2BLNA

N-terminal formyltransferase domain of arna in complex with n-5- formyltetrahydrofolate and ump
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
304
structure length
298
Chain Sequence
MKTVVFAYHDMGCLGIEALLAAGYEISAIFTHTDFYGSVARLAAERGIPVYAPDNVNHPLWVERIAQLSPDVIFSFYYRHLIYDEILQLAPAGAFNLHGSLLPKYRGRAPLNWVLVNGETETGVTLHRMVKRADAGAIVAQLRIAIAPDDIAITLHHKLCHAARQLLEQTLPAIKHGNILEIAQRENEATCFGRRTPDDSFLEWHKPASVLHNMVRAVADPWPGAFSYVGNQKFTVWSSRVHPHASKAQPGSVISVAPLLIACGDGALEIVTGQAGDGITMQGSQLAQTLGLVQGSRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN YFBG
publication title Structure and Function of Both Domains of Arna, a Dual Function Decarboxylase and a Formyltransferase, Involved in 4-Amino-4-Deoxy-L-Arabinose Biosynthesis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 89
structure length 298
sequence length 304
chains with identical sequence B
ec nomenclature ec 1.1.1.305: UDP-glucuronic acid oxidase (UDP-4-keto-hexauronic acid decarboxylating).
pdb deposition date 2005-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
A PF02911 Formyl_trans_C Formyl transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.25.10 Alpha Beta Roll Methionyl-tRNA Fmet Formyltransferase; Chain A, domain 2 Formyl transferase, C-terminal domain 2blnA02
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 2blnA01
4ZZ1A 1FMTA 4TTSA 3KCQA 4PZUA 4EW3A 1GARA 5J9FA 2BW0A 3TQQA 4NV1A 3W7BA 3O1LA 3R8XA 4Q12A 4ZYYA 4TT8A 3AUFA 4ZYZA 1MEJA 4EW2A 4YFVA 4ZYVA 3TQRA 4ZYUA 3OBIA 4DS3A 4ZZ3A 1ZLYA 3P9XA 2CFIA 4ZZ0A 1RBZA 2YWRA 1GRCA 1YRWA 3AV3A 4IQFA 1MENA 3GARA 1NJSA 1RC0A 1RBQA 1ZLXA 4QPCA 4QPDA 3LOUA 1MEOA 1CDDA 5CJJA 2FMTA 4YFYA 1CDEA 4ZYWA 5J63A 2BLNA 1C3EA 1RBMA 4ZZ2A 4TS4A 3DCJA 3DA8A 3Q0IA 1JKXA 1RC1A 3N0VA 1ZGHA 1RBYA 4EW1A 4ZYXA 2GARA 1C2TA 4S1NA 4R8VA 3NRBA 4ZYTA 1S3IA
chains in the Genus database with same CATH superfamily
1BW9B 4F46A 4QX6A 1E94E 2C57A 1EINA 3HEBA 4DLYA 1DAIA 1IL0A 3MHPA 2VZEA 4RETA 2O2ZA 3JQAD 4H7DA 4MI9A 4PZCA 5IT0A 2C3UA 3Q4GA 2I9PA 1QRAA 3HDYA 4IFIA 1QF9A 2G83A 2D3TA 1EWQA 4HDQB 1YDWA 5DGTA 4GF5A 1E20A 1BS9A 2X1HA 3DTVB 3IHKA 3OD1A 3UHFA 1B6TA 4HQOA 3UZUA 1E2NA 1JGTA 1FUYB 2I7VA 3KR0A 4WIAA 1ZR4A 1NW6A 5KJ6A 1GL7A 4HADA 3FTFA 2LVBA 2PZ8A 1C9NA 1GRQA 2RGBA 3R5TA 1KZ4A 3AOEC 1RXYA 2NO9A 2YBDA 4XTCS 2P30A 2WZQA 2QAGA 3AFMA 4BP8A 4DQXA 3CV3A 1QIGA 1PJCA 1E8NA 2OZVA 4PBTA 2IPAB 2V6JA 4YCSA 4P58A 4TLEA 5BSUA 5C7IO 1KVSA 1C1XA 1WS6A 1JG7A 3PC2A 1PR1A 4RU1A 5LMCA 1M2EA 4E7PA 8GPBA 3RVOA 4P7GA 3AUYA 3MHTA 5C46F 2O9JA 1BN7A 1GLVA 1YD7A 4MUAA 4GM0A 2FG6C 1YWGO 1Z7GA 4FOSA 5LZ2A 1NXWA 4RW0A 3KDPA 3O1IC 4ZHSA 3KKEA 4FYIA 5DULA 1V1MA 1NF2A 3IQGX 3BXEA 3ABIA 2EJCA 3QVMA 4DCGA 5BNTA 5THQA 2GBFA 1DAMA 3QE0A 1XHFA 3CX8A 2OOKA 3AG5A 4B6EA 4NBKA 4EG3A 1YIAA 4XCQA 2TECE 4S24A 1ODCA 3AF5A 2B8NA 4U2FA 1ZI8A 2IYYA 4XWGA 2G77B 5KNCH 2GCIA 4JYMA 4XVCA 4X8MA 4I46A 1YGPA 1K5GA 3AM5A 2Q6OA 4RPJA 4E2WA 3A10A 1FQJA 4MLZA 4FFPA 1QYIA 4JLJA 1V9SA 3CRVA 4ZC8A 1SBYA 2XQIA 1XR3A 1YQQA 3D3WA 2KBFA 5IAAA 1NV9A 2O2EA 4KLZA 1YC5A 1AQ6A 1R9GA 3EZ7A 1W96A 4GMHA 2VSQA 4GNRA 1A3CA 4MKGA 5DXFA 5GVRA 3UGTA 1IWOA 2OO3A 4RHEA 2P0YA 2WI8A 3BRQA 1KORA 2BCJQ 2LWIA 5AJWA 4DA8A 3OE5A 3SYLA 1E4VA 3QWAA 2V65A 3HEAA 4JEIA 3FSJX 4ON9A 5LWQA 4UM7A 2AG1A 5IAGA 2BEWB 2X0FA 4UTNA 1UDCA 4PYIA 5F2NA 3VU9A 2HU2A 4BO7A 2PRJA 2VA8A 1SCJA 1BE0A 3QF4B 4LMPA 5FFNA 4FDTA 3RRNA 3LDGA 4OHPA 4HB2A 2NU8A 4FT4A 2HSEA 2QM8A 4N01A 1U1EA 1IJFA 2Q2WA 3GJ6A 3LPCA 2Q3EA 1MAHA 3O82A 3NLLA 1MJNA 1LDYA 3DKRA 3TD6A 4N0QA 5D3MA 1MPXA 3PTLA 4TTJA 2O2JA 3BT7A 1R74A 3CU5A 1MKYA 1AV6A 1LK5A 4ZVPA 2FSSA 2GARA 2QV7A 4FWIB 4W5QA 4CKCB 2IPLA 2QGZA 2WJVA 2WK1A 3N7UA 4P35A 3RREA 3RVNA 5ALEA 1GLNA 3KSUA 3KAKA 4N8DA 1JSCA 3BXXA 4FLMA 2WHQA 3FPFA 5F35A 3CJQA 1ZMTA 4AMUA 5TGDA 1IU9A 4UPEA 3JSAA 4HJRA 1HWYA 2FETA 3JAWB 1ZUHA 10MHA 3BH0A 3GGGA 4RFVA 4MP6A 3GRKA 4YH1A 5C0OE 2XGGA 2Q07A 4PZUA 2X0KA 1QHNA 3G2HA 3LP8A 4KPYA 1KJNA 2GM3A 3FVQA 4U2EA 4KAJA 4ZDIA 4ND7A 4FDAA 2RC6A 3QELB 4FLEA 4KMOA 1Z25A 5GONA 4BLQA 1SG0A 4G5HA 1N5JA 2QN2A 2AUMA 5GIPE 1FFEA 2X5JO 4WZZA 4TZ0A 4KIFA 4L57A 1U11A 1L8OA 1XZEA 3B1XA 1Y7IA 3HU3A 4WK4B 3IMFA 5THKA 1QBKC 2WEKA 4AU1A 4LGVA 3QVTA 1GGVA 1NIPA 1T29A 3MCAA 1F0KA 4NZOA 2M6KA 2XDYA 3EZ2A 1JR4A 4P5PA 3UWMA 1KRWA 3RAPR 4MV8A 5KI6A 3ZCVA 5HIAA 3PHBE 1MRSA 2J8ZA 1QE3A 3RYHB 2W2QA 3AHEA 1UEJA 4R7ZA 1DQYA 2XR1A 4BKRA 3T1HB 4H31A 3Q3CA 1MO6A 2IYWA 3SN6A 4O29A 1QBGA 2IYSA 2O0JA 3KTAA 5JDCA 3IOCA 2I3GA 3WQQA 2HF8A 2UYYA 2Y8EA 1CG6A 1KI6B 4MVJD 4RIIA 5U1PA 3BA6A 1OBHA 1U5CA 2WJWA 2B8EA 5IAEA 2AR9A 4F5YA 4RK6A 3HJUA 4NAUA 4E22A 3FHTA 1NTRA 2WMDA 5NULA 1VGRA 3RVBA 1QIJA 4JUCA 2XCLA 2JFFA 2YHAA 3TQTA 3N8IA 4QUKA 4PQEA 3B1JA 1BMTA 3BILA 4KQ9A 4V0RA 3EVEA 3WIBA 5C4IA 5ES4B 4F2GA 2J0UA 1QYWA 4LY3A 5TMPA 4WK0B 4U00A 1E64A 1SJ9A 4X6YA 1B23P 1TEVA 2WFMA 4BWFB 1YZTA 4AFNA 1ZGJA 4AIIA 5FYQA 5BN4A 2MT9A 3DVSX 1FBTA 1FDOA 2EKDA 1G7RA 2OCKA 2WKPA 2WYUA 2XX3A 3WTCA 2XKAA 4DNQA 3S1SA 2ZR0A 3M4YA 3ZVLA 2Y1LA 4QUEA 1L2TA 1QKKA 4MB0A 3AI7A 1SUCA 2H06A 3RTGA 2BR3A 4RJLA 1QHGA 2H1RA 3C3CA 3VZRA 1DXQA 1UMCA 1OH8A 5A71A 1E9VA 1U28A 3A11A 3GBVA 2ZT5A 4TS4A 3NDIA 4OIFA 4J9VA 2J4CA 5EP4A 3PUXA 3K5WA 2ZK7A 2ZIXA 2OC4A 2ZSBA 3DCJA 3KCNA 5JT1A 3GN1A 1XK6A 1E77A 4X65B 2ADFA 3QK7A 5D3ZA 3T38A 2BUCA 2H4JA 4HVTA 4ZJPA 2QR5A 2OQIA 2BSAA 4LXHA 3PUWA 4YHBA 2N47A 4Q01A 5EP1A 3QU4A 4B09A 3ILXA 2ZTHA 3OPVA 5TQ2A 1T1SA 4DMMA 3IB3A 3QXJA 4RTJA 1RWBA 1PVDA 1WBJB 3EK2A 3TS1A 3P9CA 1RLJA 5IP5A 3PGXA 5JMPA 1JKJB 1O6ZA 4B5LA 1G9TA 4HZUA 3EIXA 1BVRA 2FUG6 1LC0A 4ZYTA 1WKVA 2DSTA 3LK6A 4OGWA 5HK9A 1OT5A 2ZPTX 5FD8A 4C07A 3VH4A 5JXIA 5EERA 4IOMA 4JUFA 2J31A 1HQKA 3VI4B 1OV4A 4A82A 2F8TA 4Z53A 1QPBA 3IEKA 4MHSA 1GQ2A 1CPYA 3L04A 1H9CA 1A4IA 1IG3A 4TXNA 4ARUA 3CFYA 3L6BA 1K5HA 3OOWA 2BF4A 5FOTA 3Q87B 3BIFA 2WWGA 4XLLA 3RC3A 3VTFA 1UEIA 1JQBA 4BCCA 1I3CA 4CJXA 1O3YA 1SUIA 2XNSA 4QGGA 3G1WA 5DRYA 1V45E 3ZDQA 4EGCB 9ATCA 2XXAA 1KL7A 4D7AA 1Q6ZA 4MPDA 2CNKA 4F4FA 1YDHA 2JFPA 4IR7A 5HBGA 1Y3AA 2IKSA 2JBHA 2XRFA 3W90A 3UAVA 3VAZA 4B5KA 1PEAA 2A9KA 1GCAA 4KUHA 4N0DA 5BN5B 3Q8XB 4PXYA 4BQRA 3BH7A 3VM6A 2QSZA 4CGYA 1YL5A 3H5OA 1X1DA 3G0BA 3KQTA 3BF7A 2ODWA 1BVUA 4G5OA 5A3SA 2ZUEA 3VPHA 4YRAA 3H0KA 3PI6A 3QBJA 4DV2B 2XUHA 2XYGA 2H2WA 3GT0A 4OI2A 3VYVA 4IO1A 4LZWA 2NVUA 3BK7A 4BFCA 3IAUA 4MIOA 2VQ3A 5FDFA 5DOVA 3CUTA 3LDFA 4CLOB 1T6NA 2I62A 1T1IA 1XLUA 4KDEA 3ZYCA 1M2FA 3CX3A 5CJ2A 2V4MA 3ZD8A 4MGZR 4EB8A 1K7CA 2WDPA 3HV2A 1QG0A 2P41A 3F7NA 5J5CA 1P3Y1 4F38A 2BKAA 2C31A 2FRDC 1NMZA 1TCUA 3GZ4A 4M1OA 3ZGZA 2NM0A 1SG9A 1CWUA 1FP1D 1RYYA 2H57A 3EGWA 2GRAA 3E05A 3BEDA 3PYLA 1ADGA 5KYVA 5JWOA 4KUEA 3GEBA 4UBIA 3O8CA 4OUKX 4PLVA 3EVCA 3GLFA 1GTZA 4EBBA 4ME6A 1P9LA 3NORA 5AW8A 2CVQA 2XA9A 4DA4A 2YWDA 2PBRA 4MQUA 4MOWA 1P2FA 4G0YA 5HQTA 4RZXA 1XTSA 4D4HA 5GJBA 3ZNNA 2W2TA 2WT8A 4UXJA 1YFJA 4IHKA 1SXIA 4LC9A 2RONA 4BX9A 1E3TA 4PX3A 5IKOA 4EKDA 5I9BA 3MJEA 1LF0A 4HYQA 5IKMA 4CM9D 3EXFA 2DPHA 3EAFA 1FNNA 1P74A 3LA8A 4ZAFA 3WKEA 4EG8A 5K0EA 4ITUA 4HOYA 2BPOA 2YV1A 3LUJA 4JQZA 2QQFA 4Q7JB 4Y9SA 4GM1A 4PLTA 1T4BA 1JIJA 5GZ1A 1HXHA 3JRWA 4G0XA 4F4IA 3AVUA 4BNZA 3WNVA 1XXHE 3PL5A 2FMUA 3VXKA 2V7BA 2XB4A 3DZBA 2HDHA 2WV9A 1NXOA 3ND6A 4D8TA 1HFEL 4H59A 3SE7A 1WB6A 5CG2A 2RFLA 3FMOB 4P3NA 4DPLA 1SXJB 3QBVA 2Q6TA 5FPTA 1Y8QA 4AWAA 1QV9A 3B6ZA 3HXKA 4QUJA 4Q9LA 3K0CC 4OF4A 5JBIA 1FX0B 4LXQA 1YS6A 3SVLA 1ULZA 2ZWIA 1NR5A 1WUYA 1ES9A 1VYHA 4JOCA 5MF6A 3BQ9A 1JNYA 3B1WA 5KNBA 5CFRA 2UVQA 3HYLA 3NEAA 2DBZA 4FGWA 4R8KA 1USUA 1EDBA 1V5IA 1YDEA 1YQ9A 3HMQA 1NVWQ 2A5FA 2GVNA 4M99A 3IDSA 3TECE 3CLVA 3WOVA 1E7WA 2V97A 2Z1DA 4OK5A 2D1TA 3DR3A 2HFKA 3PHGA 2M2IA 5EZQA 4A6DA 3ZWCA 3SQXA 5KWJA 2CXXA 1E79D 3F47A 1N7JA 2VXBA 3CE6A 4OK6A 2R00A 1OYWA 4X1IA 4XARA 1UZMA 3RC2A 2VKQA 3LHDA 1NQTA 4Z0TA 3HB5X 4LYYA 3JALA 4CIXA 2NO7A 5E2BA 3EMBA 4AXXA 1OT3A 4B9AA 4CV3A 1ISHA 1JLLA 2Q45A 4NDAA 2PKEA 1Y4DE 1VRCA 5CD1A 4DOMA 1B8UA 3AHIA 3MT8A 2BSQA 5DF1A 1G8GA 4HXFB 5E6RA 4BOYA 4EUEA 5G0SA 4NOMA 4B4WA 4C0KA 1OWLA 4EW2A 4FKMA 1SZPA 2A0FA 1DG9A 3F7MA 4UXHA 2OAP1 3IIEA 1MEEA 1SUPA 5JAIA 4MV1A 4UATA 3UUFA 2EJBA 4O1IA 4KYIB 4QUIA 4Y9DA 1XSEA 1OGJA 2GPSA 4DLKA 2ZI6A 5CCDA 1LFDB 4YCBA 3T9EA 2OMKA 4XJSA 1VG1A 2R7NA 3RK1A 3DOCA 4GNKA 6NULA 5K09A 3A4TA 4BO0A 3QKRA 3ABRB 4MGKR 4F12A 4BJ1A 1U5BB 5AQ1A 3BAZA 3GNLA 5U4XA 3JR3A 3KVRA 4NOKA 4GS5A 3TRIA 3KT3A 2O8VA 1ZLYA 3B9RA 2JAOA 3U26A 5KWIA 4KJZA 2ID4A 4J0HA 3TE6A 1KMMA 1A50B 2IY8A 1J7JA 2PFKA 2VDQB 2CFCA 3FPGA 1V3TA 6CHYA 1PV4A 2F9FA 1SCAA 2UZ1A 4YLEA 5F2KA 4JP1A 1F20A 1VMDA 2XUIA 4AKIA 1WPGA 2DMRA 4XI9A 4DA9A 3WIVA 3FWHA 3LTNC 2HHHB 1OCEA 3BRWD 3KSMA 2UXCB 4XJXA 4EP1A 3IULA 1RZRD 2RAVA 2UAGA 4TPKA 3WYFA 1PIWA 2Q29A 3BKXA 1AE1A 4LDJA 4J7AA 4V1CI 2H1FA 1HLFA 4GKAA 5FI0B 1P7ZA 3R7NA 4EI9A 5C53B 4NZYA 1ILEA 5THXA 3QWHA 5ETJA 2PFSA 3EASA 5FLKA 3QI7A 4EVIA 4DDTA 1M66A 3ROXA 3UQYS 4DM3A 1TIPA 1Q0RA 4WBXC 3LHSA 4ALMA 3SY8A 1VECA 4OLJA 4O4JB 4C3ZA 1XVIA 1EE2A 1T34A 3HUUA 1K1EA 1PWHA 2NZYA 2ZYIA 3ITEA 3F5QA 4HLQB 5KYNA 4HV4A 5GM1A 3E84A 3A1UA 1C3OA 5AYVA 2W2MA 1CZKA 1KE2A 3IEXA 5HTOA 2ZJ2A 1HZJA 4PSCA 5A9TA 1HRKA 4OHKA 4DRXB 3Q5EA 4BZXA 4WW0A 4UNQA 5IZ4A 1C29B 2NZ8A 2YRWA 3ORYA 2BEJA 4JWTA 1DT3A 2EBHX 3P9RA 4RKQA 3GB9A 3OCCA 3ANLA 2A84A 3FRIA 4YI3A 1NAHA 3ZS8A 3T4PA 1QANA 3SJUA 5FJJA 3H6GA 1Z4QA 2NXJA 2XW6A 3RSLA 1NFRA 1TM2A 1YXMA 2WG2A 3K5IA 3TW6A 4DDUA 4Z51A 5AVUA 5I8ZA 1ORIA 1MABA 1PR0A 2HPHA 1K2WA 3H2JA 4EPYA 1U7HA 2EWWA 2OG2A 3AF0A 3QYAA 1FVHA 2WWXA 2DULA 4URWR 3TG2A 5BYAA 2FPSA 1EPUA 5B4UA 3NO4A 1K92A 1Z0ZA 2NPOA 2GEJA 1C1HA 1NASA 2B34A 3VKWA 5KVSA 3IUEA 1UQUA 2JH8A 2V96A 4H1WA 4BBAA 1EE9A 4FM9A 1JU3A 5FNVF 1OKKD 2BW0A 1T2VA 2GHRA 1T3LA 2QD3A 4R68A 1MX1A 3W6PA 3O73A 2QEQA 1NVKA 3CH4B 3FZNA 3SYKA 4TM7A 2O2GA 2YQ4A 3RJZA 5D84A 1USGA 4ZI5A 5SYAA 5A4KA 2F4VB 2QYSA 3PF9A 1TNDA 1ZM4A 4BNIA 1RABA 3D4LA 3LL4A 1MN6A 4LXGA 4QTYA 4PHGA 4A0QA 3DAHA 2YWBA 2VPPA 3GXOA 4HP8A 2X0EA 4AUKA 4B4UA 5DLPA 1DBRA 3ZNQA 3TLMA 1KAHA 2XQFA 3G5MA 5AHXA 4AAYA 1OI7A 2QXUA 4ARSA 4BFYA 1UUFA 2E2WA 3MWEB 3PUKA 4NWIA 2W4QA 3LO8A 1XTQA 1Y37A 4KXQA 5F77A 3PC7A 1AHIA 3OEHA 2IZZA 4EYEA 3ELYA 4PCVA 3W5JA 1E2LA 1T8PA 5DGXA 1J70A 5LU9A 4LF5B 2I22A 3RT9A 2R1TA 2EFYA 3EULA 5CT6A 2VHTA 3MNFA 4X63A 1I1NA 4F2WA 1BVHA 5ALOA 1PSZA 3C3EA 3AWIA 1BWRA 2Q3HA 3AEQA 4G4JA 4AYWA 1AKQA 3HSYA 4JUDX 1OBFO 2ACEA 2RHRA 1ELOA 4PE5B 1KBZA 4H7PA 3ZCXA 1TZKA 1MDFA 1K5PA 2REOA 3DV0A 4PPGA 2Q7OE 3ZZNA 4V0NA 4XM2A 3OP4A 1PJ8A 1JTVA 3VGPA 1L1RA 4GBGA 3F97A 1WXHA 2FP4A 1GQSA 2NTJA 3M89A 2A8YA 2PG3A 4ZAXA 3D6AA 2XXJA 1O57A 3DJFA 4N49A 4DHEA 1OGYA 5CT8A 2PGXA 1IPHA 2ZRQA 1H4VB 1C3VA 3AY0A 1XRQA 4ARBA 3M5CA 1AKUA 5AW7A 4DA7A 4GZLA 1SXQA 2LUOA 3BD8A 4J16C 1KI9A 2OGZA 1EA7A 4NFYA 1A8SA 2M9MA 2QW0X 4EVRA 4KFCA 3HDGA 3UTDA 4AXBA 2BLNA 2YQ5A 1X94A 2OSVA 4FZ3A 1D1QA 1FK8A 4X7MA 2YY5A 4B6OA 4Q3KA 4ESOA 1ZU5A 1OBCA 4V0OA 4EKIA 3MCWA 1BMDA 1NXVA 3O26A 4C0AC 5HYVA 1BKDR 5BRAA 1W9HA 3L8YA 4LHYA 5ILQA 3ESRA 3DZDA 1QFSA 1RC1A 3N0VA 5IM4F 5EEGA 1T0UA 1T13A 1CUGA 2O0HA 4LJ7A 4RQBA 1AKWA 3SQDA 2HW8A 4XWTA 1KI2A 4GD3Q 5LVAA 1X1QA 5EJ7A 2JLCA 4C08A 3R5JA 4JUBA 2UUCB 2D2EA 1CV2A 5JG7A 1SCNE 3RSOA 1XDDA 2WE7A 3A1TA 2V45A 1ONOA 3AHHA 4KR6A 5BOVA 5C35A 4ARIA 4PSAA 2G06A 5H02A 5LCXA 4B33A 1BHQ1 5E9QA 1K89A 4EUHA 1S2LA 1LS6A 1R8QA 1U7ZA 4NBRA 3LHIA 5F4ZA 3S1AB 4TKVA 4OFXA 4QOIA 3RROA 3EJ6A 1CUUA 2NU6B 1Y1LA 2X19A 3ROMA 1JSRA 1XDUA 5LP6A 1DBWA 2EJVA 2FSUA 4KCGA 3WL5A 1H2FA 3GJ5A 3M81A 4ER3A 5JFGA 1OFUA 2Z30A 3LXRA 2VTKA 2P78A 2ZJOA 1WHTA 3ETEA 4N3GA 1G4UR 2NU9B 2XGSA 1AG9A 1OLSB 3BHNA 3ESZA 5B3JA 2P1ZA 4HMPA 3HUTA 1Z4KA 3G82C 3KR9A 5ADHA 3AVQA 2PUCA 4W9NC 4TWZA 3AETA 1I3LA 4PRZA 4DRYA 2QD5A 3OIYA 3OICA 1WLYA 5I7RA 4K40A 4KR0A 4LYGA 3UWOA 2GOYA 2AR7A 3A14A 4JMPA 1IHDA 4F06A 2EYQA 1T5TA 3T9CA 2OVBA 3ISVA 3HFSA 3O03A 4PICA 5B36A 1REQA 1HQCA 4G1EB 4JENA 4MLPA 2ODBA 3T1QA 4TT3D 2YFKA 3OBIA 3UOGA 4MEAA 2OV3A 2C3PA 2QX6A 3HADA 3IUSA 3OU2A 4GR4A 1CJTC 2R6R1 2ZVPX 1FS4A 3ZVKA 3GH1A 1GQOA 4UU8A 3UENA 1R7RA 2K87A 5UKDA 3FZEA 4CLDA 3UATA 1IUOA 3ZJYA 2IL1A 4L78A 1NA5A 2O3UA 5HZKA 3TL2A 4BO4A 3B1ZA 3WGOA 3U56A 4TLDA 4YLYA 3EW7A 3WWDA 1KKLA 1HO3A 3ESBA 1UK8A 5AHWA 3T7TA 2FWMX 1C0LA 2B1QA 2H4ZA 3D6TB 3W6OA 3BB3A 3FCEA 2WQZA 2G76A 3GMIA 4I9FA 3KKMA 4WFKA 5G4LA 3RFXA 3AU8A 3A6ZA 4DV4B 3OOJA 4TS9A 3T52A 1KAMA 1W4BA 2V4ZA 3E9QA 4J4BA 3IQHX 1YE3A 2YH2A 2ZIGA 2KX7A 2PLNA 3GP3A 3IPYA 3ZJTA 4NMWA 4BVFA 3TINA 3I3SR 4RH0A 1NJSA 1SB9A 1C30A 3JD0A 4O4JF 4WDRA 5JPIA 3T3GA 3UJHA 5J58A 2D5LA 2HRQA 1XZBA 2X8LA 2QHXA 4JBWA 4BB9A 1OVGA 4HQLA 4ZJYA 3LYHA 3HY3A 3T9BA 4OQLA 3ELUA 4GXRA 4PANA 2C94A 3TDKA 2HHAA 4DBVO 4ETNA 1ZM7A 3WGQA 1EUQA 4MKZA 2EBUA 4PGHA 4BAZA 2JGJA 3ETJA 2VZLA 4AY3A 3EYAA 3TTSA 5CVJA 1ETHA 4Z1MD 2O5VA 5H81A 2CXTA 3IJRA 2V7XA 4TMVA 5C3MA 3KXKA 1TOAA 5JXWA 1CK4A 1DJNA 2IOQA 3OPNA 1QGOA 1QDUA 3TLZA 3FFBA 4YRNA 3S2UA 3AKYA 2BGRA 3TQOA 2RCNA 1YJCA 3NIFB 1YQTA 1KP2A 4NULA 5LQMA 4TV9F 4Z6KA 3PQ2A 3O38A 1GHTA 5EGSA 5KNDA 3KSRA 2C0PA 4R8LA 4CFSA 1XEWX 3DSRA 1VKOA 5LXTA 2VBIA 3FOCA 4JZKA 4NMLA 3FFWA 1KDZA 1T24A 1ILWA 4ADSG 4EEKA 3HB9A 4OGKA 1GAXA 2HTEA 2ZAMA 4TM8A 2OGTA 1CRLA 4WZ6A 2W7TA 1HQDA 2QRZA 1MW9X 1N1EA 2QX7A 3PDUA 4FFBA 4O2BB 4AN1A 2DUUA 4KGZA 1TQ2A 1TF5A 2QP9X 3W2HA 1G16A 4GX2A 3OZXA 5A9SB 2BHTA 1Z0IA 1UJ4A 4PLHA 4RAOA 4E33A 3O5AA 1AQJA 1SXJC 5HZGA 1RXUA 2IOFA 3CBGA 4QXPA 5M04A 5JMWA 2FPUA 4G36A 1RI2A 1O9BA 2LZ0A 2R6DA 4KVZA 4WOKA 4YO7A 5BYKA 2P2DA 5JIBA 2BFOA 1M1ZA 3VKHA 2Q62A 3FBWA 5IFLA 1QK4A 2P3SA 1DAHA 2BKEA 3BHMA 5FWXB 1VL5A 4FGLA 3ZE1B 2R85A 1PUXA 1MFZA 3LQ4A 4CEHA 1IHPA 2QQEA 4I1SA 2DETA 4J1TA 2VPWA 2OQRA 2GD6A 2A14A 4LDZA 3DR5A 2DWCA 1HPLA 4U2GA 5C8XA 2W6ZA 1CJUC 1NU8A 4YFVA 2R5NA 2J3EA 2ZIAA 3E22A 1DFHA 3GRVA 5EL0A 1EXWA 3NT5A 4MR8B 2G04A 3CMCO 2PMFA 3QX8A 3HHPA 4RF2A 3CH5A 4HLUA 1JN0A 1U2ZA 3CQ9A 4OBBA 3BFPA 4XEHA 4RELA 3A06A 3SC2B 1BKSB 4BU1A 1JIVA 3BMCA 5DHTA 3WO1A 1HSOA 2J3DA 5K8UA 1CP3A 3H6KA 2QMQA 1ENYA 3PFIA 4JJ4A 2ZZNA 4F2HA 1K88A 4MUHA 3D43A 4C76A 5L3SB 1NX6A 4IEFB 4TWIA 5TR9A 4QJBA 3AJ8A 3QOWA 3SK0A 1PZXA 4EX7A 1ZSYA 4O63O 1MA3A 1S8NA 3PIIA 4E94A 4DBLE 3OQJA 4TWJA 3G68A 1XWWA 2EFGA 1LPMA 1CLEA 1GP2A 1U7DA 1W46A 3ADKA 4AZVA 3OQIA 5TT1A 1Z8HA 4C20A 2YFHA 5DNWA 2GN0A 1F0NA 4RKFA 3DV9A 3T7IA 4DBZA 2I8CA 4C5BA 3OMLA 5TQ0A 1CQJA 1DCFA 1V9LA 4HYTA 2KLBA 1WZ2A 3TKLA 2OR3A 2A67A 2W4IA 3R7BA 4FYPA 5HFNA 5K3SA 4LFBB 2R8PA 3ASUA 3MTBA 4H0CA 1G20E 4Q48A 4DQKA 1SIBE 2R8RA 2EP7A 2FPIB 3VR4D 1MO2A 3IEUA 3CWQA 4JLOA 4N12A 5DX1A 2BFPA 1L4UA 3OAAA 4REQA 5TPWA 3NMUF 1MJHA 1MB3A 1NUHA 2CF6A 1JUDA 1K08A 2A78A 2C07A 4XLTA 3ZHRA 5I9LA 4GW3A 1HEIA 2W9XA 1E6UA 2VCYA 3MELA 1FA9A 3HFGA 3KKLA 2EERA 4W63A 2UZ4A 2H52A 1VSBA 3I83A 1SKYE 3USCS 3L7CA 1CW2B 1ZC3A 4JLNA 3FOBA 5EIAA 1P5ZB 2QP3A 2CNNA 4KEAA 3S29A 2O5CA 1G0NA 2R4QA 4KQXA 3JVVA 5JXHA 4HNTA 2WKQA 3JR7A 3P2IA 4PCLA 4C4YA 2ZVQX 3OZTA 1CSEE 2WVAA 3HCAA 1C2TA 1IN7A 1PJSA 3ZNOA 1QIFA 2Y3IA 1EFKA 4GXQA 3TW0A 5A4IS 3VSAA 1P6QA 2VF8A 3JAKB 1ZK0A 2CMFA 1JAIA 1D04A 1CVIA 1JZQA 2CJWA 5FUQA 2ZI4A 2DQYA 4FFBB 3FYDA 1LLFA 1EBFA 4LUCA 1YRQA 1XU4A 4WNIA 4M2LA 5FADA 5FHQA 3PNKA 1WUIS 2D5BA 1YSCA 5A04A 1XEXA 4BYMA 5JZBA 3OC0A 3I4LA 1PLLA 3LUPA 4D9EA 1BOFA 4PR0A 4QG7A 1CUXA 1YS1X 3ZU2A 2F9LA 1AD2A 1WQ4A 1D2NA 3NDJA 1TF2A 3B52X 1VSUA 1WUKS 2ZRCA 4ND1A 2FWAA 1GT6A 3B1VA 3PA6A 2ZVJA 2R7LA 3ED1A 3NTXA 2ZJAA 3O8QB 1G8FA 4KXVA 4MUYA 2P9BA 1L4NA 3ZU3A 4D9MA 1ORWA 2GK3A 1R5BA 3QYPA 3NTRA 4NDZA 1Z2AA 1DIBA 3BMOA 4GKBA 4WY5A 5EYPB 1U0FA 1QB7A 2D5CA 1HDRA 2J33A 2WKWA 3P2OA 3WBJA 3A3OA 3I32A 3Q8WA 4RD6A 5AW9A 2X9LA 1U9IA 5CFQA 4WL0A 1KYVA 1JDZA 5ITZA 2QUKA 3VAYA 1Y34E 4CDGA 2YJGA 4MI6A 2C03A 4OEHA 2AI1A 3T54A 5CITA 1ZN2A 1T4CB 1VE6A 1FCJA 2PUTA 2C7RA 3SZUA 4KGXA 1NE7A 1NQXA 1U0OC 1VBKA 1Z35A 1EXMA 2KI5A 4JT9A 1EWRA 2L82A 3JASB 1R5OA 4IYJA 2XE4A 4RA6B 4Z49A 4YUZA 5ERGB 2KLHA 4NNJA 5EPUA 2C8JA 4Q1VA 1QCZA 3T1VA 1UAGA 3TLYA 3H9UA 1PYGA 1Z18A 5LBIA 1BMFA 1F38A 4C4SA 5HVNA 1HDCA 1ZRSA 1CBUA 3VPAA 2XADA 5FOWA 5FNVB 3C3DA 3P20A 4N6NA 5JVDF 1LDBA 2QMHA 2JAPA 4NEGA 4M87A 1FRFS 3OSUA 1SBNE 4WHMA 1T9CA 1TTQB 3ZVMA 1SXGA 1ZPDA 2ODNA 2ARKA 4P3OA 3DDSA 1V16A 5AJHA 1WWKA 3CH7A 4NP6A 4Z0NA 1XVVA 2QLLA 5K3EA 4NRDA 1WBBA 3T0GA 5MFZA 3TJRA 1KU0A 1TTHA 3M6WA 2ZIZA 2XMCA 4AF7A 2TSYB 4BASA 1DKNA 2H4WA 1KC3A 3UQZA 3SVZA 4ID9A 5JNTA 4JC5A 2JFBA 3HVRA 3U4QA 1DMRA 1QH1B 4F5EA 3EIOA 1GVNB 1Z5VA 4ZAYA 4JBGA 1M2OA 1UQTA 5D6OA 3MMSA 1N75A 4YCAA 3V4SA 2XWBF 1NP3A 4I5GA 1TPZA 3E27A 3L7KA 3RRFA 1DEXA 2P7HA 3LPMA 2A9OA 1PDOA 3J81A 5IBPA 4P84A 5BR1A 521PA 1ULBA 1PNTA 4O3FA 1W1WA 3UA4A 3U1BA 1W581 3C8DA 5JC8A 4UTVA 4IHAA 3TL6A 2BRUA 2QL7A 1Z7YA 1SHLA 2IYXA 5KAMA 3I5AA 3I9LA 1TK9A 2FHSA 2HA2A 4MPRA 4W7IA 5DW3A 5ARDA 5HCIA 2C9ZA 2YXEA 4B3FX 1A82A 3UJ6A 2P75A 4NFHA 1UWLA 2Q6IA 2W5UA 3RV3A 3TAHA 3B6KA 5JO0A 5ALGA 5INTA 1E6EA 3FETA 1OE0A 2UVPB 2ZUCA 3ZZUA 3DDNA 3AUSA 3TIIA 1NLFA 4LWOA 4EJSB 4PO3X 5KVCA 3NDBB 4GPTA 2NUTA 1RT9A 1JIKA 5JNWA 4ESVA 4E7OA 2GNAA 2VPQA 4OLAA 3EEFA 1YI0A 3O91A 2JLZA 1WXDA 2YWHA 4P08A 5AUNB 1RYZA 3V2IA 4C06A 1Y48E 3TZKA 1FYFA 1IH8A 1SOAA 2CXNA 2H1WA 2RG1A 5AJTA 4ZN6A 3IILA 5BV7A 3O4RA 4M21A 2QQ0A 5HEKA 4ZHQA 2GNOA 2WPDA 4C7OB 3E5MA 4C29A 2BI4A 2RK3A 3E9CA 5CLGA 1XRRA 2XMQA 3UMVA 1L7RA 4UUPA 2B2CA 3ZJVA 3QY9A 1GWNA 3R0ZA 4G8DA 4EY3A 2NXEA 2W70A 1N7HA 4L5JA 5GIOE 2PCLA 2H17A 1HDGO 1FDIA 2HGZA 5CXUA 1XWFA 3GZTB 4R05A 5CVUA 1Z8FA 2RGYA 1VIAA 1WU7A 7MHTA 4KQMA 4BJ6A 2FK7A 2QAIA 1N25A 2EL7A 2PZGA 1BA3A 1J25A 2BZSA 3RODA 3HM2A 1TCAA 3ODPA 2Q4TA 3P71T 5K8VA 4P4SB 3H4MA 4C4OA 3RS4A 1MX3A 4L9SA 3D7SA 2XMRA 1XT6A 4OQNA 3AR5A 2AOTB 3VR3A 4ZOCA 5AD1A 1V4BA 2C1EA 4F56A 4DM4A 4X71A 2PGNA 2XB2A 4HSEA 4JROA 1FVFA 4J94A 3SXUB 3VR2D 3NAQA 4TWRA 1F7UA 4IDCA 5EIFA 2FEPA 1DC4A 4EG4A 3NR2A 4ZC1A 3L2OB 2Y0BA 3OUTA 1H0KA 4M1TA 1BE8A 4XEUA 4OYRA 5JISA 4FCVA 1TZJA 2O2HA 2C3OA 4NCHA 3S6JA 4B80A 4IDQA 4PYKA 3DOJA 5J2TF 2VYNA 4YS6A 3THYA 3KOOA 3EODA 4GE0A 1PRYA 3CNLA 4B35A 2OORA 4LXXA 3KUKA 3A58B 3ME5A 3LW8A 4BNDB 2A1TR 2C9OA 4TWBA 3SCZA 1P7YA 2A6PA 2VDWA 3G2IA 1QGED 4DB4A 3MXTA 3BMQA 1U0GA 5HKLA 1IEXA 1SVWA 2R6CA 4MRRA 3W7VA 3GAZA 2Y0CA 3RYIA 4FFSA 3ZW8A 3SHTA 4D56A 4I66A 1AVTA 3KJGA 2AG8A 2P9TA 2Y92A 2D6FA 4IBOA 5A05A 4ITVA 3COVA 4EI8A 1RTTA 4CKZA 3VSEA 3WBKA 2R8YA 1DG1G 2BHRA 3KJQA 4IWNA 4GX5A 3ETCA 4MRPA 2YS7A 1GGJA 2QZJA 4NABA 5E7MA 2RE8A 1PZNA 1M6VA 3DBLA 3FWYA 3PWSA 2GRUA 3H3FA 3S68A 1KRXA 4D44A 2YXBA 2D0DA 4FEEA 3MT7A 5ITWA 2D7JA 2VUSA 1P0PA 3W0LB 3FYCA 5TS2A 3ZKWA 3ASZA 1QKIA 1LWNA 2D59A 4QG3A 2XYPA 3RIEA 3SQMA 1GTL1 3OLVA 4K0RA 3LWZA 3I8OA 3N2YA 2DUMA 2E82A 1G3IA 1H85A 2H8KA 5MN6A 2W6IA 2FQWA 2PKQP 4FGSA 1HORA 4Q3LA 3MMXA 3RS2A 3U3KA 3UJBA 3VTZA 1ZITA 4QARA 1TVMA 2JLRA 4HEA1 5TQJA 3N8HA 1Y9AA 2WYWA 3BIWA 1PQYA 1RWVA 1CYEA 1SA0A 4DCOA 5JD6A 4ND8B 3SEFA 2HLNA 3TR5A 1FJGB 1I7NA 1KA9H 1SC1A 2EZ9A 2Z0MA 3LBFA 3MINA 4HNHA 1SQ5A 4HR7A 5CGQB 5D5PA 4F96A 2GX6A 1JRLA 3W5DA 2ZUFA 5K03A 1HYQA 4ZANA 3DD5A 1A04A 1M1YB 2X5NA 3OZUA 4TV9B 1OZHA 4UUOA 2CDBA 3D7KA 1LVGA 3QUTA 2M6RA 3NIGB 4D4MA 4EHNA 1Z5PA 3UUWA 3TIGA 1AF4A 2D00A 3AEKA 4A92A 3DDWA 2L2QA 3HLYA 4OOFA 3QNMA 1A4UA 3D8NA 3HY4A 4RY8A 1G6HA 3GD7A 4BUZA 5A6VA 3PC8A 1V26A 4LFCB 3NHRA 1LQUA 5AUQA 2RI1A 1MG0A 4IFBA 3NBAA 5IK2D 3WRVA 3GGDA 1E69A 1JJIA 3W77A 1QTRA 4AULA 4HDOB 4Q9IA 2WAOA 2JLXA 4JBLA 1L7MA 5D86A 1YB6A 3OF5A 1TU3A 1FEZA 2LTAA 5C8YA 3OZIA 1U8UA 1YCGA 2X13A 1K0FA 3H2BA 1C4OA 3KB1A 5C4GB 2H85A 4JR0A 5KNLA 3EN0A 3GFVA 1FTNA 4LF8B 5FWYB 1ULSA 4XTRA 1AKYA 1VSTA 4EW6A 1ZN8A 2DJIA 1M34E 3E2MA 1CE8A 5IUNC 3DYBA 1ZRHA 4UFOA 1SQ6A 2AX4A 1LEHA 4FBLA 4HS9A 4PSDA 1YFLA 1J22A 1U5AA 3OFVA 2NUPB 1RRGA 3MRVA 5EWMB 3N2IA 5BR7A 5FPQA 1NW7A 2F3TA 3SJCA 2VHXA 1QX4A 5DHPA 5E3IA 1XD2B 1C50A 3THSA 1W4CA 4FFMA 2HDOA 4YFYA 5BRJA 4I55F 1IMOA 2HZ7A 2IEGA 5B53A 1KYZA 1MXFA 1U81A 1QV6A 3NTQA 4Y2RA 3WLTA 3WWEA 5EXEA 1A4RA 1O9HA 1ZIYA 2PUWA 3MWGA 3U3RA 1M73E 1F8UA 2NVBA 4R69A 3PTAA 1F2DA 1PEDA 2PJRA 4FUTA 3ICOA 3I0MA 2PEZA 3WB9A 1T2UA 3CZ9A 5D01A 4EEZA 4F8JA 5GY7A 2XI4A 1RAIA 1BMQA 1Q1BA 2AKAB 3KPUA 4IOLA 1KO5A 2SKDA 1GTMA 3AB8A 2CLHB 3KHKA 2JCBA 2ZJFA 4L02A 5AI6A 1XRNA 1OIWA 2B7BA 5IEJA 1MGPA 7GPBA 3V8VA 3ONNA 5K01A 1PG0A 4NV3A 3R75A 3O94A 3W04A 2G9ZA 2OHJA 3SZOA 2I4IA 4J2OA 5G4KB 4ZMSA 3ZDEA 4XX0B 4EDHA 1Y8AA 4G63A 5HE8A 2P3OA 5JDIC 4Y7CA 4IJ6A 1SFRA 2FEKA 2OCGA 3G89A 4CN8A 4NS1A 4RYDA 4FGKA 4LECA 1GJRA 1Z5GA 1AKMA 4IGEA 5JCOA 2O14A 1OI4A 2WTBA 3F4KA 1RJ9A 1EX6A 2GETA 2I03A 5FNZA 5HMMA 4MJ3A 4ZV4A 2UXDB 2VN8A 1IWBB 2KQUA 4D43A 1VKHA 1ZJ4A 2I3DA 3JQ7B 4QC2A 1CC1S 4YTEA 4Y6LA 2DR3A 4I2NA 3T15A 2REQA 3FGZA 1M74A 3WGVA 2Z6AA 3QOXA 3DL4A 4KOAA 1U6KA 1R6XA 2FPLA 3NM6B 1PZGA 4PYJA 2EFHB 1Y1KE 2B4YA 1E2KA 1YR6A 2EBWA 2Z2XA 2BZGA 3MLBA 4HG2A 4OP1A 4C22A 2BGWA 2V03A 2Z5LA 1C9EA 3L7AA 2QD4A 5EIXA 3WBFA 1K97A 2CXRA 4MDYA 3V8RA 5AM4A 5L53A 2OK8A 1RXCA 2PMCA 1EM8B 1B73A 3S2FA 4KXWA 2Q3CA 2W11A 3HA3A 1ORRA 1Z6GA 2R8EA 3QSGA 1CIVA 4W5RA 1H8ED 2WJIA 3KC2A 2VZ9A 4II3A 5IVDA 3SJAA 4HNGA 3HKBB 4L3VA 4XOIA 3ZCPA 4DF3A 3ZD6A 2O8DA 3VYUB 3NDPA 2J30A 1R8YA 2O2CA 5CYOA 4A0HA 4FHFA 1QTNA 2Q5OA 4HAIA 4DIEA 3RJTA 4CM7A 5KOJB 4XWWA 4YCCA 2FA9A 3T1OA 4IX1A 3ROQA 1YIOA 3A2LA 1ATZA 3KQPA 1CZOA 4BBPA 4CN9A 4DJAA 1SKMA 5GMOA 5AKZA 1F3OA 3PVZA 5E38A 2HLDD 1WB5A 3ABSB 1G4AE 4RY2A 3BN3A 1Z88A 3L0DA 1ZI9A 4RC9A 4UE3S 1WIWA 3WA6A 4CM4A 1A9XB 1H0HA 4LJ9A 3U19A 3AL2A 1TEXA 4G41A 1IXKA 3Q6NA 3Q3IA 2P62A 3VVLA 3T9FA 3LBIA 4QREA 4XQCA 3L0IB 1Z06A 4YRTA 3FZYA 3NHMA 1TUBB 4ABTA 3TD2A 3HNPA 2WOJA 2BMAA 3KALA 2ZRIA 4LAFA 4M86A 3Q7EA 2YYZA 2XUJA 3I04A 3ZLJA 4Q1AA 4KFRA 3ZIAA 2XA2A 4RTRA 1LTHR 2OZLA 4HUQA 4BVLA 1YBAA 3IBGA 5ELMA 3RNLA 3QVJA 3FCAA 1ZGBA 4X0EA 3AYZB 3JATA 4CMIA 2F3UA 3PUIA 4LOIA 3DUWA 2C9CA 2CYBA 3AESA 4J0CA 4XD2A 1DAKA 3M3DA 3W5UA 4X7RA 5BW5A 4HRXA 3DEZA 3JQGB 1ECFA 3JCZA 2HWUA 4OXRA 5DTRA 3C4JA 3RU7A 2I2FA 1Y6GA 1KP3A 4DADA 2G8NA 3DZKA 4MB2A 1E7QA 3GFOA 3K0AA 4GPBA 1I13A 1CJCA 1GSAA 1LS1A 1KERA 2A5GA 2BY4A 4J0JA 3DTVA 5CG1A 1IAVA 2DFPA 3LWDA 4XQ0A 3W05A 3HYTA 2VLBA 3L7JA 2YOHA 4H27A 3WRYC 2VP4A 1P9NA 2XUKA 4C0BA 2FKAA 4AP9A 4ZJZA 2XOKA 2H2IA 5KTKA 3BYZA 5LC1A 2J48A 2IIVA 4B1FA 3D4OA 1DEHA 4GC5A 1NBWB 2BGJA 4MR7A 4IKPA 4J75A 2QTCA 5AHKA 4S2UA 4WXMA 2IYQA 3VMFA 4HWRA 2Q0HA 4XWOA 5AVKA 4WBNB 1EDZA 2OHXA 4PGGA 4QBTA 2WD8A 4P0TA 5CVTA 1LSOA 2E37A 4RBNA 4YAJA 2IU0A 4IKOA 5KC8A 4P0QB 3U3JA 4PX9A 3KV1A 4I3GA 4HYYA 2ASEA 3SMQA 2XXBA 3C0KA 4N5HX 3KD2A 3KKOA 4WCFB 4O25A 4BE4A 4Y18A 3CMMA 1EUDA 1LDNA 5JSHA 5DCYA 3D5EA 1QIMA 3GVCA 5ALIA 1YV9A 1C7JA 2CNOA 1FDSA 3UFXB 1DAFA 3AVYA 4DLUA 4BNJA 1FPQA 3E2PA 3BXOA 4B7XA 3I58A 3ZPXA 2AFVA 3DDHA 4QDZA 2HMVA 2D74A 1Z68A 3FTQA 5DM70 2GXUA 3IBFA 3DC2A 5CBKA 4Y1RA 5J1SB 1CUCA 2G9RA 4ILKA 1VZ2A 1CR6A 2RBGA 3KQWA 5ALPA 4K9KA 1OXUA 3KU1A 1OYVA 1GCIA 4ZEXA 4EYSA 3DOHA 5FPPA 3P4XA 1ZA2A 3BG5A 4NQRA 1S2DA 4EJSC 1K7FB 3DEFA 4PC2A 5LKAA 3ST7A 4PC7A 3HL0A 1XO1A 3ANTA 3SIRA 4JLMA 3H99A 2KHZA 7MDHA 1C3LA 1IZ0A 1JMKC 4IWYA 4HGZA 5AKKA 1EJ6A 3S2IA 5ALKA 4BFVA 1GNQA 4CHTA 4L08A 4MKRA 1R5NA 4TTTS 4U9HS 1J97A 3VZQA 2WD7B 3VSCA 1RZRA 5J40A 3NBMA 4OU4A 3HQ4O 1ABFA 3W8EA 3QF4A 4B79A 2XTJA 2O3QA 4BAUA 3IP3A 1X80B 1QE0A 1OPRA 2DFTA 3QPVA 2GPYA 4PXAA 2GZDA 2M6LA 3WYCA 3X43A 4E1VA 3NU1A 1FFSA 2E3JA 3K1TA 4JP3A 2QI9F 5GTDA 4ARVA 2R25B 3JYLA 4YRCA 4XWYA 1NW5A 3LY5A 1XX6A 3MOGA 2D2VA 4A10A 3SEQA 1GZHB 4EYQA 5AR1A 2I3BA 4RZQA 1QWSA 3V4LA 5LP1A 1QDLB 4JL5A 1ZYUA 3E7XA 2N75A 3LTEA 3LT1A 2G82A 3L02A 4R1OA 4AP6A 4BNNA 1X7XA 4CGZA 3QXHA 5I51A 1P2DA 5KQRA 2YMLA 4RMHA 5F12A 4AM8A 3JQFC 1N6KA 2A5LA 5EUBA 1USVA 1UBFA 4ZQFA 4URYR 1ZICA 1N3YA 1QU3A 3R3ZA 2ACKA 4X91A 2C84A 1JKXA 4CT0A 3IHTA 5KCMA 2XDWA 3IALA 4ED9A 4GR5A 1P33A 3QELA 2H3HA 2ODPA 3N0WA 1SR8A 4UD6A 1NMYA 2A0YA 4QAQA 4BLSA 4AKGA 5FPHA 4H35A 1K6IA 2GESA 3PDHA 1GIAA 2B4RO 3NKLA 4PC1A 3PXGA 5FBHA 3VX3A 3T0IA 4OU5A 4CETA 2ZATA 2BH9A 1G2IA 1VHLA 5SZIA 3PNVA 3LF2A 2Y4OA 1SNYA 5AM0A 4DMFA 1MV5A 3W2GA 1AN0A 4IIDA 1RLMA 4QHYA 3LQ1A 2V8OA 4RV5A 3PXXA 3QV2A 2ZKIA 4O0MA 3TH5A 3AFIA 1A8QA 2R6ZA 3PE4A 5IAKA 4ID3A 4FSDA 3RYHA 2WR8A 5HM6A 1N2IA 1U2EA 2BUAA 3LSYA 4HO1X 4JXJA 5J2TB 4YGYA 4A3SA 4CMJA 5IDXA 3R5XA 1NPYA 5ICGA 1INLA 2AN3A 1P75A 3FPKA 2Z57A 5LM3A 1P39A 2J3MA 5FUVA 3KBBA 2FRVA 5CD9A 1NDUA 3IDAA 9LDBA 2X9NA 3PENA 1KH2A 1X6VA 4YT8A 2PANA 3UMBA 1SCKA 1XMXA 1Q3KA 1NYQA 2XVZA 1XL0A 5J3JA 3VKFA 3OPXA 3OQPA 4A15A 4LY0A 2ISCA 2G5GX 1M7HA 2QUBA 4X6XA 1Y80A 4BJHB 2QX9A 3IKVA 4M22A 3WE7A 1GGNA 4CKYA 1N2XA 1C81A 2AG5A 3BCUA 4L5AA 4HMOA 5JD4A 4TYYA 3FHLA 4XJVA 1L5MA 1H1LA 1OAKA 4YYZA 4V0SA 2PRZA 2YHUA 2GPWA 3IURA 5K0FA 2JFHA 4IDPA 3C15C 3NNSA 4DV6B 1ABEA 1PR2A 2L69A 2SCUB 3F3MA 4DABA 3KR2A 3ER6A 3C6QA 3K0KA 1AHNA 1ISMA 1JHYA 2JIMA 3I2JA 3IP6A 4KFUA 2QZPA 1ZD9A 4PZEA 2QTLA 4GSLA 4OLHA 3GVXA 3L7LA 3KUDA 4IGIA 2BR5A 4L0CA 3V7UA 4DCPA 2V7GA 4Y6RA 3FPCA 2IJGX 2OK7A 2HBRA 3E9NA 4UM9D 1TYBE 3L79A 2OFPA 3ZHCA 9LDTA 2RD2A 1KI7A 2GM5A 2IOYA 1IPEA 1EDDA 4FSHA 4NYIQ 4Y9UA 1AUPA 2RHWA 5ITSA 5JXGA 3PIRA 3R09A 3P19A 4YAEA 2VQFB 3ZWXA 2I4LA 1TFUA 3TSCA 2FQXA 1XJ5A 2W48A 1U6IA 1P91A 3NOVA 3BWBA 3OG9A 1FYEA 1EFRA 5G3YA 3MD9A 1SQGA 2JAQA 2I2CA 2IZOA 4ETMA 2K7FA 3ZVNA 2R1ZA 2Y1CA 3DOIA 2EKLA 3IOMA 2WF5A 3AKEA 4PAMA 4D6PA 1MENA 4D8YA 5F2OA 3GEHA 1RU3A 5DZSA 3REOA 3VZSA 1JLRA 4BFUA 1DVRA 1HX7A 2LD4A 5BV0A 4FQ7A 4KNYA 1L1FA 2FEOA 3HXQA 1JKJA 2VTEA 2O8CA 1CNMA 1YZUA 3ROKA 3TOZA 1D2AA 1XVLA 3L0SA 3DM5A 4EQZA 1NOJA 1VE3A 3MUOA 3Q9SA 4RSGA 2C88A 4WERA 4WZAB 4BV9A 4F5DA 1PNVA 4ECEA 2PS9A 3STVA 1O4VA 5DP1A 3R20A 2PYZA 1AQNA 1KK3A 4PM4A 1NRWA 3U4DA 4JGGA 5SY4A 1YBVA 2ENUA 3K8OE 1GNPA 4RZ3A 4X00A 5SYNA 3MS4A 4XJTA 2WQ6A 1P72A 3LGXA 4Y7DA 4C78A 1O94A 3MTDA 2YXPX 4PWYA 4B3CA 2YWXA 3EOZA 1FNMA 3EVDA 1R6UA 1I6KA 1KMIY 2Y1XA 4UHBA 4FHCA 5LMNB 2QYOA 2VNKA 2OHHA 2WWHA 3H11B 1RCTE 2GO1A 2QVXX 2ZKLA 2AWOA 2R6JA 2GDZA 1DDGA 3AY6A 3FSGA 1RR6A 1Z6AA 3TQIA 5LD2B 4EATA 4FC6A 3T7EA 1JNXX 5B6IA 1NM5A 5JNSA 2OY0A 2PLFA 2PZEA 3GOQA 4WOCA 1QS0B 1ABBA 3VPFA 4CMCA 1T5BA 1A9YA 1ZNQO 2MSWA 3HU5A 2VZ8A 4L9WA 4RWEA 1RLTA 2ZCJA 4JKYA 2DT5A 2UUOA 221PA 3SR4A 3UMGA 4BZZA 2XTMA 2Y77A 1E3IA 4I55B 5H8WA 3FYUB 1NI4B 5KKCA 3URKA 4C01A 1UJ2A 4XVHA 5E9WA 3KZVA 1UPFA 3QLUC 1BWQA 4KFTA 3O4FA 2GFIA 4LBZA 4B31A 2GR9A 1ST3A 3WDKA 1C0EA 4G0PA 4ZYYA 2J9YB 5HIKA 3LQYA 3VAAA 1NY6A 3QX7A 2P68A 2V5AA 5JSUA 1LWOA 1DC3A 4K9QA 4MP8A 3OI7A 5BSVA 2XYHA 4AX8A 1SPXA 4WD3A 2GEKA 4V3BA 3U7GA 2C29D 1EFUA 2C8LA 2HC9A 4EF6A 1ODFA 1YHYA 1GY8A 1V3QE 4D9KA 2AH5A 4JBIA 4XRGA 3DB1A 4G0ZA 2P77A 3IBCA 4JP8A 3GYBA 1MLDA 5KEIA 2M1ZA 3U0VA 3V7YA 4NL4H 1HE5A 5JSQA 4YCMA 4U6NA 2ZW9A 2Z2JA 1Q21A 2POQX 1UOEA 1J24A 3C6KA 2Z4RA 2FZCA 4BWYA 5I7UA 3ZDRA 1NRIA 4D3ZA 3EC7A 3CGWA 3N58A 4UCWA 1JDUA 3JQBC 2E4UA 2J59A 1D8TA 3TVDA 1QIHA 5HG0A 3QJ5A 2WTAA 4NHOA 1VA4A 3AR4A 2C1XA 1UJBA 2G1JA 5HKAA 1Y42X 4ZVVA 4H0NA 1FU8A 3ZTTA 1AUVA 1A98A 2JIOA 3QHAA 4DLNA 5J5VA 3LHKA 4DWWA 3PDIA 3VR5H 2Q7DA 3T1YB 1MOZA 4IF6A 4EHBA 3SC6A 3D0KA 1DU4A 1H2YA 4YRRA 4P36A 4DWVA 4EMSA 1A4XA 5A1TA 1E9FA 2DUJA 3PV0A 2G4LA 1SM4A 3MUNA 1GUZA 3OOYA 4DIMA 1Q15A 3A1FA 5DWDA 5IJ0B 2FPPA 1UT6A 4I7EA 2P2GA 1C7RA 2BTQB 3IKMB 4LYEA 4EARA 1TO1E 5JSFA 4UCXA 4K6HA 4WKBA 1J8FA 2ZR9A 1M2NA 1JQJC 1ZUIA 2FEWB 4KK4A 1ECPA 1EUCA 4L16A 4TXMA 3TSWA 3FMVA 1ZH0A 1DBVO 2QE6A 3K9HA 3OLCX 1BOOA 2GD2A 2I2XB 2WW8A 3JVDA 3MJCA 2FMKA 3QUSA 4H1UA 4JT8A 4PIPA 3CVWA 5CXSA 5ELLA 3ZH2A 4F9TA 5FO1A 4Z4IA 5I8WA 1ZW6A 5ED4A 4UBOA 1QZZA 3U7QA 4Y2VA 2WTUA 1ADBA 2FFQA 4K05A 1SXPA 1VCHA 4QNNA 4U6QA 2N9UA 2R4UA 3CRRA 3GWGA 3L8HA 2GBPA 2IW3A 4RDHA 3FTDA 3GUHA 3Q3VA 3ZDZB 5FX2A 3ADBA 1THGA 3MTJA 3GDGA 5DI3B 3QPBA 4KXNA 4BQFA 4KACA 5JR3A 3JRXA 4DA6A 1OFVA 4IRMA 2FFHA 5A3JA 5B2FA 3REQB 4MCHA 5G3ZA 2I66A 2XWJI 4IS2A 4P4NA 1AU9A 1UDWA 1VXOA 2IIBA 2WSMA 4E07A 5JAZA 3U4GA 3ZCSA 1GPUA 4YRDA 3G9UA 3TTTA 4F1JA 1UR5A 1IHUA 3BGDA 4LDAA 4AG3A 4LKOA 5KJCA 1GARA 2LW7A 4KDCA 2KE5A 4AJ4A 4IV8A 4DY6A 3SC3A 3P0IA 5JMOA 2H6EA 3LLMA 2BMEA 2X6QA 4HH4A 3T94A 4EK9A 3ZEIA 1KEEA 3D1JA 2BM1A 2HJWA 4JQSA 3NAZA 4HDNB 2E9SA 3EISA 1XZDA 1HK7A 1P7WA 1LNQA 3K09A 2OHVA 2QY6A 3M7IA 4JNKA 1QR2A 1R4NB 3F8WA 1G98A 5EE5B 4DMCA 3PPIA 3ZHUA 2ZZMA 2FW6A 2I7DA 4BTVA 5COAA 1FUKA 1Y1RA 1X7ZB 5I7SA 4DJEC 2ZU6A 2Q49A 3BIJA 4WCFC 5IC5A 3WS7A 2B6HA 3EHEA 4RPGA 4ONEA 5L3RA 1M6NA 4AP5A 2R9VA 5REQA 3VOTA 3SM3A 4K3UA 4QNRA 5TF0A 4C04A 2G5PA 3W5BA 2IS1A 4YQFA 4TGLA 1F51E 3WLHA 3WJ2A 1F2UB 5AK3A 1P4GA 5KYXB 2DGDA 1P7VA 1LTKA 3WWYA 3IQZA 5CEJA 2R65A 3PX2A 3R2JA 4RGYA 1VPDA 5AVVA 4WJKB 3ZI7A 1PDWA 1RBZA 2O8FA 2VP3A 2IEZA 3C8ZA 1K6MA 3PXEA 4QDJA 1R9MA 3EEBA 2AIRA 3ZHQA 2YWFA 1J90A 3KQNA 2QD1A 4O1MA 3I30X 1YMVA 3IAFA 4GSKA 3ORRA 4J0FA 4C7VA 4EJFA 1KFJB 4H7FA 4PLPA 3BE5A 2OMEA 2IE8A 1JE1A 2X77A 3F7TA 2QJFA 3GDOA 1ENPA 3VFDA 3SWWA 4DKJA 1I33A 2BFFB 4DMKA 3NALA 3UAOA 1B8NA 4KZPA 3RS9A 4F3YA 1Z5OA 5EJ5A 2ZE7A 2XVMA 1JFSA 4G0UA 1CEQA 2WKRA 1XVAA 1W87A 1X9HA 2FRXA 4M46A 3L9WA 5DHFA 1O6CA 3OZVA 5ALYA 5C7OO 1G41A 3WP1B 2QTMA 2O4UX 4YDRA 1N9ZA 4DIDA 5I9IA 2MR6A 3VV3A 4CF7A 1BG6A 4O4IA 2ZTMA 4YRLA 2QW1A 3WZ2A 3YASA 3G6WA 2PXXA 3CPSA 4PFKA 3I62A 4N1AA 4PZDA 4PG4A 1PVOA 1WW3A 2PQ6A 2JHCA 4KLCA 1VL0A 3T8YA 1BGVA 1M2KA 4NK4A 4UTRA 1UAYA 4L72A 5A0VA 2YBEA 3PGMA 1ISPA 5FOSA 3W8FA 3WYEA 4YJHB 5TC4A 1Q7EA 1VIYA 2HEGA 3ZZ0A 3FBTA 4KH0A 2PSEA 4IEIA 2H5JA 2O0LA 1M2VA 4WAUA 5IARA 3S4YA 1OLUA 1R4AA 2MWMA 3MPUA 4ZODA 3K70D 5AI9A 2PGLA 4NBWA 3NHZA 3PHLA 5ICFA 1ZL0A 1KKUA 3B3GA 3R7WA 4C0XA 2NV0A 4MO2A 2QK4A 1JT2A 1BRMA 5LJLA 4XUEA 2YMMA 1O89A 2AI2A 1BXRA 1V95A 4GOND 5KNBD 3TW8A 2CZGA 4HFJA 1FFHA 1W4ZA 1WAMA 1DOZA 5IASA 2HRCA 3C70A 1V6SA 1UQRA 4O8ZA 4QKQA 1USKA 5E8JA 2G5CA 5AK0A 3KB2A 3KPJA 2EF1A 2GUGA 4WN9A 2E1RA 5CNIA 2E89A 1DCKA 2A1UA 3T6KA 1E3SA 3MGAA 3AW8A 4BMYA 5HZHA 1J8VA 1Y7HA 1KZ1A 3DVRX 1K8RA 4MRVA 4BNMA 4FYHA 3VDMA 1KK2A 1F2TA 3NOQA 2YVAA 4FJ0A 3U37A 4MRMA 1G8SA 1M8FA 3UT0A 1OXVA 5CRIA 4FILA 3FFTA 4E5MA 5FFMA 4Y2GA 5LZ5A 1HBJA 4R98A 1FRQA 7ADHA 4UUBA 3TEFA 1AV7A 2AS0A 1NUQA 4BP9A 3ESAA 3ICVA 2ZE5A 1WSAA 1YJ8A 4OP3A 4WLNA 3JD1A 3VTKA 1BDIA 4FYMA 3AB3A 3AIMA 1Z63A 2YXDA 4IY1A 5DTQA 2FAXA 2J32A 2C2XA 4URHA 1P77A 3AUUA 4ZTZB 3S2ZA 8ATCA 5HGXA 4R9RA 1DPFA 2HXGA 3VPDA 3SS8A 1QGUB 3H5AA 4FIDA 3DHWC 3KBOA 1YOVB 1F48A 4JJEA 4XIGS 3JWIA 3GEIA 4ZEMA 3RUIA 1PI3A 4R3NA 2NXCA 4ZEWA 4G25A 1FDVA 4H6PA 4QFCA 3VOBA 1XTIA 2J5RA 2J9GA 5ESDA 4LGYA 4JY7A 4Z3OA 4WOJA 1IM2A 1KPHA 1R9NA 3DEAA 3TUJC 4W1QA 3TVYA 3G0OA 3ZZTA 4XGNA 2VQEB 1WV0A 1ZGZA 3V1LA 5TRTA 1YS4A 1OTYA 1VLQA 2H51A 1J0XO 4PLWA 3H2YA 4CLRB 4JKIA 4Z4HA 1X7WB 3GLQA 3HUEA 1HY3A 3RANA 3D59A 2OL4A 3MMZA 3D4NA 3O7MA 4KUGA 3MS7A 2ECQA 4I50A 4K6MA 2CBGA 4MAFA 4QYXA 5B1SA 3AEUA 1ZXXA 3NV7A 1NW4A 1XC7A 5E95A 3FUUA 2GAFA 3C87A 1X87A 1ACLA 4YC7A 1MH1A 1MVOA 3NKVA 4V02A 3VR6H 4C4TA 1R0KA 5K3OA 3JAMA 5KPJA 2WT4A 1H2ZA 3L8ZA 3WK9A 2O5RA 4Z7NB 3EXG1 2AOVA 3C1TA 3A0RB 2GASA 4JLWA 4PZ9A 5A5GA 4XWKA 1XHLA 4BJ3A 4HAYA 1WM1A 1FZQA 2TRSB 3DKIA 4N5LA 3VZDA 3ER8A 1NVTA 5TS3A 4HH0A 1JA9A 2DFKB 4WXRA 4S35A 2Z3VA 1RP1A 4U02A 2PUEA 4TXLA 2V7EA 4XYBA 3ZHZA 3EPLA 3FNRA 1NWCA 4I6GA 3V33A 4KB5A 5EQDA 3S2YA 2G9VA 3TSAA 3GJTA 2O2IA 3RVKA 5EJ9A 3VU8A 5EJ8A 4IIVA 4P83A 4DLBA 3SHFA 2QF7A 1NRXA 1JIUA 4ZP1A 3OEED 4RJJA 1FMCA 3P45A 4XLZA 1JFFA 5FF9A 2A88A 4OB6A 1ID8A 1T6BY 1PS0A 4Y67A 2C54A 3UIEA 1FMTA 2P9QA 3CNOA 3FTPA 3PVSA 1X70A 2OLJA 3ON5A 1OX5A 3LGSA 2FZVA 2WFLA 4KWHA 3X2SA 2OKCA 3WYDA 3A1SA 4N9QA 2Y2VA 2VJLA 1RQ2A 1S3SA 1RWWA 4DLXA 1CQPA 2G9NA 2BUBA 5IDYA 2JLVA 4I6JA 2OZKA 4OA8A 2XUAA 3IKTA 1KNQA 4GG1A 4WKCA 2COUA 4L4YA 3AR8A 2FE4A 3JY6A 4FMCF 5JAPA 2JATA 2WU3A 1DX9A 3EZ6A 1Z29A 1IVYA 1Z12A 3AFNA 1U9ZA 1ZD2P 4ER0A 1UXOA 3BXGA 4HATA 2VUTA 4PO8A 2UUBB 1TVCA 2FPGA 2B78A 1LLCA 1K3FA 1CUYA 3QKTA 1Q14A 2Z2ZA 2YY6A 3D6JA 3I64A 5EJEA 5TLSA 2H1CA 5CCXA 3FOEC 1SXJE 5K0BA 4NZPA 3FROA 4YRQA 3OU7A 2EJUA 4X8LA 1Q12A 4CBVA 4K88A 2DQKA 1LUAA 3GV0A 2WICA 4C7BA 2P91A 3WRXC 5EHXA 2CNBA 1C1XB 3MJRA 2GK7A 1UAAA 1KJYA 3WV5A 1DELA 3QIAA 3NI2A 1RMTA 1NGSA 2O1WA 2OTCA 4DXDA 3BQMB 4UM9B 4GMDA 5JYCA 2QT9A 2RH4A 3GFFA 4JZYA 5DX8A 3I2KA 1O2DA 3BMNA 4KIUA 4TX1A 4XAQA 4KOEC 2Z2IA 4AB1A 2UYHA 3OEHD 5DMHA 1CNFA 2HKIA 1U7XA 4Z2YA 1ZOOA 5T67A 4DR5B 5FP0A 4A0GA 1FSGA 2DHQA 3Q7PA 2Y1DA 1G5TA 2VHQA 4IILA 2ASVA 2Q0QA 5F7ZA 4L85A 1MRNA 2JEOA 1KU6A 3A3NA 4J0KA 3ITDA 5G02A 4DNXA 621PA 4YCLA 5C1OA 1JYFA 3EGIA 3HV0A 5H83A 2V7TA 3SE0A 4QGSA 1D1TA 3SXPA 5GADl 2ORYA 3DZIA 4JD5A 1DKPA 2XSZA 1NYLA 2PZFA 3E82A 4K03A 4N7BA 3D3WB 4MYSA 1YH3A 2W2KB 1MHTA 2VS1A 3WFZA 1J0BA 2NYVA 4YDSA 4B6RA 3I42A 3OE7D 2SECE 5GJWC 1XZFA 2W6JA 2V5UA 1BHO1 1NN3A 3D3EA 4BKPA 4E5DA 4V0LA 2P79A 2WP0A 1JWLA 1EXDA 4HX9A 4CI0B 4ZYWA 1QUFA 1HL7A 1UOQA 3LLCA 4CODB 4DWOA 5BNWA 2IQ5A 5LWHA 4KR2A 2FGKA 4CNQA 1G3QA 3K9WA 3QFCA 1YQGA 4DA0A 3RG2A 3VU9B 1AUOA 4TRMA 4B84A 2WPNA 2NPIA 1C0PA 3WLAA 5FLXA 1JDBB 1G8AA 2NO1A 2VNAA 5A5VA 2DX7A 3FDJA 1L4HA 1K8YB 2NU8B 4TXJA 2GCPA 5FH9A 1CY0A 2WIJA 2DUNA 3NBYC 5F3DA 2WSBA 4O0LA 2JG3A 3OIUA 1E4YA 3A32A 3L93A 3ASYA 4BNXA 1QFJA 1E1KA 1M33A 2IU6A 3NC4A 2YL2A 1S1MA 5LQCA 2X8JA 1EXNA 5D3MB 1H2HA 4A03A 1QZTA 4B82A 1ZDMA 1SD5A 3X1DA 2ZUTA 1IOLA 2VP6A 1EX9A 1ZCFA 1TLTA 3T7CA 1S8AA 3L4BA 3EZXA 1Z4IA 1L7PA 1XA0A 2AKYA 2X9VA 4DARA 1G8MA 3IDZA 2C4VA 2PSJA 4Y6GB 5DTMA 4WRRA 3ILYA 1XMQB 1GTSA 4DCVA 1P4RA 2WUGA 3Q1LA 4QPPA 2WF9A 3HZOA 4N7RA 2P6RA 5J9FA 1APBA 2LIVA 1DFGA 3WAKA 2JLYA 1CYDA 1TMYA 1VL2A 1Q1GA 1Z33A 4E5NA 2ERCA 2IH5A 3ISTA 3NIDB 4JL8A 1VTKA 4ZT5A 3X44A 2ORIA 4FDMA 4MHTA 5GONB 1NJGA 5FOQA 1JI0A 2CLIB 3WGUA 4RIFA 1FSSA 4F60A 3OWXA 4CQNA 3EHDA 4L6AA 3KSDO 3O8OA 1IIRA 1JB9A 3Q9NA 4U39A 3EWSA 1XG5A 1C9MA 5EZYA 3P5SA 1U04A 4P4TA 2VT7A 4P32A 4DC1A 2H4FA 1GGKA 5BQOA 1A8UA 1V39A 3LNTA 1EEXB 4LPKA 1Y4SA 4NHEA 3RU2A 3UM9A 4EH1A 3ACBA 1KQFA 1NVMB 2PY6A 4FC7A 2AYXA 4GOLD 3GH3A 3RVPA 4CLXA 4DIBA 5HS4A 1Q3TA 3CR3C 1OYOA 2VPZA 3FVVA 4AO8A 1J5EB 1NKVA 4KPUA 5AW0A 3RB8A 3RFVA 4TUYF 3KTAB 1N0WA 1ZKDA 3WL8A 3OURA 5KOHB 2Z3WA 4AJHA 2IYOA 3QRWA 3M2TA 5IULC 1C7FA 1A71A 2DHCA 2X7HA 4ND6A 4Q3BA 2W6PA 4WEQA 4EELA 5GWXA 5CB6A 1Z0DA 4BXOA 2JGNA 1JHPA 2R62A 2Z9CA 3ZKAA 3ZXSA 4X85A 1YBHA 4QUHA 3WYAA 1EP9A 5EP3A 4G4SP 3U7JA 4OO3A 5HMLA 1E1MA 1L3CA 1T3ZA 1J2RA 5LSAA 3WQRA 2J0UB 2O7NA 5AKYA 5BWCA 2FTKE 4LX8A 3VVMA 5JLJA 2M1XA 1XZCA 5BN4B 1OAOC 2F1OA 1YGYA 2QY9A 2IDMA 4LQLA 1WW2A 1QHYA 5FAKA 4R2LA 3M6XA 5C51B 2H07A 1COWA 1DWUA 4XVRA 3DKKA 4NECA 4GXNA 1H23A 4MV0A 4MS1A 3TLCA 1E3WA 5HIJA 3N5CA 1T2AA 2PR7A 3TLXA 3D6FA 3ZY2A 4CTNA 4D3DA 4P82A 1ZGGA 5ICEA 5DO9A 4BE9A 1TTTA 2OGSA 1UMCB 1O5IA 2XEXA 4HPJB 4PFQA 5FR2A 3AQ4A 4BMNA 5K8TA 1TM5E 3R7LA 4ECAA 3KYCB 1NVBA 4KAXA 4MVJI 5MGBA 1Z6TA 8ABPA 4ND3A 1W4LA 1BNCA 3JPWA 3AXSA 3C1AA 3M49A 4LQCA 5DHUA 1FJXA 1IEWA 1IZ7A 1BVYF 4CF4A 3FAKA 4NFLA 4M37A 1CEXA 4ZGGA 5JANA 4E2YA 1YCDA 3KKZA 5EWLA 4LNHA 2ZTLA 1E99A 3CTPA 1P9RA 4D46A 3GLTA 5T8KA 4MYCA 3O3CA 1UKZA 1M72A 1XHEA 4OX9Y 2W93A 4HZUB 5JQGF 3HXPA 1XA3A 4Y0VA 3L8DA 5FQOA 3TNYA 1ZX1A 3BGWA 1RKBA 5HOQA 4OI0A 4JA0A 4HEA6 1ORVA 2D0OB 4G8BA 4ER5A 3K9FC 1LF5A 4Q82A 3SSNA 1BGWA 3BXZA 1IK4A 1N2SA 4NYJR 3E9YA 2ZJ5A 1IMJA 2Z2YA 3L6OO 4QPZA 4BN0A 4Q19A 5KHOC 1EB8A 2AJ8A 5AI8A 4AYXA 4M0LA 2PVCA 5CLLA 2ERXA 4A27A 1TMKA 3R77A 1RXWA 4HN4B 2GZ1A 3AHGA 4GRDA 1YB4A 3CTMA 2QG6A 2HADA 2CLCX 2XGMA 2E1PA 2NQTA 4WFJA 5FNVA 4AUEA 2J6HA 3AOEA 3C3KA 3PRJA 5EOVA 4KQHA 3TUZC 1YVEI 4H2DA 3EC1A 1MUUA 4N6GA 4OQ4A 2FDRA 4QVKA 1JKIA 4CCYA 4F9FA 4BNFA 1T35A 1PLKA 4JBNA 2V6GA 4X1YA 4NXMB 1E18A 4JYZA 4KMSA 2OAQ1 4FYXA 2ZB7A 2D1SA 3PPVA 2I54A 4WINA 4MWBA 4QDOA 1I0ZA 1ZC4A 2IUEA 2YTZA 2PXCA 1GL3A 3M33A 1BJRE 3PQ3A 4K87A 4MW5A 4O4HA 4PONA 2NVUB 4R83A 1KFEB 4WK2B 4XCVA 2WWRA 1TA9A 1Y1QA 3CH6A 3FKJA 2XB9A 4XGRA 2J67A 3JTMA 1TQ4A 4J4TA 1LNZA 1DIRA 1U2DC 3G9ZA 4JXZA 3U48A 2O5EA 1KSHA 4W8OA 3QXXA 3KK0A 2QQ5A 2IA5A 5FIUA 5TMDA 3BFJA 1A97A 2IIQA 2Y6UA 1I5OA 2QTBA 1Z83A 3NTUA 4YN3A 4HWPA 5F3WB 2PX3A 3FCUB 1GQRA 5FWDA 1MPTA 1I7PA 2Q9BA 1CR4A 3RSHA 3GLFB 5LXTF 1KZYC 5CFNA 5EXPA 2HJHA 1H3EA 4GZ5A 4B85A 4QSMA 2ZDGA 3SG0A 4DG9A 4BFZA 4K6KA 1MO4A 3T06B 2KM1A 5JI2E 1K7XB 2OESA 3LY8A 2ZYRA 1HZZC 5FA5A 1WD5A 3QMMA 4QPDA 5E7IA 2OXTA 1US8A 3C6ZA 3WYNA 5B12A 2WZDA 4MI3A 5T3UA 1NXXA 1KI3A 2XITA 1H65A 4M36A 3PDCA 1DHTA 4UNIA 3BUSA 1JAYA 3HCCA 3QHQA 1ECBA 4PRLA 5H4GA 4N5MA 1SZCA 2DOKA 2FMFA 2PCJA 4QZVA 2AV6A 1J07A 4F86A 1ZAYA 4LFAB 1OD6A 2AEFA 3JZAA 4V39A 1C9KA 4QYIA 2PUVA 1TLLA 5A0TA 1JBEA 3TRKA 2VCHA 1F4PA 2VP2A 5GV8A 3RC9A 3B1KA 5JJ5A 5LJIA 4GRIA 3KIPA 2PL9A 2G8LA 1BEZA 4M1WA 2JANA 5LLDA 1XKTA 2DCMA 4HFNA 5DNVA 1AS2A 2J7PA 2ZBRA 3IVAA 1XZQA 3RGWS 3A4YA 3NBZC 4MVJP 1PD0A 3QKWA 2CFSA 4L4RA 2GN8A 1VJGA 3WISA 3DG9A 3WHLA 4YMHA 3QKIA 5JPDA 4YECA 1NYTA 1XQXA 1I6LA 1Y8QB 3D64A 4U2CA 5E6UA 3TM5A 4A26A 1Z0KA 1PK8A 3OO1A 5IM4A 2Z6QA 3K70B 3RBZA 4DLVA 4I1PA 3CLRD 2NSJA 1AN9A 3DLAA 4JGIA 2GPNA 2A0WA 4RF3A 5J5AA 4CF3A 4H0FA 3A04A 1V47A 2HM7A 4YWJA 3IP5A 1GN8A 4MVYA 1PR6A 4XUDA 3TO5A 3IC5A 1OJ7A 4I81A 4IFTA 2D1YA 3NCHA 2V9CA 3KXIA 2WY2D 3HU2A 4CG3A 4C6TA 4DV0B 2WM2A 3KDSE 3BTVA 3HI4A 3LX6A 5DGCA 3TM4A 3A6FA 2IWHA 3PLRA 1W34A 4BXOB 2OD2A 1GRNA 4LNUA 4X1IB 1WCV1 1CULC 2H2DA 2A59A 3LW7A 1PGQA 2PUFA 1A1SA 1VKZA 4UE6A 2O8BB 1DE0A 3JALB 3KT0A 1S8OA 5BWOA 1FFCA 1LBQA 4QL3A 3I5YA 1TUGA 3W34A 3H04A 3OIGA 3LPDA 2AOTA 1JLLB 5LN1A 2C20A 2OFWA 2J46A 3HB4X 4FZRA 1EQUA 1TZCA 1QVWA 3UCXA 5E6RB 3UFBA 4IO0A 3SP1A 3UT5B 4BNLA 3B3FA 1YB5A 2IZ1A 4KQ2A 1DC8A 2H11A 5K3AA 1P7CA 4AJNA 1UZAA 4D4IA 2QTWB 3P5BA 2GJAA 4HEHA 5AKXA 5DU2A 1WW8A 4WXEA 1TZBA 2JJMA 2WNIA 4R1MA 2HWYA 5AKJA 5DBEX 4RLFA 1FP7A 5CURA 1KDYA 1S9DA 2VQDA 1PR5A 2D62A 2BMVA 2IX9A 3MT9A 3FVRA 2HV9A 2LCQA 3UW3A 3E5NA 3WADA 1IBKB 5KKAA 2AJBA 1P2VA 1N57A 4PFSA 5JTTA 1L5HB 2FWRA 2IUFA 2WG1A 4LMBA 5LYJA 4IZIA 1EZZA 1QFZA 2WNHA 3H4VA 4XD7A 2QRLA 3P8ZA 3KZOA 4B3XA 5BWMA 5IYZA 3R3SA 2G25A 4N5NA 2IS4A 1HYBA 4ZI7A 3ZGVA 2IYLD 4IX9A 4FNGA 3JWJA 2Z9BA 1O6FA 1ZK1A 1W75A 2QAGC 1BMFD 2UZ1B 3ET4A 3M6VA 1SQ0A 1VE1A 3Q2KA 4NMMA 4RV4A 4FMCB 4LA4A 4ZRNA 3T41A 3U6BA 1Y6FA 3NFRA 3G0IA 5KJFA 3VI3B 2H4HA 2O1EA 3D02A 5IVPA 4NJMA 4CV1A 2JF0A 2XUFA 3G7SA 1ODSA 4DLAA 4ZEVA 5B5SA 1IZZA 3U9SA 1EAMA 4CMKA 3QM1A 2MINA 2RGAA 4GECA 1F1JA 5JD5A 5LZ9A 2HIHA 1RWQA 3LOUA 4NY1A 2K5UA 4LXTA 1GRVA 4TV8A 5FI3A 2J4DA 2ONYA 2PMWB 2WSYB 3B7PA 4M76B 4O4JA 2CDRA 3GT4A 1EX1A 1WULS 3I9OA 3IA2A 4KN9S 5KSWB 4QRIA 2LBPA 3L05A 1FUIA 2IPOA 1KEWA 3FJOA 3PIDA 3ZGXA 4C05A 4MWGA 2G4VA 3S2SA 2IBSA 3DZFA 1X1BA 5BUZA 4WACA 3CEMA 3CKKA 5TDHA 3CNQS 3T5DA 1KJQA 3MYYA 4INAA 1CDZA 3FZQA 1P1RA 3AI1A 3BULA 4UBMA 2DPXA 4BQOA 4UCFA 1TQ6A 1C3OB 4YX9A 1EFDN 1TA4A 4X93A 1U7TA 2CC2A 2WFAA 2ZB8A 3IO5A 4JCOA 3OECA 4XVUA 2Z43A 5IKEA 1I0IA 3NYRA 3ZHXA 5HKOA 1XCLA 2TMKA 1RQNA 3I9V1 2VVTA 3PQ7A 5ALUA 1VLHA 3TTVA 4CNBA 1FFXA 4MPPA 1U63A 1QCDA 3I2IA 4B7UA 5ENDA 1D2MA 2DM6A 2PSDA 3KQSA 2JD1A 1GA1A 4W5NA 4V03A 1E1CA 3H18A 3HFRA 1XF1A 1WR8A 3R9XA 1E59A 4ZICA 3SX0A 3Q3JB 1MABB 4ER6A 2ZI9A 1A7KA 1JDBC 1J8YF 1ZSVA 2CXSA 3EMDA 3K71B 1LVUA 4Z7QB 5C4MA 4EPTA 3VZPA 2XOEA 1JIQA 1OBVA 4MWDA 1EHCA 3K7EA 3FDFA 1XTUA 5DGIA 2WSIA 1RYEA 2Q8QA 2OVFA 3UC9A 4GFDA 3RKRA 4JR2A 1I2DA 2RC5A 4OGLA 4R2IA 2A9JA 3AQIA 2BT4A 3QLVC 1SKYB 4OTZA 1AQIA 1U6JA 4HDRB 3OCVA 2JLSA 3GFPA 3CLKA 3QUCA 3X1YA 4N6OA 5KS2A 2EW1A 1YZYA 1GPDG 1HYEA 1IOWA 3E5RA 3MF4A 4ZIRB 4K28A 3IAHA 3NEPX 1GKIA 5EPOA 1RPZA 4NCKA 1LJLA 2NZVG 4DMRA 3ED5A 5K99A 2WPDD 2XQGA 3ZXXA 4XQGA 2IVZA 1G3RA 1STOA 3R41A 1ST2A 2MSNA 2QYTA 4FD3A 2H0RA 3RVLA 1IBCA 2P2YA 3H1EA 3PCRB 1JU4A 3RU3A 1HLDA 2XIJA 4MRSA 3O8BA 1TD1A 3G17A 2P0EA 1KIAA 1AUQA 1SEVA 1NI3A 3AR6A 3MJDA 4K8OA 3X1JA 5JRDS 3G2PA 1YVPA 2N1BA 2QGNA 1CS4C 3LAWA 2H8GA 5ABPA 1MA0A 3IODA 1MFPA 5AIAA 2JLAA 4MCJA 1J0DA 1ZQ1A 4OAQA 2R1TB 1X8KA 5ESWA 3AP1A 3ZOZA 2O19A 1JIIA 3DHVA 4LTDA 4ARZA 3FHOA 5TB5A 1N8TA 1P1KA 2FJPA 3K9CA 3AEQB 3HDVA 4CDMA 3RRMA 3RSCA 1ONBA 4ZQGA 1FP2A 5PNTA 4DVJA 3AINA 4I9NA 2ZJYA 1Z4JA 4XYEA 4I4TF 5K3BA 5M2QA 1F8FA 3VR3D 1GG8A 3A6JA 3DV0B 2CMHA 2GAIA 4Y8VA 5D3KA 1OREA 2C5HA 3F5DA 3VHLB 5K0ZA 4KQWA 2DXIA 4N48A 1PE0A 4GLOA 1QLJA 3P0JA 3CGGA 2IV3A 4M7OA 4L4XA 3AL0C 3Q0EA 2FP4B 4AD8A 3N07A 4QJIA 4CQMB 5IZCC 1EE1A 1LLDA 1I1HA 2M6SA 5F5NA 2EQAA 5AICA 5JDCC 2IFTA 4GUAA 3W9SA 4GGPA 4CV2A 1AJEA 1DUVG 4BIMA 2E6KA 3WLLA 2VYND 1XNRB 5EMKA 5HCUA 5BOSA 3P4YA 4R2MA 4GPAA 1J9EA 1Z39A 4K86A 2QG4A 2HF9A 2PLAA 3WGLA 2B1IA 2R6GA 4JVOA 1TF7A 5EMLA 4GKJB 3PD1A 5JNUA 3JQ7A 4LZLA 5EZSA 4A5OA 3HRHA 4IH9A 3ITNA 3ZHSA 3QSYA 2WSLA 1NONA 2HPAA 4X97A 4YLGA 4JI8B 4RD4A 4KQFA 1ARZA 1HMYA 3U3DA 4C4XA 2VJQA 4R9UC 1UJCA 2JA1A 4M54A 4RV9A 2C61A 4A9AA 5AK6A 5B1YA 2P5YA 3OKPA 5JMTA 3DYVA 5HX7A 4OB7A 5EG5A 4E30A 1CB0A 1XPUA 1D6NA 2VO1A 3F1LA 4E6PA 1G59A 4IUDS 2QPAA 5DLDA 1L6IA 4R7GA 5I7AA 5KTPA 1YJXA 2VSOA 2GPAA 5H0IA 1QYCA 4J2HA 3I34X 4B44A 2IS2A 1K68A 5SV2A 5HS6A 3N2GA 3GQVA 1E4EA 1M1UA 3PQDA 4CL0A 1TYEB 4IQ0A 1A9OA 1DEOA 4TTRA 1K4MA 4IDHA 5G0UA 4X3OA 3TB6A 1XZAA 4DCMA 1QF7A 2NT4A 1BHJA 4DW8A 2QJTA 4D5GA 4TKVB 3OX4A 4INJA 1Z75A 2XMZA 4N9WA 3V7WA 3BZWA 1WPXA 2FW9A 3K2BA 4OHFA 4BRZA 5A2QA 2ZAIA 1SD1A 4R9SA 2DFLA 2NSYA 4OCZA 5LP6B 2ZWAA 2NSDA 3ZCTA 2P9GA 4R3UC 2W6ID 4LVOA 3S8MA 3ZE0B 4BNUA 1M6WA 4WSOA 1BDMA 5BQ3A 1VPEA 4NBTA 2F1RA 5DSXA 5F5LA 3SDSA 1CRPA 3DDZX 3H42B 3ZQUA 3KE8A 4I36A 5ECWA 1N32B 3FNHA 1ZCBA 5HKBA 4XIIA 1F60A 2JH9A 2AQ8A 3H8VA 1NG9A 3NVDA 2OYCA 3AETB 4AZWA