3PSAA

Classification of a haemophilus influenzae abc transporter hi1470/71 through its cognate molybdate periplasmic binding protein mola (mola bound to tungstate)
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
326
structure length
326
Chain Sequence
DRIITDQLDRKVTIPDHINRAVVLQHQTLNIAVQLDATKQIVGVLSNWKKQLGKNYVRLAPELENMAMPGDLNSVNIESLLALKPDVVFVTNYAPSEMIKQISDVNIPVVAISLRTGEVGEKGKLNPTLTDEDKAYNDGLKQGIELIAEVFEKKQQGDELVKAAFANRKLLADRLGDVSADKRVRTYMANPDLGTYGSGKYTGLMMEHAGAYNVAAATIKGFKQVSLENVLEWNPAVILVQDRYPDVVPQILNDQGWANIQALKDKKVFLMPEYAKAWGYPMPEALALGEVWLAKALYPQRFQDVDLDKMVNDYYQKFYRTSYKPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords protein HI_1472
publication title Classification of a Haemophilus influenzae ABC Transporter HI1470/71 through Its Cognate Molybdate Periplasmic Binding Protein, MolA.
pubmed doi rcsb
source organism Haemophilus influenzae
total genus 113
structure length 326
sequence length 326
ec nomenclature
pdb deposition date 2010-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3psaA02
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3psaA01
3U7QA 2XDQA 1N2CA 4GICA 3G9QA 2Q8QA 3U7QB 5JPDA 2YNMD 4WZBB 1KARA 5CX1B 2PS0A 3AESB 4WESA 2XY4A 4MLZA 2X4LA 4WZAB 4DBLE 3AEUB 4FNAA 5JG7A 4MX8A 5BVGA 3CX3A 4WNAA 5KOHA 5BVGB 4INPA 2XUZA 3K1AA 4MDYA 3ZKAA 4FKMA 5KOHB 3R5TA 5GGXA 4N01A 2OV3A 3EIXA 1K0FA 2AFHB 3AETA 1N4DA 3ZTTA 1N2ZA 2XQVA 1QGUA 4XPIA 5BVHA 3AETB 3PDIB 4G09A 3MD9A 2AFIB 1PQ4A 4ND8A 3MINA 3HH8A 1ESZA 4OVKA 5CR9A 2M6LA 4PM4A 3R5SA 3AEQA 3BE6A 5KHLB 3MINB 4NNPA 3NU1A 4FI3F 3TEFA 1M1NA 2OV1A 3PSAA 2XDQB 1N2CB 3ZK8A 5AFSA 3MWGA 3BE5A 3TLKA 3ZK7A 5KOJA 4LS3A 4H59A 1MIOA 4OXRA 1N4AA 3GI1A 3ZK9A 3HJTA 3MFQA 2O1EA 1KAEA 1H1LA 4WESB 1EFDN 4OXQA 1QH8A 4NNOA 2OGWA 5M29A 4M7OA 4WNAB 1M34A 3K1AB 3MWFA 4K3VA 2ETVA 2QI9F 1PSZA 2R7AA 4TKUA 5JOQA 2PS9A 2YNMC 4XPIB 1QGUB 5BVHB 1G21A 4HMPA 3AEKA 4TKVA 4ND8B 4PAGA 3EIWA 5B58T 1G21B 1QH1A 3AEQB 2PHZA 4TKVB 1M1NB 1M1YA 5JJ5A 5M3BA 3AERA 2PS3A 1FP4A 1XVLA 1M1YB 5KOJB 3AERB 4HMOA 4UDNA 1MIOB 5M34A 1L5HA 4H0FA 4B8YA 1H1LB 1K7SN 2MINA 3LHSA 4UTOA 1QH8B 1L5HB 4UTPA 2RG7A 2MINB 1M34B 5I4KA 4IRMA 2M6KA 4HN9A 4WZBA 5CX1A 3LI2A 4FILA 4INOA 4G07A 2R79A 4TKUB 3AESA 1K75A 3HXPA 5M2QA 4WZAA 2WI8A 5FLYA 3AEUA 3UJPA 4UDOA 4MO9A 2XH8A 3AEKB 1K2VN 2PRSA 1QH1B 5GGYA 2OSVA 2XV1A 4CL2A 5HDQA 2AFHA 2Q8PA 3PSHA 1FP4B 4WN9A 4BBPA 1KAHA 4LJSA 3PDIA 3TNYA 2AFIA 1TOAA 4HMQA 4WN9B 2WHYA 1G20A 1G20B 5HX7A
chains in the Genus database with same CATH superfamily
2YOHA 2PA3A 2PL3A 2EBFX 4GEGA 5LSAA 1NWHA 4W8GA 2WRZA 1KWKA 3DM5A 1YS6A 4DUGD 4U9UA 2Y92A 4NE2A 2YFKA 4X8MA 1JI3A 2V03A 4HWKA 1DZIA 4HGNA 4KVGA 3ODPA 4U2GA 2W2NA 3B82A 2C3OA 2ZRBA 5HUQA 4HAWA 4J90A 2HM7A 1CUEA 3X1YA 4F5WA 5FNVA 1U2QA 5LXTA 3DUFB 4P54A 1PJTA 3N7TA 4FD3A 2QRGA 3AZPA 2A3NA 3RM3A 2R7MA 4MV6A 4NMHA 1E1CB 1LQ2A 1QUEA 2C5SA 2CZCA 2Q1TA 1ECBA 3II6X 1RAHA 4RD0A 5GJCA 1UXOA 3GK3A 5E4TA 3JRNA 1FZTA 4ND8A 1QIMA 4JEHA 3E03A 3WYCA 3F74A 5GINE 1WP9A 2C2YA 1FW6A 3IQFA 3UGJA 1RE1A 2ZK7A 3DQPA 4NENB 2UDPA 4I50B 4LBYA 4LIPD 4PWYA 4XX0A 5JATA 5K8TA 4E7PA 5CLIA 5DTJA 3SJ7A 3HNRA 1MRZA 2JLCA 4BO8A 3UHOA 5AXAA 5CDTA 5G0VA 3EARA 2VBCA 3IDSA 1BMDA 5FFFA 1KI6A 5BXYA 3KQLA 1OZGA 1PZGA 1LZLA 1RTKA 3UYLA 3V55A 4OJQA 2ZUTA 5AVVA 3HRIA 4G9BA 1QLJA 4EVQA 2X5NA 2X42A 1Z8FA 4RGBA 3JTEA 4TLLB 1NZJA 1XBTA 1G20E 2VJLA 2SKCA 4G5QA 5REQB 4EUSA 1A8UA 2P3SA 1T2FA 3PQDA 1LJUA 4DQXA 4CHGA 4MR8A 3H99A 3IE2A 5ALKA 1GY8A 3BD7A 1MJGA 2H8GA 4YMLA 3HWWA 2IUFA 2ODBA 3K6KA 3OO0A 2QP3A 3OT5A 5JUWA 1WPRA 5JBNA 4X6YA 3N75A 5IABA 4UQLA 5AM1A 3EBOA 5KWVA 2ERYA 1TEVA 2X8BA 3V1LA 1BNCA 1WXDA 3ZU5A 3IUYA 1YI0A 4EH1A 4EO9A 4MKFA 1VL8A 1S02A 3VTAA 4Q03A 1CJSA 2Y0DA 1JVNA 2ESRA 4KAJA 2RI0A 3VRHA 2OCBA 1R15A 4B43A 2P1DA 4BNNA 2Q1SA 5CM2Z 2QLNA 4KSCA 2VUHB 1VSBA 2CN1A 2WNHA 4JGGA 4Q3OA 5GV7A 1S8FA 1LRLA 2O0KA 4M53A 4OYRA 5JC1A 3CW2A 3AI7A 3EYAA 4C0QC 1L1EA 3PS9A 4CTJA 1NLZA 1HDEA 2V7BA 3PWTA 4F8JA 3PIDA 4AULA 1NSTA 1LA2A 1DC5A 4DLSA 4UQOA 2FR8A 5I4IA 2O06A 2D6FA 1EFUA 4B0OA 2GM3A 4FYXA 2VL7A 5AW3A 3NGLA 5COQA 3G2MA 3ZHUA 5COAA 5ICEA 4BY9E 2B7BA 4RZ3A 5DBHX 4UEJA 4NYJQ 1S1MA 3FNEA 4GR5A 5JD4A 4F56A 4O1IA 5AMXA 1A4RA 2BMAA 2J5QA 1RJWA 3CR8A 4I81A 2AI1A 3WYAA 1A8QA 2Q4OA 3ETDA 3ASYA 3JWJA 2YVAA 3CH6A 3V9AA 2P2DA 3C1UA 5KCZA 3FCEA 4PRZA 1WCXA 3M0EA 3EZYA 1LNSA 1DPGA 1GKUB 1I1OA 4JOBA 2IUUA 1JLKA 1GG2A 2F3TA 2EP8A 1VHWA 2JK1A 4JSTA 4LEIA 3SQOA 4CKZA 1B0AA 4KQHA 3CEJA 1XCPA 2M1ZA 5BMVF 2QVZX 3VA7A 2FQXA 4US0R 5C53B 1WDWB 4GE0A 2PXCA 1KI8A 4R1TA 1I2BA 1RBYA 4RGQA 4AJNA 4D0SA 3F1LA 3ZJTA 1XZ8A 2IC5A 2Q1YA 2QT0A 5CFMA 5JZOA 1EHCA 1VRWA 2VIIA 3FDZB 3PEWA 3AVUA 3NI2A 4NNJA 2WHEA 5IJ9B 1XD9A 2JJYA 2JVKA 2ZB8A 4Y9RA 4CLHA 1KY2A 2R1VA 4QU5A 4OOFA 5L7YA 1NR7A 3EMKA 3O4JA 5DIFA 1IN5A 4EKDA 2FG7C 2DH5A 1G3RA 1WXEA 5I7RA 1I14A 3G23A 1QVZA 2FMHA 2DWOA 3S3TA 1Z0IA 3PKJA 3ZZ1A 3SQXA 2UZAA 2YWCA 5EESA 1V2GA 1JVBA 1BCRA 1R0SA 1TCVA 3KJHA 3VOSA 4WCFA 2PMBA 4F45A 4B3MB 2WSIA 1SD1A 4Q9KA 4X1YB 4HB0A 3TEJA 1ZUWA 5IDYA 1CKEA 5ECYA 4ZT2A 5ENZA 4U2CA 3MRSA 1OTYA 3SYNA 2DR3A 5DYWA 1V48A 4BLWA 3D3WB 4YREA 2P9CA 1N4AA 4BQNA 1CUSA 3KL2A 2BUCA 1MOQA 3GUZA 1W36D 3O3OB 1MO3A 3GRFA 3OT1A 3SOPA 3DL0A 3WIOA 4AJJA 2EJTA 2ICAA 1WW3A 3VKVA 3PFFA 1SKUA 4FJ2A 2AFIE 2XKJE 3WLIA 3WLOA 1IHDA 4AW9A 5BOVA 4HN4B 5IJZA 4JLSA 1OBOA 3ICCA 2AMLA 1Q3HA 4HN2A 3NEJA 4LHWA 4LRQA 1C41A 2KSQA 2HK8A 4PNHA 2BW0A 4KWHA 1ZCAA 3A36A 2NUTB 3WLAA 2G6BA 3JYHA 1MLDA 2CHFA 4OK6A 4K7JA 3AILA 4V0QA 5CXSA 2JS7A 2WT9A 4B6SA 4GQIA 5CT4A 2R6GA 1JPNA 1BU5A 3NEPX 1DIOB 2I4TA 1J9EA 4G5SA 4EEKA 3PGJA 1P3Y1 1U2ZA 1PJRA 4TLCA 4U2EA 4O3FA 1C3XA 1GZ6A 2YIDA 5K0ZA 3NAZA 3VR6A 4CMIB 1AU9A 1I7LA 1EVQA 2Z9DA 3QVWA 1EP3B 1CJVC 3MJDA 4NH4A 2J6IA 2CLOB 4GZMA 1NUHA 3FWNA 1EWVA 1HLFA 4CKEB 4L15A 2A5LA 3BD6A 3LPNA 2ZRAA 3RDPA 1KQFA 4B82A 4BNUA 1CQPA 3UAXA 4V0RA 1YQEA 1YRBA 5A06A 5HVNA 1WP4A 2WHXA 4K0RA 4LHVA 4ZT7A 4CIVA 2Q9CA 5A4FS 5LP6B 1J0DA 5DMHA 2ASVA 1U8FO 2C5AA 5K0LA 1TM4E 1T9AA 2XVXA 4GMHA 3QVMA 1QZZA 5F1YA 4B8ZA 3LKZA 4I4TF 4C14A 1XJCA 5G1PA 4NESA 4CR6A 5HJEA 4EPVA 4HCJA 1U4SA 3VVLA 1JKMA 2ZYGA 3MMPA 5EIEA 2VJBA 4JMLA 4DGSA 5EMKA 3IAUA 1OF1A 3KD2A 1MNQA 1XZKA 2IEYA 2JH9A 2B2CA 4M1TA 3TMYA 4R9VA 5FWDA 4A0RA 1U1GA 4ZOEA 3I92A 3E9ZA 3H2IA 5KDLA 4EL5A 2Q7XA 1QG2A 3W3AD 1XTBA 3QUTA 5K9ZA 2C8JA 3RAGA 3MCVA 3LWBA 1ZNZA 2XUAA 2XF2A 3WGUA 1NULA 3DTVB 4O4JF 3BIFA 3H5VA 3Q5DA 4RF3A 1RRVA 1SZJG 1UPFA 4JVMA 4UTVA 4G56A 3PC3A 1FS5A 3KVVA 2R8YA 3CWQA 4L2IB 5G0TA 4MGKR 1L4KA 1P1FA 3CLRC 1FY2A 3HJHA 2FN7A 3UJ9A 5KOHA 1I3OA 1T4GA 1Y4UA 3GIDA 4A5SA 5KZMB 4IH9A 3TR6A 3KAKA 1QAMA 2N1BA 5BN4B 3VFDA 1M6HA 3B9BA 4MAAA 3P4XA 2Z9BA 5C5IA 3KR2A 3Q8KA 1RIFA 4IBOA 4XGIA 3ZX4A 1Z0ZA 1P1BA 1J8YF 1P3DA 1PGJA 3ZTYA 1A97A 4JI2B 5I9TA 1X70A 4JJ7A 4DGQA 5LQUA 4GL2A 1E32A 3CRQA 1TZBA 4KFSA 4C0SA 2HNBA 3IO3A 3L0CA 4AT1A 4CFSA 4CKBA 2BSQA 2QEQA 1VGQA 3V9PA 1U5CA 2O7NA 4LK3A 1TU4A 1FUEA 1X7XB 2PMFA 1C9KA 4IDAA 3OJEA 3N8IA 2XDAA 4IH1A 4L7VA 5IXJA 5AHWA 4HAZA 1E5QA 2AGVA 1YZVA 2WJPA 5ANRB 3UV6A 1RQRA 3YASA 4CM5A 4KIWA 2G76A 4BLOA 4DIUA 6LDHA 5KJ1A 3R1IA 2ZU0C 3VMFA 1BCSB 2VOEA 2QLMA 2GZ1A 2X8JA 3Q87B 1ZXBA 1RYHA 2H17A 1XPRA 4WPGA 3OEHA 3PQ2A 5FLKA 1J8QA 2ISSD 4MEJA 4MKGA 1V3TA 1L6RA 4F5DA 4YXWA 2R7AA 3QMWA 4ENVA 3TS1A 2W2LA 5DSTA 5I7EA 4F96A 2WTUA 1DLIA 1I80A 4X60A 3TN7A 2CK3D 4OSOA 1X8JA 3PXAA 1T1SA 4PSCA 1AKQA 4PIVA 4EY5A 1Z6QA 3G0OA 4AO8A 3LLUA 4D3FA 2B1IA 5DV9A 3G8AA 2FLWA 5EHGA 2SNIE 2RHTA 4FS3A 4U1RA 4CKCA 4BNGA 2CNDA 4OP3A 2R6JA 2UVDA 3P4UA 4QYIB 5I48A 2HWKA 3WIDA 1ZOPA 1JDSA 2GN2A 2I3ZA 1KJQA 1N2IA 1WUTA 2CJFA 2RBEA 2Z2YA 3EVAA 3JRXA 4LMAA 5TC4A 3WNZA 4BBZA 2QE7A 3GGJA 4BTVA 1IXYA 3ZJ5A 5BVHA 1B41A 5BNFA 5I4KA 4YMVA 3KJIA 5DNWA 1T0UA 4HUTA 5DM0A 3EW9A 5E6SA 2WKRA 3R6TA 5ES3A 4AY4A 4B80A 5EQJB 1S6YA 2CLKB 1JILA 3AL0C 3K9QO 4BU0A 3HN2A 1P2SA 2Z3VA 4DS3A 3BA1A 2ZUVA 3A1SA 3OPYB 5KYXB 1MO4A 4OAPA 4XGQA 2EGGA 2P0YA 2G77B 4MRRA 5B36A 2ZBQA 3HU5A 4AYXA 5AESA 1ZWKA 2G28A 3AZOA 4J1SA 1JH8A 2LDBA 4TV9A 4Y2JA 3VSAA 3ZV3A 4C5AA 2VZ8A 2POQX 2QTRA 3NM5A 1E3JA 4QOEA 1P73A 2AZ4A 4PYKA 2PKWA 2PUDA 2B99A 1FFDA 3AJEA 1USIA 4JYMA 5A5DA 1TJ3A 4BATA 1X3LA 2OVBA 1OJ7A 4QECA 3NM6B 3WLJA 3LBFA 1UWCA 2REQA 1X7GA 4D4LA 5DASA 1IBSA 4AS1A 1H69A 1TUGA 1QS0A 3SBEA 3UH0A 4AXBA 2C9BA 4COKA 5JARA 4CLOB 1IBLB 2W90A 3OKPA 2QL5A 3H9QA 5K5EA 3GQBB 1Y5RA 3MRXA 3TTVA 4E31A 3B9RA 4B5KA 1TVKB 4N5MA 2JBAA 3ZE9A 1OWPA 1QQAA 3PGA1 5IJ0A 1NV9A 3EAQA 5AHKA 4EX6A 5K6AC 2ODNA 4MQ4A 4WOBA 1XJWA 3HA3A 2QAIA 3I6YA 3QK7A 5AH0A 1RI4A 2K4MA 1B2LA 1QKKA 4TL8A 4XIJA 3HP4A 1YBFA 3DE0X 4X97A 2FI1A 1M72A 3MD9A 2F43A 1Z63A 1P3JA 3ZOZA 1Z73A 4PX5A 4HATA 1XQVA 1KC1A 2QY6A 5FEMA 3QVGB 2VRNA 1FFAA 3VR0A 1B6TA 3LVRE 4YJHA 4GP6A 1TQHA 2QLTA 5BW6B 1A7UA 1Y7HA 3FCYA 5CDHA 2XUHA 3TJZA 5KQSA 4X8LA 1CUDA 1TX4B 3K9BA 3LX6A 2D0IA 2GYVA 5F2OA 4ESHA 1R9GA 1W46A 3JATB 2DSNA 1IOZA 1S2NA 1JF8A 4N03A 1N32B 1SXQA 3K30A 3ASUA 2O3SA 4YP0A 4S1WA 3GOQA 2CV2A 2PE5A 4IIJF 2HF8A 3FSGD 1C8VB 4ZODA 2QRNA 3BCHA 4ALKA 4KZPA 1SRRA 4BO4A 4F4UA 4P7JA 3AVVA 2HU7A 4R2IA 5J43A 2BDEA 3B51X 5ADWA 1DV1A 2EHJA 2PKEA 1BXRA 1FQWA 1NVDA 1GRQA 1YQWA 5KNBA 2FX5A 2LD4A 4LC1A 3L46A 3N58A 1E7YA 2QTTA 1KY4A 2GERA 3AVYA 1CWUA 2P1RA 3I9JA 3ZWKA 4BX3A 2HFKA 3E9MA 2BFEB 4ID3A 4IIHA 3H9BA 5E8JA 3OHSX 2NYVA 2XE8A 3AF1A 4FDLA 1JR3A 1FP4A 4P3NA 4BNFA 3CWZA 1DAKA 4RZXA 4P3OA 2ZRQA 2VLIA 3I9KA 3PC8C 2GXAA 5DGDA 1OXUA 2BFWA 1BG6A 2I2BA 1VCMA 1AGRA 2IYAA 2QMEA 3H5IA 5IYZF 1FUIA 1JT9A 1O6CA 2YJZA 3E81A 1WABA 4LNUA 4DLKA 3BXPA 2FFAA 3RBXA 3ZQUA 1GAEO 2WHPA 4KH1A 5FBVB 1NNLA 1YC2A 3L05A 4LZZA 4BDTA 5JPCA 4RTJA 2EVWX 1UK7A 2V7PA 3LD9A 4K2HA 1R4AA 1DELA 2BI8A 2H65A 1OFUX 3NM4A 3TZEA 4CEHB 3KQOA 1VSQA 4MWSA 5F7OA 5KYUB 1N2SA 2WJWA 3L0DA 2C4KA 4QXRA 5GGYA 3R7BA 3RH0A 4DNOA 1ZJYA 1HZZA 1DFHA 4FYKA 4MUHA 4JDUA 1VDZA 3E5MA 4OFBA 3ZWWA 3UXHA 2J8ZA 2AHRA 3IVCA 4R8LA 3WLKX 2WVAA 1P2GA 1DE0A 2WJYA 4C4AA 1P60A 1Q14A 3U4HA 4IIXA 4MITA 4IYJA 2JH8A 4TRRA 4UTNA 2PRYA 4U7PB 3IEXA 4ZOCA 5EP3A 3T9AA 5B3KA 3FSRA 4ARZA 3WAKA 4IDEA 5FO0A 4UUQA 4YVFA 2WYVA 5C8VA 2R25B 3PNKA 1TF2A 4CT5A 4DIKA 3Q5EA 5L51A 2PS0A 1TYDE 4TT3A 1YS7A 4AZSA 3L7NA 2IF0A 2XY4A 1IXSB 4I8DA 4L6AA 4PLCA 5AOAA 4M0CA 4LRXA 1NUSA 5KCMA 4DSUA 2BKAA 4D9IA 3IOYA 4BVJA 1G8FA 4N5DA 2XXAB 1X1DA 3O9MA 3H3FA 4ZVMA 2X8WA 5CD1A 4QJ4A 4ZYYA 4RPIA 1NVKA 2NZYA 1A5SB 2DTXA 1AZWA 3A1WA 1VMAA 4C1BA 3FUVA 1URPA 3TNFA 5IJXA 5A1JA 1M33A 3FHJA 4QE3A 4WVLA 2A33A 2DQ4A 2IYLD 3TIGA 5JZ9A 1SUPA 4B4VA 2N9UA 3FUUA 2RK6A 4M1WA 4FWIB 2JIZA 4WAUA 1UPXA 2ORVA 1HYQA 2NO6A 2R85A 2VH1A 1N2EA 4S3MA 4I3HA 4F2GA 3BE5A 2NV0A 3P7MA 4PX2A 4JOCA 4RC9A 4BUZA 1A1SA 1UAAA 1SHTX 1K6MA 3LY7A 4W9NA 5ITVA 3B6IA 1JMVA 2ZUBA 5GOZA 2V4MA 5JNLA 5JJLA 3UC5A 3M6IA 1TLLA 1CZKA 2C7GA 3F71A 4WASA 4HNAB 4BCCA 2VHXA 3BWBA 1OZAA 2V5AA 2ZE5A 3RU9A 2QRUA 3WHLA 3HDHA 3TJRA 3JVIA 2VXYA 1XD2A 5I9SA 1ZUIA 3QFRA 1JZTA 1U7ZA 1IHYA 2XYHA 4FSDA 2ZWAA 5KJCA 2DR2A 3FAZA 1PP4A 1VI6A 1ECCA 3NANA 4G5FA 3D7NA 1BGWA 5KOIA 2R62A 3K9FC 3WGLA 1KWGA 2CUNA 1DQNA 4CUKA 1HDIA 3D3QA 3NALA 4NJMA 4OM8A 5JYCA 1MH1A 4EEXA 1QPBA 1ORDA 4E1AA 5LP6C 4OCZA 2C95A 5DNUA 1XPOA 1N1EA 4O4IA 1II8B 4BQOA 4JB8A 1LI7A 3DW1X 3VR4H 1VL6A 3TQTA 1CYEA 3BXGA 3TPCA 1CS0A 3QXGA 2V7VA 3GFPA 3AFIA 3EXAA 1E3TA 3LY8A 2YJ3A 4LF9B 1W25A 4QNMA 4YGYA 1DXYA 1NBEA 3CLSD 4NLLA 2CNBA 3CJRA 4FEGA 4D9BA 3MXTA 4B5LA 1SC4A 2IVFA 2W6ZA 2XIQA 3K94A 2NU9B 2QMQA 3QLUC 5HIAA 5F12A 1ZNQO 3N6VA 1ILEA 1U31A 3LUJA 1Q0ZA 4G9GA 3STXA 4MI3A 2P11A 1GU0A 1FC0A 2B25A 1CRZA 3G1WA 4PEVA 2C57A 4GM1A 3PD1A 4NYJR 3WA6A 2A3RA 3WHKA 3MHTA 3LI2A 1CQJA 3WQQA 4BNIA 4JJEA 1MAVA 1PR4A 1XTQA 2EZUA 1RRFA 2JKYA 2IUSA 1M7BA 1GL6A 4YJ2B 3KQQA 4Z53A 1IYZA 3KQTA 3JQAD 4UMDA 4FLEA 3Q10A 3TLGB 1ZOIA 3DL4A 1QAOA 3C8UA 2JAOA 2VBIA 4DBVO 1DB3A 3PFNA 3A9WA 1DU4A 1PV1A 1EFPA 3EEBA 4YASA 5JJBA 5KC8A 5AW7A 3D5TA 1E3LA 2DTDA 2NAFA 1ABBA 1M7GA 4QQKA 1QGAA 2AOVA 1OGYA 4LXUA 1VCHA 1DT3A 3BGIA 3NGMA 5DTIA 4AF8A 2WWYA 1V1MB 2V7UA 1G3IA 3DYIA 1RJ9B 1E6WA 3ADDA 2OE2A 1N0UA 2X2OA 3KDPA 4PAOA 1O4VA 4A27A 1W35A 5JNVA 1S5PA 4FYYA 4UNQA 3R9KA 1AZTA 3A6EA 3ZDAA 2J31A 3T7DA 3LX5A 3W06A 2PBFA 2IX9A 4LJAA 3CSDA 1JIVA 1HDXA 1DARA 2W6IA 3FZYA 3WL3A 5JRDS 1A2OA 4UULA 4C5CA 3HCFA 3HP7A 4QOSA 5FOQA 1PEYA 2R48A 2O0HA 1QHHA 4N5NA 3OQBA 2WYUA 3QPAA 4ABYA 3ET5A 1NE7A 2OCLA 4FW9A 1XTTA 5IXSA 1I7SB 3BK2A 3KAJA 4KI7A 1GEGA 4WK2B 1UC5B 2G67A 4OA8A 4YJ3B 1IOVA 1K3TA 1PQWA 4D02A 4BRWA 2NO1A 1GGHA 4R1UA 2W0MA 1U2DC 4NJEA 4IHAA 3A9CA 3QVXA 3AJ9A 4YJFB 3CZQA 1X0XA 4RV9A 1AGXA 3B3JA 3KT8A 2BKXA 4FIZA 3DTNA 4RLFA 4XDHA 4AY6A 3TX2A 4QT0A 1XXHE 1GO2A 4MPJA 2C3YA 3UTCA 5KYGA 3MWEB 1M1ZA 2XAUA 1RI3A 5IJAA 4OUDB 4G5GA 4R0NA 1CIPA 4HQLA 4X7RA 1L1FA 5FFMA 4KUHA 1KRXA 1YQGA 1KJJA 3HKEA 4IIDA 1AY0A 4D4GA 2C3MA 3QXXA 4BO2A 1Y42X 2QORA 5AVUA 4U9IS 2VPQA 5LLTA 2I3BA 1SBZA 3CMMA 3D7KA 2RK4A 1IMOA 1EVKA 2QM7A 4LMBA 1K9VF 3NBUA 2I4LA 1SXPA 4NZOA 3SYTA 4HMPA 1NT4A 3GNSA 3X0DA 5AVYA 2V0GA 3PQ4A 4LZOA 4PO1A 5F9MA 4BO0A 4C30A 4EB3A 5IUNC 1PT7A 5ADVA 4CGZA 3NHAA 5HBGA 5F52A 4UUOA 4ZVVA 2QRKA 5B55A 1NQ5A 3WZMA 3ROKA 1RXVA 4G5RA 1NXOA 1A5ZA 4LHSA 2UYGA 3WB2A 5DGTA 3ECCA 1RKXA 3G79A 3B1JA 3VR5A 5A02A 4NONA 4HDNA 1YB6A 3DFUA 4R3NA 5JI2E 2FWBA 1F12A 2YWHA 2VT6A 4I2NA 2I9PA 2UZ4A 4D0LB 3GN1A 3ZZMA 1TO6A 4AMBA 4EJFA 1O4WA 1ZD9A 1U6JA 2HAEA 1VCIA 1AXGA 3WK8A 1AKTA 4AICA 3OZDA 1HRKA 1JKFA 3N0TA 1JHYA 1UKAA 3DCNA 1ND5A 1OX5A 5DCWA 1BA2A 2VPYA 4J1NA 4KE6A 2GJAA 3DMYA 4B75A 621PA 1FYFA 2J4FA 4G8CA 3H11A 1RXUA 3USZA 3C3WA 1TW3A 2O05A 4O25A 1UPBA 4C29A 1RJFA 4BNKA 1OC2A 3HBJA 3MIIA 3GLIB 4XJVA 2YZ2A 4OQEA 5HDQA 3K2EA 4MWTA 3TW6A 3NIGB 1P1CA 1RBMA 5SY9A 2GKGA 3T9BA 3TIXB 2B3DA 3I2YX 1KIAA 4FBLA 1JFRA 2WQ7A 4IJQA 4PO9A 5BMVA 2PKRA 1BMFA 4TRMA 1XP5A 5HKBA 1S9HA 2DPGA 5D2CA 1VI2A 3P9KA 2NU8B 5KNCD 4W7SA 4A23A 1AVTA 2D3WA 2QNRA 1WMEA 3IALA 3IAAA 3H6KA 4ZP1A 5JZMA 1AN0A 2CLLB 3T1TA 5L6LB 4B7UA 2OMKA 2R5NA 4RIGA 4PHGA 2C7VA 4RYDA 4Q48A 3V7UA 3FA2A 3CTMA 4P92A 1TGYA 2XZTA 2FEWB 2ON6A 1RACA 3RAJA 1E7SA 3WAJA 1XZBA 2GBLC 3NBQA 1MX9A 2EGUA 4GMGA 4F93B 4ZCLA 1U94A 3A04A 3OM9A 3SKVA 2YQ5A 4LYGA 4C0AC 1YF3A 2JFPA 5KYWA 7ADHA 2H2WA 1T5IA 1NTRA 4H16A 1GCIA 3HCWA 2EX1A 4YR9A 3QWHA 3ZBQA 4F60A 5C4IA 3GLFE 4YTEA 3BAFA 4MVJI 1WNTA 3WK9A 3GQVA 4BP8A 4NCJA 5KO2A 1QU3A 1QZUA 3AW9A 3VV2A 2V7GA 4B33A 5CFNA 3M6WA 4NATA 4LY9A 4DQLA 2XT6A 1EUDB 4PFQA 2DPYA 2NUAA 2ZTVA 3OURA 5U4QA 3U16A 1D4OA 2IYXA 3BWVA 3N3AC 2I5PO 4JJ8A 4N5HX 1SKYE 1XQ9A 3AI2A 3OIDA 3Q11A 4U7FA 3RNLA 2B69A 4DREA 1JDJA 3FWYA 4RVDA 5KYNA 5JALA 4IIEA 4C5BA 2OGWA 3VR4D 1U9YA 3HYRA 3L7IA 4EGFA 4K6FA 4Q3LA 3EPKA 3ZD6A 2AKYA 1VGVA 2EQ5A 4B8WA 5FNVB 5LXTB 2PFGA 3F5FA 1T8SA 3RBVA 1O97D 1I4LD 1IBCA 2P9HA 2Q4RA 2ETVA 3OE7A 4FZRA 2JC3A 1DJMA 1JEEA 4WGFA 1AM4D 2C2MA 4G0PA 2YNMC 1VM6A 1N3LA 2FN9A 3PPYA 1JNYA 4RULA 1NXXA 3AJ8A 3HZZA 1IM2A 5EHNA 1F3LA 1LTKA 4ND8B 4BNXA 1P9OA 2QY9A 1CVIA 4PX3A 2EL9A 2VDKB 1QH1A 1GU7A 2WFAA 2YCBA 2VF5X 2G83A 4XX0B 2PR7A 1GM5A 3N70A 3PFGA 3GRRA 2G1KA 2JKZA 3WJ7A 4MQ5A 1R9JA 2XVYA 1CR4A 4KDFA 4AYWA 5J4KA 3GF4A 1XJ0A 4BNVA 2PRIA 2Q5OA 1KI6B 3D3JA 3OHPA 4BKOA 1NVWQ 4EHHA 4PU0A 2CXTA 3PGVA 4Q05A 2YRXA 1OREA 5L6MB 4Z4QA 3BCRA 3OQOA 2GQ0A 3KIPA 3PWKA 1KK2A 3LPCA 1WMSA 2ZT6A 1YDWA 1W44A 1RKVA 1KC3A 1YACA 1V11A 2VP6A 4IZ6A 3DR3A 1TCCA 4YAFA 5DCUA 1AGNA 3NRCA 1RP7A 5FKJA 1HDRA 2YYAA 2WNSA 4I4TA 4X95A 1ZGGA 2FW1A 1NN0A 4I4LA 5H81A 1ESNA 4RYLA 4F06A 2WZQA 4RJKA 4B2LA 1KK1A 2PUVA 1ZHFA 3C5VA 1B3RA 4MPPA 4ZAVA 4AN4A 2E4UA 2CLDX 2HO5A 5SZKB 4D9MA 3BFKA 4J7UA 4OSEA 3ITEA 3ZJVA 3SFTA 1F2DA 1JP7A 1NUTA 2AA3A 3B6KA 2ZKLA 1HLGA 4TMVA 5CAEA 2OL4A 4B83A 4FN5A 2AJBA 3K1JA 1G20A 4RHTA 4AM8A 1FX1A 3G6KA 1S2LA 4GR9A 4O4JA 2XT0A 4H17A 2D5LA 4LAFA 5J59A 4PVCA 5EN4A 3TH5A 3U7QA 2XDQA 3GUCA 1GDDA 3GDHA 4D6XA 3NDIA 4Q6BA 1LLUA 3U39A 4LJ9A 4BFVA 5LR6A 4R3UC 2RCNA 5JNWA 2ECKA 1UJ4A 4BECA 5GJVC 3N6XA 2O2XA 4LCJA 5FBRB 4AP6A 2JGRA 1IIBA 4IUYA 1YQTA 4QRIA 3PWZA 1XQ1A 5FHRA 3COWA 3WOVA 3CVXA 2DETA 2YMPA 3LC1O 4NV1A 2I7DA 1H4TA 1FFYA 3S68A 4R1SA 3EA5A 2I6UA 1YRWA 3A9VA 1RC1A 4X3OA 4EL0A 1JAYA 1UDBA 3JXEA 4R1QA 5C8DA 1KJWA 3SN6A 2PZJA 1SBHA 2IXGA 2OTCA 2HTEA 3D6JA 2B37A 3R40A 2WV9A 4JI4B 1TMYA 1Z56C 1KZYC 3C7AA 5F2NA 3BL8A 2B5VA 5AI8A 2IU4A 2DZDA 3AEYA 3T3GA 4BGVA 2ZBDA 4IDCA 5BQFA 1P2VA 3PSAA 4JC4A 4RCZA 3FJYA 5KNLA 2JLVA 1GNRA 1YR2A 3WYBA 1NLYA 5JSYA 2YIJA 5F9HA 4R40A 4EZEA 5EE0A 5D5QA 4Y67A 1K3UB 2O1EA 3OJWA 4TS4A 2VYVA 3VAAA 3THWA 3N07A 3P97A 1IY1A 2E4AA 2VWGA 3Q9SA 1XZPA 2QTVA 1MZVA 3UB2A 3A28A 1LF0A 5B12A 2WAOA 4YYZA 4C88A 1Z5GA 3TCXB 3A3KA 1WE2A 5IP5A 1G5IA 2DHCA 2J7KA 2XKAA 2Z2IA 2AF4C 3ZCPA 2GN1A 2AB0A 3GCGA 3NOXA 2IHKA 3VTZA 4B6QA 4MIKA 2B8NA 4RF2A 3L2OB 1J4AA 1GFWA 3A7EA 3JAKA 5KS2A 1U7WA 4OJKA 2WMYA 1BCRB 4FD2A 5K4AA 5AR1A 3ZGXA 4WCFB 1MCZA 1T13A 2R8BA 3QX3A 2XUQA 4UXIA 4U7GA 4MDHA 4A2PA 1L6IA 3CM0A 1REQA 1QV6A 3PB3A 3IR5A 1DIGA 2BONA 2HA7A 1CY4A 2JHPA 2GPTA 3M49A 4QGGA 1SVNA 1T8YA 1C3VA 4XSHA 4DIFA 3J81k 1U65A 4BLQA 1L4LA 3EC2A 1YI8A 3T7TA 3HVUA 3A1DA 1A3CA 4RPHA 1W52X 5JWHA 1NQVA 2GPSA 3DS8A 4DF3A 3OT1B 3HU3A 3UQYS 3TW0A 4IQGA 3P32A 2XQKA 4ZI2A 2JAUA 1SUWA 2E7ZA 2PSJA 2RGBA 1B8VA 3L6DA 5GONF 1Z74A 1K2WA 4Q3CA 1GJRA 2Q9AA 2F6RA 3B1VA 4RMIA 5G1OA 4CLEA 1L7AA 1N75A 4DYVA 5DOZA 4BB9A 1X14A 2PEZA 1NDHA 3MMNA 1XK6A 1VRCA 4XYBA 3LUAA 4KQCA 1XTUA 3DDOA 3TRKA 4DW8A 2QLFA 4EKNB 1MX1A 1WWKA 3D8SA 4LGCA 5PNTA 3WAGA 5B30A 1NBIA 2EKLA 3BMQB 1OH5A 3FGPA 4OM7A 3ZDFA 1JDUA 4ZV9A 1SZCA 5LBUA 4I46A 1KVUA 4QO7A 4CQLA 2ZSHA 3QM1A 2H1LA 3I9OA 2AFIA 3AI3A 1GV0A 1QE0A 1S01A 5DNEA 1CQIA 2P79A 4EGSA 3U5TA 3HA7A 4BFTA 1I2AA 1XI2A 3B3AA 2VYCA 1J8DA 4Z4HA 3ENZA 4LRTB 5EXDA 2IIPA 1DAOA 1J6UA 4H1UA 4PLPA 3L8GA 4RXUA 1OXSC 1SCKA 5CYFA 4AFNA 1MO2A 2OR3A 2PGJA 4DMMA 2IXFA 3RT9A 1DGQA 2AT1A 2J9FB 1PD1A 3LYUA 1Z68A 4NWIA 5ILGA 2N75A 4X62B 2X6QA 2C3UA 3HJAA 4IJKA 5HJ7A 4LFAB 1HLPA 1TPZA 2WFLA 2QF7A 2JIPA 4F2HA 3BJRA 3LIIA 3MW8A 4D57A 4A6EA 2I6XA 1FJGB 1D6NA 2B82A 3UK1A 4M6WA 3Q3VA 4RKQA 3EGXA 4UVGA 3D54D 1J2TA 2BTEA 1KNQA 5ENDA 3NHSA 2AZMA 4YV7A 2QLLA 4YP7A 4XTCS 1NW9B 1NJ5A 2GEVA 4ZMRA 4QBHA 3BN3A 1JAXA 1HTWA 4HGYA 1X15A 3KYBA 4Q21A 2HZBA 4HBZA 2X1MA 4TGLA 5T5QA 4PC3A 3NT5A 1RXEA 2O8DA 1JHQA 3ANTA 3K96A 3QV1A 5KDOA 5F3WB 3TLKA 1NF2A 4IIJA 4EA9A 5AVRA 1B23P 4QUJA 3OZVA 4XDZA 3W5SA 1RAGA 1DTEA 3A11A 3FDJA 4YXFA 2D74A 2B1RA 1NM5A 1GLVA 4BLUA 4MH0R 2OGSA 1P9RA 3KFXA 5B4UA 2YMQA 4II7A 1U0OC 1QCYA 1QZTA 3D2AA 1W2WB 3QFSA 3OF5A 2B30A 1SU8A 2G71A 4UEWA 4MCAA 2F1HA 1N5JA 2BAGA 1CZUA 3WRXA 1DJQA 1WPGA 2WABA 4C6SA 3IKJA 1KY3A 3DFMA 2AXEA 4G63A 4QQRA 9LDBA 1F3OA 1W76A 1FSZA 1CNFA 3M5CA 4C7VA 4HC4A 3S4YA 2KX7A 3S6JA 1QP7A 1GKYA 1O9HA 1ZCZA 2ZVJA 3OCYA 1VPEA 3RAPR 2VP3A 4QTTB 1YS9A 3PZRA 5IYZA 721PA 3R9XA 1U98A 3A4NA 4NMMA 2DQSA 3WBKA 1SPBS 2DY0A 3U4QB 4XOUA 1FZQA 2W6PA 5DU2A 3JWIA 4RA6A 1U8XX 3P8ZA 4AQDA 4N6NA 4NBWA 3I2GA 3CH4B 2X8JB 4QATA 2FDRA 1OY1A 2FE1A 4HNTA 3UPTA 2CLIB 4CHTA 1JPVA 1PWHA 2B4AA 2FZEA 1EQAA 1VPDA 1P1KA 2HGSA 4IVNA 4J94A 1V45E 5B3AA 1KJYA 1EVJA 2IEAA 1FE8A 2POCA 2WT4A 4BP1A 3IE1A 4D80A 3NVKI 4B3SB 1GQ2A 4R2HA 1A69A 4ZOBA 5TQ2A 5B1YA 4XA8A 1JDBB 4ZI5A 1ZM4A 2AV6A 2P90A 4AUEA 1CFZA 1VL5A 1DKPA 3PQCA 4CKCB 4INZA 3DOEA 1LNZA 1ATZA 4J6EA 4HV4A 2G5GX 1RBQA 5BXQC 4ZAWA 2Y4NA 3E58A 1AMUA 4MV4A 1E3IA 4QLOA 4B85A 1UXHA 1HYHA 4KYTA 4ZO4A 3RUAA 1YZ3A 1ZZEA 5E6SB 5C5EA 1E20A 4Q3EA 2O19A 4DKXA 1T91A 4KVZA 3RSCA 2V45A 1AIPA 4P58A 3W7VA 1ORRA 4YLGA 2ID4A 1C3LA 1N77A 4J7AA 3U4CA 3F6PA 3D7RA 2R44A 5AHOA 1OH6A 2DERA 2VCHA 4JU9A 5KTNA 1RPTA 4EJ2A 4V0ME 2IH4A 3PTZA 2D4AA 4RENA 1WMAA 2W2VA 1PR6A 1KO1A 4AJLA 4DLBA 2HXYA 2PYIA 3EZFA 3NTUA 5SYNA 3W5CA 1A4XA 1EFVA 1TCUA 1WXGA 2GKOA 3AR5A 1YZLA 1FMTA 2QUAA 3G89A 4QAQA 4TV9B 5TRTA 3FIJA 4UZEA 4ZEVA 3LNCA 3B38A 1SR8A 5EMMA 1V4VA 3E18A 4CMGA 1ZC3A 2VNKA 4EA6A 1KHTA 5NULA 2BFBA 1JHXA 2GD2A 3CPEA 2REQB 3LZCA 2HK6A 4G84A 5ALIA 5EC8A 3D0KA 4P53A 1UEJA 2XB4A 1QS0B 1GDHA 1DRJA 1YE8A 2PWYA 4Z9FA 4ZALA 3V6LA 4UOZA 3ENVA 2I91A 3ZWXA 4ZI3A 3UT5A 1IXKA 3IDZA 5BUSA 2ZRDA 4OXRA 4YCAA 3ABOB 1OAAA 4JGBA 3FWHA 2P2CA 2XVZA 5I7UA 3TIVA 3C3JA 2H07A 3A4TA 3EZGA 3FTDA 3NBYC 4JA2A 2GF2A 2H1FA 2RHDA 4RSMA 3HHPA 4YPOA 5IVIA 3BDIA 3I5UA 4DR5B 2VJMA 1NI5A 3VAYA 3T4XA 1A9OA 2PGXA 2VA8A 4HPWA 1Z22A 2P6MA 4Q47A 1P0IA 3JD0A 4ND7A 4EKYA 3PUYA 1V9SA 2NSDA 4AG5A 1A4UA 1H9BA 5F98A 1Z5NA 1VZ2A 2F43B 2R8ZA 2UZ1A 2O50A 3E8MA 3OOJA 4GU5A 4YUWA 1G38A 3WMFA 2PHZA 3O38A 1SOWA 2TECE 3VBEA 2I1VB 5T6MA 5D3QA 5KSWB 2Q5QA 4X94A 3GJ7A 4YJHB 1EWKA 3H7AA 5M3BA 2CL0X 3FWPA 1S9DA 4XYEA 5AJTA 3HVRA 3BSWA 2OZPA 1TFRA 4G97A 2PIDA 5FTKA 3U7IA 5M04A 1N78A 1X42A 2I7CA 2CV0A 3SS7X 5JXJA 2QN1A 1Y1TA 3HVIA 3IPXA 2QMOA 2DB3A 1CV2A 1UDWA 4FWTA 2OC9A 2X2PA 3OD1A 4WXPA 1M0SA 4ZC8A 5AUNB 2ZPAA 4K1XA 4UCXA 4ZVLA 1CB0A 1Z4KA 2IEZA 2J0UA 1ETUA 2NIPA 3U0BA 3WHIA 1JAHA 1T0HB 3BFPA 3OZCA 1Z2DA 2XCUA 1YBMA 2XB6A 2B7LA 4O4LF 4RGVA 3CCBA 4WTOA 3RSZA 3THYA 4AZVA 5C32A 3W79A 3OY2A 2A88A 3F6RA 3URMA 2C5HA 4N0PA 4OBBA 3VDRA 5TF4A 1FU4A 2DBZA 4GZ5A 4P2BA 2HDNB 2GESA 1XMVA 5SZHB 1L5NA 3N2EA 1N2GA 2QOEA 1OB5A 1NP7A 2A35A 1BGVA 5IFLA 4FXPA 2A0YA 4XEUA 1W4CA 2FTKE 3LVQE 4R31A 1FP4B 4QYWA 2UYHA 4P5PA 4PYQA 3ND7A 3ETJA 3KB2A 4NBNA 4EMUA 2WUGA 1USKA 1G3MA 2PAFA 3M70A 4OP2A 4XFJA 4NL4H 2A7XA 1SPXA 3E3AA 3FSJX 1L7VC 3TZLA 3WC4A 4FEEA 4ECEA 4UJ3A 3LQ4A 2D2EA 1UH5A 2W37A 4LNUB 4W1PA 3R9IA 3NKFA 5CA0F 5E2IA 3MHPA 2RKOA 2WHPB 1QJ4A 1DXQA 1FRVA 1L8LA 4K88A 5B1SA 3NAQA 5BSHA 5AKJA 2A86A 4F3TA 3RJMA 1V7CA 2E4ZA 4H4DA 3DEHA 1E1MA 1T3GA 2JCSA 5F78A 3OOYA 1C9DB 1QR2A 1MORA 1CVRA 1R8XA 2ERCA 2R9VA 2CBGA 4GOXA 4P7BA 2XWBF 1ZI8A 1K63A 3FR7A 5A7FA 3HDYA 1PZXA 5T64A 2GNOA 3BK1A 1PE0A 1P2BA 1YIDA 3HO6A 4Y98A 2RKBA 4YCMA 2HLPA 2IT1A 4HEA6 3N6RA 1YI1A 3O82A 3N2KA 5DHRA 4Y0VA 1R9MA 3RRNA 1ZLYA 3IV6A 4XFKA 2DPMA 3MGAA 4J6FA 3WLHA 4EARA 1W0KA 3SAJA 3R8CA 3WB1A 4D4MA 4URWR 1QHNA 1J97A 4GQBA 1E5LA 3K70D 1FU8A 4RV4A 2FW9A 4CXMA 1XZIA 4KLAA 4MLDA 1DWOA 3G13A 4WCFC 5FTWA 1DQPA 4ARZB 4HEA1 1GPNA 1NXVA 2MSWA 3VM6A 1YIAA 2OD2A 4AB1A 1TUIA 1NUQA 1PGPA 2TYSB 2W11A 3GELA 5DCLA 1HEUA 1HQKA 3C5EA 2OESA 3EG9A 3LLSA 1RPJA 4C9BA 1QTRA 3EXHB 1M2GA 4YRKA 1XOIA 2X9QA 2X7JA 1QHYA 4U8GA 5E9QA 5JDIA 3UKOA 3ZHYA 2RGGA 3RK4A 1AMNA 5C5CA 4JSRA 1XRPA 2VPWA 1FK8A 4AZ3A 1ZL2A 4E46A 1XJ5A 4Z9AA 2F8SA 5SV2A 1D8AA 1KZ4A 2P2YA 1SB9A 2HUNA 5H16A 3OQNA 1PK9A 1BN7A 2OCKA 5LCXA 1CRWG 1Y4SA 3GEIA 4MV5A 4RBNA 4MJXA 4TVSA 4QOHA 1GNTA 3LP8A 1O0CA 1V35A 3AEKA 1XEXA 4ZVUA 4HB4A 3RVDA 4Z5XA 2CFCA 1TKCA 2AG8A 4MIOA 821PA 1QK3A 1UBCA 3EQ9A 4L9RA 1KYYA 3U56A 1HSOA 3IQWA 4IFEA 1NQTA 1RC0A 2FWJA 2M1XA 1IATA 4QU9A 1D9XA 1J8MF 3A37A 4ACAA 5BWCA 3NOOA 2GKSA 3E7PA 3EUAA 5A0FA 1U4OA 3MGCA 4AKIA 4IDOA 2GMWA 1AB6A 4ASUD 5C4MA 3AFMA 3FRHA 3PZBA 1VIDA 1EDDA 4OY3A 2XUIA 4XWGA 3E7XA 3L93A 4HX2A 1U2GC 1XD2B 1COWA 1CF4A 3S1SA 3MRVA 4ER3A 3ZWCA 4FILA 1A8HA 1X1RA 4WDRA 3U3ZA 5KREA 2R11A 2VSFA 3TE7A 5FH9A 1ZAYA 4XARA 3DE2X 5CVEA 1YS2X 3VOTA 1HE5A 1RMYA 3KR1A 2ZCUA 1FYDA 5AKLA 3CUTA 1QIHA 1YFZA 1ZA2A 3LSYA 2FX3A 4JUCA 4NCNA 2YN0A 4S1VA 2GJ9A 4O4IB 2OBFA 1XVVA 4KUGA 1PVOA 5L7TA 3P0RA 1AQYA 4AP5A 4LOHA 1XTKA 2H7XA 3K5PA 1CS0B 5A4KA 2JH3A 2QTMA 2BI4A 2ANBA 2SCUA 1BHJA 1MV5A 2XGSA 2YVKA 3HKBA 3IBTA 4GXNA 4M1ZA 4V0NA 4WH0A 4NFHA 2D62A 3D2LA 1RM4A 2JCYA 3D4OA 4XLTA 4JEUA 3K7EA 4L8YA 3NBFA 1X94A 1CHNA 4EHIA 2J1LA 1Q6YA 3QPCA 2Q41A 1L5SA 3GL9A 4OMUA 2PRKA 4LC9A 1N2CA 1T1RA 2ATIA 3N87A 4AS2A 1I4EB 5F33A 4X54A 1XVUA 2Y9MB 4OJYA 1WPQA 3HJCA 3SOZA 3ZS8A 1RWMA 2O14A 2WYOA 4JOSA 4M7RA 1QP0A 4ARUA 4M86A 1CQJB 1HG0A 4NZNA 3UHPA 2HRCA 4C01A 1OXKB 1ETHA 3OLCX 4ISCA 4LDNA 1ECJA 1DBPA 4RZ2A 2QD2A 1UINA 3WMGA 2JG3A 3VUFA 3D9QX 2HLNA 3I45A 4REOA 4G24A 5AVKA 1IOWA 3UG7A 5CXUA 1F9EA 3Q0EA 3ZWYA 1ZNWA 1A82A 4MNTA 3IT2A 3MOIA 4MVJG 1WIWA 5DRYA 4CG1A 1NTOA 2OPBA 4HDKA 3DZBA 4HJRA 4OI2A 2EDAA 5ED4A 3IP9A 5KBYA 3P96A 5K8CA 1TVCA 2FDXA 3G88A 5DSXA 3SDBA 2J59A 2X0EA 1Q57A 1EPUA 3S2EA 1PT8A 2O7QA 4KFCA 1FB5A 3R44A 1WF3A 1U28A 2HBYA 3MMXA 1M8FA 3NHLA 4IHJF 1MOPA 3QTLA 1JIUA 4PQYA 3TTWA 6YASA 1Z4IA 2H18A 4HWRA 2GEJA 3MQFA 4JJ4A 4DT1A 2RAUA 1QUFA 3VMMA 1Z7GA 5ECGC 3HCDA 3RHFA 3VHRA 1PJ8A 3JR3A 5F3DA 1QH8A 1HWYA 1LB1B 4NNOA 3CVYA 4RY2A 2EATA 1GXSA 3QPDA 4KXLA 4BS9A 3CX6A 1Z5OA 3EUFA 3U09A 1QHHB 1K92A 1NUAA 4RCYA 1MO5A 3ELDA 4BC1A 5KWEA 2F3PA 1NRIA 4H15A 5B7QA 2VHTA 1ZINA 3RIHA 1LZKA 1W4AA 4CQMD 1MVLA 1NASA 4ENSA 3WJAA 3ZNPA 3U1BA 1UDXA 2RJ3A 4CUZA 1X7WA 3B5IA 3EIWA 1CDDA 1ZGBA 2QM3A 5CVCA 2ZYWX 2QZJA 3GIWA 4NJEB 3QLVA 3RUCA 1G59A 1JDBC 3IVRA 4KR3A 3H42B 3GT4A 4MDFA 1KQ3A 2QE6A 4CQNA 1N34B 4C7OA 1P8AA 2H4YA 4TYYA 4QXQA 4P4TA 4LDZA 1J99A 3BRWA 2BD0A 1CF9A 5LFAA 5JEEA 1UJBA 1TMKA 3QWAA 3I2IA 1GG5A 2QIOA 4JUAA 3RS5A 2F8LA 2BKLA 3EDOA 3HKEB 5FDFA 1F8UA 4OFXA 4ZQEA 1JLLA 1IN8A 2Y27A 3U4MA 4WY5A 1NSYA 3OOEA 4B7ZA 4M8IA 3HYCA 3T5MA 3OCVA 1M9NA 1BMQA 4N0EA 4ER7A 5L53A 5JQGF 2QQFA 3W5IA 4EG4A 2WU8A 1I7NA 1OWMA 3HFGA 1TU0A 4R84A 4JUIA 3PX2A 2TS1A 4KXYA 4WLNA 4FQ5A 3UPDA 3I2FA 3WO0A 2OZKA 2DT8A 4MWGA 1QRDA 3COZA 3PP8A 4GNKA 4IY1A 3SZUA 4IWYA 4YBRA 5FBQB 4BPRA 2IZZA 4D0GA 3SC6A 4DR4B 4NU8X 5EJ5A 1P77A 2NGRA 2Q1WA 5DHAA 5LBTA 1ULSA 3QVVA 5ALZA 3VNAA 4N39A 1LTQA 3DV0A 3ER8A 5KWIA 1J0EA 2AFVA 1K0UA 1UKEA 3Q8MA 3FIUA 3FGOA 3NH9A 2PV7A 1Y3AA 3DH0A 3KBOA 4HDNB 1W9HA 3A1NA 4KFRA 1YOVA 4TLEA 1C8KA 1Q12A 1XA4A 1Y0BA 1ZGHA 3AF4A 3E1KA 4L85A 3EH2A 4FYWA 2CZQA 1G5RA 2E18A 3W05A 1YCHA 1EFKA 5FI1B 2LPMA 4LHXA 1DFGA 5EHQA 3KR9A 4TS3A 5DLDA 1G66A 3WXMA 1OFHA 2WAXA 1NXQA 3ENQA 3QPVA 4MPDA 4MOWA 4L74A 4CKXA 4NE7A 4KIGA 5KNDD 5ILOA 1GHTA 3TLAA 3O8RA 1E9EA 1PEDA 4LMRA 3ZDXB 5BPHA 4NABA 3JQBA 5LDGA 3K0BA 2OXIA 4R54A 1YL7A 2YN4A 1D2MA 3W9BA 1MTOA 4LI3X 3KLPX 3UJ7A 1L5MA 4L3VA 1N2BA 3NDPA 3MILA 3GJTA 4IV0A 2R68A 4N3NA 5BT8A 4MGZR 1CRLA 1VBKA 5CBPA 2XNDD 4W8OA 3H5WA 3COPA 3NYRA 3WKEA 3G5UA 4CUJA 4UPEA 3D31A 4P80A 2GK4A 1PDVA 3ZXXA 3DLHA 1W94A 1I1HA 4RESA 5JU6A 4YAEA 5BMVB 1DIHA 3PPVA 2H0RA 2PNFA 4Z4GA 2CNWD 1FDIA 4JLAA 2ENWA 2JAPA 4F3KA 3ZUPA 3K0SA 2CYBA 2VR1A 4MQBA 1KMQA 3DF9A 4P9NA 5BV7A 3I0MA 5LZ4A 2FFHA 4XR4A 5KOYA 1YJ8A 2JJ8A 4GX5A 4X7PA 3PR3A 2C4MA 5G4LA 1DHRA 3D4BA 3SVZA 3NBZC 5JIBA 4GI2A 4HFNA 4GP7A 1O3YA 2L82A 2VEDA 3CPSA 3OPYI 1L0BA 3J7TA 1YMVA 2BCEA 2OBNA 3G9XA 4TN1A 5DM60 5IKXA 4UMFA 1IEQA 3B5EA 4YECA 6ADHA 4LF6B 2W2QA 3DBVO 2FJ0A 4DARA 2NPIA 2HC9A 2XB9A 4URUR 1Y33E 1SGWA 3WL5A 2EFJA 3ZCQA 2FR0A 5ELXA 1WXIA 5KVQA 5DI9A 1XLUA 1DTSA 2F2TA 4JJIA 4D92A 3EEQA 4FXOA 1JPJA 3U0VA 4IG9A 3L18A 2NUAB 4BNDB 1EIWA 1D2AA 4F3YA 1Z5UA 1LDEA 1FTNA 4QBTA 1KFCB 3UOGA 1T6NA 3MTGA 4LOIA 3EEOA 2PH5A 4Y2TA 4PYNA 3TLZA 2GBGA 1ZMBA 2W8ZA 2BGWA 3BXOA 3DQQA 2XE7A 1R88A 4OHCA 1WO8A 3QFTA 3A1VA 2BEUA 3KHUA 4QYXA 4YDRA 3EE6A 4K9KA 5EIXA 2G1JA 4WECA 1WSWA 3L6BA 3GLFA 2Q2QA 4TX1A 3FPSA 4W5HA 1W4RA 1VA4A 1VKJA 2EV9A 1N92A 4MGIR 4NF2A 4R5HA 4W82A 5HCIA 1OXTA 2CDRA 2Q3LA 1CDEA 1PI3A 2ZE7A 3R6WA 4OGWA 5TY0A 2NUBA 3HY4A 2EAUA 1YB1A 1PZFA 2I3AA 2ZR8A 3GJXC 2NV6A 3O83A 1U1DA 1J06A 2H2FA 3ZBPA 3M9WA 2OXFA 4ZV7A 4H31A 5AM3A 2X7XA 2P67A 1O6GA 2PUWA 2A1UA 1QH1B 4JT9A 4NOKA 1DDGA 4KN8A 3U9TA 3B89A 3F3MA 2DP4E 3VBCA 5DHTA 4B6FA 1RWVA 4WGGA 1HZZC 2FZKA 3OMWA 2ZSFA 2RGXA 4MVJD 3MT0A 3AHFA 3EMDA 2ZIUB 4D3YA 4QT4A 2PBRA 4C2TA 4S35A 3GJ3A 5LWHA 3N8KA 5B57C 5FWYA 4RIFA 1PL6A 2VHZA 1Q0LA 4I5IA 3RS8A 4PPGA 5DDIP 2IIVA 2FNAA 5IUJC 1CBUA 3RUFA 2B8EA 1JG4A 4CLDA 2NXWA 1AV7A 3L8YA 3Q8XB 4BUJA 1XRMA 4QOJA 3WLTA 2QUKA 1RXYA 4GVLA 4GWLA 3TL2A 1Y6JA 2QMZA 2VDPB 1GA6A 3EXHC 4H7HA 3C4QA 1SA0A 4DSTA 3Q8LA 3CX3A 2X5OA 1MKYA 3PTAA 2PG3A 1RQNA 2OO3A 3AMVA 3FUXA 2Q7OE 2H85A 4P0TA 3LYAA 3IP5A 4C21A 2JFOA 1W34A 1EFRA 5HK8A 1NQXA 1Q7TA 1ZW6A 4FFDA 5CAEB 4DDVA 3LHFA 1LEHA 2ZITA 3HVHA 3RLFA 1RT9A 3GXOA 3K3PA 5I7AA 4EF6A 1QQ5A 1QDLB 1OC4A 3IOBA 4JBLA 4D4IA 2Q5JA 4TMZA 521PA 3OIUA 2DPLA 4CCAA 2XDQB 5D1HA 1H0HA 2XNCA 3H9UA 5EZYF 1WKVA 3A8TA 4R4JA 3TOSA 1SXHA 5TGZA 2YRWA 4I8XA 5B7NA 1Q0TA 4X3CA 3DNFA 3LX8A 3MELA 3U17A 1KDRA 2NMVA 2GAJA 4W9NC 1BJTA 4ZCMA 1G0OA 1SUBA 4YDSA 2Q62A 3EPJA 1MFPA 1JMKC 2HIAA 5D51S 2C31A 4HUQA 1WM1A 2PMDA 1KBZA 5JYBA 2SKEA 1NAIA 1IHUA 3G8BA 2H16A 2OWEA 1D07A 1SIUA 3NJ8A 5PGMA 2PUJA 4XDYA 3P1JA 3HUUA 1P7ZA 5FTNA 5HZMA 4TXMA 1OA1A 4HO1X 4KMOA 2CL5A 5L4NA 5HS6A 1XZDA 3LUCA 4F8EA 2CJWA 3IE0A 1EUZA 4RIEA 5TXGA 1KDVA 5I6DA 4KHZA 3D3EA 1AKYA 5T4HA 4BKRA 3FLBA 2XUDA 1SOMA 4KQ9A 3RC2A 2Z83A 4KDEA 1BW9A 2FZ5A 2AWOA 4H6WA 4JB3A 1ZQ9A 3JPYA 4J9UE 4N7RA 3KTAA 3GLGA 2HDWA 2XTMA 3HJBA 1X1QA 1G8AA 3MWLA 4MAFA 3RRYA 3V7WA 4E33A 3CNQS 3EOZA 1QYVA 1WR8A 2QYTA 3JQ9A 4OK3A 1FFXA 1WSAA 3C8DA 4C04A 4V1CA 3THWB 1WUKS 3D6VA 3V1TC 4MW0A 3H9CA 1AF7A 2QTVB 4D4JA 3NS7A 3LQRA 3V97A 3WRYC 4C4XA 3S0JA 3IDOA 3R5XA 1KU0A 1XDZA 5EIBC 4FFWA 4JX9A 2XCOA 3FVRA 5DN6A 1E0AA 1YL5A 3JAKB 3AUYA 3N2LA 4G0OA 3FKSD 3NB0A 2RH8A 2VJYA 4NK4A 4ZAFA 1JQEA 3OZXA 3T0IA 4CW7A 5JS2A 4LFBB 1EVIA 1QK4A 1REQB 2QSJA 5B2ZA 1JG7A 1VYTA 3GJQA 4YAIA 1ACLA 2OLEA 2VI5A 1M2VA 1J1ZA 3OPNA 3WK6A 1N6HA 1OE0A 4CT4B 1Q7CA 1SQFA 1XN1A 1BXGA 4UFOA 4CN8A 3JZIA 1PJCA 1NVUQ 2FWIA 2CXQA 4ZEXA 3IOEA 2OAQ1 3NDBB 3D4PA 3GNTA 3UVEA 1OXBB 2I6FA 4DA8A 3TZKA 1PZEA 1ZVKA 1WZNA 2FSSA 3OKAA 2WIFA 2QVXX 1DO0A 3FF4A 2EZ4A 2GXSA 4H1TA 4D9NA 2OUKA 4RJTA 1HPLA 3NDJA 4K3UA 4FCCA 4Y2VA 3L0YA 1MR3F 1MDFA 4IFTA 3TQIA 3VU8A 3O6VA 1I01A 1T9GS 1QCZA 1UBTS 5BVGB 2QWXA 1F51E 2QTWB 4C0JA 4NYMQ 4Y1RA 2PQ0A 1BOOA 4IVQA 2HCFA 4D97A 2GPAA 1UBEA 3FAKA 3NASA 3DVRX 4LJ4A 3TSAA 1STOA 2NZJA 1KKMA 3DA8A 2V58A 3HABA 2OWDA 4RELA 4QTYA 5C8YF 4CQLB 5EKDA 2V55B 1DINA 3DO8A 1L5OA 3T3PB 3H1BA 2AFIB 2X86A 3DJYA 2NNLD 3HH8A 3MSXA 3I12A 3RF6A 1CQIB 1U7XA 4JFRA 1UDRA 5ALEA 3VZCA 3EQ8A 3H4MA 3ZU6A 2A9RA 1T3TA 2XOKD 3DDHA 3ICOA 3ZNQA 3GNQA 3GJ0A 2JZOA 1JE0A 4EW6A 5B3LA 5HUHA 4RKWA 3O92A 3OM8A 1WU8A 3KYJB 4HH3C 4PBRA 4LS3A 3GLVA 1M2NA 3LPDA 1GPWB 4EJMA 1CY7A 2ZCVA 5GZ1A 2J5KA 1C4KA 5KSOA 2X1VA 1NURA 1R0ZA 4CV0A 3L8DA 1BD4A 3DD1A 1CVLA 5BWOA 3QELA 2NSHA 4R2WA 1A1VA 5FOTA 1SHUX 3BHJA 4IMIB 4M6WB 1IJEA 2JIRA 5DM1A 1PFYA 3K09A 5MGNA 1FS4A 3MNFA 4JI5B 1DPFA 1OLXA 4PF1A 5AI6A 3TL3A 5KKAA 3IMGA 2B1QA 1NMEA 1SZDA 2G4LA 3PDWA 2JDID 4GG1A 4X6XA 2AVNA 2BBSA 5HFNA 1Q7GA 5DW3A 5JR3A 2O8DB 4NU5A 3IP6A 4YA6A 4YDQA 2CVHA 1OOEA 4L95C 5ITWA 2FK7A 4KXFB 5E9AA 2CV1A 5GIPE 3RS2A 3CW9A 3ZHQA 1NA5A 3PPXA 4UZFA 2QZZA 4IIJB 2VF4X 3X1MA 4YT4A 5FWNA 3UCFA 1BN6A 2GETA 3C41J 4B6EA 3W6OA 4QLBA 4DV5B 1QHIA 1ZZGA 1HNXB 4O4LA 5FXMA 1APBA 4RFVA 1YJAA 4BASA 4I1SA 1Q83A 3R2JA 3U37A 1ZL0A 1ZXXA 2TSYB 2H59A 3CUSA 1U5AA 5IEBA 1RQ7A 3ICEA 3LPMA 3VDXA 3FNBA 1T15A 2JFHA 1KYWA 1EIZA 2YYYA 3W2TA 5JCOA 3Q2IA 4E5VA 1XJQA 3DOFA 1JQAA 4Q9HA 1HKUA 1XF1A 3VDMA 5L9AA 4OSPA 3S7TA 3NHFA 1RBZA 4RY0A 1QTIA 4D3SA 5AKYA 4ZJYA 3RU2A 3IIMA 3CINA 5ULLA 1G5QA 2XR1A 3S2FA 1TQ4A 1TZMA 3HVKA 4JLPA 5IYZB 5LQSA 2WLTA 2JF0A 4H2DA 3R9XB 1BVYF 4YMGA 3KVYA 1KE1A 2RFLA 5CA0A 1S0UA 1VCNA 2DBVO 3HKCA 4DJ5X 1RI2A 2A78A 5E0KB 4MW4A 3E15A 2ZB3A 2BN4A 1GKLA 4F3NA 1R8SA 2EDCA 2X9LA 2MOKA 2B8JA 3TF5A 4P0PB 3AVOA 7YASA 2PVCA 4D4HA 5IM5A 3D2BA 1E5TA 3CRZA 1U81A 4ZAYA 5EGNA 3HVJA 2YV4A 4YYEA 3BGDA 1KI7A 1GUZA 4UBIA 2WUDA 1OH7A 2VDJA 3ETNA 3UUEA 4DLAA 1YUNA 1PJ4A 4KJZA 3CSUA 3ID6C 5T6BA 4AJEA 4DNXA 5KJ6A 4RTMA 1K27A 3H83A 4R9SA 4JQZA 5KQGA 2IHUA 4FYHA 4QUIA 2O4CA 2ZQZA 4PZYA 3MA0A 3NNDA 4HDMA 2PTGA 1FEZA 1PK8A 3TTSA 4GYWA 3DG9A 3ORSA 3AIKA 2E5FA 4Q3DA 4RFSA 4AJPA 4G0MA 1QGUA 2O2HA 4OXNA 3AXTA 2YHAA 4NFSA 4ZVRA 1RMTA 5FOUA 1ZICA 3AEQA 1RAIA 1FXUA 8ABPA 1U0SY 1E2FA 1CDOA 1U8CB 4UAVA 1I0LA 1ZD5A 3ZWQA 4URHA 1N7IA 4BFZA 4DM7A 5DYYA 3FI9A 4BN4A 4J4TA 3NHBA 1PG0A 2XT9A 2YWGA 3E5NA 3AVXA 2O8CA 4BLSA 1DAEA 3B1WA 3RS4A 3CEPB 5B2FA 4AUKA 3EUEA 2PZFA 3O2QB 3A1EA 3IAM6 2C4NA 2VPIA 2QXUA 2YVUA 1GCUA 3F47A 2O23A 1LU9A 4I1RA 4H3VA 1EXMA 1J8VA 1HE4A 3NXSA 2O20A 2VPZA 5AKEA 4Y2SA 1C9MA 3R7FA 3WB0A 4H4CA 1RM3A 3C3DA 3EVDA 1JLHA 4QC2A 5J1SB 4D3DA 2J41A 1KOJA 4FFBA 4E5UA 4GYYA 3RS3A 1EGAA 3JYQA 5HWSA 2J0VA 3IAM1 4ME6A 2VJAA 3MUNA 1OIVA 2VP5A 5EJMA 1WXXA 1Y5LA 3LK7A 3V7FA 4Z2AA 3UT5B 4UNRA 2ATCA 3GPIA 4L1KA 3DDWA 3TRFA 4H35A 3BGOS 5CNJA 5F1PA 3CLRD 3QEMB 1FLAA 4D56A 4QPJC 2QUZA 4H9GA 2QQ0A 2PU7A 1K4YA 3H4VA 4YDHB 3T94A 1I13A 1YFJA 2MINB 3O1HB 1GTSA 4A5OA 3GV0A 2PGLA 1UK6A 2YWXA 2ZSIA 4XUEA 1Q0HA 4KR7A 4EA7A 1MB2A 4WZBA 4OH7A 2EZ8A 4R16A 1OD6A 1P17A 1QYDA 3O93A 2OXCA 2OYRA 4G5YA 5AT1A 2C2XA 3H1AA 3NEAA 1NVVQ 4DVJA 1CNMA 1RFGE 2BSXA 3ZCUA 4EOGA 4S05A 5B7GA 3WZ2A 1K2VN 4Z7OB 3VJRA 3WWCA 1UM9A 5TARA 1KJIA 2BFPA 3ZU3A 1UDCA 1UKCA 3RLIA 1GL3A 3JWGA 4XJTA 4MARA 1XXLA 3VC2A 1CETA 2O0JA 5BN5A 1QSGA 3NCHA 1VIYA 5TNXA 1AQLA 3ZWDA 3PA8A 2NV2B 2FN4A 2ZDQA 2DBQA 4U2DA 2WWRA 1NC3A 1I2MA 2WVGA 4L8WB 3VTKA 1QVWA 1RJGA 2P69A 4TM8A 4XFDA 4Y6QA 5GZ3A 1X9IA 4B17A 2J0UB 2O3UA 1LI5A 3T1YB 1FVXA 4MGYR 1EZ4A 2N0SA 1Q1BA 1T25A 1HA3A 2YHSA 2GCGA 1PLLA 1DZ3A 4G1MB 3THYB 2NU6A 3FFBA 1TUEA 2J6CA 1DBSA 2QDXA 3CN7A 1QORA 4L8VA 1ATIA 2FWNA 1H42A 3C1OA 3MERA 2V6MA 2XXJA 5DFAA 4B1FA 1H2FA 4DC9A 2F4NA 2R0QC 2VRCA 4U7WA 4TVBA 3OFSA 2FCRA 3Q2KA 5CDUA 3SFZA 1YKGA 1YNSA 2ZBPA 2M32A 1LI4A 2NO4A 3ONWA 4LVCA 4RK7A 3WNBA 1N4DA 2FPKA 1YMQA 4HR7A 1N0VC 1Y6ZA 5FOXA 5FV4A 4LXHA 4IHJA 1B15A 5BQOA 1Y7TA 1EXWA 5EL0A 1XGKA 3WBJA 1WV1A 3FPGA 3K0KA 3DVLA 1VIVA 3JARA 3SY8A 2VQFB 5FNZA 4IZOA 1A5TA 1B6SA 3B3QA 3JQ6A 3QEKA 5AXDA 2YW9A 5BRJA 3MPOA 1HL7A 2ZRCA 3D8UA 1VJ1A 4JSYA 4G36A 4C3UA 8LDHA 3MWGA 1WVMA 4W6QA 4RWZA 5TGTA 4W1RA 2ZSBA 4DBLC 5DHQA 4ZJPA 2XB8A 5JW6A 2F48A 4TTSA 4LYJA 4J0EA 3GG2A 3IELA 1LFDB 2E85A 3MWYW 1YR8A 1Q1NA 3KEQA 4BBJA 3F4BA 1UJ6A 5AW4A 4J0JA 2NO5A 4QQNA 4GS5A 4LY3A 2ATXA 1XCMA 4QNNA 1FFHA 3TSCA 4Y6GB 4XZ3A 2IXTA 4EF5A 4CV2A 1ODJA 5EQTA 4KXXA 3IQGX 3N2KB 5AKGA 2R751 3HACA 3H9EO 4WW0A 3LGAA 2TMDA 4EF4A 1T9HA 2FY8A 3KLMX 3M1YA 1QGDA 3TBKA 4WZAE 2X1HA 3NC4A 4S1OA 4YCBA 2QQ5A 3EOAI 1F6BA 3F7NA 1ACJA 1COZA 2OHGA 3E84A 1JLMA 3EWSA 3FRJA 1CQWA 4AAYA 4LRWA 5IH3A 3FBTA 2COUA 3SEAA 1FFSA 1V4BA 2Z6QA 2IDJA 5CYGA 2HWWA 3AERB 2V0NA 2WJHA 3EG9B 1CY2A 2X9NA 3PNMA 4GKAA 2ZIXA 5FBHA 5JNRA 1YDGA 2PD3A 3KXDA 5ERGB 3RRJA 1ADJA 1Z33A 5TT0A 3A6ZA 2EFGA 2W83A 1TC1A 4IQ0A 5HGJA 1EVLA 3P0JA 4HGPA 5JQGA 2XUFA 1T1IA 3GT7A 4K6OA 3Q7PA 4AZ3B 4DIMA 1R3UA 3PKZA 2C5LA 2ILVA 4LWQA 5J47A 1EUYA 2QX6A 1NYTA 3OWXA 3F3YA 4HX9A 4KTVE 1YAHA 2D1YA 5ALDA 1L4MA 5EJ2A 4IEIA 1Y8QA 1XEXB 2VUIB 3AEKB 3L4BA 1FIUA 2CYAA 1RPAA 2PQ2A 3HEAA 4F71A 1FJ2A 4ZI7F 4EG8A 3EZLA 1SQ5A 2R1ZA 3IYLW 3P45A 4QX6A 4PGAA 4PZAA 2J6HA 4RKRA 1CUGA 1MXHA 4YAGA 3V34A 3BTSA 4WOJA 4ARSA 1D0VA 1X86B 5ED0A 5G4KA 1XNJA 5JECA 2P7IA 2W2XA 9LDTA 1RYYA 3EF1A 3PLNA 1CXZA 4JV5B 2YQ4A 2GZ2A 4IZIA 3H97A 1RLTA 3HGQA 1JWLA 5A6SA 2GN9A 1V37A 3N2GA 1I6KA 1ZPDA 4TKZA 4LV6A 2Z8YA 2ZBUA 4EECA 4GPTA 5GAJA 5MFZA 1W85A 4QUBA 1NX6A 3IUMA 1ZVMA 2E82A 2BZGA 3R3YA 3F6EX 4EBBA 2IUEA 2YXPX 4FGZA 3LQYA 4ZYXA 1CDZA 4Y9SA 1MN6A 3ZTWA 1FP6A 1Y1RA 4HD8A 4CG2A 1ARZA 3JQRA 5T67A 3GWGA 2ID7A 4RHEA 3RFXA 4E15A 1EK5A 4P81A 1SJ9A 2DMRA 2C96A 2I2FA 2VK4A 4ZZ3A 1V8ZA 3R4VA 2YZ7A 2R8PA 1FFWA 1KJNA 2F1KA 2XDWA 4RQTA 3V8QA 2A30A 4KODA 1X6VA 4XIYA 2CDCA 3HJFA 1PW5A 1QYRA 1TA9A 1N2OA 1VCOA 2X6RA 4NYIQ 3LBAA 4XTRA 1D6MA 4YRLA 3ZZ0A 4ZQBA 2SCUB 4IF4A 4FP9A 1AO3A 1NC1A 1V16A 2Q3HA 3HKBB 1HQYE 4K9PA 4OVKA 3T1QA 1X0VA 3I23A 1U1CA 3PUKA 3UWDA 1JALA 3D0OA 3ZH2A 3FLMA 1XQYA 2F3SA 1BVRA 1Q0SA 3LK6A 2H1WA 3P52A 1OXXK 1DI0A 1H8HA 1N2CB 4ZXFA 3V7YA 3SMQA 3WB9A 1GLGA 2BFFB 3LX4A 4WBNF 4HYEA 3LUKA 1GADO 1SWWA 3WNQA 4ATNA 4CMEA 4EUNA 5AK3A 3DPSA 4JVSB 5DP2A 3D4LA 3N0WA 4RHYA 3NYWA 3SZ3A 1QKIA 2BMVA 4ZC1A 1JJIA 3DM9B 3DFKA 4M9XA 3TFWA 3PC7A 4YQZA 4TQAA 4Z0NA 1MDBA 1XRSB 3ADBA 4JB2A 1RLIA 1O87A 4FQ8A 1ODTC 2ZBGA 1E98A 3F6BX 2GNAA 2XGOA 3I8SA 4HDKB 4ZCPA 3CZ9A 1K6EA 3KPJA 3LUBA 1WHTA 2QVBA 4TXLA 4ZZ2A 3HFRA 3WRXC 4QG3A 4ARIA 1OBVA 2P0AA 3HRHA 3JZAA 4D7AA 5ECDA 2F9MA 3ZW9A 1ZJZA 4MZXA 2IX3A 5CDFE 3RADC 2YTZA 2HF9A 3T54A 5IMBA 3IL2A 1NBOA 3QOYA 2PJRA 2K87A 4FMDB 2C2BA 2D8MA 4FT2A 3ND6A 5DEIA 3UPUA 2OD9A 2P40A 4URZR 4DT1B 4EJ6A 4EFDA 5LMUB 5M34A 1SU6A 1T4MA 2C5FA 1OLOA 2LE0A 2QN9A 1WMFA 3CU5A 4YCDA 1QH8B 2IP4A 1W19A 4EMSA 1DG9A 4PPYA 4EELA 3D5QA 1GXSB 3KB6A 1CUXA 1ZSYA 5A1TA 4X00A 3EWIA 4HDCA 4RQBA 1N33B 3OC6A 1ZLXA 3OEEA 4UPVA 5B6IA 1WLSA 5BNIA 2ZS8A 4YS6A 4IOJA 4WOPA 3H5NA 2AOWA 2Q99A 4EPYA 3GJZA 4OB7A 5J2UA 5BYKA 1DC7A 4XKJA 4A3SA 1HR0B 2HQBA 2KPOA 4L08A 2H1HA 2R65A 3AP1A 3JQCA 4BWVA 3CLSC 1OLUA 1M2WA 2IBTA 1XRJA 1WUHS 2PLNA 4CL2A 3L6OO 4RPKA 3U6KA 2OOSA 5K8VA 2IHVA 3VPFA 4C7OB 3OECA 4KXWA 1C7QA 3IMCA 5CFRA 2H00A 2HLDD 4PRKA 1UFRA 4BLPA 4M98A 4HVTA 5LN1A 2X41A 3U6BA 1FS6A 1ICEA 3CJTA 1YVUA 3CLUC 3DMDA 4Q9AA 3R20A 5AI4A 5ICGA 3TWOA 1EP9A 1YAJA 2P75A 2GLTA 5L8VA 1C4OA 1UQRA 2JJQA 3REFA 1G21E 4BZPA 3KYDA 1TQ6A 1SUDA 1T4CA 1JLLB 3Q1LA 2G70A 3U40A 1HNZB 1UL1X 2WPDA 3OQHA 1EWRA 5IW8A 3C3YA 4F9TA 2W5UA 4BCDA 4KQEA 3S55A 4D0RA 3MYRA 3DHNA 3VGJA 3MJSA 4UHEA 3DULA 2IPAB 2H1OA 3FSGA 3GGSA 2JFYA 2GVDC 4DDWA 2VDVE 4MW9A 4WACA 1I7DA 1S2MA 2LDXA 5IAAA 1S89A 1Y37A 2VATA 2XODA 1E0KA 4LG1A 5B6JA 1M75A 1II0A 5K0TA 4KGZA 5IVHA 1I9CA 1ZMTA 3E5HA 5L40A 2PLWA 2BGJA 3DV0B 4UU1A 4GOKA 6Q21A 1RCTE 3UTDA 1YQDA 5EZYA 3DLIA 1C8BA 3E05A 4NNPA 4RAQA 4B31A 3DWEX 3IV7A 3I05A 4GP9A 3RD5A 3CWCA 3HLTA 4MQLA 1E2DA 4NFYA 3DTVD 3GG9A 2AKAB 1QFSA 1W0CA 2MMCA 5CHYA 1ES9A 3E2PA 1YVDA 3UZUA 1L5ZA 4AS3A 1E1QA 4BV3A 1WB9A 2I3GA 3QKIA 4ZMBA 1QKJA 1V9LA 2H5IA 1IMJA 1EJ6A 2IYPA 4EITA 3QWIA 2PS1A 1D9ZA 2ZUEA 1O8CA 2IPLA 2PTHA 1QPGA 1K89A 3MTEA 3ITNA 4AKGA 3DZKA 3TXYA 3CE9A 3U7FB 1BQEA 1XEFA 3H7IA 4JENA 5CBPB 3FVWA 3OCUA 6ABPA 1E66A 4XAQA 1V39A 3RAEC 4J3FA 2D1QA 3LG2A 1KP3A 5BORA 3L4SO 1IHXA 2P8JA 2CT8A 1JT2A 1ZI6A 1MW8X 1KTIA 2CEAA 5EXXA 2HSGA 3O9VA 1W1IA 3RASA 2DPHA 1EBUA 1R6AA 1FNMA 2CC2A 1V8FA 5KTKA 3AKZA 4W99A 2YR0A 2J3EA 1N6NA 1TEXA 3HUFA 4O2AF 1IAVA 5IK2A 1ISFA 1M1YB 1V8PA 3CEMA 4YJGA 3E9CA 4JHXA 3TRDA 4Q24A 2XOXA 4QPZA 3EZ9A 2WB4A 3D5EA 5EXEA 1RR6A 5DM2A 4R9RA 4PPQA 1HQCA 3PXXA 4BAZA 2XUJA 2J08A 2JFWA 3KC2A 4FLMA 4WKGA 3S1AA 1W47A 2OZEA 4OHFA 4C43A 4O5OA 5G0UA 1WETA 2HJWA 3JCZA 4AMYA 3KOMA 1JQKA 5IWCA 1QRSA 1YHNA 3GLUA 4L51A 4L3OA 1Z38A 2GM5A 2YICA 3U1TA 4IDGA 3DE4X 4C0KA 3W1EA 4ZA2A 1I33A 3KCQA 1ONPA 1FPMA 3ZXIA 1OWNA 5I01A 3FW1A 4GLJA 3M6LA 1G5FA 3ZKWB 5BV0A 1ZH6A 3ME5A 3UGTA 3FCAA 1Z4OA 1ZS9A 3EGVA 4C1NA 1E59A 1KH1A 3C4JA 1NOJA 1P31A 2XLBA 3IVAA 1HXHA 3PGLA 3Q3CA 4JQSA 5DX0A 4CVNA 4F4DA 1GPMA 1KOFA 1LX7A 3K8YA 3VNQA 4A8HA 1CY8A 3VKHA 3RSHA 4WFQA 5TV2A 3F98A 3RKRA 2B36A 2O8FA 4LRSB 5HRAA 3IEMA 4ID9A 2D1FA 2VHEA 2IJGX 3QE3A 4FX2A 3RV4A 5TJ9A 4OLJA 2BEUB 3BD8A 2IA5A 3DHYA 1RNLA 1OSNA 1ZOSA 3GT0A 1ZBQA 3QIAA 3HUDA 2OG2A 2H4JA 3GBPA 1BDBA 4K81B 1D1PA 2CHGA 1NVBA 1N3YA 3BIJA 1PWEA 3AF5A 1VFNA 4U4AA 4KIUA 2OAGA 1JSCA 1KO4A 1LK7A 1LV7A 2PA0A 4ARAA 1T4BA 1WZIA 2RC5A 1RZ3A 4IIFA 1IWOA 1PR1A 3B8EA 3FDIA 5C8YA 2RH4A 3RTAA 5IZCA 3RO7A 2W6JA 4PC6A 5I5EA 1RWBA 3JQFA 4IDQA 4UE6A 3C48A 3KKLA 2ZSEA 1BE6A 1C14A 1TK2A 2I66A 1X7HA 3EVFA 3PR1A 4TLAA 4ZICA 2PUBA 3ASVA 5CLLA 3VAZA 3CZ4A 3FETA 1LXCA 1JDPA 5HEKA 4N8SA 1G98A 2Z4TA 3N0VA 2ATEA 4PCAA 2G88A 3DEYX 5FWYB 3JAWA 2FVYA 4FI3F 1M8KA 3KM0A 4M54A 4PRYA 1KEVA 3WVNA 1XDWA 4KEAA 5E4JA 1J24A 3L8EA 4IJVA 7MHTA 1HO3A 2DYKA 2G4VA 4HEQA 2YXEA 4QQ8A 5AD1A 5EJIA 4RDXA 4LF4B 3I6IA 3M4YA 2WWHA 3OWHA 5FBLB 5SICE 4PG5A 1SA0B 1Z6GA 1RW4A 2NN3C 3IO5A 4Y6RA 5CJPA 1ZEJA 4FHCA 3N28A 4EQZA 1GAXA 3T34A 2QYSA 1NUPA 1N1GA 4YMWA 4D1YA 4CN9A 2ZZNA 1AF4A 2P2SA 2GJ8A 4WNIA 1RQGA 1NRXA 3FOAA 1FPQA 1I6LA 2ONKA 5B3JC 3L06A 4XQ9A 4ALLA 1XZCA 4MKIA 4ON9A 1PX0A 4RZIA 2QTBA 2ID8A 1LPOA 1CZRA 2V6BA 3FXAA 4YGXB 3DVAB 1LJ8A 1RQXA 3CISA 1KH2A 3K53A 4EJSA 3EEFA 4JLNA 4EVRA 2JHGA 3PYXA 1F4VA 4NIMA 2WJ6A 4MWDA 5JAOA 2CMGA 3G2IA 3LMKA 1BVUA 1VSUA 4I3FA 1VJDA 1K06A 5MF6A 1T35A 3DBLA 4WKBA 1FUUA 2QZ9A 3ELBA 5CT5A 4DSOA 4UTOA 4FHZA 4L02A 5CGZA 1G8PA 3TRIA 2VHWA 2WU0A 1OU4A 4Y9UA 1SCIA 3B1FA 3LC2O 1P9NA 3P2OA 3FLAA 1C1XA 4HUQB 1ICIA 2KWIA 3L8HA 5EYPB 2OFFA 3CUYA 4BNYA 5AM2A 3R9WA 2KQUA 2VP0A 2ZI9A 1H0KA 3JWHA 2CE7A 2ZSKA 3REOA 2BY4A 2HRRA 1SB8A 1N25A 5K3OA 1QK5A 4FIDA 3COYA 4O1HA 2YZMA 3K9WA 2AK2A 4WLOA 1X74A 1SIOA 4O1MA 3AY3A 3CRVA 1Q19A 1VE9A 2RBGA 2AYXA 4FDVA 4C4RA 1CY6A 1U3TA 3G2LA 1GZ7A 1YFKA 4FGJA 1H2WA 1BW9B 3ESDA 5CM9C 5DF1A 2A57A 3KTAB 3DEFA 5FADA 4S0ZA 5HFJA 4WE3A 4CT0A 5AVWA 3GLGB 1TVEA 3FPBA 2AXPA 1DBWA 2QTFA 4M0FA 4PC2A 5JISA 2A5GA 3B2NA 1FFXB 5KU1A 4RPLA 2Z5VA 3WMRA 4AJKA 2FKNA 4V1CB 3OF2A 4XLZA 5FP0A 3NVAA 2BTOA 3G9ZA 2NXCA 4KE7A 1GLNA 1Q15A 1CFJA 2EBHX 1JZSA 2F1IA 2FXIA 2YNMD 3HI4A 1U80A 2PU5A 3O8OA 3RBAA 5BURA 2J5RA 1Q1AA 4MIEA 2YH2A 3CGWA 4DLXA 1XMQB 2Q1UA 1NXTA 1PW7A 1U3UA 2Y71A 3NJ4A 4I55F 4O2RA 4LTNA 1E8MA 2WHRA 3EGDA 4OQZA 1H94A 2GPWA 2E3JA 2XA9A 3W78A 5HOQA 1NKSA 4HADA 1DBRA 3STTA 3RIMA 5U4XA 3CB4A 3GFVA 4IGAA 2JAXA 1UK8A 3O8QA 5CLJA 1UPUA 1VJ0A 2J09A 1C3OA 2CE2X 2PX6A 3FKQA 4M0KA 1P4GA 1M2VB 2I3DA 3L8CA 4MUXA 3M6UA 4MHOA 3HPQA 5E6UA 4C0LA 1LDNA 4POOA 4MHTA 1T36A 1OVMA 1QQTA 5FUMA 5A2GA 2KW5A 5F3RA 3SKXA 2XRZA 2WICA 2D00A 2VSNA 1U28C 3MJ4A 3TAUA 3R24A 4C7BA 5FTLA 5JSZA 2YL2A 3MWDA 4BYMA 1ECPA 1TDJA 4X8OA 3TE6A 2FSVA 4QTZA 4ZO7A 4A2CA 4ALIA 4OIFA 3CSSA 4F92B 1U63A 3EG5A 1EFTA 1LD3A 4O63O 5AJZA