3PSAA

Classification of a haemophilus influenzae abc transporter hi1470/71 through its cognate molybdate periplasmic binding protein mola (mola bound to tungstate)
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
326
structure length
326
Chain Sequence
b'DRIITDQLDRKVTIPDHINRAVVLQHQTLNIAVQLDATKQIVGVLSNWKKQLGKNYVRLAPELENMAMPGDLNSVNIESLLALKPDVVFVTNYAPSEMIKQISDVNIPVVAISLRTGEVGEKGKLNPTLTDEDKAYNDGLKQGIELIAEVFEKKQQGDELVKAAFANRKLLADRLGDVSADKRVRTYMANPDLGTYGSGKYTGLMMEHAGAYNVAAATIKGFKQVSLENVLEWNPAVILVQDRYPDVVPQILNDQGWANIQALKDKKVFLMPEYAKAWGYPMPEALALGEVWLAKALYPQRFQDVDLDKMVNDYYQKFYRTSYKPD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords protein HI_1472
molecule tags Metal transport
source organism Haemophilus influenzae
publication title Classification of a Haemophilus influenzae ABC Transporter HI1470/71 through Its Cognate Molybdate Periplasmic Binding Protein, MolA.
pubmed doi rcsb
total genus 113
structure length 326
sequence length 326
ec nomenclature
pdb deposition date 2010-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3psaA02
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3psaA01
4UTOA 5BVGB 4NNPA 1QH8B 1KAEA 4WNAA 4ND8A 5CX1A 3U7QA 5KOJA 1FP4A 5JG7A 3R5SA 3NU1A 5I4KA 3PDIA 2R79A 1M1NB 1KARA 1M1NA 3AESA 4FI3F 5HDQA 4DBLE 5JPDA 2MINA 4WZBB 3AEUB 3AEUA 4WZAB 3TLKA 4FKMA 3AERA 2XUZA 1QH1A 3EIXA 4H59A 2XH8A 4NNOA 5BVHB 4TKUB 5KHLB 3MD9A 5AFSA 3TEFA 5KOHB 2WHYA 4OVKA 3TNYA 3AETA 4WESA 3ZK7A 3ZTTA 4HN9A 2AFIA 3MFQA 1K75A 1N4DA 1QH8A 4HMOA 5GGYA 1ESZA 3ZK9A 5M34A 1G21B 3AEKB 1K0FA 4B8YA 1QGUA 1XVLA 2OGWA 2PS9A 3HH8A 1M1YA 2PS3A 4MO9A 4WZBA 4G09A 4WN9A 2M6LA 4PM4A 4G07A 3MINA 1MIOB 4UTPA 1MIOA 4K3VA 5CR9A 3UJPA 2AFIB 5B58T 5FLYA 3EIWA 2OV3A 4MDYA 1K7SN 1N2CB 5KOHA 4XPIA 1QGUB 2XV1A 1M34B 3PSHA 5CX1B 1G21A 3U7QB 2OV1A 4INOA 5KOJB 2MINB 2XQVA 2YNMC 2X4LA 3HJTA 4WNAB 1G20A 3CX3A 4FILA 3R5TA 1L5HA 1H1LA 4XPIB 3LI2A 3PDIB 5JOQA 1N2ZA 3G9QA 2Q8QA 5M3BA 2PS0A 4TKVB 1EFDN 1FP4B 2QI9F 2AFHB 5JJ5A 2AFHA 4MX8A 5BVHA 1TOAA 2YNMD 3MINB 2PHZA 4BBPA 5BVGA 5HX7A 2PRSA 1H1LB 5M29A 1G20B 2WI8A 3MWGA 3HXPA 4UDOA 3K1AB 3AESB 4M7OA 2ETVA 1N4AA 1M34A 2XY4A 4WN9B 1PSZA 3AEQA 2O1EA 4ND8B 2XDQB 4HMQA 3ZKAA 4INPA 3MWFA 4CL2A 1PQ4A 4FNAA 3K1AA 3BE6A 1QH1B 4OXRA 1M1YB 4IRMA 4WZAA 3PSAA 4UDNA 1N2CA 3AEKA 3AETB 4WESB 4HMPA 2RG7A 5GGXA 3ZK8A 3BE5A 4LJSA 4TKUA 2XDQA 4MLZA 4H0FA 1KAHA 3AEQB 4GICA 4TKVA 5M2QA 2OSVA 3AERB 2M6KA 2R7AA 2Q8PA 3LHSA 4N01A 4PAGA 1L5HB 3GI1A 4OXQA 4LS3A 1K2VN
chains in the Genus database with same CATH superfamily
1V7PC 1AS3A 4GT1A 1K97A 1IXZA 2FB9A 3ESBA 2RAFA 3IUNA 3HEBA 1DFIA 2ZJ1A 4UEJA 3SE0A 3EMVA 3RJTA 4RXTA 4UASA 2LCIA 1NMXA 4ZVOA 1XTBA 2IDKA 3ORQA 1VFPA 3KCNA 4ZT3A 5A71A 1PJ2A 2V1UA 2B2CA 5JYEA 1FZTA 3EIQA 3R6GA 1TU0A 5CFOA 3RKSA 2GS9A 1VYTA 1WDWB 4N0QA 4V0OA 5E6SB 3BD7A 5A5DA 2Y1XA 2I6FA 3AW9A 1I8TA 2R44A 1MAHA 3B1ZA 2QRVA 2ZU6A 4H1HA 1LZLA 1YE8A 4AZ0B 3K2EA 1XO1A 2FP4A 2JFHA 1LV8A 4CV3A 4HFRA 1DQNA 1ODIA 2WM9B 1KU6A 3QPVA 4RBNA 5F7JA 2W70A 3HP4A 4HDAA 3TDKA 1REQA 2YOFA 4DJFC 2WJVA 5JY1A 4G4JA 4ESHA 5IRCD 1TAQA 3ZK7A 4L85A 3OG9A 2O8DB 4MWDA 1WHSB 1W75A 2VQEB 1H5UA 4EKDA 1WL8A 4A15A 5IDYA 3R4CA 2ABWA 4XVQA 2GETA 1YAJA 3L7NA 2JAUA 2Q5QA 3IH5A 1XVLA 3L6OO 1L5MA 2NZ8A 3A6DA 2ZJ2A 3CZ5A 3MTGA 4R4JA 3RVJA 4BECA 1HF3A 2OZVA 4KFUA 3WL7A 4OD0A 1O5TA 4HB2A 4NICA 1PGJA 3JWPA 4J9UE 4JVOA 2YHUA 3E05A 3PYMA 1KVQA 2HZBA 3DL0A 4M0LA 4EX6A 1AG9A 3K4HA 5B58T 1H9CA 1X94A 4ZO7A 4PNPA 2NU7A 2CHUA 1QX3A 5AW0A 1IC6A 1T9BA 1FUUA 2BDUA 4TWJA 3P0FA 1NW4A 3H0EA 2B92A 3IOCA 4O02B 4C43A 3NEJA 1K4MA 2V7PA 4YCAA 3M82A 3VDQA 4NHEA 1GEGA 3OA0A 4OI4A 1GADO 1TJPB 4RHEA 4RENA 3UK2A 5CUQA 3CHYA 3OCWA 3E0QA 3R3ZA 2YC4C 3VHQA 1WR8A 4Q24A 3PHHA 1SQGA 3AHEA 4ZOBA 2WJJA 4MUIA 1WZIA 4RDHA 3H3FA 2G0TA 2OAQ1 4GG1A 4RK4A 3EZGA 4ALKA 4MUEA 5JZMA 2ZBFA 3BIXA 5K01A 4LBVA 4RH0A 4GBMA 1JWAB 1MDBA 1NUQA 4WY5A 5HP4A 4GE0A 2Y27A 4N9WA 4XARA 4OYHA 1M34E 5J1SB 1GDDA 4G65A 2PK3A 1SU8A 1Q6ZA 2PKCA 2BFEB 2HSWA 3R5FA 4QTZA 5CFLA 1RJ9B 3FTFA 3E3MA 2FX2A 2FCAA 4MRNA 3JASA 3LRTA 3GRVA 1PZMA 3HP1A 1PV1A 1KK1A 3H7IA 1UC5B 4MJ3A 4FCCA 4C2TA 1PFGA 1AJEA 1KETA 1AHIA 3NT5A 3AILA 1S02A 3PJDA 4IY1A 4HQNA 3RIEA 2WLSA 5TLSA 1YZLA 2ZUUA 4OXRA 4F1WA 1L8AA 1VGQA 1J49A 4MCIA 2XMPA 4E46A 2HO5A 3ZXYA 3OX3A 3CZQA 3F8TA 3WICA 1ZZGA 4ZHQB 1YCGA 1ZI8A 3I2KA 1HFJA 3L7BA 2NXWA 1J0BA 2IU0A 1Q3TA 2X22A 1V1JA 2FPRA 4HDMB 4F5ZA 1AN9A 1VHQA 4AKTA 2V59A 1ULTA 1TVEA 2NO5A 1LBIA 3DHNA 1PBTA 3S81A 4BUZA 2X19A 4NV0A 4FLMA 3X1MA 1XZIA 3DOOA 3UK1A 2IY9A 4XIJA 4YRRA 5CBPA 1QIHA 1QRRA 1G6OA 1Y5IA 4K40A 4NJEA 3CLTC 3PDHA 2SCUA 1N9ZA 2UXDB 1OH5A 3IBGA 4RYLA 3U48A 2QP9X 2Y6VA 4X41A 2JHAA 4DF3A 2FEMA 5ALVA 2I87A 5I7FA 4DPKA 1M1NA 3KT6A 3O82A 4EJ0A 1DXQA 3DUFA 3ZVKA 3V2IA 4FB5A 4K6CA 2QE6A 1E7RA 1K98A 4NZPA 3GLSA 2PGIA 4Q4HB 4ZDWA 3OLYA 4P3YA 5JHHB 4BB5A 4W5HA 4Q16A 1OBHA 4BATA 2HDOA 2JVJA 2QVCA 3I04M 3GEPA 1I3OA 1OBCA 1G0NA 3TEFA 5EKUA 1DO0A 3IP6A 1Y1SA 2WIFA 3DMYA 4OHVA 4AF8A 5CURA 2J3MA 2EWVA 3FYDA 5JNUA 5EFZA 3IEVA 2WC1A 2O3UA 4AMGA 3BBLA 3KZCA 2VDLB 3TEJA 4RELA 3OM9A 4BP1A 1YZYA 1Q7GA 2ILTA 4FDLA 3JWEA 1VSTA 4KXUA 3ADCA 3E1KA 1MV8A 1W87A 3QH4A 4LAFA 2X9NA 1D2GA 1TGVA 4WZBA 1JDNA 1P8AA 5AKKA 2ZSIA 4D3XA 4DZTA 3L0SA 4ADSG 1TVMA 3G0DA 1PTKA 1QH0A 4BVJA 3CLSD 4RF5A 5DGDA 1L1EA 2F43A 2OB2A 4FYHA 1NF8A 2WJIA 5DHQA 2ODBA 3MCVA 1NG9A 5KNBH 4R2WA 4EB0A 3LX5A 5C35A 5JLAA 3PLAE 3MM4A 5DTRA 5FO0A 3ZY3A 1ZK0A 1XHEA 2ISCA 3SX4A 3Q7SA 3VOSA 1MMFB 4DZRA 1T4MA 4XSHA 3RSGA 4HATA 2WPDD 3K6KA 1Y7IA 3LT0A 3MT9A 2Z2IA 2B34A 3ORFA 5JYCA 1VGVA 4AJ1A 1WCWA 3GJ7A 4RDIA 1QIEA 2WWXA 2ST1A 3GGCA 1G8SA 3DEZA 3V9AA 3QE9Y 4IJVA 2F4VB 1ECFA 2RCNA 3BQMB 3C6ZA 3K8QA 3QKRA 1AKEA 4Y9UA 5ECYA 1HH4A 3UH0A 2PSFA 3QVMA 5G0SA 2RARA 2MMCA 1Z39A 3DTNA 2ZZNA 3WKEA 2J0EA 1K92A 3KJXA 1E3JA 4QUAA 2IH2A 2GA8A 4YJ2A 3LHDA 2GAOA 2I4MA 4HHEA 4ZI5A 5D2CA 3OTIA 3ZBTA 4EWLA 1PFWA 1ZUNB 2DLNA 4QXMA 3OCYA 1F5SA 3WLJA 2FFJA 2Z95A 3HKBB 4DCPA 3Q15C 4EQ6A 2FSSA 4CL2A 3QEMA 4HS9A 2RK3A 3IESA 4QODA 4MPTA 3V6MA 4JI2B 3A4YA 1Q77A 1A1SA 3EVNA 3GJXC 3SQLA 2FWRA 3C4QA 5EE3A 3WWOA 1PWEA 4XR9A 1US8A 4FCWA 3H7AA 4AY4A 2PE5A 1V96A 5KTNA 1CZKA 5GZ1A 1O89A 5IYZB 1DQYA 1EHYA 3BIWA 2XUOA 4HYTA 4DIFA 5ALRA 1DP4A 2OZKA 1E20A 4TKUA 1CZHA 4X97A 4F8EA 4OSEA 4XUGB 2A1TR 2HMUA 4ABTA 1SCUB 1FVHA 3IA2A 4H4EA 1BCRB 3W4IA 1E1YA 2M6KA 2WF7A 1PJLA 2HU8A 3O1HB 4JENA 4KDRA 4Z1MD 1YQDA 2YFKA 3BSWA 1HNNA 1THMA 4ED9A 1XTQA 3ZYCA 2K5UA 2MSDB 2REQA 2X58A 3GROA 1VI2A 3M33A 3ZQKA 2ORVA 1M8PA 3FMFA 2NU8A 3K96A 2YWHA 3SXUB 2D06A 3KYCB 3X1DA 3LRPA 4OP1A 2HA2A 3D7LA 2JHGA 1T26A 3O4GA 2JGLA 1BYUA 1T5TA 3DTTA 3HPRA 4G0QA 4I55A 4J94A 2Q9CA 4R40A 3RVBA 3S2YA 4EHJA 2VS1A 3UMMA 2R11A 1IZ9A 2ACWA 3D3JA 5AK5A 3RAFC 3FKJA 4HEA6 1MQ9A 4MQEA 4MGZR 4WKPA 1ZH6A 3ZTWA 3FNBA 2EBFX 3M6LA 4EF4A 4OKIA 3ROGA 2VYQA 4J75A 2I2BA 3NOXA 1WPQA 4P82A 4UE2A 3FMGA 3ICQB 5CCBA 1UR5A 1G8KA 1I2MA 5H8WA 1XL1A 4HTFB 3B7PA 5T67A 2G7ZA 3KR9A 1MQSA 1W8DA 2VPXA 3EZNA 4WY2A 2DZDA 2P9TA 2DE0X 2V3CC 1NVDA 5KMGB 3RSLA 1UM8A 2X0RA 2OOKA 3IERA 4JMLA 4RVDA 3BD6A 1QK3A 3CZRA 2DHCA 3VA7A 3G2OA 1EFVA 1ZZEA 4QX6A 4OLHA 1M2VB 2AQKA 4JVMA 1POXA 4AQYB 1EG2A 2Z6AA 2GCPA 2DM6A 2WILA 4K9NA 1Y3CE 2P9CA 2ODQA 3LWBA 5ALFA 1E9SA 2G9NA 5DBGA 4DG8A 1DQSA 5AP9A 1DTWA 2FEXA 3GNLA 1BMTA 1V5GA 5GJBA 5EHXA 2ZYAA 4KHPB 3LF1A 1Z4JA 4WXEA 5JH7F 4W5QA 1YZTA 1LLFA 2EIXA 4TRRA 5EP3A 4C5CA 1SZJG 1JB9A 2B25A 2ZRHA 1NFQA 2TMGA 1VG1A 3OEHD 3R6LA 3U31A 4DNQA 3MWEA 2RH5A 1WD5A 2WAMA 3F90A 4LVOA 4NVRA 1X1DA 1R6VA 1DC3A 1E8NA 2H2DA 1ZVKA 4RK6A 4M9QA 4DJDC 3CRZA 4OQYA 4QYIB 3RS9A 1J8VA 1L7QA 2F4NA 1GGHA 2XCTB 2B1RA 5DK6A 3GGGA 3BCRA 1DTSA 4FZJA 1NQXA 1KZ9A 4H08A 1QLJA 2D74A 3BX1A 3GO4A 1OAOA 3RBVA 1YBAA 3TYXA 3W4KA 1RXVA 4G1FA 3K70C 2PLRA 5JECA 3TTSA 5HQ3A 3TWOA 4IDNA 4MCJA 4FMPA 3K1AB 2N0SA 2CMHA 1V2GA 4FNGA 5FAXA 5JCJD 3GUHA 5BWNA 4H77A 2REBA 3OEHA 1NKVA 4X45A 4BLSA 4J6EA 2JFNA 4PAOA 3FHTA 3GJ8A 2XGSA 1NW8A 3IHWA 3K0KA 2GCIA 3PQ2A 1P6QA 4XLLA 4AXXA 2C8JA 4JI4B 3FY4A 2CL0X 3JD1A 1D6JA 1DMRA 1Y9AA 4C4OA 1KRWA 3GRZA 3C3CA 4U2GA 3A7EA 1CC1S 2KB0A 4MW6A 1B0UA 1JQ5A 2HA6A 2NNWB 1V4NA 1Q3KA 1SRRA 1VKHA 1YJCA 2XJ9A 3AUFA 1CJMA 4LNUB 4G5SA 4LXHA 3TZCA 1FFDA 1KQPA 2YV4A 2QMZA 3K0AA 2Z8YA 7AT1A 4GX0A 1NWHA 1KF0A 4Y2XA 5F2NA 5LDDC 5T8KC 3UENA 3CO5A 4EY4A 1W9MA 2JGKA 3QMWA 2Q8PA 2XCLA 3LHSA 4D9FA 4YAOA 2ZYRA 5BMVB 5LJIA 1GGVA 2GXAA 3VVCA 3ND9A 4NEQA 4YMIA 1XB2A 5JC8A 1WMDA 2F1IA 3WL6A 3GAAA 2NUTA 1UXJA 5CK4A 3T41A 4HN4B 3E1SA 1YB4A 2O6HA 1LPSA 1N2JA 2IQ5A 4MWCA 3RREA 3O7WA 1SKUA 3DW1X 2XOKD 1BEZA 1AIPA 1ID1A 1UBHS 3ETCA 4WIAA 4U7JA 1CDDA 4U2BA 4K6GA 1Y9EA 3UT5A 1P1CA 4CIAA 4CUZA 3LPAA 2XWSA 2APJA 3CUKA 1IK6A 1N6RA 3U3OA 1RAEA 1FQOA 1IQRA 1N9GB 3AEUA 2YWBA 4AG6A 4KWHA 5JR3A 1ESNA 4DR1B 1GTRA 4CT5A 1Z2OX 4KK4A 4XM0A 4W8HA 5EA2A 1NQWA 2PZGA 2PZBA 1M7GA 3E3AA 4DR2B 3U7FB 1TTPB 3UHOA 4B4VA 3KKNA 2AC2A 3K0HA 1E4EB 3C24A 2JS7A 2YMLA 1DARA 1MDFA 4J0DA 5T6BA 4AYTA 3C7KA 4BMVA 3GCXA 2R1VA 2W6IA 1KNXA 4TUYA 2EFEB 1IXKA 1C80A 1CUBA 1QQ7A 2O3QA 3UHJA 1DDOA 1KAOA 3V1KA 3A7DA 1A71A 4G0NA 4ASUD 4D9BA 3CH6A 4YDQA 4P93A 3B5IA 3F8SA 3ERCA 1NYTA 3FPSA 3JSAA 3L8HA 1R9NA 1IHPA 3A3PA 3AHJA 4MA5A 2FGKA 1Z7BA 4FBMA 4A27A 2O14A 3TW6A 1EAYA 4D79A 3BEOA 3WLIA 1L1FA 1S2MA 5K3EA 4MKRA 1YJAA 2PX0A 4FJ2A 3ADKA 4Q00A 2WF9A 3ZR4B 2QL7A 4XPIA 4UBOA 3TB6A 2HDWA 3B51X 2BM1A 3GCGA 1SVLA 3OZSA 4KX3A 2QRGA 3VSEA 5KYVA 4DMCA 2DHQA 2AD1A 4WNAB 1FDWA 1THTA 3ABZA 4JFRA 1MO4A 4JJIA 2C4HA 4ILKA 4WHMA 4YRJA 1E9AA 2GM3A 1CWUA 4QOSA 1U8AA 2VZ0A 1E1QD 2BAGA 2PZLA 3PPIA 3CRW1 1EP9A 1SIBE 1ZJYA 3A3NA 2WUVA 5TR9A 1SA0B 4OQPA 3ZXXA 2A5DA 1T2UA 1KAGA 1KOFA 3BJZA 3RVPA 3CWZA 2G63A 2ZE7A 1KVTA 4CIDA 4J76A 3FG9A 4KCGA 1N7IA 1W59A 3SJBA 4LRXA 2I2FA 3NHZA 5HMLA 1FSPA 3LBNA 2FR0A 1MRNA 5BN4B 1LH0A 1BIFA 3BK7A 2GAFA 1ZBQA 3CJTA 4GSKA 3W5VA 3GLUA 1SHLA 3LFUA 4DLYA 1NFFA 1EIWA 1I10A 1YR2A 3QU9A 5FA6A 1ZNYA 2VXBA 3C3DA 4BX2A 1K7YA 2RBKA 1FMJA 3LCUA 5EXDA 1RXEA 2IHZA 3NR2A 4NBWA 1ZNXA 5K45A 4C4PA 3B9RA 3S8EA 3IQWA 5B2ZA 1TLTA 2I3AA 3V4PB 5LN1A 1E18A 3OMXA 2C4NA 1GIAA 4JS0A 5EJMA 5EIAA 3SMQA 421PA 2FQYA 4ND5A 4JP1A 1UPBA 1IK4A 4EL0A 4RPHA 2QHXA 4RJJA 1T4GA 4R9RA 1QHNA 5B6IA 3KP1A 3WL3A 3NV9A 4BQQA 3MERA 2IXTA 1QGDA 4FYXA 4PZPA 5ADHA 3FDJA 3R3VA 3WXBA 3Q8KA 1M1UA 3RYIB 4R31A 3GWZA 1RVV1 4EF5A 4HWPA 4YIHA 1CKEA 1QYCA 3JYOA 4KNVA 1P9LA 3EVTA 4OU4A 4EGAA 3SZGA 2R68A 5F78A 2HV8A 3JALA 4L9RA 3LYUA 1XUOA 1RWVA 2CLKB 4KR7A 2RHBA 3W1VA 3HS3A 4KXMA 4K6MA 4Q01A 2CL6X 2NT4A 5KQPA 1XLUA 2QTVB 3U2QA 4LXYA 1UZUA 3ANXA 4G4SP 1BXRA 2XUQA 4G0VA 4BX9A 2UVPB 5JPDA 1UBJS 1PZHA 1ZI9A 2MINA 3T5DA 1JLRA 1YOVA 2JHPA 2VFAA 3COVA 1IULA 2WMNB 3MCAA 4UHJA 1B74A 3KRTA 5CFZA 5JH7A 3GQVA 2BKXA 5CIWA 5M7EA 2GI4A 4ROTA 5F4BA 5DI3A 2WT4A 5G2OA 3HWSA 3W6OA 1TIBA 2C1EA 2VF4X 4OUDB 1E5LA 2BD0A 5I5EA 2BEKA 1JGTA 2VNSA 2Z5VA 1QZUA 4P08A 1APBA 1H2RS 3U4IA 1RC0A 3SR3A 4YRFA 3ZHCA 1FXWA 3M5CA 5BSWA 1THGA 1RPJA 1KYQA 1QRDA 3DMRA 4D5EA 5JNVA 4DV1B 3LT5A 5DN9A 1GZ5A 4D9IA 4QO8A 2JVIA 3G7NA 4ZVSA 3ZIDA 1FSSA 8MHTA 4EY7A 1XNHA 2B7BA 1L7VC 3RS4A 1MFZA 5BSEA 2PWPA 5HW0A 5DULA 2VZ9A 1NVAA 4O4JA 4P7JA 4F0JA 4A0RA 1ZOIA 3FWNA 2Q8NA 2WYWA 3HLKA 1EE2A 1QK5A 2Y68A 1Z5VA 2BR4A 1SZPA 3SBOA 5AK0A 2W2OA 5K0LA 4J16A 1VMEA 2WG0A 1VI6A 4JOSA 4W1SA 2VJLA 5P21A 3W77A 1HFKA 1U2EA 4XA8A 2D1TA 1P6UA 3BXXA 1H85A 1VP3A 3S28A 3EQ6A 1KZ1A 1QBKC 3NTLA 4B3XA 2QUJA 3ZWNA 1WHTA 3M3HA 1LQUA 3B7WA 3QBJA 5M3BA 2IHVA 3HUTA 3EEYA 5A4AA 4MPRA 1FU8A 1ZGBA 2B99A 5HM8A 1KQOA 4ALNA 1G5TA 3JQGB 5DXJA 2D5AA 3EVZA 3LP5A 1B8PA 4EKNB 2KHZA 3KT8A 3SS9X 2YOGA 3D4PA 5EESA 1U0NA 2RBEA 4CM1A 1OVMA 3K20A 4LJ9A 4RYDA 3C14C 5JEEA 3AF5A 5KCZA 3IR5A 1G16A 4OHZA 2PZFA 1WUHS 2IA5A 2AKEA 3H0CA 3RC3A 4PQFA 3ANLA 1BX0A 4LHWA 4C3ZA 5JT1A 5JANA 2VZEA 4GOJA 2L19A 1EKXA 5ILQA 3K70B 2P7IA 1ZD5A 3PJFA 4UUOA 3WHIA 3F6CA 3W5DA 1BKSB 5U9CA 1Q14A 2YY6A 3FCXA 5E3IA 2B8NA 3ELDA 3T3IA 1LI5A 3K4QA 1BHO1 2KQUA 2WJGA 4EI8A 4HVLA 1MX5A 4NNJA 5B1YA 4X6XA 4JYPA 4KIUA 5AVVA 2JG3A 2AC4A 1CEEA 1EBUA 4MW4A 4YWJA 3DAFA 1GZUA 1KMMA 1KI8A 1YQEA 2QGZA 4NYIR 4HV4A 1HZZC 4YRDA 5ILGA 3CVUA 1U7ZA 1V3TA 3EJ6A 4P2GA 1E6WA 1T8TA 4YROA 5IG2A 3AKZA 3SSAA 4EGFA 4ID3A 4A6PA 2Q0HA 3LQYA 3CCCA 2IBMA 4FEAA 4D3YA 2WNHA 1EGMB 1XYYA 3AWDA 3FJ1A 4QBTA 3THSA 2A9VA 1OZAA 2AD5A 4FGZA 2IH4A 2C57A 4NFLA 1H3NA 1H9BA 1AKMA 5HFAA 4P9NA 2CV0A 1ZC4A 2R85A 2WDZA 2XGMA 5LQRA 4J03A 5CGQB 1RI5A 2FPPA 1PLKA 1QHGA 1R12A 2EKPA 2H57A 2VXCA 1AMUA 2W2LD 221PA 1KYZA 2QP4A 4PLTA 5DBEX 1RQPA 4FZVA 1JIQA 3TRJA 4PG6A 3RPEA 1ZCJA 4EDHA 2AOWA 3D6AA 3Q5EA 3GQBB 3QFRA 3C7TA 4LQ4A 1UBFA 4MWZA 2JGEA 1VECA 1XF9A 1VJRA 3OHMA 5C18A 1J9GA 1NC1A 1SUSA 4P0TA 3A3YA 3ZHBA 5A5VA 4KXLA 3AR9A 5KYUB 1USGA 1GL3A 4JUCA 1QH8A 4Q1DA 4ISBA 4EITA 3A4LA 4YN3A 3NUQA 4FIZA 4LXXA 5TEWA 1ILEA 2ECFA 2YXLA 5B7PA 2AW5A 3KSDO 4WN9A 2BFBB 3NASA 3EZ7A 4E5NA 4LJYA 2GHIA 2QX6A 4IDEA 4JLVA 3A3KA 3L0BA 1D3AA 2WAOA 2XF8A 4YPFA 5DX0A 3PV0A 1F20A 4BNVA 4ZGGA 1WM1A 1KXZA 2V4MA 2ID4A 1UJMA 3MXTA 5FL7D 4GX2A 4RZ2A 3SSMA 3QGMA 3RNOA 4I4IA 2A5YB 3QPWA 1JG3A 3N28A 1X1QA 4HKTA 4JLOA 4A10A 3V4ZA 1SGWA 3UFXA 1VSUA 5IX8A 3UJNA 3V7WA 1MW8X 2G04A 1CY1A 3ESQA 1F9AA 5LP1A 1RAGA 2VP2A 2X76A 2RJOA 3PL1A 1X1SA 3HLTA 2GH1A 4ZARA 4I1PA 2UDPA 2AZ4A 2QTMA 2E87A 3KJNA 3P2IA 4L1KA 5IHXA 4UHDA 4K8OA 4FGJA 4Q18A 1X7YB 2C7BA 4MQ6A 5H83A 4D25A 2HF8A 4PFJA 4FGWA 3IXQA 2G25A 2MDTA 3KSZO 1F2UB 4ZI3A 3ZCUA 3U19A 3NG1A 1JJFA 2GCGA 4DBLC 3OX4A 1YJ8A 4LDQA 2OC9A 2XUJA 4BLVA 4F21A 2FDCA 3WLTA 1WXEA 4XX0B 1SVWA 3HN2A 1BEUB 1TA4A 1YQQA 3KHSA 4RADA 3S68A 6PFKA 2Q1XA 3X2EA 1M2HA 4DR7B 1PYDA 3QWFA 2GF2A 5A2GA 2QW0X 1G98A 2P65A 1OHHA 2QDXA 2ZJ7A 3DR3A 4M3NA 3V33A 1V48A 4DQ0A 4UBIA 2W2KA 1TAHA 1TM7E 5G41A 4MYSA 4BUCA 1C30B 3K1YA 1G8HA 2D1SA 5CLLA 1DEXA 3TQSA 4D0RA 4EUHA 5I8PA 2QLFA 2I6QA 3H05A 3RAPR 5C51B 3ZVRA 3WMGA 2Q2WA 4UCQA 2ATVA 1M2FA 2YR0A 3B2QA 4WVFA 3JVIA 5F35A 3ZEAA 2V6BA 1KSGA 4H1VA 2UZAA 3IYLW 4EHHA 4YCBA 5LQCA 3D1LA 3TLYA 3HO8A 3CURA 1PSDA 3RS8A 2QKYA 2BHTA 4R1LA 4I99A 3RR2A 1W2GA 3VC7A 3T5MA 3JU3A 2H9AA 4TS9A 4D8XA 2HC9A 2QPLA 3HGMA 1T0IA 4C2BA 3RU7A 5JO0A 1GTSA 4OIFA 1ARZA 1POWA 3CPEA 2OY0A 4MR9B 4R16A 1I5RA 1IXRC 2VUIB 1AB6A 4XJSA 3VHXA 1YIAA 1JJVA 4RWEA 3EXIB 1QB8A 1TO1E 5AOAA 1NASA 4HNRA 5CB4A 1RJGA 2JPDA 4DJJA 4X20B 3RUCA 3FKSD 3USZA 2AOUB 2VDWB 4ZV7A 1MNQA 4TMZA 3IBCA 4P7FA 3Q10A 3NJ8A 3MIIA 2A94A 3K5IA 4B7AA 3OECA 2GX6A 2YV1A 5IMSA 2GEKA 4LZOA 1ZVVA 1X0XA 4ND2A 4XQGA 5D8DA 2BTEA 3HY6A 3BB3A 2W4IA 4PO9A 3WZ2A 4EJ6A 4QOEA 1U9ZA 1SXQA 10MHA 3NHRA 4B43A 4Q7JB 5NULA 4XWKA 4D45A 3WTBA 1EVKA 1ZGJA 4XQ9A 3AKDA 4ER5A 1GQ2A 2JIDA 2ASVA 2HJRA 3D4NA 1D9ZA 2Z83A 4D9GA 1UH5A 2QPOA 3L84A 3T3NA 1WCV1 1SOWA 1W7AA 5I3ZA 4FT2A 1M2JA 3Q6NA 3DAOA 2GF0A 1NPDA 1ZVMA 2BY4A 1JBKA 9GPBA 2MSLA 3DZJA 3WKDA 1O0SA 4LK3A 2VT7A 5JROA 1L7DA 1NVXQ 1T3ZA 2IVFA 1WXXA 3K6JA 2QE7D 1J39A 3O4JA 4J16C 1SC4A 1ZM9A 5FQOA 3KSAC 1KO4A 2RGWA 1W9HA 3Q3HA 2X0DA 5FLEX 4DLLA 5FLXA 1WUTA 1Q5PA 1QFYA 1QZTA 3QENA 1FP4B 3AY6A 4QBFA 1WBBA 3KJGA 1AGXA 4I4TF 4BO7A 1QVRA 2OLJA 2VF8A 4WERA 3S44A 1EFLA 3I23A 4Z6KA 1UP7A 4M0KA 1MUUA 3CXRA 4R9SA 2IELA 1SXJD 2VPYA 3C3JA 3W6UA 4CDGA 4W9MC 3C1TA 1KEZA 4X1KB 3IOYA 1IWPB 1FNBA 2YJZA 3EGDB 4I5IA 4Y2HA 4M7OA 4YQEA 3J81k 3MAJA 3SMVA 1T4DA 4M22A 4B9AA 4ZQGA 1R6BX 5KWVA 3CFYA 1OT3A 5F9HA 4O0LA 3VJRA 1JEQA 1SUPA 4X3CA 1FRFS 4NBUA 4Q12A 3QSGA 3ONVA 3WDMA 1YFLA 3HVKA 1SVSA 1E6MA 1T0PA 4UBJA 1J90A 1DQPA 4CR7A 4GRIA 5IWCA 1FMFA 4E5VA 1DJQA 2O9JA 4QGFA 3QVOA 2BFBA 2Y9MB 1MO6A 2EYUA 3L93A 1WXGA 2F64A 3MSCA 3JQ6A 2QRHA 3NVMB 4P32A 1NBAA 3RU9A 1QKJA 1BE6A 3ASVA 1GPNA 3CF0A 1Y5LA 5HG0A 2NUAB 1Z8HA 3Q9UA 2ZQYA 2WHPA 4RQTA 3HB9A 2R62A 4J2OA 4E5PA 2ZJYA 3IEKA 3QFSA 4GKKB 1QFMA 3DGEC 1P7CA 1TMYA 1O5IA 2GKGA 3DLAA 4P4SB 4TTPA 3OEED 5BURA 1R0WA 5JQGB 3CLVA 4FBLA 4L9WA 2ZANA 4JKIA 4BHTA 3EX7C 4MARA 4LC1A 1WBDA 1H65A 4IGKA 4DJEC 1ADYA 4G5XA 2Q9AA 4E5SA 4G36A 1QGED 4XTRA 1VJTA 2LGJA 3CW9A 1Y9JA 2WUGA 3QYFA 4HAXA 1JFLA 2WT9A 1N5DA 4ZVVA 2PL1A 5C37A 4B79A 1FFXA 2GO1A 5K0JA 1F17A 5CDHA 3KHTA 3MGCA 4I5DA 2GN1A 1I80A 5DISB 2UUOA 1E1DA 3THYB 1W5EA 2XIJA 4WRRA 4F3CA 1X7WA 1QH1A 4H7JA 1DCMA 4A2PA 2XE6A 2FHSA 1EEHA 2QT1A 3D6TB 3CXUA 3L49A 2R65A 4N6GA 1ZUD1 1DAMA 1QO9A 1C50A 1JEJA 1T8RA 3IQHX 3MT0A 4KG7A 2NZYA 3JRWA 1ZN2A 2DPLA 3WB9A 5BNIA 4QQNA 1OB2A 1SHJA 2P4UA 3GRYA 3HXLA 4R9VA 3TJMA 4QASA 1NUSA 5HIJA 5DM70 3OJLA 1W4CA 2AS0A 2JKZA 3MG9A 3WWCA 4GUAA 4MVJI 1G7TA 4BKOA 4F12A 3WIUA 3R8FA 4G8JA 1FFAA 1UM9A 1CVRA 2DR0A 4G01B 5CTJA 4F3YA 1G3RA 2JFBA 2JEOA 3FN4A 2QXTA 3PRYA 4GOLD 3BRCA 3ILHA 2W2LA 3FI0A 3NM6B 3ACCA 4OL9A 4PXSA 5KKAA 2ZWMA 1LNSA 1SELA 1XVVA 1Y4SA 5CCXA 1GP2A 2QR2A 3SC4A 4BXOB 2ZBVA 1YOBA 4IFBA 2JLSA 1EVJA 1OWMA 4YMTA 2G4CA 1M54A 2BUCA 4L5JA 2WYUA 4G4SO 4LOAA 1Q1ZA 3ABOB 3GLKA 1K9VF 1U3TA 4O1HA 5TGZA 2ZBUA 5EIBD 4EKIA 4OX9Y 2GBLA 2J9FA 3NDPA 5AW1A 4GU5A 4DSOA 1RFGE 1WPXA 4HI0E 3BGIA 2O4CA 3OUTA 3SPXA 1QDLB 1O57A 2ZWPA 1AHPA 5JJ5A 4WLNA 2BHNA 1R8YA 4N03A 3COZA 1KVSA 5EYPA 4M1WA 1XMQB 3PX2A 2YYZA 2AJ8A 3QU2A 1JHPA 4ZVTA 2BM0A 4MO2A 1QP8A 2KBEA 3WKCA 3COWA 3P94A 3S1LA 3VH2A 3GLTA 4ZCPA 4CKZA 2VJPA 2PUTA 4I8DA 5DB4A 1E5QA 2Q6LA 2R00A 1CR1A 1S8OA 1JJ7A 1COWA 1C1HA 1ISRA 2OP1A 5E1DA 2G08A 3LUFA 3S1AB 3T9DA 1WUIS 1ZD4A 2O5VA 3NHAA 1E9VA 1ZPDA 1Q0LA 3W5BA 2CXTA 2JIOA 1C8KA 2F9FA 2ICAA 2IOFA 2G40A 4ZQEA 1F1JA 1KMNA 4P3XA 4QXRA 4TV9B 4AW9A 1F9EA 4L2IA 4J9VA 4KN5A 4ZEXA 1G8GA 2EFGA 2GILA 2CVOA 3ROXA 3WLHA 2D4AA 3MTAA 3WADA 4EI7A 1Q2UA 1WLSA 1HE8B 1NLFA 2ZYIA 1RRKA 3LLVA 4ZQFA 5M2QA 1E6UA 1J5PA 3E70C 5E6UB 4WJLA 1ZR2A 3B2NA 5EQTA 1LU9A 4KQEA 1QQTA 3BCUA 4CKBB 3HP7A 1P6XA 1TJYA 2K2QB 3KKQA 2OFFA 4KITB 1HG1A 2FZ4A 1RDFA 1M3SA 2O52A 4MPDA 4O08A 3VNSA 4XGNA 5AK6A 1IB0A 4B46A 3ISTA 1G9TA 4JBGA 2C29D 3R5KA 4Z1OA 2EZUA 1DOHA 1YQXA 2FZEA 3MNFA 4U8HA 3G1TA 3QPDA 2JARA 3N2GA 4JQSA 1W36D 3HU1A 1PG2A 4KE7A 2DKFA 5SV2A 5EKDA 4LJLA 1NF9A 3K94A 3FYUB 4HQ0A 1HE4A 4JL8A 1T2VA 1UKYA 1Z33A 3TTUA 3U4GA 3V8MA 1KI6A 4KH0A 3OMWA 1TEXA 3FRIA 4DDTA 1PR0A 4XDZA 2X0NA 4M1YA 5BVHB 2VEOA 3GJTA 3K0EA 4HDSA 1U1EA 2QT9A 3RQSA 4W1RA 2FUG6 2GBFA 1P0PA 2VSXA 3GT4A 2ATXA 2Z1MA 2Q4TA 1NRJB 3QMVA 1GV1A 4LHZA 4MQLA 4ZO4A 4E7PA 2YC2C 3RU3A 1TVKA 3KVVA 3CH5A 7GPBA 3A2MA 1DWPA 5D51S 3BXPA 3AIKA 2VJKA 2ZRQA 3L40A 3ONDA 1NSFA 4PSDA 3PR2B 5AO9A 5IAJA 4FOSA 3OPMA 3L8EA 3HDHA 4ZAXA 1RZRD 4KQCA 2NSJA 3AQIA 4E7OA 2Q6VA 4QGBA 3R7FA 3KTFA 4GZ5A 1CULC 3RHFA 4M7PA 3O2JA 4DW8A 2DSNA 4GMKA 4IEIA 5HILA 3NHSA 2J5RA 2BR3A 2Y0PA 3PPXA 4HDQB 5AUPB 5FL7A 2BEUA 5E4TA 1ND6A 1OE0A 1HYQA 2O3JA 1M74A 1Z5OA 2VP0A 4IV5A 1CHDA 2DHDA 3OHSX 3VX3A 3HI6A 2AMLA 1WKBA 1YZVA 2N46A 1U4OA 2VP4A 2C07A 4KH1A 2XQVA 4WFKA 3QWAA 2ZJ3A 3BWVA 3I0ZA 1ZRHA 3LQ2A 4YRAA 3GLGA 1VJ0A 2CUNA 1OWOA 1HM5A 3G9QA 3RRNA 1LSJA 4FTWA 4HUJA 4N0DA 2P9QA 3WIVA 3ZE6A 2AX4A 1E0DA 4E30A 3OFJA 5BVHA 1SKYB 1K4YA 2WUWE 3OFKA 4QA9A 4TMVA 1AKWA 1EUCB 2PUJA 3HN6A 3LY8A 3IR6A 4EUSA 2XQIA 1P1FA 3EXAA 1DIHA 2D2VA 3M8KA 4FHCA 2ZW9A 4JX9A 4YT5A 4O25A 5JSYA 3G1UA 3WMFA 2VJDA 4F04A 1J00A 4J91A 3GT7A 3RI3A 3EDQA 5FWYB 3V8PA 1I5OA 1XTRA 4IZ6A 4KUEA 4YRQA 4KOEC 5LQKA 2CNOA 1FVXA 2G4LA 1B43A 2BI4A 1JNYA 1H3FA 3H1BA 5EIOA 1QDUA 3NXSA 3ZHUA 1HNWB 1JDJA 2OO3A 3P52A 2K7FA 3T7JA 3UVEA 3T06B 4LHXA 1S2OA 4UAUA 4HDOB 3N74A 4UDNA 1JIIA 5JBIA 1DC4A 3EY4A 1BW9A 4L3OA 5CAEA 3FHOA 3C8UA 4ZJZA 3V8EA 1LRLA 1TCAA 2H2GA 4BUJA 3UTCA 3WZMA 4KJXA 3PIRA 4KRXA 5I8WA 5INTA 2V7VA 2QXUA 5HIKA 1ZI6A 1B3RA 1IIRA 1MW9X 2CL7X 2G4VA 2O8VA 2VP3A 3HDGA 3JQDA 3PNKA 3SEAA 1E5VA 3L7DA 2AQIA 4G97A 1OV6A 2XBLA 4JLWA 3IMEA 4PLCA 2VYND 4TV9A 4ZJUA 1NSTA 4I66A 1CQZA 5DGTA 5LVAA 4JUBA 4N0EA 4WXHA 3SBXA 4CMGA 5IAOA 5TQ0B 2X15A 3QTBA 4P4TA 1T1GA 1P2GA 3K70D 2OYSA 4EO4A 1NUUA 3RC1A 2JCSA 1Y5RA 1T2CA 4ZPJA 1CEXA 4DCUA 1Y1PA 1DIAA 3PLNA 2TS1A 2X9QA 2WJZB 2ZI3A 4KWIA 4MI6A 3ZNOA 4PG7A 4GX1A 4CTKA 4OREX 4Q21A 2OXTA 4ZVKA 1ABBA 3NGLA 4TX1A 4C22A 1HORA 1U3VA 1KL7A 2CK3D 5EZYF 4EFMA 3B1VA 5L6MB 4U2EA 3TAHA 1PWXA 2A14A 4R9UC 5EYPB 1XAHA 1WUKS 3NIGB 4C0XA 4DTCA 4PTLA 3ONWA 2QUHA 3WAGA 3Q0TA 1L8OA 2I2CA 1FRVA 1X1CA 3HKEA 4RD1A 1NIJA 2D3WA 4CTJA 5KOHB 4DA4A 4QHYA 1E79D 3E81A 4TWAA 3W9BA 1ZKDA 4RAOA 4NCHA 1G6HA 2XVMA 4H18A 4HNVA 1RLJA 2IUTA 2Q7XA 1K6IA 2YV3A 4MRRA 4AMBA 1XTUA 2VQSA 1EYZA 2W2VA 3E3LA 4NI5A 1R4ZA 2BKLA 4QQ8A 3VUFA 3OLVA 2A1TS 1K0FA 1CR6A 1LI7A 3G9ZA 4CLDA 4JH0A 1TD9A 1BQEA 3H11B 1M1ZA 4TKZA 4U39A 2PMBA 5CTAA 4A8JC 2PVPA 3CB4A 2F2TA 4E4RA 4ETNA 1ZNZA 3CPHA 4P7KA 4FM9A 2OVFA 4CCWA 4F45A 2CVHA 3NORA 3E8XA 4LI3X 2FOXA 3ZD8A 4DYHA 2PLFA 3B7GA 5IARA 5JCOC 3LIPA 5B7NA 4KYVA 3BIOA 2QE7A 5LMZA 1KTVA 3QOXA 3SDSA 2ZTVA 2CW5A 4FWIB 1N3IA 2XEDA 3LP8A 2YWFA 1Z2NX 4HFJA 1CPYA 2XUKA 3W3AA 4RKEA 4EFKA 4QSHA 1LVHA 3KPWA 5CLIA 2XEXA 2IEDA 1UBCA 4OQ4A 3A0UA 4I3FA 4FZ5A 1BA2A 4Y2PA 1X7WB 2OP0A 3HABA 4PSUA 5HX7A 2E2WA 3IHTA 4NS4A 1OFGA 2PGJA 1CLEA 2XA2A 1FFXB 2J32A 5E1MA 4QJBA 5G4KB 2H2IA 3VYWA 3HVRA 5HKOA 2F17A 1CE8A 3PTAA 5T4HA 1GRRA 1SCIA 2W6JD 4Q9NA 2VR1A 4BB0A 1C2TA 1YU6A 1VZ3A 2BBTA 4V0SA 2EKBA 2XMQA 3WQBA 2OD9A 2XGJA 2EATA 3NQ41 2HYDA 3A9SA 4YALA 2TSYB 4P4SA 3O8BA 3WLLA 3TKAA 4D9KA 3RTDA 5FUVA 4NLLA 2QZZA 3P96A 2B0CA 4NOLA 4EL5A 3G9UA 2D3TA 4QDUA 5MGBA 2FKNA 2I8AA 2Q4BA 1KFBB 4QPJC 2PXHA 1N5LA 1P4HA 1Y34E 3B9PA 5LQSA 2ZJAA 1HNZB 4B2LA 2Z4TA 1VHLA 3UUFA 1ZP6A 4BRUA 1EGQA 3FF1A 5BV1A 2H6EA 4NIMA 1WVIA 4LHSA 3NHLA 3NHMA 1NAIA 4U8GA 5IWAB 3DE2X 5TY0A 3U7JA 2IDZA 2I55A 3JQFA 1V43A 2QBYB 1LC3A 1M6HA 4G1EB 4G0ZA 4ZI7B 5MGNA 1FDUA 4DDVA 4AJEA 1G6KA 1D7AA 2AEJA 3M4JA 4GMXA 4FYIA 3HO6A 5J1TB 3NDBB 1UPTA 2V54A 3FF4A 5BT9A 3SBEA 3KK0A 3FRJA 3K35A 2HU5A 2YIMA 2FSHA 2QIPA 3RFFA 2DP4E 2GR9A 9ATCA 3C2QA 2EX4A 1XXHA 5HJEA 4Q3DA 3IURA 3C6KA 2H29A 4NPCA 4KTTE 1WTAA 1Y9ZA 2DJIA 1K7EB 4BMSA 3ETDA 1A8PA 1C4OA 1L5OA 1JLMA 2WD7A 4C0JA 5EXXA 1RFLA 4HQKA 3GL9A 4JYMA 4MIKA 4ZYZA 5AVXA 1KQFA 2CV1A 2HT1A 2D2EA 3PCTA 4C6HA 3L06A 2CDBA 2CLOB 1H69A 1SUIA 1ACLA 1R8XA 1V11A 4HPXB 1R0LA 4LECA 2F8SA 1J8DA 2XUHA 1UT8A 1JLKA 3CEMA 3UKJA 1QZ3A 1ABFA 2NO9A 3FH0A 3QWHA 4YA6A 4Y6PA 5IYZA 1MPXA 2PLWA 3W2EA 2C5HA 1VTKA 4N0MA 2INGX 4NJMA 5HJ2A 5P8WA 2O1SA 2WSYB 2IPLA 2V7WA 3N2ZB 3M1AA 3KB2A 3U3XA 4NQZA 4HWTA 2HMWA 1R4NA 2G5GX 2ZUWA 1EEXB 3INGA 2V7XA 4P4LA 4WNYA 5EJ4A 3Q3CA 1DRUA 2RHWA 4G1MB 2ZATA 1QBGA 4K0KB 3MVEA 1U8ZA 1CQXA 4BP9A 3B13B 5CM2Z 1AGRA 2GK3A 1JAXA 1ZUNA 5IYZF 1LPBB 3ORYA 4Q9HA 1JQJC 3OIVA 1CHNA 4YVFA 2HMVA 3HNPA 2PKRA 4LFCB 1QQ5A 2XZOA 3N76A 1X9IA 2HOQA 1I14A 3K09A 1JFRA 3UMSA 1JKMA 1QOPB 1SC6A 5HGXA 1SXJC 3WRVA 1R5BA 3CT6A 3KSBC 1ZWKA 2OVBA 1Q7BA 1W52X 1WKCA 1C3LA 1GL6A 1AKNA 1OAOC 2N9UA 5JWHA 5I4BA 1DT3A 4GEGA 4OHKA 4AK9A 1W0JA 3OJOA 1SKYE 1YB7A 3I9LA 4GVPA 3AUJB 3LT4A 4CRWB 5J4VA 4YY3B 2PRSA 2WWTA 3W2IA 4MA4A 3ABRB 2Q3LA 3D8TA 1R0KA 3F9RA 4XXHA 2CE2X 2JW5A 3BGSA 4LY6A 4M6WB 4PSCA 2LDBA 3MJHA 3AKCA 4MR9A 2JGIA 3IOMA 2IHNA 1H0SA 3RARA 2F43B 4IXNA 1SXJE 1PSZA 1U2RA 1KK2A 3G6WA 3NHPA 1F2DA 2AJLI 3C3XA 5HA5A 4XJXA 3P4UA 1U7WA 4C01A 1FUKA 3FCCA 4PLPA 2HEGA 1VG8A 3SEFA 3J80A 3CIOA 3FLBA 1L7NA 5DGHA 1EUDA 3A58B 5LZ8A 2XVYA 1YZUA 4E5MA 5E4FA 2CCGA 3NI2A 5C8YA 1QPGA 4X54A 3IHKA 2H48A 3QI7A 5AK4A 1KAHA 1OYYA 3IEPA 3LCRA 4RJTA 3GEHA 1M33A 2EEPA 4NZZA 4D4HA 3FPHA 1JQBA 4PHFA 3U0BA 3ZD9A 1CQJA 1U8CB 1Z83A 1NXSA 4MW7A 3TLBA 2FW7A 2QTBA 3CT4A 5CMLA 4QZVA 1JHAA 4H17A 4GC5A 2PWYA 2P0EA 3E22B 1QR6A 4I4LA 3VAZA 1OAAA 4ND1A 3ZHOA 3DB2A 5KOJA 1NF2A 1ZIXA 1FP6A 2P7HA 4A82A 1CZRA 1UK7A 2LR0A 5DMXA 4P0QB 3FHLA 4XX0A 2AN4A 3GIWA 2HQBA 1T35A 4UMEA 2G6BA 2PRKA 5TV2A 4DCMA 4MV3A 1M1NB 4QTXA 1URPA 5FP0A 4Q1BA 5BW6B 5IJ9B 5C8YB 5AHKA 2GTPA 4B3BA 2VNHA 1PU2A 1IBKB 3MOSA 2JFVA 2JLQA 2QJTA 3IELA 4NJEB 3TIXB 5KSPA 5CBPB 5CDSA 2FUG1 2FW8A 1FB5A 2QRMA 4G1BA 3NMUF 3ZDAA 2FPIB 2W58A 4FIDA 4AZVA 2YIJA 5K2MA 1ADCA 4OAQA 3HZHA 2X5OA 1H6CA 4N6OA 4OHCA 1J06A 3ZJVA 4BAUA 1EVZA 3IRVA 4F92B 3EH2A 2D6FA 1IBCA 1OT5A 4HCJA 2IEIA 4IJUA 3DZIA 5AI5A 4B44A 3L41A 3LC1O 2Z5LA 2Z2YA 1ZSNA 4CLXA 2J6CA 1P2SA 1Q1AA 2PS9A 2R7LA 1Z08A 2CYAA 5D86A 3T4PA 3UK0A 4LQDA 4TN5A 3ZDEA 4BU1A 5JRJA 5HZGA 5DVZA 4BNYA 3QYPA 1QYDA 5ECGC 1Z28A 2Q6OA 1JEEA 3FUCA 4OTZA 1TUBB 1X42A 3FNFA 2ZXEA 1A9XA 2ZAMA 3BH7A 3EGOA 2BYTA 4IF4A 4Y2UA 3NTQA 3CKYA 4FYPA 3OCJA 5DGIA 1MT3A 2GPAA 1EZZA 3L8YA 3MOIA 1P3Y1 1KYIA 1QHIA 2C58A 4MVCA 2XMBA 4QPZA 1ENZA 1TYBE 4TMKA 2PH7A 4TV9F 4PVDA 5D7BA 2B6NA 5A62A 1MT0A 3AVPA 2Q07A 2FFQA 1PKXA 3FZYA 2BZ1A 3G6KA 3M5PA 3QE4A 3TTVA 2GEBA 4ZAZA 3M6AA 2WU4A 3PPWA 1RW4A 3F47A 4GI7A 2W6QA 4W9NC 2ZTHA 1D2HA 3NJRA 1G4AE 3G85A 1T8SA 4HQRA 2PO5A 3M83A 1ODJA 3PUIA 2XY4A 3KV1A 1XKXA 1RBMA 1SVKA 1RLTA 1UK8A 2V8BA 2WZQA 3KEGA 3X1KA 4MHTA 2OPBA 1YULA 3ZI4A 3EWSA 3SI7A 2CXHA 2GFHA 2XYPA 3DJFA 3MWFA 5JWRA 1EDEA 2I1WA 1FTNA 2F8LA 5LOVF 2WHRA 4MWGA 1OFTA 3TPFA 4ZOEA 2G1JA 4WSOA 3ZPXA 4P0PB 4JLUA 1PT7A 3BK1A 3L1IA 3PUVA 4JXKA 4FMCB 4D0NA 2BOVA 4RTKA 3PX7A 4GNRA 2O8NA 4JJ4A 5EI5A 4D92A 2JGFA 1WHSA 1Z73A 2QN1A 1A8UA 1MOSA 1WB6A 2Q5HA 1PGQA 5JASA 2DUUA 1PLJA 4JK3A 3CVWA 1ENYA 3AU8A 2XZDA 3EXG1 4MJXA 3ROQA 4ECAA 2IVZA 2Q6TA 2M9MA 3OU7A 4CMEC 4DQKA 1S01A 2YQZA 2J4CA 3HA2A 3RUFA 2C2XA 3AONB 3Q1LA 4DE5A 1UKBA 1ZMXA 4RSRA 3VQTA 2IYQA 1P4JA 3TBFA 3FNRA 3ZIAA 2YUTA 2HXSA 4MW2A 1RACA 1LEHA 1TF2A 3JXEA 3UJ6A 4WNCA 1KJIA 1A77A 1L7AA 4BWVA 3GU3A 3KFVA 5E6SA 4IOLA 1U2QA 4RZQA 1PR5A 3LHIA 1CUFA 1GWNA 2GNPA 2X14A 5AW2A 1S2IA 1XD9A 1T0BA 1NJSA 3FFBA 3PD7A 4K28A 5CXSA 3SOZA 5ELXA 4QOGA 2P3OA 2K7ZA 2E21A 4LF9B 3DAPA 1RYMA 3T15A 2AWNA 3UATA 1Z2EA 2W6ZA 5EHNA 5AOVA 5SYMA 3G8YA 1G5RA 1RKQA 5LD2B 2YV5A 3PVZA 4K1XA 3ZWQA 5CGZA 3CUSA 3F7OA 5IAEA 2FMUA 4URHA 3IUSA 2RGGA 5DYTA 3ANNA 1U4SA 2IOHA 2ID8A 4PC3A 2XCRB 5HFNA 4M0MA 3HQ4O 5ERGB 4IOKA 2QMYA 4MV7A 3W8DA 1JMVA 4HEQA 3O73A 2OXCA 1YQWA 3DV2A 4R1UA 4RKFA 3ZK9A 2RGRA 2FFBA 3B36A 3GGSA 4YRIA 3N0TA 2VZLA 3PD1A 3WNDA 4EECA 5K51A 1CUDA 4E88A 4MDFA 4J1NA 1T15A 3WNZA 1E5TA 5CR9A 1KERA 1QIKA 1PD0A 2FU5C 1E7SA 5BSGA 5L95A 2F55A 2VBIA 5JYDA 4DLAA 2ATEA 4XFDA 2W42A 2AK2A 2OCBA 1L5LA 5FF9A 3RVSA 3ZYZA 4DKXA 2OBNA 3FTCA 1ES9A 4FNMA 4HLNA 4C6TB 4HWOA 1ZHHA 5HQTA 3VTKA 2BMEA 3IUBA 4LJAA 1VE3A 1Z2DA 3R5TA 1W4RA 4FWBA 2ZB3A 3NVAA 1BN6A 3WYBA 4JNKA 4RS3A 3KZOA 3WHKA 3T9FA 4GQAA 3W6ZA 3N3BC 1EAMA 2PD3A 5LLDA 5BVGA 4IS3A 1ULZA 2I6UA 2NN3C 2YVKA 5KPDA 4CLHA 1FXUA 2ARKA 3ROMA 1BGXT 4DNXA 3IQGX 4LHYA 1YJQA 4BNIA 1RLUA 4DHWA 3TOVA 4LMPA 4Z86A 1KDZA 2YHBA 3ZE0B 3C6MA 2ETVA 3PFCA 2JANA 2NO7A 4XM2A 4HXYA 2W6ID 2FJ0A 5T4FA 2UUCB 2BGJA 2MYPA 3OZIA 4L72A 1JQAA 1TI7A 3HKEB 4LJ7A 1X7ZB 1O03A 1S2DA 3ZKAA 5EIXA 1U90A 1ZK4A 3CC8A 3JPWA 5A3SA 4BRZA 4WKCA 4CKXA 4DYVA 1VHTA 3DE7X 3HJUA 1PTJC 3TNDA 2AMYA 4HH4A 3VISA 3UCEA 5JXGA 1GZ4A 1B76A 3OCXA 4LVNA 1GUFA 1GR1A 2DQSA 3V00A 3OM8A 5F7XA 3RFXA 2QTGA 3UCXA 4F2GA 2OCAA 1DAOA 2VHZA 4C7OB 3H5OA 2BEWA 2C5GA 5DN6D 2BGGA 4IXTA 1WNTA 1VA4A 1VIAA 2Q2QA 3HR4A 4GWGA 4IMPA 4ETMA 2CJPA 1A27A 4DAEA 4C5AA 1GNPA 1MU0A 1JB1A 1K88A 1DX6A 1SOUA 3PCXA 4TUYF 4JA2A 5E3JA 5K0NA 5G0WA 4ERXA 3GLIB 1M8FA 3UT0A 3HRIA 4M87A 2PUEA 3SLRA 2ZT6A 1Z5UA 1GUYA 1FDSA 2M2IA 2VDMB 3E9RA 3F4KA 3HCRA 4ARSA 1NBHA 2GEDA 1E62A 3ZY5A 3DCYA 5ADUS 2O57A 2EJBA 3TIVA 1QVAA 4JCCA 3T1OA 1AZSC 4RXUA 2IKSA 3ZH9B 1ZM2A 3EHDA 1JAYA 3OZCA 3ZWYA 1OF1A 1KDOA 4PHTA 4UNSA 5K2OA 3C8HA 1G8YA 5CAEB 2BGIA 1B1AA 1AXGA 2Z5FA 4XDHA 3Q8MA 1NQAO 1JEAA 1U5CA 3I1JA 3E7FA 3VZPA 5BXQC 4QTYA 1S8FA 1JEDA 1PX2A 2PKWA 3T1YB 3JD3A 1E99A 3E9CA 3HCCA 1MJGA 1SA0A 2DFVA 1EVQA 2HRDA 3PKZA 3OTWA 3UICA 3G5TA 1D1TA 3E84A 3HV0A 4V3BA 1X8XA 5EWMA 3UMFA 2LPMA 4EO9A 4F6RB 4Q03A 4J7XA 2QSZA 4NENB 3M6MD 4YJFA 4MUKA 2ZIVB 4Z2YA 3EGCA 3T94A 4CF4A 3DL4A 5HDBB 3U7EB 4QUEA 2ZBRA 3DFIA 3CINA 4IILA 2OK8A 1NE2A 5KC8A 4O1MA 16PKA 1EUCA 5KQSA 1SU6A 2C2BA 4MMYB 3AIIA 4BDTA 3H4MA 1ISJA 2V7BA 3O0TA 4GSYA 1U3DA 4ENTA 1HK7A 1G59A 2JBAA 2D8AA 3L9XA 4QU0A 1ONSA 3GFQA 3V7YA 4EP1A 2WWWA 1N6HA 1Z5GA 2J4DA 2WR8A 5AIAA 1IN6A 2YXNA 4OJQA 4D8WA 4PSVA 3TD9A 2QK4A 1ODSA 5DSZA 1IVYA 4FOTA 1CZNA 5C4IA 2OCIA 2LUOA 1UPCA 1W4LA 4IDAA 3SD7A 3KPVA 3LT2A 1LLCA 2ZSAA 3TBKA 4EUNA 1RBYA 3SZOA 4CF3A 3K0FB 4DR5B 4QYXA 2X7JA 3H9BA 2ZIUB 4RQAA 4NDZA 4BYGA 2BONA 2BCEA 1IOVA 3M6VA 3HBMA 1BFUA 3JAWA 3O8DA 3QQPA 4JWKA 4D5GA 4RHFA 5ITSA 5J2UF 4X71A 1L4LA 3PXAA 1Z0KA 4CU2A 1UMKA 1ZYUA 4DARA 4QREA 2ADFA 3A2NA 3BTUA 4C7OA 1TVKB 4BFSA 5HKBA 4QGGA 2HO4A 3DE1X 1R6TA 3NGMA 4H7EA 5HZKA 3SR4A 1C9MA 3WGHA 3DLCA 4KIFA 1RKVA 2VT3A 1BDBA 2XDAA 3AR7A 3OIWA 4LJ4A 4TQGA 5CDFE 3ZVNA 5D00A 1D4ZA 1ICEA 5FORA 4BKUA 4C0LA 5IVKA 2P4QA 1YU9A 5D3KA 3I39X 4CXMA 4I9HA 1KI6B 1RE1A 4FLFA 3PC6A 4FR2A 3C6XA 3ROTA 1MOQA 3Q85A 4HH0A 5MFZA 4JP2A 3OETA 2E0IA 2CXXA 5G3ZA 3V1YA 2EFHB 3W79A 2Q6KA 3ZW9A 3VYUB 3Q4GA 1XA4A 3N86A 1T5HX 1X7ZA 3ZNQA 2XCSB 4JT2A 3L7YA 4KAXA 4R2IA 3D7KA 4OK3A 1VMDA 3AERB 2OBFA 4YUZA 1U98A 4IIDA 1M1YE 4P5EA 4KACA 5LD2C 2Z98A 4V0QA 1J33A 2QSYA 3NIDB 3N6XA 3NCHA 5TC4A 4B0PA 3UHFA 3I2JA 5BVGB 3HN7A 2B9EA 3VYRB 2WYHA 4LXTA 3B3FA 5C5IA 5BO5A 2GZMA 3CTPA 4EY6A 1CSEE 2VKTA 4LC9A 4GPD1 1M2NA 1FPMA 1FYEA 4GZ6A 1H8HD 1J2TA 2QUKA 4HZUA 3G7UA 2H1LA 3V42A 2B8JA 5TE9A 3RVNA 4NYJR 2CMDA 2BRUA 3C1AA 4BCDA 1GQQA 1QO0A 4GQBA 3JQBC 4UVIA 4IMIB 1C81A 3PRKE 4FYKA 4J4HA 5DBHX 1JSLA 1YDWA 4D9CA 4PPQA 1Q7TA 4LRSB 4BGIA 3ND5A 1UAGA 4FEEA 4HO1X 1SQSA 4OO3A 4QAQA 4QVIA 4QYIA 1O0CA 2G5TA 1PGNA 3B78A 3M6XA 2W43A 4GPIB 4DMHA 1K8YB 5DHTA 1USVA 3U9SA 5AW3A 4CR8A 4REQB 1XLTA 1VPEA 3ME5A 1TAGA 2PRYA 1RM0A 2F67A 3MB8A 1II9A 5DM2A 4JAVC 4M8LA 4ARBA 2IUFA 1X1RA 3IP9A 4IO0A 3UWMA 3REQA 2E5WA 4MAFA 4MITA 4JLSA 5IC5A 3N8DA 3DZBA 1BU5A 2GZ1A 4HY3A 5FBRB 3DO8A 1L7EA 3E03A 1D5WA 2Q4RA 5L7TA 4MUBA 4GOND 5TMEA 1NC3A 5LZ4A 3ZN2A 2KWIA 3ZU2A 4XRGA 2ZE6A 5AI9A 1ISIA 3THXA 1HY3A 3X2SA 1AGNA 1VB5A 1X1AA 4B45A 4INOA 5JFTA 1GT91 3NHKA 3PQ3A 4BE9A 3LD9A 2JIBA 2A9QA 1XT6A 4AS1A 1U2PA 2WEKA 3B82A 3TDNA 4JLNA 2JFUA 3C4JA 1FU4A 2H51A 3WB2A 1GAXA 1E7QA 4A6EA 5CFQA 3AO0B 4H7IA 3SFVA 2GFIA 3GRKA 4KR9A 2G7MC 3LZDA 3UMCA 2VTBB 4KSCA 1G55A 2QN8A 3B70A 2C5SA 3FYSA 3U9TA 3Q6MA 4D41A 2IXDA 4R2JA 1ZMRA 2OCDA 3WFJA 6CHYA 3ESAA 1WXQA 4DKJA 3DXXA 2B98A 2NYAA 4UBLA 1AKVA 1Y89A 2EQ5A 4HC4A 3FUWA 3W90A 4MUGA 5C7IO 1D09A 1QHFA 4BRWA 2R4TA 1WO8A 1XF1A 4EA9A 4IJ5A 2VF7A 3PR1A 2AKAB 1N5OX 2YVAA 2VRBA 2VYVD 3FCEA 2I99A 2JATA 5IXYA 4ZT6A 1L7OA 3CONA 3TB4A 3WA7A 4YP0A 4INPA 2DFPA 4MWTA 3HXTA 2WHQA 3TD6A 5IMBA 4L4RA 3WAKA 1SB9A 3RYCB 1QH1B 4FLEA 4LIPD 4IRMA 5FOXA 1JQEA 5IK2D 2PQ0A 4KXXA 3KJFA 3X1YA 4QEZA 3RJZA 3E5RA 4EDFA 3L5OA 3WHLA 1P9WA 1X8KA 3A37A 2CE7A 5A3QA 2B1IA 2XOXA 4BNUA 1GZVA 3O8NA 1DJOA 4PG5A 1PS9A 5JAPA 3L79A 4EVSA 1IDOA 3FETA 1JDVA 5FFMA 2MSCB 1BYIA 3AY7A 5CVDA 5B7GA 3VJKA 4PYLA 4DYDA 5HF8A 5KNDD 1VYUA 3C5HA 4NCNA 2IEGA 2A1UB 2H17A 2LRHA 3M6UA 3UJDA 4I1IA 3TL3A 3TLXA 4ITRC 2P9EA 2X1LA 6NULA 4PQRA 3DQPA 3IDFA 4DM7A 1V95A 4LF7B 3MGKA 1YS1X 3BAZA 1AGYA 3B38A 2HCRA 4PXAA 4YJ2B 2QXYA 4XUDA 3TM5A 5GIPE 4CM4B 1KARA 1YZHA 1XCMA 3HNRA 3S29A 1XP8A 3I61A 1DWQA 1ZFNA 3AUSA 1H05A 3BHNA 4Q9DA 1QU3A 2ADOA 1O9BA 1N7JA 3QF4B 4OXKA 3T35A 3TRIA 5L7WA 2JFWA 3CE9A 1Z8DA 2O05A 4DLZA 1SWVA 4OLFA 4QUKA 2X8JB 2Q0SA 2YNMA 5FOUA 3PDCA 4EH1A 4ALMA 1RU3A 2BKUA 2QL6A 3L46A 1KH3A 1PX0A 2ACKA 2O7SA 3OQ1A 5G0TA 1Q1EA 3V8NA 1YD7A 5JI2E 1YZ3A 4BFCA 2QJRA 1Z4IA 3ZGXA 1NZDA 2WPNA 1LD3A 4M46A 4HN9A 5E1BA 4AKGA 2YFQA 1DTEA 4BLRA 2B8WA 4BPRA 3CB2A 2JJYA 3WBFA 4G0WA 5KQLA 5JUWA 7MDHA 2ZWIA 4XGQA 4RY8A 4BZXA 1OYOA 1R37A 2ERXA 1L5QA 1N6PA 4X1KA 8ATCA 1MQ8B 4U2KA 1RWMA 3RK0A 5ELMA 5LWHA 1TMGE 3OZRA 5HE9A 3CTMA 3SYRA 1RKBA 3R77A 4DEXA 1JLSA 5TS3A 4YUVA 1O4WA 3MJFA 4IG4A 2QRLA 2QV7A 2QY9A 3A28A 2FN4A 3HYSA 4GM1A 4RA6B 1R2QA 5EE1A 5KWEA 4OIMA 2ORIA 1FRQA 1HLDA 1CUGA 4FDUA 1WZNA 4R69A 5KVVA 5DZSA 3LXUX 3SC3A 2GLTA 3UAGA 3PK0A 2IZ5A 3TAUA 3P0RA 4YT2A 4HNTA 2OMEA 1CW2B 1NM5C 2VJAA 1T1IA 3HY3A 1KU0A 2VL7A 3EEFA 5T41A 5H0IA 1RTTA 1EE9A 2AR7A 1WABA 2LZ0A 3CR8A 1YJXA 1LSUA 3IRUA 5FOWA 1IDN1 2EFCB 3MUOA 1NOKA 3MS7A 4LWZA 1H6AA 4FSXA 2WYOA 4RK1A 2JKYA 1JLLB 4RNDB 5L7YA 3IIMA 2ZYSA 2FJUA 4LZJA 4NOJA 3DT6A 3BFXA 4C4RA 1CQJB 3HJRA 1GSOA 1ZD9A 1A04A 1QGZA 2D0DA 3BXOA 1IOZA 3INTA 3OZGA 3AX6A 1W73A 1FNDA 3EIFA 4HZIA 4PYRA 5BWBA 1JLLA 1RS0A 4QHSA 3L0DA 4M98A 4I4NA 1Z5NA 4EGJA 3ZXUB 2X1HA 4IIHA 4OOEA 1Z6ZA 5DJ5A 1X86B 5H82A 4JB3A 1RC1A 2A84A 5GONA 5JCPA 4P80A 2FK7A 2PX4A 3Q7QA 4WQMA 4AFNA 1QIJA 4ZDJA 5C8XA 2AEEA 2C9OA 2W6NA 1I7DA 4KDEA 2FX3A 4OHWA 4IKOA 3BICA 3BDAA 3WLNA 3V4VB 1NJGA 5CG1A 3KKZA 4K2AA 5C8DA 2IV2X 3WMEA 4YRTA 2YWGA 3IPLA 5CB4B 5KKNB 4IIJF 4D0SA 4Y67A 1Z25A 2YWDA 1UT5A 4ZC8A 1NLUA 4AJ2A 4DWVA 1UADA 3N2NA 3QKWA 3ZKWA 1ESCA 1VLJA 1L8XA 2ZRBA 3OJFA 2WWRA 1L5WA 3DEJA 1E7WA 3IE2A 4II7A 2C03A 4GLBA 1DBRA 5JSHA 4YRBA 3GVPA 1C4XA 4KUHA 1OJ7A 4J0QA 3AZOA 4PANA 4C0HA 1L5HB 2YWEA 2WY2D 3L4SO 3JQQA 4B17A 3IDZA 4M6WA 5DTQA 4FDTA 5KUTA 1EWVA 1J2RA 2DJ5A 1M83A 1R8JA 2H4JA 5MFPA 1I4OA 4Z4HA 5C8YF 1X92A 1M7HA 2R8OA 3JASB 4UNNA 3ESYA 4FPXA 3EISA 1RJ9A 5E7IA 2BFEA 1MABB 2J9YB 4U9UA 5ERXA 3ZOKA 2PGDA 3TI7A 4BNFA 3DMNA 2EJUA 1TIPA 4ISCA 5IJZA 1YE5A 1WW2A 3QBDA 4UUAA 1RYYA 2W2KB 1BE8A 3CZ9A 2H11A 7MHTA 1JZTA 1V3VA 2ZZMA 1ULSA 2IODA 3WRXA 4ALIA 1QHSA 1H2AS 2FH5B 5PNTA 2C98A 3GFVA 3IVAA 3KXIA 2PEYA 2AN1A 4J0GA 1P80A 5BSHA 1IPEA 3WX0A 4B83A 1R4NB 1P7VA 4LDJA 3IX7A 5ANRB 5HZMA 1YZQA 4NR0A 1FFGA 1K63A 2FFAA 3AF0A 2PBZA 3TVDA 3DDCA 4LHVA 2DF8A 5KBYA 1F2UA 3PLRA 5GV8A 1XJCA 2A1UA 4Y8VA 3TFWA 2Q2NA 5TSDA 1KPIA 3LOPA 5IABA 5JARA 2H1CA 1U9IC 1CJKC 1U7HA 2A88A 2XR1A 2NU7B 3LDAA 4NJMB 4LWOA 3RJ5A 4EG5A 5CB8A 1SQ0A 4G1UC 4JBYA 1UC8A 1SVOA 3CU5A 2V96A 4ZP1A 3MZ0A 2JD1A 3C87A 2X4IA 3K5WA 4MZDA 4WK0B 2ZR0A 2LVBA 4HGNA 3RSOA 5K4GA 4LV6A 3Q98A 4OQFA 1AK2A 1SEVA 2OAGA 4YMUA 1XXHB 2VSYA 2AQHA 4I55F 3QVSA 1WSDA 3PFIA 4HFNA 4QGHA 4JOBA 1E9DA 1DKMA 1PW7A 4M7WA 3U7IA 1ORWA 2PGXA 4JEUA 3ZE8A 3HZZA 5CEFA 3BC1A 2QUZA 3LGSA 4R6WA 3QLUC 4I08A 5FLKA 2Y05A 3ZGOA 5EJAA 5DHAA 3EQ2A 3PA8A 5AKYA 2I91A 1IEXA 2ADMA 2YY5A 4X61A 1SBCA 4GPBA 3M34A 2AOTB 4ZOAA 3AFMA 3ASYA 1K8XB 3FMPB 4LYGA 1J25A 2BE7A 2NM0A 4X7MA 5DNDA 3ZCXA 3IGFA 2C2KA 3LYAA 1T5SA 4DLWA 2B1JA 2ZQZA 1H94A 1Y6QA 4Q48A 5TARA 3MIZA 1RZVA 1SD2A 4F93B 4I4CA 4BZWA 1B6TA 1S89A 2FEOA 2QRUA 3JATB 4NZ9A 1KEPA 3IAAA 3DOEA 1DWUA 1FCJA 3C15C 4AS3A 3X1ZA 3AI3A 1FSZA 1XJQA 3EFBA 3IAS1 4II3A 1DBQA 1XK6A 5BR1A 3CKKA 4FHFA 5FEMA 1O5OA 3SBDA 3IV9A 4FFPA 3DAYA 2ANBA 1ONOA 4X3PA 3UOGA 5B2EA 4H6VA 1OXBB 5FBWB 1QSGA 1N75A 1IVNA 1L7BA 1D4OA 3LPDA 3V1MA 2JIRA 2W5UA 5JDCA 3M9XA 1SEPA 2P0AA 3ELWA 5HGJA 5JZVA 1ULHA 2QYSA 5G4KA 2Y66A 5C8ZA 1VLQA 4HTAA 4GLFA 1EX7A 1B8NA 3R1IA 5FH9A 1YKFA 4ZMSA 1CE8B 1RWKA 4P92A 4E0BA 3PWZA 1HDXA 4D82A 3O1JC 2VSQA 4C0AC 2RK4A 1CFJA 3W5IA 2JH9A 3SNHA 1GRNA 2X6QA 4IIGA 1EFKA 3H8VA 1LBQA 1RYNA 2HJGA 5AKJA 4UFOA 4OI0A 5JG7A 4REQA 3VU1A 4DSTA 4G24A 4QECA 3W8FA 2H1WA 2W71A 5AMXA 1T2DA 1UK6A 2VP6A 3DZDA 1I4LD 1X19A 2PX3A 2VK8A 1PGPA 2WMDA 4JJFA 4N1AA 5EJGA 1IY9A 2Q5FA 2V6JA 3LECA 1S7CA 3WV4A 4V0LA 3LWDA 2QT0A 3D8HA 3ZCQA 1WP9A 5AUNB 1CDEA 5K3FB 3R6WA 1Z47A 3ET5A 3ZWDA 2C82A 4KQ2A 2JZCA 3QV1A 4ZO9A 2JI7A 3UHAA 3LMKA 5JEDA 1OH7A 1KI7A 4FKMA 2NP6A 1I94B 2OQRA 1YHYA 3JWJA 2WV7A 1IEQA 2P2LA 1FFBA 1PJRA 1AQYA 3NONA 1AQUA 1NHWA 5FJIA 1YHZA 4F4UA 5LLTA 5DMHA 3A1VA 3DHEA 3JYPA 2NZXA 1VL5A 4PYKA 4MV1A 4W1QA 4MB0A 1AQLA 4BRSA 5AM5A 4JUFA 4BNWA 1A88A 5HCNA 4QBIA 1L4BA 1MX3A 3E4CA 1B2RA 5CPFA 3ZZTA 4IFTA 2OFPA 2BGWA 2OR3A 1XJ0A 5F9FA 3B85A 4O3FA 1QIIA 1WZ2A 2WVHA 4PGMA 4RTPA 3ZXIA 4P5DA 3VMFA 2JHFA 4JJEA 5DGXA 5GVSA 1M73E 4L4SA 2Q9BA 2EBUA 1OUMA 4P4GA 1UKVY 3E9NA 2XX3A 4P3KA 2PMEA 5I9NA 2I7XA 3TLGB 5KZMB 1FA9A 4KEAA 1T29A 2DB3A 3LAWA 4ZCMA 1HEIA 4LEIA 5KOHA 3GLQA 2VPIA 4KTVE 3I9OA 3IODA 1ZNQO 2J3KA 3W3ZB 1QPZA 1TJNA 4TLEA 4O2AB 3SLGA 1KJ9A 1X7GA 4DV0B 4UTZA 3SVZA 3KM0A 1FXWF 2PRIA 4E94A 3PEFA 1A9QA 2P11A 5DCUA 1ZSVA 5FPPA 2I67A 1FP2A 1JBQA 4B31A 3P9QA 3NPMA 1PGOA 1RJFA 2IEBA 3IAHA 3OPVA 3R24A 4MRSA 5AW9A 4DLNA 4AMUA 3CM0A 4EHLA 4WKGA 2HRBA 2PSHA 2QTZA 3I53A 1EZ4A 1ODCA 1Y6GA 3NXKA 4O4JB 2WNSA 4YLYA 1B0PA 2IYTA 5TQ0A 2Z3WA 3GYGA 1FUYB 1K6JA 3BJIC 3ETJA 3BF8A 2FVXA 4INZA 4PZ0A 4M0UA 4DTIA 3FBTA 2V5AA 1CFZA 3ONNA 3KR0A 3A4NA 3HB0A 4RLQA 1O87A 4OJTA 1UFQA 1PDOA 4DSAA 2GRJA 1GYPA 3OY7A 1CF9A 2O5CA 1YR3A 3O8OA 1FJ2A 1GG2A 1VSQA 1ZITA 4QRDA 5AYVA 3ZDFA 3IE1A 1W34A 3PXDA 3K6RA 2ISSD 3BWDD 3S70A 2VJQA 5G40A 1DOAA 1YRLA 3ENKA 3G49A 4RIGA 5DI3B 3IILA 4K7JA 3WNQA 4AQDA 4CT0A 5F2OA 3DDNA 3QK7A 1YOVB 4ZRDA 3USES 2FEWB 3DDOA 3H3JA 3ZJTA 1YRHA 3BE5A 3T52A 3O0DA 4FSDA 4B3TB 5KSZA 4M4SA 4LWPA 2PAFA 1IQPA 1XROA 3ETNA 1TQHA 4P7GA 5CA0F 1UJBA 3LLCA 1HUQA 3OPYB 4W7HA 1I7QB 3ZE2B 4FHGA 3WA6A 3NCTA 1M0EA 4RA9A 3FAZA 4UMVA 4WFIA 2DH6A 2QYOA 3TLJA 1IJKA 1COWD 5J23A 1E3LA 2WP8J 5B3AA 2YZKA 1NT4A 3H0KA 1KMHA 5COQA 2EQAA 4UD6A 2KX7A 3LXRA 2R60A 4HLUA 4K03A 3ZCSA 3RADC 2HADA 3TZEA 1ODTC 2BLNA 2OECA 4ENUA 4LC0A 3KJQA 3P0EA 1F4PA 1BDMA 2CFIA 4F97A 4MUYA 3Q11A 3R09A 3ROFA 3RTAA 1GUZA 4X84A 1Z6PA 3TXXA 1IBRA 1U3UA 3I45A 3U7RA 3UK6A 3NS7A 4PC6A 4D46A 1YAHA 3ZGNA 4DA7A 4NEHB 5CW2A 1WU8A 4X00A 1XZMA 2F1HA 2WHYA 3C3YA 3T5GA 1J8FA 5AJUA 1OLSA 4W7SA 1TEZA 2LW7A 4BVLA 4ABYA 3NBKA 5DKFA 4DT1B 1OREA 4EUKA 3GLIA 1O08A 6Q21A 1C0IA 1G21B 1GRVA 1Z0FA 2XQKA 2Z43A 5AKXA 3VR4H 1E2EA 2VBCA 4POAA 1K6EA 1JA0A 3WNVA 3D0QA 5E3HA 4R1SA 1PT8A 2J30A 3A25A 5B1DA 1C2YA 3AUAA 2BEWB 3U1BA 1Q95A 2IE0A 1Z88A 3COPA 4Y9RA 2ZVPX 2YMPA 1LNZA 4MAAA 5FOSA 4Y2SA 3CA8A 3EVGA 4FX2A 1RKUA 3VM6A 1DMSA 1CJCA 1JT9A 1LUAA 1YRWA 3CBQA 3IBFA 3O93A 3QVJA 3IB3A 4WN3A 5CJ2A 3TSYA 5B3LA 4HDSB 1LRKA 3HVUA 1V7QA 2EKDA 3ND7A 4JP3A 1G38A 2VRWA 3RRMA 4IHAA 3FYUA 4BKQA 3LUAA 2VJYA 5IFKA 1SZDA 3W1WA 3IMFA 4LVCA 1TZKA 4NESA 4ES6A 1VLMA 4KL8S 5AJYA 4XPIB 5BORA 1I3KA 3TJZA 5EGSA 4HVCA 2OAEA 3TGLA 3VZDA 4R3UC 1PWHA 2GHTA 3GYBA 1P44A 4J0HA 4KGVA 4Q66C 1U04A 3R0VA 3AI2A 4OJMX 3N2GB 4J0EA 2DQKA 4BBJA 2O2GA 2R6HA 2XKKA 1E1LA 4CKBA 1GL7A 3DG9A 3OJXA 3HJFA 3BWCA 1CU1A 1F5NA 1XBTA 1OGYA 3BQNB 3HCOA 1J7JA 2HRRA 2VDOB 1OYWA 2GZHA 3BE8A 1C4KA 3T0FA 1XDSA 3CF4A 4JI3B 5TPWB 1XIVA 3IUEA 1V5EA 3S0JA 4MQBA 4ZZ2A 5JS1A 1NMQA 3HSYA 5AHOA 3DGFC 4F2DA 4TZKA 5LA6A 5BUQA 1AKUA 5AJTA 1NG1A 4UOQA 5HJ7A 1WDTA 4BFXA 1QLWA 4D0GA 1JFVA 1U1FA 1V9SA 4L2IB 3TTWA 2W2MA 3AEKA 3HM2A 4CQMD 4DMMA 2IXBA 4Z4GA 1NJ1A 3DLTA 4RORA 2WG1A 5K8IA 1D2EA 5LU8A 4LY0A 3VR4D 3AJEA 1M6WA 3PPVA 2J9XB 4Q6BA 1RZUA 2WP0A 1P33A 2C2ZA 3I5AA 4UHHA 4UTXA 1XD8A 1J07A 4WFQA 4JBIA 1X74A 3VO1A 1HT0A 1Z06A 2FCRA 2JHCA 4ENQA 1RADA 2NUTB 3U0VA 2VTDA 3K30A 1IHUA 1OD6A 2AQ8A 1RIFA 2P1ZA 1MPTA 2Q3DA 2VOJA 3W2FA 4BBAA 1D5CA 1DXOA 5DX1A 3A6FA 4G4IA 4S05A 3BJEA 2HKIA 4QQRA 5EZSA 3L05A 4AJKA 3TLGA 4Q3EA 1U8FO 3ITNA 2O5EA 1Y4DE 5IDQA 2IHJA 3B1KA 4MI3A 1RR6A 2FRDC 4ZTZB 2E9SA 2QDKA 3AFNA 1H23A 2PEZA 2UZ3A 4BY9E 4E32A 1PVDA 1Q91A 3QOWA 2AK3A 1QNLA 3ZE7A 1MRSA 1L5ZA 1ZJ6A 1DUSA 1O94D 3PFKA 4GLJA 4KQJA 3AUYA 5BW4A 3A8TA 1QJ4A 5BR4A 1IY1A 4S1NA 1BKYA 4V2UA 1GVHA 2O7NA 4F2WA 2QVYX 1MOZA 2PIDA 2HA3A 3RKRA 1BWSA 3PRJA 1WDKA 4KZKA 4MTCA 4N48A 3KQTA 3QW2A 3SJAA 5FBVB 3BD8A 4PAWA 1DDIA 9LDBA 3FUUA 1P17A 1R18A 2YY7A 4OHMA 4EEKA 4PWZA 8GPBA 1UM9B 3IPAA 2OV8A 1UBMS 4MMXB 5JVDF 2PS3A 1ZGCA 2GAJA 4G09A 1JYEA 2CNDA 2BFNA 3CJQA 4FDVA 4PZUA 4WCFC 5K3FA 3EPHA 3DUWA 5DYYA 4QDXA 2PZ8A 1L3CA 4OA8A 4BQOA 1WD7A 3VHLB 1ZR4A 4BN5A 1Z07A 3FCAA 4LN1A 5C1IA 2PYDA 3ZU6A 1U65A 1VGRA 4YASA 4AZTA 5ESRA 1P1JA 4CUKA 3EPJA 3R9IA 4J1QA 4B2PA 3AU9A 4IVQA 2OO7A 1JHOA 3AKYA 1JE0A 2K2WA 3THYA 4GVLA 4PYNA 2PMCA 1DTWB 4PZAA 1N2EA 3O26A 3TLEA 2POQX 4L8WB 2BDEA 4BAGA 4X1OA 3RHZA 4V0KA 2PUVA 4KHZA 2GD1O 2IRWA 5DP1A 5MN6A 4NXMB 4IHQA 2FLKA 1KY3A 2YNMD 4K6KA 2M98A 2R5WA 2ZROA 5C3UA 4O6VA 3DE3X 2P6MA 5SY6A 3OQPA 4L50A 2PA0A 2WOJA 2VH2A 5FADA 4KO3S 4GM4A 1KIMA 1XK7A 3JWIA 2WWIA 4G5OA 5I6DA 1RJEA 3UJ7A 1Y7TA 2ZS9A 1NU6A 2EKQA 2ONKA 4X7PA 5BWCA 5ISMA 5E4YA 3RYTC 5JQGA 3FDXA 2WG2A 3OFSA 1X7HA 3PKJA 4W9NA 2KYRA 1JVSA 1STOA 5HK9A 1AMOA 3RRZA 4H3VA 4KQMA 6REQB 5JAMA 3PCRB 1DXYA 4BPBA 5CDYA 3HDTA 4A0HA 4Q1AA 3UKDA 5K8UA 1HSZA 3O4RA 3PC3A 2IHYA 4KFTA 4MA0A 3NRBA 1A9XB 4AX4A 2OCXA 2GKSA 2QM8A 3NKLA 2QQ5A 4XIFA 3V4LA 3ND6A 3VC1A 1YS6A 3O74A 1QNFA 4LXQA 5JPCA 1C3VA 3WL8A 1UMBA 2DY0A 3QPUA 2F59A 2AIRA 2B78A 1E9BA 3HE3A 1J8MF 5JY6A 1AUPA 2RJNA 3EGDA 2I29A 2C4KA 3GEBA 3ITDA 2IWRA 3SXUA 4IIXA 3DE4X 5T4EA 1QVWA 3LBAA 5J4HA 1Z0SA 2KPOA 4I50F 1NRWA 4L9SA 4P22A 4Y2QA 3EAFA 4MUXA 3SM3A 4EHDA 2REQB 4NF2A 1F0YA 3WGNA 4BO2A 2GMWA 2OO5A 1FP4A 1LBTA 2IXFA 2ONZA 1F60A 3F49S 3VZSA 1EVIA 4QWMA 4JLKA 4DCSA 5KYXB 1I1OA 4FI3F 1OLXA 2FPIA 2P75A 4PBRA 2Z2JA 2JLXA 1XRSB 4Y6LA 3X44A 3KYBA 3SK0A 5JXJA 3ZHSA 1AY0A 3BJRA 3SR0A 1RQGA 3NAZA 2WIKA 3OZAA 2Y1KA 1EM8A 4M9RA 4NP6A 5J43A 2I0FA 5JS8A 2FLVA 2PV7A 4FGKA 4B73A 1L5VA 1JTEA 3A0RB 3Q12A 3NEAA 3VPDA 4EQ6B 3R9WA 3HKBA 2QOEA 3TD2A 5ADVA 2GN8A 5JISA 1S7GA 2G8LA 2PSSA 3FWHA 3PDWA 2ANCA 4TM7A 4P3PA 3DMGA 1FYDA 3QUCA 4Q47A 1KEKA 2OQ2A 1AO0A 1ZUHA 3M9WA 3ETHA 4RK7A 5GAJA 2FEPA 1XLVA 4Z9YA 4KXNA 1LJUA 4RGYA 4QE3A 2XTMA 2VBGA 4IW3B 1SXJA 1V41E 3PXXA 4K46A 3RQIA 1JPUA 3FFAA 5CH5A 3CS3A 4ZAYA 1MIOB 1E64A 3A1CA 5JLJA 1WUYA 3BSFA 1FYFA 1FSFA 3LKVA 1KJNA 4YP9A 3RAGA 2AOUA 1Z2AA 4MS4A 2BGRA 1EFPA 3HCNA 5CD1A 1U0HC 5K3DA 1V6CA 2VHTA 4IJWA 4TRJA 1Q17A 4S35A 2FQWA 4UVHA 1L5HA 1KWGA 3ESZA 1A4XA 1ZKMA