2BLNA

N-terminal formyltransferase domain of arna in complex with n-5- formyltetrahydrofolate and ump
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
304
structure length
298
Chain Sequence
MKTVVFAYHDMGCLGIEALLAAGYEISAIFTHTDFYGSVARLAAERGIPVYAPDNVNHPLWVERIAQLSPDVIFSFYYRHLIYDEILQLAPAGAFNLHGSLLPKYRGRAPLNWVLVNGETETGVTLHRMVKRADAGAIVAQLRIAIAPDDIAITLHHKLCHAARQLLEQTLPAIKHGNILEIAQRENEATCFGRRTPDDSFLEWHKPASVLHNMVRAVADPWPGAFSYVGNQKFTVWSSRVHPHASKAQPGSVISVAPLLIACGDGALEIVTGQAGDGITMQGSQLAQTLGLVQGSRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PROTEIN YFBG
publication title Structure and Function of Both Domains of Arna, a Dual Function Decarboxylase and a Formyltransferase, Involved in 4-Amino-4-Deoxy-L-Arabinose Biosynthesis.
pubmed doi rcsb
source organism Escherichia coli
total genus 89
structure length 298
sequence length 304
chains with identical sequence B
ec nomenclature ec 1.1.1.305: UDP-glucuronic acid oxidase (UDP-4-keto-hexauronic acid decarboxylating).
pdb deposition date 2005-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
A PF02911 Formyl_trans_C Formyl transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.25.10 Alpha Beta Roll Methionyl-tRNA Fmet Formyltransferase; Chain A, domain 2 Formyl transferase, C-terminal domain 2blnA02
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 2blnA01
3AUFA 5J9FA 3GARA 2BLNA 4R8VA 4S1NA 1MEJA 4ZZ3A 3KCQA 4PZUA 4QPDA 4ZYUA 4ZYTA 1GARA 3TQQA 4ZZ0A 1CDDA 3N0VA 3P9XA 1RBQA 2GARA 3O1LA 4TT8A 1MENA 4NV1A 1MEOA 1RBZA 1JKXA 2YWRA 5CJJA 4IQFA 1RBMA 1FMTA 4EW1A 1CDEA 4TS4A 4ZYXA 1RC0A 1NJSA 2BW0A 4ZYYA 1GRCA 2FMTA 3Q0IA 2CFIA 1ZLXA 4EW3A 1YRWA 1S3IA 3TQRA 1ZGHA 4EW2A 4DS3A 3DCJA 3DA8A 4Q12A 3W7BA 4QPCA 1ZLYA 4TTSA 1RBYA 3AV3A 5J63A 3R8XA 1C2TA 3OBIA 4ZZ1A 4YFYA 4ZZ2A 3NRBA 4ZYWA 4YFVA 4ZYZA 1C3EA 4ZYVA 3LOUA 1RC1A
chains in the Genus database with same CATH superfamily
3JYNA 4JT8A 1D6NA 1XZBA 4HQOA 1OYOA 4LQLA 5FADA 5E0KB 1DDOA 4RVNA 3HKEB 4ZV4A 2VOEA 1DHRA 5JG7A 4CL8A 4QHYA 2PLAA 6CHYA 2DLDA 1KSGA 1XL1A 4HAYA 1WD7A 4UTOA 4KQ6A 1JPVA 4Y1EA 3RVSA 2QRJA 3ZEAA 4RSMA 1C50A 3TXAA 5I3ZA 3L7MA 3B12A 2QL9A 5KDOA 4KVZA 3GY0A 4RSGA 2HQ1A 1JLSA 3A1NA 2XA2A 1XPUA 2P9JA 4N8EA 3PFGA 2NQ2C 4RU1A 3PL1A 3WMFA 1XU4A 4JUCA 4B3FX 4ZAGA 3AG5A 3IUQA 2BGRA 3KK0A 4FC6A 3DZFA 2AS0A 4UD6A 2V1UA 1DOHA 5I4BA 4Z7NB 5LC1A 2F17A 3GDHA 3L79A 4O1HA 5H9VA 3KOOA 5CBKA 4DV3B 1KAEA 2F3UA 2XBLA 3FPAA 4FHCA 1RDFA 4RV4A 5D00A 2ORYA 3LCUA 3U16A 4CDGA 1NNEA 2G5GX 5T4FA 1YGPA 4H1WA 1ZK1A 3DONA 1AUVA 4MUEA 1O6CA 5ALOA 3RANA 4D9HA 3LX4A 1J2EA 3Q40A 1YJQA 3DDHA 4KOAA 5E1OA 3UT6A 3IVGA 3K70D 5DHRA 3LUBA 3PLRA 4AL4A 4AMZA 3RNLA 2Q1XA 1E1RA 5EN4A 2OHHA 1JDVA 4IQGA 1BFKA 1TTTA 1QCCA 4GWLA 3HDQA 2P6PA 3IDZA 1GDHA 1MDFA 3ROGA 3U9TA 4YREA 2PX8A 4TVSA 2QL5A 2EWVA 1N3BA 2QHXA 3CU5A 1T5SA 4NXMB 1XDUA 2P1ZA 3VOTA 2QBYA 4KPEC 5AK6A 2I7DA 4MXDA 1O9BA 4EJMA 4CE6A 2PO5A 3KU1A 1AV6A 2BKEA 1SKAA 1KAMA 2OHVA 3ETLA 1YULA 2BMJA 2JATA 3GGPA 1QH1B 2O14A 2ZSAA 4H6VA 2XT0A 1M5RA 2OCPA 1PVVA 2DZDA 3P97A 5JDIA 1XLVA 1VDMA 5K0BA 2JLUA 1AXRA 2G1PA 2UU9B 4HDKA 3GNLA 4DXDA 4M53A 1E0KA 1K92A 2ZU0C 5DWVA 1DIRA 2C03A 4F4JA 3VI4B 1Z6GA 1IQPA 1ZMOA 3BBPA 3MG9A 3WO1A 4WPGA 1QGYA 4DF3A 1S2MA 2H63A 1PF7E 3K30A 4LHWA 4D3DA 2XF8A 1KORA 4GRDA 2VF4X 4JGBA 4PLYA 1P1HA 3WNDA 1NVAA 4YT8A 4LYGA 2V6FA 3EVGA 3T3PB 1LPNA 2EJTA 4FZRA 3P2EA 3UK1A 5A4JA 4UNSA 2ZSJA 2HT1A 5JASA 1I13A 2NUTB 4QGFA 4R2WA 5HEKA 3AESB 1VJDA 2WFLA 1VIMA 4B3RB 1YK1A 3HYRA 3KDPA 1Q1BA 5LZ8A 4TZKA 3GJTA 4F85A 2BFPA 3AEKA 5F98A 1Y1LA 1FNDA 1DQZA 3LQYA 4RZSA 3M6XA 4I8IA 1SVSA 2BISA 3N76A 2KWIA 3ZDQA 2Q5HA 4LXYA 1QGDA 1EAYA 5AJVB 5IEBA 3R7SA 3P9KA 1E60A 2NSDA 4KYIB 3B89A 3X1MA 1KO5A 2C2KA 5HE8A 4KXLA 1WMEA 5I8ZA 3E1SA 3O5AA 1MQ9A 4G8BA 1DP4A 4C20A 1DBQA 2RG1A 3N07A 3MT9A 3OCVA 3OM1A 4KO8A 4KWEA 1PZMA 3A70A 4Y2QA 3WYEA 4DG8A 4DMFA 1SUDA 1U8UA 3JQAD 3SHOA 2VHZA 4MUGA 3TPCA 3WZ2A 2MMGA 4C0XA 1D0IA 2YVKA 1TU3A 1TFRA 3I9LA 5BMVB 5BQ3A 2FOLA 2KQUA 1XFAA 3AUAA 3FKSD 3IAM6 1G5HA 1FRNA 4YRCA 2O0MA 2HLDA 5BOSB 4KR3A 3OM9A 2WWTA 3IOCA 3AUJB 3T9BA 4D44A 1GPUA 5FLEX 3BJIC 2CSUA 2PUVA 3IC5A 3HJGA 4O2BA 4QYWA 1U65A 4MWOA 4Y9TA 1YZQA 3NHPA 3OM0A 5BY2A 5EHQA 3FJ1A 3ZWVA 4MQ5A 1OQAA 1DARA 4N12A 4WLNA 3U61B 3X44A 1BX3A 3GCXA 5AVZA 4OMUA 4DR5B 1U7UA 4NOMA 2FRDC 1PQUA 2I99A 1B15A 4IFIA 4XFJA 4RFSA 1I6LA 3ZGOA 3VHQA 4CI0B 1M1YE 1MHTA 4K9SA 5KYGA 2BKUA 2BF7A 4L16A 4DCNA 2RONA 3W78A 1JW9B 4L4SA 3D1VA 1J2RA 3OZWA 3TF5A 5BW6B 3UCXA 1E2EA 3T99A 2UV8A 4B2IA 2HBQA 2WSLA 3WLFA 2VAWA 3FUTA 4XIJA 1DWQA 1UQUA 1UBRS 2A9RA 1X42A 1P5HA 3AF3A 4OU5A 4JEHA 3UHFA 4FQ7A 1PJRA 3AP1A 4UQOA 1CQJB 2W2XA 2CW5A 4ROSA 3KFVA 3RBZA 3K3PA 4EABA 1J90A 2BUCA 2H1VA 3EPRA 2BFFB 2PIAA 4HFNA 3ABIA 5CPBA 2P3QA 3L7DA 5K51A 4JBGA 4LY3A 3ZDCA 2GHTA 2BFOA 5FUQA 5E9QA 1QVAA 3G2NA 2CFCA 3O3NB 3ZV7A 2B98A 2EXXA 4RTOA 2AW3A 2QTBA 3CONA 4EHFA 2ILTA 1JDPA 3NYRA 3VJKA 4CG1A 3QFFA 2HU2A 2ZM5A 1CU1A 3R20A 3BHIA 4LRSB 4O25A 3SSNA 5F12A 4EZBA 3C97A 3U40A 2P68A 1R0CA 3HL0A 3FHLA 4KDCA 3VSEA 2P8JA 1MABA 3C5EA 3NRCA 2OAEA 4XSHA 5IT4A 5JI3E 4YCNA 1W5FA 1N5OX 3KBOA 2R62A 3ND5A 4RKFA 4EY7A 1VKHA 4GR5A 4JQYA 1E2BA 2MJLA 1QIMA 4BHTA 4ZEOA 4JR1A 2O3QA 3ZQJA 4LNAA 4OJTA 4TQ9A 4N0EA 1RCFA 1ULTA 1NXOA 2Q5FA 3Q3VA 2PJDA 1YE8A 4NBKA 1O0BA 2NVWA 2ZDQA 3B9QA 2LIPA 2G9QA 3MWJA 3VR2D 4HFMA 4ZMSA 4EPYA 4U2EA 1WE2A 4MQEA 4KBGA 2R79A 1E9DA 3W7BA 1Q50A 4P86A 5B3JA 3RTDA 4B6FA 2WD7B 3Q5GA 4ZC1A 3WSWA 1L6IA 1GEEA 1KWKA 4B6QA 2A1TR 1WU7A 4KJXA 4YALA 4B3DA 2EX1A 3EZNA 5L53A 4UBJA 1W85B 1O08A 4B1FA 3VJLA 2MSDB 1UZUA 2C20A 3DTVD 4GPIB 4KG7A 4BN0A 3HQ4O 4F5WA 1GNVA 1S5PA 1PYGA 3W4IA 3ADCA 5A4AA 3EGOA 2HTFA 2EEZA 3H8SA 4TYYA 3EEIA 3H2GA 4H7DA 3OKAA 4B6RA 4GVPA 1WV1A 3COVA 4ED9A 4GC9A 4DANA 2BFCB 1VP9A 1DJLA 2CL6X 1WULS 4DLSA 3USES 521PA 2PWPA 3GEPA 2Z04A 3GLIB 5IULC 3R3ZA 5JIBA 1DKUA 3INTA 4U2CA 5DBGA 4OBXA 2IA5A 5BW8A 5H8WA 4ZWNA 3ILHA 1JIKA 4BVAA 1WUYA 2OQ2A 3C8MA 5DNAA 4CLOB 3IQWA 5L51A 1WOYA 1SB9A 1P0FA 1T3HA 1XKLA 5HQJA 3W9SA 5JSFA 1ZVQA 2KS6A 4BPBA 5A1JA 1CVLA 3WGHA 1KQGA 3H6GA 3AHCA 1PT9A 1X86B 1RE1A 3L6UA 1W29A 3E9CA 3T7TA 5COQA 4C0QC 4HD8A 1J2TA 3OOJA 1OXUA 3RAGA 5KC8A 1DC7A 3R8CA 4BMSA 3KJEA 1IRXA 2C4NA 4PU0A 1DL5A 2OZEA 1N0HA 5DX1A 1RAGA 3O47A 4IF4A 5C7YA 1N5MA 5FXMA 1V95A 3U6KA 3RS4A 2QTAA 1GG5A 4JKIA 4OG2A 1J4AA 2JFQA 3CVVA 5ITWA 4IIUA 4RV9A 3N8HA 3ZXSA 5BMVF 5K6AC 1XYYA 3IQEA 4JYAB 4BNDB 1P62B 1J23A 1RYNA 2ODBA 3T5CA 2WHXA 5FORA 3BF8A 3Q9NA 2OHFA 2JASA 2QYHA 4E2ZA 2J7PA 3BJEA 3OFSA 2HK8A 1KMHA 3M1IA 3Q3IA 1ONOA 5ENVA 1JSRA 3KTFA 1FDTA 2PJUA 3RRBA 1ZHOA 2GCOA 4CIVA 1X87A 1JAYA 3HBNA 1MEEA 1AUQA 1V9LA 3NUGA 1QPZA 1ECFA 4MKIA 4Q7EA 4DFDA 2Q49A 3UWKA 1OIXA 4UOEA 3FHJA 4BRSA 2VNIA 4DA9A 3GLGE 2HMYB 4X1IB 2AXEA 2ZETA 2RGNC 2CUZA 4Q4CA 4NZYA 4P0QB 4LA4A 2H2AA 3LTEA 3MK31 4IV0A 5J4KA 1M5UA 2J9GA 5LDHA 2XKKA 4GI7A 4LG1A 1NYRA 1P3DA 1ZCZA 2YN4A 3AB8A 3EXFA 4LHSA 3TLBA 5LMZA 3QA9A 1WTAA 2BYTA 5DI9A 5EC8A 5AM1A 1RTKA 3SYLA 1NJ2A 2ATXA 3F6SA 4IDCA 4MVJI 1JNXX 2WF7A 3LCJA 3A06A 1RKVA 1XCJA 3HNPA 3K9BA 4LMPA 1WW2A 4PVDA 4RIGA 3GN1A 3KKKA 4BMZA 2AZXA 3W3AH 4IW3B 1A8QA 3W4JA 1FDUA 3Q7SA 4KLZA 1RXSA 1K7FB 2C94A 2D1YA 2XUDA 4KXYA 3E70C 4RYLA 3OEHD 5AO9A 2AQ8A 2HWYA 2GK3A 2INGX 1CDOA 2NZ2A 3D6JA 5FTKA 5IVKA 4PPNA 3HB9A 4IDDA 5JBIA 1GQRA 4PGHA 1R8YA 5AKLA 3DLHA 4C5CA 1OXMA 1YASA 2BHLA 2BF4A 2HBYA 1NFRA 4CHGA 5BSHA 1ZZEA 3TGLA 4OYRA 3L41A 2H00A 5ALDA 4UHFA 4BKOA 3O4FA 5IT5A 3I4LA 5LMUB 1FBTA 2GZ2A 1HLDA 1D1TA 1YR3A 1FLNA 3PDWA 4OOFA 4F9FA 4QHTA 3CRZA 5D3KA 5FWYB 1AXEA 5GOZA 1ZJ5A 3GVPA 4WEQA 2ZZMA 1VJTA 4I1SA 4P58A 2XBUA 4FD2A 2F3RA 5IWCA 1C3OA 2C2ZA 2QTTA 1D0SA 3DMYA 3X43A 5B3KA 1W2HA 3ZDDA 1PGOA 3A1UA 4KAJA 1FQJA 5AVKA 1MO2A 2OZPA 1BS9A 1KSHA 1MQ8B 2YOGA 3PFNA 1E8NA 1Y6JA 4OAQA 3ZY6A 1ZY2A 1C41A 1Y98A 3A4NA 2JAUA 4MS4B 5DGDA 1E3JA 3WAGA 1V1JA 2RGWA 4LDRA 1KDRA 5BWBA 4AMVA 3OC0A 4R69A 2G1UA 4KVFA 1IG0A 1DC5A 2Z9BA 2GBCA 4MO2A 2Q41A 4V2IA 1U8TA 3AM1A 2IGBA 3FVVA 1C1XB 2E5WA 4QUIA 1OASA 3JV7A 4DCUA 2H48A 3UB3A 4ZICA 2DETA 1TLTA 3U09A 5K03A 1L4EA 2OV3A 3Q6NA 2PXHA 1C7ZA 3HJCA 2OYCA 3VRHA 2BFEA 4IWYA 1ZJYA 2YY7A 4P2GA 4S12A 4WEOA 5ESWA 2ZYRA 1WMFA 1AE1A 2NTNA 1UJ6A 4QOJA 5T67A 5EL0A 5FLKA 3W9UA 4C4ZA 5MDHA 1FDRA 2A9JA 2AYXA 1R4ZA 4MW9A 5DMXA 1MX1A 3ZIAA 2ZBUA 2XGMA 1XJ0A 2VHTA 5A3SA 4PG8A 1S2DA 4RIFA 3I01A 1VXRA 1IXKA 2HADA 1B3RA 1WXEA 3C8ZA 3H6KA 2CZGA 4CMAA 5IKXA 3RWBA 2DFLA 4J91A 1V4NA 4IZHA 4TLLB 3PXGA 3VR5D 3D7NA 2B25A 1EWQA 3LVRE 4X20A 4LVCA 4MQUA 4CEJB 2O52A 3QSGA 2A0WA 2YHSA 4W5RA 4JXXA 3WMXA 2AR9A 2IHJA 2SKDA 1N8KA 2P4HX 2LE0A 4PLVA 2DRIA 5IVPA 3C3AA 1ZOLA 2Q50A 1KP2A 3P0RA 3IP8A 1U3WA 2ZTSA 3R7FA 2XWBF 4BFVA 5BNTA 1DFHA 4NE2A 2CLKB 2PGXA 1KZYC 1R8XA 2I3AA 4W1SA 2V58A 1U98A 4P0TA 1PTKA 1E7WA 1TADA 3DG9A 3HH8A 2FWAA 1YCFA 4HYEA 4OFWA 4BATA 1U0GA 3JAMA 3JARA 4IV5A 2LIVA 3CLHA 1JJFA 1NMXA 3KLBA 2C59A 2IBSA 4AJOA 3KZVA 1HNXB 1OU0A 1YXMA 3IKVA 3C3WA 5CT9A 4BB6A 1K0FA 2ZT6A 3K0EA 4NWIA 4UHKA 1ZJ6A 3ES9A 3WLSA 1SUCA 4TL8A 2F3QA 4KYUA 3WQRA 3K9WA 1N6RA 4PN7A 1V3UA 2FG7C 4QVKA 2E6KA 2QTVA 1RRMA 2C42A 3WXMA 1UM9A 3P9PA 4EI7A 3QM1A 4JOBA 2F4NA 5DGTA 4GKBA 2LXNA 1MF7A 3D6TB 4J3NA 5ERYA 4G25A 2P6UA 3HGMA 1BWPA 3IOEA 2AMJA 5EIXA 3UH1A 1A98A 1ISHA 5GZ1A 2QRVB 2ACVA 4K1LA 3R5JA 1TKAA 1UPXA 3HU1A 5EUBA 3L9XA 5FB3A 1JPNA 3D1JA 4F3TA 1JR2A 3BE4A 3ROEA 4E5PA 1HF3A 3QOYA 3I09A 1RD4A 3DE0X 2PZBA 2BSXA 1F6DA 5ARDA 3SK0A 4X1YB 2CKDA 1PFQA 4H77A 3TSYA 3H9GA 3GLVA 3ENWA 4XYBA 1L5WA 2DWCA 2P4EA 5CK5A 5FRDA 4JQCA 2EHJA 2F6RA 4QTYA 2X4GA 2J5KA 3L4BC 4RCVA 4L0DA 1MXFA 4M46A 4CDRA 1XZQA 4KACA 3E5RA 5CDYA 4J7CA 1L5NA 1V5EA 4LHXA 4NZPA 2GPWA 4LQDA 3QK7A 3VBCA 4G1VA 1II8B 3CX4A 3B36A 4LBZA 4NBUA 3T7CA 4AXBA 1DMRA 1NBMA 3EQ8A 3PDCA 3PHBE 2PLRA 3MHTA 1ORWA 3S44A 3P52A 1RYDA 1UZAA 3VH2A 4K8RB 3P0HA 3TD9A 2F1HA 3GG9A 1L7XA 2BRUA 2FSPA 2FW1A 3OY7A 4IXTA 4QDJA 4Y9SA 5AVRA 1SXGA 1O6FA 3HVKA 3U7JA 3QELB 4O29A 2IEBA 1LQTA 3UH0A 1Z5UA 4V0NA 3V32A 2G76A 1OLSA 3PHIA 1NZDA 1XAIA 2AX3A 4GP9A 1GL9B 2VYFA 3MINB 2EKZA 4RF3A 5L4SA 4ZO8A 3CH7A 5D84A 4PR0A 2BVNA 2Q0QA 1SKUA 4WOBA 1T0BA 2ZB4A 2KSQA 3N1UA 4UW9A 1Y42X 4BUZA 3OTGA 5F1YA 3UPTA 1U4SA 4EPXA 5JJLA 2CKMA 1C0EA 3NS7A 4ZA2A 3DVRX 4QT0A 1X1CA 3GQVA 4FGWA 4ITRC 3HV2A 1UFOA 5A5VA 3BFJA 3VSBA 1A50B 3NOVA 5KJEA 1OAAA 4QXQA 5F1OA 3TJZA 4BFUA 2B5VA 4BEBA 2V4ZA 4DLTA 3NHMA 1R0RE 1HRKA 4FC7A 4FFBB 1G3QA 3KUCA 2B6NA 3RLIA 2YV4A 3NYQA 4F8JA 5H59A 1SHUX 3DMTA 3NBUA 5FOTA 4GRIA 1W0JA 3C3JA 4WA8A 3WNBA 4EHNA 1SCJA 1BG6A 1XU7A 1MUUA 1TTPB 3GA5A 2Q7DA 4QPJC 4DUYB 4TM8A 1GNQA 2ZWAA 3B2QA 4MLPA 3I4CA 1FFEA 2BBTA 2X3YA 2AH5A 1VFNA 1KIMA 2L2QA 4D6YA 2H0AA 3S2GA 2PQ0A 3ZNOA 4CV2A 2E37A 4DTIA 1UEXC 2GLUA 4KQXA 2J0QA 1E2NA 4LJYA 4YRPA 1KOJA 2R60A 1IRIA 3PF9A 3R6TA 1EXNA 2OAQ1 4FR0A 1QF6A 3DL2A 1CE8B 3H8WA 3I53A 2HKIA 3O2NA 5JCPA 2BDTA 2OORC 3V1TC 3GAZA 5CVVA 3HY4A 3L7LA 3ZWKA 4S3MA 1F48A 4A8PA 1Z6TA 4R81A 1P19A 4WUVA 1WCYA 1SA0B 2G1KA 3NHKA 4KGDA 3T1OA 1YJBA 2JLZA 1M3SA 3QX3A 1P2VA 4KE8A 4CQNA 2O2IA 4HYYA 4US2R 1W76A 1HPLA 2I87A 2UYHA 2QLNA 4OBWA 3FYSA 1OBOA 4UQPA 2H0RA 2PZFA 3G8DA 2HL6A 5J2UB 1IN7A 4JXKA 4ZTZB 1SJ9A 3DMGA 4DC1A 3ZVMA 2Z1MA 4KO3S 4L6IA 4OEHA 3AEYA 4RTRA 4A3SA 1AQ6A 3OZTA 3PBKA 4PIMA 1Y1KE 3PQDA 4JLKA 5ERGB 4JJ8A 3UXMA 2CXHA 3OLCX 1Y4AE 3QUBA 2RSLA 3UJHA 3U7EB 1T3LA 1ILEA 2DH6A 3SSAA 1P73A 1GPWB 1LJUA 1EFPB 2HSJA 4ALJA 1NLUA 2XNDA 4JBHA 1ZI6A 1GTG1 4PAOA 4XR4A 4M1ZA 1BYUA 1PJ4A 2OLEA 4L4YA 4QUHA 5KIAA 4BLPA 2BGLA 2AEEA 2C04A 3IUJA 1GDDA 2AHRA 3PNQA 1K75A 2H0QA 2BGNA 3RU3A 2Q45A 1HDGO 4BBPA 3IOMA 3LKBA 2G4CA 2H65A 3D4BA 3EVTA 5TMBA 3FVQA 1JHPA 4E08A 2Q8PA 2WNIA 3MUOA 4Y2UA 2QT9A 1BOFA 4JT4A 1P1CA 5DWDA 4AO8A 4UPEA 1HMPA 1B23P 1PEDA 1AD2A 1R0XA 1R16A 2P2GA 1K68A 3OT1B 3PFFA 3Q5EA 4TTQA 4GZ3A 3T15A 3TM4A 4C5AA 4CEIB 3CG0A 3K2IA 5LPNA 4CKXA 1DBRA 2NV6A 5AKHA 2AG8A 2X1LA 3BWBA 4X00A 1I3LA 3LBNA 4E46A 1XMSA 2ODAA 4DIUA 4TYMA 4XTCS 4BMOB 2I8AA 4L78A 1NJ8A 1R64A 5DEIA 1VG1A 3F6RA 2VUHB 1K6EA 3VAYA 3ZQ6A 1J33A 4P22A 5CA0B 4GL2A 1I24A 3KSDO 4ZT6A 1Y5MA 3QOXA 4YRGA 3TR0A 1HYGA 3BF7A 5DNYB 4YVFA 2ANCA 3V34A 5IC4A 3VHXA 4KQ1A 1N2HA 1A9XA 4S35A 4D9BA 1NW4A 3F8SA 1MD9A 2OESA 5ITZA 3DZGA 5C3UA 3LZCA 4L28A 4JYZA 3QSYA 3FW1A 1R0BA 1HFJA 1T5OA 1FUUA 3G8CA 1BEEA 2RC5A 3X1ZA 5E38A 4B85A 2VFAA 2GESA 5ICEA 5KTYA 2Y1GA 2WFAA 2K87A 5LQRA 5BVHB 3FLEA 4YJGB 2GM5A 1STOA 2JLSA 3GGOA 2QQGA 3H0EA 2ZOSA 3PNOA 3T5TA 4CTOA 1O58A 4BQPA 4YR7A 3ETDA 3GZJA 1T2EA 4GI1A 5CG2A 3Q2IA 2VJKA 4B84A 2O8CA 4M9QA 2FAXA 4LF8B 3LO8A 2NVOA 4WLOA 1S7CA 4H7PA 2H59A 5LZ4A 3ZHQA 5EINA 3E0QA 3QU2A 3RSZA 2WSYB 1P0QA 3O82A 5DNVA 1Z74A 3LQ4A 1EVIA 2B7CA 1C8KA 1KC3A 2D4HA 3D5QA 1TD9A 1TVKB 2CJFA 3BMQA 3EIWA 4O5AA 4XX1A 2R66A 3C6XA 4A03A 1G6HA 1XLWA 4HLNA 3VKFA 2FN9A 2WKPA 2V5UA 1U3VA 4OGLA 2RHJA 2FK8A 1KIFA 4I2VA 4G5HA 1YBFA 2AN1A 4O2AB 5JU6A 1OI2A 1U2RA 1N2JA 1IVYA 1WXXA 2R1VB 4YAWA 3KT3A 4E3WA 1J5EB 1U6KA 5AUOB 1KY4A 5FBZA 2DJIA 2ZB7A 5HIIA 3VKUA 2XECA 421PA 2R00C 4NEQA 1CUSA 1BDBA 3LLMA 3GXBA 1GA1A 5KTRA 2A84A 1K3TA 4QDOA 4C9BA 5IWAB 2XNHA 5ALJA 1RQXA 1JUDA 2ZCUA 2ZWOA 4MYUA 4Y2PA 1VE6A 4ZEMA 2GVZC 2WWRA 4IKOA 1JEAA 5JZBA 1SELA 3PGJA 5EZ6B 5AVXA 16PKA 1GL6A 2VJBA 4A82A 1W5EA 1JLRA 2IEYA 3QPAA 1NC3A 1NSTA 4LYEA 4DR3B 4M0CA 5AHWA 4E3ZA 3LGAA 4IH9A 1FF9A 1M6VB 3TMYA 3W2TA 4QJ4A 4OY3A 2OL4A 3BCRA 1FY2A 2GVDC 2HWXA 4Q21A 5CUQA 5L6MB 3QKWA 3WK5A 2QAGB 1BHO1 3I6BA 2ACKA 3PWSA 5ELXA 2DYKA 1FTNA 5AI0A 2YJTD 3ZVKA 5JH7B 1JXQA 4FGSA 1EIZA 2FUG6 1X7XA 2BMVA 1BOOA 2W6IA 1LDBA 4WUTA 4II2A 1JLLB 2YWXA 2OXIA 1Z7EA 3NI2A 5J2UF 1ZRSA 2C5SA 4OQQA 1O95D 1YF3A 3NP7A 4LJ6A 4GX2A 2RG7A 5EHXA 3ISVA 2QZ9A 2AZ4A 2WP0A 3UENA 2NXWA 4B6EA 2V9CA 5G4KA 4LC1A 3GLQA 3T4PA 1AUPA 2CK3A 2R6GA 3CX6A 1Z0AA 4IINA 4RE6A 3BTVA 3E0XA 4UM5A 1NLYA 1VKOA 1SK9A 4LJLA 2WAXA 3AIKA 2IHKA 2XJ9A 1GADO 2IYTA 1RWBA 1EHYA 3FMFA 5CFOA 3VYVA 3ZXYA 1JQKA 3TTWA 4C3UA 1XO1A 4FE4A 4RKEA 2OGSA 2X40A 1YBMA 2W8BB 4K9RA 5AK5A 1E59A 3O6VA 1D1SA 2WUVA 3RJZA 3TZLA 2HK6A 3ZDYB 1P2GA 2HJVA 2I34A 3OG9A 4MITA 5KWJA 1YU9A 5F9FA 2BZ1A 1G8PA 3HN7A 3M3HA 2ZT8A 1R9JA 3ENQA 4WIAA 1KJ9A 3F96A 5EG5A 1V3VA 2VUTA 3IEPA 4XUDA 4R8MA 2PKQP 1E2GA 4X9XA 4HCJA 4UBIA 5CH8A 4EHKA 4Z1MD 1XRRA 1PFUA 2A3RA 3ADKA 2AOUB 1AT1A 1M7HA 1ESEA 3D3EA 4QE3A 3TLYA 2OCBA 4ZPJA 1FX1A 2GD1O 5M2QA 1X80A 3OKFA 3EX7C 3Q15C 2C7VA 1ZPDA 5A0FA 3JZFA 3IJ5A 2IU4A 1K63A 5KU7A 3G8YA 2VDUE 3S70A 3EMBA 3M82A 3D4PA 5CA0F 4FFLA 2H1WA 2VDOB 5AWFC 2OC9A 1NBHA 2Y4NA 2Q1YA 2WU8A 5LZ2A 4KJZA 4PNPA 1VLHA 2IUSA 3TQFA 2C97A 4B9EA 4MV9A 1QE0A 2AC2A 2V4MA 3JW8A 4I9UA 1MP0A 1O95C 2XKAA 3GNTA 4MMXB 1WB9A 2PH5A 3MD9A 1CJVC 3HUFA 2G63A 5TF0A 3AW9A 5DTEA 5AVVA 4AQDA 4BNVA 4G5QA 1UM8A 4PQFA 3JZAA 4OK3A 3VNBA 1XZEA 1DZIA 2HF8A 3AZOA 2JGJA 1XJ5A 2ZKIA 3HSYA 3PGVA 3LUPA 2WPNA 1YRHA 2JI6A 3HWRA 1OFHA 4M88A 3TQRA 3ESZA 1QQ6A 1CS0B 4LI3X 2Z2IA 4BBJA 3WGGA 1GZ5A 2HSZA 3TUJC 3ZTTA 1PL8A 3A1DA 2GEUA 4GF5A 5CCXA 4D9JA 1JSZA 1G9XA 3B3FA 1IAVA 3C7DB 4K03A 4A26A 1CJMA 4X6YA 3RVKA 1UZLA 4JL8A 2RAFA 4PX3A 1JQAA 4E88A 1PQPA 5AKJA 3CRMA 1KVRA 2FK7A 1YOVA 2R1UA 2HFJA 2BKVA 4EP1A 1ZNXA 4O2AF 2JIDA 3KOMA 4FFOA 3UMMA 4K6GA 3TX2A 5JWHA 3DTNA 2XTNA 3UW3A 4G56A 1DFIA 1RZ3A 1XMXA 2QQEA 3KZCA 2WICA 4A0RA 4J0DA 1FTGA 2CSXA 2PGJA 2HW8A 1GN9A 1YQGA 3FDXA 1PLLA 4M9XA 1Z0UA 4H7HA 4WE3A 1BXGA 2VJPA 3FYUB 3JYPA 1Z6PA 1LGYA 2CB0A 1FDOA 4H7KA 3OE7A 2NSLA 5IFKA 4K86A 1NN0A 2OFOA 3ZLTA 5DM4A 3PR3A 3F73A 1H23A 2NU7B 2PSHA 3W5UA 1FDWA 2DY0A 4ZRMA 5BT8A 4PYOA 5T7BA 2DEUA 2QPOA 1VSTA 4RNDB 1EGVB 1IYZA 1ODLA 3EXIB 2ZBQA 3QYAA 5ITSA 3RU2A 3F6YA 5FFNA 1AM4D 1NQOA 2F9MA 1C3LA 1XDZA 3PQEA 1QANA 4R83A 4HNRA 2WUFA 3C4VA 5FUBA 4AJKA 4V03A 1L0BA 3V2UA 1CR6A 3JTMA 1K98A 4DV1B 1PTJA 3GP8A 4YQYA 4Q66C 3L0BA 3EZYA 4LJSA 4ZYTA 5JH7F 4P84A 4RGQA 5JVDB 1IBCA 1F20A 2CLOB 2F43A 1E9RA 1EUDB 1Z25A 2FDRA 4UMEA 2CNBA 1U7WA 4PHFA 5FPTA 3CVWA 1YCHA 4QELA 4BO1A 2D8MA 4BGEA 1RR6A 2E85A 1EZ1A 4RY0A 4F5EA 2ZSEA 4TRJA 3T5GA 3WBKA 5BNWA 5JT1A 1R12A 3KELA 1TRHA 3MTAA 4HNGA 3STVA 3DAPA 4I1UA 3TW6A 1KYXA 4DLRA 3ESXA 3K2BA 3HZZA 3LRTA 4WAUA 4H4EA 3ROPA 4C2UA 1NUQA 1ZA1A 1A88A 1F0PA 1NJ6A 1K3UB 1QFJA 1YRAA 1JIVA 2AFHA 2PPLA 3OAAA 3QPCA 5DISB 1AGXA 1XN4A 1N2OA 1AZTA 2SBTA 4L0CA 1SHJA 4NAUA 1V1RB 4JROA 4M7PA 1EE2A 5IN5A 3ZY4A 5A04A 1J8VA 1UFVA 1IONA 1C8BA 1KTVA 2WG0A 4FK8A 5ER6A 1JSCA 2O3SA 3WYCA 1S2NA 6GPBA 4R40A 4AJJA 3LK6A 2Z6AA 3HI4A 5EHNA 4QBKA 2ZJ4A 5EERA 1A5AB 4IG4A 3NFRA 1X0VA 3HWX1 5DNUA 3K5PA 4D5GA 3LV8A 1H6DA 3EVZA 2XDWA 5TSDA 4AFNA 1AA9A 1JB1A 2OFPA 3OIVA 3UB2A 1MRSA 5LQMA 1LH0A 3U3OA 1CZRA 4LV8B 4DQDA 2HEIA 3SNKA 1SXQA 3AVPA 1ID8A 5B64A 5BYAA 3F97A 3ESRA 3GJ8A 4HUQB 2J32A 4QBGB 3RWOA 2Z8YM 3GLHE 4G2TA 1P61B 2E4UA 2ZZKA 3UOAB 3W6NA 2HYDA 3KYIB 3ZCSA 1MNAA 2QNBA 1SQ5A 2H9AA 1UQRA 4FN4A 1KDOA 1L5QA 4MVJD 1FOEB 3CVOA 4G0ZA 4P81A 1QNLA 4TL7A 2AC7A 2J5RA 1KF0A 3H1EA 3PNSA 1Q0PA 3HBJA 1Q1ZA 3DV0A 4QWMA 5I9BA 2XCLA 2Y8EA 2Q6VA 1T5HX 2G9VA 4MQ4A 4X62B 1VYUA 2IE8A 3EDYA 2QIOA 2QQFA 3BULA 3L7JA 1CS4C 1KZ9A 3W7AA 1GNPA 4RY2A 4R5MA 2GCEA 1T4MA 1JJVA 1W87A 3GFSA 3QE3A 4U7PB 4B8YA 4ZVPA 2X8LA 5CX4A 1YR8A 3VMMA 1CEQA 2REQB 3L5KA 4PPGA 4V02A 4F86A 2CXTA 1IHPA 3R5SA 3HCOA 1VJ0A 3OUZA 2IELA 4LDZA 5LNK6 3LGXA 1TA4A 3EA4A 4NYJQ 1TMOA 5TJHA 3ZGZA 1PNQA 2KYRA 4C05A 5KYUA 4ZV9A 1JEEA 1BVYF 3KM0A 4PLGA 4DABA 1FNNA 1U0TA 3CLTD 4HNAA 4Z3OA 1ONSA 3CH4B 4N6GA 3HE3A 3C8HA 2XB4A 2VF8A 3CF4A 3IKMB 1H1TA 2QRPA 1UK6A 1N77A 4B7XA 4DIDA 3OICA 1L7RA 4K9OA 4WASA 4ATNA 1ZK2A 4XGRA 1NV8A 4YPOA 4YMGA 3RC3A 4QRDA 3BC1A 1E3IA 5H3CA 3MSXA 3L8ZA 1EK6A 3CZPA 2AR7A 1G8YA 1P5FA 2JGKA 1MEJA 3DEIA 2W6PA 5SYNA 1ML3A 4HAZA 3I8OA 3B6EA 4AD8A 2D1SA 2I1QA 2Q1TA 4RNCA 1JA0A 3PRYA 3F47A 1Y8AA 2YN2A 5EEGA 4E4TA 2QN3A 1PK9A 2GX6A 3MWFA 4FCWA 1QH9A 2P75A 3D6FA 5JECA 3GJQA 3GRAA 1LBSA 5B7NA 2XLCA 1Q6YA 2BEWA 1CHDA 1QHGA 1X7YB 1EBUA 2I2AA 2QPTA 2X0JA 3DE6X 3KXLA 2VO1A 2B1JA 2CMHA 4YNBA 4DADA 5FTNA 1DAPA 3PX3A 1RLMA 1RJDA 2Y1EA 3P7MA 4M9SA 1OXBB 4NCIA 4P7FA 4DYVA 4EM6A 2XEXA 1V45E 4R9VA 5IJ0A 2BD0A 3N05A 4RF5A 4TKVB 4XLZA 3FYTA 4YONB 3LYLA 3SEAA 1V8BA 4NE7A 2MYTA 3MC1A 1XEFA 3RYFB 4XJVA 5C8VA 3IT2A 1GPBA 4I6EA 4X45A 5TXGA 3Q7PA 3TW8A 1L1FA 3W06A 3K9FC 4RK0A 1DJMA 2O1WA 3WTCA 2DUMA 5ARBA 5LLTA 2QVZX 1TZMA 3G6KA 4JXZA 5AVYA 2QXUA 4UATA 1USWA 4H3VA 1MT3A 1XUOA 3CQ9A 4CKEB 5LUAA 1P7YA 5JVDF 1IJFA 1XP5A 3D8BA 1H93A 2LPMA 2ZJFA 5TQJA 3T3HA 4JNKA 2IOQA 4BNXA 3CKKA 2Q46A 2Q8QA 1NSYA 4RZUA 1PWHA 1K08A 2IS4A 3HA5A 4Y1FA 2GJ8A 3CWQA 1K89A 4MVWA 5BN5A 1WPRA 3NWJA 4DJJA 4Y2RA 4YIHA 1YB2A 5HRCA 3AF6A 4EH1A 3BE6A 1VHJA 3CF0A 4MWSA 3B82A 1ZSNA 2QM0A 5IARA 4OYYA 2MU1A 4ND4A 3AJAA 2QU8A 1HETA 3E7FA 1GTZA 3U0VA 4O08A 1HE8B 1XKXA 5A02A 5LD2C 3D3WA 4FHDA 1A27A 1QZXA 4YJ2B 1CUGA 1RSZA 1ZM9A 4HLQB 4MB0A 1C81A 1IUKA 3TXXA 4CFSA 5LLSA 2ZZNA 3CTPA 1N2SA 2GZDA 2HXSA 2I03A 4GC5A 1SIWA 4ZP1A 4HNVA 4QVIA 1CK4A 4QECA 3RVNA 1IY0A 5E6RA 1IM5A 3OJXA 4YCCA 1T0HB 1OFGA 4DLBA 1YWGO 1L5OA 1ADJA 3L8MA 2I8CA 3KP1A 2AVNA 4Z8XA 4HH0A 5DYTA 2G80A 1A8SA 3HO6A 2DERA 4KQCA 2QSUA 4AZTA 1EA5A 4LHEA 1PJTA 2MSWA 3CJRA 2ZPAA 3DZ8A 3SBOA 3O2JA 1F7UA 1ZNWA 4A23A 1NNUA 4CV1A 7AT1A 1K4KA 2VK1A 4TSFD 3IPCA 3UYLA 5IU6A 4JV5B 1RQ7A 2J3HA 1J22A 1TDJA 3L9WA 2PKWA 1NW9B 3CEHA 2VBIA 3C4JA 1JR4A 2X0NA 1E2MA 1FYEA 3N7AA 2VHJA 3BCHA 2EG9A 1PFKA 3KLNA 4AG5A 1IWOA 3C6MA 2JFVA 4CPDA 2ECPA 4MMZB 1JS1X 2PWAA 3FUWA 1KFJB 2FP4A 3A6FA 3WRXC 1ZUWA 4L08A 4LRUA 1RI4A 4AP9A 1QG0A 1LZKA 5KKCA 3WLMA 5GVSA 2ZIWB 2UUAB 2FFHA 3OD5A 3OIGA 4MRSA 2C2YA 3V42A 5CLIA 3LFUA 3QKUA 5CB4A 4EJ2A 3PUZA 5CMLA 1QGUA 2QB5A 3LT0A 3SMQA 3GHHA 1KRHA 2X7JA 2VJNA 2DHEA 2W71A 4KXUA 3B6KA 4ZVKA 5J1SB 1IBLB 1L7QA 5F7XA 1O5TA 4BUJA 5C31A 4WK0B 2P6OA 5F1PA 3A6ZA 3CISA 1NFFA 3TKAA 5D5QA 3LUFA 2GCIA 4H7EA 4YCJA 4DBLE 2A33A 2FDXA 2Z2XA 2QBYB 2W2TA 4FHEA 4FLEA 4IMPA 5IMSA 5EXXA 1K8YB 2WG2A 3FOZA 2P0YA 3DR3A 1NNI1 1NN1A 1TI7A 1VECA 1XZLA 3B1XA 1O96A 3R44A 4LDJA 1B1AA 2FRDA 5J59A 1TYZA 1U90A 1SY7A 3QU7A 5CNIA 3WGLA 4XX0A 3BRCA 1P9LA 1O8BA 2PRJA 3ML1A 5FOQA 2OD2A 2XQIA 1I4EB 4LBYA 4KI0A 1OV6A 1LRKA 4HDKB 4TWJA 3DKIA 5HE9A 4RY9A 1PJAA 3L6BA 3MHPA 3OPQA 1DEOA 1R8SA 4KPGA 1PCXA 2YUIA 2ZAOA 3LX8A 1P18A 2FEWB 4CDMA 5DHUA 4ALKA 2OCLA 3ICEA 2E9SA 3HDJA 1CZHA 3PHJA 1J2YA 4ZALA 2YWEA 4ERXA 1B73A 2DPYA 4YI5A 1EP2B 1TYCA 2Z8YA 4EMBA 5JSZA 5DTJA 1X1AA 1ZEMA 1DJOA 1C2YA 2Z83A 4RDIA 1HM5A 2CXUA 1ZXXA 4J4HA 4HXFB 4G36A 4Q3CA 1Y8ZA 2YFQA 2WFLB 3ZYZA 1NQAO 2CLSA 4ZAZA 1ZGAA 3BD9A 3K8OE 3JQAA 5FYDA 3UN1A 3AEKB 1QH0A 2DSNA 3FCXA 4IEEA 4KGZA 2J3IA 3JATA 2R68A 2VG8A 1T34A 4MPDA 1E2LA 3ZV3A 1O77A 3FKSA 1S1MA 2KLBA 1JYSA 5AM0A 2I4OA 2PNFA 3GGGA 5JRJA 3H4TA 3OOHA 3O7WA 4M8KA 2QY6A 4ZYYA 3I2YX 3QEKA 4IBOA 3PJEA 5K0CA 5L3QA 3QUTA 4N41A 1ULAA 2PU5A 3CV3A 4COKA 3BGVA 3UT5A 1S3FA 2IPLA 5HKLA 5B58T 3BTOA 5BR8B 3PB3A 2RB5A 5C32A 2B4YA 5KOHA 3FSJX 2BI4A 1JXAA 4F8EA 4HKTA 2XB6A 2NOAA 5FBWB 1TJ3A 4RKRA 1I4DD 1XXHA 3A2KA 2IU6A 4WKPA 3RSLA 1TCUA 5KC9A 2CL5A 1LSOA 4IOLA 8OHMA 1EDBA 1VL1A 2IOFK 3LCCA 1DPGA 3K71B 3VHLB 3WO0A 1PGQA 1R0LA 4O2BB 1VE7A 2CYBA 3I6ZA 3ENVA 3R8XA 3NJ8A 2ODNA 4V0KA 3BQMB 4N9QA 1L5RA 3ZY3A 4YCMA 5K09A 1H8HD 4YJ2F 3D2CA 5A4KA 3DT9A 3CS3A 1R4MA 4WOJA 1CF9A 2X2PA 1YZ3A 4MIEA 4ON9A 3GMSA 5DCUA 3O8OA 2HRBA 3ZBUA 1QGOA 3M6LA 1PYDA 1H4SA 2DPGA 3DDUA 2ZJ1A 3FOCA 5EKUA 4B45A 3GLRA 3DDSA 4KO2S 4HS9A 4RFSB 2JVKA 3PEEA 4Q9NA 2MSLA 3QU4A 3HWWA 4U9HS 3C0KA 1PLJA 3ZDXB 4NFLA 3HMKA 3KEMA 3COZA 2RI6A 3N28A 1CW2B 2DPLA 2QZSA 3P1JA 4UDOA 5K05A 4AK9A 4B32A 1E6UA 1YDMA 3NTRA 1V2GA 1HDEA 3DGEC 5CM9C 1Z8FA 1SVMA 3O4HA 4CQMD 4RTKA 1ISFA 1Z18A 4C4PA 3B6MA 3D6UA 1EJBA 3VPHA 3ACDA 4XVCA 3KAJA 1YJ5A 3CT4A 3GRZA 2FN3A 4MB2A 4I8XA 5FD8A 1EA7A 1LSSA 1O9GA 2W83A 3P19A 2ZJ2A 4YRMA 3ZHSA 4ZRDA 1OREA 5ICGA 3EVNA 3SS8A 3KPWA 3RS7A 1N7IA 1EQAA 1PR2A 2WJIA 3K53A 3RS5A 3PKJA 3PGXA 3OO0A 3VR2A 1Y6GA 4Q4DA 4DJEC 3VPFA 5A3QA 4TXNA 3E7DA 3GVIA 3C74A 2XQFA 1ADCA 3HZOA 4MYCA 5AM4A 4YH1A 3RUCA 1OVMA 5K6AA 1C3XA 3KEGA 3DZCA 4WXMA 2P6MA 5FPKA 1Q11A 1MABB 1VL8A 1XL0A 8ADHA 5EMKA 3LY7A 1JDTA 3SE0A 4OX9B 4MUMA 1L7DA 4HFJA 1NXTA 1E9EA 2QSYA 1I2AA 3P9QA 2BUBA 4NS4A 4C22A 1GZSA 3DTVA 1VYTA 1RBZA 2ACWA 2IV2X 5JAPA 1A2BA 3WAKA 5JYBA 4N7BA 3CLSC 1W35A 2CHUA 1EG7A 3HLTA 1T9AA 1Y3CE 2XODA 4MQEB 3SKVA 4YMLA 4EF4A 3GJSA 1DKOA 4BVLA 2R4UA 2RGNA 2Y1DA 4OLHA 2YMLA 1SHTX 1JTFA 1UEIA 4FW8A 1VSQA 4C0BA 1ZM3A 2C8LA 3HEMA 1KI7A 4ETNA 4AUMA 1KE1A 3SZGA 2OMEA 3JASB 4RQUA 1ESDA 1SOWA 3PNKA 2PUJA 1MTZA 3HZHA 4J3JA 1FYDA 1S1CA 1T5TA 1VIDA 2G70A 2W2QA 3JQEA 2GJKA 4RD3A 1JEOA 3GROA 5CT5A 5F2OA 1IM8A 2O0LA 4JLVA 5WRFA 1H9CA 4CM5A 3ZS8A 3KTAA 4BQSA 3T0IA 4RTQA 3M6WA 3LKZA 3QX8A 4N40A 2OXCA 4LX8A 4Q7MB 1N8SA 1M6HA 4WFQA 2NNWB 3DL0A 2GSDA 4TL6A 4B2PA 2QRGA 2ADFA 2FZGA 3CEMA 1DG1G 4WN9A 1VSBA 1EFKA 1NKSA 3K1AA 1H4TA 4PV7A 3INGA 1Y89A 4EVQA 4TUYA 5HW0A 4Y6RA 3GRRA 2PWZA 1UKAA 3GBPA 7REQA 2MSEB 4DJ5X 4OJQA 3OF5A 3AEXA 3SJ7A 2GHQA 3PGLA 4NK5A 4GYJA 4D74A 5JANA 2A8YA 4I66A 2H2DA 3C3MA 4G86A 1DUIA 4WL0A 4A5SA 3VYTB 2HLPA 1CD5A 1O89A 2C5AA 1MB9A 4D81A 1JA9A 2XCUA 4RLHA 5B2ZA 3B6IA 4P93A 1C7RA 5EXDA 4IDPA 1DC6A 3MTJA 4AMBA 4BJ6A 1DX6A 3KG2A 3UJAA 1LEHA 1OFUA 1EMDA 4OKNA 3CLKA 5M29A 2PZKA 3AUFA 4ZCSA 4G84A 1DEKA 4IVRA 4K9PA 1IJBA 1USKA 4OQLA 1QP7A 3IV7A 3DB2A 2IYZA 3MOSA 4R9UC 3SLKA 4YT4A 1Z0KA 1V11A 3BICA 4O2BF 2YYSA 3UB4A 3MJSA 4IIXA 4EUFA 1KMHB 4UXHA 3UM9A 2HN9A 5CG1A 4EA7A 4JEUA 2D7DA 2ZE8A 3KL2A 1DT3A 4OSOA 4I9GA 3PFBA 2GEJA 3I5XA 3RV3A 4AX8A 3P2KA 3GNQA 1U8YA 2OBXA 1A5TA 1VBMA 2H08A 2HIMA 2HQBA 4GU5A 5EYPA 4YRLA 2P9BA 1P9NA 3OEHA 3EGDB 3IPAA 4C21A 3CFYA 1FXUA 2IUEA 4CCAA 4L8WB 1IOZA 2R7AA 4U7JA 1I5EA 1USVA 2DC1A 3MWEB 1JG6A 1QIFA 3EXFB 3D7MA 1N92A 2MIIA 4QTUB 2FUEA 3RGGA 1SVOA 2XRFA 4LYJA 2UVQA 4CKCA 1BE1A 3BMCA 2C7QA 5I7HA 1KEWA 2BCEA 3MIZA 1EE1A 1N9ZA 3A6DA 4HHEA 1YMUA 4OHWA 4KWHA 3ROQA 4KQJA 3ZDEA 2NSHA 2ZTLA 3E27A 1MH9A 4AF7A 2EX0A 3JQFC 2XTAA 1YFZA 1UC8A 3IIJA 2J3DA 2ZJOA 2R8EA 3LDAA 4X1KA 4LC0A 2QU7A 1QRUA 4PZZA 3SE7A 3EMDA 1RIFA 1E5XA 1O2DA 2V0CA 3HUTA 3VPBA 4C1NA 2PMKA 3IBSA 4NLLA 2C82A 3E15A 3K94A 1IC6A 3ZD8A 2YXLA 4A2QA 2C7OA 1XQWA 1WPQA 2OV4A 3NCHA 1PX0A 1QR6A 1YKGA 5I8PA 5CLFA 3BIWA 3DHYA 2PJZA 1I6MA 2C9DA 2OCYC 4M7RA 1E2UA 1FFDA 3NVKI 5BV2P 4J9UE 3W5SA 3ONNA 5U9CA 1MC8A 1T8TA 2G4LA 2JFBA 1Z3IX 3QUQA 3C43A 1XTRA 3MBIA 2ZDGA 4W63A 7MHTA 5D51S 1ENYA 2V7TA 1C3OB 3IXMA 1DKRA 2P9HA 1P17A 1Z2CA 2OC4A 3EVAA 4MR7A 4I1OA 4QXRA 3WHLA 4DCVA 3LQ1A 5HXAA 5IAJA 1V39A 3IUSA 4AZ0B 4XTRA 2GRJA 2PEYA 1P91A 4HQ6A 5B1DA 3LQRA 1E2IA 4UFNA 4ND2A 4URUR 4EKYA 1A2OA 5CFMA 1J99A 2EV9A 4F56A 3KJXA 3ODPA 5TPWA 1XRNA 3V1YA 3EAFA 2Y66A 4C6TA 1RMQA 1ICIA 1T9DA 4O0LA 3KSUA 3BL8A 4QXAA 3RAPR 1OWPA 2VJDA 3DAYA 3AVTA 1UQTA 1OU4A 4DVJA 4FN5A 2X0EA 3G7UA 1DAHA 5K0TA 4BC0A 2VUIB 4WXHA 4UZSA 4QGSA 4N8SA 3UNXA 3TRHA 1CQWA 3BZUA 1GA4A 4O8CA 2DAPA 1N5DA 3ICWA 4L5IA 2BFEB 5FI1B 4ZYWA 3DW1X 4J6FA 1C9NA 1K5DA 4MINA 3UAXA 3RQIA 4I6JA 5L3VA 1CC1S 1PUXA 4EMUA 4RVCA 3L4BA 4BIMA 4Z9AA 4R41A 2QMOA 3K6SB 4QTXA 3HGQA 2IDZA 3BA6A 3T5PA 4D0RA 3AH8A 3FYHA 4MUYA 3TZKA 5EJ6A 5MFZA 4LFBB 4YDRA 3NBAA 3I6IA 1IBSA 1Z07A 4F8YA 2JFUA 2HK9A 1P7ZA 3E1KA 3H9QA 1QV6A 3T1NA 1Z6ZA 4X20B 4W8HA 1FCJA 1WY5A 3PE3A 1FNCA 2WZCA 3IVRA 2ONKA 3W5CA 1EH5A 3L5OA 3MVEA 2VRCD 1HLPA 1W6UA 2P7HA 2BKXA 3NAQA 4LOHA 1ZS9A 1J56A 1E63A 1VKNA 2CC2A 2QL6A 2QLFA 2XI4A 4IDHA 4L5YA 4GI5A 3KQHA 4I5EA 4X61A 2H9IA 4Q16A 4AKHA 2O3UA 1NJ5A 2F8MA 4GVLA 1Z13A 1O4VA 5GJCA 1JFSA 4HX5A 1CNFA 1XG5A 1Z22A 2VSXA 1VB5A 2WTEA 3IXQA 4JL6A 2I33A 4ZGGA 2FPPA 2OHIA 3KX2A 2IP4A 4H60A 4JOQA 1E5VA 4K9DA 4J4BA 1E1KA 1XDDA 2YWHA 4DQLA 4Z3KA 5EXPA 3JARB 4PBRA 2YS6A 2IZ0A 4ZCQA 1GO2A 4EQZA 1TUGA 4KHZA 1W73A 4M8SA 4JVSB 1NQUA 1M74A 3PA8A 1H3FA 1LDYA 1MJGA 3K73O 1L4YA 1NKTA 2IKQA 3OPVA 3O4GA 5DYWA 4TT8A 3TOCA 3V7NA 5I4IA 1NPTO 3SEQA 1HDXA 1NQTA 1TM1E 2OM6A 1QG2A 4KRYA 2QTFA 1VGVA 4ER5A 1GLGA 2QTVB 3EG5A 4O4HA 3WGOA 1CJTC 1UM9B 1WZCA 3ZWWA 4HGQA 2DGDA 4OHUA 4UPDA 3W05A 2V9PA 1SOMA 5A2GA 3J81A 1Z4LA 1MJFA 3UKOA 3IJRA 3QPVA 5K3BA 1SXHA 3H2IA 1W34A 4FFDA 3BJRA 4KGXA 5CTJA 1VLQA 5G40A 3WGNA 1NN3A 3DYBA 2V7QD 1C5KA 2X15A 2OLKA 2OORA 1IN6A 2XMDA 5D3ZA 3ZU5A 3TPZA 4JMLA 4TQUS 5ESRA 5I8WA 4D8XA 1JXOA 1RHMA 2D54A 5C8YB 4LI0A 1ZA2A 2WG1A 3A4LA 1PBNA 4F96A 4MUIA 1DG3A 1Q44A 5GINE 4P08A 2GPBA 4K8OA 4YUVA 3HPQA 2GYWA 5DK6A 3G5LA 2L42A 3ME5A 4PAMA 2V3WA 4ITUA 4MV5A 1DCKA 3DAOA 3NORA 3KT8A 4MV1A 3D3JA 1K6XA 4HQRA 5KOJB 2GAFA 4WNCA 2A0UA 4C14A 1XX6A 1IOLA 1UMDA 3N8DA 1XVAA 1Z06A 2GA9A 3OJLA 4MGEA 5E4YA 4EJSC 4F3YA 4DCCA 4XB1A 4ETIA 4FSXA 3WKEA 2C5GA 2C83A 4LJ7A 4DDUA 3QJGA 1IN1A 2PX3A 4TTSA 3E9RA 4Z53A 1CQXA 3WHPA 4MKFA 4HGZA 1UOPA 1JJAA 5J63A 2VOJA 3RTBA 2PUCA 1KZGB 2IPOA 2RI1A 4U7DA 4IIDA 5HCIA 4EKNB 4RSRA 5E8JA 1T3TA 2IHZA 2ODTX 4EB6A 4X0EA 1IZ9A 3PA6A 1A71A 3LE8A 4Z9FA 2IXAA 1VJRA 1OLSB 2EQBA 1EWKA 1Z7BA 2BHTA 3SGLA 3SJUA 3TSOA 3ZWDA 3NXSA 3QVGA 4GT1A 4QVGA 4RA6A 1IXSB 1O7JA 3F3YA 1E3MA 1ZK4A 1C1HA 5I4CA 3FSEA 1SKMA 2EX4A 4UTPA 4GBED 3SQOA 2Q5LA 3SHTA 5BN3B 1EPUA 1Y3DE 2QD3A 1CETA 1M1XB 2FWBA 2W6JA 3GAMA 1GGEA 5CDUA 2YZGA 4RPLA 1KDVA 1DAFA 1DC3A 2PKYX 4PLTA 3H7IA 5LMNB 1BAPA 1GGMA 2IEAA 2VUUA 4QFMA 5DTMA 2XYRA 4QA9A 1G3RA 1M1NB 3QMVA 1JU3A 5EE0A 1S2GA 4OGFA 4EG8A 2QZ4A 3QYPA 1CRLA 2ZSKA 2F1IA 4YRRA 3PNBA 1VDZA 2QR3A 1XTVA 4WZBA 4IFBA 4MQFA 2MOKA 4LV5B 4OFBA 3HYNA 1NXXA 4RGBA 1BJRE 3LYUA 3KZ1E 5GV7A 5JSUA 3QPUA 2JJ1D 3SZUA 2FW9A 4L8VA 4C0HA 3L4JA 5HJEA 1UPFA 4M55A 4JUAA 4YIKA 3QU5A 4QPZA 5KSZA 2FZ4A 4PSKA 1YQEA 1Q74A 4CN9A 4H4DA 2WU0A 1X70A 2QAIA 2NG1A 3CKMA 4O6VA 1E1CA 5HIMA 4B2LA 4URXR 5EGSA 4Q1DA 4BQEA 1GKUB 2V03A 4IGIA 1MW8X 3QFSA 5TARA 4YHHB 4N49A 1PFWA 3RG2A 1RWXA 5HK9A 4MAFA 4S1OA 1PX2A 1YS9A 2HSGA 4N7RA 4YJ3A 1I7SB 1Y33E 4UEJA 3UMRA 1YE5A 4UUNA 3ECAA 2Y0DA 4RVSA 1OB2A 2O8FB 4JZYA 4N65A 4IHQA 1M1ZA 3AERA 4OHKA 4ASUD 4GGOA 2WUDA 5CBPA 1MA0A 4PYRA 5F4BA 1PWZA 3Q3EA 4YDHB 3D2AA 2BMEA 2H29A 2W93A 1Q7GA 3KEOA 4P3KA 1KFKB 2OFWA 3SJBA 5CD1A 4KE9A 1PJ3A 3R9XA 1CUYA 3JRWA 3U5TA 2AFIE 1BTOA 2B4QA 2H4YA 1X8JA 1BH6A 4AZ3A 4N5MA 1IZYA 1SU4A 5ECYA 3TNDA 4LZZA 3TINA 1ZD3A 2RGUA 4YY3B 3IYLW 2FSHA 3A1VA 3D4LA 1JHDA 3OU7A 1QLJA 2J6BA 4JHLA 5IN4A 1WBJB 1GXSB 1NVTA 1YIOA 5IDVA 1QHIA 5IKPA 2P90A 1FK8A 2M6LA 2R00A 3MNFA 4XWWA 1TK3A 1QBKC 4BTVA 4ZI5A 1X13A 3IT1A 1K8XB 2G28A 2XV1A 3P0EA 3LIPA 4HDNA 1KJNA 5A6SA 5JBNA 4C78A 2J3LA 4KQIA 1LZLA 3QWHA 1QGED 3ZHVA 3CVYA 2O8BA 2JH9A 4PC7A 3DM9B 1CZNA 4TSKA 5A4FS 1ZRMA 2WIFA 4OI1A 5FA8A 5IYZA 6AT1A 1PJCA 4RZHA 1VM6A 5H68A 4AKTA 3R23A 5FWNA 4KLRA 4UE6A 5IAEA 1YJXA 4TX1A 2VTBB 3E9DA 3O2QB 3OQBA 4WKOA 5JXWA 3THWA 2QTHA 2A0FA 1M34E 2GN6A 1FYWA 1QYIA 2Q62A 4R3UC 1R66A 1DBIA 5KYNA 10MHA 3BB1A 2OXRA 1Q1NA 3PPVA 4TV8A 4R7TA 1ZD5A 3ZBTA 5PNTA 1G5PA 3WDSA 2O5VA 1I7PA 1UBCA 2G1JA 3HHPA 3N39C 4GE0A 5CT4A 4F6RA 2AT1A 3PWZA 5EI5A 1H2BA 1SG6A 1VHWA 4BASA 3D8TA 2J33A 4L50A 1L4HA 2L17A 2P3SA 4YMWA 3VHXB 1I30A 3HR7A 4B33A 4RJTA 1A9XB 1WHTA 1Q14A 4IF6A 4B73A 4Z7OB 5ITZB 2PRYA 5JC8A 5BSRA 1P9RA 2TYSB 2FNAA 1QRSA 4NG4A 5K8JB 3IPYA 3R0JA 3ZI4A 3WQHA 5K3SA 3U7IA 3TLKA 5M7EA 2HUNA 5KX5A 4PINA 5SY4A 2ZRGA 2BWJA 4EPWA 1N7HA 3C3YA 2NXEA 4FIZA 4IAOA 5FOVA 1F8FA 3B2EA 3OQPA 4R1PA 1HYQA 4DNXA 2GNPA 3U56A 2O8CB 4YRFA 3WDMA 4F5DA 5LQSA 4IHJA 2WWWA 4M1WA 3G88A 1M8JA 3OCYA 1BU8A 2OV8A 5IASA 3BFPA 4RDHA 3AC0A 5AW6A 4KFSA 4H1UA 2RHTA 4CIAA 3AWDA 4DV0B 4X66B 2WJJA 1T2NA 2ZJAA 1NQXA 1NRJB 5I9TA 2ZRPA 4BFXA 3ZTWA 2FQQA 3BMQB 3RRNA 2XGOA 4ESEA 2VK4A 1YRYE 1E7MA 4LWOA 2Q4RA 2I71A 4HN9A 2J07A 1L7PA 3N3AC 3T7DA 4L7VA 3ADPA 2W58A 3OZXA 3G1UA 3KUUA 4MKHA 1BSVA 3MA0A 5LOVA 2FFBA 3QW4B 1ZDMA 1NONA 2WDZA 5H83A 3UJNA 3ANLA 2PYDA 4HEJA 2E5LB 3L1UA 4GR9A 3ZVNA 2PSDA 1X7DA 3O8NA 2Y2UA 5T5QA 4EK9A 2D7CA 4EEXA 3FF4A 2YYAA 2IEGA 1Y6RA 2ETXA 3N8NA 3HPRA 3CF6R 3RAEC 1ISGA 4BMCA 2ISQA 5NULA 3VMFA 1QYWA 1HC7A 3LHKA 2D8AA 3JYLA 1LFAA 2A59A 4MO9A 4C08A 5K8CA 4P5EA 1CKEA 1O95A 4DTCA 2Q4BA 3IKTA 4BNKA 1NY5A 1RYEA 1JL3A 4HN2A 1U1IA 1MG5A 1WSDA 1QJCA 3ZI0A 2FPSA 4BNZA 5C1PA 3C4QA 2X0DA 2I91A 3PRKE 1VYHA 4FHGA 5B12A 3VC7A 1XVUA 1U2EA 1S2LA 3ANTA 1RCUA 3EVCA 3ZZMA 4ZN6A 4P34A 3C24A 2WHPA 4YCDA 1DUVG 3QHQA 4DBLC 3NUZA 4HEA6 5LYYA 4CMGA 3S29A 1DRJA 1AH2A 5F51A 1ATIA 1CY6A 1EKXA 1G17A 3D59A 3NDIA 4JDPA 3I12A 4OQ4A 1O97D 4QPNA 3ZH2A 3RSGA 5L4NA 1T43A 3G82C 3A9CA 3QF7A 1M2NA 1M1YA 2BN4A 4RV5A 3IIMA 4P82A 4EO4A 3UK7A 4BKQA 2HM7A 1G98A 3THRA 1UBEA 2FZ5A 2VYVD 2YUTA 1FFWA 3QEMA 2ZW9A 2CLCX 2O07A 4GOMD 3VR6A 4ANFA 3AI2A 1EFDN 1GUAA 5FV7A 4H35A 5G4KB 1GCUA 5HMLA 4A16A 5LQUA 3GEMA 1ZVVA 4UEWA 4Z1MA 2VKQA 4ZOEA 1EINA 2FF5A 3COPA 1IK6A 4I4IA 4XXHA 2X0FA 2YVUA 1NBIA 3HJHA 1CUCA 1SCBA 3U60B 1NMYA 5D3MA 2YX1A 4K05A 3G85A 4BPRA 5DI3A 2F9FA 3B1WA 4XYGA 4B7AA 2EIXA 2P0AA 4J2OA 1FFCA 1E2KA 3D81A 1CB0A 1NX6A 4KIUA 4W1RA 3W5JA 4K7JA 4LPSA 4ZZIA 4GX0A 5HG0A 4JJGA 4OMDA 2QVYX 5IVIA 3A1EA 4G0MA 2WA1A 4MTCA 4JU8A 4D9KA 4R1MA 3R9KA 3MPUA 5CB8A 4IJMA 5J5VA 1Z2NX 2B4KA 3BXEA 3SFVA 5BPHA 3U19A 4EUNA 3STUA 1OXSC 2VRWA 3JAWA 4LSGA 4GYYA 4L85A 3JQ9C 3AGQA 3ZE2B 4Y7CA 5BSVA 2BFDA 1U4OA 3G1TA 3P5BA 5KWEA 2GSWA 4L4UA 3CNEA 2XUOA 4EMTA 2Z8ZA 4OI4A 1GSOA 1M54A 3HCFA 3TVYA 4R0MA 1M0WA 1XTBA 2QGFA 1RJ9B 4KNYA 1QPGA 2ZBRA 1X80B 1PS9A 2YICA 3SDZA 4BAUA 1BFDA 3TCNA 3ZE1B 4F3CA 1GPKA 1QRAA 1Q16A 1HE3A 3ENKA 2NTJA 2DCMA 2IT1A 3JVEA 4PICA 2R25B 2XTMA 2XEDA 4O4IA 4ZYUA 5AM5A 3I9NA 4R3NA 1O97C 3GPDG 5BXQC 1TZ2A 2AOXA 3AFHA 1G0NA 4GMXA 2G7MC 2JK1A 2R6R1 4IM7A 4DOMA 4IJVA 3W9YA 3A1WA 5B3LA 1GARA 3HXQA 3TLZA 5CVTA 5JNWA 5ALEA 3DAGA 5IZCC 2Z3WA 3MXTA 3VOSA 2ONCA 3QLVC 2CXRA 1JLKA 3R4CA 4KQFA 2YJ4A 3WLJA 4MCHA 4NOKA 2ZB3A 3LT2A 3R5FA 2QI9C 1QRTA 3FWNA 3CNQS 2W6QA 1YZFA 3HUDA 3IUPA 4P9NA 4X94A 2ZBGA 4M9UA 3ISJA 5F5XA 2JEYA 1YK0A 3HB1A 1NR1A 3FMPB 1IHYA 3C39A 5AW2A 1L4GA 3TB6A 3OWXA 4O2LA 1HI9A 1IOWA 1UDCA 4OP1A 3H04A 4HXGA 3GJXC 1Q7BA 2IYUA 2P3LA 3L2OB 1D2HA 1YS7A 3AONB 4MR8B 1XE3A 1VHTA 1EBFA 3DF7A 3H5WA 5KJ6A 3QI2A 4FT4A 3O8QB 4C4YA 5HM8A 2OO7A 1JG1A 1YOVB 3EARA 4NJEA 1JZQA 4CLEA 5LNK1 1KDYA 4DDHA 3NAGA 3CF4G 4KXNA 3VYRB 4BNGA 3E48A 1VZ2A 3MJVA 1PGJA 4BNYA 5I6DA 3C3PA 5JPCA 4YP6A 1DEXA 5EJ9A 5F23A 4HDMA 2HGZA 3NIDB 1BXGB 2O0JA 2ZTHA 4QDKA 3V33A 2QYTA 3O9ZA 4LAFA 4PSUA 4YAOA 4ZMRA 2JFXA 2O2EA 1VHLA 2WD8A 1ELOA 2EOAA 4P3XA 4BBZA 2W4IA 3FAZA 3TBHA 2VP2A 3N5CA 2D1QA 2ZWMA 1L8LA 1F6BA 4RWZA 3PXAA 2A92A 2JAWA 4GUDA 3EGIA 3ICOA 2ZXUA 5JHHB 1GKIA 2VCYA 4X44A 2FRVA 2QRNA 2RHLA 2YXBA 2ZWIA 2XB2A 1EFLA 4YRAA 4BNFA 1H8ED 3LUDA 1LLDA 3EGVA 3DEYX 4DPMA 4YAFA 2V7WA 1W2GA 4PZ9A 2AJ8A 5SV2A 3RU7A 3UY4A 2PH3A 4I1IA 3TX6A 3A28A 4D5EA 2C8KA 1UBFA 4GX1A 2ZRNA 4LHVA 2F43B 1EHCA 4NDAA 4AWBA 3BQNB 4PZCA 1Z26A 1Y9ZA 3HVIA 2VJCA 1H2FA 3WP0A 4ETMA 3LOUA 4TL9A 2C5FA 3LY9A 4CV3A 1XMVA 1YC5A 1EESA 4CG3A 1UH5A 1NW7A 1IN8A 2A5GA 2E1PA 2YJNA 1ZC3A 4MPTA 1KAOA 3KE9A 2QORA 1K6IA 3IUNA 1D1PA 2AFHB 2JKYA 5IX8A 1IAQA 1JR3E 1WW3A 4HQFA 4KAFA 4P7JA 1N2IA 4ZVTA 3UJ7A 2LCQA 3O2SB 2XVYA 4JFAA 4M99A 4U5XA 1JKJA 1ADGA 1ZQ1A 1AN9A 3SY8A 1AQLA 4TRNA 1BNCA 3Q8MA 3OT4A 3PS9A 4B4DA 5KNDD 4KVAA 5KWVA 4P53A 3EZ7A 1Z5OA 2WAAA 1NL3A 2O1EA 1TYDE 4TT3D 3VZPA 3WWZA 2FPIA 2HWUA 2QR5A 4F2GA 4BNMA 4EF5A 4CFZA 3UBTA 1GG8A 3OTOB 2H7CA 5EUCA 3GIWA 1Z2DA 2F64A 5F7ZA 1MX5A 1BRMA 3S5JA 4KPUA 1U7XA 1E1DA 3AF4A 2EFDB 4IIFA 3RR2A 3EXHC 4OQDA 4CL3A 5ALXA 2FCRA 2ZYGA 3JWIA 4P83A 4A92A 4CQJA 1B4DA 1KOGA 2IZ5A 5HWSA 2PXXA 5IDQA 1ZK0A 3MT0A 4HLDA 5JADA 2I7CA 1TGVA 2NO1A 2EL9A 2YH2A 3WWEA 2UZ4A 1E9VA 2DBYA 5AJXA 4OQMA 2FQYA 3GEBA 4LVOA 4YTEA 1SVNA 2YWCA 3WX0A 2IHVA 1TM2A 2VT6A 3R7DA 4YBRA 1NJGA 3UKJA 1YZLA 2OCKA 3U39A 4CIBA 5BOVA 1G4AE 4G0NA 1JNYA 2V0GA 1YB1A 2E5FA 3F7MA 1BO6A 3IUEA 4AKGA 1XA0A 4DCMA 4EGFA 3Q88A 4I1PA 3CWCA 1RQGA 4QOEA 1IB6A 3VZCA 1OJLA 5F2EA 4KFTA 2CLFB 2XZPA 2AQIA 4HGRA 5FOSA 1K88A 4R1UA 4TTRA 4F46A 1PNRA 3OZEA 2ZULA 4BX8A 2HRQA 3WV4A 3OO1A 4PWYA 1CUBA 3ST7A 3HO8A 3EPKA 5KYUB 4E5NA 4RORA 1PUJA 3QVLA 2IPMA 4R01A 1TQDA 2H11A 2ZJ7A 4HNAB 3KUDA 5E2BA 5G0VA 3G9UA 3W2FA 5JNVA 3ZWOA 1UIMA 4EW2A 5DGCA 5CD9A 1X38A 4ID3A 3SS9X 4X93A 3WLLA 2CFSA 1M8PA 1KFBB 2OZVA 3RF6A 2DHRA 3ZWCA 3I05A 2XUAA 2D00A 3LC1O 1JBEA 1K8RA 3HJAA 1SBNE 1M2HA 3KU4A 4IQ0A 4KQWA 1ZU4A 1DAKA 1JEQA 1H2HA 3A3OA 4UNQA 3NDJA 4NYMR 3ZU6A 2H1IA 4YMHA 1SN7A 2KLHA 2JEZA 2YZ7A 4DAOA 3TYXA 4BFLA 2VXBA 2EFYA 5CDSA 2BHSA 4RK4A 1JDBC 4OU4A 4BCBA 3R3VA 1B6TA 3LXRA 3EQ2A 4Q3KA 2WWIA 1T8WA 2BEWB 2FV8A 4QDXA 3WRXA 4BLTA 3SS7X 3COYA 2IGTA 4CN8A 3Q41A 4AY2A 2OB1A 2RGDA 1RC1A 2PSJA 4ZC8A 3VSDA 5IJ0B 3IQFA 4GMHA 4AXXA 2R1ZA 1Z0ZA 4D0LB 4F6LA 4JLOA 2JFPA 2X5OA 1X15A 2N9UA 1QVVA 4OYLA 4UAJA 1GCGA 1WQ4A 2W0SA 2IOYA 4XA8A 3TW8B 1KMQA 3DEHA 1Q1GA 2A86A 1EZ4A 2WVAA 2XQJA 4CU5A 4ABTA 4K88A 4D8WA 1RRCA 3OQIA 5HUJA 4XVRA 2HZ7A 2CCGA 1ZOIA 3P9CA 1SB8A 1RI3A 2JLRA 1W5BA 3BXXA 3MIIA 5FL7D 3MQ2A 4CIWA 2Y05A 4L9SA 3AEQA 5IBPA 2QKYA 1GCOA 3LC2O 4U4AA 5EP3A 1SBTA 1PZEA 1U2DC 3RSHA 4CEHB 1I3CA 1YMVA 2ERYA 2FQWA 1P1JA 3ZCPA 1KA9H 5BN5B 4UUQA 1OPXA 4FCVA 1Z08A 4TWBA 4JC8A 1XVVA 1YAJA 1O3YA 2EVWX 3DMNA 4AX4A 2JBHA 1HT3A 1TC1A 3OZBA 3TNYA 1M9NA 2OXEA 3X2SA 2IQIA 4DIEA 2BBSA 1DIHA 4P3NA 5A4IS 2JH3A 1J5PA 3D3WB 3HJBA 3HU5A 4LBWA 1JJBA 3VDNB 5TEVA 1L7AA 4D25A 4TSFA 4YMUA 4E14A 3UMFA 2BM8A 1DAEA 3DPSA 1Y4DE 1Q12A 1NAHA 3FNFA 2H5LA 1AN0A 5E6RB 1HG1A 3JVDA 4KODA 3DB1A 4MQMA 4X6UA 4PQRA 1OAOC 4JI5B 1RHUA 3V00A 3T61A 4KAAA 2DQ4A 3DZKA 1L6RA 4LJ9A 3SC6A 1OI4A 1JEYA 2NP6A 3CH6A 4J90A 4AB1A 3BZWA 5KKAA 2R48A 3WIOA 4F93B 2GEKA 2WKWA 2A94A 4FTWA 1GQYA 2DR3A 1M0TA 2NQ8A 5H02A 3ORFA 1J0AA 3PKZA 4QUKA 2C0PA 4ZD6A 1K6MA 2ZYHA 3N0TA 4HNTA 4HNQA 4URZR 4HQNA 3HP7A 4QBTA 1TAGA 4K9LA 4Z2AA 3T06B 5C4IA 2FJ0A 1I2MA 2IV7A 3TLGB 1E99A 2AXQA 4J94A 4BJHB 4ZMBA 2J5BA 3HSKA 2V45A 4U6SA 4YV7A 4JBXA 2A5JA 1D8AA 2X0RA 3A36A 2FGJA 4IVNA 4ZO6A 3VNAA 2FP4B 4YLEA 4DDKA 3K16A 2GYYA 4KR6A 3JWGA 5BW4A 1F6WA 1YS2X 2ZJYA 2DJ5A 4R0NA 1UK7A 1ZMTA 3C7KA 4J76A 1G6KA 5DKFA 3SIRA 4TV9A 1QGUB 4D6XA 1QHNA 2QPAA 1M2VA 1BJTA 1LRLA 3TMKA 2ZVQX 4O2RA 4HX9A 2R5FA 1A5SB 3IE0A 4FFWA 4G1UC 3NNDA 3H2JA 3PWTA 4RJKA 2IHNA 5SZIA 2QG4A 3S2SA 2X5KO 5J58A 1T5BA 3MD0A 1Z0DA 3IKLA 1LW6E 4FYJA 3S6JA 4DYHA 1E6MA 1ZRHA 3EA5A 1GQFA 3DAFA 3PUXA 4FYHA 3ZV6A 2YFHA 3EC1A 1QOPB 3PP8A 4A27A 3M1YA 2YJZA 4AWAA 1R9MA 4YV0A 3G9TA 3KAPA 4XX0B 2QRZA 3ANSA 4AJ4A 4P98A 4D4MA 3V8EA 4HBZA 3O4VA 4K6KA 5DYYA 3PR2B 4MDFA 2JCYA 1N6PA 4LNUB 2A1TS 1MDBA 3MUFA 4J8PA 4YJKA 5DIFA 3DOOA 4DV4B 2D3TA 1TFUA 3W2IA 2ECQA 2QGNA 2XNJA 2BCJQ 3G8BA 1N6IA 2ZVJA 4BX3A 5HNKA 4ENQA 1L9KA 1QFXA 2AC4A 3DVQX 4QOFA 4DT1A 2PWYA 1SCUA 1PVOA 1L5LA 4RLFA 1XZDA 4M1OA 4RF2A 3SI7A 5JSZB 1NY6A 3PWKA 3RVBA 2H4ZA 2N47A 1NX9A 3DSRA 2V98A 3RYCA 4D4KA 5EIFA 3A31A 2QN1A 1WA5A 1EDOA 2WJVA 3E7PA 4A5OA 3HUEA 3LM8A 3NG1A 2Y99A 3AETB 3ZY5A 1BHJA 1BQ3A 1UJNA 3WKAA 1R18A 1OZAA 2I1LA 1QIKA 2V7PA 4B3TB 1DE0A 1YS6A 3JQ8A 3JQAB 1NU8A 2C9CA 1PDWA 2FPLA 2CCKA 2YC2C 4Q4JA 1SXJB 1NI3A 1UPCA 2R8YA 4MRMA 4S2UA 3JATB 5G0SA 4ND5A 2XGGA 5DPMA 4BFTA 1E96A 1U02A 1NBAA 2GR9A 2B69A 2ZSDA 5AW5A 1YA4A 3OPYI 2P9TA 5L3QB 4FFRA 3OJCA 3P8ZA 4RX1A 1I4TD 1SPBS 3K4HA 5IT9A 2HCJB 4BLRA 4KO4S 2NP7A 4HQ0A 3TSWA 1FZQA 3ZXXA 2JCXA 4EGQA 1H8HA 2VRBA 3UT5B 2B34A 3V1NA 2WM2A 2Y1CA 4UM9D 3K9LA 5KOHB 1JYEA 3TZBA 4K3VA 4LTMA 4FGKA 2ZATA 1NHWA 1GZ4A 2BBWA 2XQVA 1XXHB 1CSEE 3ASYA 3LPDA 4CRWB 2BJWA 4GOND 3R9IA 4EGJA 3ELBA 3ZGXA 1G5FA 5EWJA 1T2DA 4XASA 2H3HA 1UPTA 2JAPA 1XAJA 2J6CA 2V8BA 5DE3A 2ZBFA 2ZXFA 1EX9A 5CLGA 2ZS9A 5AHRA 4U2DA 5FV4A 1BD4A 2JKVA 1COWD 2EJWA 2ZAMA 2Q2WA 4X6LA 5I45A 3PD0A 2COUA 2X8JB 2EG5A 1IM2A 4C43A 2E21A 4PZPA 1ODSA 4OJMX 4Q9HA 4IOKA 4U8GA 3S8EA 5CEEA 3BSSA 4Q03A 5AHOA 3D4IA 4CQMA 5C53B 1GKLA 1R4MB 1YD7A 1LVGA 3ROTA 4D79A 4NNOA 3O8OB 3LGSA 4HPWA 1JEDA 4FGZA 4K3UA 2WYVA 2GRAA 1SMKA 1YA6A 1G55A 4P1ZA 1QRRA 4XH9B 2JI4A 4RA9A 5ES4B 4KR7A 5BORA 2GCNA 2YWDA 4Y9RA 2FSGA 4D9EA 4HTFA 2SCUA 1RT9A 4JIMA 3FE2A 1T0UA 4PYNA 2AN4A 5B1IA 5I5GA 3N53A 4TMZA 3VVLA 4BCCA 1ZKDA 2XXJA 4F1WA 2FH5B 4UCQA 5H70A 3F98A 2Q9AA 1RQPA 3EIEA 4IEIA 5C5EA 4DZZA 2AMLA 4XARA 4B7CA 4N3CA 1TVCA 1T4BA 3LUHA 3URKA 4EJFA 5C3MA 4WI1A 3OHSX 4P5DA 1AK9A 1GTSA 2PGDA 3G2IA 4IZ6A 4PEVA 3O8RA 5CJ2A 1ZLYA 3TVDA 5KQLA 1YL6A 4RIIA 3LAWA 2JFHA 2JW5A 3AJRA 2VP4A 5AESA 1GL7A 4RVOA 5BYJA 3A05A 2CV2A 2EZTA 2REOA 1O6BA 3NIBA 3ABOB 1Z2AA 3EFHA 3I76A 4D9CA 4DJAA 4KN5A 3NH6A 1FMFA 4QXMA 2ZM6B 5J5CA 1N25A 2FZVA 2QUZA 1RADA 1VCMA 1OLXB 4ND6A 3JYOA 3LQKA 2DFTA 5BWLA 1FFBA 2AL7A 4BCDA 4OI0A 1GAXA 4X71A 3A4VA 1YR6A 3SR4A 2Q5QA 3BDAA 2QRLA 2Z9DA 4QRIA 5C1BA 5E3IA 5CFNA 3K0CC 2EU8A 4YI3A 1XNGA 1G8FA 2H9YA 4F5YA 3KSAC 2JAHA 4ALLA 4D8VA 2HDOA 4KXQA 4DJTA 3V2GA 4IHKA 3RRXA 4FBGA 4GMGA 3S1AA 4TYWA 1U3UA 3B51X 1N2CA 2FYTA 1DQPA 2NTEA 5L3ZA 3DTVB 2Q9CA 4IJUA 3EDRA 5L7YA 1ADYA 3KPVA 2CZCA 1I3KA 1Y4UA 3A3NA 1WKCA 2B8NA 3H5OA 2B0CA 1VA5A 2V7XA 4A1FA 2A6PA 4M89A 4N5LA 2X6QA 4G81A 4DPKA 4I1YA 1PQ4A 3A1FA 3HFSA 4MQBA 2PMEA 3E9EA 3OMLA 3WYGA 4EIWA 4IVPA 3QEJA 1H4QA 4QG7A 2FUKA 5ALIA 1K9VF 2VK8A 2ZVDA 5AKXA 4ARZA 2ZYIA 4BFZA 3CM0A 2F90A 4J1QA 3ZCRA 2RKWA 5ALWA 1EHIA 2H2IA 3LBAA 4JC5A 1DB3A 3H5AA 2BGUA 2WZDA 4MQLA 3KTAB 4RZXA 4QICA 1UP4A 1Z5VA 2ZI4A 4IRUB 2GMWA 1N4AA 4C3OB 3JQFA 3D6VA 3GH1A 1G7RA 3PNLA 4J16C 4ND8A 1P7CA 2J9YB 3LK7A 4LX0A 2HSEA 3ESYA 2H1HA 2CLHB 2O0HA 1ULBA 1EVYA 1BC5A 2HD4A 3K1AB 2XD9A 3IKJA 2EERA 4WZAE 3KHTA 2C5LA 3UF0A 2B0JA 1Q21A 4TUYB 1T1GA 4F97A 1KRWA 3MFQA 2BR3A 1AG9A 4JZKA 4YRIA 1SUPA 3IBFA 2XW6A 4ND1A 1Y5RA 3UHAA 7REQB 4F04A 1XZMA 2W2NA 3DWIA 2Q27A 3GJ5A 3OLYA 3TIVA 2ZRDA 3IR5A 4XWKA 1N0WA 2ZJ5A 5EJFA 5EE3A 3W8EA 3GRUA 4X7MA 3I9V1 1R8QA 4C4RA 1B0ZA 3M83A 5HBGA 1E1NA 3EG9A 4URWR 5C5DA 1EX7A 1CLUA 2ET6A 2CXNA 3NAZA 1E58A 1DOAA 4B4VA 2P62A 4ZI7A 1LPBB 5GVRA 1G20E 2ODEA 4G0OA 5EMHA 4PX5A 3FTCA 1ZSYA 1I6KA 2ZCJA 2I55A 1HDIA 2J5XA 3LBFA 2QS9A 5FR1A 5CB4B 2WSSA 1WKVA 2IXTA 4DV5B 2HXGA 1X7GA 2IHUA 5DN6D 4O8ZA 3RSFA 4LRTB 3UXEA 2EKPA 1B0AA 3T34A 3PICA 3AR9A 4ARCA 1V11B 2R2GA 2NO0A 2QUBA 2UZIR 2W2KB 5IP5A 3D1LA 4CGZA 3KJIA 1R6VA 2BHNA 2H52A 1FTSA 3VX3A 2APJA 3CA8A 3UHOA 2DOKA 3EODA 4M6WB 2X5XA 4NX2A 3ZKAA 4WDQA 1SD1A 3MEQA 3O93A 1OGYA 3RVRA 1Q15A 4DYDA 2FEAA 2SKEA 1HE1C 2A67A 1KQOA 4K6HA 3FVRA 5EYPB 3VX4A 7MDHA 4K0KB 2R6JA 3NT2A 1GGVA 1AKUA 1F5SA 3QBEA 5G1OA 2XE8A 3I64A 1X6VA 3QVUA 1U3CA 2C31A 3RNOA 5BNFA 3N6VA 3GA0A 4GRAA 1T5DX 3ZHTA 2Q28A 5C18A 4XJSA 1FP1D 3F8TA 2GOYA 1J0EA 1SBYA 4ZOLA 3FKJA 1O0SA 2LDXA 3BMCB 4PCVA 3LL4A 3EC7A 4BVBA 2RBGA 4M1YA 2I2XB 2P2YA 2W4QA 3NZEA 4R1LA 4D2IA 4ZDKA 3LKDA 3EDQA 3QZUA 4MROA 4ZIRB 2HPVA 3P4XA 5KUTA 4FYXA 3LQQA 2IEDA 3EEBA 1V1MA 3F1LA 4X1KB 2PGIA 5D6NA 1KL7A 3V8RA 1RLOA 4YX9A 4AECA 1ZIOA 4V1CB 2D0OB 3QIAA 1L7MA 1L5GB 5BNIA 4N48A 4UDYX 1OZ0A 3WIDA 2VHCA 4IXNA 3DP7A 4KAXA 4MA4A 2DY1A 1ACLA 3O8LA 4DMMA 1IULA 1CDDA 3DBOB 2FG6C 1T0PA 1H2ZA 4AKEA 1THMA 2FKAA 2ID7A 3BMNA 1YC2A 3V9AA 1N1GA 3I32A 3PIRA 4NBWA 5B2EA 1L2TA 5FBRB 1M8GA 3AZPA 4QEZA 3ZHZA 4G6ZA 4QGAA 2R97A 2XKBA 4F12A 1RTTA 4NCJA 2OHJA 2QRMA 2J9FA 4LPKA 3H1AA 2ZPTX 3OMXA 4URYR 4CM4B 1W4ZA 4E2WA 4QLBA 2UVDA 4UZEA 4WOCA 5GP1A 4L5CA 3WQSB 2PV0A 1T3GA 3AVUA 4JJAA 1GPJA 2CN1A 3I0MA 5AKGA 5DN9A 3W7VA 3MRTA 4BNNA 4C7MA 1LUAA 1MCZA 4C6RA 1EUZA 2VT3A 4TXLA 2GZSA 1NURA 2QE6A 3MOGA 1E9SA 3E18A 4PCLA 4OGGA 4R98A 1XELA 4Y30A 3OHMA 2R6FA 1M8FA 3QKIA 3FUUA 3UEOA 2ZG6A 4C6TB 3KQOA 1ZD9A 1AZSC 1EGAA 4RMGA 4HXEB 1M6NA 3AL2A 1UMBA 4GLOA 4NESA 4QLAA 3V2IA 3T8YA 4FYMA 4PSAA 2O50A 3MILA 4JYCA 2AWOA 2OP1A 3N86A 4QXPA