1LS6A

Human sult1a1 complexed with pap and p-nitrophenol
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
288
structure length
288
Chain Sequence
b'SRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGHSLPEETVDFMVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords aryl sulfotransferase
publication title Structure of a human carcinogen-converting enzyme, SULT1A1. Structural and kinetic implications of substrate inhibition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 97
structure length 288
sequence length 288
ec nomenclature ec 2.8.2.1: Aryl sulfotransferase.
pdb deposition date 2002-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ls6A00
2R65A 3LBNA 3U7FB 2ZRDA 4B48A 2FZ4A 2HT6A 1Y3AA 2XAUA 4XJXA 3UXMA 3B85A 3CR8A 2WVJA 2B7BA 1EFHA 1YE8A 1Z83A 2C96A 1JR3E 3AKEA 3X1DA 3C4JA 4IVPA 4CRWB 3L82B 4B3XA 4C3ZA 2HF9A 4LHVA 1ZD9A 3V9PA 1W2HA 2AKAB 4KFSA 3A1TA 4ZKEA 1UDWA 2KE5A 2H1LA 4QJ4A 4LJ4A 1N0WA 5FUVA 1YQTA 3CO5A 2UZ3A 3TVDA 1OJLA 521PA 1OSNA 1O3YA 2GA8A 4CEIA 5IF9A 2SHKA 1E2QA 4D25A 1XCMA 3RNLA 1T5LA 4KBGA 4OHWA 1N6NA 4BZQA 4LJYA 1Z07A 4ITRC 4WZ6A 1KI8A 3VX3A 4C0LA 4N1AA 3DHWC 4DLTA 2DHRA 2VEDA 3JVUA 3P32A 4JKIA 1FX0B 5L3VA 3GLGE 1NMXA 1AA9A 4IOKA 3WHLA 5A4JA 1IY1A 4JT4A 4Z51A 3O47A 3B5JA 1G1MA 2REBA 3MJHA 2XTNA 3C15C 2D4HA 2WPDA 1G7TA 2QE7D 3BWDD 2ERYA 1CJUC 3GCGA 3GPLA 1T0JB 2I1VB 3U44A 4DLSA 2BMJA 2GJKA 3LX5A 5FOTA 2MSEB 1PUIA 2QNRA 2W6ID 3QPVA 2E1RA 4JLAA 2KJQA 1C1YA 5BW8A 4IRUB 1NNEA 4XSHA 5HCIA 4O2LA 1COWD 1A4RA 1R7RA 2WWHA 4NH0A 2KSQA 1YRAA 1DG3A 3LAWA 3QVUA 4KFUA 1XNJA 1P9RA 4KXFB 3OEHD 2VF7A 3C16C 1E32A 3RC8A 2LKCA 4QGGA 4WVFA 1B0UA 1DARA 1MABB 1XXHE 3AV0B 4MKIA 4M4SA 1OFTA 4M1TA 5SZKB 1G3MA 5KSOA 2BDTA 3FMIA 3FMOB 3PITA 3N2EA 1X1RA 1ZNYA 1CR4A 4UKDA 3GFTA 3B2EA 1ZMXA 3LO5A 2WAXA 1WP9A 2HUPA 3IO5A 3K0CC 3LVRE 4AY2A 3SJCA 5E7MA 4BGDA 3MSXA 1JR3A 2FPMA 4M9ZA 5E4FA 4AKHA 1TAGA 3MRSA 4HDOB 2W6JA 3B82A 1UEIA 2FFBA 4YQFA 4L4UA 3GEHA 5DE3A 3CM0A 2XOKA 5EUQB 3KQNA 1XPRA 4BWYA 1X1SA 1ZW6A 2R8RA 1XMJA 2OHFA 1W49A 1SXJC 4BLSA 2V4ZA 3SJAA 1Q57A 4XTCS 1WMSA 3CH5A 5EE1A 3TGPA 1FP7A 3IILA 4TLAA 3I62A 5LBIA 5EE5B 1DAIA 3SHWA 1D5CA 1Z0DA 1L4YA 3ZZUA 2JCSA 2FSHA 4NCIA 1ESNA 2CHQA 2Z43A 2P65A 1IN8A 1JI0A 2CCGA 1KJYA 4OL0A 4RFSB 2QSZA 1QHHB 3MWYW 3SJZA 5FBLB 4JL8A 2CK3D 2O8EB 3GLGA 4AC9A 5L3QA 1WF3A 2ORIA 2ZE7A 3BGWA 4D0LB 1QRAA 2LCFA 4MA4A 1P9NA 2F1HA 4GOKA 1SKQA 4EFMA 3CRRA 2YKGA 5EP3A 4ZIRA 2O8BA 1G4UR 4JVLA 2CJWB 4QBHA 5J4KA 3FKQA 1IHUA 2QSYA 2Z83A 1J8YF 2PZEA 4HAYA 4B43A 4Y0VA 3ZZTA 4M2LA 3TUJC 1K5DA 4F7WA 4A36A 1SHZA 3K9GA 4RKEA 1TTTA 4XWAA 3NG1A 1RIFA 4UXHA 4URYR 3FB4A 4Q1AA 3ZS8A 3LX8A 1W46A 3KZ1E 3MG9A 2EWWA 4IFEA 2XITA 1VYVA 4PZYA 3JZAA 1N0UA 1AS3A 1TF7A 2XZPA 3GLIE 1NJFA 2QL6A 3EA0A 2P6RA 1NG1A 3LXRA 4JT2A 3ZQJA 3CZQA 1II8A 2WWIA 1XXHA 1G5PA 3A4MA 4Q4HB 5L3QB 1BKDR 1OT3A 1OV4A 1KSHA 5EP1A 3F0TA 4N0DA 3ICQB 2O8BB 1KI3A 2C99A 4CVNA 4HZUA 4ZIRB 4IOMA 5JECA 1SGWA 1ZBDA 4JVNA 2PL3A 4WAUA 3R7WA 4NTZA 1Y63A 4P31A 1DE0A 2ZRPA 2IXEA 4Q21A 4HZIA 1G8YA 2GEDA 3N70A 3R8CA 5KNCA 3PUXA 1J2JA 2RGDA 4P4UA 4YMTA 2ZM5A 2XTZA 3PJRA 2DFLA 4ZI3A 3MWJA 4GI7A 1XD2A 1Q22A 4JLBA 2RGCA 3WMGA 4A1FA 2V3CC 1UBFA 1QHSA 3AM1A 4PC2A 2CNWD 5IK2A 4DKXA 3U6KA 2OCAA 2JJ2D 1QG2A 5FL3A 2GCNA 1KAGA 4NYJQ 1DO2A 1MO3A 1XTKA 3KTAB 3MMPA 4FMCB 2HDNB 3BH6A 3H2YA 4HATA 2VA8A 4D0NA 1G5TA 3A58B 2HT1A 3CX7A 1PLLA 4MUAA 1GDDA 3ADCA 2W2XA 5C4GB 2BHRA 2VTKA 4JKYA 1KI2A 4MRRA 4RZ2A 2QT0A 2H8KA 2Q3MA 2A5YB 4HZUB 2OCPA 4U00A 4WZAE 4U7DA 3CBQA 2IUTA 2EFCB 1QVAA 2ZSEA 2RGAA 1J90A 3FKSA 5CM8B 3ZQ6A 2JGNA 3AB3A 2ZQ5A 3P20A 4QOSA 3R7WB 1PV4A 1UF9A 1P9WA 3CB4A 1EFCA 2JLXA 3RS7A 2D3WA 2JLWA 1B23P 2YOHA 2G9NA 3AVTA 2L0XA 2O0HA 2DFTA 3GD7A 1KO5A 2PBRA 2XJ4A 1NN0A 3IQXA 2QTHA 2CLSA 3TVTA 1Z0FA 1IN6A 2ZYTX 4GT1A 3TE6A 1XD2B 4KU4A 1KJWA 3BFVA 4KVAA 1NN1A 1G3IA 4ZDKA 2IHYA 3C8UA 2CBZA 2AWNA 3FFBA 4PSAA 2ANCA 2QY9A 1Q20A 2R2AA 2WM9B 2E87A 2ZYWX 5G3ZA 4CT5A 4YXWD 3ZS9A 2ZSFA 1P3JA 1ZIOA 3GLIA 3EWSA 2AXNA 2AD1A 3OFND 3OAAD 4QHSA 1OXTA 2QI9C 4B3FX 5HKKD 1KI4A 1A5TA 2IWRA 1P73A 3AP3A 5LDDC 4MDEA 3ECCA 5JEEA 2G1JA 2ZJ2A 4BPBA 5L3SA 3A8TA 3A1WA 4Q03A 3SQXA 2JDID 1RRGA 4Q00A 2JLZA 3PVSA 2EYUA 3D8BA 4DCTA 5HE8A 1KHTA 2BBTA 3GJ5A 3RSOA 3TKLA 2VSXA 3FMPB 4B3BA 4RD3A 2NZ8A 2FF7A 2NIPA 4BFTA 3REFA 4QKQA 1PJRA 1E79D 3LVQE 1RZ3A 3LA6A 1WRBA 4XSGA 2BMFA 1I4TD 3CUEF 4NYMQ 1KK3A 2XTMA 4RD6A 3A36A 221PA 4GZLA 3TR0A 4B73A 3REGA 4ESVA 2DB3A 1M7BA 4F4IA 1ZD8A 1U8AA 4PHHA 1R5OA 4FCVA 5CK5A 2O8DB 3NC0C 3R9WA 3RRZA 4DLYA 1VG0B 3X1YA 2IS1A 4Q02A 2QAGC 3T1QA 1W4BA 2FPKA 1G6HA 3BC1A 1XEWX 5C2JB 5L3SB 3FVQA 4YMVA 3TSOA 3HWSA 2RGGA 3BJIC 1OH6A 3MWLA 1EFUA 2WHXA 3EZ7A 4DEXA 1U9IA 2W0MA 1S0UA 5SZIA 3GMTA 1RRFA 4QG7A 3HU1A 1DPFA 5EE9A 3GJ7A 3W34A 4A8JA 2QG6A 4HB0A 1XD8A 2J46A 4CT4B 1H8HA 4MH0R 1ZIPA 2C95A 4XD7D 3AUXA 3PUYA 1G3RA 1Z22A 2UZIR 2GBLC 3T5DA 1XTJA 4NCKA 1Z28A 4DIDA 2A3RA 1JECA 1XEXB 1OKKD 2RGBA 4LJAA 5CYOA 2GCOA 2C77A 5FPHA 2XSZD 2HF8A 3ND8A 1FPMA 2RGNA 3C5CA 1YU9A 3CONA 5FBWB 4TSFD 3RYTC 2UKDA 3K8YA 2IYQA 1YJ5A 1KI6A 1KI1A 2WZQA 3VMFA 3JVVA 1NBME 2A5DA 2OEPA 5FI0B 3FTQA 2IS2A 2CL6X 1KDRA 1E2LA 4KFTA 5KUTA 4JSTA 2G6BA 1I2DA 3QKRB 3TW4A 3MCAA 5FOSA 1AS2A 2BM0A 1YKSA 3T5GA 1OIXA 2ZETA 4NCJA 1OH5A 3VKHA 4HAVA 1P7CA 2EYQA 1XB2A 5TVKA 5J4VA 2I1QA 1E3MA 2GAAA 3CPEA 1BIFA 3ZGXA 4D26A 2J59A 1VCIA 4QL3A 3IKJA 1MKYA 3DOFA 4PC6A 3GJXC 3CNLA 3LLMA 4PPFA 3HDTA 2QBYB 1Q1EA 2XX3A 4AI6A 1ZU5A 2QN6A 5FUWA 1KI6B 1UFQA 4TLBA 2BIFA 3T34A 3NBZC 2ZI6A 5C18A 1FUUA 1HUQA 1ZINA 4Q7LA 4HAWA 1F2TB 3FDIA 1EFRD 1XFAA 4EUNA 3ADKA 3L0IB 1R0WA 1MO4A 4UNSA 5FR2A 4Q01A 2VP9A 3ZVLA 4L9WA 4MKGA 1TQ6A 1XJCA 3QSYA 3T1VA 2YHSA 3VX4A 1GKYA 2BEKA 1CLUA 1T5IA 3E1SA 1DBSA 4JLPA 2H17A 2V1XA 3CPJB 4TL7A 4BE7B 4ILEA 5SZHB 5KNBA 4OI0A 2PJZA 5DIFA 3TJZA 2AK2A 1GZSA 4BFZA 3KKMA 4Q1FA 2F1RA 5JHGB 2VO1A 2WJGA 5DN6D 1XTIA 3AVVA 2X2FA 1MR3F 1VCNA 2IA5A 3LBHA 1CJTC 5DI9A 2C03A 2BKUA 3U3MA 2QTFA 4LYHA 2HXYA 4OBEA 5EP4A 2XNDD 1E1QA 4M1OA 4DLUA 3B60A 5JMTA 4OQFA 2Q9AA 2YWFA 4TZ0A 4PC1A 5FTNA 1Z2AA 1E2NA 1JR6A 2FWRA 2GXQA 1OB5A 1R10A 2Q0HA 4M1SA 5DNYB 5EUMA 1NBMA 3Q9LA 4BFUA 6Q21A 1OH8A 1UBGA 3DM9B 3S1AA 3U60B 1P2SA 1U81A 3R9IA 3H0KA 2CL7X 4PTLA 1G17A 3FHOA 3B7GA 1VPLA 2ODWA 1HURA 4LUCA 1VHTA 1XU4A 3W3ZB 2J5XA 4PFSA 3Q7QA 3QQ5A 1EK0A 2A5JA 3FGNA 4PC3A 4Q7JB 2OESA 4TWZA 5BWMA 3AVXA 2AR7A 3AVWA 4DZZA 1PVOA 2VH5R 1M8PA 4IEIA 3U3OA 2OBNA 3MJRA 4P3YA 3ZIAA 2IW3A 3QENA 3FE2A 3IO3A 3Q8XB 3SFVA 4XWOA 1QHGA 4US0R 4G0NA 4HYYA 1ZM2A 1JQJC 2ZRLA 1Q44A 4BEJA 1N6LA 1X86B 3DZDA 3VFDA 4LZZA 1Z5ZA 1X8KA 3I1FA 5M04A 1NSTA 3WMEA 3D31A 2W83A 1N25A 2OLJA 4FMDB 3BRWD 2FFAA 2WWGA 1UPTA 3EG5A 3NTUA 1YR7A 3QF4A 2P6NA 4JMPA 3S1AB 2YWGA 3ZVRA 2P5SA 2F9LA 2FSGA 1E2KA 1ESMA 4Z8XA 1IY0A 2FGKA 3EASA 4JL5A 3TSZA 4Z54A 3LQRA 3I73A 2ZRBA 4ZO4A 1KSJA 1FTNA 1MT0A 4LSGA 3KQLA 1F60A 2PH1A 4N0EA 3H86A 1NMYA 3AGQA 2PCLA 1JB1A 4FMBB 4JS0A 1G16A 4LV8B 4I1OA 1GTVA 1CJKC 2YC2C 4WOPA 1M74A 5FPKA 1AN0A 1SVIA 3WNCA 1C9KA 2ZTSA 1GFIA 2IUSA 4MRPA 3TMKA 4ACBA 4PPGA 2PEYA 2CVFA 3KXIA 2HYDA 3K70C 1WCV1 4IDNA 4DLWA 2Z6VA 1AGPA 3GJ3A 3QF4B 1TMKA 2OAP1 3CW2A 1G291 3MLEA 4RY2A 2IEYA 3TUZC 4EDHA 1R0YA 2JASA 4JZKA 2OBLA 4DSNA 2V9PA 1Z6TA 3ASYA 2ZRKA 4M1MA 1KI7A 1P60A 1PZNA 1IJFA 1IXZA 2J1LA 5HE9A 4DVGA 4MRSA 4WZBE 3W5IA 4C0JA 2HEIA 1CULC 2IYXA 4IDPA 3UPUA 1GNQA 1CS4C 2OILA 1WA5A 1NN5A 1T3HA 2EWVA 2F43A 3OIWA 3QF7A 1HYQA 1KKMA 1OLOA 3HR8A 4PZZA 4ARZB 3BFKA 4TQUS 4URWR 4F4JA 4EPVA 4UXIA 2NO9A 3X1XA 4PC7A 3RS4A 2WWYA 3K0EA 1TPZA 4DIEA 3RS5A 3D7MA 4D82A 2DWQA 4EPWA 2JIZD 2BMEA 4LYFA 4DSUA 4EPXA 4A92A 1D9ZA 4CIDA 3BFXA 4O25A 4M9QA 1XCPA 4AYXA 2D7DA 1P2UA 3LRPA 4TYYA 4KYUA 4QBFA 5K8TA 5H8WA 1DOAA 3P26A 1RYFA 5EP2A 3AQ4A 1QHXA 8OHMA 2EFGA 3F3YA 4LCBA 4RVCA 3UWOA 1W36D 2BBSA 3ETLA 1OXXK 5B2ZA 4MGKR 4UNQA 2F43B 5DO9A 2A7QA 2VP0A 4E07A 5DISB 4HSEA 2ZSDA 4EQ6B 2GTPA 3KFVA 3W9YA 3ND9A 4NYJR 4TL8A 3WBJA 2PMKA 1ZYUA 3H84A 1CJMA 5FFMA 2F55A 4S35A 5DHAA 3SJBA 1E2DA 3I3SR 1GP2A 5J4YA 2JLRA 4M1KA 2B21A 5F3WB 1HE8B 3QEOA 5JWRA 3U4QA 1M6NA 1J70A 1XJ0A 3NBXX 3QKTA 5AJYA 2RHDA 1GL7A 1Z2CA 1U94A 4PX9A 1YHNA 1ZM7A 3PUVA 1E2HA 3QOFA 1NRJB 5TB5A 5FL7A 1TF5A 5K8IA 1E96A 2PZFA 3CF2A 2FSFA 3BE4A 2IYLD 1E2JA 2QPOA 5J4HA 3K0SA 3W3AA 1G3UA 2F1IA 1CR0A 2GETA 1M7GA 4FMCF 4B74A 2R44A 3M1IA 1FX0A 4ON9A 1KO7A 2FPLA 3CZPA 3ZVMA 4LOAA 4I4LA 3R9XA 2YJTD 1FNNA 1HEIA 4Q4LA 1Z8FA 4MYTA 1XPUA 3I5XA 1I4LD 2WPDD 2ZE8A 1GILA 2ZE6A 4RD2A 2ATXA 2VPPA 1EFTA 2ZI5A 3T12A 4HLDA 1IBRA 3U4QB 1Z0JA 4JJZA 3SBDA 2ZRHA 2XNSA 3A37A 1PLJA 4YMSA 3B78A 3NDPA 5BN3A 1P4SA 2JLYA 1JEEA 2HXSA 3BBPA 3CIOA 3OIVA 4J0QA 2GVDC 4BRWA 1G3QA 4OI4A 4DEYA 2ORWA 3AF4A 3P27A 1XWIA 1P75A 4PSVA 2D2FA 2WWFA 1GIAA 2GVZC 2QT1A 1KO1A 4EJSA 2O8CA 1O87A 5HPYB 1DELA 4BLPA 1CRQA 1MABA 4M0LA 1OIWA 2GNOA 4G1UC 5FUYA 4KO8A 3TR5A 4ERNA 4LC1A 4K46A 2C9CA 4NYMR 4ZI2A 3Q5EA 3EC2A 5EZ5A 2PT7A 2PZGA 3IHWA 3MFYA 1OXVA 1OHHA 3K70B 1Z08A 2XB2A 2CDNA 2X8AA 3FWYA 3T06B 4V0ME 2B8WA 4KBFA 4II7A 3CPHA 4TTPA 3SS8A 2WAYA 2X1VA 1JR3D 5CLQA 5J47A 2H5EA 5EZ6B 1OF1A 5EJEA 2RGXA 1R4AA 2W6JD 4TYQA 4AKIA 4TT3A 3OZXA 2FV8A 3TAHA 2XOKD 1T4GA 2ZRJA 3EZ2A 2VP6A 4DT1B 4Q18A 4N3NA 1GL6A 4G5RA 2VF8A 3P4YA 1LW7A 4QXAA 2OG2A 3O8DA 4P32A 3GP8A 4EJSB 2O8CB 2NQ2C 1M2OB 1ZVQA 2WKQA 3PR1A 3OHMA 3QE0A 4CEHB 4RFSA 5BXQC 3K09A 1QHHA 2R6DA 1N2CE 4A9AA 1RW4A 2GCPA 2HYIC 2O8EA 2ZRIA 1MOZA 4NU0A 4TMVA 1CIPA 4ZCMA 3W8RA 3RAPR 2ZSBA 1S96A 2AN9A 4RD1A 4A2PA 4PHFA 3DM5A 1RRCA 2CJWA 2QTVB 1NY5A 4UNPA 3EZ9A 4OI1A 5B58C 3SNHA 3WYAA 3F5FA 3AUYA 5AUNB 2VBCA 4C0KA 2A2ZA 4TMTA 2QGZA 4G01B 4B2IA 2VP5A 1OH7A 5BQ5A 5JSZB 2ZS9A 2OFXA 2QE7A 4NDZA 4RFVA 4TYPA 1MV5A 1QHYA 4ZCLA 5FR1A 3PXGA 1M1YE 1Z0AA 4B75A 4LRWA 1N6HA 5K8UA 4E5UA 3VAAA 1KK2A 3QKSB 2QRNA 3TLXA 3VKWA 5JJIA 2IF2A 2K5UA 4LJ7A 1L2TA 5D3MB 5EE0A 3QXJA 5TV2A 3RC3A 3VHLB 4Q4HA 3THXB 3LH5A 3OE7A 1QF9A 4XIGS 2ODEA 3K9LA 1F48A 2GKSA 2ZANA 4PQYA 2FMXA 3KJIA 4LDJA 3T1TA 3ADBA 1YZGA 2Y8EA 1G9XA 3AVYA 5KPJA 3KQKA 4HLQB 2ODNA 4PAOA 5CLLA 3EPKA 3RRYA 5GJWC 4AYTA 1Q1ZA 1V5WA 5E3HA 4V0MA 1SXJE 1NLYA 4PO9A 3GFOA 4TLEA 4BLTA 4DUGA 1XBTA 4XVRA 3SEAA 4S2EA 1UAAA 2A30A 5TMPA 2XGJA 3AVUA 1DVRA 3V00A 2F9MA 1FMJA 1N6KA 1UM8A 2CCKA 1E9FA 1VIYA 2D74A 2HCBA 2PEZA 4MGZR 3THYA 4B6EA 1J7KA 1ZU4A 1T9HA 3WP0A 5DYIA 2QMUA 1QDEA 2VSOA 3KTAA 4HUTA 5HR5A 3BH0A 3CNOA 1FQKA 4XVUA 4BECA 3NDBB 1UBCA 2QZ4A 1IY2A 2UVQA 2WOOA 4KODA 4MGIR 5KSPA 1LB1B 4ZDIA 5JLJA 2Z4RA 5DI3B 4DBLC 2ZAMA 2RMKA 3EX7C 1N0VC 3QPWA 4Z1MA 4NE2A 1HV8A 2WKRA 2GRJA 2IYTA 3KQHA 3FKSD 2CHGA 1U99A 3THOA 3IBYA 2VP4A 3QBVA 4LWZA 4G5QA 1VECA 1JAIA 1TU4A 1GRQA 3NKVA 4F4CA 2OE2A 3KXLA 3U61B 3PENA 4MGYR 4DRZA 4DDTA 3NHAA 3THYB 4Q9HA 3OEEA 4KFRA 1FUKA 3WHKA 5CITA 3GLFE 1CJVC 1JEDA 1NSFA 2QQ0A 4YMUA 2HLDA 4QGHA 1N5KA 3EIEA 2YZ2A 4JLJA 1KIMA 2D7CA 4XWKA 1E6CA 4ZDJA 1E9SA 1E9RA 4CZ2A 1F6BA 1OFUX 3I8SA 4Q66C 3L2OB 4OI2A 4NCNA 3K0CA 3U5ZB 3A4NA 1R0ZA 1QZXA 2H7VA 3CWZA 5CJ2A 3B6EA 4LBYA 2X2EA 3BB3A 4DCVA 1ZUHA 4TTQA 2IYSA 1U8ZA 5BYKA 1J99A 4R98A 1HTWA 1KNXA 4QBGB 1R6BX 4FW9A 3KKQA 4LYAA 3AKCA 5LD2C 5HZHA 3VR1A 4C0AC 1SXJA 2GILA 3GLHB 4ZDWA 2JEOA 3AF0A 4E09A 1E9EA 4I81A 2PX0A 4W9MC 1YVDA 4JLVA 1E2EA 3I32A 3SI7A 4E22A 5H70A 2RGNC 4NKRA 1E2FA 5GADl 1EG7A 3AF1A 3BK7A 1HE1C 3O8BA 4Q4JB 2P0EA 2ZVQX 2Q9CA 4V0OA 3TIFA 4FXPA 1M7HA 4A6PA 4PXAA 1G8PA 3PEUA 4IFBA 1KYIA 4IW3B 4KCGA 3NVAA 2O8DA 5FOXA 2B8TA 4PAMA 3HP1A 2DY1A 2VLIA 2W2TA 1XMIA 3U3KA 4CEJA 1MRNA 2CNWA 3A6PC 1VCOA 3RRNA 5JJKA 1YZUA 1GITA 3AF3A 4IDQA 3TAUA 4I1UA 1NN3A 1X8JA 3IIJA 1DAFA 3G82C 1S4QA 4ZPXA 2ZJ8A 5FPYA 1SVKA 1GNPA 3IEUA 3W6NA 1E2MA 4FMDF 3W90A 3OESA 1T3LA 3TSWA 1XEFA 1R2QA 2CLDX 1XDBA 1SXJB 1W2GA 5KHOC 1SZPA 2OAQ1 1AZTA 3QBTA 1GG2A 1S1MA 4H1VA 4MITA 3PUWA 1XRJA 4A4DA 1HQCA 2GAOA 4M9SA 4F92B 4R7ZA 2C8VA 1A1VA 1Z6AA 1ANKA 2R9VA 4LI0A 3GLFA 4Q9JA 3FHTA 5K8LA 1DEKA 2QMEA 1G41A 1UKEA 2OFWA 4JSYA 1OYWA 3ZD6A 2V8OA 1E2PA 3DDCA 1XEXA 2BC9A 3QXSA 4KAXA 4V0LA 3C14C 5CB8A 1TUEA 1H8EA 1VKJA 1NY6A 1RE0A 3A1UA 2OO7A 5B64A 1JAHA 2QPTA 4YDSA 4C0QC 1LTQA 4BUJA 4CEJB 2P3SA 1F3OA 4D4KA 3DKPA 4CDGA 1VMAA 3N5CA 5DYGA 4DCNA 4D0GA 2IK8A 2ZJOA 4LBZA 4DDUA 5KO2A 1D8TA 1P61B 3QKRA 3LY5A 5AJWA 1KNQA 1LY1A 5CM9C 3O8CA 1W4AA 1GAJA 2JLUA 4LPSA 1DTSA 4LHWA 821PA 4B3GA 1ZM4A 3KKPA 5F9FA 1NLFA 3ZVNA 4DLRA 2OZEA 3GLFB 2JDIA 2ZJBA 1BOFA 2GZDA 3EC1A 1E9AA 2W58A 4IJMA 1IN5A 2QBYA 4IVQA 1N5LA 2FGJA 4HAXA 4YC7A 2NGRA 2JLQA 1G8FA 3EW9A 4AKGA 1N6OA 2ZI3A 4LV6A 4P33A 2KBFA 1BS1A 4HLUC 1BMFA 1F2TA 5GVRA 1KSFX 1LFDB 3BXZA 2G1KA 1L7VC 5E7IA 1UDXA 3G5UA 5FBQB 3RWOA 4DCUA 3QXCA 2WWXA 4A2WA 1WE2A 4M9XA 3C41J 1SULA 2EFEB 3SQWA 2J87A 2IYUA 4ZKDA 5H68A 4GDFA 1XCGB 5KTYA 5ANRB 3TBKA 3G0HA 1SVLA 2O0KA 5JZVA 5FI1B 2ECKA 1AIPA 1EWRA 2FN4A 1DAGA 2ZITA 1LNZA 4C2TA 2CMKA 2KB0A 3LWNA 4AD8A 2AKYA 3QY0A 1E1QD 1K5GA 3W5JA 4RZXA 4R2IA 3CWQA 4MYCA 4UNNA 2FDCA 2OCYC 2YC4C 5AJXA 3BORA 1P62B 2GXUA 1YZLA 3B9PA 1Z6YA 1OYYA 2BEJA 4JYCA 2GJSA 1U2RA 3TW8B 3SHFA 4H1UA 1CR2A 3CRMA 4L15A 3ICEA 4DJTA 3EAQA 3FHCB 1NBMD 2YV5A 4E03A 4XTRA 1SKYB 1W0JA 3AF2A 4ESHA 4EPYA 4B3CA 1R5NA 2RGEA 4Q4AB 4NPHA 4DCSA 1W0KA 1HH4A 3TH5A 1L8QA 3U3RA 1ZM9A 1XP8A 2ZI7A 1EX6A 4CW7A 4M22A 1IJEA 1NIJA 2ZS7A 2VHQA 3AVQA 3PG5A 1S3SA 1E1RA 4HB4A 1NVUQ 2R6AA 1E99A 2DWPA 3SYLA 2FA9A 2KI5A 1KO4A 3U3JA 3IIMA 3ZIAD 1TL7C 2GESA 3X1WA 2RB4A 3DKVA 2GJ8A 1JXOA 2OSBA 3LNCA 1NI3A 4Q1DA 1E0AA 1KO8A 4IOJA 1F2UB 4LX0A 5C1BA 1KZGB 3WP1B 1G8HA 1W4CA 4RCZA 2ZI4A 3A4LA 1VTKA 2R6FA 2R6CA 4QFMA 3RSLA 3U7EB 3VU9A 2OM2A 3PEWA 4B6FA 2QRZA 3VNVA 4Q7MB 1GUAA 1NIPA 1FMLA 4OK5A 2A78A 1KY3A 2ZPTX 3BIFA 3I61A 3RS2A 4GOJA 1IAQA 3AGPA 1N3BA 3KDSE 2GBLA 5FOUA 1T6NA 4PHTA 1A2BA 2KWIA 3U6BA 1KSGA 3ZLJA 1RYHA 1KDPA 2DWOA 2NG1A 3TNFA 2QP3A 1G8GA 2F6RA 1W4RA 3CKLA 4MQBA 2O0JA 4RKFA 3E5HA 2QAGB 3PCRB 2ZJAA 3SYKA 2WJVA 3CX6A 5B57C 4YONB 1DAEA 2P6UA 1UKVY 5DN6A 3VTKA 3ADDA 4HAUA 1KMQA 1ZD1A 1V43A 1DAMA 4JBXA 4B35A 4EKDA 3V4RA 5G3YA 3VU9B 1D2NA 1ZNXA 4PO1A 4GZMA 4MKFA 3RVBA 4MDFA 5EXXA 3RS0A 3QKUA 3WMFA 4XVQA 1Q21A 5IDVA 3O8RA 3WYGA 2BBOA 2ONKA 4OK3A 2AFIE 5HZKA 3NHBA 1JJVA 2WIBA 3GEIA 1HT2E 4JLKA 1Z06A 2ZRFA 4K81B 4OJQA 3IBGA 4PO8A 2BCGY 1G7SA 5GJCA 4B76A 1JJ7A 1Q3HA 2DYKA 3VKGA 1XD9A 1LS6A 3QG5A 4URXR 1XX6A 2JATA 3GJ8A 3UKDA 4ARZA 1XPOA 1K8RA 3FMFA 2DPXA 3T15A 2CLCX 5GJVC 2LKDA 4L16A 1GVNB 1T8UA 2AL7A 5IRCD 3T35A 1GOTA 2NO7A 2NPIA 4GMDA 2JJ1A 1BO6A 3AKYA 5DLQC 1EESA 1VYTA 4KV9A 4AWXA 2AK3A 3JZMA 4XH9B 4D81A 4MYHA 3RWMB 3AKDA 4W5JA 1OB2A 1W36C 4NZYA 4NHOA 1D2MA 3L0PA 4X8LA 4ZCIA 3UATA 621PA 2GXSA 2WMOB 3BERA 1P2VA 3PUZA 1Q1QA 5JI3E 4LY6A 4URVR 2C04A 4V0KA 2I3BA 2B6HA 4GFDA 2ONJA 1KTVA 4QRHA 1XTSA 2OXCA 1OXSC 4AYWA 4HDQB 4FWTA 1ZAKA 2CXXA 1S3GA 4AK9A 5CK4A 2WSSA 4EQ6A 2DFNA 1JQLB 2JLSA 2J7PA 2OXRA 2MMCA 1NP6A 3DOEA 2VIIA 3N2IA 3NXSA 4GMXA 4HEJA 4JBYA 4X8MA 2AXPA 2IXFA 2GWHA 3UWKA 1UADA 1UEJA 3K9NA 3U2QA 2ZRAA 2ZVPX 1L4UA 3KX2A 3LQQA 1YR8A 4Q9KA 2QP4A 3OIUA 1VHLA 1TADA 3LXXA 1CTQA 1FW6A 5E95A 4ASUA 4QBIA 2QORA 1W5SA 2GK6A 2VL7A 2QM8A 3TUIC 3VNUA 1S2MA 2J0UB 1XF9A 2BJVA 3OIYA 2CVHA 1VIAA 5FL7D 4ACAA 4URUR 5G41A 1W1WA 3ZYCA 2EQBA 4FWIB 1GM5A 4L9SA 1UBEA 3AH8A 4TQAA 1E2GA 4BFYA 2ZAOA 4G5OA 3IQWA 1RJ9A 5FTJA 1KMHB 2V7QA 4RD0A 3EIQA 4U5XA 2WJJA 5FBVB 1RFLA 4QNRA 4A15A 1SVSA 1XTQA 4NCHA 4BFWA 1FP6A 3PIRA 3X1ZA 2V54A 5JI2E 3E70C 2ZRCA 4L5BA 4POAA 1Z0KA 5CB6A 4BFVA 2Q21A 1CRPA 1N6RA 2ZUBA 1X8LA 3NBFA 3KJGA 1GNRA 3VR3A 2BCJQ 4W5HA 1P72A 1S9HA 1FOEB 3K09C 3BAFA 1VG1A 2AFHE 5CYPA 1A82A 3ONWA 3FPAA 1LF0A 2WMNB 2FFHA 4KHZA 5FOVA 3ZD7A 1E2IA 2XB4A 5FTLA 2CE2X 2QA5A 4NYIQ 5KSZA 1WXQA 1RJ9B 1AQYA 2JIZA 4GSYA 4UXJA 1AKYA 5EQTA 1ETUA 3IUYA 1AQUA 1WQ1R 3CRVA 2W0SA 2EVWX 3CRW1 3DL0A 5KDOA 2G3YA 1A2KC 5ELXA 3CRQA 4C9BA 4PZLA 3DEFA 2WJIA 3AVOA 1JNYA 3GQBA 3RABA 2QEQA 1OHHD 2HCJB 4US1R 2VHCA 1LS1A 3NEYA 4EFLA 4DSTA 1UKYA 2ZI9A 2ZROA 4HI0E 5B30A 2NZJA 4IHQA 5JHHB 4JVSB 4TT3D 3LDAA 4DT1A 5JEDA 2QAJA 1QHIA 4PPQA 4KSBA 3FOZA 2D62A 1E0KA 3Q72A 4IXNA 3SN6A 2QMHA 1R8SA 4UJ5A 1E94E 4QGFA 1IN4A 3QI2A 4O2RA 4MKHA 1AM4D 4NP6A 1TF2A 2J45A 1G5RA 5AR1A 3IDQA 3GJ0A 2GHIA 4IEEA 4CEHA 1VYUA 3B13B 2OT3B 3K9HA 4R71A 4DC9A 4MRVA 5UKDA 5DH9A 1KGDA 2FEOA 4GL2A 2VHUA 3W6PA 3TQFA 1NKTA 1W36B 4FINA 4C7OA 4KITB 4NONA 4QHTA 3D6TB 3K0FA 2IX3A 2ZXUA 3SZRA 4D4JA 4WA7A 4QJ3A 1GWNA 1N6IA 2IEZA 1RVDA 4OQLA 5AJZA 2PJRA 5JSZA 5CIQA 4LGMA 1HQYE 3FFAA 5JFGA 1AJEA 5FPTA 5JRJA 2C2HA 3C7KA 2A5FA 4D4LA 5GJBA 3QKSA 4A6XA 1D6JA 4JVMA 3SYNA 5KU1A 5D3MA 5AWFC 3KL4A 5A0FA 4AURA 5EXSA 3THXA 1ZUIA 3OE7D 4CEIB 2ZU6A 3T61A 2VRWA 2VYFA 1DG1G 4KLNA 2IWHA 3UIEA 5D3QA 2N42A 4LHXA 4C7OB 3AVPA 4AIIA 1IXSB 3P4XA 4GP6A 3QG1A 3I92A 3GLHE 3IHLA 3K0FB 3SU8A 3UK6A 1YZTA 3HJNA 4A82A 1E69A 3DPUA 4BQSA 1E98A 4DUGD 5L8VA 1GSIA 3BB1A 1W7AA 2CCJA 1YZNA 3KKOA 4BZPA 3RDPA 3LV8A 5DHFA 1Q0UA 3Q85A 1IONA 4IDHA 2QENA 4QM6A 3EPJA 2QPAA 5LPNA 2GJAA 1Z3IX 2RHMA 4DLXA 3U44B 3NC1C 3R20A 1QHNA 2FNAA 2W6IA 3CH4B 4F91B 4M21A 4PPNA 4PANA 2NO0A 4I1SA 4QGAA 1DAHA 1QBKC 5SZJA 1COWA 1WBDA 1G20E 2H57A 1YZQA 4B32A 1FTSA 3KQUA 421PA 1MH1A 5DI3A 2DCUA 3MWKA 1IQPA 1G7CA 3QJYA 4B34A 5AUOB 1JXMA 3SR0A 3WNDA 2ZREA 3OEHA 2ZJ5A 4A2QA 2GXAA 1XJQA 1Q12A 1DAKA 1Z29A 1KI9A 4GPTA 4A0FA 4HB2A 4Z1MD 1NLZA 2QM7A 1E4VA 3A1SA 3X2SA 1CF4A 3HU2A 4BLRA 1IN7A 3CF6R 3J81k 4AG6A 5EXTA 4F93B 1NMZA 2NO6A 1T8TA 2P5TB 4TYWA 4V0NA 3PEYA 2IYWA 1NVXQ 4I99A 3IGFA 4JL6A 5CJPA 2V1UA 2G83A 3OEED 3L0OA 4TTRA 4BLQA 5IK2D 4JBWA 1Z63A 4OKSA 2HLDD 1U0HC 4LJ8A 1Z47A 4EAQA 2X19A 2YWHA 4Q9LA 2FG5A 2Z4SA 4Q1EA 1AS0A 4KLZA 5FTKA 4TN1A 2IBMA 2O52A 3E2IA 1YR6A 1NVVQ 1I2MA 1ZUNB 4IKEA 3MD0A 1A7JA 2OLKA 2J0VA 2ZRGA 2G88A 4P4TA 3BOSA 5KDLA 1ONBA 4KJZA 4URZR 4D2IA 4DB2A 2RKOA 2CK3A 5CDFE 3GLHA 1P6XA 1ZNZA 1SXJD 2YYZA 2G0NA 3B1XA 1II0A 2KBEA 3MUFA 3PFIA 3GLGB 4C4PA 1TQ2A 2AX4A 4G3XA 4WBSA 4FIDA 4Q5IA 4BLOA 2Q3FA 1KK1A 4Q4JA 2GEUA 5IHPA 1KK0A 1XEWY 2QMOA 3EZFA 3IEVA 4GBMA 4MUBA 3GFPA 1XMVA 1SQ5A 4HUQA 1U9IC 4UQOA 1HY3A 4CYMA 1E0JA 2W00A 1HA3A 3H1TA 3Q5DA 4F38A 5FBRB 2J0QA 4UNRA 1ZC3A 3FYHA 2F7SA 3EA5A 4AKEA 5LB2A 2A9KA 3BS4A 4V02A 4A8JC 4NMMA 4BASA 1RC8A 3B1VA 4RCYA 4C2UA 3RANA 4D4MA 3NH6A 4DB4A 3QXHA 1II8B 1XXHB 3SOPA 2QROA 1G4AE 2IYYA 3HR7A 2CE7A 1EWQA 1NL3A 2ZR0A 4KI0A 1GL9B 4LPKA 1UKZA 4BFSA 2WOJA 3DMNA 4I1VA 3RHFA 4TYNA 2WV9A 4PQFA 4PAQA 4C0BA 1P2TA 3W8NA 4CF7A 4FI3C 4H9GA 5TY0A 4KSCA 1JBKA 2Q9BA 3RS3A 1TQ4A 4B44A 2VSFA 4HUQB 4P4SA 1WBBA 1GRNA 1H8ED 3EPHA 5JS7A 2IS6A 3LW7A 2ANBA 2AWOA 4LYJA 1ZRHA 3EXAA 2IHBA 2JJ2A 2GJ9A 721PA 2WICA 4JLNA 4B47A 4TL6A 2V6JA 1J8MF 1SKYE 2ODBA 1KZ7B 1OIVA 3SE0A 5F98A 1R0XA 4ZV4A 4RJLA 2PT5A 1ZM3A 3LD9A 1AK2A 2RCNA 1W44A 3V4FA 1FFHA 1KOFA 2OUKA 4R2HA 4LHZA 5CDFA 2FU5C 1BYIA 1ZJ6A 4U02A 1ZCBA 4R9UC 3SDZA 2JA1A 2F3RA 2JJ8A 2BJWA 1H8HD 4HB3A 3LFUA 4OQNA 5JRZA 4OJKA 5KOYA 1OXUA 1XMSA 3NBYC 4XOIA 3WY9A 2XZOA 3BB4A 2CL0X 4P4SB 4YMWA 3QUSA 3NIBA 3W6OA 2HJVA 1JPJA 3EPLA 2WJHA 3H4MA 2CHVA 3DMDA 3C5HA 4FD2A 2WWWA 3Q3JB 1R5BA 3B1WA 3L8YA 3PV0A 4AG5A 5F9HA 2B7CA 4TLCA 4YXWA 3WYFA 1BMFD 3NH9A 4CGZA 4TL9A 1FQJA 3CR7A 3U7GA 1MO5A 2ZUDA 3OAAA 1ELOA 3OFNA 5HKKA 3GLIB 2QP9X 2GF9A 2D2EA 2H16A 3KUDA 4PR0A 5JCPA 3DZ8A 4IDOA 2AHOA 2ERXA 2IF0A 4Q1BA 2IC5A 1SVMA 4NBSA 4HLCA 5BYJA 4BFXA 4X8OA 1D9XA 2BVNA 2IT1A 3B9QA 4GRAA 2JAQA 2C9YA 1OFIA 5JCZA 3RRMA 5P21A 5F2EA 2NOAA 2JLVA 3L43A 2PX3A 3EIHA 4TZ6A 5JWHA 1EXMA 1LVGA 1T3SA 4JLOA 5DGXA 4Q47A 1YRBA 1SVWA 1E79A 3HU3A 1G21E 3HYRA 1TEVA 2FJUA 2GF0A 4LHYA 3WRYC 1KKLA 2BV3A 4Q19A 2FZLA 4C30A 2C5LA 3AEZA 2EW1A 3QXXA 2ZS8A 1KDTA 1AKEA 1JPNA 2IUUA 2CEAA 1KJZA 2PLFA 4TMWA 4LBVA 1CXZA 1US8A 3THWA 3GJ4A 3R8FA 1W0JD 4Q4AA 2IS4A 4PHGA 3I72A 5LB4A 3IPYA 1W0KD 1AZSC 4Q1CA 1NF3A 1YZKA 1ZNWA 3BD9A 1XZPA 4YLGA 4JLDA 4DWJA 1M34E 3RLFA 1OW3B 2A5GA 1RPZA 5BN5A 2R6GA 1CR1A 5KPDA 1TEXA 4C0SA 2VHJA 4W7SA 2HJGA 2WJYA 1E1RD 5DSZA 2FEMA 3M0EA 5FTMA 1WDTA 2FSIA 2ZUCA 1T91A 1U0JA 1XZQA 1Q1BA 1U0LA 1NG9A 1KAOA 2Z0MA 5JJLA 1AGRA 3NEJA 2FX3A 1VG8A 3VHXA 2FFQA 1MO6A 4NYIR 3KJEA 3ZZ0A 2NMVA 1QG4A 4YDHB 3SBEA 4A8JB 4TQ9A 2ZSAA 1F2UA 4JIMA 4OHZA 2FH5B 4XD7A 2ZEJA 2XZLA 4DSOA 2O8FA 4NL4H 1F5NA 3IPXA 5LD2B 2N46A 1NVWQ 3EARA 1BH2A 4TMXA 1G19A 2ZR7A 3U7HB 4OQXA 1JALA 4V03A 5FPSA 1TUIA 3ZJYA 3B8HA 1US8B 1OKKA 3THWB 2OCBA 2H18A 2XSZA 1CP2A 2GCOB 1SVOA 1E9BA 4A0GA 5GVSA 2WSMA 4TSFA 3SFZA 1CKEA 1W5TA 1U98A 2B92A 4WIAA 3ASZA 2FE4A 3GJ6A 1GRRA 2NTYC 3LLUA 3HPRA 1G18A 4QNMA 2HV8A 1DADA 1TQDA 4HAZA 2MSDB 4OYHA 5G40A 3ZH9B 1HT1E 2FOLA 2GK7A 2OBMA 3UG7A 4IXMA 4EIWA 1X6VA 2QAGA 1E9CA 2I4IA 4B2LA 4OK6A 1W48A 4QC2A 5A5GA 1Z6GA 2YOFA 4G5GA 2O8FB 4PSKA 2GZHA 4QM7A 5J4LA 4FCWA 3QEJA 1D2EA 4TMKA 1KDOA 4M53A 4LBWA 4QHYA 2WIAA 4A0HA 2PLRA 5AK0A 2PMDA 2Z5FA 3KB2A 2YOGA 5G53C 5JBQA 1ODFA 121PA 4LV5B 4Q9IA 4FCTA 4K8OA 4HDCA 5EXPA 4EPRA 5IT5A 4A0RA 1U8YA 4IOLA 4GOXA 2ORVA 2ASEA 1EFRA 1CBUA 1PLKA 1I4DD 3P1JA 2LWIA 2F3TA 1E9DA 3DVLA 5FH9A 2PCJA 3B1YA 1ZCAA 4M1YA 2E9SA 4B2PA 2IXGA 4HLUA 3BH7A 2J9RA 3WBKA 4B33A 2C9OA 2JJ1D 1P5ZB 2ZJYA 2XEXA 3AP1A 3L0SA 5HTKA 3UMSA 3PQCA 2YNMA 5C4MA 5EE3A 1VDZA 4B3DA 4DDWA 4RD4A 4DHEA 1MRSA 1KY2A 1U90A 5BN4A 2IYRA 2X77A 2XNDA 2O5VA 4Z8YA 3QPUA 1IM2A 1RRPA 2WKPA 1VG9B 3MGCA 1OFHA 2VQSA 1YR9A 2EU8A 2F1JA 3I8XA 4JLMA 3KJHA 4O0MA 4P0TA 1LV7A 3M4YA 1OPXA 3KUCA 2C78A 4EFNA 2GZAA 1G6OA 2AD5A 4M1WA 1CEEA 4TLDA 5KSYA 5TDHA 4BZXA 5TARA 5J40A 3QNUA 1TNDA 4DLVA 3EWAA 2Q6TA 1FNMA 2WSSD 2ZYVX 3I5YA 2N1BA 2J7PD 3DO6A 3K0AA 2BMDA 1DO0A 2RAPA 1S1CA 3CX8A 1IOZA 1TU3A 5AUPB 3SC3A 1S9DA 1GKUB 2V55B 2BM1A 1NKSA 4C0HA 1GKIA 4UJ3A 2NPFA 2ZU0C 4G5SA 2NO1A 3I4LA 3ZDQA 2TMKA 1VCMA 4ASUD 5KDDA 1G7RA 1Z6XA 4RZ3A 2J0UA 3WXMA 4KVGA 3PEVA 1PUJA 4BEBA 2QGNA 4EPTA 5L3RA 4JJKA 1E0SA 4M8NE 4OHYA 2J0SA 2WBLC 1N5JA 1FL9A 1KMHA 3CNNA 2YINC 4LJ5A 1Z0IA 2V7QD 3KXKA 3D3QA 1E4YA 1N6PA 2BBWA 3UANA 2W2VA 3QVVA 3VR4A 3K0AB 5KNDA 3HYTA 3KB1A 1S8FA 4Q7KA 2MSCB 1H65A 3Q7PA 2XJ9A 2EFHB 5J5CA 1UJ2A 3MAAC 4RZUA 5FOWA 4Y0AA 2GDJA 4EJSC 1BYUA 1NVVR 3EZ6A 1R8QA 3KFXA 3TK1A 1II9A 4US2R 2ZRMA 2G0TA 2BWJA 2J41A 1ZP6A 2DFKB 2ZYUX 3A1VA 3VR5A 1W47A 2IYVA 4X8HA 1EX7A 2VHTA 2WTUA 2J3EA 4BRUA 2EFDB 2REXB 4KYIB 2QUZA 2IL1A 2G77B 3WNBA 4LJ6A 5TXGA 2J7KA 3T1OA 1N5IA 2MMGA 5JS8A 4W5WA 4D80A 1CU1A 2REOA 5H1YA 1QVRA 1TX4B 2BOVA 2ZRNA 1EGAA 2ATVA 2ZE5A 4LJ9A 3K53A 1XTRA 4WXPA 1C4OA 4MRNA 3UG6A 4Q48A 2R62A 4GNKA 3K1JA 2DR3A 4IVRA 3K70D 1K6MA 2XXAA 4QJ5A 2D06A 3F8TA 5FUXA 2YVUA 3IIKA 2ZJZA 5AJVB 4JYBA 4OQMA 3UMFA 4O3MA 2IYZA 2OV2A 3NWJA 4MYUA 4PQRA 1SHKA 2V6IA 1LF5A 2ZIAA 5HCNA 2QU8A 3TRFA 3CLVA 3L8ZA 3LBIA 5KYKA 3OF5A 4LC0A 1OE0A 2DBYA 1NJGA 2YWEA 3UMRA 4ABYA 2QQEA 3CF0A 2OFOA 4LK2A 4OHVA 3VR2A 1ZC4A 2Q3HA 1G64A 3KKNA 3VR6A 3HPQA 1WB9A 5E7JA 1FZQA 3QIAA 2P2LA 2ZR9A 1Q3TA 4FN5A 5C46F 4RSGA 4DXAA 2H92A 4WXRA 2RH5A 5JWOA 1RKBA 3TQCA 4GP7A 3VQTA 1DS6A 4L8GA 4DDVA 2GEVA 4DLZA 5CIWA 3M6AA 1IXRC 4B71A 2BKEA 4D6PA 2XXAB 2C98A 4OHXA 3GEEA 5AUQA 4TMZA 2P67A 3LW8A 2VP2A 1X3SA 3WRXC 3B1ZA 4WW0A 3AP2A 1T0HB
chains in the Genus database with same CATH superfamily
4GMHA 4UBKA 5EYPB 1QKKA 4UHBA 2R11A 2R7AA 3SBOA 2H3HA 3R5JA 4O4LA 2J09A 1U3CA 1ADCA 3CR8A 1NONA 3FW1A 1EFHA 1L6RA 1Z83A 2GCEA 3DE0X 3GT7A 5ALLA 3X1DA 3H0CA 1RXCA 3L82B 1N34B 1J0DA 2HA7A 4LHVA 5IVKA 4EQZA 3V9PA 1SKUA 4HFJA 1OLXB 1OI2A 3ETCA 2KE5A 1NYTA 4U2DA 4F45A 2BGTA 1XT6A 2CW5A 5IVHA 4LJ4A 3AOEA 1LK0A 3ZI0A 1N0WA 1NXSA 2IU0A 2ZUFA 1PFUA 2UZ3A 4X7RA 3DWGA 1OJLA 2GNAA 2SNIE 1O3YA 4NS1A 4V39A 3UT6A 3IXMA 4D3XA 3RS8A 4XVCA 1E2QA 4CEIA 4MSUA 4E4TA 2QRVA 4KBGA 2HFKA 1THTA 2QXYA 3VU3A 3AIKA 3EVZA 4G56A 3VHRA 3T99A 3TLGA 5DBIA 4DLTA 2P75A 1NTRA 1TC2A 2I66A 3LQKA 4RMGA 4JKIA 3SQLA 4PYRA 3WL6A 4DR5B 1SCIA 2P9FA 4NICA 5A4JA 3WHLA 1O97C 4AL4A 2PX2A 4XFDA 2APJA 3MJHA 5LUBA 3IESA 2WPDA 1BDHA 2DTEA 4QTYA 3GCGA 4GGPA 4FKBA 2F8LA 2D6FA 2DQYA 4OSOA 3D4LA 4CM8A 3PYXA 4PGAA 3U44A 5A5VA 1I7QB 1VQ1A 4MINA 4TMFA 5FOTA 2XECA 4PYJA 3QPVA 2BE9A 4TYMA 4NSNA 5D6NA 2KJQA 1T9KA 2W6ZA 1GTG1 3QLJA 4OL9A 1HDYA 3NAQA 5EERA 4O2LA 5K4GA 1N2XA 2WWHA 3BRSA 1CHDA 1HT3A 3NVMB 4Y9SA 5KQMA 1RZRD 3PUKA 3R77A 3ZHSA 2P35A 3C3XA 2C92A 4C7MA 5EJEA 3OQIB 4KXFB 1SR8A 1OB5A 1E32A 3FDZB 2V6BA 3OQPA 4RVGA 3RC8A 5I4IA 3VI4B 1Y8CA 4CLOB 1DARA 4PIPA 1EVYA 2Q3LA 1T1SA 3JZIA 3KQYA 3KWFA 3KOOA 3D0KA 2IKSA 3A4YA 4M1TA 2QYHA 4JENA 4ES6A 3FMIA 3FMOB 3RT7A 2P9EA 2D0IA 1EJ2A 3K70C 1X1RA 1ZNYA 1DMRA 1CR4A 2VK1A 3UUFA 3LO5A 3B2EA 1ZMXA 2J5BA 1SM4A 3HVKA 3QUTA 3IO5A 2HUPA 2XT9A 4AY2A 3QE2A 1GNVA 5AT1A 4HJXA 1JHVA 4PG8A 3FF4A 3F7NA 1FVOA 4Z49A 3G5AA 3JAWB 4M9ZA 4ESOA 5JOQA 4LSWA 5E4FA 4YGYA 3GOQA 3MRSA 4RTNA 3CR3C 3N0WA 1X1SA 5CAEB 2OHFA 1U7WA 4ZQCB 4WFJA 2V4ZA 5LM3A 5FLYA 4G84A 1ADYA 1QKIA 1X2BA 2C97A 3SK0A 1MX3A 2W5UA 5L9AA 4ABYA 1D5CA 1XE3A 3N87A 3D6JA 1ORHA 1L4YA 1Z0DA 2GD1O 3ZWMA 3ZHVA 8ABPA 3TB4A 4NCIA 2Z43A 2P65A 1IN8A 2XQGA 4RFSB 1QHHB 3MWYW 4DN6A 3SJZA 4JA0A 1IWBB 2BEVA 5FBLB 1ENPA 1G5IA 3ZJVA 4COKA 4AC9A 1WDKA 5DCWA 3NWOA 5DXAA 3SM3A 4D0LB 1QRAA 2LCFA 1CQIA 4IQ8A 3KK0A 4C06A 1Z4MA 2JFHA 3WIVA 4YASA 1E62A 5IDYA 1PZGA 2H4ZA 4R3WA 2YKGA 1M3SA 3OECA 1E6MA 1JR4A 4P08A 1UFKA 4JVLA 1PJ8A 1G66A 5J4KA 2QSYA 3ETDA 5E9QA 2PZEA 4KN6A 5K0NA 4F85A 1Y7IA 4QYXA 3M1AA 2GERA 2R6ZA 3TUJC 4JUCA 4PINA 1JJFA 5KU7A 4RANA 4HEHA 3ABRB 4RKEA 1Q7CA 3NG1A 1CY8A 3QX3A 2WAOA 4EMSA 1WL8A 3GZ4A 4J29A 4Q1AA 5ENDA 2ZJ0A 2F90A 4IDEA 5KCMA 4YVFA 1W46A 2QDXA 3AU8A 3BREA 2DZDA 3CW9A 1VYVA 1ZQ9A 1UDAA 3HCRA 2ZUEA 1FXWF 2P9HA 1Z5GA 2JZNA 3KYDA 4TXNA 1KYXA 2FR0A 1NJFA 3MRXA 1LQTA 4KWEA 4EELA 4W6ZA 5ITWA 2P6RA 1NG1A 1Z5NA 3QHPA 2A9PA 2QRUA 4KG7A 1H3FA 1II8A 1XXHA 5JC1A 4R83A 4C7BA 2EP5A 4EEKA 4F96A 5I3ZA 2C8KA 2FPGA 1I1HA 4M98A 4RWEA 5K0TA 4Q3BA 3MCUA 4I4TB 4AN1A 4WK6A 1JPUA 2YIDA 4IO1A 4N0DA 1V4NA 5EIBC 3V4LA 3PEEA 4ZIRB 3IE1A 2O8BB 1FX1A 4KZPA 2G9ZA 2HA3A 2E4ZA 4JVNA 5B36A 3M3DA 3L0YA 4EYOA 4DBLE 5EKDA 2ZRPA 4PZUA 1G8YA 1GGFA 1T6XA 1FVHA 2GEDA 4X3OA 3KFLA 4DTIA 5D87A 5JAMA 3DBVO 3E0QA 1QX4A 3D8NA 2GYWA 4P4UA 2ZM5A 3FLEA 1FPQA 2OBBA 1P1RA 1EE9A 1GT6A 1KYTA 3M6FA 2UXCB 3MWJA 2RGCA 2ZW9A 4A1FA 2XYHA 3O2JA 4IQ4A 2CSXA 2CNWD 5IK2A 4LVCA 1DDOA 4PRKA 2OCAA 2X9QA 4JQYA 1QG2A 3STHA 7ADHA 5JSFA 2AOVA 4JB8A 5DNWA 5TMBA 4NZZA 1MO3A 2YQ4A 3KTAB 4MR9B 1QDUA 2WWRA 1WX1A 2VPQA 1HRKA 3UGKA 4D0NA 1G5TA 4IUYA 4OMFG 2MWMA 3O3NB 1R0SA 2C2MA 2P3QA 1A4UA 2WIFA 3R23A 4XWYA 4JI7B 2BHRA 2RHWA 1RVV1 4CT5A 1KI2A 1PUXA 3DTVD 4MRRA 4N6NA 4RZ2A 4F5WA 5LXTA 1R9MA 3N76A 3PYLA 2OCPA 1RRVA 2F8MA 3F6SA 4WZAE 1CUFA 5IJ0A 4U7DA 1PK9A 4UZFA 2EFCB 3ROZA 3OZWA 1J90A 1ZICA 4MKXA 2A0WA 4U6NA 1MA3A 2JGNA 4C78A 1E89A 3R7WB 4ERXA 5CBPA 1IZYA 2AEJA 1PV4A 1Z8HA 2D3WA 3I12A 1WMFA 1FY2A 4HK4A 4KGZA 3LKDA 4RZSA 1IOVA 1L4KA 2L0XA 3BTVA 4U3JB 2GBGA 5BSWA 1CLEA 3PGKA 2C07A 1DGQA 2WA2A 4UATA 1IOWA 1MQSA 2E6UX 4B79A 2Q0XA 5EIBD 3S7ZA 3SX2A 4BLUA 3SEFA 3SF0A 5PNTA 1SZDA 2I3ZA 1GADO 2FN3A 3L7KA 1O5OA 3TE7A 1M1YB 3HO1A 2R2AA 2WM9B 4YP9A 3ZKWA 2FWNA 2PJDA 4RKYA 1ORRA 2B35A 2JZOA 1WG8A 1ZIOA 5K3AA 3EWSA 2AXNA 3OAAD 2HU7A 2QI9C 2TYSB 1JFVA 2YV4A 4I1PA 5EKXA 1KPIA 4ND1A 4ALIA 1P73A 3M6XA 4TMYA 3AP3A 2R0QC 2CUTA 2VDNB 4HDNB 2ZJ2A 3I23A 1WVMA 4H27A 2IJGX 4JLUA 1A4IA 2VTVA 4PQEA 5L3SA 1G9SA 3SQXA 3COPA 4LQCA 1RRGA 4Q00A 4H31A 1EJBA 2X5KO 3OE1A 4HEQA 1PWYE 4ZK2A 3R7NA 1C7QA 1I7PA 1JW9B 2BBTA 3NHUA 4B3BA 4RD3A 4GC5A 2C7BA 1EA7A 2EOAA 2NAFA 1X19A 4HWSA 4DA8A 1MW8X 3MA0A 4ZOLA 4QKQA 1O95A 1PJRA 2ID4A 5EWMA 1RZ3A 1UEXC 4O4HB 1WRBA 4CWAA 4D99A 1DKNA 4U7PB 1PWEA 2Q1SA 3GP3A 3MQFA 1U5BB 3OEYA 4ZD6A 4FOLA 4JYZA 5FD8A 1X74A 5G0SA 4GVLA 4BGUA 4KQMA 4GZLA 2OGZA 5G4KA 4B73A 1FMFA 3REGA 4ESVA 1RCTE 4F4IA 5K5EA 1RT9A 1U8AA 4PHHA 3OLYA 3NC0C 4H2DA 3QU2A 1B2RA 1XZLA 3TZKA 4MJXA 1YS2X 4KE6A 3OJXA 1QV7A 4L95C 4M0UA 2QAGC 4Q02A 4BVBA 2XE8A 4D9EA 3ZUPA 3C5VA 2A0KA 3BTSA 4B4UA 3A6ZA 3C1AA 4YMVA 3AK4A 3FOBA 2C94A 1JG1A 2IQIA 4Q9DA 1KOJA 3AL2A 4ITUA 3A10A 4EB6B 4DEXA 3TXYA 3UAVA 3Q1LA 4XLZA 5I45A 1U9IA 1ZK4A 3OOJA 5DMXA 1MQ8B 3TOZA 3OA2A 2Y67A 1OXBB 2GLUA 2PK3A 4ZVSA 5SZIA 3UKJA 1IK4A 1RPTA 1GSHA 1J8DA 2D1SA 3NHPA 1UPCA 4G1MB 3CU5A 4HB0A 4NBVA 4I14A 3KETA 4MH0R 5HZMA 1FK8A 1TA0A 4OBXA 4X7BA 4CV0A 1Z22A 2YQZA 3MWFA 1CDZA 4NNPA 4RPHA 4EZIA 4I5EA 4E1VA 1XRNA 1ULHA 3GIDA 1CUGA 1W8IA 1XA4A 3G8DA 5IVIA 4C21A 4CCYB 3FR7A 3HYLA 3WYBA 1FJGB 1UZUA 2B3TA 2F8TA 2XSZD 3CLTC 3I37X 3RJ9A 1DPGA 3CONA 3PQ7A 4AP9A 4TSFD 1M6WA 2F1OA 4CI0B 3OLCX 4Z99A 1HE3A 4PLFA 3VMFA 4BOYA 3EXEB 4CV1A 4MO9A 4L2IA 4YR7A 5A7FA 3BXGA 1VL8A 3D4OA 3IRVA 5FI0B 3T6KA 1N36B 1OTHA 3L7MA 1JDTA 2QW8A 3EFOA 4LHEA 1UWLA 1J00A 4ZVUA 3S2FA 3FTQA 4BB5A 4E31A 4R0MA 1E2LA 4KFTA 2TMYA 1C14A 5BYAA 1I3OA 5JCOC 1G59A 5KUTA 4YH1A 5LYJA 2JAPA 3O2NA 9ATCA 1I2DA 3TW4A 1N9KA 3FMGA 1UANA 5DCYA 4FNAA 3MRTA 1OBCA 5IUKC 4IIJB 2ZETA 4FOPA 4NMWA 1OH5A 1JSCA 3F46A 1IPFA 2BGIA 4M0EA 5ICGA 5J4VA 4UULA 1G63A 5AKXA 5CVEA 2GAAA 3IXLA 1N8TA 3ZGXA 3HJUA 3G1WA 1YOBA 4QL3A 1MKYA 3QSGA 4PC6A 1R37A 1U0GA 1VI5A 2FMFA 3H5AA 1JPVA 2CNDA 2JHAA 3IXQA 2QBYB 2SBTA 3DYBA 1S2GA 4FE4A 4S1WA 4WXYB 1ZN9A 1ZU5A 1SUEA 1Z73A 2OD2A 5FORA 1AB5A 4GLFA 1UFQA 2XLCA 3DT8A 2BIFA 2KX7A 3HCOA 5KJCA 1O94A 2IUYA 1KETA 5H81A 4D1YA 3MOGA 4HAWA 4GOND 3IOYA 1XFAA 2WAMA 2VQDA 2R84A 1R0WA 4G97A 1U3FA 4KRXA 5FR2A 5THQA 4MO2A 2VP9A 1WW8A 1TQ6A 3MMXA 4TKUA 1NXVA 3CLTD 5TPZD 3HCPA 3M70A 2BEKA 5DHRA 3ACDA 3E1SA 5A05A 1DBSA 3RFTA 3CGGA 4LXQA 4TL7A 3T5CA 5SZHB 1WPQA 4EY7A 3K6RA 4F12A 5B3KA 4BP9A 3WWPA 1GZSA 3KKMA 4RNCA 1RLMA 3HP4A 2VO1A 3A6EA 2WJGA 4OX9Y 1XTIA 1EP3B 1RC0A 4WZZA 2DBVO 1DBPA 2Q9UA 3RBAA 3H18A 5DI9A 3IQFA 3R0IA 4XX0B 1QAMA 3ZLBA 3L8DA 4OBEA 5EP4A 3COVA 4HMOA 1X9GA 4REMA 5JMTA 1M2VA 1WY7A 3VC2A 1TK9A 4NC9A 4CDNA 4TZ0A 1Q91A 3I30X 3DQQA 3OZBA 4ZAFA 1Z2AA 4R0VA 3TLCA 1YI0A 1S2OA 2QL5A 3DDSA 5CCEA 1QRDA 1U65A 3KSDO 1LDBA 1QGED 2JVKA 3TIIA 1ORWA 4BB0A 5LZ2A 3A05A 3MOSA 4NV3A 5COQA 4LDPA 1L5ZA 4Z4QA 4AJOA 3DM9B 3RVPA 1ZMOA 3QVLA 4AS3A 1QFZA 4AO6A 4X5OA 3H0KA 1MIOA 5M5BA 1GTJ1 4KE7A 4KXWA 4DOMA 1UXIA 3S5JA 1TC1A 1VPLA 1ULZA 4KNYA 5LQNA 1V7QA 3EG9A 1Z74A 2A6PA 4B09A 1WF6A 1MOQA 5HF6A 1C7ZA 5ICEA 2ZSJA 5DBHX 4LGCA 1JG4A 4TWZA 2NU7B 3AVXA 1KRWA 1XZBA 3GROA 4NX2A 4WUTA 3AVWA 2CY0A 4DZZA 2I4TA 5HBRA 1M8PA 4W7HA 4IEIA 4DNOA 1R8XA 3MAJA 5BSRA 3IT1A 4GVXA 1AD2A 1UPUA 3IO3A 4RVSA 3SFVA 1QHGA 2PR7A 1F1JA 4BGEA 5H9WA 5IANA 4M83A 1GYPA 3LZDA 1ZM2A 4HYYA 4O4LF 1N7HA 1YVUA 2DBQA 3V8QA 3WK5A 3EEOA 2HFJA 3DZDA 1S2IA 1EINA 2D8AA 3EVDA 2CFSA 4D41A 2FZKA 2EP7A 3OJLA 3OX3A 5FA5A 2A5LA 3PB3A 3CV3A 5DIZA 1AQIA 2C61A 2IU3A 2B6NA 2W83A 2AQHA 4B2LA 3AC0A 4PGMA 2FFAA 2WWGA 3HKEB 3NTUA 1YR7A 3DZFA 3RM3A 1OV6A 4AJPA 4ZJZA 2YWGA 1WBJB 2AZ4A 2P5SA 1JE1A 2DERA 4YCNA 1E2KA 2J9FB 3B6MA 1L7MA 3JQDA 3NWEA 4Z8XA 5EEGA 2AZXA 1IY0A 1JH8A 3MHTA 3MWEA 4G0YA 1PYOA 3FYSA 4DDKA 1DHTA 1NFRA 4RAOA 4X24A 4F21A 2DXIA 1JKXA 1KH1A 1PQ4A 2FMHA 5CDGA 3GN1A 1T5HX 1GA4A 1FTNA 1W96A 2V0NA 1MT0A 1TCAA 2FMIA 3E61A 4LTDA 4LSGA 5HA5A 5TNXA 1FLVA 4Z0TA 3KQLA 2XPCA 4FC7A 4LF4B 2WTXA 5BQPA 5TMDA 3SC6A 1A71A 1HT0A 1QO0D 2C5FA 3WLMA 4FMBB 3I8OA 4F7WA 1G16A 4WOPA 4I1OA 1WJGA 1CJKC 1ZN7A 3RGGA 4ZYXA 6ABPA 5FPKA 2WTEA 4FDAA 4D0RA 5AW5A 1QYDA 3AEXA 1C9KA 2J4DA 3VR5D 2ZXEA 4WBNB 2WPNA 2RGUA 4HWKA 4PPGA 3R3HA 2DSNA 4E6EA 1Q7RA 4AUMA 1YJ8A 4RL4A 5GY7A 1UXOA 1VL1A 4DGQA 1IXKA 4IDNA 5H5JA 1IN1A 2Z6VA 1AGPA 5EFOA 5T57A 2XW6A 2IUEA 2WP8J 1DEXA 1OILA 1G291 3HDVA 4RESA 1M54A 1QAQA 3JYOA 4KXUA 1VLVA 4EY6A 1R0YA 2OBLA 3M4ZA 1CNFA 1Z6TA 3ENZA 3QX7A 3JQAB 4M1MA 1P60A 1V7ZA 1FYWA 2GHQA 3IOMA 4JU8A 4I55A 4AN4A 4NJMA 3JATA 4MQFA 1CULC 3UPUA 3SJ7A 5JQGA 2Z5LA 1GNQA 1YDWA 1CY4A 1CSEE 1XI2A 1NN5A 4OJMX 4QVKA 4AZ3B 1VYHA 1E3DA 4NENB 4J0DA 2ZIVB 4KSYA 1NBEA 3VR5H 4UXIA 5ECDA 4BVHA 2NO9A 3MGAA 4FHFA 4EVSA 4FIZA 5FJJA 4PN3A 3IAS6 5BMOA 4QDJA 2B69A 2AZMA 4QO8A 1EFPA 2CYBA 3B3AA 3K0EA 3RC2A 4ZOEA 1JDPA 1XDUA 3LSYA 4JNKA 4DIEA 3O90A 4FZRA 3RS5A 3RU2A 3DZCA 5CDSA 5FX2A 1QS0B 3PHJA 2QXTA 1RWVA 1U2QA 5AM2A 5HX7A 2JIZD 3MINB 1VGVA 2JG3A 3SNKA 4EGAA 4TWJA 4C89A 4CIDA 1D9ZA 4DG5A 3OJWA 3BFXA 4ETMA 3FA2A 1F12A 3DGFC 3VV2A 4D6XA 3DBLB 3PQFA 1EVQA 1C3LA 1Z75A 2GN9A 3IQZA 1GKLA 1H0RA 2ON6A 4EGJA 1TT7A 4WJKB 4UZSA 3WGNA 3WQRA 1FMCA 5C9ZA 3P26A 1RYFA 2ODPA 4FQ5A 4NQRA 5EP2A 1QHXA 3VJLA 4ER6A 5B7GA 3G17A 5HP4A 3LUBA 1IUNA 3Q0IA 2BSXA 4LCBA 3WGOA 3ETLA 3UUGA 4Z7NB 1ILEA 4MGKR 2WK1A 3IDAA 5DO9A 5ITVA 4C88A 5AK3A 2WHPB 1X70A 4HSEA 3KQMA 4Q3DA 1L9XA 4CTOA 2VYQA 1Z0UA 2RHRA 4V2IA 3OCUA 4LF5B 3ND9A 4AXXA 4JSRA 1SWWA 4MVJA 1GHTA 4TL8A 4QPDA 3NTRA 1MAHA 3VR6H 4ZCPA 3H7AA 5D6OA 2E4VA 1NKVA 4RIEA 3FDXA 3KPJA 4N7BA 2JGAA 4EABA 1L5VA 1I80A 3NBXX 2GGSA 3PNQA 1GEGA 1M66A 1OI4A 1QGUB 2CVPA 3AUSA 4JVOA 3T5TA 1RJGA 1ZS9A 4YEDA 1ZONA 1ZM7A 2JGLA 4ALKA 3NNSA 3IJRA 3N8HA 2R4QA 2BGGA 1TF5A 5KJEA 5K8IA 2R47A 4U63A 1T9GS 2IYLD 4RKWA 3JTEA 1K2VN 1HFKA 3W3AA 2WLSA 2DECA 2IP1A 2XUDA 3BGOS 3DLIA 2F1IA 2G28A 2LNDA 4KUHA 4TQGA 2GETA 1YULA 3HYSA 4M54A 3ROEA 4B74A 3OTHA 2R44A 1Y5NA 4HGRA 2PX4A 3A3NA 3ZXSA 3L8MA 1IG3A 1KO7A 1N2EA 4H7DA 1SBNE 1U1DA 4OHCA 4PYIA 3TD6A 3ZVMA 3R9XA 1PVOA 1BHJA 1V11A 1Z8FA 1XPUA 3IA7A 1DJLA 1CUSA 1I4LD 1N57A 3CUWA 3ENNA 1KE1A 3IVAA 1BE6A 1PS0A 3JWPA 1A9ZA 2IHZA 1S5PA 2ZI5A 3Q7SA 3T12A 1V45E 2FEKA 5AIAA 3PLRA 2J67A 4HH3C 1E20A 2PL1A 4JJZA 4OMUA 2P8JA 1L7NA 3IKVA 4RGBA 2XNSA 5H80A 3ZXUB 3B78A 3NDPA 1P4SA 1C4KA 5D2CA 2EDCA 1VSBA 1WQ3A 3F6EX 3VPSA 4KFCA 3JVEA 4IDAA 1GGJA 1SCDA 2V7GA 2VAVA 2HXSA 3BBPA 3F4LA 3NX4A 5K3OA 2YJNA 3DF7A 4J0QA 4BRWA 4OI4A 1WPXA 3RAJA 3AF4A 4CG1A 1F8GA 1SD2A 1XWIA 2E6KA 3NATA 3OKCA 3JR3A 3B7WA 2WWFA 2GVZC 1J24A 2JBWA 4MS3B 4OGFA 5EZSA 2QTRA 1MNQA 4QPNA 3VDXA 3P9RA 2B4YA 1UOQA 4G4IA 5HPYB 1DELA 3A6GA 1JF8A 4L5YA 1PTJC 4IINA 4B17A 1OIWA 4KP7A 3J81A 3JWHA 2CEKA 2GNOA 3BSWA 4JP1A 4NEGA 3TR5A 5TJ9A 1KQOA 4ERNA 3T52A 4K46A 1EGMB 3M89A 3MCWA 3HCFA 3IUJA 2UVPB 3JD0A 4OYRA 3PI6A 4YMLA 2Q6IA 1YMVA 4FHDA 5EZ5A 1THZA 2PZGA 3K0BA 3MFYA 1FUIA 4AZ0B 4NABA 5LXTF 4FILA 5F2NA 3E9RA 4B3MB 1GL3A 2NAPA 2XB2A 4L8WB 3GRPA 1B6RA 1W9HA 2B8WA 4II7A 1NURA 2ZRQA 3R4CA 4PLPA 5CLQA 3H1GA 2AZTA 2JZCA 4TYQA 3BE6A 5JFTA 5CNMA 3OZXA 4YO8A 1VGRA 4QXRA 1RPNA 2ZYRA 4Q18A 4N3NA 4XGKA 4B80A 2P91A 2VF8A 3B6KA 4QXAA 4CG2A 3A7DA 3O8DA 5ADVA 3GVPA 2C3OA 2Q7XA 1CCWA 1XDZA 4Q37A 4C0WA 3IDZA 1NOKA 2O8CB 3G79A 3QUCA 2X0IA 3IODA 2NQ2C 2IYNA 1IWPB 2PSJA 3BHMA 3GEDA 1U3UA 5GOTA 4EP1A 1ZVQA 5J23A 4CEHB 2ICAA 3OHMA 5E4TA 5B7PA 3SF8B 2R6DA 2MOKA 2OZVA 3MM4A 2Q5QA 1QCZA 4GPEA 4MMZB 1KZYC 2ESRA 1O08A 2FFJA 2PSEA 4Y6QA 3JAMA 5JD4A 2XE4A 1CIPA 4KRYA 3A04A 4TMVA 1ZGAA 3KXDA 1FP1D 4H7KA 1HDZA 4YV1A 1LPSA 1Z5OA 5CFLA 1T8PA 4BQRA 1HRDA 4RD1A 4DJJA 1N5RA 3G23A 4PHFA 1RRCA 2RFLA 1XMOB 1NY5A 4UNPA 3EZ9A 5F35A 3IDOA 4OI1A 1XELA 3CVOA 4P80A 5B6IA 3LZCA 1YA8A 1K4YA 1IVSA 2PGDA 3H42B 2AA3A 3I6YA 3LCMA 3MJEA 5B7QA 2A92A 1I7NA 1XHEA 4O4JA 3ADOA 2P1RA 4TMTA 4G01B 1E4EA 1DX4A 1ISHA 1J20A 2Q29A 3JASB 4QAQA 5AHWA 1GCOA 4JIGA 3QPBA 4OFXA 2YN4A 2IZ6A 2WKSA 3DKIA 1E8DA 1KL7A 2QE7A 4TYPA 4ZOLF 4ZCLA 3R24A 5E0OA 1E1CB 1ZA1A 2E4AA 1Z0AA 3I52A 2B4TO 4F2GA 4U0KA 5KYYA 4U9HS 4W1QA 2H29A 1XGKA 1N6HA 3H9UA 4MGHA 3RVRA 5K8UA 4ICIA 2GD0A 4E5UA 3VAAA 3QKSB 2QRNA 2P78A 3CNHA 2RARA 4AM8A 3VKWA 3KSAC 1HQDA 1HMPA 1E6WA 4JZYA 4ZANA 3K9CA 3HWWA 5EE0A 3S2ZA 3VHLB 3VXKA 3OT5A 4MUMA 2FEAA 5FO0A 2ODEA 3CNEA 4A5OA 1B73A 1JDZA 1F48A 4PQYA 4EFKA 3ANSA 5IX8A 3Q9SA 4BJ5A 3ADBA 5ALDA 1CE8B 3EGDA 1W8DA 1GQSA 2H4FA 1ONPA 1XZAA 3FNFA 2ZB3A 3C8ZA 4G6ZA 4S1PA 5GJWC 3RRYA 1E63A 1X42A 2GM5A 4ZALA 1V5WA 4TXJA 2GTIA 4AYTA 4BLTA 5E3HA 5KQPA 4OHBA 4JUFA 3X2EA 3K8QA 4S2EA 3EEYA 1N2IA 4IDGA 4JBHA 3AVUA 5HMLA 3VYSB 2I62A 2PD6A 4Y2YA 4B8YA 3VZPA 5KNCD 1K66A 5ISMA 4R9VA 1VIYA 4F5YA 4KX3A 3FI0A 2HCBA 2A3NA 3TX2A 5AXAA 1JWLA 2H08A 1VJDA 1D4AA 4J6FA 3OZTA 4I3FA 5EIAA 1HKHA 2ZIXA 2UV8A 2BUCA 4J0JA 5HR5A 4FGUA 4I3HA 1FQKA 2DQSA 2GZ2A 3P0EA 4Q12A 1E3WB 1E61A 2I2AA 2QLBA 2QZ4A 1IY2A 3EQZA 3P45A 5B4VA 5K8CA 2UVQA 1XVTA 4UU7A 3ITKA 1LB1B 1Y3FE 3KVOA 5KSPA 3D5TA 4DGSA 4ZZ2A 1N2CA 2O20A 2EKLA 3INRA 3W06A 3N8GA 4FONA 1FS4A 3WX0A 3RIXA 4YRPA 5JZBA 3B6ZA 1KGSA 5A71A 1HV8A 2FCAA 2WKRA 2E0IA 2GRJA 3ZK9A 5JS6A 3KEOA 1C8LA 3TLMA 3WTCA 4HVTA 4N54A 4N7RA 3ZYZA 3IKMB 1B8NA 1ZWLA 3U4GA 3KQHA 1REQB 4HWOA 4UE2A 2W8ZA 2G82A 1YCGA 2PV7A 3G59A 3HA7A 3A06A 4FZ5A 1CS0A 1SVNA 4NZOA 5KNCH 2D0PB 1FP4B 3IBYA 3QBVA 1Z82A 4KAAA 4G5QA 4LY0A 3WB0A 5IAAA 1TU4A 3NKVA 4HH1A 4O2AB 5LYJF 2OE2A 1JSLA 1ND6A 2V98A 2WZBA 5TF0A 4DDTA 1U8EA 3PF8A 4Q9HA 3THYB 1KYZA 2G09A 3UWPA 3GLFE 1JEDA 1PR6A 5AJTA 2BF4A 4FGSA 1I30A 1MG0A 3OJOA 2YZ2A 2IU4A 2ZZNA 3P4UA 3P9IA 1Z68A 2Y0BA 4XWKA 3ITNA 4Y6GB 1E6CA 3GRVA 3MEQA 4V38A 1L1QA 3MB8A 4CKCA 1JDNA 1E9RA 2IZOA 4E46A 5I9NA 4KR7A 2DUMA 1RYDA 1TLLA 4YAOA 3N0VA 4G0UA 3RFUA 1DIRA 5C0OE 2JCVA 3CZCA 3SYTA 3K0CA 3QA9A 2IHTA 3A4NA 5TJHA 4R8MA 3CWZA 2RH8A 2Y1EA 3B6EA 3AV3A 3GNLA 3EVGA 1U8ZA 1OR8A 2RI6A 2FR1A 2XAAA 3F5DA 5BNTA 1DRKA 3SX0A 4GO1A 4I2NA 2PUDA 1G5QA 4KR3A 2O2SA 3ZQ4A 1IU9A 1ZIYA 1OLSB 1F4PA 2FUCA 2R60A 3VR1A 5BPHA 1UMDB 2JEOA 1E9EA 1ZGCA 1X2EA 2FQWA 4QAJA 5SV2A 5CFMA 4W9MC 4X9XA 3QW2A 2BGMA 1E2EA 1P1CA 5H70A 5AM1A 4NKRA 4QEZA 4OJYA 3PC7A 5ALJA 2AOUA 2DOKA 2BN4A 4Q4JB 3DTYA 2XOEA 4AP6A 1PDOA 2V59A 4ZCSA 3JV7A 3PRJA 2XYQA 2Q9CA 4ZYTA 4V0OA 2HK7A 1WEHA 1KKUA 1Y5IA 4UCQA 3QVMA 3W8EA 3ZE6A 3TIFA 5D7BA 2XZDA 4M89A 4OIFA 4A6PA 5A3VA 2L82A 3DVQX 4IFBA 4PXAA 4NAUA 3UK7A 2VKQA 2XA2A 3PPVA 4IW3B 2B34A 5IARA 3AESA 4KCGA 2ISQA 3AM4A 1Y81A 3NVAA 2HHHB 1NJ5A 2B8TA 3H17A 1TYEB 3MB5A 4UAJA 1OAAA 4JUDX 1A9YA 5CVUA 2YJ5A 5JJKA 1XMIA 1ETHA 3U3KA 2BTQA 2AXQA 4W5RA 4CEJA 2ETVA 1GITA 1LI4A 2C4TA 3P2IA 4I1UA 3LUJA 4CMIA 3BMNA 1X8JA 1KRXA 3LUKA 1DAFA 3LL7A 5FPYA 4P54A 3ICVA 3D8TA 3VU0A 4Q6WA 3KE8A 5LSAA 4WLNA 3CF4A 2CLDX 1XCJA 3I2JA 2HWXA 4AY3A 5KCZA 2VHZA 2IOHA 2ZR8A 3LQ1A 4HXFB 2YY7A 3MF4A 4PZ9A 1AZTA 3R0QA 4R2WA 4P4NA 4P4GA 3PUWA 4OB7A 1HQCA 2PYDA 2VWHA 2KS6A 1W1IA 5TQVA 3CWCA 2KM1A 1JFLA 4LZWA 4BV9A 3BWYA 3PQ2A 2IV7A 1D04A 1XVIA 1DEKA 2QMEA 2TECE 1CHNA 1UKEA 3KBOA 3DDCA 1XEXA 4H15A 2OHGA 3AR9A 4BNLA 3S81A 2RH4A 2PH3A 5KVSA 3AT1A 1VKJA 4PLCA 4H4EA 3PYMA 1Q11A 1RSZA 5LNK1 4OJNA 1M72A 1NMSA 3G2PA 3JAKB 4F2HA 3D7RA 2GWRA 2YFKA 3ROTA 3FFXA 1X8XA 2P3SA 3CH7A 2E89A 3TTYA 1ZXXA 3DKPA 2YWDA 1RC1A 1VMAA 3N5CA 4AECA 4CDGA 4D4KA 4DCNA 1ODLA 4H7HA 3HXOA 5BN1A 2RGWA 4E12A 1IQUA 4DDUA 2WABA 1QCCA 2XV1A 1JVSA 3GFRA 3OA0A 3EIFA 4NNOA 1K1EA 2BFOA 2IGTA 1RYZA 3T41A 2YW9A 3LY5A 3QQPA 3E53A 3J7TA 4HN9A 1GGNA 2ZUVA 4B3JA 3W05A 3COZA 5T3UA 5AVSA 3LHFA 1GAJA 1MB3A 5DNVA 2JLUA 3CVJA 4LHWA 4OOEA 4Q3CA 5DLYA 5IULC 3WV5A 4EYGA 4JXJA 1XNQB 1I0ZA 3I64A 2JDIA 4GR4A 4R68A 3VOSA 3EOBI 2PPLA 4WASA 2B9EA 2X2PA 3F3KA 2QUKA 5CB4B 4UBIA 5FNZA 2WHQA 5FAKA 1WKVA 2R5WA 3GGJA 4IJMA 3CZ4A 4TS9A 3R7AA 4E5DA 4W5QA 1Z5WA 1N5LA 5FA8A 2FGJA 2AOTA 4HAXA 4YC7A 2NGRA 1Z4OA 1G8FA 1ZMRA 3ZU2A 5IWAB 4IH1A 4R3UC 2CJYA 4D98A 3GO4A 4P33A 1SQFA 3GL9A 5I7AA 2XCTB 3SHOA 3TQRA 2V3VA 4BB6A 1F2TA 1WSAA 1OREA 5AM4A 3UM9A 4NU6A 3BK1A 1YVPA 1AH2A 4BV3A 1Y4SA 3OPXA 4L7VA 2H2AA 3G5UA 5FBQB 3RWOA 4BO6A 5BV8A 2CNKA 3C4QA 3AUTA 3EF3A 4M9XA 5KWSA 2HCFA 1RYEA 1BMDA 2VT7A 5KQRA 2YZKA 2IYUA 5H68A 2EQAA 4GDFA 4AUNA 4XGRA 3OWOA 3TBKA 5KHLB 4DBZA 4XD2A 2O0KA 1PD0A 1W25A 4GUAA 1C1XB 5JZVA 4I55F 3AHGA 3KIPA 3RKUA 4IUCS 5JQGF 1ZOPA 1AIPA 1IEQA 3E1GA 4IIEA 2VR1A 2OGUA 4C2TA 3I6IA 3M8KA 4F6RA 2FW9A 3OU6A 2KB0A 3LWNA 5KNLA 1KMMA 4AD8A 3CSSA 1DC4A 5IUJC 1JKIA 2FDCA 4R2IA 2PQMA 4MYCA 4UNNA 1V9CA 4FTWA 2GXUA 2CWWA 2YDXA 5THXA 3TOVA 2BEJA 3AF5A 4JYCA 1EWYA 1TA4A 1JMVA 1U2RA 2EEZA 2PSFA 1BH6A 1FFXA 3O4IA 1AGNA 4HN2A 5LLDA 3CRMA 4DJTA 2WT4A 4INZA 4Z4HA 2WJWA 3U39A 1NBMD 2YV5A 3PA8A 4E03A 2ZTUA 2EZUA 2O4UX 1SKYB 5AVZA 1PRYA 2FMUA 1OD6A 5IN4A 2QV0A 1X94A 1YQWA 3FMVA 2RGEA 3M6MD 2VS1A 5CA1F 4UOZA 2A8YA 4IMJB 3TH5A 3TCXB 3LHSA 3KNZA 1PCXA 4B4WA 3UPTA 2QN8A 2VJKA 1RWMA 2WSBA 2FN7A 4JI6B 3IAFA 2OCKA 3TZLA 1XQVA 2NVWA 4NMLA 4MWSA 4WDRA 1NIJA 4R7GA 3VZBA 3ZGYA 3MC1A 2VHQA 3KKLA 3WVNA 2DKNA 4FX5A 4ZZ0A 1UC5B 2GNPA 2PS9A 1CFJA 2R6AA 1E99A 2OV8A 3ZHTA 2DWPA 1DXYA 5HGXA 1K68A 1KFEB 3BWEA 1TQHA 1VI2A 2Y1WA 5ESWA 4QEKA 3WAJA 4NBRA 3L06A 3IIMA 4MCHA 3V2HA 3ZIAD 4ZTUB 2IXBA 3X1WA 2RB4A 3VDRA 1JXOA 3TRDA 3FPLA 4MVJF 1XVUA 1IHXA 2RIPA 3PFFA 4PLTA 2P4SA 1Z12A 1EIZA 2Z2ZA 3COSA 4LX0A 3L7NA 4MUHA 3OZEA 5G1NA 3WBBA 3WP1B 2BFMA 3O84A 2C4HA 3OEWA 4DAEA 1ICEA 5DHTA 2O2XA 3O4VA 3R6TA 5HJ2A 1GPBA 1SC4A 3PEWA 1HC7A 1U6JA 2PVPA 5ER9A 3W79A 2J08A 5A7GA 4TTAA 3I34X 4O1IA 2I29A 3KZOA 4OK5A 2A78A 4YAKA 5FEUA 3DUWA 4MV1A 1XKLA 5E6UB 1V1JA 4TV8A 1JEYA 1CUCA 4RLQA 4JT9A 3KDSE 5FOUA 1T6NA 3PSAA 4RTPA 1I2CA 3BFJA 1VM6A 4HDRB 3U3DA 3PA6A 2ZYAA 4KQGA 4RW0A 5ECYA 5KC8A 2W4QA 4O0LA 2QP3A 1MD9A 2F6RA 1S6YA 1W4RA 2ARKA 3CKLA 2WQ7A 2O0JA 2VCEA 2EARA 3CYFA 3E5HA 3D1JA 4MICA 4GAEA 4PO3X 2ZJAA 2IZ5A 2LD4A 3STVA 4OPMA 1G9TA 4HY3A 3C3YA 3DOOA 1MT3A 3NLLA 2IHUA 2VDWB 1P0QA 3F9CA