1LS6A

Human sult1a1 complexed with pap and p-nitrophenol
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
288
structure length
288
Chain Sequence
SRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGHSLPEETVDFMVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords aryl sulfotransferase
publication title Structure of a human carcinogen-converting enzyme, SULT1A1. Structural and kinetic implications of substrate inhibition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 97
structure length 288
sequence length 288
ec nomenclature ec 2.8.2.1: Aryl sulfotransferase.
pdb deposition date 2002-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ls6A00
2AKYA 4B35A 3GLGB 1M2OB 2C98A 5ANRB 3LW8A 4A0GA 1SVOA 1G41A 1JAIA 1GVNB 3RRZA 1KI3A 1GKUB 521PA 4MKHA 1WMSA 2XEXA 4V0MA 1R5NA 1KMQA 1K8RA 2X77A 4LV5B 3DMNA 4Z8YA 5DIFA 1OKKA 2BBWA 3B2EA 1GOTA 1Z6AA 1PZNA 2WV9A 4FMDB 3GLIE 2F7SA 2XZPA 3FHTA 1KYIA 3S1AB 1KO7A 1D5CA 1II8B 1TQ4A 4G0NA 2J0QA 3P20A 3T5DA 1RRFA 1OIWA 2PJZA 5AR1A 5IDVA 5IK2D 2BBSA 1MO6A 3RS0A 2O8CB 3ND8A 1G9XA 1X8LA 4C7OB 2QGZA 2P6UA 4Z8XA 2IF0A 5JSZA 3SU8A 1Z0AA 4DSUA 1KJWA 1Z83A 4LI0A 4K81B 4PPGA 3OZXA 4EDHA 4GL2A 3TKLA 4Q21A 4ILEA 1E0JA 3SYKA 5TARA 1I2DA 3NVAA 4ZCLA 4FMCF 4XWOA 5FBWB 4ESHA 1I2MA 2OBLA 3MD0A 3AVVA 3TVDA 1P6XA 2BMEA 4OI1A 4HUQA 2Z5FA 4DLVA 1R0YA 3W90A 2ZJOA 4UXIA 3DHWC 1VG0B 1E2GA 3PUZA 2VF8A 4DKXA 3QSYA 1CU1A 2ZJ8A 1XZQA 3TK1A 1W2GA 4YMTA 1MH1A 2OXRA 4CEIB 2HV8A 2ORIA 1FUKA 3QENA 3VR2A 4II7A 4Q9IA 1W36C 2W6JD 3NHAA 1JNYA 4P4SA 3VTKA 5L3QA 1RC8A 3N5CA 2CCGA 3Q5DA 2E1RA 4JVSB 2V55B 4O3MA 1G5PA 3ZZTA 4B44A 5F9HA 1YRBA 2JJ1A 1NSFA 1DAEA 2BHRA 3K0CA 1ZNXA 5JBQA 3OIUA 2WPDD 2J7PA 2ZSDA 3QBVA 5FPYA 3W9YA 4AG6A 3D3QA 4I1VA 2Q3MA 1XEWX 3OFND 2FGJA 2QQEA 1IN6A 2OE2A 4Z51A 3AUYA 1EWRA 3LBHA 1TADA 2IYQA 4FMBB 1LFDB 3EARA 4G01B 4C0AC 1E4VA 2AWOA 1GUAA 1L7VC 5DYIA 2V4ZA 3E70C 3I8XA 1I4TD 4HLDA 5AJYA 3I8SA 2RMKA 1BIFA 4PSVA 2JAQA 1CRQA 3A1TA 3NDPA 2ZUCA 1IOZA 1XD2A 3T34A 3SFZA 1S9DA 1NN0A 3ZVLA 4PAOA 4Q66C 3H86A 1E1QD 1N25A 3R20A 1JR3A 5FR1A 2J0VA 1KSFX 2NO9A 3FE2A 3EA0A 1FX0B 1MABB 2JLWA 3T1OA 1II9A 1NLYA 5KDOA 1U9IC 2OLJA 5F9FA 2EW1A 2ZU0C 4W9MC 1ZC3A 2W0MA 3K0AB 3K70B 3RC3A 1E98A 1NKTA 1W4BA 1UPTA 1U8ZA 2UZ3A 3VQTA 4OK5A 4WXPA 4DCSA 4F38A 2DB3A 2JJ2D 2W83A 2ZRCA 3JVUA 1RRCA 2GXUA 1R5BA 1T8UA 4B6EA 4RCYA 1XRJA 2VL7A 4TT3D 3SR0A 1VIYA 3C15C 5KDDA 5CB6A 1KI6A 1XNJA 1ZD1A 1HQYE 2C9YA 4ZI3A 3OE7A 5BWMA 2B6HA 3SYNA 3T5GA 1Z29A 1ONBA 4YDHB 4N1AA 1G3MA 1TF2A 2J0UB 3JZAA 4LGMA 1TUIA 2LWIA 2QM7A 2WSSD 4H1VA 4YMUA 2ATVA 2N46A 2YOFA 3THWA 4B6FA 3BWDD 1XPRA 4WOPA 4XTCS 5J5CA 3WYGA 4ZIRB 4GRAA 1DTSA 2CJWB 2D7CA 2H18A 2RGNC 4LHVA 3KB2A 2CL0X 5BYKA 3U3KA 4LX0A 3AF0A 5FBRB 3KUCA 1E1RA 1W36D 1E2EA 5FPKA 2QNRA 3QXJA 3IIMA 3QNUA 2AXPA 1E2LA 1N0VC 4DDVA 1Z6YA 5FBQB 1GFIA 2ZRHA 8OHMA 2CL7X 4Q19A 4UNQA 1DS6A 5FOWA 2VSOA 3IILA 1F2TB 4HAVA 1ZW6A 1U94A 4LDJA 4R2HA 1E9DA 3X1WA 3H4MA 3VR3A 2ZSEA 1U98A 3VAAA 4KI0A 1Z63A 4IVQA 3THXA 1YR8A 4XH9B 3DM9B 2VP2A 2WJJA 1LY1A 3LQRA 4Z54A 3IKJA 1ZAKA 2DBYA 4QGGA 4XWKA 2J87A 3BS4A 2IYLD 2BM0A 4QGHA 3EPKA 2XOKD 3HP1A 4LV6A 3TBKA 3GFPA 4NCIA 4HDOB 2K5UA 4FW9A 4TMXA 3HU2A 2IXEA 3IUYA 4NCNA 3GJ5A 4Y0AA 1G7CA 1ZC4A 5EP1A 2VQSA 4YDSA 1E9AA 2PEZA 1YZNA 4OHXA 4V0NA 5B58C 3U60B 3DOFA 1E2HA 3ETLA 3Q9LA 3K0FA 4K46A 2DHRA 2VHQA 4RFSB 5JSZB 3WMEA 5DH9A 1YR9A 2EQBA 3NEYA 4R71A 4L15A 3FHOA 1QHNA 2IEZA 1KO1A 4FCTA 4LJ4A 2ZREA 1KSGA 3LX5A 4F4CA 2P67A 2XSZD 4V03A 2IS6A 1Z0IA 4HDQB 3AP2A 4F91B 1IXSB 1RFLA 1Q3HA 2R6GA 1WBDA 1GRNA 2OEPA 5J40A 4DLSA 4HUQB 3TLXA 5IT5A 5LD2C 3IEUA 1A5TA 2YHSA 3DOEA 4EFNA 4D4KA 3BH6A 2GAOA 3O8CA 1R8SA 4C0SA 1NN1A 2D4HA 4KYUA 4PC6A 4DDTA 1NIJA 3IGFA 4LC1A 3U3RA 1P2SA 5E4FA 5EE3A 3PUWA 3SQXA 4P4SB 5L3QB 3LH5A 4XVRA 2ODWA 5DHFA 2WMNB 2D3WA 4KV9A 2HYDA 1ZM7A 4R98A 3L43A 4B71A 3CIOA 1XTSA 3D8BA 3K9HA 2G1JA 4AKIA 2O8DA 2XNDD 2JLRA 5FL7A 1FW6A 5JS8A 1U0LA 3WRXC 3B7GA 4EPVA 3BH7A 4Q03A 2A5FA 4M9ZA 4C0LA 1PV4A 4XSGA 1KAGA 1EXMA 3REFA 1R8QA 4D81A 4JYBA 2P6NA 3THOA 4EKDA 4UNPA 1FTNA 2OBMA 4G5QA 3R9IA 3LLMA 1A2BA 2UZIR 3IPYA 1ZCAA 1E9RA 4A2WA 1AK2A 2WSMA 4MYUA 1KOFA 4OJQA 4Q5IA 4X8MA 1XD2B 3LVQE 1CJVC 4M22A 1EG7A 1JEEA 1TEVA 1VECA 3QPUA 4JT2A 1DVRA 4US2R 2PZFA 4TLBA 2CE2X 2QRZA 4I4LA 2GJ8A 1P9RA 1XX6A 4C0QC 3A36A 4HLUC 5JJIA 4IOLA 3U61B 1RKBA 2RGXA 1JECA 2V7QD 2X2FA 4M9SA 5JWHA 4D6PA 1ELOA 1S4QA 1Z2CA 3B9QA 1Y3AA 3QE0A 2WTUA 4M4SA 4TLEA 1M34E 1NVUQ 1WCV1 4P3YA 3A1UA 2V6IA 4GDFA 1TQDA 2O5VA 1KGDA 3KJGA 5P21A 4EJSA 3ICQB 2A5JA 3VR4A 5J4LA 1ZUIA 4JMPA 4BEBA 3J81k 1J99A 4ESVA 1LV7A 5CLLA 2R6AA 1P75A 2QSYA 3BFKA 4LBWA 4IOKA 5EE1A 3UG6A 4C2TA 2JCSA 5EP2A 2IX3A 1DAHA 3THWB 2MSEB 1QHSA 2WWIA 2ZJBA 1FQKA 2P5SA 5AJWA 5FBLB 4FWTA 1M74A 2J5XA 2RGGA 3SFVA 2FSIA 1G3QA 3K9LA 2OCAA 5JCZA 4PX9A 4I1UA 3AB3A 2CHGA 3RS4A 5L3VA 1KO5A 4LC0A 4TLDA 2P65A 2BJVA 2FU5C 2VHJA 4GMDA 2GKSA 1OH8A 2D7DA 3ADDA 2ZETA 1GAJA 2ZRFA 1FUUA 5H1YA 1KI8A 1J8YF 3EG5A 1VCMA 3H2YA 1T3HA 5KYKA 5H8WA 1P72A 4WA7A 2ZYVX 4JBWA 1KSHA 1H8HA 3CZPA 2IS2A 2O52A 4C9BA 2D74A 3IBGA 1E2IA 2VP6A 3GD7A 1BS1A 1NBME 3HDTA 2GZAA 4BRUA 4D26A 3THXB 3CB4A 1XEFA 1NMYA 2A2ZA 2AK2A 2WKQA 3ECCA 4TYYA 2ZJ5A 3DMDA 1IM2A 3VR5A 5FOUA 2P5TB 3L82B 4M21A 3B1YA 3CBQA 2Q9AA 3CPHA 4V0ME 1M7GA 3CR7A 5EUQB 1KI4A 2H5EA 3ZQJA 2IYSA 2IBMA 4NP6A 3NH9A 1TU3A 3KQNA 3AF2A 5FPHA 2QAJA 1ETUA 4AY2A 1AKYA 3Q7PA 4P4UA 3R7WB 2NO7A 4FCWA 1T3LA 2CE7A 1VCOA 3C8UA 3AQ4A 1KDPA 3MWLA 5CM9C 1P3JA 5B30A 2BMDA 3KQUA 3U6BA 3FKSA 5TVKA 2GESA 4RKFA 4XVUA 1CRPA 1I4DD 1KI1A 4TYPA 1CS4C 4OI2A 4HDCA 3K0FB 3CRVA 1JAHA 1OFIA 3KQLA 1N6LA 4M8NE 2BKUA 4HAUA 2YC4C 1G1MA 1XXHA 421PA 2O8FB 3NKVA 1KDRA 3WMGA 1E4YA 3UMRA 2UVQA 2J9RA 4LWZA 1PUIA 3PQCA 4IEIA 1CR0A 1TAGA 3C5CA 4TL8A 1OFTA 3C7KA 4ZO4A 4JLPA 2IW3A 4EUNA 4CEHA 2PEYA 4JBXA 3EIEA 1YZTA 3B1WA 3ZLJA 4B74A 2W0SA 3EWSA 4D4LA 1XD8A 4UNSA 1G19A 2FSGA 2F9LA 2A7QA 3E5HA 3QXXA 1E79D 1E2DA 2PMKA 1DO2A 2GCOB 4GBMA 4YLGA 3MJRA 3MG9A 5E3HA 5K8TA 1P9NA 3A1WA 1DAGA 3CX7A 2ONJA 5IHPA 4FIDA 2AN9A 1JPNA 4ITRC 1M1YE 4DB2A 2F6RA 2ZRPA 3IIKA 2JLZA 1NN3A 1SVSA 1TF7A 4JL6A 4LUCA 1NJFA 3PENA 5DI9A 4OQNA 5E95A 2O8DB 1UEJA 1US8A 1D9ZA 4IFEA 2BV3A 2FX3A 1IN4A 2ZVPX 2R2AA 4BFZA 2Q9CA 5IK2A 4ZDIA 1VHLA 2WHXA 4US1R 4JLDA 5CJPA 2R44A 3L0PA 4TZ0A 4AYTA 1E0AA 4DIDA 3VX4A 3MFYA 1OW3B 1AGPA 1RJ9A 2FPMA 2PH1A 3PVSA 2NQ2C 3LV8A 2AR7A 1WQ1R 2ZRKA 1G7TA 3GJXC 4S2EA 2ZITA 2FEMA 5J4KA 2R8RA 2AHOA 2CDNA 2VPPA 4X8OA 1X3SA 3DVLA 4NZYA 3EX7C 2FOLA 1H65A 4JLKA 4N3NA 1ZM3A 3T06B 2BMJA 3QPWA 5CITA 2GEDA 2Q0HA 1AS0A 2GEVA 2J46A 4Q1DA 3TMKA 4B2LA 1N6KA 1FFHA 4M9XA 3V4FA 4PZYA 1IN5A 1Z3IX 1T9HA 2QUZA 2GXSA 2NO6A 3N70A 1M8PA 4JSYA 2WIAA 1ESMA 4GFDA 2JASA 3RLFA 2W6JA 4KBGA 3RWMB 1Q1ZA 4DCTA 2EYUA 4NTZA 1XEWY 2W2TA 5KOYA 1OFHA 1SVWA 2GAAA 4C0HA 5CIWA 4PANA 3TRFA 2ZJYA 4U5XA 3QKSA 1ZD9A 3WRYC 4DJTA 5DN6D 2RHMA 1IXRC 4JYCA 2EU8A 1KNQA 1N0UA 3A4LA 4MGIR 1W5TA 1CJUC 2REBA 2BCJQ 3OFNA 2QN6A 1DPFA 3CX8A 5HCNA 1HV8A 1J8MF 2YNMA 5GJVC 4D0GA 4F4JA 4CEJA 4LJ8A 4PAMA 3THYB 3Q72A 1JJ7A 5EUMA 2V6JA 1OXSC 4OL0A 1S1MA 1KSJA 3G5UA 1NJGA 2OM2A 3W3AA 4Q1BA 3SHFA 2GK7A 1SULA 1FOEB 2BEKA 4JIMA 5EE5B 5K8IA 4PQFA 1G8FA 1N6NA 1XMJA 4C0BA 5HZHA 1QVAA 1XD9A 4A0RA 2D62A 2WKRA 2RGAA 1DADA 2ZE8A 1GNRA 3LXRA 2H1LA 2E9SA 1E1QA 1IN8A 3CRRA 3TE6A 4XJXA 4TQAA 5KSOA 1A2KC 1XBTA 4QFMA 3CF0A 3BFXA 1Z0FA 4KHZA 3RSOA 4DSNA 3PEYA 5JRJA 1WBBA 1G7RA 1QHHA 2GCPA 4AWXA 3WHKA 3X1ZA 2Q3HA 4O2LA 1FP6A 2JJ2A 1Q0UA 4A6PA 1U8AA 4GOXA 3MWJA 3I1FA 2GZHA 4QBGB 1JEDA 2QEQA 3GEEA 3UMFA 4O25A 221PA 4OBEA 3WBKA 3WP0A 2F43B 4LHZA 3KFVA 2Z4RA 4TT3A 4F93B 4E22A 2ZRLA 4QNRA 2IYRA 3KJIA 4U00A 5EQTA 1P2VA 3B60A 2R6FA 3G0HA 2MSDB 2OUKA 3RRMA 3FGNA 3R9XA 2WSSA 2Z6VA 3PIRA 2ZI7A 2DR3A 3D31A 4QHTA 4CGZA 3CUEF 1XTJA 1CULC 2XJ4A 4A15A 4TWZA 2OFWA 1MRSA 4C0JA 2ECKA 3CRW1 1RRPA 1XDBA 3LBIA 4QJ4A 1LB1B 5AWFC 3WP1B 3SQWA 1R4AA 1EGAA 3HYTA 2FN4A 3EZ7A 2YC2C 5HPYB 2WM9B 3ZZ0A 4TLCA 4DLZA 3R9WA 2QRNA 3K1JA 2DYKA 3ZVMA 1OH5A 1WXQA 2WOOA 2QTHA 2ZRMA 3R8CA 3FHCB 2RGBA 2F1JA 3UWOA 2B21A 4TSFD 3X1DA 2RCNA 4A36A 3GEHA 1Z6TA 2H8KA 1FNMA 4OKSA 1P2TA 2VP5A 3WYAA 2IT1A 4CT5A 4Q02A 1YKSA 2CHQA 2FH5B 4UJ5A 2QL6A 5FUWA 4QC2A 3RSLA 3IO3A 1XMSA 4IXNA 4DRZA 2HF9A 2HF8A 1ZIPA 5CK4A 3RABA 3U5ZB 4MKGA 3K53A 3OAAD 1Z0JA 2V8OA 3BAFA 3F5FA 3L0SA 3IBYA 4NDZA 4HAYA 4PFSA 2RGDA 5KDLA 5KPDA 2IXGA 1R5OA 4IDQA 3AVPA 4GOKA 3FDIA 4M2LA 3W8NA 1KO4A 2GDJA 5FUXA 2IK8A 2QMUA 1G6HA 2J45A 2JGNA 1OE0A 2XOKA 1AKEA 4G5RA 4MRNA 3VFDA 4DSOA 4E07A 1TX4B 2QAGB 4Q4AA 1EESA 1XPUA 2H7VA 4B73A 1D2MA 4KYIB 3BRWD 3QI2A 4QHYA 3T35A 3F8TA 4QBIA 4KFSA 1KJZA 5L3SA 4JSTA 5C2JB 3M0EA 1SQ5A 1U9IA 3ZVNA 4TLAA 1O87A 2GILA 2OSBA 2G88A 3A8TA 3B6EA 1Q12A 2WICA 1UADA 3SJAA 4P33A 4Q7MB 2BIFA 1CF4A 1ZYUA 4BFUA 1M7BA 2EFCB 3SZRA 3L8YA 1RJ9B 3AUXA 3JZMA 1KK3A 1SXJB 5DE3A 2EWWA 3PR1A 4UNRA 4EPWA 2P0EA 2XTMA 3NIBA 4HSEA 2C9OA 3HJNA 3MJHA 5BYJA 4URVR 1JXMA 5HE9A 3AM1A 3P26A 1E9FA 3SEAA 1G7SA 1FQJA 3BXZA 2VA8A 2XTZA 2XTNA 3U4QA 3OIVA 3HPQA 2W6ID 4ON9A 3W8RA 4MGZR 2C99A 1MO5A 1UM8A 4CVNA 5DNYB 3KJEA 1PJRA 2PX3A 5TMPA 2RGNA 4JLVA 4PHHA 3AF3A 4QKQA 4Q4JB 5GVSA 3U2QA 1VTKA 2VO1A 2VBCA 2Q9BA 1NI3A 1Q20A 4FMCB 4OQFA 4RY2A 1NNEA 3F3YA 2QG6A 1OSNA 4QOSA 2IYWA 1LF5A 1P7CA 5FPSA 3EW9A 5G3YA 4JVMA 4V02A 2HUPA 5BXQC 1D9XA 3F0TA 3WYFA 2WIBA 2VHUA 4WAUA 1XMIA 2RAPA 3MWYW 5GJCA 4CEJB 4PR0A 3A58B 1GZSA 3B8HA 5HZKA 3LBNA 1SZPA 3W34A 2QA5A 2TMKA 3BOSA 4TTRA 4D4JA 1IN7A 1NVWQ 1W5SA 3ADKA 2A3RA 4DHEA 4WW0A 1HY3A 1G3RA 1AQYA 4JKIA 1VG1A 2ZSBA 1TNDA 2FV8A 1GNQA 1T91A 1SHZA 3TW4A 1JALA 1IY2A 5HE8A 1GTVA 1CJTC 3LXXA 4MA4A 1T0JB 4A2QA 3FTQA 3V4RA 1DE0A 4DLYA 4ZCMA 4KSBA 3B1VA 2O8BB 1JPJA 1QHHB 2V7QA 2WBLC 3M1IA 4GP7A 1G8GA 1J70A 2UKDA 1Q57A 2ZQ5A 3AEZA 2AFIE 2OZEA 4KVGA 4KLZA 4ABYA 3ZYCA 1BMFD 2OBNA 5FOSA 1UJ2A 2V1UA 3OEED 2KBFA 1HTWA 5CYPA 1SKQA 3BBPA 3TVTA 1G20E 4NE2A 3T1QA 2OO7A 1OT3A 2G83A 1W49A 2LKCA 4AYWA 2RH5A 1RZ3A 1WF3A 1YZGA 1CR4A 1UBFA 2GK6A 2OCYC 3P1JA 4JKYA 4JZKA 3SOPA 3W6OA 3EPHA 2CK3D 1NY6A 1CR1A 3SI7A 3C5HA 2PZGA 3TQFA 1LF0A 2V1XA 3E1SA 1H8ED 2D2FA 3RS5A 1QF9A 4O0MA 1WRBA 1ZCBA 3G82C 4B47A 2OXCA 3I4LA 2ZYUX 1E96A 3FVQA 4PHGA 1XCPA 3L0OA 4B75A 2O0HA 4DSTA 2BC9A 1LW7A 4H1UA 4TL9A 3TNFA 2NMVA 1W36B 1ODFA 4GMXA 3FFBA 1HE8B 2QSZA 5G3ZA 1G4AE 3GLGE 2HXYA 3NHBA 3CRMA 4NPHA 1NBMD 3EPLA 1G17A 1R0ZA 2BDTA 1E9CA 4EQ6A 1C1YA 3ASYA 4WZ6A 1NLFA 4BLSA 4QM7A 2EFDB 1D2NA 1ZD8A 1GRQA 3U7HB 2A5GA 4A4DA 2ANCA 2ZS8A 2DY1A 2YWFA 5G40A 4POAA 4Q47A 4B3BA 1UF9A 2CLDX 2QE7D 4MYHA 2YWGA 3UATA 1TQ2A 4F7WA 1N6IA 1W4CA 4X8LA 4Q9KA 2KE5A 2QI9C 1A1VA 2P2LA 2WJIA 1NRJB 3CWZA 3NBYC 4RJLA 4HB3A 4NBSA 2W2VA 4F4IA 5JMTA 3ADBA 1Q22A 2OG2A 2QMEA 2CMKA 5H68A 5CIQA 4AKGA 1R7RA 3LAWA 2EVWX 3GEIA 1OIXA 2SHKA 2KBEA 4EIWA 3N2IA 1Z2AA 2OHFA 1KAOA 5EP3A 4AIIA 1BYIA 4JS0A 4OJKA 1B23P 2IS4A 4DLTA 4Q4AB 3FYHA 5DI3A 4D0NA 2WVJA 2EFEB 3CR8A 4HLUA 1CJKC 5L3SB 4HEJA 5CDFE 3QF4A 2I1QA 4DVGA 5K8LA 4KO8A 1MRNA 3RC8A 3IQWA 5TDHA 3LLUA 1X1RA 2ZRJA 3ZD6A 3AVOA 2W00A 1Q3TA 4R2IA 3ZJYA 2IYZA 2XB4A 3T15A 4CRWB 2F1IA 4MKIA 1BH2A 2WJVA 3A37A 3CM0A 2CLSA 4M1MA 4TMZA 4W7SA 3BB1A 3KDSE 1X8KA 2FMXA 1SXJE 3BH0A 3I92A 3Q5EA 3TR0A 2P6RA 4IDNA 4DUGD 2XAUA 5FFMA 3EZ6A 4Q7KA 3TQCA 2WWHA 4MRVA 4AYXA 5G53C 2C77A 4R9UC 1FZQA 1O3YA 3P4YA 1HE1C 4QJ5A 4QNMA 4NYMQ 2WKPA 1IHUA 5EXTA 2XB2A 3EIQA 1II0A 2X8AA 3CONA 2G1KA 2GCNA 3A4NA 4GZLA 1JB1A 3EA5A 4HATA 4M1TA 4LSGA 3GLIA 1E79A 1FL9A 3NG1A 1G8PA 3RS2A 2ZRAA 1E69A 1Q1QA 4JLOA 1N3BA 1LS6A 2EWVA 4PSKA 2G9NA 2AD5A 2JA1A 4ZI2A 4KVAA 3SNHA 1E3MA 2JEOA 4FD2A 5C46F 3AV0B 1AQUA 3T1TA 1N6HA 5JEEA 2F9MA 3GLFA 5IRCD 1KI2A 3A1SA 1P62B 2F3TA 2C04A 3TSWA 3C16C 3CH5A 2QT0A 1KHTA 2QROA 4IKEA 4P0TA 4NONA 1ZNYA 1YJ5A 2OAP1 1E2JA 4Q1CA 5FH9A 4LCBA 3CNLA 4A0FA 1TEXA 3FMPB 1NG1A 2ZI9A 3GJ8A 2IXFA 4MH0R 2NO0A 1E2NA 4UQOA 2I3BA 3N2EA 5KNDA 1Z5ZA 1W0KD 1KMHA 1EFRD 5J47A 2VIIA 3X1XA 1Q44A 2EFGA 2JIZD 3TJZA 2GJ9A 1ZU4A 3A1VA 3QJYA 1OJLA 1MO3A 5JHHB 3SN6A 4IOJA 4ZPXA 4ZV4A 3GJ7A 5JECA 1UDXA 3QUSA 3GP8A 5DISB 2VF7A 2GWHA 1Z28A 1GG2A 3QY0A 1G3UA 4EPRA 2ZRBA 1CXZA 1KI6B 4IDPA 3K9GA 4DT1A 2BEJA 3Q7QA 1F48A 4DEYA 5JJLA 3FB4A 5JS7A 1W1WA 1VYVA 1XEXA 2FA9A 2FZ4A 2NOAA 2YZ2A 4BQSA 3MWKA 4G5GA 3NH6A 2ZUDA 2DWQA 2FF7A 3VHXA 1XJQA 5DN6A 2IHBA 2ZROA 3CPEA 1IBRA 1EFTA 2WMOB 1WA5A 3HYRA 2F3RA 4LHWA 2IF2A 4NKRA 1F60A 1J2JA 3QVUA 2ZU6A 5JHGB 5LD2B 3EZFA 4BZPA 1UBCA 2ZM5A 3NC0C 2O8EA 1EWQA 1OXXK 1ZUHA 1YHNA 4LJYA 1UKYA 2A5DA 4Q01A 1M6NA 2WWXA 2JLQA 4RD4A 5CM8B 3UG7A 2FEOA 2YOHA 2YJTD 1E94E 4HZIA 1VYUA 3WNBA 4BFYA 2ZYWX 3PEVA 4FN5A 3PUVA 2VYFA 4FCVA 2C2HA 2VLIA 3ZVRA 4EQ6B 3RNLA 3U3OA 2C8VA 4UJ3A 1W7AA 1J90A 4G5OA 3I3SR 2G3YA 2BJWA 1GL9B 3KX2A 4CW7A 4HB4A 2YOGA 1JBKA 5C1BA 4BGDA 2QBYA 3D7MA 5SZHB 1E6CA 1MOZA 1DBSA 1KKLA 1N0WA 2R62A 5HTKA 1WDTA 4OI0A 3T12A 2WJGA 2OV2A 3IDQA 4B48A 3OESA 1OLOA 3TW8B 1BO6A 5EJEA 3ND9A 2ZE7A 2A30A 2DFLA 2I1VB 2ZRDA 2HEIA 1A7JA 1OB5A 4RZUA 1AS2A 1OH7A 4RZ3A 5FOVA 2L0XA 5EE9A 4A8JC 3ZD7A 3LVRE 4PTLA 4D82A 2ZI5A 4W5HA 1DG3A 3TGPA 1PLLA 2FPKA 3LRPA 3VU9A 1PLKA 1P5ZB 5C4MA 4LPSA 4TMVA 1CJMA 1TPZA 2ZSFA 5HCIA 3Q85A 3SJBA 3U3JA 2NZJA 3QBTA 1G4UR 1G64A 1TUEA 4Q1AA 3FMIA 4ZDWA 3K09C 4PC2A 3C14C 1CTQA 3H0KA 2C9CA 1XU4A 4M53A 4TSFA 4DLXA 2GBLC 5C18A 1XJCA 3K0SA 1LNZA 1S1CA 1ANKA 1FMLA 1X1SA 1NF3A 2AK3A 3CO5A 3LDAA 4L8GA 1XPOA 1PVOA 2YWHA 3M6AA 1NKSA 3C4JA 4AC9A 2IS1A 4C30A 5LB2A 1XTKA 1L8QA 1QDEA 1G291 1S2MA 1TU4A 2QP4A 3GJ6A 3GLHA 4OK3A 3VMFA 3K8YA 3SYLA 2PT7A 3LFUA 3OAAA 4B2PA 1VHTA 2BBTA 3CKLA 2X1VA 4AG5A 2C03A 2D2EA 1RW4A 1K5GA 2O8CA 4EFLA 4NMMA 4DXAA 1DOAA 2LKDA 2FG5A 4C7OA 5KO2A 4QBFA 4LY6A 3GLFB 3DZ8A 5KHOC 2ZJAA 5M04A 4KODA 4BASA 1W44A 4B3CA 5F98A 3U44A 3WNCA 1ZJ6A 2GVDC 2J1LA 5FUVA 2NZ8A 1W4AA 1JR3E 3D6TB 4NL4H 4QBHA 2ONKA 1QZXA 3OF5A 3AKDA 4S35A 5DSZA 4PQRA 4MDEA 2Q21A 5AJXA 2KWIA 1LTQA 3CNOA 4B33A 1DEKA 4BLTA 4TL7A 1S8FA 2QZ4A 3KJHA 1U2RA 2DPXA 4DCUA 1R10A 4BEJA 1PUJA 2ODEA 2PBRA 5CB8A 1P73A 4PC7A 2FWRA 4CEIA 5KPJA 4DIEA 3I5XA 4C2UA 4MQBA 4M9QA 4O2RA 3QQ5A 4DWJA 4EJSB 5EE0A 1BYUA 3SBEA 2WPDA 1X8JA 2YVUA 3SE0A 2W6IA 4MRRA 5AUPB 3NXSA 1M7HA 1R2QA 1X6VA 2EYQA 4BLPA 2DWOA 4DT1B 5GJBA 3NC1C 5SZIA 1W46A 4DEXA 2IL1A 2ZRGA 1N5IA 1IONA 5KUTA 1G3IA 1J7KA 3SDZA 4TL6A 2GF0A 4LZZA 2KB0A 5BQ5A 3RWOA 2ZUBA 2HJGA 1G5RA 3I73A 3FOZA 4GSYA 1OYYA 4Q4HA 4BFXA 4YXWD 1DAMA 2QPOA 1Z07A 1C9KA 4LHYA 2QY9A 1GM5A 3FWYA 3B9PA 3PCRB 3KQKA 1GWNA 2XXAA 1SVKA 4CZ2A 1JR6A 1KJYA 2FJUA 2WOJA 1E2MA 1YU9A 4KFUA 4MYCA 4L9WA 4MYTA 1Z0DA 1P2UA 2QM8A 3AVUA 3OIWA 2QAGC 1W47A 2BCGY 2PT5A 2ZR9A 5DO9A 3AVXA 4UKDA 2KSQA 2AX4A 2QPAA 3HR8A 3IHLA 3LY5A 2HJVA 1RE0A 3PG5A 4JL5A 1CKEA 2ZPTX 2O8EB 1E0KA 4L16A 2PLRA 1OYWA 3VR1A 1NSTA 3SC3A 3KFXA 1P9WA 4QGAA 4Q7LA 3AKYA 4Q48A 3AVQA 3BERA 4BFSA 2C96A 6Q21A 4Q9JA 1ZM2A 3NBXX 5TV2A 3CZQA 1W0JD 1TL7C 3VHLB 1G18A 1VCIA 1SXJC 3M4YA 2H92A 4K8OA 4IHQA 5UKDA 1ZNWA 1IJEA 2QP3A 1I4LD 2ODNA 2JLXA 2DCUA 1KY3A 1YZKA 1AZTA 2ZANA 4XSHA 5CK5A 2F1RA 3QIAA 1HEIA 3T61A 1BMFA 3OEEA 2JDID 1YR7A 3DZDA 2ORVA 2QBYB 3UMSA 2ZYTX 2C78A 3CPJB 5E7IA 2BWJA 1TQ6A 5JFGA 1NP6A 3E2IA 4NCJA 4DB4A 2FZLA 5JWRA 4FMDF 2FFQA 2CK3A 1BKDR 4OK6A 2HT1A 4WVFA 1VDZA 4PO9A 1H8EA 1JXOA 4BPBA 1YRAA 4Q00A 4M1OA 4QRHA 4TMTA 3TH5A 4LBZA 1S3GA 1E99A 4NYIQ 2GRJA 1XXHB 3RS7A 1KNXA 2VP4A 3K0EA 4LJ7A 5GADl 5CLQA 3BJIC 3O47A 4XD7D 5HKKD 4CDGA 2PCLA 4RVCA 1K5DA 1HH4A 2NIPA 1QHXA 4CEHB 2Q3FA 3HWSA 1UKZA 4KAXA 4ZKDA 4CIDA 4LYAA 1HYQA 5J4YA 2G77B 2WAXA 4NYMR 4JJZA 3LNCA 2GXAA 3IEVA 3MCAA 3IHWA 1NBMA 2PLFA 1Q1EA 1NY5A 4LYFA 4A0HA 4N0DA 4YONB 3AGPA 4IW3B 2QMOA 4G3XA 1P60A 3K70C 4GT1A 2C5LA 2C95A 3WNDA 3BFVA 3ZS8A 2R9VA 1ZRHA 4G5SA 4ACAA 5BN4A 621PA 3MAAC 3Q8XB 5DGXA 1OXTA 2OLKA 1W4RA 4HAXA 4OHVA 2XZOA 1KIMA 3UKDA 3AKCA 1Z06A 2QE7A 3GLHB 1OB2A 2CCKA 2QQ0A 5A4JA 1E0SA 3OIYA 2HLDD 4I81A 4NYJQ 3TIFA 2GZDA 2YV5A 2XJ9A 3PJRA 3CX6A 1US8B 3KXKA 1X86B 4UXJA 3QKUA 2EFHB 4PC1A 3W3ZB 4D2IA 3VNUA 3P32A 1T3SA 2IHYA 2ZR0A 4B32A 3QXSA 4EAQA 1AZSC 3O8RA 1K6MA 1XTQA 1U0JA 1EK0A 1UKEA 4OQXA 3U7GA 3CH4B 3W6NA 4JLAA 3GLFE 3ICEA 4RFSA 4OQMA 3TUJC 1UBGA 4A6XA 3DKPA 4AURA 1RYHA 4DDWA 2XSZA 2DFKB 3X2SA 4KBFA 1SXJD 1PLJA 4RD1A 3U44B 1Q1BA 2IWHA 1GL6A 2VP9A 2YKGA 4ZDKA 2XITA 1OFUX 4LBVA 2FDCA 4QJ3A 4RFVA 4ASUD 5JLJA 1D6JA 4HZUA 4CF7A 3EAQA 3GJ0A 4BECA 1F3OA 4KCGA 4JLJA 4KXFB 1XTRA 4X8HA 5CJ2A 2ZIAA 4I1SA 4DUGA 5B64A 3WXMA 5AJZA 5FBVB 1KK2A 4Q7JB 4YQFA 1GKIA 2WJYA 1DAFA 2A5YB 2ATXA 2GJSA 3OEHD 4HB0A 4E03A 4YMWA 1VCNA 3L8ZA 3QKSB 2XNDA 2N42A 2VHTA 2E87A 5DHAA 4RD6A 2AL7A 5AUNB 5GVRA 5KSYA 4MGKR 2GNOA 2QP9X 1T8TA 1ESNA 2GA8A 1F5NA 3HU1A 3A4MA 5JCPA 2YWEA 1S96A 5JI3E 4D80A 2CNWD 1N5JA 2B7BA 4I1OA 3RANA 4AKEA 1VG9B 3B78A 4Q4HB 2FPLA 2QT1A 3HR7A 4AKHA 2ODBA 2AWNA 2Z4SA 1SVIA 2OILA 1IY1A 2KI5A 3I72A 3IPXA 2OFXA 1CIPA 1EFCA 3NTUA 4MITA 1NVVQ 2GF9A 2AD1A 2XXAB 3K70D 1KDTA 2Z0MA 3PXGA 5KNBA 2J0SA 4XVQA 4QGFA 2ZJ2A 2BVNA 3MLEA 4TMKA 5FI0B 2RGCA 1XWIA 4NHOA 4Q1FA 2XZLA 3UXMA 1VPLA 1W48A 1XF9A 3QOFA 5G41A 5TB5A 2Z43A 3TR5A 1W0KA 4BWYA 2F55A 4ZCIA 2H57A 1EFRA 1UBEA 3U7EB 3MRSA 3ZIAD 2AXNA 1WE2A 2JIZA 2J41A 4PO8A 4AI6A 3BGWA 3VNVA 1RVDA 2W2XA 4URYR 5J4VA 2NPFA 2IYYA 5ELXA 4UXHA 4EPXA 3WY9A 2ZI6A 2QU8A 2ZS7A 5F3WB 2QORA 3AVWA 1TTTA 1F2UA 3EZ9A 1GILA 1KDOA 1QHGA 5EZ5A 5FTKA 4ZDJA 5JJKA 1UDWA 5EXSA 4JJKA 1G8HA 4PHFA 5BN5A 2FGKA 1HUQA 1XB2A 3HU3A 5LBIA 4Z1MD 2CHVA 3K0CC 3B5JA 1T4GA 5AJVB 5FOXA 4IEEA 4LJAA 2ZE5A 3U3MA 5FI1B 1EX7A 4XWAA 3GFTA 1AJEA 2MSCB 2VSXA 5GJWC 5B57C 2HCBA 2NO1A 3RS3A 2GJAA 3BORA 5D3MA 2YINC 3O8DA 1SVLA 1OHHD 4LK2A 1S3SA 4LPKA 1COWD 1ZIOA 4P4TA 4B34A 1CBUA 2XGJA 1L4YA 1U81A 2GXQA 2OAQ1 1XXHE 4ERNA 1OH6A 3GJ4A 2B7CA 4MRSA 1RYFA 3BK7A 4Q4LA 5LDDC 4RSGA 5H70A 2IWRA 5K8UA 1QVRA 4E5UA 4Q18A 2B92A 1QRAA 4LHXA 4URUR 4M0LA 3EC1A 4DLWA 1ZVQA 3B1XA 1LS1A 1OKKD 2N1BA 3QEOA 3KKPA 5E7JA 3V9PA 1FPMA 3T1VA 4RKEA 3KKMA 2VHCA 4TMWA 1N5LA 4IDHA 3AKEA 3RVBA 821PA 4J0QA 4URWR 3SJCA 1QHIA 3QXCA 721PA 3FFAA 3AH8A 3ZH9B 1IJFA 2RKOA 2IYXA 2R65A 2VH5R 1SKYB 1CEEA 4DCNA 4G1UC 4BFTA 2G6BA 3GLHE 3OHMA 4KFRA 1L2TA 4RZXA 3R8FA 5FPTA 4H9GA 3VR6A 1E2KA 4BE7B 1VYTA 3R7WA 4YC7A 2JLVA 1AM4D 3PEUA 2B8WA 4IOMA 3JVVA 2G0NA 3PUXA 3ZDQA 3KTAA 3WBJA 2Q6TA 1KZ7B 2FFAA 2FFBA 1ZBDA 2JJ8A 4US0R 4GI7A 1IXZA 1RIFA 4PXAA 4QXAA 4NU0A 3GJ3A 4HAZA 4N0EA 4XOIA 2O8FA 3FMFA 3TUZC 1Z8FA 3ASZA 3B82A 3SBDA 4IRUB 2IA5A 4D4MA 4ACBA 1Z6XA 1OPXA 2R6DA 1Z47A 4A1FA 2QMHA 1DO0A 4HZUB 2PJRA 2WAYA 1IQPA 1OV4A 1D8TA 4L4UA 4JVNA 1NL3A 2JJ1D 3U4QB 4DBLC 2ZAMA 2JLSA 4QG7A 3H84A 2QTVB 5KSPA 2J7PD 1OIVA 3A6PC 1YZQA 1SVMA 5TXGA 1G5TA 2GCOA 2J59A 3I5YA 5AK0A 1GSIA 1N2CE 2IUUA 4A9AA 4LOAA 1W2HA 1OXVA 1SHKA 1KY2A 3QKRA 2IYUA 1MO4A 3KKQA 4OQLA 4RZ2A 4DLRA 1KK1A 1JJVA 5JWOA 1A82A 1KK0A 2IEYA 4Q9HA 4PQYA 3NBFA 1B0UA 4MGYR 4TYWA 3EC2A 2CL6X 1WP9A 2VEDA 4B2IA 3ZS9A 4KU4A 5KTYA 1DAIA 3FPAA 3U7FB 1KTVA 5AUQA 3PV0A 1JR3D 3SS8A 3MMPA 4IVRA 4EFMA 3VX3A 2CXXA 3MUFA 1KKMA 2A78A 1V43A 2BM1A 2G0TA 121PA 3O8BA 3I32A 2IYVA 5A0FA 2GHIA 4C4PA 5DLQC 4DLUA 2RHDA 4CT4B 5LPNA 4GOJA 1YZUA 4C3ZA 2P3SA 1XCGB 4MRPA 3CW2A 4MUAA 3KB1A 4CYMA 3W5JA 1F6BA 1GRRA 1C4OA 2F1HA 2VP0A 3LW7A 4V0KA 5BW8A 3AVTA 1P61B 1NN5A 1QHYA 3I61A 2FSHA 3OE7D 2VSFA 3KXLA 3TSZA 5HR5A 3ADCA 2WWYA 4HLQB 2FFHA 1XP8A 3QF7A 4JL8A 2J3EA 2DFNA 2B8TA 1DARA 2GETA 4W5JA 2FNAA 2ORWA 1N6PA 1EX6A 1R6BX 3QEJA 1NIPA 4NCHA 1F2UB 2XNSA 4A8JA 3AF4A 4WBSA 3RHFA 5SZJA 5C4GB 4M1KA 2V9PA 1NG9A 4TZ6A 4WXRA 3RDPA 1E1RD 1ZUNB 1DELA 2X2EA 3L2OB 3REGA 4JLMA 3THYA 1EFUA 1U8YA 1ZMXA 1ZP6A 1OF1A 2BOVA 1DAKA 3WHLA 2ASEA 3EIHA 1VMAA 3B1ZA 4YXWA 4NYIR 3AP1A 3K09A 1AIPA 5EZ6B 3LX8A 3NBZC 5B2ZA 2V3CC 1FP7A 2GBLA 5D3MB 3KKOA 1R0XA 3TAUA 4JVLA 5FOTA 4KITB 1NMXA 2O0JA 3X1YA 3CNNA 3LQQA 4M1WA 4B3DA 1XJ0A 1YR6A 4KSCA 2FE4A 1QG2A 1N5KA 2GJKA 4EPTA 3BIFA 5J4HA 2RB4A 2YYZA 4B3XA 1GL7A 4HB2A 5LB4A 4TYNA 1FTSA 3CF2A 3RAPR 2ZI4A 4OHZA 3RYTC 1GNPA 4PSAA 2MMCA 3VKGA 5KNCA 1RPZA 4GZMA 1D2EA 1Z0KA 5FR2A 1YE8A 2IYTA 2ZI3A 4W5WA 5F2EA 4E09A 2IC5A 4B76A 1LVGA 1W0JA 1XFAA 4IDOA 3ZGXA 2F43A 4ARZA 2H16A 4NYJR 3FMOB 4WZAE 1AA9A 1G16A 1QG4A 4DDUA 4QL3A 2NG1A 3DDCA 1T5LA 1FNNA 1SKYE 2DWPA 4HYYA 1GIAA 5IF9A 4RD3A 2W58A 3W5IA 1HT2E 2KJQA 4EJSC 2D06A 4B3GA 5DI3B 1GP2A 1T5IA 2JDIA 4GP6A 3TSOA 2CEAA 1G6OA 5L3RA 4HLCA 1N6RA 2CCJA 3KTAB 3QF4B 3KL4A 4PZLA 2OCPA 1YZLA 1P4SA 1RRGA 4GPTA 4M1SA 2A9KA 3BB3A 3GQBA 2AKAB 2BKEA 1XMVA 1ZINA 2REOA 4A2PA 4D0LB 2OFOA 2Y8EA 3CRQA 1E9SA 2CVHA 2QENA 4XTRA 2HT6A 1UFQA 1T0HB 3QKTA 1AN0A 2VRWA 4DZZA 1ZM4A 3GLGA 1TF5A 2QTFA 1XZPA 2Z83A 4XD7A 2GEUA 5HKKA 3CWQA 2PCJA 1G8YA 2BMFA 3QVVA 4WIAA 3AP3A 3NDBB 1U90A 4PPQA 5D3QA 4IXMA 4AK9A 1EFHA 3GPLA 3IQXA 4GNKA 1MKYA 2OESA 3ZZUA 3GLIB 3S1AA 4UNNA 4KLNA 2GTPA 1II8A 4TN1A 1IY0A 5FL7D 3EASA 4RD2A 3BD9A 4PO1A 2VTKA 3SJZA 5EXPA 3DEFA 3ONWA 5FUYA 3UK6A 5AUOB 3B13B 1JQLB 3QKRB 4URZR 1GITA 5FL3A 1ZM9A 1VG8A 3U6KA 1KI9A 2QAGA 4Q1EA 3DL0A 3PITA 1NVXQ 3GFOA 2HLDA 2QPTA 3QXHA 4XIGS 3C41J 4PHTA 1NLZA 3B85A 4I99A 4TYQA 5L8VA 1DG1G 4LYJA 2AFHE 3K9NA 3EPJA 4D25A 4LYHA 3RRYA 1NVVR 5CDFA 3L0IB 3I62A 2BBOA 4BUJA 2ZJZA 1MV5A 4MKFA 4WZBE 3LD9A 1T6NA 4L9SA 1KMHB 2WWGA 3ZQ6A 1S9HA 2PZEA 5JI2E 3TAHA 3EWAA 3LO5A 1SXJA 3MSXA 4IVPA 4PC3A 4TTPA 3KQHA 3UPUA 3VKHA 2ZRNA 5JZVA 2GVZC 4LJ5A 1TMKA 3LWNA 1E32A 4ASUA 2ZS9A 1HURA 1HT1E 3Q3JB 4PPNA 4BZQA 4PAQA 2WWWA 2ZVQX 4FI3C 2WWFA 4BLQA 5JRZA 4NH0A 5FTJA 4OHWA 4BZXA 1MR3F 3KXIA 1GKYA 2H17A 2HCJB 4L5BA 3UANA 3P27A 4C0KA 2ZEJA 4KJZA 5EXXA 4V0LA 1NMZA 4BFVA 2V54A 2XX3A 1XEXB 3PUYA 3QPVA 2LCFA 3OEHA 1WB9A 4B3FX 4HI0E 3PEWA 4LBYA 4Q4JA 5FTMA 3AVYA 3GCGA 3DKVA 2I4IA 1Z08A 4TTQA 2REXB 5E7MA 4A92A 4F92B 4A8JB 1R0WA 2HXSA 4R7ZA 2PL3A 1SGWA 4FWIB 3DM5A 2JLYA 4U7DA 2JLUA 1Z6GA 3QG1A 4HUTA 1UAAA 1BOFA 3P4XA 3NWJA 4BFWA 3NEJA 4DCVA 1E2FA 3BB4A 4HAWA 1Y63A 2CNWA 4OHYA 4MUBA 3V00A 1V5WA 4BRWA 1FX0A 5CYOA 1MABA 2IUTA 4DC9A 4YMSA 4JLNA 4EPYA 2ZTSA 4P32A 4LJ9A 5DYGA 2OCBA 4FINA 3MGCA 1U99A 1E9EA 1E2QA 2PMDA 1JI0A 3K0AA 1G21E 2ZE6A 4TQ9A 2R6CA 1H8HD 2NGRA 3KZ1E 3TUIC 1OXUA 3AGQA 1L4UA 3PFIA 3VKWA 4URXR 3DPUA 4KFTA 3SHWA 1YVDA 3QG5A 2FSFA 4IJMA 4M1YA 4NCKA 5FTLA 1VKJA 2CLCX 1AGRA 2IUSA 3KKNA 4LV8B 4OI4A 2ERXA 3CLVA 1KO8A 4Y0VA 5KSZA 4TQUS 2CBZA 3CF6R 3KUDA 3ZIAA 1N6OA 3W6PA 2ZRIA 2O8BA 4BLRA 2J7KA 4IFBA 4RCZA 5KU1A 1Q21A 1XCMA 4A82A 1E2PA 2J0UA 2MMGA 4QM6A 4AD8A 1FMJA 2ANBA 5A5GA 2NPIA 1CR2A 1E9BA 1HA3A 4B43A 1JQJC 4QHSA 2O0KA 3GMTA 4ZIRA 3FKQA 4RD0A 4ARZB 4U02A 5JEDA 4MDFA 1IAQA 1KZGB 2QGNA 2CJWA 3FKSD 3HPRA 4FXPA 4LJ6A 1HQCA 1AS3A 1CLUA 3UIEA 2JATA 1KI7A 5FTNA 3IIJA 2HYIC 1XTIA 1UKVY 4LRWA 3DO6A 3UWKA 1S0UA 2WJHA 2CVFA 2DFTA 3WMFA 4Z1MA 2RGEA 1VIAA 1MT0A 3LA6A 4JLBA 5EP4A 1CP2A 2ZAOA 3AF1A 1YQTA 4BLOA 5TY0A 4JT4A 1QBKC 4PZZA 2WZQA 4JBYA 3RRNA 1GDDA 4P31A 5SZKB 3VU9B 2ERYA 3EXAA 4YMVA 2ZXUA 3BC1A 2ZSAA 1Z22A 1ZNZA 2X19A 1U0HC 1F2TA 2NTYC 3IO5A 1ZU5A 4OYHA 4PPFA 1OHHA 1UEIA 4V0OA 3EZ2A 3H1TA 1COWA 4ZKEA 2PX0A 2HDNB 2ZR7A 4Q9LA 5BN3A 3BE4A 2OT3B 1A4RA
chains in the Genus database with same CATH superfamily
2WF7A 1M2OB 2C98A 3PXEA 2HZ7A 1P4HA 3BZWA 3LC0A 3S70A 5IVPA 3K6SB 4DA9A 4NCBA 3VHQA 1FVOA 3I2IA 2XRFA 1R4MA 3DBHB 4MW0A 1SOAA 4MKHA 2EX1A 1CR6A 1HL7A 4PNPA 5AM3A 4UTNA 4ZXPA 1TMOA 1Y1PA 3K15A 1KMQA 1CUAA 2XVZA 1RU3A 3OWXA 5JSQA 4K9DA 1PZNA 3CLUC 1R4NA 1EVJA 1WP4A 1NOJA 2DQSA 2XZPA 3O8QA 4M38A 3SFTA 3TL3A 3WIDA 3OU7A 3L8CA 2VJPA 1TQ4A 2PGLA 3PRYA 2J0QA 2D3TA 3TBHA 1RWVA 1OIWA 1AKMA 2PJZA 5AR1A 3MQFA 1POWA 2FK8A 4L95C 5KWVA 1ZD2P 4QASA 2O8CB 5IDQA 4EECA 5JSZA 4NENA 5A62A 4LK3A 1PJ2A 4ME6A 2FG7C 2VG8A 3WGUA 4C2AA 2DRIA 2OPHA 3RROA 3HHPA 1PJLA 4K81B 4N6GA 1SRQA 4BGIA 1X1CA 3A9TA 3VR0A 3DMRA 4A03A 3A1EA 1I2DA 1GUYA 3NVAA 4B46A 2P1DA 3RTCA 1UJCA 1BJKA 1X80A 2SKDA 3WLFA 3T1YB 1ESCA 1P6XA 3G5LA 3HKBA 2Z5FA 3I23A 2JJMA 1M1XB 4ID3A 3QEMB 1L3IA 3WMXA 3W90A 4QOHA 3LG2A 1CX9B 1E2GA 1GPWB 2QG4A 3DZHA 5AI0A 3ZE8A 3E2MA 4DKXA 3QSYA 1Q1AA 2BGUA 1DEAA 1W2GA 4YJ2A 1MH1A 3L7OA 3RVRA 1A0OA 1LPMA 2B1GA 1FUKA 3MW8A 5AKXA 3UQYS 3HXQA 1RZUA 4Q9IA 1W36C 2HMAA 5CLFA 2W6JD 3NHAA 3PNVA 4P4SA 4JI4B 3PGXA 3RVNA 3OKAA 1UMBB 2JIRA 2WFZA 3Q5DA 3TIXB 2V55B 4O3MA 1M1YA 5EWMB 3MJCA 3ZZTA 1Z4JA 1GAXA 3GC6A 3RYFB 2JJ1A 5K3FA 1DAEA 9LDBA 1ACLA 3MIZA 4J2HA 3DDOA 2C3MA 4RIGA 1ZD5A 4H7DA 2WPDD 4KTVE 4KO3S 3T9AA 2ZSDA 3IS3A 2C8LA 3EIWA 1R64A 2CZGA 4HRAA 3DLTA 2H9AA 1VPVA 4EUKA 5LQKA 2UYCA 1YJAA 4PZUA 2Q3MA 1XEWX 4MOWA 1A3CA 1YJBA 1IN6A 3ID6C 2J07A 5F3DA 1U3DA 5DBFA 4MTLA 2YRFA 1L4LA 2RAVA 2F8LA 4C0AC 4MW4A 2NNLD 3HVIA 3EE6A 3FPLA 2AWOA 3W3AD 1L7VC 4YJFB 3COVA 1FCJA 1XKQA 1Y82A 4Z9BA 5DYIA 3I8XA 3QU5A 2DOKA 2QYSA 2JAQA 2Y2VA 2CV2A 4EJ0A 2XUDA 2QN1A 1H1LB 4XQ9A 3T4EA 2YVKA 3QHAA 1WO8A 4MLPA 1X92A 2BDUA 3JD3A 1XD2A 2WNSA 1GN9A 4G65A 3AB8A 4OSOA 3ZVLA 3TIIA 3V80A 2CJFA 1NLMA 4EMUA 5LQNA 1OBFO 3R20A 1OXKB 2B0CA 3KT8A 5FR1A 1L5YA 2VDUE 2ZQYA 4MQEB 1MABB 1XROA 2ASVA 4UPDA 2BM9A 3UA3A 3VZSA 1CUHA 3DO8A 4I4IA 1U9IC 4J3NA 1EYZA 2A1IA 5ARDA 4W9MC 3NGXA 1W88A 1YA4A 4WY8A 1O96A 1YBAA 3ILXA 1E5TA 4IGFA 3O1JC 1W85A 1U8ZA 4NS4A 2BHTA 4REMA 1E92A 5KJ1A 3G2KA 2FYTA 2GZ2A 1TM3E 3RT7A 4ZCRA 1P1HA 1V16B 3A7EA 3EMKA 4PLCA 3SQNA 3V4PB 2ZRCA 3A0UA 3IAM1 3ILYA 1YBVA 1M34B 1V35A 3ANTA 3PNSA 4I9GA 1R5BA 1PWZA 5HS6A 1BEUB 4EHIA 5B4VA 2WM3A 3PD1A 4LF6B 2Q99A 4ALKA 4MVYA 4KPYA 3A11A 1FYXA 4TT3D 3SR0A 3HCOA 5FKJA 4B7XA 4E0BA 3OOWA 1KI6A 1XNJA 3AXTA 2VUSA 1ZD1A 1HQYE 3CEHA 3W2HA 2Q5FA 3OE7A 5B7GA 5BWMA 2C97A 4WNAB 2XGJA 2PO5A 3FNRA 3VSDA 3ZDDA 1G3MA 1TF2A 2E3JA 2J0UB 3JZAA 3UUWA 2NW6A 2QM7A 1NWCA 2H1IA 4GIBA 4RFLA 5LMZA 4G1FA 4NMXB 3ABOB 3AR6A 5BMVF 2YS7A 5FWYB 3CKYA 1XQXA 5AI9A 4YRTA 1ADGA 5J5CA 3SR4A 3UQZA 3VR4H 3WYGA 4GRAA 4ATNA 3EB9A 4DA8A 2NP6A 1DTSA 2RGNC 1SQGA 3DOIA 3KB2A 4F2PA 1W87A 4EX7A 2CL0X 2EW8A 5BYKA 3U3DA 3U3KA 1EGQA 3AF0A 4PQEA 1JPVA 4OB6A 5AVXA 2HQ1A 2H7CA 3S8MA 1E2EA 2JFWA 1K88A 4XDHA 4MUEA 1X1AA 4JMLA 3PQEA 2R96A 1BE0A 4BBJA 1Z6YA 2BI4A 3ED1A 2AOUA 4Y6GB 1REQA 5K0EA 4R2XA 3QNWA 4O4HB 1GFIA 3VJKA 5B5SA 2ZRHA 8OHMA 2BGMA 2CL7X 4Y6PA 3R5TA 1YOVA 3REQA 4MV5A 2VSOA 2I2FA 2OGUA 3NBKA 4LDJA 2UYOA 4NOLA 2X4GA 3E6AA 3Q9UA 3WRWA 3VAAA 2YDYA 1SJ9A 2ZUWA 4KI0A 1B41A 4R1QA 3ILHA 1RI2A 3THXA 3O0DA 4LRQA 4BMNA 4BO4A 2WUDA 2PTHA 1LY1A 4Z54A 2FZWA 3V1NA 2DBYA 3OC6A 4MROA 4MYCA 2IYLD 3Q9NA 1KQOA 2XOKD 3HP1A 3GFBA 4IYJA 4W99A 3T3OA 4ZOCA 2IY9A 3H1BA 5HFJA 5GIOE 4HGQA 4N82A 3WK6A 4M1QA 1KR5A 1DIGA 3X1MA 5FQOA 2IXEA 2KMLA 2PFSA 4WECA 2IIVA 1UKBA 3O8QB 3VR5H 4DHWA 2EEPA 1ZC4A 4BX2A 3JQ6A 1QKIA 1VHDA 2NVUA 1E9AA 1O7JA 1E4EA 2PEZA 1MXFA 3WLHA 4LXIA 2PKCA 3CTMA 3U60B 4H0CA 3HHEA 3E15A 3ETLA 3Q9LA 4L08A 5IN4A 2C29D 2FR8C 5JSZB 4NENB 4LTDA 1I13A 3RIMA 3Q10A 1P33A 2JGAA 4R71A 4PLFA 2OXTA 2BI7A 1QHNA 3EDRA 3R4VA 3S2IA 3HLYA 1KO1A 3H04A 4KQWA 1H2WA 1XMPA 2ZREA 3BJEA 2PJDA 1ZHHA 1KSGA 3TKAA 4MQ4A 4C5AA 1OGJA 5ALJA 1QRTA 3G2OA 3AP2A 3CUWA 1T5OA 1TQHA 1WAMA 2R6GA 1HSZA 1EJ0A 3TLXA 2NXJA 4GUAA 3IEUA 1T6BY 4UZSA 4EFNA 4P38A 1HQDA 3LQFA 4MV7A 4F60A 2XAAA 4TX1A 4YJ2B 4BL5A 3R3ZA 4K0RA 4V38A 3CRNA 5JS1A 1NN1A 3P0HA 4BNUA 4DDTA 3PPVA 2JI6A 4O0LA 5EE3A 3PUWA 4P4SB 5LMCA 2PQ6A 1DDGA 1XJWA 2DWCA 3WNVA 4DTIA 3NPMA 4XVRA 3AF5A 1N4AA 4PYKA 1M1YB 1N1DA 1RKVA 2D3WA 4KV9A 4ERXA 5HKBA 5IUJC 1ZM7A 3QVGA 5K3FB 3DF7A 1JSZA 1XTSA 1U7TA 2ZP1A 4AKIA 1B4DA 2L2QA 4RANA 2P9EA 1U7ZA 2ZJFA 1LD3A 3M3PA 4MUNA 3WRXC 2I4OA 4UVGA 4EPVA 3H3FA 5A9RA 5KYWA 2A6PA 4M9ZA 1PV4A 2ZZNA 3E7DA 4OREX 3S55A 1MFPA 4PW0A 2ZUFA 3ETEA 1Y7IA 2IYFA 1QIHA 5HGXA 3PC3A 3THOA 3EVAA 1XN4A 3PUJA 2J3MA 4HLNA 3ETNA 1A4UA 3DTVD 4UNPA 4X9XA 4OUDA 3LLMA 4H0FA 4R84A 1CUUA 5F7OA 1JFSA 4Y2GA 4ZEWA 5H3HA 1E9RA 3AY3A 3L5KA 3EZLA 2WSMA 4MYUA 2FUKA 1CZUA 1KOFA 1VLJA 2YXEA 4QD3A 1XD2B 4X8MA 4ARAA 3KHUA 3SS9X 3TW0A 3RG2A 3HMKA 5HDBB 3LGAA 1JEEA 4A26A 3ND7A 1VECA 4ND8A 4CQMB 1KFJB 4US2R 4TLBA 2CE2X 4MR9A 4C0QC 1P9RA 1XX6A 4MDHA 3A36A 2OWDA 3TB4A 1QH8A 3LYLA 1Z6ZA 3KOWA 3QXGA 3FMVA 2RIRA 3SQOA 2AYXA 4OQYA 1XDWA 1RKBA 3CJQA 4RPLA 3VV2A 1R66A 2X2FA 1W88B 4M9SA 4MV4A 1O96B 1T2DA 2NZUG 3B36A 3N2ZB 4P3PA 4WDRA 4CTNA 1W85B 4EHFA 1ZQ9A 3GEGA 3B9QA 4BKUA 1V96A 1J06A 4R0VA 3KVRA 1M34E 1OFVA 1ZCJA 3MGGA 4P3YA 5BR4A 1RWNA 2X0IA 2V6IA 4CIYA 1TQDA 4E31A 5I5GA 1SCAA 1U3GA 2QRVA 2RC5A 3QE2A 3I6IA 3ICQB 3PA6A 3UUGA 4MI6A 5IBCA 4G4SP 3OZDA 4ESVA 5CLLA 4ALNA 3C6BA 3NWOA 4RESA 2QSYA 3PT5A 3Q3IA 4C7KA 2CC2A 2FLVA 3M6FA 3MF4A 5L7TA 5EE1A 1O5OA 3UG6A 1B16A 5DTMA 1LLUA 1LPOA 1TJNA 2JCSA 1YACA 2BFMA 5L51A 1ZWKA 4LQCA 5BR7A 1XQ6A 3B1JA 2XGSA 2X13A 1DAHA 3R77A 5THXA 4NXNB 4QXRA 5AOCA 2CJXA 4FFPA 3SKYA 2VZLA 4E15A 5AJWA 1LC0A 4IVNA 4YT8A 3QK7A 5KJFA 5CYFA 1M74A 5DBGA 2J5XA 1YBFA 2CXSA 3GDOA 4P93A 4B31A 2FSIA 1SUSA 3T7SA 4RETA 3ZX5A 3HXMA 1P8AA 2E82A 1IEXA 4O4JB 5TMDA 2FWBA 3TCKA 3NOOA 5BV8A 3ZGZA 3NDJA 4WACA 4H1TA 3D02A 1EUDA 3RTAA 4BU0A 3AB3A 1U7DA 4PX3A 5L3VA 5LQAA 2JHFA 3W3AH 5KB3A 3OZBA 3WWEA 2GKSA 3DKIA 2E4WA 2D7DA 1NJ1A 3TLEA 2ZETA 1L4KA 4G4IA 3RYIA 3T5CA 1CRWG 1GAJA 2AOUB 3JQBA 4UPVA 1TJYA 5H1YA 5FUMA 2GEKA 3HWWA 4KRFA 2JI9A 1VGRA 3H2YA 4KOAA 5JSUA 5H16A 1KOJA 4BMZA 3RBXA 1YOVB 3REQB 1P72A 4DGSA 4F3NA 4W5NA 1CETA 4WKNA 2ZUSA 1Y5IA 2HREA 3OE1A 3EPPA 4OSEA 1AX9A 3CZPA 4PZCA 2D74A 1E2IA 2AQIA 2ZT7A 3GD7A 1PQYA 3I01M 1P2FA 3HDTA 1W581 2GZAA 3EEQA 4BRUA 4G41A 3CB2A 3THXB 4FYVA 5AJHA 4TGLA 1J97A 4ZVMA 2R68A 4FOTA 4R8KA 1OI4A 3ECCA 2C20A 1VJCA 2INGX 3PQDA 2Q27A 1NP3A 2V0NA 3GYBA 4PCLA 5FOUA 4K40A 1TAQA 3BTOA 3L82B 4OGKA 4ZYZA 3CPHA 3EFHA 4PLPA 2EX0A 3AHGA 2H5EA 3H0CA 4PTYA 2IYSA 3VH1A 4CDRA 3TG8A 2Q41A 3GEDA 2JI7A 1AKYA 2NADA 2VDOB 2HBYA 4P4UA 5CNJA 2NO7A 4QOJA 4ZREA 3UY4A 1GG8A 1T3LA 3AYXB 2CE7A 1JHRA 1RYNA 4MWDA 2D1YA 4DR6B 3CCFA 4OLFA 2H4HA 3GVIA 2HRDA 2D5AA 1YGPA 2BFCA 2OCXA 3D2CA 3FKSA 3MJFA 2NM0A 3IDOA 4TV9A 5TVKA 2I2BA 2BUAA 3BKXA 5KTKA 1IXKA 4HDCA 5J43A 1Q2XA 4EKYA 5ALTA 2YN4A 1R8XA 2YBEA 3KQLA 1R00A 1Z5WA 1RJDA 2J32A 2E6KA 4JJ4A 4EK9A 4I1IA 5KINB 2X5KO 3BCRA 2YC4C 3TSYA 4OH1A 5HW0A 2UAGA 3WQQA 3MGAA 2P77A 1QGDA 3KYIB 3NKVA 4BVEA 3BVPA 1SRRA 5KYTA 3B48A 2QZSA 2JAPA 4REQA 4LWZA 1QKJA 1R8YA 1KMMA 4DMRA 1RXVA 2G1PA 3C5CA 3NV9A 3WL5A 1MPTA 4CEHA 3N58A 1RBZA 2PEYA 3LUKA 1HNZB 4CM4B 3P9QA 3EQ8A 1BKYA 3EMBA 2UUPA 1RAEA 5IVIA 5CLJA 1BU5A 4K6FA 4NFLA 1NZFA 3OEWA 4YCLA 1NLUA 1G19A 3EULA 2FSGA 2F9LA 1OBHA 4GU5A 1OZFA 3GARA 2FN3A 4QNNA 4X1OA 1PG0A 3W04A 1XQWA 1S2GA 4IGIA 4LX8A 5AK6A 5E3HA 5K8TA 2FPPA 3OJ0A 2H1WA 5IHPA 1RMYA 2H2IA 4QA9A 3UW3A 2AN9A 5HJ2A 5HA5A 2K2WA 3WLQA 4ARSA 1JPNA 2XUJA 1M1YE 2JLZA 13PKA 1M1NA 3GLUA 4MARA 5LN1A 4LUCA 5ALIA 3QVGB 2H59A 2OBYA 1J00A 3G5MA 4L8YA 5DI9A 1GCUA 1AXEA 1UEJA 3I45A 4GWKA 4IFEA 4V3CA 4EJ6A 3IBTA 3ASUA 1BOOA 1HGXA 4AUNA 4BFZA 5KYWB 5IK2A 2EGUA 2HNKA 4US1R 3KR0A 3JYQA 3SZUA 4RIIA 4BVGA 1Q0PA 1ZSYA 2ZIWB 4AYTA 4EKNB 1TA4A 5I3ZA 4DIDA 4TZ0A 2DPGA 2B4RO 3UT6A 1GQQA 4FPXA 3VX4A 3G6KA 4AMUA 1MQSA 4H3KB 1K8YB 4XEHA 4BNMA 5JC8A 4OUDB 2LRHA 5JIBA 3T0FA 1N7JA 5HILA 2AQKA 5ER6A 1WQ1R 4YDQA 2ZRKA 4Z4FA 1VZ3A 1X19A 2BEWA 3GJXC 3E5MA 1E6UA 1L1QA 1USUA 1B8NA 2ZITA 3C6MA 3KQQA 2ZT6A 5J1SB 3EX7C 1GFZA 2CDNA 2R8RA 2FWPA 3DDHA 4OYYA 4C21A 4JLKA 3MMXA 3T06B 2XQKA 1Z2OX 1D4FA 5KOIA 3W6ZA 4MR9B 1NF9A 3RVDA 5TIIA 1QH8B 2B1RA 5BOVA 4BNHA 4B2LA 1XMXA 1FFHA 3VYVA 5KYXA 3V4FA 2A9OA 3U1TA 3EVNA 4DARA 4TRMA 2D8AA 1QP7A 2AR9A 1ESMA 4EM6A 1JS1X 5A03A 5A5VA 1FUIA 3EWNA 4YAGA 4HXGA 4OMFG 5F12A 3R9KA 3AQIA 5FF9A 5THKA 1KRXA 2L69A 3QMPA 1KFBB 4GE3A 3SIRA 4WH0A 4IL5A 4DQ0A 5B6JA 5JJ5A 3ZQ4A 1SVWA 5IZCC 5HP4A 3GJQA 4K1XA 1DP4A 2PQ0A 4U5XA 1FMTA 1O6CA 2FEWB 4QOGA 4AZWA 1NWHA 4MGIR 2REBA 4LTNA 2QVYX 4N4AA 1RLMA 4HNVA 1A2QA 2ALJA 3GFVA 1RQ7A 3PNBA 1QIKA 1HV8A 1J8MF 1PD1A 2YNMA 4RW0A 4X1KA 4UNIA 1OFUA 4D0GA 2JA2A 2IV2X 4CEJA 2DPHA 1LBHA 2WIDA 4JC0A 1JJ7A 4PAMA 1DKRA 1W5FA 1OXSC 1SB8A 2MINB 4OL0A 1JGTA 5EUCA 4HC4A 4K0KB 1LX7A 1SNYA 2HLHA 2OM2A 5BSHA 4Q1BA 2GK7A 4WI1A 3FN4A 1JEYA 4J6FA 5DCLA 1SULA 1FOEB 2BEKA 4LN1A 3PKIA 4L8LA 4PQFA 3WL6A 3O9VA 1N6NA 1XMJA 2EATA 2I6QA 1QRRA 2RG1A 2BKVA 2H1SA 3BXPA 4YQEA 3T0GA 4EW2A 3FH0A 2H5IA 5HZHA 1V1RA 1HLGA 1EUDB 1UZAA 2WKRA 2G5PA 2RGAA 4DDHA 2EIHA 4I3HA 1GNRA 3O03A 1M75A 3LXRA 5E1OA 4B6GA 2H1LA 3CH7A 2XUZA 3AM5A 3C6ZA 5ESRA 2X5XA 2I1WA 2ZBVA 4E4TA 2WVHA 1ODCA 1O94C 4DBLE 1Y1QA 3RYIB 2WE8A 4MWBA 1I6KA 4TQAA 4UUMA 1DTWA 3UWMA 4DG5A 1A2KC 3H99A 4B84A 3RSOA 3PEYA 1RRVA 1KJNA 2B3DA 3VC2A 5JRJA 1G7RA 4RC9A 2O1EA 3CLTC 1NMSA 1ZXBA 4IDEA 3UCEA 3UKOA 4DV6B 2AEEA 3OOYA 3ZI7A 4E5PA 3OTHA 3PHLA 4ND2A 1QGOA 1FP6A 5K6TA 2ECOA 3JXEA 5F78A 3SR3A 1U8AA 3MWJA 2GZHA 4HNAA 1JEDA 2QEQA 4O25A 4WK6A 1A5AB 4F2GA 3VZRA 2FI1A 5C0OE 3WP0A 6REQA 1V5GA 5KZMB 5DSXA 1F0YA 1ICEA 1V48A 1G38A 3HVUA 2OQIA 1VHWA 4CLRB 2ZRLA 3IAS6 4QNRA 2IYRA 3KJIA 3MOSA 2NAPA 5EQTA 3DE7X 3MJEA 5I51A 3B60A 4KQEA 1PX0A 5B53A 2PBZA 2IYEA 2PWYA 5BSKA 1RJWA 1I80A 1ZIYA 1G6KA 5EJ5A 3DZJA 3VU8A 4XWWA 3O2QB 1CY2A 4RKQA 2C42A 3H7AA 1YL5A 1U0EA 2YW2A 1LXCA 5AVWA 2XJ4A 4FNGA 2H2GA 4Y98A 1U8UA 2ECKA 4PR3A 4XIFA 1RRPA 3LBIA 4G0QA 2BFCB 1LB1B 1A8SA 1KEZA 2E48A 2W6ZA 1VB5A 2IOYA 1EGAA 2YNMC 4LJKA 4M0FA 4DCPA 1R27A 4EGSA 5HPYB 4HL6A 5KQLA 4XRGA 4YMGA 4EB3A 2JGDA 2CF6A 2QRNA 4W8GA 2HUNA 2RHWA 3MB5A 2WOOA 1R9GA 3BMCA 3HVRA 2B0JA 3H1FA 4A8PA 4JB8A 3UWOA 4ND4A 2FE1A 1C7QA 1QCCA 2RCNA 4A36A 1UJ4A 1FDIA 4REQB 1K8QA 3ELWA 1FNMA 4O2AF 1Y4AE 1BU8A 4IV8A 4QTZA 3Q2KA 2D0IA 3JQ9A 2QL5A 2YR0A 1UQTA 5T41A 2G08A 4DQXA 3RJMA 3FOFC 4BXOB 3N3AC 4QC2A 3IO3A 3SYMA 2IHJA 1NOIA 3OECA 5A04A 1ZIPA 4HNHA 5ESXA 3RABA 5CA0A 2CDCA 3U5ZB 5GQSA 2O7NA 3BAFA 1ADJA 4KWCA 3IE1A 1SU8A 3NEPX 1D5WA 1SELA 3HI6A 4PFSA 3T54A 4BLVA 4IDQA 4UFOA 4PIPA 1NBWB 3NJRA 1HEYA 3O91A 4M2LA 5ALXA 1KPGA 4JT9A 2IK8A 5FUXA 4D8YA 2JGNA 1OE0A 1TUGA 3T9BA 2YWDA 4MS4A 5DNVA 4PONA 2PS1A 4X64B 3GP3A 4MV1A 4DSOA 2BLNA 1M1NB 3WZLA 1J8DA 1DC8A 1WLSA 5IW8A 1ZH6A 2FN9A 4U8GA 4ZGBA 3BRWD 2P4HX 4PXSA 1LI4A 3E53A 4GKAA 1UAGA 4QBIA 1C29B 1RC0A 1V95A 3DF9A 4XWYA 3OI7A 2PJUA 3PL5A 2NV2B 3NWBA 4I5DA 4E2FA 5HBRA 1O0BA 2WTNA 1Q12A 1DIRA 4ZMSA 3P0FA 4EY8A 1P5RA 5ADHA 4DR5B 2JVIA 1Q77A 2PZAA 1M7BA 2EFCB 3BX1A 3SZRA 2YMLA 3JRNA 1EI9A 2AZ4A 2H7XA 4M55A 3G8YA 2F3UA 2UYYA 1SXJB 3PR1A 3TOCA 2BEWB 4UEWA 2QOEA 3MGKA 4YRCA 3T38A 3Q7EA 4EF6A 4KNYA 1D04A 2P0EA 2XTMA 4WHMA 1U9JA 3WA7A 3HJNA 3FB1A 4N9QA 2D13A 1RZVA 5HE9A 5F3RA 3GGOA 1QO7A 3P26A 4W1SA 1E9FA 3R3XA 3SZMA 1FQJA 1X1TA 1OU0A 2XTNA 1CRLA 1P7PA 2W6ID 2B34A 5KYXB 3IR7A 1PR4A 4L27A 3F71A 3JASA 1C7RA 1UM8A 4CVNA 5K99A 2JGLA 2ZT5A 3MRVA 4NDAA 2QYTA 3CCBA 1K6IA 5TMPA 3YASA 1R9NA 4D4GA 4AJOA 3WYNA 1S7CA 3NVKI 4QKQA 3L18A 5K3SA 4Q4JB 3NW9A 4U7WA 5F7XA 1H9CA 4UTXA 1NDHA 3Q7TA 3ZCPA 4IO1A 3MCZA 1BD3A 1AK1A 1H0SA 1WNTA 3F47A 5HRCA 2IYWA 3VPCA 3R5JA 5FPSA 2F67A 3RTBA 4V02A 2HUPA 5E7QA 3AUSA 3OOEA 5LLSA 3WYFA 1QK3A 4D9KA 2G70A 2ZJ7A 1BVUA 2WIBA 3MTGA 5EYPA 4X1KB 5FLYA 3UENA 3NRCA 4CEJB 4PYJA 3ZG6A 5KYYB 2M9MA 1H66A 1P0IA 4B17A 5DW0A 2XRMA 5FBHA 3LBNA 3QMVA 4XWTA 3OPNA 5IJ0A 2QLJA 3H4IA 3TOSA 1CY8A 1GUZA 4B4OA 3GNQA 1GCAA 1W5SA 1USVA 1O1YA 3ADKA 3N39C 3OP4A 4MWOA 4ND7A 5HMMA 2P8JA 4B7AA 3R8XA 1XZEA 1DWPA 3BGDA 1AQYA 4MXDA 4IJWA 5MGBA 2HA2A 1VFNA 2P3QA 4OU5A 4M0KA 1T91A 3A6ZA 3I5AA 4E7OA 4COOA 1IY2A 1CP3A 5HE8A 5B37A 3LXXA 4MA4A 2F3QA 4TVSA 2OZLA 5EMJA 4A2QA 1ZN9A 3DH0A 4B8ZA 3V4RA 2UUCB 4RELA 1DTWB 2BGIA 1BE1A 1DXHA 4DLYA 4ZCMA 5LC1A 2DXIA 4OOEA 3B1VA 1QV6A 3L1VA 2WZBA 4GOOD 3ZWBA 2ADMA 2C1EA 3BWEA 4HXEB 1MJ5A 5LJLA 3OX3A 2ZQ5A 4UOEA 5DEOA 3EOAI 4DMUB 8LDHA 4MA0A 1N8KA 2NN3C 3FPKA 1ZLXA 2FOXA 1GZ4A 1UJ2A 2JH8A 4R8SA 5FOSA 3TG2A 1NVTA 2QN2A 2KBFA 3OEED 4HNAB 5CW2A 1SKQA 3EWIA 3TVTA 6REQB 1YRWA 2VDPB 3B52X 1SZDA 4WWHA 5TGDA 5K0FA 4MHTA 2G83A 2GYYA 4QQNA 1C14A 5HOQA 3ROMA 3AHHA 4CM1A 2ZIZA 1WF3A 4EVQA 4DCCA 1B3BA 2NUBA 3DZKA 2HLNA 3VO2A 3Q3HA 1LRKA 2FWNA 3EPHA 2CK3D 2C4KA 3SX0A 3JAWA 1BHQ1 1LF0A 2VN8A 2JH3A 3VV3A 2AMFA 1WRBA 1VL8A 3X2FA 4C3UA 3IP6A 1V6SA 4RKRA 4OXKA 4F2WA 3I4LA 2ZYUX 3CS3A 1G2OA 3FVQA 1QQ6A 4HV4A 3JAKA 1XCPA 4LKOA 1KERA 1UQRA 3AWDA 4YO8A 3OIDA 3EGWA 3W8EA 5LMNB 4UDNA 4NVRA 2FPGA 3KTDA 4B82A 1RXWA 5B36A 2C1ZA 4H1UA 1XAJA 3D6VA 2LCQA 4DMKA 2NMVA 5DTRA 2JGDB 1SOWA 3MS2A 3EEIA 2NYUA 3R4CA 4GMXA 2CVZA 5EWLA 5G3ZA 5BUSA 4P5PA 3IRUA 3HACA 3GPCA 4NPHA 1L6RA 2FMHA 3BMCB 1SZJG 3CRMA 2BDTA 3FTDA 3EPLA 5EIEA 3QA3E 1E9CA 4EQ6A 4Y6RA 1V8BA 1NLFA 4WZ6A 1M2FA 1NW5A 4QM7A 4RA9A 4FXOA 3FYTA 2GK3A 1ZD8A 1GRQA 1QBGA 5CNIA 5FWNA 1MVOA 2NXCA 3UYLA 3UJNA 3TNLA 2W43A 2E1PA 3KYCA 5HUJA 3QEAZ 3BE8A 5BMVB 2FQQA 4P2GA 1UODA 4POAA 5IKXA 4WDQA 1R6AA 1CEYA 1A9OA 1I3LA 3G9QA 3OMLA 5A7HA 1UF9A 2GHTA 1OX5A 4MYHA 3UATA 4BU1A 3DWIA 1KOGA 5FUBA 2EAUA 1T9AA 3IEKA 3NV7A 2NWQA 1S8NA 3CW8X 3E4CA 2DFPA 4Q9KA 1C9NA 4Z7NB 1A1VA 5ERYA 2WJIA 3CWZA 4DLBA 1NUHA 1CS0B 1AHHA 3K8QA 4HB3A 2ZUVA 3MJTA 3ADBA 3WGMA 4BNYA 1CV2A 1E64A 5CIQA 2ZVDA 4JVOA 1PYDA 1PRYA 4ZVPA 1OIXA 5H3CA 4EIWA 4MS4B 1HKHA 3TLKA 4A8HA 4BO5A 1UT6A 4J94A 4K88A 5EP3A 4KW7A 4AIIA 2IS4A 3GRUA 1NURA 3L6RA 4RK4A 3URMA 1RSZA 2AW5A 2A7XA 2MSWA 3TD2A 5A1JA 1TIKA 3UMBA 1DT3A 1XKTA 1XNHA 3IJ5A 3CR8A 3GJSA 4AMYA 1CJKC 1WUTA 4WEOA 1QTIA 4R16A 1Y8QA 2NYAA 2I1QA 4KVFA 1JA9A 2BGNA 2QGFA 4MRAA 4ZC1A 4ZWNA 3WK8A 1WWKA 1YJ8A 3HB9A 1ZH4A 4HGZA 1AT1A 4QQKA 3V4SA 1S4MA 4C7JA 5A3QA 3DOJA 4RJJA 3ZHSA 3C5WP 1RI1A 1C3EA 2X7XA 2F1IA 4MKIA 3A37A 1VMDA 2H2FA 3BB1A 1CNMA 2V5AA 3FNIA 4G0PA 4R3UC 1NKVA 1SXJE 1AGYA 2V7WA 2XDWA 3I92A 4YMIA 5TPZD 3TR0A 4QRIA 1FRZA 3VVCA 5C51B 1PT7A 1U9CA 1MAUA 3EZ6A 3AI1A 2ZBRA 3TQCA 4AP6A 4EG0A 2MCFA 4NECA 2IXBA 1OA1A 1WXIA 3TNDA 4YRGA 3AM4A 5FV4A 4B0PA 2JEZA 2V96A 4IP0A 4CHTA 3RYHA 2A9PA 1LWNA 4N8DA 2P79A 2PUHA 2YWRA 4N18A 5EXTA 2R7LA 4TS9A 5EA2A 3ZV5A 2X8AA 2G1KA 3CXRA 2GCNA 1WKCA 3ZDAA 1U2DC 2GZRA 1XTZA 3EA5A 3IP3A 4I1PA 3A31A 3JASB 3GLIA 1L9XA 1FL9A 1QDLB 1G8PA 1N3YA 2CYCA 2PXCA 2Q6KA 3EFEA 4JA0A 4JLOA 2WUFA 2BZSA 3A06A 3B7WA 4BBAA 4ZVUA 2VSYA 1QKKA 1U3CA 2QI9F 5PGMA 1E3MA 4U7HA 2JEOA 4KQXA 1Q3KA 3PRHA 3N8GA 1Z4NA 1AQUA 1N9GA 1OY1A 1SUEA 2F9MA 4QOFA 4RABA 4D97A 1BVHA 3SYTA 1PK8A 4JP2A 2ZYSA 2CNBA 1VHJA 3UHPA 4KPUA 1DI0A 4EHAA 3KQYA 3LT1A 4D9CA 2QROA 4J1TC 4YGYA 1YJ5A 2OAP1 3RFCA 1USWA 2VTVA 3FG9A 5FH9A 3EODA 2EKLA 3SSMA 2P0AA 4GVXA 3WLAA 4X97A 1TEXA 3IMCA 1NG1A 3SEZA 4KH1A 3GJ8A 1FFCA 2Y1WA 5JO0A 2NO0A 1E2NA 4C07A 5EGNA 2P5YA 3T7JA 5BYAA 5KNDA 4CFZA 1AMOA 1W0KD 4S1PA 5IJ0B 4XLLA 1LDNA 1XYYA 3WGTA 1RWMA 3UKJA 2EFGA 3R9XA 3TJZA 1I01A 3TD6A 5GOZA 4WY5A 1O9HA 4RHYA 1MO3A 4BATA 3OCYA 5JHHB 3TX6A 4ZAWA 4CMAA 1FDRA 2H4FA 4ZPXA 2QB5A 4G1MB 1UDXA 3QUSA 4YAFA 1EA5A 3TXAA 5DISB 4K9OA 3FZGA 4A16A 4DMCA 2L17A 1FTQA 3EUFA 1WXFA 1YK1A 2ZRBA 1CXZA 4IDPA 4KR7A 1KEEA 3K9GA 4I9HA 1AA6A 3HZRA 2FETA 1OOEA 5MFZA 2BYTA 1X7XA 1UMKA 1IEQA 3GRZA 1WXWA 4UPEA 1PQUA 1OAAA 2XDAA 3ORQA 3TRDA 4C1NA 1W1WA 1ZVVA 2FA9A 2FZ4A 1FVFA 4JX9A 4AXBA 3WLTA 4EG8A 5BT8A 5K0NA 5CFZA 1T26A 1ZPDA 1EUQA 3E9MA 4N3AA 1UOOA 1K86A 1K08A 4BKOA 1I2AA 1S8OA 2OYCA 3KEQA 2WAOA 3ONEA 1BZYA 4A3SA 2VEOA 1EFTA 3W5VA 4PVCA 4RTKA 2YTZA 2ZIEA 3JAWB 1DOHA 1WA5A 1E4OA 2CB0A 2P9YA 4M0PA 3RIGA 1IQ0A 2D0OB 4PLHA 1PG2A 4O2BF 4XGKA 7MDHA 5JZOA 1KEVA 1Z68A 2GPWA 2ZU6A 1VJ5A 4BZPA 1IOVA 4GQAA 2I80A 2O8EA 3JAMA 1Y8RB 3K9QO 1OXXK 3A32A 3JAKB 3UMCA 1CUDA 2HCFA 3DV2A 4LJYA 3T95A 3DLPX 4GOMD 2A5DA 4Q01A 5ICGA 1GUDA 1BVYF 1M6NA 2G4LA 3CE6A 2WWXA 3LPLA 1JTFA 1AUOA 4RD4A 4TVOA 5CM8B 1D1SA 1E3EA 3EMVA 2IX9A 1IOLA 3QVMA 3IQHX 1Q1GA 3GUUA 1RM3A 2LGJA 3VYRB 4P3OA 2PNJA 2E5WA 1F4VA 3GG9A 4EQ6B 3DCIA 2C2HA 4FCVA 1JLKA 2GGSA 2GN0A 4L0MA 3RNLA 4KE6A 4RA9B 3ZY2A 3USCS 5JG7A 1TOAA 1A9RA 1G5HA 2BN4A 4GI2A 3GW8A 4D8XA 4ZU1X 2QXYA 2G80A 2IKSA 1J0BA 1ZKDA 2C07A 2ZTHA 1JDBB 3QIVA 4U2FA 5IAGA 4CW7A 3VR6D 1A96A 1SIUA 5AT1A 4HB4A 4RTLA 3G49A 1EFLA 5DGTA 3EHDA 3IT2A 3D7MA 3RADC 5SZHB 1NBOA 3X44A 2E4XA 3STVA 4AS3A 3MUOA 4BNWA 5HTKA 1FZTA 3ONNA 4HMPA 2FMUA 4F5DA 1I10A 1E3JA 1JHPA 1W35A 1WPQA 2OV2A 2EP8A 3HRIA 4GX0A 4UASA 4HNQA 2AJLI 2ZDQA 4LJRA 3ZWCA 3H9JA 1MLDA 2DFLA 4G07A 2C3YA 4PYIA 3O8OB 1CUFA 2EOAA 3FKJA 5H7XA 3DEZA 1OB5A 1U6IA 4OB8A 1RD4A 1C3VA 3QWBA 4NOJA 4ZZ3A 4PTLA 3BJRA 2R1VA 3DEAA 4D82A 2ZI5A 2PLNA 4AWAA 4YRKA 3BIOA 1E6WA 2Q6OA 3TGPA 1N92A 3HY6A 5FFNA 3B2NA 3IUEA 1FTGA 2CLIB 1Y8QB 2HBQA 3GRVA 4UD6A 5LDHA 1ID1A 1P5ZB 1KWKA 1WL8A 5TJ9A 2FR0A 2VJCA 4LOLA 3IJRA 3SJBA 5DM0A 3U3JA 5BSWA 2NZJA 4OSPA 3QBTA 4N7JA 1N2OA 4EGAA 2ON6A 2VP3A 3IB6A 2RCYA 3C3KA 3DC2A 3C14C 4ZHQA 1CTQA 1QHFA 2C9CA 3H0KA 4FZ5A 4M53A 4N39A 1Q7EA 5C53B 2B9VA 1GZVA 1E5DA 1LNZA 2P5UA 3GNSA 4QPCA 3EHEA 1NF3A 4FQ5A 2W2OA 3DWGA 3HBAA 4XUDA 2GARA 1NKSA 2DX7A 3C4JA 3ZV4A 5L6LB 4MK4A 3LBYA 3TQTA 5LB2A 1XTKA 2I7DA 2Y1XA 3M1AA 4IF4A 4PGAA 4MUMA 4NPAA 3QYJA 3K8YA 4Q93A 3FYUB 2Z6UA 3P9PA 2PT7A 1K89A 4FHEA 4NS1A 4B2PA 1J56A 1VHTA 3WKBA 5LIPA 5DNDA 4HPWA 5AW7A 3CLRD 3UJBA 1L5GB 4L0CA 3S68A 1PFGA 5A4DA 1RW4A 4BTVA 1UXHA 3UAZA 3HJUA 2FUNB 3F7OA 2EJVA 3O4IA 1M6HA 5AVRA 4F5EA 2VK2A 2I8LA