3PSAA

Classification of a haemophilus influenzae abc transporter hi1470/71 through its cognate molybdate periplasmic binding protein mola (mola bound to tungstate)
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
326
structure length
326
Chain Sequence
b'DRIITDQLDRKVTIPDHINRAVVLQHQTLNIAVQLDATKQIVGVLSNWKKQLGKNYVRLAPELENMAMPGDLNSVNIESLLALKPDVVFVTNYAPSEMIKQISDVNIPVVAISLRTGEVGEKGKLNPTLTDEDKAYNDGLKQGIELIAEVFEKKQQGDELVKAAFANRKLLADRLGDVSADKRVRTYMANPDLGTYGSGKYTGLMMEHAGAYNVAAATIKGFKQVSLENVLEWNPAVILVQDRYPDVVPQILNDQGWANIQALKDKKVFLMPEYAKAWGYPMPEALALGEVWLAKALYPQRFQDVDLDKMVNDYYQKFYRTSYKPD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords protein HI_1472
publication title Classification of a Haemophilus influenzae ABC Transporter HI1470/71 through Its Cognate Molybdate Periplasmic Binding Protein, MolA.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Metal transport
total genus 113
structure length 326
sequence length 326
ec nomenclature
pdb deposition date 2010-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3psaA02
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3psaA01
2QI9F 1QH1B 1N2CA 1FP4B 5M29A 1KARA 1QGUA 3MD9A 3AERB 2M6KA 2XH8A 1L5HA 1H1LB 2PRSA 4PAGA 1K0FA 4FNAA 4WZAB 3AEUA 3K1AA 4DBLE 3AESB 4IRMA 2AFHA 3AEKA 4H59A 4PM4A 5KHLB 4OXRA 4TKUA 4K3VA 3GI1A 3PDIB 1M34A 4UDOA 3ZK8A 5I4KA 2PS9A 4H0FA 5JJ5A 3BE5A 4NNPA 2XDQB 4TKVB 1G20A 3HJTA 4UDNA 3AETA 5KOJA 1TOAA 1M1YA 2MINA 3U7QA 4WNAA 3HXPA 1XVLA 3EIXA 4FKMA 1QH8A 2O1EA 2YNMD 4ND8B 1MIOB 4FILA 4WZBA 5M2QA 4MX8A 3TEFA 4LS3A 5CX1A 3AEQA 3ZK7A 1EFDN 2XUZA 4XPIA 2M6LA 4M7OA 3PSAA 1L5HB 1N2ZA 5M3BA 2AFIA 3K1AB 5BVGA 2OGWA 5HDQA 4MDYA 3ZTTA 5BVHB 3AERA 4G09A 4G07A 1K7SN 4FI3F 4WESB 3G9QA 1H1LA 5KOHB 3ZK9A 3LI2A 4WZAA 1G21A 4HMPA 1G20B 5CR9A 3HH8A 3AETB 3MINB 5M34A 3U7QB 1M1YB 4LJSA 3PDIA 5B58T 5AFSA 4WN9B 4HMQA 1M1NB 2Q8QA 1K2VN 2XY4A 3MFQA 3ZKAA 1QH8B 1ESZA 3TNYA 1N2CB 2XDQA 4TKVA 1KAEA 1QGUB 4WZBB 2R79A 2YNMC 2RG7A 2OSVA 4HMOA 4OXQA 2OV1A 5HX7A 3AEUB 4UTOA 2ETVA 2AFHB 3AEKB 1QH1A 4TKUB 1FP4A 3EIWA 1K75A 5JPDA 4MLZA 1M34B 4UTPA 2AFIB 5BVGB 5GGYA 3AESA 2X4LA 2PS3A 2PHZA 3R5TA 3R5SA 5KOJB 3CX3A 2MINB 2OV3A 4WNAB 1G21B 4HN9A 1PSZA 5GGXA 4OVKA 1PQ4A 2WI8A 2XQVA 4GICA 2WHYA 3TLKA 1N4DA 5BVHA 1N4AA 4WESA 5FLYA 4B8YA 2PS0A 3MWGA 5KOHA 3NU1A 5CX1B 2XV1A 3AEQB 4NNOA 3PSHA 3BE6A 3LHSA 4INOA 4N01A 4XPIB 1KAHA 4BBPA 4MO9A 5JG7A 3UJPA 5JOQA 3MINA 2Q8PA 4CL2A 4ND8A 3MWFA 1MIOA 2R7AA 4WN9A 1M1NA 4INPA
chains in the Genus database with same CATH superfamily
3LWZA 4Q66C 4LC0A 4DE5A 1T1IA 3EAGA 2B1JA 1NUAA 5BYBA 4LZAA 5IARA 1WBBA 1B42A 4XGNA 1F2VA 2ZOSA 2ZQZA 4HNAB 5ESRA 2OBYA 5IWAB 4WZAB 4KW7A 1P45A 2QRVB 4LWOA 4MHTA 2OXRA 3Q3EA 3H1FA 1TAQA 5BN3B 1H9BA 3MUEA 5JJ5A 1GG8A 1Z4KA 3ANSA 2WU1A 3O75A 4HS4A 2JATA 3U13A 3V2GA 4RTJA 2CVOA 1JWAB 3MWJA 1KSGA 5HM6A 1ENOA 5DSTA 3HY3A 3UUWA 3H75A 3F4LA 3HYNA 4F2GA 1P77A 1UBKS 5F52A 3V7UA 5LQDA 1DC3A 1QSGA 3F3MA 3IH5A 3HYRA 1G9XA 2NM0A 1OX4B 4YAOA 2DPHA 4J49A 5PNTA 3CYFA 4CWAA 1TRHA 1F8UA 2IEBA 4M36A 1N57A 4NK5A 1GPDG 3N1UA 1GPLA 1RHJA 3H2KA 1SG9A 4KHZA 2C2ZA 1NN3A 3Q85A 1JLSA 1RI2A 1XIVA 2HLPA 2JJ1D 4O29A 4EMUA 1JIKA 1FPMA 4CQLA 4KAJA 1N6IA 3FKJA 3AUKA 2FR0A 1RP1A 2FQYA 3VMMA 6ABPA 4JN6B 5EE3A 3O21A 1FFXA 1ULSA 2QUHA 4K28A 4NYIR 4EFKA 3WRYC 5KX5A 4BIIA 2BYTA 2R4QA 4RSGA 2ODQA 1KYWA 1SNYA 4G56A 4TM8A 1SIOA 1NIPA 4C3ZA 4DIDA 4OJTA 4EI7A 3H9BA 1Z63A 4FMCF 5DH9A 1B7GO 4IX9A 2FR8C 1G21A 3C6MA 1ZRSA 2PZ8A 2DH5A 1N6KA 2D5AA 5CJ2A 1ZH2A 1FP2A 2XX3A 1BYUA 1M1YB 3IDSA 4KQGA 4F2DA 5FWYB 5DTQA 1Z4PX 2G1UA 3KWMA 4S04A 2LW7A 2QYHA 1LV7A 4TXNA 1N2HA 1QC5B 3E3NA 4KO3S 4LC1A 1NDHA 4NV1A 2VSXA 5EAIA 4AYTA 3F46A 1S7CA 1QHSA 1W8IA 3LVFO 4Q1DA 3THYA 3V7WA 1V41E 2OUIA 3UB2A 3WE7A 1EJBA 2F1IA 2P9BA 3UK6A 1UOEA 1GTL1 1ILEA 3Q7TA 4PF1A 3PEWA 1H66A 3IR6A 4J29A 1MV5A 2CVFA 4D02A 3T9DA 1HXHA 2ATCA 1Z37A 4BLSA 1XJ5A 4FB4A 2EFEB 2GNOA 1GSOA 1PIWA 4YRGA 1G17A 1UP4A 2QB5A 5L3QA 3R7FA 3CBQA 4Q9KA 1K5DA 1RKVA 1RRMA 3LBNA 4WLFA 5B37A 2F3TA 1DHTA 1F8XA 2JK1A 1ZQ1A 4ITRC 3SHOA 1V7CA 1BX1A 4QATA 4EHLA 1I7NA 3ZE8A 9MHTA 1LA2A 1Q0SA 5AVJA 4PS0A 2C9OA 5TY0A 2OMEA 4LFCB 1CUVA 3D3WB 3K2QA 3MCWA 5EP4A 4XEUA 4DCGA 4DR6B 1A2BA 2W0SA 3L0CA 3J80A 3WTBA 2GJKA 4CEJB 1PKEA 2DM6A 2QDKA 2FSGA 4NNOA 4O2BF 1XF1A 1TT5B 2ORWA 5EZ5A 1SAYA 3UMRA 4OMFG 4XQ9A 2G06A 3PGLA 5JMOA 1CRPA 3RC2A 2BHSA 3NX4A 4BN5A 3JQAB 4DV5B 4LF9B 3ABZA 1IZZA 3DFMA 3GUVA 3PQ3A 4C6TB 4HY3A 3NVKI 3KEQA 2JIBA 4XB1A 3UB4A 1T6XA 3UXEA 2A5FA 3NMUF 2VJNA 1SXJE 4LWPA 2X6TA 1X3LA 3IT0A 3VV2A 1FMFA 2VHXA 4FUTA 4HAIA 3BMQB 1SXHA 1IVSA 3PE4A 4QECA 4CM8A 2ID4A 3A6JA 4HDSB 4ITVA 1QOZA 3KJHA 2C61A 2N47A 4Q9JA 1B41A 3THWA 3GI1A 3ZLUA 1XPOA 4F2HA 2FMTA 2YY7A 4F6LA 4Q5IA 4MUXA 3R7SA 5ESXA 3EIEA 4X90A 1WP9A 1Y8QA 4X6LA 3QE4A 1CS0B 5CPBA 3RK1A 4D96A 4LY9A 4ZHQF 5K0JA 4E12A 1JEOA 2Q9CA 3OLYA 3IQFA 1XAJA 2A84A 3Q3CA 3EODA 3NDBB 2GILA 1MOPA 4KE9A 1T0HB 5K3DA 4EUNA 2XUAA 2ZITA 2CNKA 3ZU4A 1KDVA 2FZLA 3KTFA 1FA9A 2IOFA 3D59A 3KR9A 3TSYA 4C0JA 3CIOA 5AW4A 2DPGA 2DSTA 3K5IA 2BGRA 2ZYWX 4EW1A 4NBLA 2UV8A 3AVOA 1SO8A 3E05A 2GXAA 2ORED 2R00C 2R65A 1KDRA 2A1IA 2AVDA 1O97D 2ZG6A 1B8UA 2JI8A 4LOLA 4BVLA 3L0OA 3ZY2A 5EJFA 4PRZA 4UCFA 1VRVA 4WV3A 2O2YA 3KSDO 1KZ1A 2I4MA 2CLLB 2ONZA 4MGIR 1ZJWA 1V2HE 4G5QA 4YV0A 5FO1A 3UWDA 5H80A 5J2UA 1AUOA 3LCVB 1KEEA 4DVJA 3C1OA 4RK5A 1HA3A 4MHSA 2I4TA 5CDYA 1U2PA 4LXGA 2FSVC 3W8NA 2E48A 3D8SA 3HKDB 3VPGA 4DLBA 3HXTA 2RARA 3W8DA 4XOIA 5ULLA 5UKDA 1PTJA 1U8UA 3AXSA 3VDNB 2I91A 3VBCA 4AJ1A 4K46A 4P8RA 2GDJA 3TRJA 4UQPA 5CDHA 4DCMA 3HEAA 2CDNA 3RKSA 5JBNA 4MPTA 3OZTA 3RYFB 1TTPB 4EX7A 4KN5A 5ALEA 4TWIA 3IP7A 5K1ZA 1SEVA 2NSYA 2Y93A 2YBDA 4Y7CA 1KH1A 3R9KA 4DWJA 3F5QA 4ZI5A 4R0MA 5J4HA 5CCBA 1ONSA 1M1ZA 1NJ5A 1XVVA 1T2EA 3A3PA 3VR4A 3U62A 2FHSA 2WILA 3HCRA 1CUBA 4PFSA 1TCBA 3CLSD 3JZIA 4H1HA 2OA0A 2P5YA 4RZ3A 3RREA 5K09A 3IVGA 4B5LA 4LMPA 1LU9A 3IRVA 5CA1F 1OXMA 4OJYA 1FZQA 4MARA 4DQKA 2YS6A 1JH8A 1X70A 2BHNA 1KNQA 1NVDA 2ACWA 1BKDR 1J5XA 3P1JA 4R6XA 4DB4A 1WU8A 5EGNA 3EGDA 5LDGA 3GMSA 4G5OA 1ZL0A 2OKCA 3O8DA 2ZTMA 4NQZA 1HQKA 4I1SA 3EW7A 4L5YA 2EW1A 3AZOA 4R4JA 4OBXA 2IYTA 3N2ZB 5IC4A 2PWBA 1RJ9B 3VC2A 3ZY3A 3F7MA 2VF8A 1OLUB 4POAA 4V39A 4Q18A 5EIHA 3VZPA 1QIMA 3KR0A 4QARA 5FPPA 5TJHA 4DM4A 4YP0A 4WAUA 1AK9A 5DI3A 5ARDA 3QPBA 1N8KA 2MYPA 2TMYA 3GF4A 4WBSA 3DZIA 1X6VA 3PHLA 5JPIA 2CMDA 2V9PA 4M0FA 1G59A 5LQJA 5IZ4A 3QEMB 4CL8A 1DKNA 1C1XB 3DWFA 3WK8A 3WLMA 4OQNA 1FL9A 4YRPA 3ZHSA 1ESNA 4P0TA 1LLCA 2FPMA 3GLQA 4A8JC 4EB3A 2AC2A 5BV1A 5KYWA 3WL5A 4C1NA 3JASB 1YIOA 3UFXB 3WQQA 4B2LA 1DC7A 4NNPA 2N42A 1KRHA 1Z5UA 5IJWA 4H4EA 3QKRA 1UFVA 3ORYA 4QG7A 5CW2A 1MOSA 3HBAA 1NPYA 3DD5A 4AWXA 4AY3A 2IYFA 3GUYA 1BGVA 2GN8A 3I2GA 5CA0B 3LXMA 4H3SA 3UCFA 1QXSA 1CY2A 1NV8A 3BZUA 2V5UA 3OP4A 4FQ7A 4MJXA 1YB7A 1QPGA 1FNDA 2AQKA 4Y3UA 4EG7A 3VYSB 1FYEA 1I36A 4V03A 1NLYA 1MPTA 5D3MA 3VNAA 5GONA 1BXKA 4OJNA 1X14A 3V55A 1U0LA 3L6BA 2R6HA 3BIJA 4Z1MA 3L92A 4KEAA 2X23A 3U31A 3ZZNA 4KO4S 1L5HB 2OTCA 1FPQA 8ATCA 3LQ2A 1NUSA 2WD7B 3X0DA 1YXMA 1JIXA 4WVFA 3ZCXA 3L02A 1JT9A 2YVKA 3K6JA 4PLPA 3CFYA 1G1AA 3V8NA 5KKCA 3DM9B 2B35A 3BICA 4JX8A 2CXXA 3U9SA 1OASA 3BGOS 2YC4C 1A77A 5A3SA 3LUAA 2FUCA 1N6LA 3CO0S 2CYBA 1CR6A 3T35A 2CE7A 3EFOB 2WM8A 1EGQA 2IX9A 1U0JA 1CIJA 3Q5EA 2GGSA 1NDQA 4D42A 1Y6JA 3PIDA 3MILA 5ALVA 2ZJ0A 3OQHA 3X2FA 4EEZA 1IJBA 1TEVA 5K5EA 3ZKAA 4MCHA 1ADBA 2QR2A 3RRNA 1U1FA 2X86A 3GQBA 1YOVB 4D43A 2WKSA 4BCCA 1ZXXA 3SM3A 4XIYA 2DPXA 1J0DA 1XEAA 3ZCTA 4YCMA 2VXYA 2A1TR 4Y6OA 1FMTA 3C6KA 2KLBA 4GUDA 1LW7A 1LSOA 3C3EA 3KZOA 2CLOB 1KIFA 1AE1A 4RC9A 2BI7A 4HUQB 1REQB 5CVDA 3VSCA 4TXHA 1E5VA 4OUKX 5HIAA 4MRPA 1LJ8A 4YPVA 1QDUA 2HPZA 3H1AA 4HH0A 2NU7B 3FYUA 1AX9A 1XQVA 5H70A 1Q5PA 3MWDB 2O0HA 4GICA 1SB8A 1QE0A 4F21A 1Y5MA 1TM4E 4FINA 4KUHA 4NCHA 4YHBA 3VR5D 4C76A 1J07A 4QICA 3UT0A 2IIPA 4F5DA 2EAUA 2NQ2C 3P32A 4JCCA 1T1SA 3JR3A 1JYFA 3R7BA 2JCYA 1GZHB 1KVQA 1N0VC 2V7EA 2OXTA 5F3DA 1CYEA 2IZ1A 3FJYA 4KX5A 4I8DA 1RCUA 4QDOA 4EJ0A 3DUFA 5F1KA 5AKLA 2QTFA 5C8VA 3BXPA 3GHHA 1M66A 2D2VA 3B2NA 2EKZA 2Q5EA 2QRZA 4JUBA 3ICQB 1Y6ZA 1T1JA 2Q5OA 3ZWAA 1U0TA 3E4CA 3V4SA 3FKQA 4BHTA 2B1QA 3C14C 1QYVA 1KTVA 3BBLA 1OBCA 1QRDA 3X1WA 2GBPA 4M1SA 3LXRA 3GROA 3KALA 1A9OA 4INJA 1DV2A 2P6UA 4G0ZA 4NHOA 4I4CA 3RS3A 2ZBFA 1E9VA 4JI2B 4NDAA 2VP5A 1RS0A 4ZJUA 4H59A 4HJXA 1G4UR 3LWNA 3C3CA 4ME6A 3UGKA 2O2XA 2FB9A 3OD1A 2JH3A 1ISIA 1GDDA 3HMKA 5HFAA 4PQRA 2OBXA 3ZE6A 1YR8A 3G2LA 2Y1CA 2AOTB 3DDZX 3MWKA 3DNFA 2AUNA 2BEUB 2O8CB 1FYXA 3M34A 4AF6A 2RGDA 1OF1A 2O3JA 5CG1A 1LRKA 1GD1O 4B32A 2GA9A 1DWOA 5A03A 2UAGA 1NMQA 2ZVQX 3BH6A 2OXCA 3CNOA 4MB0A 5HK8A 4F3RA 1V5WA 1UJCA 4FPXA 2QN6A 4EO9A 4IV5A 4O5OA 3ZOKA 5A04A 2LIVA 3GGPA 1HM5A 1SXJB 1FQJA 3IV9A 3QPWA 4O4LA 2RHBA 4R8KA 2MSLA 1VE7A 2WG1A 3QU4A 4R68A 3FZEA 3INTA 2IH2A 2F9FA 4B09A 1F0YA 4WZBE 2FEXA 2WEKA 3BERA 3K9CA 4MWOA 4TN5A 5D1NA 4ZEOA 2B9EA 3DMYA 5GV8A 1ZL2A 4GYJA 3TBHA 5HTOA 2XXAA 4TZ0A 1Z38A 1DX4A 3RB8A 5K05A 1KJZA 1GPWB 3PTZA 2H1SA 5DCUA 4O3FA 3AIKA 3GW8A 4CTJA 1GTVA 1JJBA 1H2XA 2A9OA 4TZTA 4ILKA 4RD2A 3B89A 1G9TA 3G9QA 2X2EA 3N2LA 4I4TA 5BR7A 2JAWA 4BFYA 5E2BA 2YWFA 2Q1TA 5E6SB 3SX2A 2JCGA 3AHFA 3WADA 2VUIB 1IIBA 4HZGA 3DPSA 1KZ9A 5H3CA 1P2TA 1VHQA 2TECE 4AZSA 1NPDA 4HNTA 2FW0A 1JKMA 1C9NA 1DDOA 1LJUA 1WAMA 2MHCA 3QVOA 4PZUA 5JD3A 4ASUD 1RM4A 2VOEA 1JG4A 2G72A 3UJ6A 1ZMTA 2AX4A 4AUKA 5IKOA 3L1UA 2Y3IA 2WR8A 3KTOA 2Y4OA 5C35A 2N75A 1WZCA 1DKQA 1JHAA 1JFFA 2PNFA 3P5SA 2O8FA 3GJ8A 2M32A 2BBWA 1XDGA 2VRNA 4P3YA 2G5GX 13PKA 4HB0A 3AY6A 2QUZA 1FZTA 4Z99A 4AKHA 1XTTA 1ODKA 4YH1A 4DCCA 4E2XA 1V37A 1BE0A 4GEKA 4B3TB 1BFKA 2FLWA 2TYSB 2C94A 4C5BA 2XTJA 5C8XA 2Q1WA 2V6IA 4RXMA 5EXTA 2I4NA 1DKRA 2G36A 3B6ZA 3K1TA 1SXGA 3ENQA 3OSUA 4A0RA 4AMYA 1GGEA 3IKVA 4HDCA 3GLIE 1LLUA 3W8FA 3JPWA 3D6MA 3M6WA 3D8BA 4MQEA 1OXVA 2AQ8A 1K06A 2Q28A 4LDZA 5K0FA 3BFPA 1OH7A 3HKBB 3NIBA 1JEYB 3RV4A 3PRYA 3ZI7A 5ARCA 1JMYA 5J9FA 1KY3A 3A9UA 1JDBC 3R1IA 4YAGA 4OM7A 4Z51A 4ZQHA 3HCAA 4B6FA 1ZXLA 1E8MA 4OQDA 2DFKB 4FWIB 4R2JA 4PIPA 5I8WA 2FH5B 3IMFA 4UC0A 1OXBB 4MDHA 4L76A 1BDIA 3UMVA 1I6LA 3N3BC 2OHFA 3DE0X 4B84A 3QK7A 4MV1A 3CS3A 3WKEA 1NVGA 3I05A 1RPJA 4KWHA 4PX3A 3WZ2A 4M9QA 1M5RA 2BEJA 4J0EA 1ZVQA 4BDTA 1FFGA 3A9SA 4KG7A 4MGEA 1U0OC 3P2KA 2EKPA 3EVBA 2PJRA 4YQEA 5BN1A 1K0FA 4ZI2A 1GV1A 3DDHA 5CVCA 3EPHA 2XE6A 4R1LA 4AY6A 4HDRB 4EYSA 3MT9A 3C16C 3FM9A 2IYLD 4TKUA 4TTAA 2PG3A 1H0SA 1QGZA 2BGTA 3K5WA 4KVFA 5CCDA 2HYIC 4Y2PA 4JI5B 5FAKA 2ZJYA 3RO7A 4WTOA 4RHXA 1LNSA 2C2OA 3BKWA 3CRW1 1VGRA 1N3YA 3EGOA 3K5HA 4OQYA 3RKRA 2V1XA 4YUWA 5F77A 3ZI0A 5JSHA 2BMVA 1RTTA 3TEJA 2CWDA 2I8CA 1R4MA 3SDZA 4CLOB 1ZD9A 5C7IO 3EIXA 1G20E 1EX7A 1AKYA 2PKRA 3MMNA 1FFWA 4QXOA 2YWDA 4IMRA 5C1BA 2UUBB 3A4TA 2IXGA 5GZ1A 4S24A 1G7CA 2X9GA 3RADC 2BR5A 4ZIRA 2O8VA 1MUUA 1PJBA 1D8TA 1EGVB 3RTCA 1H4VB 1ACMA 3P2MA 4P5DA 4TYWA 4KUGA 4N5DA 5ENVA 4H77A 3LTEA 1KBQA 3GEGA 3CX8A 3OE1A 3UMBA 4C6RA 3OU7A 5FUQA 3EJWA 1KRXA 2ATEA 1DWUA 2CXRA 2IHTA 2Z58A 4I81A 3PL5A 2B69A 4RVNA 4H1UA 3TM5A 2J5RA 1G5FA 1J5PA 3TQOA 5TPWB 2C2GA 1TVCA 1SQGA 2OCPA 4OQZA 3C85A 1XVUA 3FOAA 1Y1KE 2WHRA 3G59A 3VI4B 3ZX4A 4EQ6A 3DE3X 4ECEA 1YO6A 2E4AA 1Y1QA 2OECA 2VSFA 4UNPA 5AOAA 5KNDH 1MTOA 3NHFA 2OZEA 3QUAA 1EXMA 4MO2A 3GH3A 1Z0ZA 3RWMB 3ZDZB 5MGBA 4G23A 4JOCA 1K2VN 4H27A 4D9BA 4RGYA 2B1IA 5FR1A 3F6CA 3PD0A 2BM1A 5DNDA 3URMA 2KS6A 1F0PA 4DMLA 5EXEA 2GJ4A 2OV1A 2YXLA 4GL2A 1KC1A 1E1YA 1P0QA 1QV9A 3TAXA 4CETA 3MELA 4OJMX 3K0BA 1F60A 1HF3A 3PHJA 3JR7A 4H6VA 4Z7NB 2QL5A 4BEBA 4F8YA 3DLHA 5BVGB 4TTPA 1L8LA 5C0OE 1MQ9A 3IV6A 3WIEA 2IWRA 2A33A 4A26A 1FUEA 3BGSA 2FPUA 2GN9A 3GT7A 3NHZA 3M2PA 3UJBA 3VOBA 4B0PA 4XRGA 2J4CA 5TMEA 1JW9B 4ESOA 4ZEWA 3OESA 4DDWA 2ZYDA 3OOYA 1XC7A 2OYSA 4G0YA 2VBGA 4EBFA 2PKCA 2PZLA 4IXTA 2VH2A 4BCDA 3C48A 4E1AA 1AV6A 3OZ7A 1NE7A 4OHZA 4JQSA 2QE6A 4TWJA 1I2AA 4HGRA 5D86A 3FGZA 4IDGA 3MPOA 1FFBA 3PGJA 3LLUA 4Z8XA 1Q0PA 5C8ZA 1PGJA 4YJ3A 3BX1A 1VGQA 3WX0A 1F3OA 2HWYA 4G0OA 1JS1X 1NW4A 3RASA 3HGQA 4O4IF 3DKRA 1IFXA 3LT4A 5MHTA 5J59A 2G9UA 4DNXA 4DSTA 2HSGA 2BZ1A 2G77B 3HLTA 4MZXA 1TA9A 2QI9F 4HH4A 4O33A 2GEDA 3B20A 4NVRA 4U7TB 2IEGA 5KMGB 1ZNZA 3ASVA 1NW3A 4AF8A 3BWBA 1K7CA 3GFFA 3ZGVA 4GOND 5JO9A 1GGKA 3ZHVA 2G28A 5CIQA 2BFAA 3AEKA 4MV3A 1W36C 4DR4B 4RQUA 2WSIA 1DC8A 3HEBA 1Y34E 4R81A 2QD2A 4IUBS 1OAOC 4NNJA 2AD5A 4XM1A 1Z2AA 3AR8A 2NUAA 4FGZA 3N70A 3Q10A 1NSTA 1QO0A 2XEXA 5K45A 2VT7A 4DEYA 2CW5A 3TH5A 2W6ZA 3PT9A 1JKJA 2I71A 2WP0A 3GLHA 4FYWA 3NYIA 4DXHA 5MN5A 1ZO8A 3S2GA 8GPBA 3OZXA 4DPLA 3O94A 4UEJA 1YZLA 4J3NA 1MX1A 4FYJA 4Z5XA 5JXWA 4MS1A 1I3LA 4HQOA 3VTFA 5L3VA 4ITUA 4LDPA 3H0CA 5KNCH 1X7XB 2C3UA 2QJWA 3CT4A 3MQFA 3TKLA 3ANNA 3TQCA 1J1UA 2CXPA 1H23A 3DT6A 3EH1A 3LD9A 3MCVA 2A5JA 1F2TB 1A4XA 3QELA 2Z98A 3H5IA 2QZZA 4EYQA 1SM4A 4JB0A 1KR5A 5IDYA 3E61A 5BNTA 4IKPA 1VG1A 3ZEIA 3NG1A 1XD2A 4X92A 5IHPA 2PD3A 4PLFA 4TTTS 3ZTTA 4UM9D 3I62A 3W4JA 2JEYA 4LYYA 3FPGA 4S1TA 4XLTA 2GTIA 4WPGA 5CB0A 5MFZA 4EVQA 4CUKA 2XMDA 4LXUA 5JC1A 1WMEA 4XUCA 1ZSNA 4ENWA 1U11A 3CH7A 2FG6C 2AI1A 1BHQ1 3H1BA 2WJVA 4KRGA 4ER5A 5JNUA 5LL6P 1VLVA 1JVSA 3Q15C 5AFSA 1T36A 2FRDC 4C14A 4D9CA 1PQPA 2VXBA 4X45A 5KQPA 1L5KA 1SZPA 3OMXA 4WKGA 4ZQGA 1CG6A 4CM9D 5K8CA 2GRAA 4WZBB 5JZBA 3ND6A 4DHEA 1MZPA 3SXPA 4KFCA 4F93B 1G16A 2ACEA 3C8HA 1U04A 1PK9A 1OI3A 2OCGA 3AR6A 4FEEA 3UV3A 3L79A 1CQXA 1YI8A 1KMCA 2I1QA 2JFGA 4MAMA 5IAAA 2OBNA 5CTJA 3SR3A 4EF6A 1TM5E 2FOXA 2O48X 5JPDA 1MEJA 3P0EA 2UYHA 4YT4A 5JY1A 5ALNA 4QYIA 1L4BA 4XIGS 5EJ7A 1T8PA 2P77A 3K9LA 1FSGA 2FFBA 5ADHA 3CKMA 2RAPA 4IX1A 5IJAA 4YX9A 4GYKA 5LSAA 4KVZA 3K1JA 3T7IA 3LL7A 3HV2A 1KI6B 2YWRA 4PQEA 4U2DA 3DD1A 2F8LA 3AF4A 5BVHA 2VTKA 3AL2A 2Q46A 5IVIA 2QRLA 4LV8B 3WAGA 2YN4A 2BFDB 4CHTA 2FMIA 3AZPA 3KAKA 4IUYA 3TTSA 2JLAA 2WSYB 1NVAA 4KGDA 3UUGA 3ZV6A 1E60A 4JB8A 5AOCA 3E3LA 2UZIR 3RS5A 4LW8A 5EWJB 2J85A 2P9QA 2VYNA 1E66A 3A4MA 3KR1A 4LZNA 1J2YA 3R3WA 3C3MA 4EJ6A 1HOTA 3UHAA 4P32A 1NXOA 4KUEA 1QB8A 3A4VA 3S2UA 4BGDA 3CH5A 2VTEA 3OA0A 4OQPA 5E1BA 2BDEA 3HRKA 5I9SA 3I2YX 5TQJA 4E08A 4XTCS 1IBRA 2FMXA 1W2WB 3GLIB 2ZKLA 4LECA 2G4CA 4DC9A 3L0SA 5IBRA 4DV7B 1QIFA 4HDMA 4ZVNA 3CZPA 1DCKA 4DBLE 1FS6A 4EUSA 3FTNA 3ZE1B 4GBGA 5KHLB 4A0SA 2PRKA 1COWD 3I5AA 2GCIA 2BKLA 3V7NA 3JWJA 3VSBA 2XGSA 2Y0PA 3ADOA 2RGWA 1CTQA 3Q7SA 4NPAA 3PJRA 3NHBA 3DTNA 3SKYA 3ETHA 1NE2A 2WJIA 3U0VA 1N25A 4LBVA 3L6RA 4FN5A 4KQWA 3EXAA 3UTCA 1UAGA 3QW2A 4M8NE 4R3UC 3RIGA 1GAJA 4TRJA 4X9XA 1TEHA 5FA5A 1QP7A 3DS8A 5DB4A 2DHQA 1QIGA 2GXUA 4B3CA 2QRKA 5BPFA 3ZQKA 2VXCA 2DU8A 2GEJA 2NXWA 4BC1A 4N41A 1QOQB 1X1EA 1I01A 1XJWA 1H8EA 1K8ZB 3FAZA 1IWPB 1FCJA 4MLDA 4BJ5A 1DRWA 1NOJA 2AFRA 4EGCB 4BMOB 1ZRHA 2AS0A 2MR5A 3OEHD 2E89A 4OREX 4PY2A 4QUAA 4TOIA 1HK7A 1C9JA 3UQYS 2IHYA 3FWHA 3RIHA 4BO4A 2ZCJA 3RUEA 3FLBA 5G1NA 1EDDA 1GU7A 1XTZA 2GD6A 1T1GA 2AFIE 3JQDA 2E5FA 4N5NA 3SSMA 3PFWO 4YQYA 2JCSA 1DBQA 2EF1A 4J1NA 1QFSA 2FKNA 1C3JA 1OBHA 4X97A 2OQVA 4CF4A 3AJDA 1G20B 3ETGA 4PW0A 5FL7A 2B6HA 4PS1A 1NBMD 1QX4A 1IN1A 1VLJA 3C3AA 4D0GA 2FPGA 3L8DA 4ZJYA 3BB3A 3FPCA 4JBWA 4BJ6A 1QTIA 4K9PA 1ZH0A 4BX3A 4EY3A 3SS8A 1IBLB 1CR0A 1KAEA 2Q21A 1FMCA 2D7DA 1Z88A 3PUZA 1Q92A 3HCFA 1ELOA 4EK9A 4MWEA 1Y6RA 3EC1A 1GFIA 1LDGA 2A2ZA 2V0CA 1G66A 2R6R1 3DTVA 3HB0A 4G4SO 1CUYA 1NUUA 3HJUA 3NETA 4TWZA 3STVA 4TT3A 3KSAC 3EBOA 3P9SA 2ZWPA 4QRDA 5K2OA 3K1YA 4YXWD 1W4LA 3JATA 5T4BA 4ZYWA 1VL2A 2B4RO 4XVUA 4ZHQA 4DMUB 2P4HX 5AJVB 3EEQA 3JQBC 3D7LA 3LPMA 5HJ5A 4YIHA 3AIIA 5TR9A 4P7FA 1OLXB 1M6VA 2I4IA 2R8EA 3DULA 4IVNA 3S29A 1F8GA 3Q7EA 3EZ2A 3GPCA 4RHUA 4EWLA 1OY1A 4Z4EA 5ALOA 4J7XA 4IG9A 4O1MA 4UEKA 5K99A 2A8YA 1EM8A 1MB4A 3K32A 2VDQB 3EMBA 2X5OA 1A69A 1SN7A 3ROGA 4JXZA 4W8HA 1M72A 1E7WA 1E2BA 2PKXA 4KQ6A 4ARBA 3AOEC 1SIBE 2G09A 2X7HA 3HM2A 3K1ZA 3U81A 3DMHA 3PLAE 3B1JA 5ANRB 2IUFA 4ZREA 5JG7A 5AI6A 3UJPA 4EF4A 4WBNA 3MS2A 3QY9A 1GPNA 2G88A 1AG9A 3UMFA 3EDQA 1CY6A 3QBDA 3TLXA 5GTDA 3U6KA 3N0WA 1BCRB 3RE1A 3AW9A 4LE0A 1PX0A 1QH1B 3S2YA 1CJBA 2IZ0A 3P4YA 3NANA 4EHKA 5KNCD 1GUBA 1TYEB 1X7YB 1EG7A 2ZPUA 4NG4A 4PWZA 3L8FA 1A7JA 3JPYA 4MW6A 3R8CA 3W05A 4DJ5X 1SOMA 4Q4HA 2GTHA 4PPGA 3W2FA 5EHQA 3CX7A 2PMKA 1ZM4A 3TYXA 4MULA 2A92A 2AB0A 3HSYA 3E4DA 4QYTA 4AZ0B 4CGYA 1UT8A 4C7JA 4CN9A 1WZIA 2FQ1A 1YRQA 3MCTA 5IAOA 2A7XA 1XQ6A 2QHXA 3MGCA 5LCXA 4BVFA 2JD0A 4HFNA 4QXRA 1L4GA 5ALFA 3B3GA 3DB1A 2BDTA 1W7AA 5KWIA 3HJTA 3PZBA 4ZVMA 2E55A 1UJBA 3QY0A 1TDJA 4WZZA 3ZLBA 4KACA 3IUMA 4KN6A 3TI7A 1VHJA 1G8GA 1ZOSA 4K0KB 4BZWA 4IQ0A 2GXQA 2DZDA 2XB9A 3D0KA 1XTKA 2ZSIA 3NZEA 1U65A 4PYIA 2NUBA 3PJFA 3LF1A 5EXDA 2H1HA 2IHKA 2PUWA 4GPAA 3KVNA 5ALHA 4DGSA 2QAGC 4PZPA 5BMVB 1U6JA 4CM4B 4AP6A 4JJEA 4MVJF 1NQTA 1PEKE 2IP4A 5CFQA 1VM6A 5BQXA 4E5YA 2CLIB 4OXXA 3GX1A 1JPNA 3PSAA 1P0PA 3T54A 1XX6A 1LVHA 1RLIA 1ZZEA 4L7VA 4TLDA 4FLEA 3DAGA 4DVGA 4MVWA 3JARB 3TK1A 4DXDA 1GILA 5AM4A 1EVJA 4HQLA 1QP4A 1A5BB 2VPZA 2RH5A 2O4UX 3T9EA 3RRYA 4OA8A 1ARZA 1GZ5A 3EUEA 4MRNA 4CKXA 1R0XA 2HA7A 2WZQA 3KL2A 1Z25A 2JFUA 3OX2A 4CODB 4KXFB 3IESA 4HMPA 4KPEC 5C1OA 1Y3HA 5BNIA 2NUPB 1OT5A 1DLJA 2Z2IA 2NU6A 2Q3MA 3I6IA 4BS9A 5ALSA 2Z5FA 3OZBA 2NU8B 2QRMA 4HS9A 2VKTA 4DHWA 5JHHB 3GLFB 1UKCA 4P9NA 5CYGA 3KOXA 4YCJA 4YTEA 4GPIB 4PZ9A 1ONOA 2XXJA 4HYYA 1Y6QA 1ISHA 2AK2A 2JIMA 1L1RA 1U3FA 2YS7A 1OX5A 4FONA 1SGWA 3HBLA 3K8YA 4LY6A 4RPJA 1WSWA 4EKGA 5JROA 3CRQA 4Y1GA 4UMEA 4OSEA 3SFZA 3RARA 4YRKA 2XRFA 3M2TA 2WWFA 3K9HA 1ESMA 3SYRA 3ZHOA 9LDTA 2VNJA 1XCGB 2O6LA 2YNMA 2HY7A 3KG2A 4Y7DA 4RVDA 2V7BA 4MKFA 3ZEAA 4URVR 1A9SA 2OXEA 4US2R 1CE8B 2CLFB 1ORRA 2HSZA 3G9UA 2P2NA 2N1BA 2IUTA 5A9RA 2V1UA 1YZUA 1WIWA 2QNRA 1IAQA 4U0KA 2MINB 5KNBD 1Z5ZA 5KOJB 3D4BA 3QV1A 4KMMA 4PZ0A 4B6GA 5JJIA 4JLAA 821PA 2R3SA 5JVDF 3L0PA 2VJDA 5F9FA 1QCZA 3FUVA 3MT0A 3WK9A 3MOGA 3OIVA 4C30A 5AP9A 5KOHA 2DPYA 3LO5A 4IXMA 1FU8A 4GIBA 4PSVA 4XUGB 4K9QA 4RAOA 2Q6KA 2XUFA 1TO1E 3UJ3X 4C7OB 4M0CA 3PR2B 4M76B 1LPSA 3DBLB 1KSHA 3AFNA 4AX4A 5JI2E 1TKRA 1BDHA 4XRRA 4V3CA 1K63A 1MEOA 3KPVA 3CH4B 5KKAA 1MA0A 1GNTA 3UOAB 5K3FB 3UK0A 2WUDA 4PHFA 4ZO7A 5CLLA 3OZRA 1E1CA 3FUWA 4R9VA 2A35A 4MV8A 3DG9A 4KPFC 5L9AA 1UMCB 4NPCA 2XOXA 2ODAA 3K31A 5JSFA 4DZZA 3BHNA 4HDNB 2F4NA 2WTEA 4JD5A 5CU7A 2RGNA 1UWVA 2I6GA 2P0AA 3W5DA 4JCOA 3RKUA 3LIPA 3NP7A 1Z3IX 3GRVA 4RTNA 4L3WA 4EHJA 2H29A 5DHSA 4A6DA 1JA1A 4JIMA 4OK5A 2FLVA 3DV0A 5A4JA 2JJQA 5F7JA 4LI0A 5I7OA 2Q1XA 4HNUA 3VSDA 2Q5HA 3UM9A 2WUGA 3CJTA 3E9CA 4QOEA 5CW1A 1OV4A 4GKAA 3UBMA 3B6KA 3SM9A 3TD9A 4I9UA 1T2NA 1YB4A 3DW1X 4BX8A 4CMEA 5B3KA 3OMWA 1LS1A 3RFUA 2H63A 3SBOA 5IXSA 4J7AA 4KDEA 4F2PA 1E99A 1KMIY 1CQJB 1SVIA 1SU8A 1R27A 1YR7A 3D3KA 4U1RA 4G86A 2HJRA 2VPPA 1C4OA 3OOSA 3T8YA 3F73A 3D1JA 4DR7B 5LYJB 1I4EB 1X2EA 3CUEF 4KFTA 3F6BX 5B5SA 4RDXA 3GZTB 3SZLA 1WA5A 2H2GA 2WTAA 1P44A 1GEEA 4Y0VA 5EMJA 1EGAA 4D92A 3H1PA 3WRWA 2HMYB 3RU2A 1C3XA 1Z2NX 3FCSB 4S1NA 3U26A 2ZUDA 4XR9A 2FW1A 2Z5VA 2Y4NA 1DLIA 2MOKA 5B64A 1M7GA 2ZB4A 3BRSA 3JALB 1U7TA 1KORA 3WLSA 2QU7A 4L6CA 1G21E 3BSFA 1SIWA 5JJKA 4RYDA 1E63A 1CZKA 2WOOA 3Q4GA 3SS7X 1EA5A 2JEZA 4EM6A 1P81A 5KYXA 4IIVA 3NAZA 3TNLA 5ESWA 4HX9A 2J31A 3QM1A 5CBPA 4ERNA 2VJAA 3M9XA 2VZ8A 4UZSA 5DV9A 1CR4A 1J06A 5ELXA 1IC6A 2FMHA 1HKHA 3GPIA 4MLZA 4Z49A 2AFIB 3CWQA 3B6EA 1HGXA 2EJUA 2OD7A 1H2RS 3DWIA 4JT9A 4OXNA 2ZJ7A 4YGXB 8MHTA 2XEDA 1HLFA 1ZN8A 5K20A 2OAP1 4EHNA 4RDHA 1XP5A 2CUKA 1JQLB 2DTDA 4E70A 4M9SA 2YZ7A 4X7PA 4RZXA 2JHGA 3FCOA 1U3WA 1UIRA 3GO4A 4MVJM 3ETLA 4CHGA 1F17A 2D13A 4TL9A 2KW5A 1VBFA 3W1VA 3BAFA 3I1JA 4YACA 1GWNA 1E3SA 3TZHA 1SG6A 1SRQA 3MWGA 4A92A 4D4HA 1L5OA 1CUHA 2DT5A 1Y8AA 2YKGA 4L08A 3UA3A 5CB6A 1OYYA 4JP5A 1V8FA 1F8YA 3R40A 2QMYA 4MO9A 3NWBA 2XMQA 4TLLB 3NHJA 4YAWA 1P8AA 4RZIA 3IIKA 2WK1A 3V9PA 5A2QA 4UU0A 2QLTA 1L5RA 1JAHA 1PFVA 1QHNA 4IYJA 3BCRA 3DQZA 3D7SA 5AQ1A 1P1FA 1XZCA 1E1QA 1ZI6A 5AHOA 3UJDA 1K9SA 4DEXA 1HE2A 1F51E 1VDZA 1QJ4A 3CRMA 4KXXA 1M2KA 1WCIB 1ZM9A 4NC9A 4K6GA 3W5UA 4CQMB 2OCAA 1O2DA 1YH3A 2Q50A 2GAFA 2PGDA 3H11B 1EXWA 4QGBA 2YYAA 5JPCA 5G0VA 1E7MA 2WA2A 2QTGA 3LFUA 1A4IA 4Q6BA 2W93A 3GN2A 4JLJA 5FQNA 5LQCA 4RVUA 2PGJA 1W5TA 2DY1A 2GPWA 2WJAA 3ROEA 5IJ0B 1I7SB 4Q47A 4AQYB 1TOAA 4IDPA 3WGIA 1R18A 4LHZA 2W2TA 5B2FA 3AF3A 2W2LD 4PZDA 1O94A 4D97A 4UU1A 1WDKA 4AFNA 4QSMA 4DV6B 1VG8A 2L69A 3UOGA 1G7TA 4H18A 4OP3A 4TMVA 3CF2A 5GOTA 2ZUTA 4P98A 5JEEA 1XNJA 2CFRA 2V6MA 3NWPA 1I10A 1D9ZA 1DAGA 1G98A 3NVDA 4HAOA 3E6AA 4N8EA 2HA3A 3R7WA 4DYDA 3LRTA 1E2LA 2CYCA 2DECA 4R8LA 3U0BA 2FDCA 5JZSA 1RWVA 4GSLA 3S1AA 1PEDA 3VQTA 3BEOA 3GL9A 1KVSA 4FBMA 3QJ5A 2BZ0A 4OQXA 4Z9BA 2G83A 4PR0A 5NLLA 2AJTA 2II6A 2QL7A 4P5PA 5LXTF 1DKLA 3WOHA 4DA7A 3GGDA 4QNMA 3OICA 2QTVB 3EPKA 2GM9A 4KX3A 2AHOA 2ZB2A 3ZHUA 3JQPA 3KWFA 2PLRA 4EHAA 3UPUA 3K0CC 4GXRA 1LV8A 1IHPA 4DR5B 2Y71A 4MROA 4HAYA 1K7XB 5EGSA 3GYGA 4ZQFA 3WXMA 5I7FA 4NZOA 5MN4A 3AR2A 4B3RB 4ZVTA 3D3EA 1RBZA 2X2OA 3D2CA 2J5QA 4RMIA 3VO1A 1F2UA 3AVXA 4L8WB 1DRVA 1DCFA 5DTJA 4E21A 3P96A 4URHA 4XAQA 4WL0A 4CM7A 1NA5A 4DIBA 1M6HA 1V7ZA 4R1TA 5BOSA 3I34X 4OP2A 1P0FA 3JRXA 2R6GA 4C08A 1YQEA 5DRYA 3EEFA 3VJMA 3GPLA 3KYCB 3EVAA 5EJ5A 1EWRA 4S35A 1KP9A 5F1YA 5FTLA 5ALGA 3CVXA 2BTQA 2GZHA 1G3MA 4EL0A 1YUNA 4U00A 3GEHA 1SU7A 3T1OA 3GUZA 1QK3A 1FX0B 4IIJA 1XTPA 4MLPA 3GAZA 1G6OA 3E15A 4XFKA 2FY8A 3CO5A 1VG0B 3HJGA 1KYTA 3PKZA 1OILA 1XE3A 3RU9A 4DOMA 2LCFA 2WI8A 4IJKA 2JGEA 4Y6GB 4CF7A 3LNCA 1EFPA 5D87A 5T5QA 3WL3A 1UAAA 3NEJA 3Q8MA 3MLEA 2B4YA 1BA3A 1KGDA 1U0SY 1BE8A 4LY0A 4Q7QA 1N3LA 4NECA 3D4NA 4RJIA 3E8MA 1W4ZA 4BAUA 3AR7A 2I1LA 3ZW7A 3P0FA 3P0HA 4KBGA 1E77A 4P6VF 4ARSA 3VHLB 4BKPA 1XLVA 4DCOA 1GPH1 2G08A 2FSFA 2GSWA 2ZAMA 3V3TA 2ERCA 3C3JA 1I5OA 5EQJB 3HE3A 2HQOA 2YVQA 4RDIA 3WGZA 3GXOA 5CDGA 1XVIA 2YRWA 1ADFA 3KRTA 3LC0A 4MAFA 4RIIA 3OSZA 4IICA 4DLLA 4NCBA 1PG2A 1E2MA 1N2BA 3TB4A 1FFCA 1P9OA 4ZT7A 2A9QA 4P7BA 2ZJ3A 3G6WA 3E9NA 3I04M 3KU1A 3EASA 2QENA 5B7NA 1VJCA 1BU5A 3QU5A 1V4BA 1U5CA 2BE7A 3FETA 3BD7A 3VZDA 5TT1A 1G18A 1R16A 4Q6WA 3PXAA 4XVCA 1MJHA 1UOQA 3TZBA 2AR7A 3E22A 4YECA 1GT91 4IO0A 1E3IA 3IKLA 4LDAA 4TSFA 3VR0A 4MIEA 1YQWA 4F3KA 4EY8A 2HZBA 2WLSA 2X22A 3QZUA 4TXMA 2IC5A 4DZRA 3OQPA 1CFJA 3IQXA 3UENA 3MBIA 4BWFB 4PR3A 2QL6A 3AEQA 1JHOA 1FJ2A 5E3IA 2HMTA 5E2IA 3ZJ5A 2M6LA 3C39A 4P1ZA 4ZU6X 1FDRA 4QUHA 3IV7A 1K88A 1IZ7A 2R1UA 2F6RA 4W5WA 1HNXB 3CY6A 1E79D 1G2OA 1UBNA 1WXHA 2QVBA 4OA5A 4PYKA 4BZZA 1AMOA 4MICA 2FFAA 1D2HA 3O3OB 2FZWA 1P1JA 1RRVA 1U3GA 3D31A 4DILA 3U4QB 1YJBA 3D5TA 1EKXA 4F3CA 1RYZA 2DWOA 4JEUA 5CX4A 4A23A 5EHIA 4OHVA 2O2ZA 1BOFA 5L6MB 5DX0A 3D7RA 1NNUA 3QF4B 521PA 3THYB 4N5MA 5EJ9A 1ND5A 2ONJA 1ETUA 2AJBA 3IUPA 3CF0A 4O4IA 1LK7A 1R6TA 3HH8A 2LCQA 3UW3A 4JYPA 4NQRA 1EK2A 3C87A 4FLFA 4ABTA 3HDHA 5TE9A 5BSVA 1YBAA 2EYQA 2OQ2A 1E1KA 3JQ8B 4G0QA 5TQ0B 2FVXA 2H4JA 3VPAA 4P38A 3NATA 2YXDA 2Y6UA 3LT0A 3T9CA 1GCIA 4HNQA 1RRGA 1ZK4A 1YSCA 1CDEA 1E61A 1N0IA 3IAUA 3PKIA 3W7VA 1D04A 3ZLTA 4BNDB 4MJ7A 2B78A 1SCJA 4KLCA 3THXB 2I5PO 4E94A 2GEBA 4UVIA 1ND6A 2BHRA 4ER3A 3H16A 4RKEA 1FFXB 5DBHX 5JZ9A 2ZUCA 4AJ9A 2BKUA 3A9WA 4YUXA 3EQZA 5IFLA 5EE0A 3WGGA 2GCGA 2H17A 4B74A 1B0AA 5LQNA 4NYMR 4J1TC 1C4WA 1CSEE 1G21B 1BAPA 4ND6A 1WMFA 2PAFA 1HYQA 4M22A 4BN0A 2XQFA 4M0UA 2AJ8A 1RKUA 2HWKA 3GEBA 3WKDA 1KPGA 4I55B 3ORRA 1EEXB 1QK4A 3IOEA 4RGBA 4YAJA 1D0IA 4BMCA 4KYIB 4I50B 1NOIA 3O73A 1OXSC 2JGIA 4MPRA 5FA8A 3RYHB 4E3WA 4C04A 5I4IA 2CXSA 4TRRA 5JYBA 1DOZA 1XRRA 3GZNA 1KMQA 2O7RA 4GE3A 4CDRA 1ESDA 4B0OA 4B7AA 1FU4A 1ANKA 5C46F 3F9RA 4XSHA 5J4KA 2UUOA 1O87A 4XGRA 2H4HA 3TE7A 1W96A 2PYZA 2VP6A 3PWZA 5F35A 2QW1A 3QI7A 1XVTA 2C77A 1SXPA 4CEIA 1SBZA 1RHRA 2V4ZA 3B7PA 3R4VA 5L3QB 2B4QA 2QD5A 3I0ZA 4IGFA 4U3JA 4XQEA 2DEUA 1EP3B 2H9IA 1BS2A 3FOWA 3I2JA 1UOPA 2H85A 3H99A 3PUIA 4M1ZA 2ZE5A 4DMKA 1VE6A 3ASUA 3KLPX 1OR8A 4PSUA 5TT0A 1J49A 1W1WA 3KSBC 4R51A 5I4BA 2XCOA 2P62A 3IJPA 4X95A 3U7QA 5BNZA 3W7BA 5IH7A 4DV3B 4ARZA 4FXPA 4IDFA 2VUTA 3G85A 4XWGA 2IP1A 4M0PA 1F06A 3L1KA 3K92A 4O1IA 1YHNA 4N0DA 4G63A 4MUKA 1JG1A 4AS1A 2OFXA 2BEWA 3LX4A 3EQ2A 4B3XA 1VLQA 3WGLA 4A8PA 3CUYA 5HUQA 1L4MA 1ECCA 1UKBA 1G291 4K87A 1PL0A 5D8DA 4NK4A 4XPIA 3MTIA 4IPTA 2FRXA 4AURA 1G1MA 4IDQA 4LRYA 4LVOA 1ETHA 3E1SA 4D9EA 1BD3A 3F71A 3A31A 2RJOA 5IJ9A 1Y8CA 3ZU2A 4QU9A 3B53X 2M6RA 2OZLB 1OLSA 3HB5X 3JQ9C 3THWB 3PWTA 4HLNA 1K7YA 1S3SA 2HXSA 4GF5A 2CVHA 4L74A 1K6XA 5F33A 1P4JA 1FYDA 3PXCX 3HDJA 3LUBA 4ZDIA 1WSDA 3JTEA 3D7KA 3LJKA 2NT3A 2Q2WA 1NC3A 3QLUA 1W9MA 3MTQA 4C06A 1CQPA 2QX9A 1AMNA 4BFTA 2CF6A 1O89A 2CNWA 2Q3HA 3NP9A 5A3QA 4E32A 3HB9A 3GGOA 1KRWA 1HLPA 2E1PA 5CK5A 3WGUA 5FBZA 3WNDA 2Q0SA 3CSSA 4LI3X 4HRYA 3RYCA 1WW8A 1X0XA 2BL4A 1A8SA 4JP8A 4HVLA 2P5TB 4YRMA 3UHPA 1G0NA 1TCAA 1IHXA 1D5CA 2ZBDA 2JL1A 1Q50A 4DM3A 2DOKA 2DUUA 1Y9EA 2FFJA 3VVCA 2GS9A 3NBYC 4I19A 2RBEA 5BWBA 4EDFA 1ESCA 3N5CA 3PWSA 4K6HA 4KPGA 2WAMA 4OHUA 1IMOA 5T67A 4HDOB 3CMMA 3FDJA 4EO4A 5I9TA 1K8QA 3F0TA 4PNEA 1KMMA 2RGRA 3MK31 1W36D 3J7TA 4CCAA 2BCJQ 1CQZA 1QYXA 2LRHA 3FLEA 1M0EA 3HL0A 4NJMB 1LEHA 2RHWA 3BFKA 3NV9A 3VBEA 5HZMA 1J24A 3PQ5A 4XCQA 2OKGA 1KEEB 4B79A 1IBMB 4MVJI 2P6RA 4KRYA 4XX0B 5KJEA 5C7OO 4E5PA 3QQ5A 4Q1EA 4G0UA 4P83A 1E5XA 4OMCA 5AM1A 4C78A 3IUSA 3M3HA 4B47A 2IU4A 3A27A 1E9EA 2EL7A 3HRIA 4U9UA 4ED9A 4W5OA 1RXSA 1Y7TA 4UHFA 1A04A 3DAYA 1U6KA 1ZJ6A 3RH0A 5JOQA 1M2OA 3H3FA 4JI0B 4KOAA 3N28A 3UW1A 1PW5A 1XYYA 4UM9B 2UZ0A 4RH0A 3I9OA 2AH5A 4CTOA 1ZD3A 4IJ6A 5ALWA 5C5IA 2VP9A 1VPDA 2YXBA 2A3RA 1S3IA 2QSYA 1ESEA 1T4BA 4Q12A 1R9JA 4G0XA 5IYZF 2DGDA 4LF5B 1R4ZA 3M4XA 3Q2OA 2DWPA 1DT5A 3OUTA 1O5TA 4IBOA 4QDZA 3ELWA 4L0QA 3OIGA 4HC4A 2BFBB 4AC9A 1NJ6A 2HDHA 2Q9AA 2WZCA 4TZ6A 3EBPA 4JGGA 2C7QA 1I4WA 1P31A 1X3SA 3B13B 3DHWC 3N58A 2GRJA 2UZ4A 3JD2A 1SUCA 5YASA 1VKNA 3ZYCA 4YYZA 2NVWA 4MWCA 3KUUA 2NX2A 1YU6A 1XVLA 3TLEA 2RB5A 1Z5WA 1QVRA 1QH8A 3NH9A 3L5OA 4I6GA 1UINA 3KAPA 2AEEA 3BJMA 2QMEA 2NADA 4X7RA 4FE3A 4X6YA 2NACA 6ADHA 3OF2A 4XUDA 3HPRA 2IHUA 2JRCA 2OCXA 4QFCA 4WZ6A 2K7ZA 2YHAA 5DI3B 2V45A 1Z83A 1UBCA 3RRJA 1XLTA 4LHXA 2FF5A 2C3PA 2AV6A 3I01A 1EFRA 1E1MA 3GU3A 1U28A 2YV5A 3KVYA 2GHQA 2VTBA 1XROA 4D26A 1GCOA 4FS8A 1UPBA 1YL6A 4RK1A 5L8VA 3RTGA 2RD2A 3IXQA 2QMOA 1NQXA 1W93A 3ACBA 4RLSA 2JZCA 1B0ZA 1CF9A 3I72A 3PQEA 3T5BA 5KYWB 4E2WA 1TPZA 3QP9A 3OQNA 4OU4A 2F62A 4B83A 3CZ9A 3MAGA 4JVOA 4LGVA 3DJFA 2P5SA 4S1WA 1E2GA 3QKRB 4MW4A 3ZJVA 3NLLA 1HURA 3MINB 1E62A 1KE1A 2C8VA 1X13A 1ZKMA 1JTFA 4R2MA 1QQTA 2QG4A 4RF5A 4CMJA 2B8WA 4FFBB 4M8KA 3GDOA 4Y6SA 1PO7A 2EW2A 3ZCUA 2O7NA 1C0PA 2PAAA 3NRBA 1ORVA 4E5KA 5D3MB 5CNKA 1LVGA 2J48A 2WPNA 2YJ3A 2ZJOA 4A6PA 2C9MA 2VF2A 3TZEA 2HF7A 3FMIA 2ISCA 3I8SA 3WL4A 4JYBA 5A7FA 3ZHQA 4R2LA 3MRTA 3RI3A 3SN6A 4PU0A 1WM1A 1V6SA 1I1HA 3ZUGA 3FNEA 2PCLA 3OHMA 1W0KA 4PZZA 4RQTA 1XTBA 4R98A 4FJ0A 3P52A 6PFKA 1C9YA 3CHYA 1EP9A 1YRLA 2YJ5A 3WJ2A 4PG7A 3MCUA 3LF2A 3MA0A 3ND5A 1E2UA 4KDCA 4US1R 5DZSA 4CR7A 2AQIA 3M6UA 2CJXA 1B6GA 3MBOA 4WOCA 5KSZA 1PZNA 2I7VA 2M98A 3B52X 3WVNA 3EG5A 4UQOA 3STWA 1SVNA 1UDAA 5CPFA 4U8GA 5FQOA 1YRBA 2P90A 3DE4X 3ZZUA 1SIUA 4MVJA 2BBTA 4DIKA 4WOBA 4Y2GA 1Z4LA 3O8QA 3DFIA 2B1RA 2W58A 1DRUA 3GQBB 1EP2B 1JLHA 2HJHA 1AH2A 4CLRA 4FDUA 4P81A 4QU0A 5CT4A 2NUTA 3RSCA 5IW8A 5F64A 4CFYA 1J2UA 1Y4ZA 4Q7MB 3WAJA 4O2AA 4LXHA 1Q1AA 1TZBA 2WWWA 1XV5A 3IP6A 3SG0A 2A4MA 4A5SA 3CNQS 3FYSA 1SK8A 3KQQA 3N0XA 5ITZB 2Q5LA 1AB6A 2J9FA 3GFTA 1BN6A 3QHQA 4GPZA 5TGTA 4DJTA 4FSDA 3FPKA 1HDYA 2V7QA 4KK4A 3KAQA 5CA0F 3TKYA 5LZ9A 5GZ6A 3OQOA 1KYXA 5CDTA 2QW8A 3NEYA 4RH3A 1GUAA 2NO1A 4WXRA 4O0MA 5JYCA 4OFWA 2CWWA 1C30A 3FI9A 3GCGA 3RTDA 4BKRA 1XNQB 2YIMA 1FY2A 1UZAA 4PTZA 4GXNA 4UUMA 5AVYA 3UUFA 5IF3A 4REQB 5JHGB 4DV1B 4AXXA 5B1EA 4DRYA 4QM6A 4BZXA 1MC8A 1XMXA 1W34A 2JK0A 4IKOA 4OMDA 3VO9A 5IZCA 5KDOA 3IMKA 3WWYA 1JTVA 2B20A 3AETA 3AI3A 1KY2A 3CM0A 2WJYA 3AQIA 3QKTA 3TQQA 3AUAA 5KINB 4CGZA 3T06B 5BP7A 3K9FC 1HDCA 5G0SA 1ZH4A 3DUFB 1L5GB 3TLGA 3C6QA 3T99A 3HO8A 2XA1A 1USGA 3GLHE 3G2HA 4PQGA 4AMUA 1QGOA 1YDMA 1GQOA 1EAYA 2O2HA 2G70A 3T7TA 3WGTA 1DXOA 4CMGA 3EPJA 3EQ6A 3OD5A 4FFMA 1FUKA 2Q6IA 1HDOA 3L6OO 5FL3A 4BU1A 2GPTA 2Y1DA 2ZJBA 4CPDA 5BWNA 3COWA 3KV1A 1JXAA 1FQOA 1ICIA 1XDUA 2QX6A 2X0EA 3C6XA 3WNVA 2OBBA 1E3TA 5JVDA 3HCDA 2GJSA 4KZPA 4CLHA 3EWSA 4IIYA 2JVJA 4Y0AA 4WWHA 3E3OA 3SJCA 1Q1QA 3ES9A 4QHYA 5ECDA 5AM0A 3D6TB 3L77A 5AW1A 3U4MA 2QBYA 3H5WA 4MEAA 1W52X 1ZGCA 2XKBA 4C4YA 3VUEA 1AKRA 4ZOCA 4AZVA 4EG6A 2P3SA 5AVOA 4A2CA 2ZUFA 4OYYA 5ALDA 2A3NA 4JBHA 4WN9B 3QIAA 3VVBA 1PVOA 1D0VA 2V03A 2XY4A 4MUNA 1J2EA 4ZKEA 1TYAE 2VO1A 2RK3A 1QZUA 2VQSA 3U17A 1J99A 4O4LB 2W2PA 3V46A 1JXOA 1BS1A 2PMWB 5FTJA 4REOA 1SZCA 4G41A 3BXFA 4QTZA 4MW5A 5HX7A 3PNOA 1G19A 4XZ3A 2RK6A 1ZSVA 1ULUA 1VDMA 2YHIB 4UU7A 4WBNF 2XXAB 3PNPA 2EJTA 4KR6A 2FUG1 1QHYA 4HZIA 3RU3A 1P5HA 1AF7A 1A27A 2GHTA 3BUSA 3QEBZ 3ER9A 1Z17A 1ZVVA 3M4ZA 1OZFA 2A94A 1R8XA 4G8CA 2HIHA 4AJHA 2F43A 3D64A 1BCSA 2GETA 2H9AA 5KWVA 2O59A 4R8RA 3F5SA 4E1BA 1TMGE 2A9KA 1F4LA 3BJZA 3N8KA 3ZNNA 1PFGA 1LH0A 2CK3D 3O1IC 2D00A 4PTYA 4ZGBA 1QTQA 5DF1A 1GGMA 2NO9A 1ZGHA 5D3ZA 1VXRA 4LIPD 4QLOA 3LHSA 2PNJA 4YRRA 1X1CA 3V8RA 2OMKA 5IT4A 2O8FB 1EZ4A 3IDZA 4E31A 3OF5A 2WIGA 1TMOA 2R7AA 3X1XA 3JVIA 1NLUA 3T7EA 2E87A 4GC9A 1KKUA 3KO8A 1HTBA 4MYHA 3CZRA 3N2NA 5BOVA 4QYWA 3OIDA 5E2AA 3K9NA 4UVGA 3ZZTA 4AJ4A 1ZCJA 4M1WA 2VQ3A 4GWGA 3HYLA 2QX4A 3QNWA 2JRLA 3RBVA 1ECFA 5B1YA 4D80A 2P9TA 2XHEA 1NX6A 4ZV7A 2HF8A 5BNFA 2BJVA 1YFJA 3KT0A 4HXEB 4I1UA 1SC1A 2H0AA 3EXEA 4EG1A 3DT9A 5TS3A 1PS0A 3OCYA 4GXQA 5E6UA 4ZCRA 3DFKA 1ZSYA 2KJQA 1L2TA 3I04A 5F73A 3TLYA 5IKXA 3K7EA 2O52A 4BUJA 4INZA 1PEAA 5LDHA 1FW6A 3WC4A 2XB2A 5K4AA 4KQEA 3RV3A 1D3AA 5H7XA 1KDZA 1PS9A 5CFRA 1DIAA 1YBMA 1OI2A 2R4UA 3NYWA 3R4CA 5K4HA 2ZR7A 3IUJA 5EIEA 1E7YA 2AYZA 1K8YB 1KS2A 1ODSA 4FBGA 2F3PA 1JEEA 4ZD6A 4JSYA 1PL6A 1VJ0A 3IAM1 3P9QA 2V7WA 4F1JA 1DCTA 1ZMRA 2WWYA 1BWSA 5HKLA 3VISA 2I9KA 4L28A 2F59A 2XUJA 3F2IA 3QUCA 5JRJA 1DQYA 2COEA 1FOEB 1BZYA 1QVVA 4XJSA 1UT6A 4C2UA 3AEXA 3FLMA 4W5NA 1HZJA 2H9YA 2RC6A 3MT8A 1O96A 4PX2A 5DHPA 3G0IA 3VGJA 4AZTA 2ZB7A 1QH0A 1NQVA 4H15A 5DM1A 5FFNA 1RAFA 3GP5A 5F5XA 3U3DA 4DCPA 3DEYX 5AT1A 4IDHA 4K2HA 3G1UA 4C22A 4UULA 4UDXX 3SJUA 2CHEA 4DT1A 2P9EA 4E5NA 1TO2E 4A73A 4HGZA 4D8VA 5HSGA 2P68A 3MMXA 3REGA 5JS2A 3FH0A 4B3JA 2B36A 1QK5A 5EPEA 2OSVA 5A7GA 1UK7A 4FDAA 1WETA 4JVSB 4X20A 4J07A 4L95C 1AO3A 4JOBA 3GH1A 4WA7A 4YUVA 2CMGA 5CB4F 1GPBA 1NDUA 1RD4A 1P0CA 3M83A 3K0AA 3TQSA 1PK7A 1JIVA 5HGJA 3KJNA 2FZ5A 1H3EA 1E3MA 1C9MA 5BSMA 4L4YA 1HDXA 4HLQB 3QVJA 2RE8A 4D4LA 1IEQA 2MSNA 2K2WA 3SE0A 4BLUA 2C2MA 2EATA 1VYVA 1J8QA 1GTJ1 5HK9A 4WY8A 2OOKA 4N5LA 3N8GA 3VU8A 2IELA 3T5DA 1BDMA 4L78A 1KE2A 3KYDB 2OCKA 2Z5GA 3K53A 5A06A 1JJIA 3FDIA 3IAFA 3OJXA 4G9GA 1QE5A 2W83A 4P33A 3TR0A 5LR6A 1IMJA 2OHGA 1F4VA 1U31A 2X19A 4FYXA 2WJGA 5JCOA 4JR0A 4BB6A 4K9NA 2IP2A 3L8HA 4R16A 3H8SA 5EE1A 5LXTA 4NCJA 1XZLA 4GW3A 4R6WA 4UMVA 2YFHA 3GJTA 1GKYA 4LYJA 3T3EA 3AERB 2M6KA 1L7EA 3KU4A 2GF2A 3IOYA 1QIEA 3LDGA 1YNSA 4PBRA 5BSEA 1L5LA 1P2DA 2DMRA 4CZ2A 4OKIA 1ZVMA 4XW2A 1Y33E 1QFMA 2HHAA 4H16A 4K05A 3M6XA 5JAQA 1RM0A 4YJ2A 2OV8A 4PTLA 4H0FA 4B4VA 5DASA 2BGWA 5DM4A 1II9A 2CCGA 2ZW9A 2LGJA 3C5WP 4R1SA 5AUOB 3QLVC 1EP1B 2BUBA 4UBIA 2H06A 1DDIA 4YJ3B 1MJGM 3W3AH 1P33A 4RHEA 4P08A 1JUDA 1OPXA 3MG9A 3EGEA 3M9LA 3IIIA 1FYVA 3MTEA 3HZHA 4HNHA 5HIMA 4F9FA 2UXBB 4R83A 5COBA 1TAUA 3E5RA 2R6AA 3Q7PA 3VOTA 4OU5A 2H2DA 1U7UA 2YUIA 4M0MA 4FEYA 4RUKA 4S0XA 2H1RA 4RK0A 1NHGA 1XNGA 3W1WA 1OH5A 4GM1A 2VQFB 2PMBA 2MTBA 3PUYA 4JJ7A 1NY6A 4OHRA 3SPXA 4C4XA 5EPOA 2VCHA 1C7FA 2O5EA 3RW9A 3SLKA 4TLEA 1MJ5A 2IV7A 1CJSA 4GLJA 4MS4A 5FNVB 1TI7A 1AQNA 4D0RA 3E9ZA 1KZ7B 4DM7A 2F55A 2QMHA 3KKOA 2UVPA 3LBYA 4ZU3A 1KYYA 1U0RA 3UBTA 1TZJA 2FHPA 5FBLB 1VPVA 1L7VC 3FD8A 4GSKA 2C4HA 4YT5A 1GUDA 2NUAB 3DCIA 4Z2AA 2GZDA 1KXZA 3W6PA 2G6TA 1MFPA 3EHDA 3CZ4A 2OM6A 4RLQA 1JKJB 1E0KA 2JGDA 3GLHB 3OZWA 4AP9A 2H1FA 4XE5A 3HXKA 1E3EA 1E20A 2JD2A 2YYZA 3SZUA 5HNKA 1ID1A 3M6IA 4JI8B 4CVNA 1PJ8A 1UBRS 2C57A 2VJPA 4MS1B 4N0QA 5KC9A 4LWQA 1BJTA 1DI0A 2DUJA 3TFOA 4I4IA 2ECQA 2XMBA 3CLTC 3F3YA 4RJJA 5LP6C 3OJOA 4TQUS 3GB9A 1ZIYA 1F38A 1VP9A 1WWKA 3GRFA 3T3DA 3QELB 2J30A 1H3FA 2C3MA 2CXTA 3B70A 4Q7KA 1X8KA 2XZTA 3KDPA 3V4OA 3MB5A 1ZS9A 3MIIA 3ZIUA 1VCHA 2WINI 3F8TA 1XZBA 4NMLA 2DTEA 5L45A 2B5OA 1GQ2A 4DYHA 4ZEXA 3WL7A 1CUFA 1C50A 3ZY4A 3PFFA 2NYVA 4EGAA 4ZICA 2IPLA 3CZQA 2D8MA 3E9RA 4FZVA 4IIBA 3M1YA 2BM8A 5E9WA 4ZWNA 3V7FA 2RB4A 4DNOA 1KFCB 5I51A 4E5MA 5LNK6 1X86B 1VMIA 2A86A 5AI5A 4YN3A 1U9YA 2D7CA 3HU5A 3I9LA 4OHCA 5EI5A 4NZYA 3L01A 3QE9Y 4YAFA 4E13A 1Z0FA 4KQKA 4TL7A 4HYTA 3C4JA 3L1JA 2FQWA 4Q01A 1MDBA 1JZQA 3ZU5A 3HP4A 4C1BA 2L0XA 1XPJA 1PI3A 3CPJB 3GOQA 4K3UA 5HS4A 2QT0A 4BPBA 2H7XA 1EWQA 2AE2A 3G8CA 3WWPA 3ZU3A 4ID9A 5B55A 1UJ4A 1L4KA 3T1NA 2GD2A 4B4DA 1C4XA 4QWWA 2GBCA 4O63O 1W88A 4GVXA 3RQIA 3M5CA 5LBTA 4RA9A 1GRVA 4CM9A 2WUFA 4QYIB 3AP2A 3NIDB 4E6PA 3KEGA 2O2JA 1KWGA 1P91A 3LKBA 4TRNA 5FOQA 2WWRA 1FW8A 2IYVA 4J0GA 2YV2A 4RU1A 2C5FA 1E9RA 2ARKA 4G89A 1WXEA 3IAS1 5I5GA 1OT3A 4EG0A 1ULTA 2YV3A 3CR8A 2QN1A 2XYVA 1FTSA 4Q05A 3ROMA 4BLOA 5EHNA 3ZJUA 3AT1A 3ZIAD 3H1EA 3KLOA 1EJ2A 3A1TA 4FEAA 1FEZA 3I9FA 1KA9H 2DFDA 1ZICA 5CGQB 2WF7A 4MKIA 3SMVA 3L4EA 1NC1A 1NF3A 4GGOA 3I28A 4QTTB 4RJ2A 4YEDA 3NVAA 3AUFA 4PRYA 2C03A 2EWWA 4MV5A 2VFAA 4I1PA 3FZQA 2GESA 4RCZA 4MX8A 4LXQA 2W6OA 1J8MF 2QJRA 2YMLA 4EATA 3CE6A 1NFQA 3CCBA 3TI9A 5CCEA 2HMVA 1ZGBA 4BNIA 4KLRA 1KAGA 2B2XA 4FMCB 1TMKA 4LUCA 5DM0A 5F98A 2O19A 5EIOA 1Y4SA 2QTZA 4TGLA 4FDTA 1DEOA 4KAXA 1XNHA 1EVEA 4FVTA 1RI1A 4HR7A 3IEPA 5AVZA 3OLZA 3ZNPA 1BFUA 3AV3A 4EZIA 4DIEA 1MIHA 3HJNA 3OTWA 4ZXPA 2FCRA 3VNUA 4HNAA 4XYGA 2PYIA 1W75A 4WZAA 4H7IA 1MRSA 4KJZA 5CR9A 4KLNA 1GZDA 1BJRE 4XYMA 2VZEA 4AYWA 5LIRA 5EOVA 1VSQA 2QLFA 3O84A 5FKJA 2EJBA 5K3BA 3RSHA 5AVVA 3OFVA 3IRUA 4CKYA 3HWWA 2XF8A 2GNPA 1COWA 4E7OA 3HU3A 3JD0A 2ONYA 2WV9A 1G7SA 1AZSC 1CUGA 1Q7GA 2JDID 2FSSA 2O3QA 2P30A 2X8JA 2YYSA 3KPWA 3O0TA 3TNJA 5JNLA 5K0LA 3P94A 4R2KA 1JHPA 3NBFA 2GPAA 5KVSA 3QSYA 4RMJA 3LP8A 4HWGA 2KBEA 1PGOA 4UKDA 1PR3A 4L5IA 1BQEA 1L5MA 2VDKB 3N7TA 3BXHA 3QVSA 4GGMX 2WOJA 3JZDA 4IDDA 4I7EA 4KBYA 3SMQA 4BMNA 3WRVA 3BA6A 2BP7A 3NKFA 3KHSA 2E5WA 3S2EA 1U7OA 2VDWB 2X6QA 3KL4A 2NZYA 1J9ZA 4II2A 4Y2YA 4MVJG 1N5DA 4BB5A 5IANA 3PQFA 3ZW9A 1J70A 2J5KA 1X87A 3IQIX 5FWXB 4O2BB 4CT4B 4LXIA 4W7SA 3BIWA 4M46A 3CBGA 1IUNA 1HQCA 3EXIB 3H2HA 3OEHA 4TSRA 1X7WA 4ZOBA 4J2OA 4LOHA 2XVMA 2FPGB 2JC3A 2YXEA 1TT7A 2X1LA 5DIZA 1WPGA 3G89A 4Z0NA 2AOWA 3ER6A 2EX1A 3P4XA 1A9TA 3PC4A 1XKTA 1X1TA 4M1TA 4XVQA 1KWKA 3KZ1E 1XEWY 1KMHA 3LQQA 1CULC 2H1OA 2C7OA 3QF7A 4F7DA 1MHPA 2QTCA 2I2WA 4GX5A 2XT9A 4DUGD 4EABA 5FWYA 4Z54A 3M33A 3HVRA 4AD8A 1T5IA 3TVYA 1JR4A 3H6HA 3PT5A 1AQJA 2ZE7A 3I0NA 1QC5A 3QG1A 3R5JA 1K3TA 3EJ6A 2NV2B 5LD2C 3O38A 4MDFA 3OQVA 3BJRA 4NL4H 4WFKA 4GECA 3N59A 1PWZA 1Y6FA 2LWIA 3E2MA 3JATB 3PHGA 4LGMA 2XMRA 2C4VA 4OF4A 2OHOA 4YV7A 4ZHQB 1RC8A 4GMGA 2IX3A 3N07A 3LVBA 5TQ2B 1NU6A 1NVEA 2OXIA 5ADUS 1Z7GA 2WP8J 4FOTA 3EZYA 5DGHA 4DR3B 1CETA 3U5ZB 4WECA 1J2RA 2R6ZA 5BSFA 1DTSA 4GYYA 3DBRB 4QOFA 4AF7A 1MBZA 2GHRA 3BWCA 4LF6B 3Q3HA 1X42A 1Y3CE 3EK2A 1UPXA 5EZYF 4CKBB 1Z4OA 2YWJA 2ZRAA 3H3JA 3CKKA 2G5PA 1XA4A 1SRRA 4BQSA 1Z39A 4CTKA 1XZDA 1NN5A 3HVKA 3CINA 3JU3A 5P21A 2GT1A 4YVFA 2GVNA 3D3WA 5C1PA 1OFHA 1NMEA 1Z4QA 3ABIA 4ND5A 1B8VA 5JAZA 3J81A 5IK2D 2VJLA 5AXBA 1XZEA 4DV0B 2XMPA 4PX5A 2ODEA 1XVAA 3EZNA 1EZZA 3AB8A 2PH1A 1L5YA 3L9XA 4L8LA 2IWHA 2GK3A 4RTRA 4KI0A 1KIAA 1RQPA 1UQRA 5DLQC 2Y66A 3SFTA 1DX6A 2CD9A 4B8WA 3JQAA 1FMLA 1FDUA 1MFZA 4G65A 4NFSA 3NNNA 3BBPA 3ZDEA 4CG1A 3LG2A 3O7WA 3DYIA 4JWKA 4IDBA 1WPXA 1WV0A 4OJQA 3M5PA 1AHNA 4KQ2A 3SNHA 1O4VA 4RZ2A 5ICSA 1NBHA 4LNUA 5EWMB 1OYWA 3INYA 1KC3A 3LI2A 4MIKA 1GUZA 3E9YA 1HORA 3GVPA 3ROQA 4D3YA 3F7OA 4J2HA 4RIEA 1Z5PA 3ADCA 4YI5A 4LZPA 4WJKB 3AM3A 1FRZA 1WE2A 5DNWA 3SXJA 1RAEA 2FP4A 3GJ6A 3WRYA 5KI6A 5F76A 4FS3A 3BILA 4QC2A 4RHFA 1XAGA 2QDXA 3DP9A 4QREA 3FROA 1CS0A 3TSWA 1AXEA 1CUCA 2XZOA 2AKEA 1P4SA 1HYHA 2F9MA 1HLDA 4C4AA 5IYZA 5KVVA 2NYAA 4E11A 5IULC 3PCTA 4OBBA 4ZRDA 1ORWA 2RHTA 4H60A 1GTMA 1L7RA 1TADA 3BDVA 2BDUA 3G8BA 5CA1B 1NI4A 4M49A 3IEIA 1AKUA 4LX8A 5EIBC 4QDJA 1Q0UA 5DISB 1IM5A 1GVHA 4L72A 4PG5A 4WDRA 1TM3E 5DCWA 3UGQA 4JLBA 2Y1LA 2R87A 3RFFA 4QA9A 5IMBA 4FDLA 3S3TA 1HEUA 4P35A 3W4KA 1M5TA 2H1IA 5ENZA 2BGIA 2AW3A 2DR0A 3DNPA 3ILSA 5ALRA 1KBZA 3ESRA 3S2IA 2NU6B 3TRDA 1QVAA 4DS3A 2GYUA 1UFQA 2IA5A 3O8NA 4FCTA 3SHQA 3VAZA 1I3OA 1UMBB 1RAHA 1MRZA 3CUUA 5BQ3A 2X0KA 1WZ2A 1Z68A 2PK3A 1AKTA 3GT3A 4NIMA 3SQMA 3PR3A 4OOFA 4AG6A 4GMFA 2CDBA 4OX9Y 1Z16A 1W35A 3DAFA 4WK4B 3QOFA 2W22A 4NMMA 1MH9A 1CY1A 3OF3A 3S8MA 2Q4TA 2MSCB 4PGHA 1DPFA 5EEHA 4YCCA 1RQGA 4XDGA 4D79A 2FP3A 4TL6A 2WD9A 1R9NA 2NLOA 1KI4A 2M9MA 2GBIA 3OY7A 1SKYE 1UQUA 1MVLA 2Y0CA 2EBWA 3DE5X 3DVSX 3FYHA 3KT8A 3NHPA 2P3OA 4PQFA 4UJ3A 3RYFA 1QORA 2BZGA 3CPHA 4BO7A 5C51B 4ALIA 4EGSA 4DCNA 1AS2A 4HQ0A 1HQDA 1XZAA 3C3KA 4GP6A 1F4PA 1U2DC 4Y1FA 1D07A 4XR4A 4CR6A 4MYUA 1PUJA 3GMTA 5BMVF 1JA0A 1ZM7A 3NTOA 2XWQA 4JC8A 2GCPA 5TMDA 5DDIP 3JQGB 1P7YA 5I5EA 2AEMA 3EXHC 3HZRA 3FDXA 1B8NA 2ZSBA 1O9BA 1OHHD 5A5VA 5H9WA 2FJPA 1F6DA 3T5TA 3WYFA 2CVPA 5FOSA 2WSSD 1PF7E 5DW3A 1V8PA 2IHBA 3LUFA 3TRKA 3L9WA 3SDBA 3UOWA 5A6SA 2L82A 2P9FA 3S8YA 4IH1A 1MAWA 4HWPA 1PQYA 3JVDA 5FR2A 1QQ6A 4UVDA 3OT1B 4Q4LA 1ZD1A 3MTJA 4ODIA 1RPZA 5GPBA 3N05A 1E1CB 1OFTA 1XI2A 3B3JA 3RABA 5KCMA 5MGNA 4J91A 1Q57A 4HBGA 2F90A 4M98A 1OLUA 2WZBA 4QX6A 3T7CA 3ZNOA 1ISRA 1XQ1A 4P92A 5BR1A 2QJFA 2RJNA 1D6MA 1GFWA 2KB0A 2XMZA 4R9NA 2FK7A 3AJ8A 5JJLA 1THGA 1E6MA 1OROA 2P3QA 4KFRA 1EFCA 5FPHA 4BFVA 4IIGA 3I76A 5IDWA 3ZXSA 4CIDA 2HRCA 5AK5A 3ELUA 3MS4A 4H6PA 4GLOA 4X1IA 2QRUA 4PLYA 2R00A 2RDMA 3B36A 1U9IA 2JI4A 2KMLA 4MW7A 1FYWA 1W8DA 3CG4A 1ULZA 1JEDA 1VKJA 2MSDB 1T8UA 3JASA 5EJGA 5IP5A 1PR0A 4LV5B 2YBEA 3X1ZA 2O23A 2BRUC 2ZSJA 4ZVSA 2OVBA 1XCJA 2Z6QA 1Y7IA 3DF9A 4JYZA 5DULA 3KC2A 4LHSA 1VKZA 4D4GA 3AGQA 5IVKA 1W85B 1E2PA 4TS4A 5CA0A 1JVNA 4U6QA 3BMNB 4Q3BA 3LNTA 1E5DA 1NXPA 1JLRA 1JR2A 2REQA 3KM0A 4PBSA 1J8YF 3L1HA 3OQ6A 5KHAA 4C07A 1WZEA 3A28A 3NONA 4DLSA 4EI2A 4Z6KA 4Q16A 3TINA 4PINA 5KO2A 1JQ3A 3GY0A 3KQOA 3OBIA 2IF0A 2J41A 3U4CA 2GDZA 1XKLA 4LC9A 2V0GA 5GWXA 2WD7A 1E1RD 2FDRA 4ZAWA 4QOSA 4FW8A 4EYEA 2Z8XA 3HA2A 4WA8A 3ZHZA 2AZDA 3CZAA 4BO9A 1MB9A 5HF9A 1VLMA 4IDOA 2FMFA 1QZZA 3S27A 3SIPA 5IDQA 2I2AA 4BWVA 3KR2A 2ZWVA 1B43A 3AUSA 2CXHA 2JFNA 3L4BC 3PDCA 3RVQA 3S44A 3SOZA 4CJXA 3EFOA 4XGQA 1TLLA 4JJ4A 3PPVA 3WMGA 5CBPB 4RY9A 3MEQA 1R5NA 4LJRA 1X7ZA 3M1AA 3E7FA 3QUQA 4UHDA 2AJDA 1OA1A 1G2IA 2VDJA 4S12A 1KSJA 3Q7QA 3KD2A 1BGXT 2C5AA 3K73O 3PXDA 2I3ZA 5DK4A 3CV3A 1JFTA 1UXHA 2WWTA 2ZI4A 1YOVA 3BOSA 3ZBTA 1IM8A 2A88A 5HEKA 1RVV1 4IIFA 5C37A 4PCLA 4LOJA 1WVIA 3CTPA 5DT9A 3VYVA 3PZRA 4R84A 4FX2A 3E5HA 2EZUA 2ORIA 2B4KA 2X40A 5BR4A 1WSAA 1KU0A 2C2KA 3QEKA 2OAQ1 3VC1A 1B16A 1RRFA 2R97A 1RP7A 4ISBA 3PLNA 3R3JA 4M1KA 3DVQX 3KZCA 4HQFA 4LFBB 4OI4A 4HUQA 1REQA 5TPZA 1YIDA 3OFKA 1EZ1A 3NH6A 1GZSA 1K6MA 1JPVA 1GZ3A 1HSZA 2AW5A 2IZOA 3ANLA 3ZS9A 2COKA 4E5DA 4AZWA 1OQAA 5LZ7A 4I5GA 5LYJF 4A8JA 1BMFA 1O0SA 3MWDA 2OO5A 2OWDA 4EY4A 1LX7A 2CNDA 2VBFA 2ZBGA 3AV0B 1M2HA 2GF9A 2GEUA 3OU2A 1MJGA 4R5MA 4UATA 1R6UA 2CZQA 3IDQA 3L1IA 2TRSB 4D5GA 5AVRA 1QHHA 1WW2A 3RJTA 4ES6A 1YJ8A 3ZK7A 4FK8A 3DGFC 5G1PA 1EVZA 3OEEA 1J25A 3ND8A 3HBNA 3JZAA 1ODIA 1V8OA 2QAIA 3JQFA 1P4HA 3PX3A 1OGYA 3PC8C 2QPLA 1YK1A 4HAXA 5FB3A 4MEBA 1PQWA 3L7YA 5H4HA 1WLYA 2P35A 1SD1A 1OIXA 2LPMA 3BS4A 1LDBA 1LGYA 2FX5A 1QPZA 3MJHA 1T9ZA 2IU3A 3K4PA 2KYRA 4R9RA 1CK4A 2X0DA 1F1BA 3KVOA 3VPHA 1RLTA 2WT4A 1WMDA 3WIOA 3O1JC 2ODPA 2QMUA 4WADA 3TLCA 4Z7JA 3HUUA 2PZMA 3TIIA 3TGPA 2O8CA 1CB0A 1L4NA 1RAGA 3KQVA 3HPQA 4NESA 1K5PA 5FHRA 5JNVA 3FSEA 2QQ5A 1H4SA 2W98A 1U99A 4CU2A 3P4UA 2G8NA 2MT9A 3EUAA 3KOZA 3N2GB 4YY3B 3EHEA 1GUYA 2P78A 3S1AB 3UAWA 1RXCA 4BP8A 2WPDA 5KS2A 2W2LA 3CNHA 3OBBA 2JFQA 2WWHA 2JARA 3IQGX 3SQDA 4ZAGA 3DMNA 3PWKA 5DMXA 1XMQB 1XLUA 3P0IA 4DC1A 3DFFA 1LLQA 3IKMB 3OAAD 3VNQA 1E32A 5GINE 4PLWA 1TNDA 2VHYA 3K05A 5AQEA 5HM8A 2OCLA 4Q3CA 2FETA 5DT2A 3FHJA 4Q7JB 3RYIB 1JALA 2IXEA 4EHDA 1W47A 1GG9A 2OPBA 1FSPA 1WZNA 1PL8A 4ECAA 4ARVA 4F5WA 4QHSA 3WSVA 5J47A 4V0NA 5EIFA 3UWMA 3P9CA 4NAHA 3GRKA 5FD8A 2VAVA 4EL5A 1F2UB 2IS4A 4A27A 4I1IA 5E6SA 2WKPA 4TS9A 3WWDA 4KGXA 5T3YA 3A7DA 5BOSB 1KDTA 1ZD8A 1KZ6A 3UUEA 4B31A 1EDZA 4IQGA 1I32A 3VU0A 5CB8A 3RFXA 1KJQA 1RJDA 1U0HC 2NZVG 4I5EA 5IS2A 1Z5OA 4J9UE 5TX7A 3ZWVA 2C3YA 2BTQB 1KARA 2WLTA 1RYHA 5FJIA 3ZNQA 1NNI1 4MB6A 5F4BA 3TTYA 2Q7XA 2WVJA 4V0QA 1KPHA 4YPOA 4YQFA 1MPXA 3EOZA 3AKDA 3W5CA 2JJ2D 5TIIA 2WAYA 4Z53A 4AYXA 2A1TS 3S2SA 4FYKA 3NNDA 1JDTA 3WYAA 4AKEA 2VN8A 2ZSUA 1DJNA 4ZRMA 2ST1A 1PD0A 4MRSA 2NVUA 5I48A 1AY0A 4YO8A 1H5QA 4KOEC 4BP9A 1EJ0A 3JD1A 4UDNA 1CF4A 4XM0A 4EJ2A 4MWGA 1XRLA 4LOKA 4RADA 1DFGA 4BNJA 2QUKA 1YB2A 2QN9A 3HKBA 3PNLA 2HGZA 2QR5A 2WAAA 2D3WA 4WFQA 3W5VA 4BJ1A 4F4DA 3TFQA 2WJZB 4YMGA 1Q6YA 1NF9A 3IQZA 3T5MA 4KZKA 2V6GA 4ZZ0A 2H0QA 3CF4A 4CF6A 3VZQA 3BK1A 1SKYB 3F49S 3LC1O 4P4NA 2ILTA 3A4LA 2RHGB 4Q9LA 4R31A 2JZOA 2PGOA 5KJFA 1PZHA 3RODA 1XRJA 1IATA 3H2YA 1GKKA 3SIWA 2P6OA 3A06A 3Q3IA 3G7SA 4Q1CA 1Q0TA 2WM3A 2J67A 4IUDS 4JI3B 5JMPA 3I6MA 1YU9A 3NORA 4EGJA 2R4TA 4DA8A 3MYYA 1N2IA 3MJRA 4JJFA 4UQLA 4G07A