1LS6A

Human sult1a1 complexed with pap and p-nitrophenol
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
288
structure length
288
Chain Sequence
SRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGHSLPEETVDFMVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords aryl sulfotransferase
publication title Structure of a human carcinogen-converting enzyme, SULT1A1. Structural and kinetic implications of substrate inhibition.
pubmed doi rcsb
source organism Homo sapiens
total genus 97
structure length 288
sequence length 288
ec nomenclature ec 2.8.2.1: Aryl sulfotransferase.
pdb deposition date 2002-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ls6A00
2QMOA 2WJHA 1G20E 2GXSA 4GPTA 3RS3A 1MO5A 1ZNZA 1ZD8A 2QE7A 2ODEA 2OAP1 3A1SA 4AG6A 2WKRA 5FBRB 3AVTA 1UKEA 2GVDC 3WP0A 2IL1A 1RIFA 3HPRA 2V6JA 4EFNA 4Q18A 5F9FA 5CLLA 5FI0B 3QENA 3H86A 3ONWA 2PZFA 1XPRA 1NF3A 1YJ5A 3A58B 3FE2A 1CEEA 3SHFA 2WPDD 3CW2A 3WBKA 1ZCBA 1SXJC 4ARZB 4YMVA 4PHGA 1AQYA 3A4MA 3CX6A 4HAZA 2F3RA 2NPIA 2AD5A 2YWGA 2E9SA 3HU3A 3K0FB 4IVQA 4N0DA 4W5WA 2XEXA 4X8HA 3ASYA 2O8DA 2Z4RA 1R5OA 4YMWA 2NG1A 1N25A 2HEIA 5TV2A 4PC7A 5DLQC 3IUYA 5FFMA 2MSDB 3X1DA 4BEBA 2O8BB 4P0TA 4DEYA 1Z63A 3QPUA 2B8TA 1R8QA 4MUAA 1VECA 3FB4A 4DEXA 3VQTA 3CLVA 3UMFA 5F2EA 1M7GA 2ODBA 1KDOA 3CR7A 2C99A 2G83A 3CH5A 3RS4A 2ZJ2A 3TKLA 2DPXA 2D74A 3LXRA 2VHCA 1X8JA 4DT1A 3NH6A 1RRGA 4D4MA 2B6HA 3I61A 1NIJA 3O8BA 3H1TA 3A6PC 1XJCA 4DVGA 1AS3A 3OE7D 2EFHB 4IHQA 4GFDA 4IVPA 3WHLA 3I32A 2ZJ8A 1TU4A 2YINC 3AKDA 1NJFA 5FL3A 4PZZA 4NKRA 2XTMA 4ON9A 2K5UA 3OEED 1S9DA 1TEVA 2RGBA 4NMMA 1D2NA 4OK6A 4LRWA 3SR0A 3MWLA 1AN0A 1CJMA 2Z4SA 1OIWA 1D2MA 2GK7A 1G4AE 2YV5A 4WAUA 1M7HA 1TQDA 4AURA 1H8HA 1E9DA 1II9A 1IAQA 4KCGA 2NTYC 3RRYA 1E79A 1RJ9A 1XP8A 4G1UC 3R9WA 4OHVA 2YOFA 1LS1A 4YDHB 1E0JA 2ZROA 2ZUCA 3MJHA 3B1WA 5IDVA 4RD1A 2PT5A 8OHMA 1CR4A 2V3CC 4CT5A 4BLTA 2F9MA 1U8YA 4TWZA 5JI3E 3TIFA 1G1MA 1T4GA 2IF0A 2PLFA 1QHHA 1EFHA 2C98A 2PZGA 4OHWA 2GVZC 1UKZA 1N6HA 4XIGS 1U9IC 2OFWA 1E9SA 5LPNA 2ECKA 1GUAA 2QP3A 3FVQA 4KV9A 2IK8A 4IXNA 5JSZA 2SHKA 3SYLA 3NXSA 3K70C 3THWB 1N5KA 1S8FA 3BC1A 3VNVA 3W9YA 2G88A 1RW4A 4Y0AA 1Z8FA 4XTCS 1KI3A 1KI8A 2IEYA 4MRSA 4FN5A 3QJYA 3RS7A 1W47A 1CR0A 1R8SA 4A4DA 3RNLA 1DAGA 1VG8A 3TLXA 4FMCF 4I1VA 4JT4A 3QKSA 4BQSA 1QRAA 2VF7A 3U44B 5E3HA 3LY5A 2AN9A 1ZM4A 2F3TA 3CPEA 4C2TA 3B7GA 1R7RA 1W1WA 1NY6A 1PLJA 2WVJA 3GFTA 5A4JA 3V4RA 4TSFA 3MLEA 3ZVNA 4QM7A 1R6BX 2QSYA 3AF4A 2P0EA 2HJGA 4DBLC 1OF1A 4CT4B 2OV2A 4WXRA 2C78A 3CO5A 1E99A 5K8TA 2EWWA 3LA6A 4NYMQ 3GQBA 4B75A 1PVOA 3GFOA 3BORA 1FUUA 1G7CA 1SXJB 1FOEB 2N46A 2VHJA 3KJHA 1S0UA 4Q01A 4R2IA 4IOLA 4BFVA 4Q9LA 2GXAA 5TY0A 1FTSA 1KI6A 3C4JA 1SVIA 2NOAA 3GLFB 4A2PA 3TUZC 1ZUHA 1WXQA 1V43A 3F0TA 4HDOB 4MYTA 4J0QA 3O8RA 2HXSA 2QL6A 1ZW6A 1BO6A 4RVCA 1ZC4A 4BEJA 3DKPA 3LV8A 4A92A 5JRZA 3KZ1E 3OIUA 1VCOA 4RZ3A 2Z5FA 1CRQA 1US8A 1UKYA 4B74A 1E2JA 3UKDA 2VSOA 1UADA 1I4LD 4Q1CA 2FSHA 2IX3A 3B1XA 2FJUA 1ZJ6A 3SZRA 4LPSA 4A36A 1LW7A 2AKAB 1KTVA 5CDFA 1Z29A 1L4YA 1ELOA 1XMIA 5CITA 3RRZA 5BYKA 2O0JA 1KSFX 2OBNA 4Q48A 5IK2D 2LKCA 4DDUA 3PVSA 1XTSA 5M04A 1MABB 1XRJA 1XTQA 1RRPA 1GAJA 3SDZA 3KFVA 3WYFA 2NZJA 3Q5EA 3MGCA 4G01B 3DM5A 4E03A 4OI1A 3QUSA 4HAVA 5CIWA 3N2EA 2CE7A 4TQUS 3REGA 1N0UA 4LJYA 1E4VA 1LS6A 1KZGB 1JPNA 1M6NA 2IA5A 1UKVY 1HUQA 1ZNXA 2GRJA 4Q9IA 1QBKC 4DCSA 1F2TA 3VAAA 3PQCA 1O87A 2W58A 2WM9B 2ZRMA 1PLKA 1J90A 2P6UA 2D7DA 4Q19A 1E9BA 2ZM5A 1P3JA 4FINA 4EQ6A 1S3SA 4OQNA 3EPKA 1K5DA 3C14C 5EZ5A 5F3WB 4RY2A 5L3QA 1VYVA 4NHOA 1E4YA 1GL7A 1YRAA 1JQLB 1XMJA 2ZR0A 1EX7A 1IXRC 1G5RA 1MOZA 1XEWY 2HLDA 4C4PA 1YZUA 1QG2A 4C0AC 1DVRA 3ZS9A 2FE4A 1FUKA 1GNRA 2FF7A 3EZFA 1WBBA 1E3MA 4B35A 2R62A 2OFOA 4CEIA 4JZKA 4V0KA 1N5IA 1W5TA 3A4LA 3CONA 5JWHA 3U3JA 4C7OB 1TAGA 3OESA 1PV4A 4XD7A 4M22A 1BIFA 4TMVA 2Q9AA 5LDDC 5EXTA 4QNRA 5G40A 3SN6A 3BERA 4DCUA 3L2OB 4OI0A 2GHIA 4FD2A 4EFMA 4B2PA 4C2UA 2ZANA 3K9HA 5JFGA 3IIKA 1BYIA 1R0ZA 4DDTA 3NEYA 1FL9A 1HH4A 1KO8A 3CRW1 3GJ5A 5JRJA 5L8VA 2QMUA 3IPXA 2X19A 3NBYC 4PPQA 2Q6TA 3ZVLA 3QG5A 4B6FA 3SYNA 2BBOA 3EASA 1UAAA 3B85A 5HZKA 4HLDA 4HAUA 1S9HA 4TL9A 1NNEA 2WJJA 4LX0A 2WHXA 2GAAA 1Q1ZA 2FH5B 1TUIA 1LVGA 1II8A 2WAXA 3GEIA 4NP6A 2WIBA 4GOJA 2J3EA 4I99A 4AC9A 1VMAA 4A0HA 3I8SA 3I3SR 4OHYA 2V4ZA 1UM8A 2GF9A 4CW7A 5LD2B 4YXWA 4XOIA 1DG1G 2JLXA 4NDZA 5DYIA 1CULC 2BMDA 4D26A 4FMDF 2FMXA 3RS5A 1O3YA 5EZ6B 2HYIC 3OIVA 4D80A 4PANA 2VP9A 3F3YA 2W0MA 4PSVA 1XTRA 3MWYW 3QXJA 1SXJE 3D6TB 1UBFA 3TGPA 3VNUA 2O8EA 3GMTA 3FKSD 4F91B 2P6RA 1BMFD 2ATXA 4RSGA 3FDIA 5CM8B 1EFTA 4Q47A 1JJVA 3T1OA 1G3QA 3CNNA 2JLZA 5LB4A 3WRYC 4KXFB 5IRCD 1W36C 3GLFE 4PC1A 1Y63A 3NWJA 1ZU5A 4LDJA 4ASUD 2GK6A 5KPJA 4JS0A 4JL5A 2VIIA 4OYHA 5CM9C 3Q3JB 3LW8A 5HPYB 3GJ0A 1N6PA 1YZTA 2WSMA 2UZIR 5P21A 3SFZA 2OBLA 4QHTA 3KKNA 5FPKA 4Q7KA 4EPTA 3TRFA 4TLDA 1XEFA 2XZPA 2D3WA 2VRWA 1JR3E 1JI0A 2Y8EA 3DMNA 5AJXA 3TJZA 1A4RA 1J8YF 3RDPA 4C3ZA 4NONA 3G5UA 1I2DA 3PITA 5FTLA 4MGKR 1GITA 1OYYA 1E1RD 2LKDA 4PQRA 4JVNA 2FEMA 2I4IA 4C30A 1TTTA 5HKKD 1YQTA 3G82C 3AVUA 2GETA 3E2IA 1X8KA 2ATVA 1V5WA 1JEEA 5FL7A 4HB3A 2RB4A 3BFVA 3GLIA 5FUYA 2PBRA 2OLKA 1Z6XA 3MUFA 3AVPA 4HUQA 3TVTA 3WMEA 1GTVA 4Q4HA 1E9AA 3KB2A 2EWVA 3C5HA 1FX0B 1TU3A 5LBIA 4P32A 2A5YB 4DLWA 3O8DA 3OHMA 3BWDD 2ZE5A 1E1QA 1BH2A 2O5VA 4TL6A 1EFRD 3AP1A 2QMEA 5DSZA 2P5TB 3LAWA 5EXSA 3M4YA 3KJIA 2ONJA 4DLYA 4AYTA 3NC0C 3RS2A 2ZYWX 3FHOA 1U0LA 4XTRA 1XJQA 2R9VA 4LHWA 2W83A 2BBTA 2JJ8A 5EJEA 2QBYB 2RKOA 1XPUA 1FQJA 3VKGA 1H8EA 1I2MA 1W48A 1GFIA 1ZM3A 3BAFA 3PEVA 4PXAA 1U90A 4D4KA 4HSEA 4LJ6A 5C18A 1ZM9A 4Q7LA 1P62B 1HQYE 1Q0UA 2PEYA 2WSSA 1COWA 3NC1C 4V0LA 3EA0A 3SJBA 2FZ4A 1GZSA 2CJWB 2ZI3A 3CBQA 2H16A 4M1WA 4JKIA 2REOA 4OI4A 4F92B 5FBWB 2XXAB 3KDSE 1Z6YA 4HDQB 1OH7A 4CZ2A 4EJSC 2RHDA 4LJ5A 3EG5A 2IYWA 821PA 1KKMA 2R8RA 1I4DD 5JECA 3E70C 3IPYA 3P4YA 2Q3HA 3A1WA 2Z0MA 3DL0A 1MV5A 4M0LA 3CWQA 1UBEA 5FOUA 3W34A 2CLCX 1N5LA 4WIAA 4H1UA 1CBUA 3QBVA 2O8FB 1RE0A 2D7CA 5C2JB 3RHFA 2MMCA 3AVXA 1LFDB 4W5HA 5BN3A 3ZYCA 2UKDA 3AEZA 1A5TA 2P65A 4KHZA 5FR2A 3QXXA 3W8NA 1L7VC 1NN0A 2O0HA 2JDID 2ORIA 4B33A 2JJ2D 5FOWA 3VR4A 2KE5A 3P32A 5AJWA 1Y3AA 3WBJA 2N1BA 3CF2A 4ITRC 2PJRA 1M74A 1QHSA 3ZVMA 1QHGA 4V02A 3SBDA 2VPPA 2QAGA 1W5SA 1WCV1 5EP3A 3SBEA 5JEEA 1W36B 5KUTA 2VHTA 1D9XA 3L43A 1EWRA 2VP6A 4LYJA 3PR1A 4C0BA 3TE6A 3C15C 3P26A 1KI1A 4Q03A 1OFTA 1A1VA 4U5XA 2IS2A 2ZAOA 3Q85A 3GD7A 5DI3B 3NEJA 3WNCA 1SGWA 2B92A 1T0JB 3VKWA 1LF5A 4BFXA 5EP4A 1FP7A 5BW8A 3CKLA 1E94E 2OSBA 2ZJ5A 1EK0A 3EZ2A 1Z6GA 4W9MC 2PL3A 4BFSA 1T8TA 3AVQA 4NBSA 1Z0DA 1NY5A 2WWXA 4DHEA 1Z83A 4TMXA 5FH9A 4KVAA 3OFNA 1HYQA 2DHRA 4BRUA 3QKTA 1X8LA 3TSZA 1Z0FA 1MO4A 3OF5A 2QPOA 3DOFA 3CUEF 3MWJA 3R7WB 2JLYA 5IHPA 3QE0A 1KO7A 3GJXC 4GDFA 1ZAKA 1UEJA 4DUGD 2BKEA 4KFUA 5TB5A 1X6VA 4G5SA 3THXA 2FPKA 4N0EA 1MRNA 4LYHA 3ICQB 3QF7A 1Q21A 1FZQA 1GNQA 4A6PA 1HY3A 2FEOA 1W49A 4EDHA 2WWIA 4DLZA 2PLRA 2RH5A 2ERYA 3MD0A 4JBWA 2OT3B 2QEQA 2V55B 2YZ2A 3IBGA 1W44A 4O3MA 1YZLA 4JJKA 1MT0A 5J4LA 3ADBA 5G53C 5JS7A 1CP2A 5KNDA 4QL3A 5ELXA 2VBCA 4EPRA 3EIQA 2KB0A 2EFGA 2JGNA 3R9XA 1KSJA 2MSEB 2F43B 3WNDA 1E79D 1OFHA 3VHLB 2YC2C 3PXGA 1IQPA 4OQXA 5G41A 2TMKA 4DB2A 4GP7A 2CK3A 3DEFA 2WV9A 4EJSB 2BEKA 4P4SB 1EFCA 5C1BA 3UMSA 3BOSA 3X1WA 2WIAA 4OQLA 3B6EA 3HWSA 4JT2A 3SQXA 4KJZA 3B8HA 4MKIA 3CR8A 3BD9A 3T35A 4MDEA 4Q4AA 2WJVA 4EPWA 3K9GA 1G6HA 1R5BA 3AUYA 1WP9A 4PPNA 1VYTA 4DIDA 1TPZA 1KJYA 3QOFA 3UK6A 2VH5R 1KIMA 1ZRHA 2MSCB 4F4CA 1AK2A 5C4MA 2RGAA 3CZPA 3W6OA 3K09C 3QXCA 3X1XA 3DHWC 5DHAA 1XZPA 4MGIR 4X8LA 4Q4JB 4B32A 4E22A 1GKUB 3THYB 1B0UA 4A15A 5DE3A 1Q1BA 4S2EA 1T3HA 4ZI2A 1VCIA 2RHMA 3P20A 1EESA 1NL3A 2PH1A 2RGGA 1P75A 1HURA 3B78A 2OCYC 4BFZA 4PC6A 4QFMA 1HQCA 1ZUIA 4LV5B 3U4QB 3ZD6A 1JALA 1XD2B 4LHXA 3W8RA 2OZEA 2D06A 2AR7A 4D82A 4YQFA 3Q8XB 1XB2A 3QF4B 2WWFA 2C9OA 4IXMA 4Q9HA 3IHLA 4V0ME 4QGAA 4PQYA 3WYAA 5A0FA 4X8OA 2R65A 5FTJA 3GEEA 3REFA 1ZP6A 4LHYA 4E07A 4ERNA 1GRNA 3KQNA 1ODFA 3AF2A 2NIPA 3ECCA 3U3MA 3Q9LA 4AK9A 4AY2A 3ZZTA 4FWIB 4XVUA 4EFLA 1KK0A 2IYQA 2GZDA 1W4RA 2YOHA 1KI2A 4QG7A 3SE0A 3QVUA 4DWJA 1WF3A 3S1AA 2IS4A 2OBMA 4TT3A 4M53A 1OXSC 2W6IA 1DELA 1W4AA 2ZRCA 4IVRA 4LCBA 3DDCA 3KKPA 2W6JA 1OFUX 2PX3A 2H1LA 3TR0A 1HV8A 3LO5A 4HAYA 3QXHA 4V0OA 2QU8A 1T5LA 2BHRA 4IOKA 4ZCIA 4Q00A 5E4FA 3T34A 4CEJB 2HJVA 2QQEA 3TQFA 3ZS8A 2FA9A 5ANRB 2FU5C 4V0NA 3UMRA 3ZIAA 2V7QA 4MKGA 2GCOB 2JA1A 3AUXA 3NIBA 3IKJA 4PTLA 3I8XA 4MA4A 4BLOA 2FG5A 4YDSA 2YNMA 4XH9B 2XGJA 3BRWD 1CRPA 4TTRA 3I92A 4ZO4A 4D81A 2ZJBA 4RKFA 2JEOA 1XDBA 3K1JA 3HYRA 2BC9A 4WZ6A 1W0KA 3IEVA 1DEKA 1AKYA 4S35A 2XNDD 2I1QA 3KKMA 4R71A 4R98A 4TYYA 1W4BA 5CB8A 4XVRA 3NBXX 4OQMA 1T9HA 4DSNA 1UDXA 2C8VA 5L3SB 4WZAE 3U6BA 2PZEA 2QGNA 3EWSA 2GZHA 4L16A 3EC1A 1CKEA 2IYZA 1P2SA 2FOLA 4YC7A 1XMSA 4LBZA 5E95A 3K0EA 4YMSA 1NG1A 2A7QA 2CVFA 4D4JA 1IN6A 1DADA 2WZQA 3BH6A 3NKVA 1CF4A 3RWOA 2F1JA 3TW8B 2HLDD 4Q5IA 1SQ5A 4TMKA 5GJCA 4ZDIA 1KGDA 1W0JD 4FIDA 1GL9B 4LYFA 3ADDA 4ARZA 3IDQA 1SKQA 2R6GA 4B34A 2KWIA 5K8IA 2ZYTX 5KU1A 4XWKA 3C8UA 3K0FA 4A82A 3EC2A 3VU9B 1TADA 1IY0A 4ZDKA 2ZRDA 1RRCA 4BE7B 4A6XA 1YVDA 2IHBA 2ODWA 4DIEA 3LBIA 3BIFA 2WOOA 2ZJZA 2O8BA 2HF9A 5H68A 3I72A 2YOGA 5K8UA 3CPJB 1GNPA 5FOSA 5HCIA 2DWOA 4JYBA 3LRPA 5JI2E 4URVR 4B73A 3U7HB 1OH8A 1M1YE 3K0CC 1J7KA 1NRJB 4JIMA 3U60B 1OE0A 1PUJA 1LTQA 3D8BA 3KTAB 3LX8A 2G0TA 5EQTA 3CRVA 1J99A 1RKBA 2F9LA 4RD2A 3TBKA 4DSUA 5H70A 2J7PA 4Z1MA 3U61B 4FCVA 3NG1A 2KBEA 1KZ7B 2X2EA 2XNSA 3BK7A 2HCJB 4JLBA 2ZU0C 1RPZA 3KKOA 1G7SA 1P72A 2J5XA 5AK0A 4KFSA 1YZQA 2AX4A 4MGZR 2QROA 4WA7A 4ZCLA 2A9KA 2W2TA 1F3OA 1HE1C 3MG9A 2QORA 4YXWD 5TXGA 3KXLA 4UNQA 5A5GA 4HB4A 1NG9A 2AK3A 1G18A 2RAPA 2HT1A 3MSXA 1Q3TA 5B58C 4F93B 1KY3A 3I73A 4US1R 2QP4A 4GBMA 3PUWA 5LB2A 1IY1A 1QHNA 5JJLA 2F1RA 2CL0X 4JLKA 4Q9KA 5EE3A 2YWEA 4KYIB 4GT1A 4A8JC 4PPFA 4BWYA 1JXMA 2J7KA 5KTYA 1PLLA 3ICEA 4LK2A 2BBSA 2QTFA 3CF0A 3NTUA 4QBIA 5FPHA 1EXMA 1GRRA 2FSIA 2XOKA 2BBWA 2H17A 4LPKA 4B3CA 3EPJA 3L0SA 4LHVA 4BLRA 1XWIA 4GRAA 2XAUA 4Z8YA 1YZKA 2OILA 3CX8A 3KUCA 4AYWA 5LD2C 4JJZA 3IIJA 1Z08A 1G8YA 3DVLA 4BRWA 1Z5ZA 1NSFA 2IYXA 4TN1A 4U00A 4PO9A 2EQBA 4TMWA 4DDVA 2ANCA 3THWA 3SQWA 2BVNA 3EARA 4O2LA 4LJ8A 2BJWA 3WYGA 4OBEA 4AG5A 5HCNA 2AFHE 2AXPA 4NCJA 4IRUB 4DJTA 4H1VA 2HCBA 1TX4B 3WHKA 1GKIA 2ZSBA 3QI2A 2MMGA 4LY6A 1E2IA 4B3BA 4GI7A 2ZI6A 4QBHA 2WWYA 4ILEA 4JVMA 2FSFA 4TTPA 3U44A 3TH5A 3SC3A 1VIYA 3R8FA 4M1YA 1Z6TA 2XJ4A 2NO7A 1G3RA 3NDBB 2QM8A 2OG2A 2ODNA 2C9CA 4DLUA 2HT6A 1KNQA 1NBME 3LLUA 3C41J 1UBGA 5D3MB 4TZ0A 3EIEA 4M1SA 3B9QA 3CH4B 4NCKA 1SXJA 4ZPXA 3SFVA 2ZVPX 5AJZA 1A82A 4LYAA 2FFBA 4M1KA 4RFSB 2WPDA 1G64A 2CL6X 4PZLA 3EW9A 3ZD7A 3LNCA 1TF5A 3AGPA 4B71A 3QKUA 1D6JA 1U81A 2CCJA 1SVOA 3GLFA 4AKHA 2Q9BA 721PA 1G3MA 2LCFA 1R0XA 3EIHA 1AGPA 1ZVQA 4LV8B 1YZNA 1SVLA 2GJSA 1NKTA 2V6IA 2WSSD 2O8CB 3UG7A 4M9QA 1KI7A 2X2FA 2O52A 4F7WA 2CNWD 5H8WA 5KSOA 3DZ8A 3N5CA 1JR3A 1DG3A 1FTNA 3T15A 1TF7A 2KJQA 2YYZA 2VHUA 3IEUA 4PFSA 4RFVA 4TLAA 5AR1A 3BGWA 4MRPA 3ZZUA 1C1YA 3TSOA 1XTJA 3I5YA 2NO6A 1UF9A 1WRBA 2ZAMA 3B60A 4GMDA 4IDOA 5TARA 3SJAA 3N2IA 4B3DA 4LC1A 3GLGB 2IT1A 4D0LB 5B57C 1MABA 1T3SA 2ZREA 3IO5A 4M1TA 4RCYA 3GJ4A 1RRFA 4ZIRB 1W7AA 5CJPA 3CNOA 3W6PA 2JAQA 4LJ7A 2NGRA 3LQRA 4DC9A 4PC2A 4BLQA 4EUNA 3GEHA 1ZD9A 2QT0A 2ZS8A 3LD9A 221PA 4Q02A 4XSHA 2E1RA 1TQ4A 1IOZA 3ADKA 1BOFA 4W5JA 4C0KA 4O0MA 3PEYA 4HLUC 1CR1A 3FHTA 2IYRA 4M21A 4M1OA 1XEXB 2ZSFA 1TEXA 5GADl 4DXAA 2FGJA 2NO9A 4A8JB 4ZKEA 3EZ9A 3RAPR 1DO0A 2F1IA 2R44A 3MWKA 5J4VA 4B44A 1ZMXA 5HE9A 4C0JA 3HU2A 4TLCA 3LBNA 4UKDA 5AUPB 1XX6A 2H18A 4Q1BA 1ESNA 2J0UB 4HAWA 3I5XA 2EU8A 4TTQA 3CWZA 3C5CA 4QJ4A 3CX7A 4XWAA 1HTWA 3BB3A 3CRQA 2IWHA 1ZIOA 2JLRA 3QY0A 1NN1A 1BYUA 2AFIE 1P9RA 1U9IA 2JJ1D 2UZ3A 4MYUA 1G8PA 2A5DA 1NIPA 5GVSA 2NPFA 5DIFA 1AM4D 4C7OA 4JMPA 4DCVA 2EYQA 1P2VA 3QG1A 4CIDA 2G3YA 4GNKA 1N0WA 4QRHA 3WMGA 2ZRPA 2ZJOA 3K0AB 3O47A 5KNCA 1P2UA 4JLPA 1G7RA 1NJGA 1A2KC 3QKRB 4QHSA 1X3SA 2JLVA 2DYKA 5EE9A 3D3QA 4M4SA 3TVDA 1W4CA 2GJ8A 1Q12A 2GILA 4G5RA 4R2HA 2QT1A 2ORWA 4MKHA 1ZNWA 1CJVC 4WBSA 3T1QA 3Q5DA 2XB2A 1S1CA 1IN7A 2CBZA 2GTPA 2VYFA 1Z47A 3AKYA 1OYWA 1JEDA 2ZRFA 4CF7A 1T0HB 5EE0A 3FMPB 2QRZA 4U7DA 1TQ6A 4QJ5A 5K8LA 2ZXUA 3WMFA 1YR9A 2ZRNA 1DAFA 5AJVB 4MGYR 4CVNA 2CHQA 1DOAA 2VP2A 2QZ4A 1SVMA 1XMVA 4A2WA 1HE8B 4TQAA 2F55A 1P9NA 3BFXA 4QOSA 1TMKA 1WE2A 2OFXA 1KI9A 3A1VA 5DN6D 5L3VA 2J0SA 3ZZ0A 1MRSA 5FR1A 4TLEA 4JLNA 4U02A 2Q0HA 3PUVA 5FUWA 4OL0A 4TL8A 2NO1A 1TF2A 2OXCA 1GL6A 1OB2A 5DNYB 4JSTA 2IYUA 1IJEA 2ORVA 3P1JA 3K9NA 1L8QA 3PEUA 3UXMA 2GA8A 5F98A 4POAA 4R7ZA 3E1SA 4A9AA 3MJRA 2QG6A 3ZDQA 2CK3D 1E2PA 3KXKA 2W0SA 4OHXA 1JAIA 2F6RA 3X1ZA 3J81k 3KQKA 3QSYA 2FFAA 4EKDA 1QDEA 4HATA 4AKIA 4TL7A 2DFTA 1HT2E 4P31A 4A0RA 2BOVA 1DAMA 4C0HA 5HR5A 2ZSDA 1G19A 2E87A 1PJRA 1F2UB 4HUTA 3U7GA 1XU4A 3LBHA 2OO7A 3MAAC 4IKEA 5IK2A 1IN4A 2QGZA 4JLOA 4Q21A 4ESVA 3RSLA 2P2LA 2OUKA 3AQ4A 5J4YA 1JR6A 3BB4A 1A2BA 5TVKA 2FDCA 3T1TA 4TYQA 1KDRA 4HZUB 2JATA 4HAXA 2BMFA 2IC5A 4FWTA 1NLFA 1G16A 1Q57A 2HV8A 3RRNA 1XXHB 2CXXA 3KQHA 5F9HA 1OXVA 1G3IA 3FMIA 2J9RA 3GLGE 3RSOA 4MDFA 3BE4A 2H7VA 4LJ4A 1SVSA 1ONBA 3C7KA 5KHOC 4E5UA 2J0QA 5JEDA 3OEHD 3LX5A 2JASA 2VQSA 1KO4A 2H92A 5EP2A 4F38A 3BS4A 2ZSEA 4Q7MB 5HTKA 4QM6A 3A1UA 1DTSA 3T61A 1XEWX 1FX0A 1YHNA 2IXGA 3QVVA 1AJEA 3UANA 4NL4H 3UWKA 3GJ8A 5FUXA 4D0NA 1X1RA 2KI5A 3DM9B 4RKEA 3WP1B 3ZQ6A 1U0JA 3AP2A 3SYKA 2BKUA 3F5FA 2R6CA 3EX7C 2J0VA 3MMPA 1SHKA 3B13B 2BMEA 4Q1DA 3H0KA 1Z06A 3GJ3A 1SKYB 1QVRA 3QIAA 4RD6A 4KVGA 1M2OB 4BGDA 3V00A 2ZEJA 2GKSA 1N5JA 1Z28A 2VLIA 2WMNB 4B3FX 4BLPA 4E09A 2QE7D 3GJ7A 2QBYA 2CHVA 5EP1A 2P3SA 5AUOB 3IBYA 4NYIQ 5D3QA 4URUR 3VR5A 2AL7A 4JBXA 4MH0R 4AD8A 2YWFA 2GXUA 1C9KA 5J40A 3KL4A 3GFPA 4L9SA 3HP1A 2CJWA 2ZRKA 5FBLB 2XXAA 2JLQA 1CJKC 4HLUA 4KI0A 2C9YA 1NMXA 1N2CE 1Q1QA 4I81A 4B47A 1C4OA 4FCWA 2IEZA 3LVQE 4M8NE 3ZIAD 1CJTC 4AWXA 2G9NA 3GLHB 4BZXA 3PCRB 4GOKA 4W7SA 4K46A 5DO9A 2IS6A 3UATA 1T91A 1E2KA 4RZ2A 3W5JA 3PIRA 4WOPA 3SOPA 2IUSA 4DSTA 1X86B 1G5TA 4O2RA 4G3XA 1EWQA 1G3UA 4ZDWA 2O8FA 3AVOA 1VHTA 4LOAA 1KK3A 2P6NA 4HB2A 4DDWA 4K8OA 3PG5A 1HT1E 2C77A 4HEJA 1JNYA 2ZI4A 1MO3A 5AWFC 5KDLA 3SJZA 2QPAA 1Z0KA 1MH1A 3MRSA 3BB1A 4I1SA 1X1SA 2H8KA 4URXR 4AKEA 4Q1AA 4V0MA 5KO2A 2ZR9A 1QVAA 3T5GA 5KPDA 2CLSA 5J5CA 1KSGA 1BMFA 1AZSC 1N3BA 3A4NA 4V03A 4KYUA 3B9PA 4KSBA 1E2QA 1AKEA 1AS0A 2DCUA 4ZV4A 3KQLA 2PJZA 4C0SA 1KI4A 4URWR 3HU1A 4JLMA 5SZHB 4GMXA 3ETLA 5DI3A 1NVWQ 1M7BA 4II7A 4X8MA 4Y0VA 1IBRA 4GL2A 1JECA 2WJIA 2FSGA 4CEHB 1H8HD 1F6BA 4K81B 1WMSA 1TUEA 4FMCB 2DY1A 3MFYA 1KMHB 1GWNA 2W2VA 1E1RA 2ZRIA 1S2MA 3HR7A 2ERXA 3RWMB 3VR3A 2ZI9A 3WRXC 3VX4A 4OHZA 2H57A 1FQKA 4Q1FA 3FPAA 5DISB 4ZKDA 5CK4A 3I1FA 1VG0B 2VSXA 3ND8A 2RMKA 4AYXA 3R7WA 1T6NA 2C2HA 1QHIA 3FHCB 3DKVA 3I62A 2GEDA 2WTUA 4GZMA 3ZH9B 4PSKA 2J7PD 1FP6A 1P60A 1XXHE 3B82A 4XWOA 5TMPA 2IXFA 2V8OA 1OB5A 1DPFA 3OAAA 2X77A 3D31A 1VTKA 4NYIR 1NSTA 1EFRA 2BWJA 1P73A 1NVVQ 3KX2A 2IF2A 1XNJA 2DWQA 3VMFA 1YU9A 1HA3A 2WOJA 4TYWA 1E9FA 2JCSA 3K9LA 4GSYA 2RGEA 3TQCA 1KMQA 3L0PA 1GG2A 2AD1A 2IWRA 4B3XA 4PHHA 4TSFD 1E9RA 1E2FA 3RC3A 1RYFA 1SKYE 2F43A 3TAUA 2D2FA 2J1LA 5JHGB 4LJ9A 2ZJAA 2R6AA 4EJSA 4P4SA 5FPYA 2XOKD 1U94A 2QA5A 1XPOA 3HDTA 2WJYA 3GCGA 1E2DA 2AHOA 2C03A 3FFBA 4URYR 5KNBA 4XVQA 1OXTA 4FI3C 2O8DB 2GBLC 4I1OA 4LJAA 2NQ2C 5SZIA 2CLDX 1KO5A 3LWNA 4DKXA 1M34E 2G1JA 3QEJA 2EFCB 1YRBA 1EG7A 1OPXA 3N70A 3U7FB 3GLHE 3EAQA 1GVNB 4JLAA 4MITA 3TAHA 4F4JA 2XB4A 2JJ2A 2XITA 4NCHA 4NH0A 4BFWA 4Q4JA 4I1UA 3FWYA 5CK5A 3THYA 2V1UA 2OLJA 4LBWA 1JJ7A 1GP2A 1NKSA 2ZE8A 3CNLA 1AA9A 3IIMA 5CYPA 1U0HC 2ZTSA 1XBTA 5CIQA 5BWMA 4DT1B 1IONA 2CEAA 1LNZA 4EPVA 4JYCA 1VPLA 2W2XA 2CDNA 4PAMA 2X8AA 4G5QA 2WWHA 4Q9JA 3U4QA 1FFHA 2HDNB 3FMFA 1XD2A 4PPGA 1D9ZA 4URZR 3W5IA 3KB1A 4JL8A 1N6NA 3H2YA 4KSCA 3E5HA 5B64A 2OM2A 4H9GA 3QF4A 4AI6A 1SXJD 3CIOA 4DCTA 2VP5A 4RCZA 3PENA 4PC3A 3FYHA 5J4KA 2JLWA 1OXXK 2UVQA 2FPLA 5JHHB 4EIWA 2D62A 1KYIA 3AKEA 3NBZC 2DR3A 1CS4C 4B2IA 1OHHA 4QNMA 3LDAA 1RYHA 2OXRA 3VFDA 2J59A 2VO1A 1L4UA 3X2SA 2I1VB 1N6IA 3EZ6A 1RJ9B 4BFYA 2BV3A 3DPUA 5EUMA 1KHTA 2DFNA 2GJ9A 2VTKA 2Z43A 1JR3D 4IDHA 1NN3A 2HUPA 1NMYA 1OLOA 4MRNA 3TK1A 2PMDA 3NBFA 4MQBA 4D0GA 1ZM7A 2OCAA 1KK2A 3F8TA 3SU8A 2DB3A 1G6OA 2RGDA 4NE2A 1E0AA 1NVVR 4CEJA 2BIFA 1EX6A 1QHHB 3UIEA 4MKFA 2XSZA 4TMZA 2G6BA 2VEDA 3RVBA 4DUGA 3QXSA 1ZC3A 1UBCA 2GCOA 4XD7D 2FZLA 2XTNA 3LQQA 5E7MA 4D6PA 5JSZB 2B7BA 1SVKA 3NDPA 1CIPA 2ZRBA 1KSHA 3DO6A 2IYTA 1OFIA 1DE0A 2Q9CA 3B1YA 4FMDB 2G0NA 2C95A 1LF0A 4O25A 3U3KA 4UNSA 3A37A 1RVDA 1PZNA 3AB3A 3SNHA 4P4UA 2ZRJA 2ZPTX 5G3YA 4US2R 3QKSB 2V1XA 5EE1A 2BCJQ 3PJRA 2XZOA 3KJEA 3FMOB 1NBMA 4RZUA 5L3SA 4BPBA 3JVVA 4HI0E 4IOMA 2DFLA 4PQFA 3RS0A 1ZBDA 3GJ6A 1IN5A 5J4HA 2PCJA 2B8WA 1TQ2A 3BBPA 5FTNA 5GJWC 4DLVA 1G9XA 4N1AA 4R9UC 3D7MA 1Z22A 2Q21A 2GZAA 1DAKA 2LWIA 1GILA 1NLYA 2C04A 3FKQA 1IHUA 3T12A 2BM1A 1OH5A 2WBLC 1KI6B 1VCNA 4IDNA 1II0A 2EW1A 4FMBB 5HE8A 4YMTA 4NCIA 2F1HA 1QZXA 3K70D 2C96A 1D8TA 3M0EA 2CE2X 5EXPA 4Q7JB 4P4TA 3CPHA 2FNAA 3FTQA 3L0IB 3VU9A 3W90A 1RFLA 2REBA 3K09A 3QEOA 1LY1A 1US8B 2QSZA 2DWPA 4OQFA 2JIZA 1Q3HA 1YR8A 3L8ZA 5FOTA 1GSIA 4JVLA 5GJVC 3Q7PA 3AVYA 3WY9A 5BQ5A 4NU0A 3SEAA 3ASZA 3B1VA 1N6LA 1WB9A 3P27A 4BFUA 1IJFA 3KTAA 2VL7A 3AM1A 1IXSB 4PAQA 4XSGA 2ANBA 1SZPA 3BH0A 5HZHA 1DO2A 3Q7QA 5DGXA 2FN4A 4HLCA 4YMUA 4QKQA 1ETUA 4JLDA 2PX0A 2A5GA 2KSQA 1DAIA 5FL7D 3K8YA 1OKKA 2ZI7A 1YR6A 4C0QC 1F2TB 2GBLA 2W00A 4EPXA 2Q3FA 1UJ2A 4CYMA 1FW6A 4XJXA 3LH5A 4MYCA 4F4IA 3AVWA 5JWRA 3Q72A 1AZTA 5JMTA 1G4UR 2A5JA 4D2IA 4EQ6B 4IOJA 1KKLA 4KAXA 4BZQA 5JS8A 1ZYUA 1G291 3GP8A 3RYTC 1E1QD 5L3QB 1UFQA 4BFTA 1Z0JA 2ZVQX 3FOZA 4DRZA 4L9WA 4BASA 2PT7A 3A8TA 4RZXA 2IYSA 4ZI3A 1U99A 1J2JA 1YR7A 5L3RA 4WW0A 3BXZA 3SHWA 5BYJA 4FCTA 2IUUA 2DBYA 1F5NA 4IW3B 1KJZA 3KKQA 4QGFA 3RC8A 3K53A 4I4LA 4CEIB 2GNOA 5JZVA 4WZBE 1QHYA 4A1FA 5EXXA 3X1YA 1W2HA 1G7TA 1H8ED 1NVXQ 5DI9A 1ZINA 5FTMA 2A3RA 4WXPA 2HF8A 5BN5A 3ADCA 1COWD 3W3ZB 1XZQA 2EYUA 2ZR7A 4L8GA 1E32A 1A7JA 1I4TD 4QBGB 3IQWA 2V54A 1FMLA 3RRMA 1CXZA 3FFAA 4M1MA 2GCNA 2GEUA 2ZITA 3LVRE 1ZD1A 2XNDA 1E2HA 4UQOA 4LSGA 3TR5A 4TQ9A 5JJKA 3QBTA 1E2MA 4NYJQ 2GJAA 1OSNA 4C0LA 1P7CA 1GIAA 3V4FA 4EPYA 4M2LA 3HPQA 5C4GB 4P33A 3RANA 2GXQA 2RGCA 3CM0A 2VSFA 1N6RA 1TNDA 1ANKA 3OE7A 4IDPA 1II8B 3HR8A 2X1VA 3TMKA 4QGHA 4NCNA 5FI1B 1JB1A 1ZIPA 2FWRA 2IYYA 5CB6A 1XFAA 5D3MA 2REXB 1XF9A 1K8RA 2ZYVX 3CZQA 1CLUA 3PEWA 1SULA 4B3GA 4IFBA 1XTKA 4RFSA 1W0JA 2YHSA 4B6EA 5CJ2A 3DZDA 3OEEA 5IT5A 4TMTA 1Q20A 3K70B 1EFUA 5KSYA 2GF0A 1UDWA 2BJVA 3IILA 3TUJC 2O8EB 4LI0A 2A2ZA 2BEJA 4UXJA 2IHYA 1OV4A 4PR0A 1ZCAA 2QAGC 2O8CA 1Z2AA 4DLRA 3DMDA 5TDHA 2WJGA 4L5BA 2GEVA 1IXZA 1NP6A 3AF0A 4CRWB 2ZI5A 5KSZA 1CTQA 5AUQA 3JZAA 3K0CA 4A0GA 3K0SA 4NYMR 2XJ9A 4PAOA 4ABYA 1D2EA 1Q1EA 2L0XA 1XCMA 2QPTA 4JKYA 2ONKA 4EAQA 3VTKA 5DHFA 5KSPA 3GLGA 1N6OA 4KLZA 3HJNA 3RLFA 5UKDA 2WMOB 5E7JA 4ZIRA 421PA 4Z8XA 3KXIA 5J47A 1QG4A 3QNUA 5CDFE 2IW3A 2EFDB 3P4XA 1VKJA 1MKYA 4YONB 3SJCA 1IN8A 1FMJA 1S4QA 2OESA 3OFND 3T06B 3TNFA 2EVWX 1JQJC 4TYNA 1HEIA 1P4SA 4LUCA 4OI2A 3GLIB 1IM2A 4HUQB 2ZU6A 2YC4C 4QXAA 4Q4HB 4HDCA 4N3NA 4KFTA 1CR2A 1UEIA 3NH9A 5GJBA 3AP3A 4DSOA 3U6KA 1XEXA 5FPSA 3U7EB 3QPWA 4A8JA 3VR2A 1K6MA 2OHFA 1S1MA 4HLQB 3UG6A 2AXNA 3ZLJA 3ZQJA 3IGFA 1W36D 2VF8A 5JWOA 2H5EA 5CYOA 4AKGA 3A36A 2XZLA 4QC2A 3OIYA 2CMKA 2J0UA 4A2QA 2OAQ1 4PO1A 4WVFA 1WBDA 5FPTA 1XJ0A 3OIWA 4B76A 2B7CA 621PA 1G8FA 5JJIA 2BMJA 3BFKA 2ZS7A 4JLJA 2ZRGA 1JPJA 2QI9C 3HYTA 4JBYA 4NPHA 3EXAA 3ZVRA 1AS2A 4PHFA 2F7SA 4UNNA 4DZZA 4NYJR 1G8HA 2QMHA 1XCGB 2VHQA 4IJMA 4Z54A 2YVUA 5IF9A 1RZ3A 1GDDA 1GKYA 1G5PA 2QQ0A 3LXXA 3K0AA 3IO3A 5EE5B 5KYKA 2FX3A 2JLUA 1OIXA 2J87A 2OCPA 1S3GA 1R2QA 2YJTD 3H84A 3QKRA 2AWOA 2ZE6A 4FXPA 4PZYA 3NHBA 1KAGA 3TUIC 4OK3A 3M1IA 1B23P 4UJ3A 2A5FA 3VX3A 2JLSA 2IYLD 5FTKA 2YKGA 3EA5A 1QHXA 3CF6R 5JCPA 4D25A 3OAAD 5C46F 4NZYA 1JBKA 2Z6VA 2FPMA 3BH7A 1P9WA 1YZGA 1VCMA 4G0NA 2ZRHA 2R6DA 4B43A 2RGNC 1VHLA 3KJGA 4Q66C 2Q3MA 3THOA 3T1VA 5B30A 1MR3F 4DCNA 3VHXA 3UPUA 1ZNYA 1DAHA 2XX3A 3UWOA 3C16C 3G0HA 1Z0AA 3AV0B 2QN6A 4DLTA 1LB1B 4KO8A 1NMZA 2QNRA 4JVSB 4CDGA 1EGAA 5FOVA 4QJ3A 5KOYA 4BZPA 1KAOA 1IY2A 3U2QA 2QAGB 3FGNA 2J45A 4IDQA 2N42A 1WQ1R 2GESA 1E0SA 2QRNA 4D4LA 4LV6A 5JLJA 1KO1A 5FUVA 2GWHA 2FGKA 2NO0A 1ESMA 121PA 2ZSAA 1SHZA 4GP6A 4KITB 2WAYA 2CHGA 2CNWA 1P6XA 3PUYA 1J8MF 2XTZA 1KNXA 1MO6A 1OW3B 2FV8A 2O0KA 4KU4A 5GVRA 3ND9A 3SI7A 5SZKB 1WDTA 3R20A 2G1KA 2BDTA 3WNBA 4MUBA 5FBVB 3V9PA 1P61B 3U3OA 2R6FA 3B2EA 1FPMA 1F2UA 1Q44A 1NI3A 2J46A 5AJYA 1SVWA 4MYHA 4G5GA 4UNPA 4AIIA 3IQXA 4BUJA 2DFKB 1E2NA 2V9PA 2KBFA 2QTVB 3AF3A 1E2EA 4TT3D 3L0OA 4UJ5A 2W6ID 2RCNA 2D2EA 3TW4A 4DB4A 1DAEA 1E69A 2ZUBA 2W6JD 4HZUA 4LZZA 1E2LA 4HYYA 4KBFA 4UXIA 4IEIA 3KUDA 1G41A 2QUZA 4TYPA 5EUQB 2R2AA 2A30A 4TLBA 4P3YA 3U3RA 1XXHA 3ZJYA 1N0VC 1QF9A 1W2GA 1NN5A 1P5ZB 2CCGA 5JCZA 3VKHA 4RJLA 5DH9A 2V7QD 2WWGA 2QY9A 3M6AA 4KODA 2I3BA 4M9XA 4UNRA 1XD8A 3LLMA 4M9ZA 2P67A 3THXB 1S96A 2OE2A 2CCKA 1ZM2A 2EFEB 2QM7A 3B5JA 3BJIC 3GLIE 1G21E 4FW9A 3SS8A 2QTHA 1XD9A 5FBQB 1M8PA 2IYVA 1VDZA 4PSAA 4UXHA 3TSWA 4ACBA 4M9SA 1XCPA 3AF1A 3T5DA 1FNNA 1F60A 1W0KD 1T8UA 4B2LA 1VYUA 5AUNB 1LV7A 1K5GA 2P5SA 4CGZA 3NVAA 1KJWA 2ZUDA 2ASEA 3RABA 4GZLA 4BLSA 4LWZA 2HYDA 3NHAA 5BN4A 1OHHD 2JJ1A 4RD0A 3PUZA 1N6KA 2Z83A 4HZIA 3EPLA 2NMVA 4PO8A 4Q4LA 2ZRAA 4G5OA 2ZQ5A 1CU1A 4KBGA 3IHWA 1KOFA 1OH6A 1W46A 2J41A 1JXOA 1OIVA 1R0YA 3B1ZA 1T5IA 1ZUNB 2CVHA 4OK5A 4KFRA 1JAHA 5JBQA 1OT3A 3FKSA 3PFIA 4BECA 2G77B 1AIPA 1E2GA 2AKYA 3DOEA 4OJQA 3AVVA 1DARA 1P2TA 1R0WA 1VG9B 1YE8A 1E96A 2QP9X 3W3AA 4LBVA 3O8CA 4ASUA 2IXEA 1FNMA 2ZYUX 3JZMA 2D4HA 2WKQA 3AGQA 1UPTA 4Q4AB 3ZGXA 2XSZD 2IBMA 4IFEA 3GLHA 1OXUA 4JSYA 4LBYA 1U2RA 3EZ7A 1CJUC 4US0R 1KK1A 3MCAA 3JVUA 4JL6A 5G3ZA 2ZETA 1RC8A 1PUIA 3LFUA 2C5LA 5DYGA 4DLSA 2RGXA 4IEEA 3R9IA 5HKKA 2GCPA 1OJLA 2FFHA 3WXMA 1AQUA 5DN6A 1J70A 4ZCMA 1H65A 3L8YA 2WKPA 1Z2CA 4Q1EA 2WICA 4QHYA 1Z0IA 1NBMD 2ZS9A 1R5NA 4A0FA 2OEPA 4KLNA 5KDOA 2IS1A 4RD4A 3AH8A 4YLGA 4L4UA 5BXQC 2QENA 4QBFA 5KDDA 3CB4A 4LHZA 4Z1MD 2ZRLA 2B21A 1E6CA 1KDPA 1YKSA 2ZJYA 3AKCA 1G17A 3CRMA 3EWAA 1KY2A 3PUXA 3A1TA 3VR6A 1KDTA 1BKDR 2YWHA 2GDJA 4RD3A 3W6NA 1Q22A 1XTIA 2OCBA 4LGMA 4OJKA 1Z3IX 4L15A 2CL7X 4GOXA 1ZU4A 3KFXA 1Z07A 1U8AA 1E0KA 3LW7A 2QAJA 2VP0A 1DBSA 5FOXA 3S1AB 2GJKA 4CEHA 1F48A 5E7IA 1R10A 2PEZA 2RGNA 4OKSA 2ZIAA 1WA5A 2HXYA 5SZJA 4B48A 1KMHA 3L82B 1GM5A 2BCGY 4NTZA 3QPVA 2JIZD 4MRVA 1G8GA 3QQ5A 521PA 1E9CA 2VA8A 5CLQA 2A78A 1T3LA 1E9EA 2PMKA 1NVUQ 5B2ZA 1AGRA 1Z6AA 3OZXA 2VP4A 1U98A 3OEHA 1DS6A 1NLZA 4DLXA 4JLVA 1VIAA 3PV0A 1GOTA 1VG1A 2WWWA 2NZ8A 3CRRA 2IUTA 4HB0A 4QGGA 4MRRA 1R4AA 2FFQA 4ZDJA 1BS1A 3KQUA 3EPHA 2ZE7A 1L2TA 3R8CA 4Z51A 2AK2A 1U8ZA 3VR1A 1E98A 1GRQA 5H1YA 4PX9A 2BM0A 4ACAA 2GAOA 3H4MA 4PHTA 4C9BA 1OKKD 3I4LA 2AWNA 6Q21A 2PCLA 3U5ZB 4LC0A 2JDIA 3GPLA 1D5CA 4ESHA 1TL7C 4TZ6A
chains in the Genus database with same CATH superfamily
1GKKA 3C6QA 3SY8A 1E89A 2WJHA 3ENKA 2CLIB 1PFVA 3HWRA 4RUKA 2IU6A 2QE7A 2ODEA 4NESA 5G1PA 4MKRA 5FBRB 1KOGA 4MX8A 4OU5A 1UKEA 5EY5B 4BJ1A 3E5RA 4FE4A 3MS2A 2YBEA 2YIDA 5BQ3A 1VI2A 4LDQA 5ALZA 1DQPA 3OM9A 1YR3A 4Q18A 2RIPA 4B8YA 1E7WA 1QX4A 4YRLA 5F1OA 3KQWA 3H86A 2V0CA 4EY3A 2NU6B 1Z4PX 2WIDA 3KSRA 4IIJF 4G1MB 3AFIA 3WKCA 3SSOA 1DEHA 2AC2A 4W9RA 3W5SA 1XEAA 3C1TA 3CW2A 4EGQA 3NHYA 2C0CA 1PD1A 4AXXA 4KH1A 2QTZA 3GT3A 1H4SA 1U3FA 1AQYA 1MB2A 4ZYZA 3A4MA 3G1WA 1D0SA 4TM8A 2NPIA 2YWGA 3TZQA 3HU3A 2O8DA 1C7QA 1CDDA 1V1RA 2XEXA 1ILWA 4HPJB 1N25A 2HEIA 2FP4A 5DLQC 4IUYA 2H1HA 5AJUA 4WERA 5KOHA 1MEJA 1GO2A 5KHLB 4P0TA 4DEYA 3HO1A 2I87A 3GCWA 4MSUA 1ZWKA 5COBA 5FAKA 4YVFA 2O14A 3LHFA 4RPKA 1R8QA 5G0SA 3BDAA 2WP0A 5HIJA 2B1RA 5TQ2B 2OQRA 1VECA 4QGBA 3ZE9A 4YP7A 4DEXA 4TKVA 5TJ9A 2WFLA 5BSTA 5IKOA 2ABWA 3ANYB 3R3VA 5I4IA 3P9ZA 4Y2RA 4HDSA 5IAOA 1WX1A 2ZJ2A 3T5BA 3P9RA 3TKLA 1XWWA 3AFOA 3ZWPA 3LXRA 3ZHTA 2QTRA 4LNUA 1MHPA 3L3BA 4J76A 3UJAA 1WMEA 4BMXA 5B5SA 1KC1A 4ENSA 3D2LA 1RRGA 1M2NA 1PR2A 2AMLA 1DJLA 2B6HA 5DBFA 3WKBA 3WLTA 2OG1A 3H1TA 4NENB 4C43A 1XJCA 4LZNA 3ZGZA 1AS3A 3OE7D 1UJBA 3VJKA 4NV3A 5FBHA 4ZVPA 2YFKA 1Z8NA 1M6VB 3WHLA 2YINC 2G67A 3DA8A 1FRNA 4EHDA 1QH0A 1TE2A 3C3EA 2XMZA 2YN2A 3D6UA 4JI7B 1YI8A 4OH7A 3M7IA 4GMKA 1SCDA 2VN8A 3PQDA 4ZRDA 4ZU3A 1Y5MA 2HPHA 4LVUA 4ZAGA 1TFRA 2WTAA 5IDYA 2WAOA 4UTXA 3STHA 3SR0A 3UJCA 3MWLA 1X80B 4IRXA 4M37A 4N40A 4G0YA 2Z4SA 1OIWA 4UDOA 4WN3A 4WAUA 1SUAA 1RM3A 4AURA 2FP3A 4YRQA 1JJBA 1DXOA 3OFKA 2R66A 1JEOA 4KCGA 2C8JA 4Q9NA 5T4BA 1TKBA 3WOVA 5B3LA 1GQSA 1B4DA 4WZBA 1T1IA 1ZESA 1BWQA 1P4GA 4M76B 2P1RA 4YDHB 5BPHA 3HI6A 1GGMA 1E0JA 5AKYA 5HS4A 5EJIA 4JYAB 1K0UA 4KX3A 1VKRA 3S8MA 3BICA 2PT5A 4L2IB 1B43A 4BB9A 4BLTA 3KPWA 2BGGA 1T4GA 4HRXA 2Y1DA 4A1OA 4AJOA 2RKBA 3DV9A 2VHYA 1QS0A 4FOPA 4XEUA 1UKZA 4Y6PA 3KXPA 4YRJA 1U9IC 2OFWA 3ESCA 3SKVA 4UEQA 1E9SA 5B55A 2QP3A 1GUAA 4HGYA 3FVQA 5HIIA 5HK8A 1I7QB 3EVEA 3GRCA 3VNVA 3ERCA 1LVHA 1GT6A 2VDUE 1DRWA 4B3JA 2WR8A 3SZLA 4Y2SA 1ZH6A 4HDAA 1VKOA 1Z8FA 2H3EA 3C5WP 3C6XA 3L84A 4A5SA 4DJFC 4LMPA 4FN5A 4GBED 4U63A 2PSFA 1DJPA 3SF8B 4MQEB 1CR0A 5F3RA 4F2GA 4V0SA 4MVJD 5GM2A 4C6SA 4CLOA 1RWNA 1DAGA 3TLXA 3JYNA 4FMCF 1KQOA 2BGUA 1EUDA 3ZLUA 3OQIB 4UOZA 1QRAA 2HK9A 3LY5A 4X45A 1Z6PA 2YR0A 3LIPA 1PLJA 3GFTA 3K1ZA 1NTOA 1A04A 5CD9A 3V4RA 4OAPA 4H4DA 3DFFA 5AOCA 2AZMA 4RWZA 5HMMA 2GRAA 1OZ0A 3AF4A 5AVVA 1C30B 1JHMA 2HJGA 3HABA 4M60A 4QXRA 4DBLC 2OV2A 4RSMA 3Q5GA 4BO7A 2H2HA 1K9SA 1KRHA 5HJ2A 2Z04A 5KJCA 4AMBA 3GQBA 4NMWA 3FNHA 3WFIA 1F17A 2GBPA 3E7DA 1DAOA 2B0JA 3KJHA 2NV0A 3EJWA 3MRXA 3EMDA 4OUKX 1EVQA 1MEOA 2EOAA 1B2RA 2E18A 4BFVA 1PI3A 2CMGA 2G70A 1L0BA 5FXMA 1E7YA 5LN1A 3ISTA 4UHFA 5I8WA 4IUBS 2R5FA 3F3KA 4RMGA 4TUYB 4TM7A 2NOAA 2C57A 2ZT7A 5BT8A 2ZWMA 4CG2A 3T7EA 3TUZC 1BCRB 2JGMA 3O38A 1V43A 3IV7A 4MYTA 1EJ6A 5F2OA 4J0QA 5AHOA 1B8OA 1RM0A 4RVCA 2R6R1 1WY7A 2TYSB 3MWDB 1J0XO 3UCFA 4XRGA 3LV8A 4N5MA 1FDIA 3TLJA 5JZBA 3D0QA 3FFXA 3OIUA 2O0MA 3PD1A 5T4EA 4B6JA 1VCOA 1C7EA 1US8A 2OK8A 2VSOA 3IUJA 2VRBA 3UKDA 1ZK1A 4PFJA 3ADPA 3DDSA 4L4ZA 4MQ6A 4Y9UA 4IJQA 3UB3A 3P9CA 3SZRA 2BEUB 2MINB 4A36A 2AKAB 1D07A 5CDFA 1Z29A 1KYTA 1GAEO 1IY8A 1ELOA 2HZBA 1KIFA 1ESDA 3GFBA 4S1WA 5G2OA 3RRZA 5K0TA 1OX6A 2OBNA 4Q48A 5IK2D 1KHHA 4IS3A 4TVSA 3FVTA 5DSTA 4Y2YA 1XTSA 2QOEA 4IJ6A 3PCXA 5M04A 4IGFA 3IP1A 1XTQA 3CEAA 2VNIA 2MCFA 3ABIA 3SDZA 3KFVA 4MCJA 1IPFA 3Q5EA 1E3WA 3EOBI 1XVTA 1ECFA 4PBRA 5DHQA 1Z5UA 3Q11A 1V35A 3W6ZA 4EFKA 2VAXA 2WNIA 3RAEC 3BRWA 2WM3A 2H48A 3A9CA 3OU7A 4JJEA 4UDXX 3IESA 3Q87B 4U6NA 1OZGA 1XNRB 1GEEA 3F90A 3QUSA 4HAVA 5CIWA 4NG4A 2PO5A 1G2IA 3AXSA 1ZLXA 3BKXA 3R4VA 4MWOA 3REGA 4LJYA 1E4VA 4NEGA 4NNOA 1A2OA 1KZGB 5ALYA 3I2YX 1JPNA 3VVBA 2IA5A 4FDVA 1ZNXA 2EF0A 3NTOA 3URKA 1CUCA 1F2TA 1GSAA 3FYSA 1GQYA 4UUMA 3G68A 2NTEA 3CINA 3MINA 1H2XA 3NQ41 3K1AA 1J90A 2A0YA 2CB9A 2P6UA 2D7DA 1MB0A 4UM5A 1E9BA 1E3TA 1EIZA 4FINA 1QYVA 2JHFA 3OTWA 3VC7A 4F3YA 4N3CA 2ZM5A 5DWVA 1U6IA 3FD8A 1XXLA 3BXPA 3JD4A 1TT5B 3PU6A 4RY2A 1O6ZA 5L3QA 3SZMA 4NHOA 3T9DA 3RB8A 5A3QA 3CUWA 3H9CA 4ZXFA 1JRLA 3PF8A 1TMOA 1JPUA 2DLDA 1E8DA 1YRAA 1JQLB 3MAJA 1XMJA 4RY8A 1EX7A 5G0UA 5FWYA 3K5IA 2J6BA 2H9YA 3IQFA 4C0AC 4D0SA 4JFRA 3EH2A 4R1OA 3ZS9A 1GNRA 3HZOA 4C1NA 5ECWA 2E2WA 3WIBA 3R3XA 4HDRA 4ZI7A 1V1JA 1N3YA 1E3MA 2WJ6A 4JZKA 4V0KA 1N5IA 3UNXA 2AEJA 3CONA 4KHPB 3GGOA 4ZOEA 1TAGA 3OESA 4C7OB 2IPAB 4M22A 1K3UB 2P27A 5DTQA 2XGMA 3OLYA 4YP1A 3FPFA 4QYWA 1CUBA 5LDDC 2C9MA 5IJAA 2PMBA 4DCUA 3L2OB 3MEQA 4OI0A 1DKPA 1HOTA 2F90A 2PSSA 4FD2A 1NC3A 1HF3A 2GZMA 3UMVA 4AF7A 3RADC 4PY2A 1WO8A 3K9HA 4PBSA 4EW1A 3KB8A 3SZ3A 5JTUA 1V5GA 4JP2A 3VU8A 3JS5A 4BHTA 4BJHB 2J3QA 1TD9A 2P2DA 2QVCA 4I4NA 3UQZA 4K7JA 2LP4Y 3FRJA 4PVDA 4FD3A 3GJ5A 5L6LB 2BFDA 5F9MA 4C20A 3PNKA 5HIKA 1L3CA 1L4HA 2X19A 3IPXA 4KDEA 3BF8A 4PPQA 4QUBA 4UMVA 3ZVLA 4C5CA 3KAKA 3QG5A 1UAAA 3B85A 4GICA 5EUBA 3DT8A 4CM6A 3PUJA 1L3BA 1WUHS 3KP1A 3N0XA 3WDLA 5HZKA 3WICA 3H05A 4HAUA 2RGRA 4C6TB 1H9AA 2WJJA 4WL0A 4YRMA 2WHXA 1CDEA 1RT9A 3ZX5A 2GAAA 2VCHA 4D3XA 4DCJA 1LVGA 3DDUA 5IEJA 3U5TA 2CJXA 2NUTB 1XQWA 3E9RA 4BQNA 2JGDA 3KJNA 4A0HA 1HRDA 1UM8A 3S2YA 4CW7A 5LD2B 3LPLA 2FQWA 2QMYA 1YB6A 2XWSA 3QLTA 4ZAFA 3VPBA 1CULC 4D26A 5KAMA 4LF4B 4QPDA 1QQ5A 1Z5GA 2FMXA 2NTVA 3M5WA 3QHAA 1X92A 4X20A 4KQCA 5EAIA 5M29A 3CY6A 5EZ6B 4BVGA 2FEWB 5LWHA 2X76A 1PK7A 1NOIA 1MAWA 3IIIA 2VP9A 3CRZA 3UAZA 4FQ8A 1RAHA 3PP8A 1RM4A 1XTRA 3GP5A 1RAAA 1KJJA 1SXJE 1WXFA 3QVGA 1GSOA 4IX1A 3TGPA 3VNUA 5LXTB 3GMTA 3FKSD 4HBGA 4CU2A 5KYNA 4H08A 4ZD6A 4RSGA 5LP6B 1U7OA 1EFTA 4F0JA 2P1DA 4IDBA 1ZITA 5F12A 5LB4A 3KAJA 5DHRA 2Z3ZA 5E8RA 1PR6A 1W36C 4CGZA 3GLFE 3W3AD 4PC1A 1Y63A 1QORA 1ZU5A 3NWJA 4Q7EA 1UCFA 1NFQA 4L4YA 2VIIA 5EKXA 4OYHA 5CM9C 1U9YA 4KZKA 1QH8A 2Q29A 5EFZA 4BBZA 3WRVA 5LR6A 3UCXA 2X6RA 1U11A 4GI3A 4G1CA 3SFZA 3UQYS 4Z5XA 4ARCA 1CPYA 1QFYA 3DEKA 4MR9A 5GTDA 4F3TA 4ND1A 3AQIA 3IYLW 1S02A 5AJXA 5ECYA 3PLNA 3H65A 4DZTA 4C3ZA 4NONA 1I2DA 1P1CA 4MGKR 1TVKB 4KQ6A 4PQRA 1E1RD 3E22A 3JQQA 3UV6A 2O2GA 4JVNA 5BW5A 1GGFA 1YZVA 3VR3D 5A5DA 2P3LA 5ICCA 2PLNA 3G82C 2C3YA 2P9QA 2BUBA 5BO5A 5FL7A 2OZVA 3D54D 1QGYA 2Q5JA 1WZEA 3MRVA 3QSGA 4P5PA 2NSJA 3RIMA 2Y1CA 4IIXA 4C2AA 3AESA 3TR6A 1N2BA 4HGPA 1C29B 4HUQA 3E3AA 5ENDA 2PN1A 4AJ2A 1GTVA 1NBWB 4I4TF 3IDOA 1DINA 2PPLA 2NU9A 1PD0A 3I2KA 3TZEA 2VHZA 2YY6A 5JXJA 2BGLA 3A26A 2GFIA 3KLPX 4J0CA 3OCWA 1R6UA 3GBSA 1JMKC 3K5WA 3OHMA 5I4BA 3BWDD 1NOJA 4LJKA 3SQMA 4Q3KA 3AL2A 4KE8A 2FETA 5AVRA 1YHYA 1EFRD 2VVTA 3AP1A 2ZG6A 3JATB 3M2TA 4XDZA 3WKDA 4HEHA 2P5TB 3OCUA 4KO1S 3Q40A 3KJIA 1QPGA 1Y4UA 5KNDH 4AYTA 3NC0C 1GNLA 1ZGJA 2ZYWX 4A16A 3DF9A 4U2KA 1B8PA 1GCOA 2OHHA 4U2FA 5H3HA 1XJQA 1RMQA 2WJ4A 1GU7A 3EOZA 2JJ8A 1RQNA 3MTGA 4FDUA 2XUAA 3DGFC 2C4UA 2GBGA 3K6SA 1H8EA 1TTPB 1R9NA 2GM3A 1AKMA 3ONDA 1SUWA 2R6HA 4PXAA 5TGTA 2DB3A 1ORVA 4OY3A 1V1MB 1ZM9A 2A84A 1TZCA 2BE7A 4IG9A 2PS9A 4ZT6A 3G2KA 3ICVA 3FLMA 3MBIA 3PQ4A 2IHKA 5CDYA 1OUMA 3EVBA 3SJBA 4RVDA 1EJ2A 4HNGA 3OZWA 5KI6A 1F7VA 2KX7A 3QU5A 4RTSA 2D0OB 1NQTA 1BTOA 3QFCA 3ZI4A 4HDQB 3PA6A 3CZMA 2JAWA 3VOTA 2O50A 3AU9A 3LHKA 4MB2A 1OH7A 4CZ2A 4EJSC 2BH2A 2G63A 4LJ5A 2NT4A 3EG5A 1DWPA 2WQZA 1R00A 2R8RA 4P38A 3IPYA 2Q3HA 3A1WA 2YHIA 4MGEA 2H52A 3T7CA 2PBFA 5EINA 1UBEA 2G08A 5FOUA 4I2VA 1FMFA 5KQRA 4WIAA 3ZQKA 16PKA 4CLXA 4ZI7F 2JPDA 5AFSA 2GSDA 2XD4A 4JB8A 1RHKA 1M83A 1F51E 1O7JA 3WVNA 1O03A 4MEAA 2B5OA 5EKUA 5BQPA 3ZYCA 5BN3A 1A5TA 4R5HA 3OTHA 4CKEB 4PRYA 1ISJA 1GUFA 1NN0A 2JKVA 2O0HA 2B78A 1H2EA 2QTBA 4QEKA 5D7BA 4ZZ2A 4WKGA 1OLUA 2OZKA 1HDZA 3P32A 3AYXB 2C7QA 3G9UA 4K9SA 3RC2A 3B6KA 1QQ6A 3ZWYA 4EEKA 3BZBA 4M8LA 4BQRA 1HYBA 1QHSA 1SOMA 1QHGA 4J0EA 2Y0CA 3LOPA 4WBNF 4JI2B 4OKNA 4LRXA 3RU2A 1DT5A 4D02A 1W5SA 1EZZA 1ZK4A 5EP3A 5CFZA 4GU5A 5JEEA 2C8LA 3HJAA 7ADHA 1W36B 1VE1A 3IOCA 5A05A 1HYHA 3P8ZA 2VP6A 3A9RA 2QUKA 4TZTA 4F4FA 3OX3A 3TE6A 1D4FA 4C0BA 3HXTA 4BVAA 1ODTC 3P26A 4MW5A 2Y1GA 3V4VB 1F8GA 3HO8A 3MMZA 5DOZA 3TG2A 4CU5A 4YWJA 2C07A 2Z56A 1UBRS 1QV6A 2AN4A 3Q85A 3VU0A 3F6EX 1KWKA 4RTLA 4PSUA 2AXQA 2EDCA 4RMJA 4X3CA 3CC8A 3MB5A 3EZ2A 3AI2A 4XM1A 3PFHA 4E2YA 4D3DA 4W9MC 2HQOA 1VBFA 4RETA 3F4BA 2NNWB 2GMWA 2WUVA 2YY7A 3AVQA 3DBLA 3ZKWB 3EODA 2B1QA 3RUFA 1Z83A 1MHTA 2F17A 3ZDXB 3GUCA 5CDGA 1ZMOA 3OMWA 2A0KA 2G71A 2YIMA 4IHJA 4KVAA 1EUYA 2PZMA 3GNTA 2AOTB 4R5MA 4XYGA 1TD1A 2O1WA 2LUOA 3DDWA 1MO4A 1X0VA 3DFUA 1HL3A 1OC2A 4YT4A 4HWPA 1IMJA 3OJEA 3HQ4O 2CNDA 3LT0A 2PZLA 3DMGA 1UEJA 2QN1A 2BKEA 3AY3A 1JQ3A 1R0CA 4ZVSA 1DJQA 1Y4SA 1BMTA 1X6VA 3BFPA 3L93A 4H35A 3THXA 4LXUA 1C3VA 3PPVA 6YASA 4YV2A 1QX3A 1XTPA 5EEHA 1LLDA 1N92A 2VDKB 3O21A 4XYMA 4X3OA 2JBAB 1Q21A 1T2CA 4WZAB 3ETEA 3QKWA 1GNQA 3CF4G 1HY3A 4MPRA 4ZO8A 2HSJA 1VJGA 5DN9A 3ABSB 4OH1A 4EDHA 2V7WA 4HDKA 3PI6A 3WX0A 2V7GA 2P11A 2QMQA 4EYKA 2Y66A 3RPEA 3STUA 3KSAC 3GJYA 3MD0A 4JBWA 3J81A 2QEQA 2V55B 1N77A 1NE2A 1PSZA 2ASVA 1I3MA 2QY6A 2W8BA 3O92A 4CL3A 1XYGA 4HR7A 4FP9A 2JLAA 4EPRA 2KLBA 4F5WA 4L3OA 4UU1A 4CNQA 2IEAA 5IT4A 3EIQA 2JGNA 2Q2OA 1EDZA 2MSEB 2F43B 4YI5A 2HBZA 1M2FA 3QX9A 2YC2C 1IQPA 3JZIA 4TVKA 3RAFC 1CHNA 3C24A 1NXQA 1VMDA 2FSVC 3DEFA 4ER0A 5C1IA 4EJSB 4P4SB 1EFCA 1AK9A 1LNSA 2R68A 3TL2A 2J9XB 3OQ1A 4E2FA 5C1BA 3UMSA 3BIJA 4BMOB 1GPDG 2PD3A 1ZHFA 2Q50A 2XI4A 2WYHA 4RC9A 3T41A 4ENRA 4EL0A 2G1PA 5CFRA 1FFEA 4AJIA 4MKIA 5HJEA 4G67A 1FYWA 2JCXA 4H7IA 1HDCA 4HNVA 3KLOA 3F78A 5T3UA 2GN9A 1ZXXA 2GLUA 2DERA 2SICE 2D1SA 4PPNA 4D9CA 1V71A 3BEDA 4H59A 2HC9A 2X3UA 3CVXA 4ENPA 1EFVB 3QOFA 4XUGB 3AEQB 2EGGA 4AJKA 1ZRHA 3U3XA 3ZJUA 1SVNA 4F4CA 1AK2A 2F3PA 5JAOA 3KETA 2C7OA 2BD0A 2RGAA 3CZPA 4EB0A 3HFSA 3K09C 1HFWA 3QXCA 5G4KA 1G38A 2CXOA 2H2AA 2OGWA 4MA5A 2IJGX 3PT9A 1SKUA 4Q4JB 4B32A 4E22A 2RJ3A 3EQ9A 3IOYA 4A15A 5DE3A 4S2EA 3IH5A 4AXBA 3QLUA 2PX6A 1H4TA 1VCIA 3C3JA 4MUFA 2GR9A 2I7DA 2PRZA 3K8ZA 3L7AA 4KMRA 1TC1A 3T7RA 5KIAA 5CB4A 3IQGX 4HNUA 1K86A 1P75A 2HWWA 3ZW7A 2OYCA 1QH9A 4PC6A 4BFZA 1HQCA 3UENA 1GZVA 2O9JA 3ZD6A 3DFIA 1JALA 2I9PA 2R87A 3BTVA 3JX9A 2EZTA 1V25A 1FZTA 4P08A 2NU8A 5ABPA 5JSHA 5E6UB 4DLKA 3GRYA 4KO2S 2AA3A 2C54A 3NV9A 2C9OA 3LF1A 4Q9HA 4RHYA 4CDRA 3PTAA 1E8MA 3P2KA 1RVV1 2PL9A 4EI8A 4ITVA 2R65A 1CF2O 1NYLA 4QOIA 5FTJA 3DMRA 3WMRA 4CKYA 4UU8A 1IZZA 5I8ZA 3IT2A 5JZOA 3U09A 3AF2A 3U3MA 2NIPA 4RNCA 1TK9A 5BSEA 2V0NA 4C06A 3QTBA 2REQB 2BM8A 2DPHA 2GZDA 2I6GA 3ADOA 5F1YA 4DMCA 1KAEA 1JIXA 1KI2A 4DIOA 4DWJA 1QHFA 4K9NA 2IS4A 3G3EA 4NLLA 4CQMD 1P39A 1Y7PA 2Y67A 3TTYA 1GA6A 3K05A 4JBLA 3DDCA 3KKPA 3RVPA 1JXQA 3KOOA 4XIYA 4O1HA 2H1LA 3TR0A 1HV8A 1MNQA 2GZ3A 4HAYA 4UBLA 4YUAA 1KAMA 3I6BA 4LA4A 3K2QA 2O1EA 1MIOB 1YL6A 4ZGGA 2WJAA 2QJTA 2J07A 1SXGA 3P2JA 3UMGA 1MQSA 4Y1RB 4CEJB 2E85A 2HJVA 2Y4NA 1XNHA 4E14A 4Y0NA 2AFHB 3A04A 3PZBA 1V8DA 2PY6A 4MKGA 2GCOB 2JA1A 4KIWA 1Z6QA 1F0NA 5LLTA 1N7IA 3UF0A 2O6LA 3CSDA 3IKJA 3NIBA 1WKBA 4Q3CA 4RJKA 4UVDA 1JLRA 1QGED 3AV3A 3E48A 4XH9B 4N5NA 4NG5A 3FOEC 4XWYA 2XMQA 3RVKA 2HRZA 4NEHB 2Y0PA 3HYRA 4OGKA 4WZ6A 1QNLA 1KP2A 1QK5A 1W0KA 2HHLA 4P82A 3IEVA 1YL7A 2P6OA 2YVKA 3SMVA 3S8EA 4M0EA 3P71T 3KKMA 2PQ0A 2BMVA 4TT8A 4CM8B 1YS9A 1UZUA 1VL6A 3RUHA 2OSVA 3EGCA 2ZPAA 5L3SB 2ZM6B 2QGNA 5JNWA 1Z34A 2WIGA 3EWSA 2GZHA 1DBIA 4DQLA 5IASA 2IYZA 3CJQA 2MT9A 4PZAA 1U8FO 4UD2A 2HU5A 1J20A 3KM0A 1KYQA 4YMSA 1ZVMA 4GW3A 1IYZA 3W5AA 4AZ0B 1THGA 4D4JA 1ZAYA 3BH6A 3Q10A 2PMEA 2WYUA 3NDRA 4HF7A 2F1JA 4NV1A 1Z35A 2HLDD 2X1MA 2XQJA 3R0ZA 2QD2A 2XF2A 5F2KA 1SQ5A 4C08A 4R8LA 4TMKA 4A0QA 2XKKA 1H2AS 4BVLA 3LY8A 2OQ2A 2H2WA 1W0JD 3IVAA 4FIDA 2IUYA 5FUBA 3JQ9A 2CNOA 3TEJA 5K4GA 4S04A 1RHQA 5K8IA 4DR4B 5ALVA 3JQAA 4XLTA 3T9EA 2IYPA 4EKNB 2PUGA 1XNQB 1B6SA 3C8UA 2YHUA 4ZYUA 3K0FA 4A82A 3EC2A 4R1MA 3VU9B 1Z6ZA 4GOOD 1A27A 3O9VA 4ZDKA 5KWIA 4NU6A 4NOJA 4F4DA 3GLIB 1RRCA 4BE7B 1UJNA 2FZ5A 5ESDA 3EPPA 5AVOA 4A6XA 4AU1A 1HLPA 4FNOA 4LDPA 3R8XA 2JH9A 4O5OA 3ZD9A 3BIFA 5F52A 5H68A 2O2IA 2D0DA 2YZ7A 1NA5A 2XR1A 2HHJA 3I72A 5CVCA 5IXSA 3PX7A 1REQA 3FWHA 5HCIA 4CCAA 2PRYA 4FQ5A 4NV0A 1AGXA 1I2BA 2BF7A 3LRPA 1V47A 3TQOA 4TXJA 1E5TA 1D8AA 4YRFA 1X94A 1M1YE 1OJ7A 5BYBA 4B73A 4JOQA 3U60B 1OE0A 3IULA 1LTQA 3RS8A 5T4FA 1RBZA 5TT0A 4W1QA 2EBFX 3EIXA 3OPNA 3O83A 5H5JA 3H83A 2F9LA 4TVOA 2XWJI 5CTAA 3SHQA 2XPCA 3TBKA 4DSUA 3PHJA 2J7PA 2NZ2A 2BEWB 2Q5QA 5A3SA 3U61B 2C2YA 3NG1A 3TECE 2KBEA 1JMYA 1KZ7B 2X2EA 4JLBA 3UAXA 2GD1O 3KKOA 1G7SA 1VGVA 2J5XA 2WYVA 3UVEA 4D74A 3EXFA 2JGAA 1YZQA 2Y6VA 2ZUVA 4DQVA 1NU8A 2QHXA 2QROA 4UUBA 2G36A 2WB4A 4ZCLA 5KTRA 5HFAA 1HE1C 1NR5A 2NU7B 5TJHA 1OBOA 3NOQA 4WPGA 3KXLA 3S81A 2MU1A 3EFOA 1MX3A 1G18A 2JK1A 4YDQA 2C9BA 1Z3CA 2A14A 2QLJA 2RAPA 2WAAA 5E6SB 1DXQA 4Z9FA 1KFKB 2R8OA 3KRTA 5K3AA 4F93B 3WQRA 4ZEXA 4JJ7A 1E2UA 2VQEB 1H5QA 4Q9KA 3VZDA 5EKSA 4CQMB 3UXHA 4A8JC 2EIXA 5BORA 1ENYA 5LQJA 1FDTA 1J1ZA 2ST1A 3VJMA 1HE5A 2HWYA 4J1TA 4MQFB 2D8AA 1X87A 4LK2A 2C2OA 3NV7A 4C87A 2B4QA 4ER5A 1H2YA 1H4VB 5CB4F 5CIYA 3NTUA 1MW9X 1V8FA 3IUEA 2ZB4A 1TIKA 5PNTA 3CVUA 4J3NA 5CW1A 3L0SA 3S27A 1JJAA 1BOOA 1Q2UA 2QTWB 4RYDA 4BLRA 1NDQA 1WHTA 4RGVA 2XAUA 3TBFA 4WRRA 4BQEA 4JWKA 2HA7A 3FZYA 4JJZA 1XIVA 1K98A 2IYXA 3GJTA 3M9XA 1D03A 3V42A 3LTNC 5E9AA 4NDNE 4C05A 1ZGHA 2ANCA 3KBOA 4JROA 3ER9A 3OCZA 3PDWA 3SQWA 2AG0A 1PU2A 3QW4B 3EARA 4LJ8A 2VJPA 3WA6A 1LV8A 3EGXB 4OBEA 4AG5A 5HCNA 1YQXA 4H1VA 2HCBA 3USCS 1JA1A 1TX4B 1GKIA 2B4KA 4PONA 4LY6A 4W5QA 4LFAB 3D8UA 4YIKA 4IIUA 2FZKA 4GI7A 2I03A 2ZI6A 4MI1A 5LU8A 4ILEA 4BNXA 2WWYA 3T0FA 2O6HA 4H7PA 3U44A 3TH5A 2V6BA 5JADA 4G89A 1NGSA 2JL1A 1YO6A 3R8FA 4PN3A 4GWLA 4DE5A 4PNEA 3FWNA 1LC0A 1IHOA 1KPHA 3IQEA 3ACCA 4O4HB 5GWXA 5K0LA 4UM7A 2HHCA 4MI6A 4LOJA 2HT6A 3NCTA 1SHUX 1YIOA 2ZQZA 4J0DA 3LLUA 5THKA 1UBGA 3J7TA 5KYXA 5F7ZA 3EIEA 2FVXA 3HCOA 3NGLA 4M1SA 4AZSA 2HRRA 2ZVPX 3BHIA 4S0ZA 2Z5GA 3UOGA 3BKWA 2WPDA 4DY4A 1G64A 1LWOA 3VYRB 1WNTA 4PZLA 3ZD7A 4L6CA 3IJ5A 3JZDA 6NULA 3FVWA 3JW8A 3COSA 2ENWA 4M9CA 4MROA 1SVOA 1UMBB 2P6MA 2PV0A 3EXIB 4IDAA 4TROA 2LXNA 1CY6A 1TO2E 4I6EA 3EMBA 3NORA 4HQ6A 4TV8F 3CXRA 3EIHA 1KQFA 4Z7QB 4KR7A 3PNOA 1PYOA 1N8KA 2JFGA 4I4CA 2WSSD 4FFWA 4REOA 4Y1FA 1VPWA 1RADA 4ADSG 1EK5A 1RI5A 5ESWA 1N9GA 3UG7A 3UM9A 4YV0A 2W2KB 3C8DA 1Q6YA 3EA4A 3IP3A 3N5CA 1J0EA 4JENA 1JR3A 3I8OA 1ORIA 4JX9A 4O4JA 4XX0B 4I3HA 2VTBB 1XZJA 2C9DA 2KJQA 1CY7A 2YYZA 3AEYA 4B3TB 2YBDA 4H1HA 4RFVA 5JAPA 3HMQA 1XKXA 1HDGO 2RSLA 3FMVA 1C5KA 3PUKA 4K6CA 4DDKA 2XYQA 3D6JA 4V1CA 2WHEA 4P2BA 3GD5A 2HBYA 1E1KA 2ZKIA 4X00A 5AOAA 4CMEA 3FYCA 3SJAA 1F7UA 2HPAA 1YJAA 2AX3A 5K3SA 4KGZA 3N2IA 4B3DA 5FORA 3EVZA 2P90A 4Z4CA 3GLGB 2UVPA 4D0LB 1MABA 1BNCA 1T3SA 1JFSA 1UOQA 2P9TA 2ZREA 5DPMA 3GJ4A 1D1TA 1RRFA 2XYGA 1AMOA 2B30A 1E3LA 5A0TA 1VXOA 3CNOA 1GPKA 4RM3A 3LUCA 3NOVA 5TGZA 1G98A 3OBBA 4LJ7A 2NGRA 4ZVLA 2CFRA 3F9RA 3UKJA 2YVQA 4PC2A 1YIAA 3DJYA 2C20A 4BLQA 1ZH8A 3CKKA 3E84A 2QT0A 4D57A 3VNAA 5KNLA 221PA 4MWDA 2DM6A 2PZKA 3RT7A 4MYRA 4ZAVA 1U8UA 3L06A 3PEYA 4K88A 1J9EA 4M21A 2I1WA 2NYRA 4M1OA 3WFJA 1TEXA 2V7UA 5GADl 2GQ0A 4DXAA 4A8JB 2M32A 3CEPB 4ZKEA 4XA8A 5EJ5A 2P9JA 3EZ9A 1XK7A 3FYUB 2IYEA 1S2OA 1ZJ4A 1MZPA 2F1IA 4OSEA 3MWKA 4D9BA 3FUVA 3NYRA 5I7VA 2JCGA 2VDWB 4C04A 2Z09A 5HE9A 4YALA 3OCXA 5LOVB 3HU2A 2JEYA 3TLKA 3G89A 1JR4A 2R7NA 3EIFA 4IF4A 1YBMA 4IV8A 4YFYA 5AUPB 5I5EA 1NSYA 1ESNA 2EBHX 3I5XA 3GW8A 3HUDA 1LBTA 1UC5B 3WGNA 3WHPA 3TFOA 1T5SA 1ZVJA 3PHIA 4FT4A 1Y3HA 4EGFA 1ZIOA 2I55A 2Q3LA 2M98A 2YJ5A 1P44A 3H9JA 2AFIE 3MTJA 1FB5A 5DKFA 4ILKA 1UK9A 1JA9A 3MJSA 4O4LA 1BXRB 1G8PA 5HQ3A 2IBTA 5DIFA 4LRTB 2PWBA 2IXTA 1KEEB 5CNJA 1VL2A 2ATIA 2POQX 4IFTA 1Y3IA 1IK6A 4O5AA 5AHKA 3TOVA 4CIDA 3ZGNA 1UZLA 1AH2A 3DE1X 1N0WA 3LBYA 2DBQA 3N7UA 4YTEA 4FBLA 3S29A 4KN6A 3IA2A 3GHYA 1U5BA 2OMEA 4DL9A 2WY2D 2I65A 4L5IA 4BE9A 1A2KC 5CT9A 4LZJA 3ZI7A 4DAOA 4DRXB 1X3SA 2DYKA 5I48A 4M4SA 3ZWQA 2FDXA 1Y9EA 3L07A 2WJ3A 1V95A 1P3DA 5AI9A 4BMCA 4E5NA 4CMGA 3O3MB 4HH3C 4D9FA 3PSHA 1NQ5A 4BKUA 5EWLB 4DPMA 4EI9A 1O0SA 1R12A 3UJDA 2OA0A 2PL5A 5DGCA 3AKYA 4ZREA 3R0IA 1IIBA 3AUTA 4ZVKA 2Y1LA 2ZRFA 1FSGA 3MB8A 1ZZGA 4CF7A 1T0HB 1JWLA 2QRZA 4QJ5A 2UZ4A 1F6DA 2ZRNA 4QSMA 5ENVA 3IVXA 5BSGA 4G8JA 4RMHA 1DOAA 2VLBA 2VP2A 1HE8B 2W93A 2F55A 3SD7A 1SQGA 1TIBA 3AFGA 4WNAA 2OFXA 4XQGA 2AJCA 4W5TA 3JQGB 2AF4C 2C58A 3ZZ0A 5EWMB 4AAYA 2WF9A 5EPOA 3ENWA 3K94A 4JP5A 4U02A 1F3LA 1NW4A 3M3HA 1WB6A 2BZ0A 2I78A 4QO8A 3S4YA 3OCVA 5JH7B 5K09A 4DHWA 4TL8A 1CB0A 1Q2XA 3WGUA 1LJLA 4JSTA 2N47A 1YE5A 2ORVA 2QV7A 2PUDA 5F98A 5AXCA 1OBCA 3WIOA 5DB4A 4RTNA 1P1JA 2HPZA 4C4SA 3KEOA 5IC4A 4OQYA 3MJRA 2FPIB 2B2NA 4WJLA 4UMDA 5LMCA 3L7JA 2R4TA 5CCEA 3RF7A 2CDCA 1A77A 1FVOA 1LDMA 1MGOA 3ASVA 2Y1KA 1XKQA 4HATA 4J7XA 4OJNA 4PYKA 4TL7A 3WSWA 3S55A 4P31A 4EKDA 1KYYA 3JD2A 4UUOA 4Y1EA 2XA2A 3LPAA 4CM3A 1G19A 2E87A 2NZXA 1RXSA 2RONA 1PJRA 3GF4A 3IC5A 3JASA 5JSYA 4HUTA 4DDHA 3U7GA 3PLAE 1IN4A 5T64A 1OZFA 5HRCA 4YNBA 4ESVA 2GPWA 3RSLA 1B76A 1M1UA 3PC8C 1WBJB 2A1TR 4Q9DA 4DLNA 3VH4A 4N5LA 3LY7A 1U7XA 4Q6WA 5DV9A 2PE5A 1JHUA 3OECA 2QW1A 2F4VB 1FLVA 2AYZA 4JUCA 2KLHA 3T1YB 1A2BA 3HB9A 3SF0A 4BRZA 4FZ3A 3SM3A 1KDRA 4HZUB 1W2WB 1S8OA 2COKA 3PGKA 2BL4A 1IZYA 4Z9YA 1Q57A 5DTMA 3LCMA 4Q3DA 4Z7OB 2CXXA 2BGWA 2R97A 1QIEA 5F9HA 1ZIDA 2WZBA 1MD9A 4I9GA 2P9ZA 2G5CA 4MDFA 4WOBA 1RWVA 1CJSA 2G9VA 4KBYA 2BGTA 4INAA 4RVGA 2XGGA 3TLCA 1SVSA 4EF4A 1ORTA 3QBDA 3QUBA 1VPEA 4E94A 5CX1A 2RC6A 4O4JF 5CXXA 1Q0TA 1LLCA 2CF5A 2HV9A 2JHCA 2GPJA 2VQSA 2VRCD 3H7AA 1QUFA 1QLHA 3I01A 4MDYA 1DTSA 2V7EA 1CUGA 4IIJB 4B8WA 4Y8VA 1S5PA 2SCUA 2X2OA 4MVJE 1U3DA 5CVEA 4D0NA 3DM9B 1ITZA 3ZQ6A 1RXVA 2CZQA 1RZRD 4NSNA 4WSOA 4C0XA 2BMEA 4KREA 4Y2HA 4MICA 3H0KA 4ZOLA 4AJLA 4CG0A 1SKYB 4NWIA 4GPBA 2FMTA 1AUQA 2XHZA 3P9SA 3ZHSA 4BGDA 2FXIA 1E1DA 4ARUA 2GKSA 3INTA 2QBYA 2QE7D 3GJ7A 5DASA 1SY7A 2CHVA 4EW3A 1UBLS 3FNGA 2WP8J 5FTWA 2A57A 3IBYA 5KZMB 3RT9A 1L5WA