA 2FPPA 1DFIA 3AUTA 4DPKA 1GEGA 4ZQBA 3S2IA 2HK8A 3RBZA 3RFVA 5FYDA 2IODA 4XRGA 1V9LA 2Y93A 5JMWA 4DPLA 3LYLA 2WYWA 4NNJA 3PHIA 1E3LA 1TT5B 1PQPA 4YT5A 4TKLA 1KEWA 1ZK2A 4WASA 1XWFA 4GLOA 4CMGA 1P9LA 4TSKA 4FFOA 2DM6A 3U09A 2C20A 9LDTA 1E3SA 3DB2A 4KOAA 5CDSA 4AFNA 3WTBA 2XXJA 2C5EA 3AM4A 3PTZA 4XDZA 4D41A 4BV9A 5JYEA 1HLDA 1K89A 2C07A 5A9TA 1S7CA 4F45A 1NWHA 2VN8A 1TB4A 3K2EA 3P5SA 4YVFA 2Z5LA 2VYNA 2R00A 2DT5A 3O26A 1I2ZA 4XIYA 5ER9A 4BNNA 1B8PA 2RHCA 4R1NA 4ZQHA 3OQ6A 1F12A 1H6CA 5F1OA 5JE8A 3U4HA 3EVNA 4A0SA 4A7PA 1VKOA 4YXFA 4ALJA 4BIIA 4U6SA 1DBVO 4YRBA 3RU9A 4PIVA 4D3DA 3MJTA 4E6PA 1GL3A 3PGXA 3BAZA 4ALNA 4WLNA 1E3WB 4OJNA 9LDBA 2BFAA 2P2SA 4B7XA 2EEZA 2X58A 4RPKA 3GEDA 4L74A 2QZ9A 3C1OA 1IHXA 3M1LA 4LVCA 4RVUA 3TF5A 1KVRA 3ADPA 4JIGA 2XXBA 3W8DA 2Q99A 4GWKA 4CMCA 4UAGA 3ZZNA 2AEJA 2ZTLA 2QHXA 3AOEA 4R3WA 2FP4A 4D0RA 3UAGA 1X1TA 3CXRA 3BTSA 1ZXBA 3ANNA 3Q1LA 1VSVA 5DZSA 5TT1A 3L9XA 4ND3A 4XZ3A 2AQ8A 4GX2A 1E6EA 4OQYA 1D4FA 4PLWA 3WTCA 5CP8A 4DRYA 2HMSA 4CV3A 2VRCD 1ISHA 4W99A 4Y98A 4D7AA 3HHPA 5HS4A 3ZHZA 5I7EA 4DREA 1YGYA 4HBGA 5L53A 4I9UA 2YHUA 1GUYA 1R66A 4PLCA 4J0EA 4BL5A 5F5NA 4DBVO 3OJLA 4KTTE 1ARZA 1K6IA 1N1GA 3ITKA 2DUUA 1ISJA 5KJFA 4ND5A 2AMFA 4DMMA 3TZ6A 3DOJA 3QY9A 2O3QA 2WJPA 1CWUA 1MC4A 1X15A 1JVBA 5A3JA 3TDKA 2OBYA 1PGJA 1OC4A 1UP6A 1UH5A 2BRUA 4R4JA 4RQUA 1EK6A 2G1UA 2NNLD 2GRAA 4IDFA 1IULA 1XU9A 4R5HA 4R51A 4AJ1A 3T7EA 4WUVA 1SOWA 2X0IA 1SCUA 1P1FA 2R6JA 1B14A 5A02A 1NX6A 3GVIA 1FDVA 1K2WA 2D4AA 3N7UA 4XEHA 5JMPA 2Q2WA 5T6BA 4E5NA 3VZPA 1YQDA 4MP3A 4J7CA 4QSMA 3C7DB 1VM6A 2FWMX 2CSUA 3DBVO 2YFQA 3EVTA 2NADA 2A35A 3RBVA 3V2HA 3UVEA 5ITVA 1G0NA 2ZTUA 3GAZA 1CJCA 5TLSA 1GQQA 4DIOA 3RD5A 5T64A 1Y8RA 4WEOA 4GMGA 3GR6A 4PLTA 4Q3BA 3S2EA 1GFSA 3GY0A 1O0SA 4QQRA 2UV8A 4WPGA 3ROPA 3GUCA 3TZCA 1B8VA 4J4BA 4RQTA 3EAGA 2Q1WA 2E82A 3X2FA 1WW8A 3HQ4O 4NJOA 5EMHA 1EBUA 4JK3A 4YJHA 4E5YA 1H93A 4R1SA 3DHEA 4BO2A 1JDJA 3ZW9A 3KYCA 3BIOA 1I32A 4R16A 1P74A 1E1KA 3PJFA 4I5GA 4Z3DA 2GNAA 1UZNA 2X9VA 3LC2O 5JFOA 2E48A 1D1TA 5EERA 3BMCB 3K92A 4B4UA 1ZK1A 4YRAA 5BNTA 1CERA 2AEFA 3UW3A 4I5FA 4Y6SA 3QJ5A 2I6TA 3UH1A 1QYWA 4EW6A 1VJTA 5TJHA 4M8SA 2W90A 1KEUA 4PZCA 2HMTA 4I8XA 1V0JA 4KUGA 3AI3A 5CEEA 3NT4A 5G0VA 3JQ9A 1P0CA 2DU8A 4CUZA 1GQ2A 2X6TA 5JY1A 1GEEA 5CEJA 1JU9A 4CLOA 1U9JA 3JQGA 1UXJA 3HDYA 4NH4A 4U7WA 4KWHA 3D5TA 3OQBA 5BSFA 5CDGA 5KVCA 1LDMA 1QYXA 3BHMA 4IZHA 3TPCA 1QORA 3OEYA 1T26A 1DJNA 3QVXA 1KBZA 1GZ3A 3UOGA 1W0CA 3WGHA 3WGOA 2GN8A 3F4BA 1F0YA 3HADA 1LDYA 4BO8A 3K8ZA 3M6IA 4IXTA 3DZBA 2HJSA 5EQDA 2BFMA 3C1TA 1GU7A 1A9ZA 4GQAA 2LDXA 3WSWA 5A05A 4S3MA 2HCTA 4RPLA 2HUNA 5KJ1A 1CIVA 1F17A 3W8EA 5JS6A 2BHLA 4JJFA 4YR9A 1TT7A 1MV8A 1RYEA 1H9BA 3NDRA 4YJFB 3DL2A 3H3JA 5I9NA 3ZV3A 4JP3A 1NQ5A 3QP9A 3ZCXA 4H15A 5K9ZA 1XG5A 1I30A 3WYCA 2PZJA 3DHNA 1BHSA 1PJQA 3Q6IA 2VTDA 2IYPA 3DBHB 3C85A 3K30A 4FPXA 4CLOB 2NM0A 2C2YA 3PHJA 4I08A 5JCXA 2J3HA 4XQEA 2FR1A 1X7GA 2OUIA 4IJUA 3ONDA 1B7GO 2HMUA 4RZIA 5BSHA 3F3SA 3UKOA 5ICMA 5JC1A 1HE2A 4YAGA 3ONFA 1H0KA 4R9SA 1ADBA 3ZN2A 4EGFA 1IZ0A 4W7IA 1U4SA 1NASA 4E3ZA 2Q1UA 1UXKA 2HDHA 2X9GA 3GGGA 4M87A 3QV1A 2NTJA 2Z1MA 3WXBA 5IF3A 2DBVO 5ITWA 1GD1O 3M2PA 1PGQA 4YACA 5THQA 1BW9A 3UCFA 2CVOA 1KC1A 3MJSA 3G1UA 1WXDA 3RC9A 1C1DB 2P5UA 5I9MA 5C7LO 3KYCB 3U4IA 1YOVA 3JYLA 3VC7A 3CMMA 3ZU3A 4KMSA 5HRUA 4YJHB 5FF9A 4G5HA 2RHRA 4H7PA 3KSDO 4PFJA 5I7SA 3R1IA 4UULA 3PLRA 2DBZA 3VH4A 1MFPA 5CPFA 3ZV4A 3NUGA 3FWZA 3HB5X 3TN7A 4R1UA 4AJEA 1XKQA 1Y8RB 3BMCA 1X7DA 1EDOA 2HO5A 4OOEA 1LDGA 2FSSA 2YJZA 1R4MA 5DT9A 1JLLA 4IJVA 4LRTB 1VSUA 4E2ZA 4QTZA 4E12A 4Z0TA 4RORA 1EMDA 3U5TA 1H9AA 1O89A 3UF0A 3EYWA 3FR8A 1DIHA 4BMNA 4NFHA 4OXYA 4M89A 3TFOA 1E7MA 2O3RA 5L3ZA 1NNUA 1ISIA 4A73A 3GG9A 2HRZA 2HSDA 4XX0A 2VHYA 5F1KA 4ALKA 2O7QA 2NLOA 1X7HA 3MWDB 2X9NA 5AXCA 3JYOA 1E1MA 5DP2A 1Y8QB 1RM0A 1P1RA 1LSSA 1PJ3A 3H4VA 4MKRA 1BVUA 1LUAA 3ZWWA 3BTVA 3VPHA 3VKUA 1TLTA 1PQWA 2HU2A 5IDWA 1Y5MA 3QHAA 2D3TA 4BO1A 3GNTA 4DPMA 3NJ8A 4HFMA 4ILKA 4BNXA 5FFFA 3CEAA 4Q3EA 3JD4A 4QO7A 2QZZA 1WZIA 1YOVB 1PS0A 4H16A 4JQCA 1L1FA 1T1SA 4RJTA 1HDYA 2Q4BA 2VYVA 4BNTA 3N58A 3OBBA 4O1MA 2I9PA 4J6FA 1EZ4A 1GQYA 3K2BA 4WCDA 1RM5A 3E5MA 1WAMA 4NK4A 3HJAA 4PGFA 4R1TA 1IZ9A 3CINA 5C7IO 2C7GA 1C14A 3NJ4A 1X0VA 5T8KA 4HNHA 3D1LA 4DVJA 5L45A 3FWNA 4WLVA 1N9GA 3JQ8B 2WM3A 4QT0A 3WSVA 4S1VA 2VUUA 2V6FA 3G1TA 2PH5A 5TT0A 3D7LA 1ZSVA 3WBFA 1EUDA 4RPGA 3BA1A 4DA9A 1WP4A 2JHFA 3FN4A 3AOGA 1HYEA 3IS3A 4ZQEA 1C3VA 4QFDA 1YL7A 3U4DA 1OZAA 3DZGA 2Z95A 3ZNPA 4LSWA 4N18A 1QSGA 3I9OA 3OJFA 2QQ5A 3COSA 5KNLA 4CM5A 5JDCC 3CE6A 5JXWA 1NHWA 1P31A 1ZJZA 1W8DA 3U62A 4JXKA 1FDUA 1XA0A 2VOJA 3I23A 3T4EA 1MB4A 3GHYA 2D59A 2FPGA 2VHVA 3ZGYA 1NP3A 3LU1A 4J91A 3FNGA 3GF4A 1B26A 1Y9AA 3BTOA 4OSPA 1ZNQO 3E18A 3PPIA 4XQ9A 5KWEA 2O2YA 2EG9A 4KQXA 1UAGA 2OO5A 2EGHA 4BO7A 4YYZA 4XJTA 5HA5A 4D43A 3OETA 3ONEA 4J43A 1DHTA 5T57A 3GVXA 4FBGA 2NVUB 4EUFA 2WD7A 2FRDA 1BXGB 4RF2A 4OKIA 4EEZA 1XHLA 3EGOA 3IQDB 4CMBA 5BNIA 3PFFA 3OA2A 5TC4A 3V2UA 2GERA 5IDQA 2EJVA 4BMSA 1EEHA 3ZWOA 1PJTA 1WMBA 1V3UA 4OKNA 2D2IA 4Q3AA 3NEPX 3E03A 3WLFA 4RLHA 4UEKA 3GN1A 2BD0A 1I2CA 3VZQA 3RC7A 4JN6B 5K6AC 5H82A 2SCUA 4DLAA 1H94A 4DYVA 1E3JA 1OOEA 4XYLA 1DHRA 4IINA 3RSHA 1K3TA 3FD8A 1M6HA 3VPGA 2PNFA 4DQUA 2PY6A 2EHDA 1XCBA 3DTYA 2EKPA 5L51A 3AJRA 5A04A 1ZBQA 1U3WA 5U9CA 2B5WA 1B2LA 2Q50A 1V3VA 1T2FA 5KKCA 2Y99A 3V2GA 2VWPA 3WR5A 4GGPA 4K28A 1MFZA 2DAPA 3ZU4A 1DB3A 4OH1A 4CR6A 4DC1A 5T8KC 3C7CB 2O23A 3F46A 3RKUA 1ZW1A 1J49A 4CLHA 2O3JA 3FHLA 3UXYA 4B8ZA 5KTKA 3PHLA 2HK9A 5ER6A 3GHHA 3RI3A 3R3JA 3OJ0A 1PS9A 3MJEA 1VL6A 2ZTVA 4U0KA 1KEPA 1KVSA 3VH1A 3B1FA 2QRJA 4E5PA 3K96A 1YB5A 1WPQA 1EE2A 3H6KA 1G1AA 1Z74A 5EPOA 1K5HA 1Q7BA 2UUPA 3PHHA 4A27A 3BMOB 1I24A 4Y6RA 4P4LA 4NR0A 1A7AA 5COBA 3GDGA 3GUYA 5BNFA 3OM9A 3H9UA 1ZSYA 2PR2A 3D4NA 1I3KA 1QYCA 3ITDA 3Q2IA 4J9UE 3RVDA 4BMVA 2FY8A 4YJGB 4C4OA 5F5LA 3VTZA 3PYLA 4ZU3A 1R12A 2FMUA 4XYGA 1C1XB 1HT0A 3MOIA 4IDCA 5JAMA 1ULSA 3GZNB 4PZEA 4UVHA 2NQ8A 3Q3CA 4YQZA 2E4AA 1Q2XA 2X0JA 1ID1A 4R9RA 4Z9FA 1JAXA 1B8UA 4P38A 3OJOA 2WYUA 4NG5A 2A92A 4TVBA 5G4LA 3T7CA 3F6YA 4DTIA 3UHAA 2V6MA 4RF5A 4MJLA 5DULA 4BNMA 3H7AA 1BW9B 1ADCA 3TZHA 1LTHR 4BV8A 4BS9A 1J5PA 2EV9A 3AU8A 2ZATA 1ISMA 3JQGB 3Q11A 4BKRA 4ALIA 1PL6A 4UVEA 4Z9XA 3VDQA 3OMLA 1PGOA 2TMGA 4G2NA 4IDBA 1ZMTA 1FJHA 3FSRA 2B37A 4CLXA 4EBFA 3GK3A 5TSDA 1P3DA 4XWYA 1LDEA 2BFPA 4ND4A 4LN1A 4OM8A 3V8BA 3VZRA 3LK7A 4D0SA 3GDOA 3EY4A 3JQEA 3KYBA 2G76A 1M66A 1N7HA 2NQTA 3KM0A 2BKAA 1TVEA 3FBGA 3C8MA 5THKA 4HNGA 4E2WA 4XGNA 2J8ZA 5B12A 5HS6A 1A72A 1K6JA 3SLKA 3VHRA 4CL3A 1U3TA 3OHSX 2DQ4A 3BXXA 4AJ4A 2VNAA 1OI7A 4L0QA 1H2BA 1R6DA 4CM9A 4AJPA 5AXDA 3F5SA 2HQ1A 1PR9A 2IZ1A 1ZVMA 1Q7CA 3OEWA 1IE3A 2B83A 4W9NC 4EDFA 3TRIA 1JKFA 3OSUA 5A9SA 2RAFA 3FBTA 3GGOA 2EKQA 1PU2A 4BGIA 1LRLA 4BNGA 1QYVA 1E1NA 1GV1A 2HK7A 5L7TA 4GH5A 4Q39A 2JD0A 2YFHA 4XB2A 4J9VA 4MVJM 4KUEA 4FJ0A 3L07A 1DSSG 2J5KA 4NBRA 4BB5A 3DFZA 3BYZA 3WYEA 3DZFA 1DOHA 4FFLA 2HKIA 1G6KA 1N2SA 1XSEA 1ZIDA 5AVOA 1NXQA 2C0CA 3C7AA 3DDNA 3KHUA 4CV0A 5K0ZA 2GF2A 1ZXLA 2O3SA 2PGDA 2BMAA 4CMEC 3IP3A 1F06A 5LDHA 1P1JA 4BNZA 4LW8A 3ETEA 4XR9A 4GVXA 1ZSNA 4MVJP 2NU6A 1NYTA 5T67A 4YAKA 4FOSA 2ET6A 3BMQA 4WNIA 4AJLA 1GYPA 4GSLA 4NFSA 3MJ4A 2ZJ1A 1M76A 4EI2A 1O8CA 2W2LD 4FB5A 4PN3A 3PI7A 1F14A 2DTEA 3ASUA 3HFSA 4MVJH 1YBAA 3U0BA 3UUWA 3P19A 3JD1A 3WDSA 1E3IA 4ZQFA 5G0UA 4NQZA 2HMVA 1LLCA 5IZ4A 2GYYA 3IKTA 1DEHA 5H81A 2UYYA 1HF3A 4CM7A 2FZWA 2JCYA 2FPIA 1MC5A 4J7XA 3T4XA 1GYQA 1XQ6A 3E48A 3WG9A 1MXFA 1FDSA 1L7DA 1NM5A 2C2XA 3IIEA 5JC8A 1E7RA 2O3TA 2NVBA 1I33A 1VPDA 3MCVA 4XRRA 2CVZA 3LT0A 1RM3A 3AU9A 2PFGA 5CEFA 1QV6A 2ZYGA 1SC6A 2NU8A 4Q3CA 1BWSA 4GSKA 5COAA 4IPTA 4I1IA 2PD6A 1P0FA 3ULKA 1CEQA 4XQGA 5JW6A 3R0IA 1NVTA 3AFNA 1EE9A 5C3MA 4X54A 4DL9A 1HTBA 2HLPA 4JBGA 4RVGA 2LDBA 3WFIA 5CG2A 2Q49A 4UREA 3AUUA 2O2SA 1U3UA 1R0SA 1E7WA 3EW7A 3PJEA 4OMUA 4BO0A 5IDXA 1YONA 4F46A 3SVTA 2B69A 4MKXA 2IZ0A 1V35A 3GMDA 2ILTA 3RASA 1DIBA 4PVDA 3X2EA 3MOGA 5B4VA 1VLLA 1H6AA 4DBZA 1IL0A 2D0IA 3I9JA 1AXEA 3HWRA 4GX1A 4NFYA 4J1SA 2H6EA 1SO8A 2QX7A 3ANMA 1IY8A 1D8AA 3R6DA 3K6JA 3H9QA 3MTGA 4IUYA 4MOWA 1KYQA 3HDHA 1T2CA 2RBEA 3QLJA 1A9YA 3VAZA 3JYPA 2JD2A 4BNFA 1UXGA 1ZEJA 1AGNA 3RROA 4CM8B 5IZCC 1T2DA 1GZ4A 1NQAO 3H8VA 3PWSA 2Y1DA 3JQ7B 1QLJA 2OGUA 4D44A 2WE7A 4OHUA 4BNLA 2NUAA 1A71A 3G49A 3LT4A 5AXAA 1RKXA 4QECA 5ENDA 3DBRA 3EMKA 4IQ0A 5LCXA 5JY6A 5EESA 4U6QA 3D3WA 5TRTA 1NFFA 3PGJA 4FR5A 5G0SA 5U1PA 3SX2A 4AICA 3F9IA 3GRPA 2PKQO 3QVOA 4E0BA 1C1DA 3JCZA 4D42A 1PGNA 2DVMA 4I5DA 4YEDA 4AJJA 1WDKA 3GH3A 5FEUA 1B15A 4CLRB 2C5AA 3PDUA 1OFGA 3PIIA 4NJMA 1H6DA 3E6AA 4CQLB 1ZZEA 2JJYA 3FF4A 2PWZA 5T5QA 1L7EA 3WMXA 3JQ8A 2NTNA 1HKUA 3ZWYA 5LC1A 1IYZA 2C59A 4CLRA 2Y66A 3Q2KA 3Q9UA 3DMTC 2Q3EA 2TMDA 3I4FA 2EXXA 4R54A 3JQFA 3SLGA 1BXKA 4FSHA 4TRRA 1IB6A 3DONA 3Q9NA 4DWVA 4M1QA 2I5PO 4Z3KA 2NU7A 4FOOA 3B70A 5I8WA 5TS3A 4O6VA 5L40A 3TJRA 3HE3A 1JTVA 4AG3A 5KVSA 1HE5A 2Y0DA 4C7JA 3EC7A 3EHEA 2CMDA 3ZWMA 4K9DA 3I4CA 4WK6A 3MJVA 2Q1TA 1ZO8A 4Z0HO 3EUWA 5F1PA 4EITA 4MIEA 2AG8A 4UEOA 1J4AA 4CMAA 5CDYA 1K6XA 3WS7A 2NWQA 1QRRA 4JJGA 1JVSA 1YJ8A 3PFWO 4NK5A 1LQTA 1ZEMA 2AG5A 1NWCA 2OL4A 1LSJA 2W98A 3AOEC 3DR3A 3NTRA 3DC2A 5JDIC 1PJLA 2FOIA 5DCYA 1AN9A 1RPNA 4LSMA 2GZ3A 1NPTO 3W6ZA 6LDHA 3W1VA 3PEFA 1M2WA 3B1JA 3U3XA 4ZICA 2Y0EA 3CTMA 2CDAA 2X5JO 1QR6A 1NFQA 4B4WA 3KO8A 4L9RA 2I67A 3QVTA 4IXWA 1TT5A 2IDZA 3GNQA 4O0LA 3WIEA 3GGPA 3C1AA 4HWKA 1LLUA 1HZZA 3PQDA 1QXSA 4TVOA 3NV9A 4LK3A 4OO3A 1LI4A 4XDYA 3CKYA 4M49A 4IDDA 4EEXA 1EUZA 1CQJA 3I1JA 4L75A 3ZWPA 4UUNA 4J2HA 1LC0A 1UDAA 4Y9DA 5B4TA 4DC0A 1PIWA 1EVZA 3I5MA 4BQRA 3KETA 1XGKA 4I9HA 3KYDA 1M67A 2QYSA 4BGEA 4RDHA 5IN4A 2A9FA 1JWBB 5A06A 3GZNA 3OIFA 5A03A 1U8FO 1E7QA 1Y6JA 2OHXA 2WWRA 4DMLA 1JWAB 3OA0A 1JA9A 4YAEA 3AI2A 4RDIA 2G82A 1U7HA 1ENZA 2EKLA 4F6LA 1P77A 3NDIA 3GVPA 3O03A 4BB6A 3BMNB 3FR7A 1SEPA 4B7CA 4YB8A 4BNVA 3RUIA 4HY3A 2WDZA 4CUJA 1CRWG 4UEJA 4IGFA 1MP0A 3V1UA 3RBXA 1ONNA 3U4CA 2P91A 4YPOA 4MO2A 3WICA 8ADHA 3WQSB 3GPIA 3UICA 4XYEA 2BELA 4YTEA 2VZ9A 4RGBA 1UXHA 3RUFA 1PQUA 4YAJA 2OORA 1GUFA 4FS3A 3DOOA 1ENOA 1MLDA 1ZMOA 3WIDA 2GCGA 3MWEB 4WLFA 3ZWCA 1P45A 3QWIA 5CDUA 2CF6A 2F00A 3INGA 2DLDA 1S6YA 2IRWA 2VT3A 4OL9A 1B3BA 2HMWA 2Q2VA 2WE8A 3DBLB 3W4IA 3P2YA 4CV1A 4TMFA 3STHA 4N54A 1N9GB 4HFNA 2VOEA 2ZTMA 4I5EA 1LA2A 1YXMA 4BOYA 3H5RA 3KZVA 1RJWA 4BNHA 2B4TO 3JQBA 4O5OA 2CF5A 2VHXA 2ZB3A 4QX6A 4ALMA 4BKUA 4J49A 3I9MA 4L8VA 3WMWA 1LNQA 5BQFA 2RH4A 2IEDA 5IFLA 4AJKA 1EQUA 1XQ1A 3OIGA 5ADHA 1UJMA 4QFCA 4WE3A 3VTFA 1YO6A 2XPCA 2JAPA 1HWYA 2H63A 2IEBA 3GA0A 3EK2A 4YRDA 3SBOA 5FI3A 5DN9A 1ONOA 3ZH2A 1PZHA 3HB4X 1AE1A 1RWBA 4NBWA 3ANLA 1VJ1A 4XGKA 5ILOA 2VRCA 1I0ZA 4TKMA 3A14A 5JO0A 4ID9A 4CM9D 4LRSB 3WWYA 2YQ4A 4MP6A 4PLHA 5KOIA 1J6UA 4JX8A 1BTOA 5DOZA 4E32A 1DFHA 1Z82A 4M86A 3KEQA 2Q2QA 4YDRA 5B37A 5LDGA 5TJ9A 3F1LA 3KBOA 4WGGA 1E92A 3D4OA 3PYXA 3DEYX 1MG5A 5F21A 4RVDA 3H9EO 4XYMA 3RUCA 1GUZA 1I5RA 2C82A 5HWSA 1C0LA 1BGVA 4BNJA 4CMHA 4L4RA 3IDSA 1VL0A 4LMPA 4ZJUA 1FF9A 4NIMA 3ROMA 4BHTA 4LCJA 4N5MA 1DJQA 4FGWA 1N8KA 1UDBA 1CYDA 4ITUA 1SB8A 4L76A 1W6UA 3TOXA 4IGEA 4FGSA 4YJDA 2RIRA 5KVVA 2GZ2A 1F8GA 1I3LA 1DFGA 3CH6A 3TQHA 1JAYA 1HDOA 2BGKA 3PP8A 5AQ1A 3OECA 3WLEA 1T2AA 4TRJA 1ZJYA 1U1IA 3DMYA 4U0JA 1ENPA 1P44A 1LJ8A 2NU9A 1R37A 1G0OA 3ABIA 3KOUA 3HN2A 3W8FA 3GN2A 2BI7A 3VVBA 3NT2A 4Q3NA 1N1EA 4NHEA 2Z1NA 2H1SA 4WOJA 3FPCA 5AXBA 1R16A 4CQMB 2AE1A 4PLGA 5C37A 1E1LA 3AY7A 3JYQA 2Q46A 2YY7A 4FCCA 1CF2O 1V8BA 2JFHA 3AWDA 1C0IA 4IQ8A 4PG6A 3M2TA 2NSDA 2ZB7A 4OAQA 3ZWAA 3VPSA 3KVOA 4IDGA 2Y67A 3RJ5A 2EERA 4CODB 5KIAA 4GGOA 4Q3DA 1CDOA 3UFXA 2Y1EA 4WOKA 4MKZA 1ADGA 1SBYA 4HFJA 5AOVA 5HTOA 2Y1FA 1KOLA 5JNLA 4MPDA 1UZMA 3H9GA 3ZDFA 3JQBC 3ETDA 4ESOA 3I83A 3OJEA 3NKLA 4Y6PA 4HV4A 5CDTA 2VT2A 1E3WA 4FFNA 3DQPA 2CD9A 3DBLA 4TQGA 4J7UA 2DPHA 3RAJA 2PA3A 3PJDA 1UP4A 3JQ6A 5DCWA 4TZKA 4WLOA 5JAIA 1ZK3A 3WOHA 4GKVA 4II3A 4RCVA 5GZ6A 4BKPA 5FWNA 3VH3A 4B3JA 3JD0A 4WLUA 1PZFA 3Q0EA 1NFRA 3CIFA 3CZMA 4RF4A 3A9WA 2EWMA 4UVDA 1I36A 2X4GA 3DHYA 3WGYA 3DO5A 3O9ZA 4HX5A 2DFDA 4JJIA 3ZNQA 4B3IA 2QIOA 5GY7A 3H2SA 1E5LA 5TX7A 5MGBA 1C1XA 3ENKA 2J3KA 2Q1SA 5G2OA 3S8MA 4BNYA 4NI5A 1LDNA 3IUPA 1PWZA 1UXIA 3AI1A 4YJFA 1ISFA 1YWGO 4BNUA 2GUGA 3LLVA 4CMEA 1YS4A 1I8TA 1HDRA 5L95A 1PJSA 1ZUD1 1PTJA 2NACA 3JQAB 2IE0A 3JQFC 4OOFA 3UGKA 5B4UA 1MG0A 4J16A 4HXYA 3C24A 3AY3A 4E2XA 2RH8A 4CL8A 2W2KA 3QIVA 2AQIA 4EUHA 2DTDA 1YQGA 2JAHA 3VOSA 1UUFA 2A94A 1DIAA 1PJCA 4IBOA 4N5NA 3ZWBA 1A4UA 4R41A 4Y67A 2B36A 4F3YA 1HL3A 3PZRA 4BNIA 2YDXA 1GTMA 4KUHA 2JKVA 5EINA 3LVFO 1FDTA 4J1TA 1O94A 5I7VA 5JAQA 2YV1A 4WNCA 2CUKA 5TGDA 5L7WA 1D1SA 4QO8A 3BTUA 2WEKA 3TZKA 5GZ1A 1XYGA 3D4PA 3GNSA 4W82A 4GMFA 3QVSA 1Z73A 1T2EA 3ROKA 4E21A 4GX0A 4P22A 4R5MA 1WWKA 5KJ6A 5A5EA 2ZKLA 1TI7A 2Y0CA 3JD3A 4D79A 1OC2A 4PG8A 2CFCA 5EQFA 1GAEO 3VPXA 1BMDA 1MX3A 3ZU2A 4AL4A 2ZIZA 5CAEA 2IZZA 3LSYA 2YYYA 4MVJD 5KVQA 5L9AA 4KQWA 3IP1A 2VZ0A 3H65A 1DPGA 1NQOA 2CZCA 4BGUA 2V7PA 2F1KA 2Q4EA 3WGIA 3L77A 4IJKA 2PH3A 1VC2A 2OMEA 4ZA2A 1EBFA 5IN5A 4E2YA 4R69A 3W6UA 2DPGA 2IYOA 3GZ4A 4Y8VA 1HXHA 4J1NA 2I66A 2AHRA 3H9JA 1XDWA 1DC4A 2VZ8A 1ORRA 2WTBA 4D3FA 3QVWA 3DTTA 3IL2A 1H6BA 3I52A 1U7TA 2JCXA 3NTQA 4BNKA 1E7SA 2ZYDA 3PQEA 3QE3A 5JYDA 4AJHA 3B20A 3FPLA 4RO0A 4PLYA 5JO9A 4EUEA 2X8LA 2GZ1A 2O4CA 1TEHA 3FRJA 1ML3A 2C7VA 2HAEA 5IXSA 1Y9EA 3S1LA 1JKIA 2J6IA 4PCVA 4XA8A 1KERA 3C3XA 4IDAA 1I2BA 3H2ZA 1ISGA 5EIOA 5IXYA 4G65A 4FFPA 2FZEA 1GADO 1DAOA 4XGIA 1E0DA 1U3VA 2UVDA 2B5VA 2PLAA 2WYVA 4BVAA 3MTJA 2O48X 5COQA 4EZBA 1HSZA 1M6WA 1EUCA 3AW9A 1VJ0A 1JQBA 2P9CA 2I76A 5MDHA 3CSDA 1I3NA 4B4OA 4UUPA 1KY5A 4CQLA 2J5RA 4AJ2A 3U49A 1IUKA 3HSKA 1KVUA 2WMDA 3GQVA 2GLXA 4CQMD 1ADFA 1WDLA 2GO1A 3JQ9C 3U9LA 3D3WB 2GPTA 3FCOA 1XELA 1EFLA 1LSOA 4NU6A 1AHIA 1IHYA 1FMCA 1DO8A 4XQCA 3RFXA 4ND2A 2VUSA 4L4XA 4W4TA 3B6ZA 2NVUA 3GVHA 1MUUA 2UAGA 1BDMA 1GYRA 2JFFA 1ZK4A 4PRLA 4P8RA 4JGBA 5IAAA 5KJEA 2BFOA 2YV3A 4F6CA 3G3EA 2H5LA 4L73A 3GG2A 2NTVA 4IMPA 1B16A 5L4SA 1XEAA 4WCFA 4IZIA 1U5CA 1QLHA 1E7YA 1SNYA 2PD4A 4M55A 3ENNA 1FDWA 1YE3A 3QWFA 3SC4A 4R01A 2HRBA 2OBNA 4XYBA 1PJ2A 3W4JA 4RVHA 5A9RA 1W73A 3VH2A 4PG4A 3NGLA 2VUTA 2WSBA 3DOCA 3LLSA 5DOVA 3IOYA 4A10A 2O50A 4ALLA 2X5KO 4K1LA 4ND1A 4RPHA 3L9WA 1UZLA 4BO4A 3A28A 4FDAA 1ZK0A 2Y68A 1RM4A 4BQPA 1P1KA 2P9EA 1KVTA 3MZ0A 1XLTA 3ZU5A 4MIOA 1AXGA 4Z6KA 5KKAA 1PL7A 1PS8A 1YL5A 1E6UA 1VI2A 1PL8A 3TOZA 4CUKA 2FHSA 3SC6A 3ZI0A 2OP0A 3O38A 3ZW8A 1OMOA 4PG7A 2EGGA 4CLDA 5B1YA 2VYVD 4RL6A 1QP8A 3NTOA 4DUPA 3NYWA 2WD8A 1VKNA 4N7RA 1R4NB 4CM3A 3DZHA 4KTVE 3ZWVA 3RC1A 3AM5A 3KSUA 4FIZA 1TA4A 2JCVA 4Z0PA 2CVQA 1NQTA 4INAA 2I3GA 1HZJA 3AFMA 5DDIP 3L0DA 4EYEA 4XIJA 4B79A 1Z75A 1Z7BA 1ZCJA 2VWGA 3FTPA 4NU5A 4XR4A 2AW5A 3GLQA 1DRVA 1U2DA 3I9KA 2UUOA 2H9IA 4MVJA 3ETGA 2PZMA 2YHIA 1HSOA 1M75A 1T24A 3E9NA 3QA9A 4RF3A 4GWGA 3DAFA 1D3AA 5BT9A 5JPIA 2JFGA 1GPJA 3OFSA 3G17A 4R68A 3ZNOA 4CMKA 4XJSA 3LC1O 1V3TA 2BF7A 4IY1A 5FI5A 2ZB8A 1LXCA 3V1YA 1SPXA 3WQQA 3ZV5A 2B35A 2D5AA 1LQUA 3HN7A 1DLJA 4MVJF 4CR8A 4J2OA 3WBBA 3BHJA 4TRNA 3F5QA 3IJPA 4J3FA 3WX0A 1D7OA 4IMRA 4PLZA 1WMAA 2E49A 5C7OO 3EZYA 4YBZA 2AXQA 3M1AA 4JCOA 1YB1A 2PTGA 3IKVA 3LQFA 3WGGA 1PJ4A 1JKJA 1O95A 3OQ1A 2BH9A 2ZQZA 3F4LA 4IS2A 1NAHA 1TXGA 2A4KA 2EP5A 3GPDG 4FC6A 4ZRNA 3VPFA 4NDNE 1NVMB 3H5NA 2E37A 4NMHA 4E5MA 1T4BA 1GZ6A 2FR0A 4C7KA 4DIFA 4J4TA 5JAZA 5G4KA 3PHGA 1OAAA 4MVJE 1R0KA 3SXPA 5BR7A 2PV7A 2C29D 3DZJA 2DBQA 3KSZO 2X23A 1R15A 1AUPA 4JBIA 4D46A 3VVCA 1PZEA 1NPYA 1DAPA 2V6BA 3KLPX 3CMCO 4W7HA 4E13A 4GI2A 1N5DA 4DQXA 3FNEA 5A3VA 3AY6A 4Z9YA 4LMRA 3ON5A 1T4DA 4WKGA 1YL6A 1Z6ZA 3GFBA 2E6UX 3E9QA 4IS3A 4OXKA 4GKBA 4I9NA 3SJUA 2P5YA 3PYMA 2AE2A 4AVYA 4YAIA 4B7UA 4CPDA 2DKNA 2P9GA 3GC6A 1BDBA 1NR1A 1LU9A 1YRLA 2Y1CA 3IAHA 4PLFA 3WNVA 4BGVA 5TIIA 5ICSA 1VE9A 1C0KA 4LCEA 2VHWA 1BVRA 1QV7A 2DFVA 3K31A 1HRDA 1PX0A 4UUOA 4MINA 2YW9A 5JDCA 4BKOA 1LSUA 4YJGA 1E3EA 2P4HX 3RJ9A 1YQXA 3DAGA 1E77A 4MVJI 4PLVA 4DIBA 2YQ5A 3CUKA 4CR7A 2VHZA 3DXFA 2PD3A 7MDHA 4PZDA 1LC3A 4JLWA 4OXNA 3WYBA 4NBUA 3RUDA 5EJ2A 4RV9A 3INTA 1NR7A 3QQPA 3MEQA 1DC3A 4J0FA 2BGMA 1HE4A 3O8QA 3FNHA 4IJWA 1SB9A 3BHIA 2O3UA 1CQIA 4EJMA 3VDRA 5GMOA 5CG1A 1MXHA 2PZLA 3BMNA 1T25A 3TL2A 2ZK7A 3I6QA 5DF1A 2PKRA 1EK5A 1Z45A 1W4ZA 3DZIA 4RVSA 3DWFA 4CM6A 2EIHA 3KXDA 3GRKA 1R4MB 2GR9A 2B4RO 5DBFA 3N74A 4GPD1 3VKVA 1SOVA 4WECA 4XB1A 4XD2A 2GSDA 4WJZA 1N7GA 3OIDA 4OIMA 1LRJA 1WVGA 3UCEA 3BMQB 2AA3A 5DNAA 3ORFA 2DBRA 3HZZA 3WJ7A 5ILGA 3E5RA 3GVCA 3HDJA 4YT8A 3TWOA 1R4NA 1DRWA 4GLLA 4BKQA 2OFPA 1CETA 3RUAA 4DYDA 2BGLA 4ZHSA 3ZHXA 1PJBA 4JNKA 2X0NA 3ZWXA 5I8ZA 1HLPA 4ZRMA 1V6AA 5DBIA 2QYTA 3A4VA 5TF4A 4DXHA 1DIGA 4GBJA 1A4IA 3RQSA 2VWQA 4EJ0A 2ZYAA 2J3IA 4BUCA 3QWBA 4E30A 5I9LA 1DIRA 5EL0A 1BXGA 2OZPA 2X0RA 4EJ6A 4CM8A 1AHHA 1H2HA 4W9NA 5HM8A 4ZVVA 2EF1A 1Q0LA 5A4DA 1Q0QA 3IJRA 1FK8A 4CM4B 2ZB4A 3JD2A 1R0LA 3E8XA 3PQFA 3ROQA 1EFKA 4CMIA 3JQDA 3SEFA 3WJAA 3D0OA 2CDCA 1KEVA 3BZUA 4K6FA 2OOSA 3LT2A 2OXIA 1HYGA 3P7MA 8LDHA 3NAQA 2G5CA 1IPEA 3G0OA 4GVLA 5JLAA 4YT4A 3G79A 5BSEA 3V1TC 1PWXA 3JQAA 1GDHA 4B4VA 1YBVA 1HDGO 4QXMA 5ES3A 3B1KA 4OGWA 3IC5A 3E1KA 3S2FA 3TZQA 3CPSA 4ZQGA 4KZPA 4GAEA 4A03A 2DUWA 5JCJD 4CLEA 4TRMA 1PGPA 3GAFA 4CMIB 3KYDB 3L4BA 4RVFA 3ICCA 5L4NA 4E4YA 5K6AA 3F47A 2D8AA 2PGLA 4PG5A 2PK3A 2QW8A 2AQHA 3PWZA 3WQRA 4BO6A 2I3AA 3E9MA 3I9NA 3E82A 5CFZA 3DZKA 3KLMX 2XOXA 1SAYA 1GV0A 4IDEA 2EP7A 2DC1A 1WZEA 1O6ZA 1GY8A 1PZGA 2VNSA 1U5AA 2PZKA 3HUDA 2QG4A 5JBIA 4K26A 1O5IA 1HEUA 4NJMB 1FXSA 2X1HA 1UDCA 5A1TA 1MA0A 1DLIA 2NVWA 4MVJG 7ADHA 3RKRA 4LVUA 1I01A 1YH3A 4B8WA 3WWZA 4B3HA 4BO3A 5HBRA 3NGXA 3IUSA 1Q7GA 1LEHA 2CNBA 2Y05A 2Y1GA 4FN4A 1N92A 1LDBA 3DBRB 4PVCA 1LLQA 1NBOA 4HUJA 3UCXA 4RLSA 1ULUA 3FTNA 2PGJA 3PK0A 3LF1A 3QW2A 4CJXA 5KCZA 1X13A 1P1IA 4FC7A 1NTOA 4YT2A 2WD7B 4WEQA 4A26A 4WCFC 1DC6A 1KETA 6ADHA 2GN9A 2HJRA 1UP7A 3W4KA 1U4OA 1YJQA 2EJWA 4QUKA 4MDHA 2YUTA 4NZ9A 3JSAA 2YZ7A 4DLBA 4J4HA 1QYDA 3DBHA 4HADA 1JN0A 4KDEA 5JDIA 2R2GA 1H5QA 1I10A 2GN6A 3GEGA 1HYHA 4IIUA 5JSFA 4A5OA 3O8QB 4ROSA 2GN4A 4NPCA 5C5IA 4HP8A 3I9LA 5TQVA 1HDXA 5IG2A 2X7HA 1XR3A 5G4KB 2RCYA 4FFRA 3RC2A 4ONEA 4E31A 3WFJA 2I65A 4BO9A 3OH8A 3RUHA 3L6OO 1ZKMA 1EVIA 2D1YA 3RCBA 3PLNA 1DXYA 2BI8A 2BLLA 4CMJA 2UDPA 3IMFA 3A06A 2Y1OA 2ZJ0A 1E5QA 2IXBA 1GPDG 3RUEA 3ZWNA 1A27A 1WNTA 3AUAA 2XAAA 3GDFA 3LT1A 2G0TA 3DAPA 4GX5A 5ENVA 4L4SA 2DTXA 4YQYA 3KV3O 4CM4A 4R3NA 4W6ZA 3I6IA 5IDYA 3K5PA 3PIDA 4RPJA 1ONPA 1J0XO 3D5QA 3PRJA 1U2GA 4FQ8A 1ENYA 3AUSA 1DC5A 1NAIA 4IM7A 4HFRA 1DRUA 1NHGA 1QG6A 3UN1A 4PRKA 3OICA 4KDFA 2B4QA 1HDZA 3D3EA 4J1QA 3NDJA 2X22A 4JP2A 4YCAA 4CM1A 3HDQA 1OBFO 3TSCA 2YHIB 4GL4A 3GEMA 5G0TA 1Y7TA 3DMTA 4CQMA 2ZCUA 3D64A 3NX4A 5AYVA 2JD1A 4DQVA 3GFGA 3I3OA 4ZN6A 3S55A 2ZCVA 3PWKA 1KIFA 5KJCA 1BSVA 1U28A 4BNWA 1Q1NA 2JL1A 2J5QA 4E33A 3PZBA 3GOHA 3ADOA 4UVGA 1VL8A 3NRCA 3PDJA 1KS9A 4U8GA 4M54A 4ZGWA 3KUXA 3RWBA 2O4UX 4DGSA 1WLYA 5DP1A 3S2GA 4FJ1A 2P68A 1UR5A 2W2KB 5EN4A 1YVEI 2VQ3A 4HKTA 2CY0A 4D3SA 1Y8QA 2IXAA 4P4GA 3PXXA 4K6CA 3DFUA 1P33A 2FR8A 4YA6A 2QRLA 3HFGA 2Q45A 3WB9A 3KRTA 4PLPA 3A1NA 4IQGA 2QRKA 3JQ7A 3SJ7A 1HDCA 1YDEA 5J23A 1A7KA 2I99A 1C0PA 4FD3A 4KWIA 3ZHYA 5IZCA 4Q9NA 3INRA 1NVGA 1O9BA 1GCUA 3LC7O 3HG7A 3VZSA 5L7YA 1DDOA 4P4NA 4YWJA 5H83A 4CV2A 2PKQP 3ST7A 2AQKA 3LDHA 4MP8A 2X5OA 3JTMA 1KY4A 2P4QA 2GASA 2X86A 1X1EA 1NPDA 3V5NA 4LISA 1GR0A 3RFTA 5A5FA 2VRBA 1E6WA 1IOLA 5G0WA 1YBMA 3GT0A 4RZHA 3WNQA 1RYDA 3FNFA 3TL3A 5GZ3A 4WLEA 1XIVA 1UAYA 1X14A 3NT5A 1Q0HA 3R3SA 2VCYA 4ZD6A 2XF8A 3AM3A 4TZTA 1YKFA 4J90A 3ASVA 1YB4A 3L4BC 4O59O 3L4SO 3CZRA 3AK4A 4A2CA 2NV6A 4LGVA 1VRWA 4D45A 2J3JA 3EZLA 3KTDA 4BO5A 2O7SA 2YV2A 2GD1O 4OYRA 2AEMA 4U5QA 3QWHA 1F8FA 2OP1A 3H5AA 4FJ2A 3HNPA 5DCUA 4IIVA 1BXZA 1HETA
chains in the Genus database with same CATH superfamily
1H8HD 2WHYA 2VZLA 2BEUB 2P2DA 3G6WA 2FZ5A 1U1EA 1KH2A 2W6ZA 1LBEA 3EE6A 3BVPA 3HPRA 1ZWLA 1KMHA 4OSEA 2XT9A 3TM5A 4AXBA 4BJ6A 5HX7A 1TA9A 1JHUA 5KTMA 1N2CE 3A37A 3KAJA 1VKJA 2H7CA 3DOUA 3C16C 3K1JA 2QD4A 2KLBA 4AKTA 1KRWA 1W1UA 4U2FA 3EGXA 2MSWA 4JXXA 3NHYA 1K0UA 3NTUA 4K9MA 4QEDA 5ALNA 1HE3A 4EY6A 1Z5GA 3PQ8A 3O3OB 3DV2A 4NV0A 4UVIA 4DKXA 2Z4RA 3UT5A 1C3OA 3GMSA 5D3MA 5EWLA 4FTWA 4GPEA 4Q05A 4OMDA 4NBVA 2WU4A 1UOPA 2PMBA 1MC1A 2R1VB 3WGZA 3AFGA 1B00A 2CEKA 4WZAE 1NMSA 4MLZA 4JSTA 2OD2A 1XWWA 4ARSA 4OQZA 1NJ8A 2EC5A 2QD2A 1KJJA 1ECBA 3B1WA 4TV9B 1VIVA 5ES4B 1EM6A 3NRJA 2GT1A 2VTEA 1WPXA 1AQJA 4G5YA 4H1WA 1G4UR 3QRWA 1A5BB 1T1JA 2ACKA 3ZE6A 2H92A 1TJ3A 4PF1A 5LWHA 4MWCA 4D5EA 1Y1PA 3LF2A 4KP7A 3O73A 4OHVA 3OZXA 3OCXA 1BCRB 3HCNA 3P9PA 1AJEA 2W8ZA 5KDLA 1ZMBA 1PSDA 4C4ZA 4TVSA 1RCFA 4IEIA 1U8XX 2LCFA 1I3MA 1OAOC 3QUSA 2JDID 3E8MA 1B0AA 1MHPA 1TX4B 1AH2A 4MX8A 2DULA 3JX9A 1DWUA 1UEIA 2JIQA 3MJCA 4J0HA 4JKOA 3PQ7A 3RV4A 4DY6A 4F2HA 1HE1C 3I61A 1BG6A 1ODTC 1A5ZA 3LUPA 3NBFA 2GAOA 2CBGA 4IL5A 4L51A 3TFQA 2QBYA 3WY9A 3A58B 4LA4A 3PF8A 3R7SA 1O3YA 3AUYA 4BN0A 2G17A 1X7ZA 2BFFA 3TLXA 2W6JD 1F2TB 1H3FA 2HHCA 4DLLA 3KT6A 1BX0A 1T1RA 3I2IA 4MAAA 1MEOA 1SEVA 4JI0B 4JWKA 3TMKA 1QUEA 3DEIA 2GM4A 4MIYA 1PYGA 1MH9A 1WDMA 1TD1A 3KB1A 2Q4TA 5DLPA 2Q9BA 1R8YA 4I4TF 4M6WB 2PUEA 5EAIA 1RQGA 4K9OA 1KR5A 3H11A 2CUTA 3PPYA 4ZQBA 3T7TA 3S2IA 4XRGA 1V9LA 3NG1A 4MDEA 5JMWA 5CLJA 2OLJA 2G5PA 5FLYA 4NNJA 1M1YB 3OWHA 2ZREA 4R8SA 3ZJYA 1NV8A 2QG6A 3SK0A 2UXBB 2CLIB 1TT5B 2QXUA 4AI6A 4YT5A 3PNSA 1GITA 1R64A 2WWYA 5HZHA 1ZK2A 1U7UA 1ZAKA 5DBOA 5GINE 4KVGA 3GLKA 4TSKA 1JPNA 4G1UC 1UKYA 3VNBA 9LDTA 5HJ7A 4EABA 1U7XA 1BX1A 4JWTA 5ELMA 5B64A 5CDSA 5KYNA 5FBRB 2IOQA 2XXJA 1FVFA 3AM4A 4RABA 4LX0A 1J2YA 2A5DA 2XTNA 1K89A 4BZZA 4X7RA 3LOPA 5ALZA 3OZDA 2G67A 4AP9A 5LOVF 2FZVA 4ZALA 1PWYE 3K2EA 4U9UA 4CG2A 2PO7A 4ZI5A 1R9NA 4E1AA 4F86A 4BNNA 4YRRA 1ORWA 2RHCA 4JC5A 5JD3A 2JS7A 2FMHA 1G5HA 4ZAGA 4R0MA 1TPYA 2VLIA 3LOQA 4IKPA 4I1OA 3ZDZB 5KOYA 1VKOA 1OWLA 2H00A 4YXFA 2NX2A 1CDZA 5KYWB 3OT5A 1RPTA 3O4FA 1DBVO 4U6SA 1MO2A 3U7HB 5LMUB 3DP9A 1GL3A 3QYPA 1K4MA 2C4VA 4X5OA 4ALNA 4WLNA 1E3WB 4E33A 9LDBA 4NU0A 2ZKIA 3A2NA 1G2QA 4LYJA 4MW4A 2EEZA 3B82A 3BSFA 3CT4A 3FPHA 3JW8A 2FA9A 3L0CA 4RPKA 4UATA 1YBFA 4NNPA 1I1HA 1KKMA 3BPSA 3IIIA 4IUDS 4X20B 2VQ6A 3M1LA 4YRPA 1P7WA 4XH9B 3MWLA 3ADPA 4NF2A 4ZVQA 4MITA 2N9UA 2XXBA 3E5NA 5CK5A 3U7QB 1WUKS 2Q99A 3JATA 4RWEA 3UWMA 3RVSA 5KX5A 2GH1A 1F4PA 3ZZNA 2GAJA 3TVDA 4IIXA 4BNFA 5LKAA 1XT6A 1VGQA 2FP4A 1FX1A 2H18A 1DEAA 3TNYA 2WU8A 4D4IA 1XPOA 1ZXBA 2BT4A 3R40A 3Q1LA 2FKNA 2FMFA 2IQIA 2PLWA 4XGRA 1V1JA 5BYJA 4ZYLA 3IXMA 5TT1A 1N0WA 3L9XA 1G1MA 4JJZA 2ASVA 4R8VA 8MHTA 1BD4A 4Q7KA 3TUIC 3EPLA 2IH5A 3KPYA 4DHEA 3DCJA 3R0XA 5JNSA 1HNNA 3LIPA 4R81A 4Y98A 4JI5B 1PO7A 2GEJA 3HHPA 4FHGA 5HS4A 4BQQA 2DQSA 1VSTA 2L18A 1R66A 4J0EA 3ABQB 5GM1A 2QBYB 3ILVA 1K6IA 5H80A 1XP8A 3EWAA 4LOJA 5DNYB 2DUUA 4CEJA 4DT1B 4LI3X 1ISJA 4OKSA 2HEGA 5FWYB 1U90A 4I3FA 4DRZA 4JUDX 1Z38A 3NUZA 3TZ6A 3DOJA 2BUCA 3PFCA 5AVQA 4EHFA 2XNHA 3B7PA 1UKVY 1YHZA 4E5SA 2Q6VA 1GQOA 1GLNA 4G9GA 1MC4A 1EH5A 2AEEA 2YXNA 2GFHA 5EGNA 4MEAA 5A3JA 4B2PA 1URPA 2PL9A 2XMSA 2DOKA 1GRNA 2OBYA 2ZBGA 4A6EA 1XLVA 1XJCA 3B85A 2IHJA 2XCTB 1VFNA 1EK6A 2G1UA 4A82A 1NVDA 1S96A 2V03A 4R51A 1KPIA 2W83A 4CKBA 1NI4B 4XSGA 1CHNA 1FS5A 1O96B 5EIBD 5D5PA 5FA5A 1B14A 5A02A 1NX6A 1AZSC 3N7UA 1K2WA 3CZQA 4JU8A 4XEHA 3B7GA 5T6BA 3ZUPA 4EYGA 5CT8A 3CUEF 2P0AA 4G85A 3H5IA 1QFMA 2FWMX 2JEYA 1GT6A 2P6OA 3DBVO 3IPAA 2YFQA 3KQQA 1OKKA 4JLOA 3T6KA 3EIFA 2VXCA 4DR4B 1A5SB 1GNQA 3UVEA 5LNK1 4UBOA 5AFSA 1G0NA 1OH7A 1G20E 5BWLA 1O57A 1JJAA 1PK7A 1GQQA 1ORIA 3RD5A 1KOJA 4RTMA 3QUBA 4GMGA 3I4LA 3L93A 3S2EA 1GFSA 1IM8A 1WXIA 3L46A 1IZZA 4QQRA 3TZCA 3GUCA 4HNAA 4MA4A 1B8VA 4CIDA 2XI4A 2NU7B 2OG2A 3EAGA 4IW3B 3X2FA 1PWEA 4YECA 3FAZA 4AO6A 4E5YA 3KJIA 1UFVA 4JK3A 4R1SA 4FZ5A 3HSYA 4JQSA 2WKQA 4R16A 2HREA 1P74A 3RAGA 2H51A 2WSYB 2J9FB 5IJ0A 2C9ZA 3HUEA 3RVRA 3GP8A 1UZNA 1XVIA 5H02A 3INNA 5LLTA 4HQ6A 2JJ1A 1D1TA 2I34A 1IZ8A 2Y1KA 2V9CA 1ML4A 3EGCA 1NP6A 4FGZA 5EERA 3UW3A 3MA0A 2V7BA 2A0WA 2WIKA 3DDUA 3QJ5A 4Y6SA 5DGCA 4Q4CA 1U2GC 4BRZA 4NRDA 4LXXA 1Q3KA 2DSTA 1HYQA 3A3PA 4ZOLA 3F6RA 4NYMR 1KEUA 4J0DA 4MW5A 4KACA 4PZCA 4XGQA 1XTKA 1ESMA 4L78A 1DZ3A 4P34A 3URMA 4EG5A 5B2FA 1OTYA 3CJRA 3O83A 5KS2A 3NT4A 4PHGA 1K97A 2ZBUA 1P0CA 2DU8A 3BFPA 3CB4A 2GEFA 3EAFA 4I1SA 4JOCA 3RYIB 4CUZA 4CKEA 3VNUA 3T99A 1GQ2A 4OJTA 1P72A 1G5QA 3TLBA 4AN1A 1YE5A 4ZT5A 4WT7A 4YLGA 1U9JA 1QRAA 1CP3A 4CCWA 4Z4HA 4G97A 4X66B 5DW0A 1N57A 1XRPA 1OA0A 1UXJA 3LY7A 1XDUA 1DUIA 1K5PA 3D6HA 4MWGA 1K6MA 1SWVA 3HGMA 3V2IA 1QRSA 5M7EA 4JSYA 2NIPA 5H7XA 5KVCA 2CCKA 2XLBA 2XMCA 4KLZA 1Z9BA 2FN4A 1QYXA 4AURA 1MZVA 1P18A 3BHMA 3HA7A 4UM9D 4EKEA 4HNTA 3KQHA 2PS9A 1NR5A 1OYOA 2RBKA 2DFPA 1IQRA 3C1UA 3QVXA 3SVLA 4EYSA 2Z6UA 5IMBA 4IMIB 3KSBC 2A88A 4QLBA 3WGHA 4CKXA 2GN8A 1MDFA 3DE5X 1E69A 2I1WA 1JMVA 3SSNA 1RC8A 4FXOA 4EO9A 3JALB 4EPYA 2ZRPA 1KK3A 1CNMA 4QARA 1ADYA 4BN4A 1KI8A 4UCWA 4W1RA 3T0IA 3C3BA 3X1WA 1K06A 4F92B 1GU7A 2H8KA 4HMOA 3IBYA 2GK3A 2OMKA 4FT4A 2P3SA 1TQ8A 1TUIA 4P3YA 1GTZA 1DC8A 3SJZA 4K0KB 1BVYF 3RT7A 3SQOA 3QFCA 1JH9A 2HUNA 3RODA 1VYVA 4ARZA 1M2OB 4RHXA 5KJ1A 1CIVA 4H3KB 1E59A 1PEYA 3C3PA 3ROFA 4YJFB 1C9EA 5I9NA 3MFQA 5HCNA 4Y9RA 3ZV3A 4JP3A 4ZT7A 1QCCA 4ZPJA 1RTTA 1ZIXA 1JFFB 3T15A 5JASA 2PZJA 3PGMA 1O6CA 1SGWA 4EH1A 1MV5A 2VTDA 4I8IA 1N3BA 1IPHA 1WNFA 3X1ZA 2VXOA 2XD9A 4CLOB 1US8A 4L57A 1JRLA 2J3HA 3DEJA 1X7GA 4G84A 3FFTA 3ONDA 3IALA 4OB7A 1ZINA 2H8GA 2OWEA 2XGMA 4IFIA 4P3NA 3ROEA 1KQOA 4L5IA 1B41A 2WTAA 4MKHA 4QXOA 1WMEA 3D2AA 4Q93A 3PI6A 4YAGA 2O6LA 1H0KA 1ADBA 5DTQA 4AF6A 1TAHA 1IZ0A 1GAWA 4W7IA 1U4SA 5F76A 5JH7B 2Q1UA 3DPSA 3RTCA 3LUFA 3O1JC 3RSOA 2YJNA 4ENWA 1UXKA 2X9GA 1XQXA 4C9BA 2ZP1A 2PXHA 2IIPA 3IT0A 2OHHA 1VOTA 1U8CB 3BDIA 4HRVA 4EFDA 3IIKA 1VE7A 1A7UA 3UCFA 5HEKA 1KC1A 3RC9A 1C1DB 1XZMA 4MQEA 2I71A 2HXSA 3LUHA 2DWPA 2A8YA 3KYCB 3U4IA 3VC7A 3JYLA 5BUQA 3IUQA 1NJ6A 2PT7A 1DGQA 5HRUA 1E2MA 1D5CA 1JECA 4GXTA 3MWDA 4EG6A 2RHRA 5JROA 2QW0X 3GFFA 1P7VA 3KSDO 4ER5A 1PVOA 3DL4A 3ELWA 3NP7A 4UULA 3WL7A 3VH4A 1CTQA 5L3VA 2O2CA 1LJLA 3HB5X 5FWXB 5FPSA 3KQUA 3GJ8A 4J6EA 4O2RA 3UWOA 4GZ5A 4BN5A 3O4JA 2MYPA 1EDOA 4FKZA 1LDGA 1E8MA 2PDAA 2QZSA 3L1IA 3JZDA 2C5FA 1P3JA 3NBUA 4M6WA 1IBKB 1UFRA 5BSKA 3KQMA 1SBIA 4YREA 5GPBA 4ZCTA 1JLLA 4IJVA 2UVPB 5ICFA 1UF9A 5K1ZA 3QTLA 1YA4A 4ZDIA 2R8BA 5EP2A 1HA3A 4M1WA 4E12A 1FJXA 4G23A 2XYHA 4HYYA 4HDMA 1H9AA 1O89A 2G4LA 1NF9A 4INOA 3UF0A 1DIHA 3PC6A 3D6AA 1D2EA 3OFVA 3TG8A 4NFHA 4M89A 4UNNA 1E7MA 2G9QA 5CXUA 4NMMA 1NNUA 2XKJE 4U2KA 1CULC 4R2KA 4CIAA 2IQ5A 5LP6B 2GWHA 2XB6A 2PXAA 2CFSA 1EWTA 2HSDA 3EQ9A 4XX0A 5D3ZA 2NLOA 2PSHA 3JY6A 3MWDB 3PUJA 3TAXA 4IHQA 1WTCA 2CLSA 2FW1A 2X9NA 1AQIA 1E1MA 3AKEA 4H0FA 4TQ9A 5DP2A 5AXCA 1T8UA 3QG5A 3I9V1 4CN9A 3B36A 2Z0MA 4ITVA 4URVR 1Q11A 3ML1A 5KINB 4YP1A 3OWXA 3T5PA 3K0HA 3I64A 3U80A 2A6PA 1LSSA 5AHKA 1ZPDA 5B36A 4G5RA 4CKWB 3LUDA 4PS1A 1BVUA 3ZWWA 3R44A 4WHMA 4XFJA 3VPHA 5JFOA 3VKUA 3AP2A 2TSYB 3GP3A 1GVHA 1MD9A 3AVWA 1AKWA 4YP9A 4DPMA 3BEOA 4ILKA 1TF2A 5JTUA 4KIJA 1CQPA 1JILA 3JD4A 1BDJA 3VC3A 3VR4H 1Z4KA 1NZFA 1OBCA 2M98A 4MQ4A 4ASUA 4D8VA 4ME6A 2IXGA 1YOVB 2ZG6A 3ENVA 2OEPA 4MW1A 1CY4A 5AOBA 1L1FA 4RJTA 3UPTA 2OO5C 3KK0A 1J9GA 3UEOA 4B7AA 1C80A 5IKMA 2JIBA 1NRJB 1VG9B 3V48A 1RMQA 3LVBA 2NO0A 1E94E 3DOFA 3GWZA 3NHSA 3EQ6A 2FK7A 1GQYA 4U5XA 2C8LA 2VA9A 2P40A 2QRNA 3ZHSA 4NK4A 5JH7A 3HLKA 2ZS7A 1CF9A 1UMBA 4MV9A 1H22A 2H9AA 3R5JA 4O8ZA 4QNRA 1C14A 3BS4A 2ZR9A 1M33A 2J85A 1N0HA 3CN7A 2R8EA 4HNHA 4UMVA 1FOEB 1Z0FA 4H4EA 5AW0A 1ZHOA 5L45A 2VBCA 1TMOA 2JBHA 3DVRX 3A1WA 3R74A 1G42A 2OECA 2QRHA 3KYIB 1N9GA 2WP0A 4OHBA 3JQ8B 1PW5A 2GPBA 1EDBA 1EESA 2WM3A 2CC2A 2ADMA 5AW9A 3WSVA 4S1VA 2B1JA 4LOIA 3GT3A 2AL7A 2V6FA 1GU1A 3G1TA 4R9VA 1E9SA 2WSIA 4LJAA 4F8YA 3BA1A 3GUUA 2R8ZA 5C8VA 2JHFA 3FN4A 4URUR 2EX1A 3IS3A 1C3VA 3M4XA 4QFDA 3K9HA 2IYAA 4I46A 1EDDA 1OPXA 3DZGA 1XD2B 4OP1A 5JU6A 4D9BA 2Z08A 4W5RA 5TPWA 4Q4AB 2O05A 1NN3A 1P1BA 2WQZA 3COSA 3E27A 4GYJA 4MUIA 4OTZA 2GWRA 4PSUA 5AJUA 1P31A 2ZDGA 4XOIA 1ZJZA 4IO1A 2GKGA 1NMZA 2MSCB 2QA5A 4A91A 1XA0A 1D6MA 3QU7A 1NW6A 5AMXA 2G1JA 1P2UA 4JUBA 4I50A 2D59A 2FPGA 1FLAA 4UHHA 3ZGYA 4C4AA 4O1IA 3LU1A 1D0IA 1BA2A 2IS6A 1V16A 2HOQA 1B26A 2I22A 5CRIA 5KOJB 3MUFA 5ISMA 2ETXA 3LI2A 3PPIA 5GJVC 2O2YA 1QQAA 5E6RB 2Z30A 1UAGA 2EGHA 4XD7D 1DT3A 4MS1A 4XJTA 3QF4B 5HA5A 4RHEA 2VPWA 3ONEA 5E1DA 3KEFA 3ZK7A 4UFNA 4B3XA 3AVYA 2NVUB 3ZZ1A 1F0NA 3WIUA 1OV6A 1BXGB 1RFLA 1WSAA 2P4SA 1CK4A 2ZSIA 3EGOA 1QC5A 3HU5A 5E7JA 1SHUX 1NSTA 2QN6A 4IQFA 4L28A 1VKRA 3OA2A 1W88A 5TC4A 3V3TA 4C0AC 2PUGA 2YXPX 1XF9A 3LUKA 1A76A 1N0IA 3ZWOA 1PFQA 4UMFA 1KP3A 1W49A 3PNQA 3NEPX 1W0JA 2B8JA 4KI7A 4OCZA 1EGMB 1II8A 4KBFA 3LBYA 3GN1A 2BD0A 1KO5A 1DO0A 2Q8PA 5JSKA 3TI9A 3CUSA 1VE3A 1M6EX 4JN6B 1GPYA 4CKEB 3Q9LA 3KWLA 3ZWQA 3B53X 5FOTA 1XC7A 4XYLA 2GN1A 3DEZA 4IINA 1GA6A 3KZNA 1PFUA 5DK4A 5JSQA 1M6HA 3OLWA 4AECA 3E3AA 4DQUA 2LNDA 4ZO6A 3L4JA 2N75A 1HFKA 2VCHA 4L4UA 2AR9A 5FL7D 5L51A 5A04A 1YIOA 1ZBQA 3ZDQA 1CUWA 3MMPA 4EHJA 5U9CA 4IVPA 3OZGA 3ZGNA 1V3VA 3Q3HA 4G8CA 4OY3A 2XOKD 2JDIA 2VWPA 3C6YA 3WR5A 4FYXA 4XTRA 3QVUA 4IVQA 3N2NA 3DMDA 1IJBA 3ED5A 4CR6A 4DC1A 4RTKA 4NJEB 1K08A 2X4DA 2ZVJA 5DXAA 3R9KA 1J25A 5TMDA 3RF6A 2WKWA 2W37A 5TMEA 5CCBA 1J49A 1LBQA 1QDEA 4NVRA 3FHLA 2I4RA 2JIDA 5CUQA 1EFTA 3RI3A 1DPFA 4KQJA 5FADA 3GIDA 3A4NA 3I2JA 1PS9A 2PCJA 3K0AA 4G0NA 4LYYA 3MBOA 4U0KA 1J42A 1KVSA 3MCZA 2CHQA 3AR3A 5C8YB 3AR2A 1R0BA 1VYHA 2W9XA 5BW4A 2HRRA 1ESDA 1YB5A 2M9MA 4Q02A 1DL5A 3H83A 3WXMA 5JZVA 1JIUA 1EE2A 3H6KA 1G1AA 1SHTX 4G07A 5EPOA 3RV3A 1Q7BA 2UUPA 3GRVA 1KO4A 5ABPA 2BGNA 2TECE 2QN9A 2HSEA 3HVUA 4Y6RA 1EM8A 3GRAA 4NR0A 3AEKA 3EZXA 3K32A 3PQ4A 5M5BA 1HT2E 4V03A 2Z3ZA 1SCQA 1TC2A 5KHAA 4EKIA 8AT1A 4IX1A 1DJOA 2C5GA 3VO8A 4AX4A 3TRHA 1VHQA 2WAOA 1UPCA 3ITDA 4UCXA 4YDSA 2V9ZA 4YCBA 1EP9A 3EXHA 5L40A 1IY1A 2YS7A 5B3KA 1P3Y1 1R12A 1J90A 1W2GA 2V7VA 5AHRA 2FQWA 4LK2A 6PFKA 4GI3A 1WDWB 3PE4A 3VYTB 3G85A 1TJ4A 3OUUA 4UVHA 2ZRDA 4NE7A 3WGJA 2WHXA 2FJ0A 4E07A 2X0KA 1E1CB 4DA8A 3QYJA 1DEKA 4J75A 4U4AA 1ID1A 5F1YA 4TLCA 5H3HA 4S24A 1JAXA 4BP1A 4UTXA 5EMJA 2A92A 3T7CA 5G4LA 4LJ7A 4C4PA 5TE9A 3UHAA 2GB4A 3R5FA 4NZNA 4RF5A 4BNMA 2MR5A 1LBTA 2AOTA 3QPUA 4MJXA 4I50B 5EJIA 3AU8A 2EV9A 3SF8A 1HZZC 1VG0B 2ZATA 4NMLA 2IHYA 2C58A 4Y1FA 3M3DA 4BX3A 4ZZIA 4FMDB 4BKRA 1QH0A 1PL6A 4BTVA 3I32A 4Z9XA 2REXB 3UNXA 3H0EA 2TMGA 3QGMA 4US0R 4GPBA 3FSRA 3HWWA 5AJXA 4O02B 1ZIOA 1FTQA 4EUNA 5FFMA 5FOQA 4B3SB 4JYAB 4GRIA 1W29A 1KJWA 4XWYA 3TLZA 3DWIA 1DRJA 4B7ZA 2WWXA 2IX3A 1RDFA 1OVGA 3AERB 4I81A 2C5BA 3OTHA 1UDXA 1J8QA 1R9JA 1M0WA 1YNOA 2NOAA 1R8SA 3RANA 3VHQA 1E5TA 1FQJA 1O9HA 2BKAA 4CKCB 3GV0A 1IQUA 3FBGA 3NH6A 2WTMA 3C8MA 2JFZA 4FONA 4B09A 3MWKA 1DARA 4DCNA 4V3BA 4IHKA 1T15A 3PFBA 5LM3A 2JIPA 1JDUA 1A72A 3SLKA 1UPTA 7MHTA 3GJ6A 3O1HB 3IYLW 2WJWA 4ENUA 3COPA 3OHSX 5ARCA 2DQ4A 3BXXA 4AROA 4ECAA 3HBAA 1X8XA 4L0QA 4NAUA 1H2BA 5F33A 3V3KA 3O2QB 4TL9A 4C7BA 5E7IA 1E2KA 2VDRB 1SULA 1W85B 1IE3A 1QHHA 2B83A 2B1RA 4KLRA 4X71A 2C7OA 3TRIA 1V11A 4RD6A 1SOUA 2PYZA 2AD1A 4N8EA 1Z7WA 3HKDA 4KZKA 2L82A 1R00A 3OKPA 3ZK9A 3QLTA 1TEVA 1QYVA 1Z5OA 4N0QA 5TV2A 1E1NA 1TVKA 3H2IA 1Q17A 3AVXA 1GV1A 1Q2UA 2QQFA 2WYHA 3RS8A 4Q39A 4FX2A 4RHUA 4X45A 4XB2A 4J9VA 3TTTA 3D54D 1PNVA 2QD1A 4MVJM 4ZCSA 1G8HA 3WZMA 3WQBA 5FXMA 5JRZA 4YMTA 1A9XA 3FZYA 3NDPA 1A95A 4X84A 4W5QA 1DSSG 4RXMA 1W4CA 3CZ9A 3DE3X 4WZBE 4JIMA 3WYEA 5I6DA 4P35A 1OWOA 3VHXB 4EZIA 1JHYA 2CXRA 2O2HA 4LZZA 4GR5A 5LOVB 1KI6B 1N2SA 1W87A 3NEJA 1SC1A 3PPVA 5CK4A 3T06B 1W9MA 5GGYA 1AO0A 1SQ0A 1ZIDA 2YX1A 5AVOA 2GD0A 3P0IA 4QAQA 7YASA 2C0CA 3W2GA 2BH2A 1YQWA 4YFYA 1T4CA 4X6LA 1F06A 3GCZA 3KTAA 4WZZA 4BNZA 1FSFA 2BR5A 4LW8A 4C30A 1EX6A 1A04A 5C35A 1ZSNA 2WLSA 1PLLA 1CE8A 3OOSA 3UT5B 3ZWDA 1WQ3A 1U9ZA 1ORHA 4FOSA 3BMQA 5HPYB 4AJLA 1FXWA 4RK5A 3D0KA 1H0SA 1X86B 3IVAA 4PS0A 5TDHA 2W2LD 4FB5A 1KYXA 2IHBA 5TPZD 4MDYA 2BUAA 4MVJH 3HFSA 1UBGA 1RT9A 1YBAA 3FLEA 3KEMA 5HF8A 2RHHA 1PD0A 3FWPA 2EJCA 3GLGA 2R9VA 1JS1X 5BV1A 5IZ4A 1RJDA 2WPDD 2JGDB 4BU1A 3CKKA 4LHWA 2UYYA 4PZYA 3THXB 3FNQA 2ZYSA 1EWVA 1GNPA 1X1QA 2FPIA 3IP6A 5LU8A 1PZXA 1GYQA 3Q10A 1Q19A 1XQ6A 3FRHA 4RA6A 5EYPB 3A1FA 3WG9A 1MXFA 1AV7A 3UB2A 2C2XA 3TS1A 3T1QA 1MT3A 2JI9A 1E7RA 1M1UA 2O3TA 2QPTA 1VPDA 3P97A 2GTPA 3V9PA 4AMVA 5DM2A 5JAUA 3LW7A 4AKGA 1K9SA 3D8HA 3MT0A 2UZ1B 3V1NA 1SXJD 4LFCB 3AU9A 4KFCA 2PFGA 4NYJR 2ZYGA 4FFBA 1SC6A 1E32A 3JAKB 3LDUA 4GP9A 5COAA 4YCMA 1CEQA 3BC1A 4M9XA 2HDWA 1EE9A 5DSTA 4IJ5A 4RVCA 3UBTA 1HTBA 2HLPA 3F8SA 3WFIA 4ZARA 2Q49A 3DF7A 4UREA 2YBDA 2JGRA 3O1LA 1DWPA 3DEAA 1R0SA 1LLFA 4BO0A 5IDXA 4ZAXA 2HO4A 1YONA 4HPXB 1V7ZA 2VBIA 4LY6A 4MKXA 4AS2A 4F46A 5JSZB 1VRCA 2ALJA 1Y1TA 3S5UA 1DIBA 2H7XA 3MOGA 1MJ5A 1S2LA 4FP9A 4N3CA 1G2OA 1OV4A 1AMNA 4PV7A 1SG9A 2D0IA 3I9JA 1KI3A 1AXEA 2QSYA 1MB0A 2X1MA 3JASA 3HWRA 4RE6A 3ND8A 4RSGA 2DE0X 2H6EA 1OQAA 3B9RA 1FRFS 4LBVA 3MTGA 4IUYA 4C76A 3OE1A 2G9NA 3QLJA 1JI0A 3B51X 3EGDB 4MB6A 1F6BA 1AKTA 1P9RA 4JR0A 4MTLA 4MS4A 5K3CA 3ESZA 4LC1A 2DR2A 5KBYA 1S7GA 3BDAA 1WB9A 5DM60 4EY5A 2WWWA 3H16A 5LMZA 3J80A 3K72B 3O90A 2VJQA 2Y1DA 2PZFA 4OHUA 4G8BA 4NCIA 1RKXA 2P6MA 3QBJA 1R8JA 3NWOA 3MGGA 2R7LA 5EY5B 3PGJA 4NMWA 4MRSA 3T8YA 3SX2A 3F9IA 3GRPA 4E0BA 3VAYA 4REQA 2ARKA 4RMHA 4I5DA 1DCKA 3DKVA 1FNCA 3GH3A 3OC0A 2PXCA 5AKXA 5FEUA 3PIIA 3MPOA 1GZSA 1XQWA 1T36A 4ZV9A 3B9QA 2JJYA 3ABZA 1D2GA 3O2NA 4RKYA 4DYHA 3P9NA 2BEVA 2FDCA 4X6UA 4TYNA 1PR6A 3OTQA 3WMEA 1IYZA 3OQNA 3NOXA 4NC9A 2NUTA 3Q9UA 4JEUA 3DMTC 2OC4A 5AHOA 2IYTA 2TMDA 3NANA 2EXXA 2EAUA 3ZTWA 4LG1A 1BXKA 1CS0A 2QS9A 1E1QA 3FNIA 4TRRA 2QM7A 4OMFG 5IEBA 4AIIA 4DDHA 3BH6A 3Q9NA 2CSXA 2WNSA 1DC7A 2I5PO 2X42A 4UBJA 2Z57A 3D3JA 3KZMA 5TS3A 3ZBTA 3NNDA 4B4UA 5IXJA 5A4MS 5ADUS 2IZ7A 2OFFA 4DDTA 2VQEB 3HE3A 2NAPA 3L18A 4FMBB 4AG3A 5KVSA 1HE5A 3BWXA 4URWR 1NZDA 3EUFA 3OD1A 1SU6A 2WM9B 4PGAA 4KO8A 1J5XA 3OIVA 3VPCA 4PHFA 2G06A 3IDAA 4IVRA 5EFZA 3ZWMA 3ZY4A 3PUKA 2F48A 1W0KA 2IXTA 3A70A 3IAS1 2AJ8A 1FTYA 3SY8A 4EMSA 5JXJA 2Z6QA 3LAWA 2ZAOA 1HRKA 4F04A 2AG8A 4WESA 2H85A 5CD9A 4BEWA 2RHOA 1K6XA 1OTHA 1P4AA 3WS7A 1FSGA 3ZIDA 1BC5A 3DHWC 3HYCA 4WFQA 1OZ0A 4GE0A 2CB0A 1JALA 1GT91 2PU5A 3DMGA 3DR3A 3NTRA 4IILA 3HUTA 4AO8A 1B1AA 1DS6A 5DCYA 2ZXUA 1NQUA 3HCFA 2J9YB 3NOOA 1O9GA 2GZ3A 3EH1A 3OVMA 4G01B 4UM5A 6LDHA 1PG2A 1NUTA 1SD2A 2OCPA 2B92A 3F3MA 3GJ7A 3IFSA 2XCRB 2PUCA 4ZICA 1AQLA 2VP6A 3BG5A 1WR8A 2CDAA 3D81A 4FN5A 2INGX 1DDGA 1QR6A 1S2IA 1JE0A 1NFQA 3KOYA 4RZQA 3KQWA 3PCTA 5TEWA 4DKJA 3R9WA 3KO8A 4L9RA 4R9UC 3GCGA 3QVTA 2IDZA 3BDVA 2AOWA 3IBCA 3KKPA 3MTBA 3OO0A 2BTQA 3GGPA 3CO0S 5TGTA 1LPAB 4LZPA 4MCJA 4TS1A 4HWKA 2H7VA 4BZQA 1F5NA 2QNBA 4HHEA 5JVDF 3PQDA 1H9CA 2QK4A 4RADA 4WN3A 4OO3A 5CCEA 3SDBA 1F1JA 3WJ1A 1V5WA 3KHKA 3CKYA 3QFFA 4L9WA 4MS4B 5K3AA 2ZE8A 3KQSA 4JOQA 1Z8FA 1EUZA 1CQJA 1XF1A 3VISA 3ZWPA 1JIXA 1N8SA 1PR1A 2H2DA 3MB8A 4UUNA 1UDAA 3L8YA 5IFKA 4PYIA 3N6VA 4NDAA 1F8YA 2CFOA 2IZOA 2JW5A 1D5WA 3HP4A 5EI5A 5F3DA 3OC6A 1TW3A 4BQRA 5LQRA 2OHIA 5IJXA 1BJRE 3KETA 5J2UB 5BQXA 4Y2XA 1M67A 2QYSA 1DV1A 5IN4A 2A9FA 2ANBA 5ED4A 2AXPA 1W1WA 4W9MC 4BRSA 1QGUB 4DE5A 4YUAA 2C9YA 2QE7A 1Y6JA 2PUHA 3FOWA 5CXQA 3EMDA 4EAQA 4FMCF 2FLVA 4N8SA 4P4TA 3DLHA 2P1RA 3IQGX 4HG2A 4ZVPA 3STXA 4MI6A 1GTJ1 1U7HA 1B2RA 1ENZA 1LH0A 4CI0B 5CBPA 3AR5A 1V7PC 5IHPA 1FSZA 1CHDA 1O03A 5DTEA 1A1VA 4TLDA 5INTA 2YJ4A 3M3PA 2EFGA 3E1SA 1DAGA 3IQEA 4HY3A 3EMVA 4UEJA 1B76A 1HTWA 4Z4EA 4IGFA 4AIRA 1AX9A 3OT1A 1MP0A 4M9ZA 3UYKA 4DA4A 1YASA 3HKDB 2P91A 3QU5A 4MO2A 3U4CA 3WICA 1BROA 3WQSB 3GPIA 4JLPA 3UICA 3V7UA 1FBNA 2BELA 3ETLA 1GRQA 2VZ9A 1UXHA 3RUFA 5JIBA 1C7EA 1N6NA 3QF7A 3ZDBA 3QUAA 5EKUA 2O2JA 2QTRA 3EHDA 4G6ZA 1XFDA 2VAXA 4JLVA 5AVZA 1CUYA 2CYBA 1RLMA 2GCGA 2ZR0A 3LFHA 2ANCA 4F4UA 3W5BA 4Y6OA 3WKDA 3P32A 3W77A 4WNAA 5CDUA 5JRJA 3HM9A 5JNTA 3FMPB 1GDTA 1S6YA 3OE7A 3OZBA 2RK6A 4DWWA 2VT3A 2C78A 2CFTA 2JLQA 2IPLA 3JAWA 4LVNA 4TMFA 5EPUA 1JSLA 1REQB 4KCGA 3CVJA 3E3MA 3QXGA 2VOEA 1T6BY 1SCIA 2ZTMA 1NL3A 4TTIA 3E9DA 2IJGX 2J4DA 1WHTA 3GWGA 2AK2A 2BFCA 3H5RA 1ULZA 3PL1A 4BNHA 2MT9A 3BJRA 4RBNA 1J97A 4QEZA 2CF5A 3VYRB 2FPMA 3BKXA 4HWSA 4J49A 1X1RA 1GARA 5BQFA 1OLSA 1TYAE 1D04A 1Z6QA 2IEDA 1EQUA 2JKYA 5C4IA 4L0MA 3A7EA 2H2WA 2IHUA 4AY6A 4C1NA 5ADHA 1BXRB 5EZQA 2GEDA 1JTEA 2PS3A 2AS0A 4JBYA 4EX6A 4X00A 1XD8A 4LDPA 1GDDA 2XPCA 2JAPA 4H2DA 4LJ8A 4MLDA 1GAJA 2XNDD 2IEBA 1W9HA 1QZ3A 2I8LA 4MUMA 4UEWA 4ZEOA 1JE1A 3RADC 1GTRA 4JUAA 2XRZA 1VP9A 3BXHA 3BWEA 1S2GA 5IH3A 3ZH2A 3PDWA 3ANLA 1L6IA 2Z9DA 2AN5A 2WMYA 4MYUA 5ILOA 2GPWA 3A14A 1M1NA 2FOLA 4MGIR 4YCNA 1NQVA 3I8OA 1UKEA 1WKBA 1U02A 1ZICA 2YQ4A 1NQWA 2ZT5A 3KCQA 4MP6A 4PLHA 1PV1A 5KOIA 1RWKA 4KR2A 3HXTA 4WVLA 2UXCB 5DOZA 1BTOA 3WHPA 4E32A 2JCBA 1UBCA 4PC3A 1PUIA 4JBXA 1XJ5A 2ODBA 3EJWA 2IYYA 3OHPA 1EFHA 2D1RA 2J9RA 1GO2A 5TJ9A 2QTWB 3IVCA 3NHMA 4WGGA 3Q8LA 3E9RA 1L4EA 3SXUB 5EKXA 2JCSA 1GG9A 3F97A 3PYXA 5EHGA 3OCWA 4F72A 2XCSB 4F4IA 3DUWA 1RAIA 4HGNA 1W85A 4XYMA 1QQBA 3RUCA 1GUZA 2FFJA 2ZS8A 1KZHA 5KYXB 4QRIA 4X7PA 1I5RA 1Z47A 2VP4A 4I9FA 3PGVA 4DM7A 2Q5QA 1FS4A 3MTIA 5TF0A 3WFZA 4AS3A 1VL0A 1XZDA 2YWFA 3QV2A 1SM4A 1CQXA 4LCJA 5G3YA 2P2GA 4N5MA 5ITSA 4LTMA 3M9LA 4JJ7A 5P21A 3M5CA 1M2HA 3F3YA 4NESA 4AJIA 4B4KA 2H4ZA 2ZE7A 1W6UA 1MAWA 4YJDA 4FEYA 2BY4A 2OYRA 3KU4A 4IF4A 5FOWA 4B6JA 4C06A 3FYSA 2O57A 3OF3A 1I3LA 3CLKA 1CEYA 4XIFA 5JPDA 2W71A 4WOBA 3HJRA 3U56A 4FI3F 3FDFA 3KSRA 1WPGA 3O6VA 3NW9A 2QROA 3RS3A 1YMUA 1HDOA 3UENA 1BOOA 3R0ZA 4DVJA 5TQJA 5LNK6 3R24A 4TRJA 1AMUA 5CH8A 2XAUA 1E0AA 3E58A 3M6MD 1G21A 5L3SB 1ENPA 1P44A 1ZHHA 3M70A 5AJHA 1ZN2A 3N75A 2IPAB 1SFRA 3BGOS 1JJ7A 1X7YB 3OOYA 4RGQA 3RPEA 4Q3NA 3ENZA 5K20A 1A97A 1DAKA 4UTNA 4NHEA 5HK8A 2UYHA 1Y98A 2BV3A 3EUEA 4LQ4A 5LVAA 4MYSA 4GR9A 3R7BA 1GIAA 3SC3A 3T3EA 5CFOA 3VR5H 4QASA 1CJVC 1N5IA 1E1LA 2AFHE 2ZAIA 2YY7A 2ZIXB 3M1IA 5C4GB 3TCKA 1MU0A 1JR3E 4HX9A 3ETJA 3HCEA 3AWDA 3T3MB 4IQ8A 4KFSA 3RRBA 1UFQA 4MQLA 2ONCA 3FYUA 4C20A 2R84A 2XA2A 4DLXA 1K9VF 4AMGA 1Q0UA 2XCLA 5HGJA 2LKCA 1QE3A 1RSZA 2GA9A 1Z22A 4OAQA 1O97D 4L7VA 3VPSA 3ZY2A 3ZWAA 1EG7A 2EERA 4XLZA 4CODB 1EFVA 1L5QA 5JEDA 4EF4A 1QZXA 3MOSA 4CIBA 1NQXA 3VO2A 2VBGA 3SG0A 4BMYA 2NPIA 3CNHA 4ZVTA 1YKGA 4S04A 1VBFA 3MWGA 1YJBA 1O94C 5IVDA 1XZHA 4TT8A 1M73E 1WXEA 2YWJA 4JSRA 2OPBA 3SYNA 2J48A 5AIBA 3H9GA 1AF7A 2VTVA 1QIMA 3AB3A 5KU1A 3I1YA 3I83A 3BHNA 4QHSA 3NKLA 4HV4A 4FFNA 4MLPA 2VA8A 4WCVA 4TQGA 2NZUG 2XWJI 5D51S 2PGAA 1AUVA 1VL5A 3FJYA 3PJDA 2J3MA 1AM4D 3JQ6A 4LHEA 3RAJA 4ZVOA 3SHWA 5J47A 1KI9A 2IUYA 3IUMA 2GPSA 4GYKA 1F4LA 4PZLA 2OVBA 1NN0A 1OXVA 1P4GA 2JGLA 2OVFA 4TV8A 4B3JA 1PZFA 4BMCA 1UC8A 3CZMA 4ISBA 2II6A 4HZUA 4RF4A 3LWDA 5I8PA 3A9WA 3F7TA 1MTZA 3NIFB 4GI1A 1F4VA 2HUPA 4WZAB 4HX5A 2PL3A 3IQHX 5AI5A 5KQMA 1O95C 4RLQA 5GY7A 4DSZA 1C1XA 1NYQA 4POAA 3I62A 4WBXC 4WACA 4EMTA 2Q1SA 1JTFA 3S8MA 1GN9A 1Z0AA 1M2GA 2F3RA 2P0EA 2WTXA 4IH1A 4NI5A 4QGAA 4BNYA 1PWZA 3QJYA 2GNPA 4BNUA 2M2IA 1I8TA 4TM7A 1PJSA 1ZUD1 2GJSA 1PTJA 4P81A 4ZHQA 2IE0A 3JQFC 1ZMRA 1KDZA 1KFCB 3MINA 2XQFA 2ONJA 1XFAA 4HXYA 3RIGA