1A9YA

Udp-galactose 4-epimerase mutant s124a/y149f complexed with udp-glucose
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
338
structure length
338
Chain Sequence
MRVLVTGGSGYIGSHTCVQLLQNGHDVIILDNLCNSKRSVLPVIERLGGKHPTFVEGDIRNEALMTEILHDHAIDTVIHFAGLKAVGESVQKPLEYYDNNVNGTLRLISAMRAANVKNFIFSSAATVYGDQPKIPYVESFPTGTPQSPFGKSKLMVEQILTDLQKAQPDWSIALLRYFNPVGAHPSGDMGEDPQGIPNNLMPYIAQVAVGRRDSLAIFGNDYPTEDGTGVRDYIHVMDLADGHVVAMEKLANKPGVHIYNLGAGVGNSVLDVVNAFSKACGKPVNYHFAPRREGDLPAYWADASKADRELNWRVTRTLDEMAQDTWHWQSRHPQGYPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-GALACTOSE 4-EPIMERASE
publication title Dramatic differences in the binding of UDP-galactose and UDP-glucose to UDP-galactose 4-epimerase from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Epimerase
total genus 127
structure length 338
sequence length 338
ec nomenclature ec 5.1.3.2: UDP-glucose 4-epimerase.
pdb deposition date 1998-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1a9yA02
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1a9yA01
1U5AA 1WDMA 4J1SA 1EDZA 1DIHA 4JP3A 3DMYA 1KVSA 5HBRA 2DUUA 3UW3A 5C5IA 2Y1GA 3QIVA 2JAPA 4W99A 3U3XA 5JCXA 3ETDA 2I3GA 1CETA 2G0TA 3T7EA 4RCVA 1B16A 4CV2A 2YYYA 4DWVA 3BMCB 4E5KA 1IB6A 4YAIA 4L4XA 4DPMA 2QW8A 1PIWA 1BW9A 1KY4A 4WKGA 1VJ0A 3CPSA 2I67A 1LU9A 1GZ4A 4NI5A 1MV8A 2W4QA 3PJEA 3ZW9A 4PLVA 1ZK3A 1LSUA 1E3IA 2OP0A 1YQDA 1B15A 5C37A 2E6UX 3H3JA 1NFQA 4XZ3A 3WX0A 2UUPA 3OMLA 1E1LA 2HCTA 3SVTA 3D3WB 4GVLA 1Y8RB 2EKQA 3DAPA 2FSSA 2Q2WA 4ND1A 5L9AA 4WOKA 3NV9A 5KWEA 3DQPA 3DOJA 3W4IA 4BNIA 4BNVA 1DO8A 1X7DA 1DIGA 1PR9A 1PS0A 4OGWA 2VUSA 3O8QB 4KQWA 4WLNA 4QT0A 3PQFA 2H1SA 4D7AA 1UH5A 1NASA 4O0LA 5L7WA 3AM4A 4AJEA 2LDXA 1NVGA 3PFWO 3NJ4A 3I52A 1WMAA 3CZRA 4TMFA 3K96A 1AXGA 1ULSA 2P68A 1BVRA 2I76A 2VHVA 3FF4A 3GF4A 4HBGA 2JHFA 4CUZA 5TS3A 3JD1A 3BTOA 5DCWA 1H0KA 3BMCA 4XJSA 4D3FA 5CPFA 3JQBC 1MLDA 3G17A 1P45A 2IEDA 1T4BA 4J6FA 4D0RA 2JJYA 1HT0A 3Q2IA 3L6OO 4GWGA 1HLDA 1U28A 4E21A 1M6HA 4IJKA 4DREA 1TB4A 5FI3A 5BT9A 3MJ4A 3VPGA 1A9ZA 1UAGA 4KTTE 5I9LA 1JAXA 4R54A 1B0AA 3ST7A 3WMXA 2HMSA 4E12A 1IHYA 3H5RA 2Y0EA 5CEFA 3D3WA 2EIHA 3G49A 5LCXA 1Y8RA 4RPKA 3O03A 3H65A 4CR6A 1A72A 1SB9A 4BO4A 2RCYA 2DC1A 5GZ6A 1ORRA 5L95A 3Q6IA 1GD1O 1YRLA 4HNHA 1SO8A 3EVNA 3O8QA 4OOFA 1QYVA 3H5NA 3GT0A 5A4DA 3ZNPA 2O23A 4R01A 1SEVA 3H4VA 3V5NA 5JDCC 4B7UA 1H2BA 3RUFA 2WWRA 4UVGA 4PG8A 1PX0A 2Y1CA 4S1VA 2RHRA 4O1MA 1VSUA 2B69A 5A9TA 5A03A 1LQUA 4BO5A 4PLCA 2JHGA 4R1NA 4L4SA 2XF8A 1I32A 3NDRA 4FGSA 4CMIB 4XWYA 1SOWA 1XYGA 2V7PA 4IIUA 5G0UA 1J0XO 4OXKA 3C85A 4GL4A 2C07A 3D64A 4BMNA 1IZ9A 1UZMA 1LDNA 1V0JA 3SLGA 4II2A 4P38A 5G4LA 1VLLA 3WGZA 3DBLB 5K0ZA 1BSVA 5JE8A 3RCBA 3TRIA 1IPFA 2D8AA 4RF4A 3RFVA 4BS9A 4ID9A 3S8MA 1B8PA 2X0RA 3CIFA 3ZNQA 4FJ2A 1UXHA 1LLDA 1O6ZA 4YT4A 1SC6A 2VNSA 4U7WA 4BVAA 1ONPA 5BNFA 1V3UA 3W6ZA 2GD1O 4O6VA 3PRJA 1GV1A 1ISJA 2AEJA 4IDGA 3R6DA 4QSMA 3PWZA 2NUAA 4FJ1A 3FCOA 3OQBA 4I5EA 1ZMTA 1JVSA 4L74A 5TNXA 4M1QA 3JV7A 3OF2A 1RJWA 1F8GA 3LZ6A 1VSVA 5JDCA 3JD0A 1HDGO 2B37A 2RIRA 1QV7A 1WWKA 1QMGA 3U4IA 5L4SA 2W8ZA 4FIZA 4ZRNA 1T24A 2EHDA 4IJWA 5JLAA 2G5CA 3QVOA 2QX7A 4DRYA 2B83A 4CMIA 1R4MB 5GZ1A 1WLYA 1DFGA 3FNFA 1T2EA 1GYQA 4RVHA 3OIDA 3Q3CA 3RROA 5JAQA 5JO9A 4C7KA 1ZFNA 1PQUA 5H82A 3AOEA 3RC1A 4YYZA 4MVJP 1IZ0A 1J49A 1VRWA 2EV9A 4O59O 2Q4EA 2CVOA 3VH1A 2GO1A 4IGEA 1DJQA 2EWMA 3JQ9A 4DQVA 3GY0A 1P1RA 2YDYA 1YBVA 1ZEJA 1XCBA 4TVOA 3UOGA 4IQ8A 3OEYA 1PJCA 3JQ7B 3E8XA 3I4FA 3T4XA 4CLOB 1BGVA 1NR7A 3VH3A 1I0ZA 1SZJG 2HAEA 2YJZA 3INTA 1HDXA 3L4BA 1CEQA 4OAQA 1ZO8A 1LBEA 1LI4A 2WE7A 1L7EA 3IOYA 4BKUA 3U5TA 5TX7A 3ZI0A 3QY9A 4EW6A 3ONDA 5IZCC 5TIIA 4OSOA 5T8KA 2X9GA 3ZGYA 4BNXA 2F1KA 3N7UA 1R4NB 2W90A 3DZJA 2JD2A 3DL2A 1PGQA 1EBUA 1LDMA 3RJ9A 2W2LD 4BV8A 1LDYA 2IZZA 3H9JA 3UKOA 3GDGA 4YAJA 1TLTA 4GQAA 3H2SA 3O9ZA 1IL0A 1ONNA 5CHEA 4K6FA 4H15A 3TZHA 4BKPA 4XB2A 2GERA 5FEUA 2VYND 3V2GA 4BNFA 1JDJA 2DUWA 1R4MA 2HLPA 4XQCA 4NPCA 4CM7A 4E6PA 4GMGA 4ALNA 3PYLA 1JKIA 1NQAO 3DO5A 3OA0A 2NQ8A 3GVPA 3WLFA 5AXCA 3JD4A 4PLPA 4URFA 4JBHA 3KYBA 5ENVA 5BQFA 3KSUA 1ENYA 1PWXA 3TZQA 4B4OA 1X1TA 3JQ7A 4UEJA 5JY6A 3AJRA 4XYEA 3WGQA 4CLDA 1HDOA 4ZQBA 1R15A 3PJFA 3OJEA 4CLRB 2C2XA 4K1LA 1ZSVA 1PS8A 2HK7A 3AY7A 4DC1A 4CLOA 1HL3A 4IDCA 4CM3A 1R66A 3AK4A 3MJVA 3P2OA 1PJSA 4YCAA 1I3KA 3WNQA 4NG5A 4FOSA 4K28A 5A1TA 1RKXA 1HYGA 1H6DA 3CMMA 4AJKA 4RPHA 5KVCA 1C1DB 1LSOA 4AJJA 2HMUA 1YBAA 1YDEA 2QZZA 3WIEA 2TMDA 4J4BA 3FNGA 4W82A 1NAHA 1R4NA 3MJSA 3BIOA 3NTQA 2H6EA 3ORFA 1ZNQO 3TOZA 2P91A 3QV1A 5IZCA 1ML3A 2EJWA 1ZK2A 5EQDA 1HWYA 2X5OA 1ENZA 4MKZA 4BHTA 3E18A 2D59A 3D7LA 2Q3EA 1N7HA 1I36A 4YQYA 5ES3A 3ZWOA 4A03A 2DVMA 1XSEA 1UR5A 5F1KA 4GGOA 4QO8A 1JQBA 1KBZA 3PWKA 4IY1A 3PDJA 2WYUA 1F8FA 2GRAA 3ZH2A 1HE2A 4BUCA 1EBFA 1LLUA 2CDBA 4EZBA 5ILOA 4CMJA 4CUKA 1ZEMA 1C0KA 5KJFA 3BMQA 3JQGA 4PRKA 3WTCA 1YBMA 5G0WA 1W0CA 2V6GA 1P1FA 2Q1SA 3BAZA 4MVJF 1ISFA 5KJEA 5COBA 4E5NA 3ZWPA 4W6ZA 2Q2QA 4LRTB 3AI1A 4ZGWA 3GG2A 3Q11A 4JP2A 4CV3A 9LDTA 4OH1A 4II3A 3ENKA 4RF5A 3QRWA 4YR9A 2ZK7A 4FFOA 3DONA 4M54A 4ZRMA 3U49A 4IDBA 4B4UA 1EUDA 4KUHA 4KMSA 1TEHA 1BRMA 4E13A 4Z3DA 5CDTA 4CM8A 1C1DA 1UXJA 2B5WA 2PNFA 4BNTA 2W2LA 4NU5A 2Y05A 3VHRA 3P5SA 3QVSA 2AQ8A 4HY3A 2OBNA 1P1HA 4MVJM 4BO3A 5A04A 2DBZA 1QORA 4WLFA 1JW9B 1Q7BA 2VYNA 2DTEA 4IPTA 4XIJA 4G5HA 3KETA 2BRUA 3F3SA 1PEDA 4FFPA 3ZU4A 1SOVA 4I8XA 4OXNA 3KXDA 5JPIA 1W73A 2PKQO 4FCCA 1DLIA 1HDCA 4H16A 4LK3A 1AXEA 1TT5B 5JFOA 3WIDA 1EVIA 5KVVA 1GPJA 4YACA 4YJFB 4PIVA 4LW8A 4FQ8A 2C54A 2FOIA 4IS3A 2JD1A 3JQEA 4JLWA 2ZB3A 1DJNA 1PL6A 4LSMA 1PJ2A 2DTXA 3AW9A 4RF3A 4E31A 4AJ1A 4GSLA 4NBWA 3WWYA 4BGVA 5FI5A 1DPGA 1R0LA 3V1TC 4BB5A 2PY6A 1LQTA 2HK8A 3LDHA 1X13A 4M55A 1U2GA 5FF9A 2Q1TA 4EJ6A 2PH3A 1FMCA 3E6AA 3GAFA 1EVJA 1YH3A 4UUPA 5L45A 4C4OA 4XDZA 1ENPA 1H6CA 1E1MA 2CSUA 3DAGA 4J2OA 1P77A 1J5PA 2Z1NA 1VKOA 1H9AA 3K8ZA 1Z7BA 4ITUA 2OO5A 3WGIA 3PIDA 4MDHA 1R0SA 2NTNA 1QRRA 1QYXA 3F4LA 3TL3A 1A5ZA 3EY4A 2WDZA 4Y6PA 4LSWA 4E5YA 1H6AA 2A35A 1WMBA 2Q1UA 1HDZA 1SAYA 3HQ4O 1P31A 4TZTA 5CDSA 1A4UA 1GCUA 5TGDA 1VKNA 1GYPA 3HFGA 4I9NA 3F4BA 3H9EO 4FOOA 1PJ4A 4ZQFA 3C24A 5BR7A 1N5DA 4CV1A 4Z6KA 2Y1EA 4ND3A 1RWBA 3JYNA 1T1RA 1TT5A 4HADA 2X0JA 1KOLA 1XU9A 4R9RA 1BDMA 4YJFA 3ZWMA 5COAA 1VJTA 3GH3A 1PJTA 1ZUD1 4CM5A 4YEDA 1ZZEA 5AYVA 5BSGA 3L9XA 1H9BA 1V9LA 3VPFA 4TQGA 1G0OA 3UCFA 1MP0A 1ADCA 1DIBA 1A9YA 2PZKA 2YZ7A 3H8VA 5TT0A 4M87A 1LC0A 3UAGA 3WFIA 2J3IA 3NGXA 1LDGA 3LYLA 1X0XA 1DEHA 1QYDA 5T64A 4ZJUA 3D0OA 1RPNA 5HTOA 3VDQA 5H81A 3AM5A 3QVXA 1O89A 1ISMA 3KSDO 3PWSA 1F17A 4HKTA 4YB8A 5A3VA 4D46A 1E92A 1LC3A 2P9CA 3NRCA 3Q1LA 2PFGA 4CM4B 5IF3A 4AJ2A 3PJGA 1N8KA 3HDJA 4XB1A 2PGJA 3TF5A 4WNIA 4J4TA 2FRDA 4BOYA 5C7IO 4PLTA 5DOVA 4RO0A 1H5QA 3C7CB 1BXZA 4AVYA 8ADHA 4N5MA 3WS7A 4XCVA 3HDYA 1E7QA 5ENDA 4Q3NA 3WGOA 3TZ6A 1ZBQA 2BLLA 3TZCA 3RSHA 4I9HA 3KUXA 3NEPX 3VH4A 3WSVA 1IHXA 4ALMA 2VZ9A 5JSFA 5EPOA 2ZTLA 1J4AA 3K73O 2C7VA 3A9WA 3BHMA 5TRTA 2VHZA 3V2HA 4DPKA 1PSDA 1U8XX 1OC2A 2B5VA 3C3XA 4U6QA 3ASVA 5G4KB 5JNLA 1YDWA 2GLXA 3ROKA 1N1EA 2CF5A 4QO7A 4JX8A 3ICPA 3D1LA 4OXYA 3HFSA 4RDIA 4FD3A 1LEHA 3R3JA 4IJUA 2P2SA 2GR9A 5T5QA 1HSOA 1T25A 4YT8A 4KDEA 2EKLA 4PG4A 3EVTA 3TFOA 2OP1A 4A26A 1NR1A 1UUFA 2X5JO 3OJOA 4BNNA 3JTMA 1VJ1A 1ZH8A 3CUKA 3W4JA 5JAZA 1TXGA 2HRZA 1T2FA 1PJBA 5ICSA 1FF9A 2PA3A 4PG7A 1JN0A 1Q0LA 1Q1NA 3MZ0A 4A2CA 1EFLA 3FTPA 3OJ0A 4BNGA 2ZQZA 4WK6A 3JQ8B 2DKNA 2H63A 2FY8A 2AE1A 1VL8A 1M67A 2IDZA 3EW7A 3NAQA 2ZKLA 4N7RA 4OJNA 4BKQA 5ITWA 1DC6A 1XEAA 3HNPA 3DZGA 3Q9UA 2GSDA 1YXMA 1ISIA 3D4PA 5DN9A 4J90A 3T7CA 2RH8A 1A71A 4TROA 4DTIA 4IMPA 5T57A 5A5FA 4OYRA 4R5MA 1GR0A 3ENNA 3LC1O 5B1YA 3ABIA 4GX2A 3ZHBA 1KEVA 3IP3A 2VOEA 1SCUA 3PFFA 1Q0QA 2VCYA 4H3VA 5G4KA 5A05A 3I9OA 3ZZNA 3EHEA 1HKUA 2ZATA 5IJZA 1XR3A 2UUOA 1JWAB 1I2BA 5C7OO 1Y81A 1YWGO 1FXSA 4B3HA 4XQ9A 2YUTA 1QLJA 4PLWA 3WQQA 5EJ2A 1U3WA 1NX6A 4N5LA 5L3ZA 2EEZA 2BMAA 2H9IA 4B4WA 5DNAA 1AE1A 1F14A 2ZTUA 4BKRA 4UEKA 3ETEA 1GUFA 3GRKA 4CLEA 3M1AA 2O4CA 5BSHA 3UVEA 3ONFA 4NU6A 3E82A 4XQEA 1VPDA 2GF2A 2OUIA 3JQ8A 2P9GA 4TSKA 2C7GA 1MA0A 4YT5A 2R00A 4IGFA 3L6DA 2AA3A 3QWIA 1U3UA 4LN1A 4IQGA 5EINA 4EJ0A 1XWFA 2HU2A 4GH5A 4J9UE 3GG9A 3S2IA 4IM7A 3TZKA 1K3TA 2Q2VA 4OKIA 4AJHA 1SNYA 1Q2XA 5I9NA 1YOVB 2VWHA 1GQ2A 3KBOA 1E7YA 5AOVA 1BHSA 3GVCA 3RBVA 4NH4A 4TRNA 1PGNA 1ZK1A 2A4KA 4Q9NA 4J4HA 5J23A 3CINA 1BMDA 1T2CA 1N9GB 4GLOA 4HWKA 5AVOA 2V6MA 4LCEA 1QYWA 1WP4A 2PD6A 2ZCVA 1NP3A 3GC6A 2EW8A 2X1HA 4L8VA 1QXSA 2R6JA 4JNKA 1PU2A 2VHXA 4A10A 2DU8A 3DOCA 2XXBA 2FR0A 4JBIA 2AQIA 4BKOA 1PJLA 3LK7A 3DR3A 4R68A 4L73A 3ADOA 3UFXA 4GAEA 1P0FA 5ICMA 1E5QA 2BI8A 4BNHA 5CAEA 2IXBA 3OIFA 3GGPA 5TSDA 3N74A 4DQUA 1ZK4A 4W9NC 2G17A 3C7DB 3ZU5A 3S2FA 3BTSA 1CQJA 4ZN6A 3U4CA 2GUGA 2HSDA 3QWFA 1K0UA 4J2HA 3O26A 1QSGA 1B8VA 3EAGA 1X7HA 3ASUA 3I5MA 3UF0A 5CDYA 4J0FA 2NU8A 2GGSA 4UUMA 3GNTA 4DPLA 2XPCA 3BMNB 2A94A 2WYWA 3W8EA 4CPDA 1ENOA 2YW9A 4ZQHA 1M76A 1L7DA 3G0OA 2BGMA 4RPJA 2VUTA 3RWBA 3D3EA 1YOVA 3ZU2A 4N5NA 2AEFA 2XXJA 1RM4A 4BL5A 3WGHA 5DDIP 3IL2A 4A27A 2ZYGA 4DUPA 1HLPA 3WYEA 1CF2O 3COSA 2EF1A 3DZIA 4NIMA 3X2EA 1HE4A 1NPDA 5JS6A 3PIIA 4XJTA 1H2HA 2C20A 4NFYA 4Y6RA 1HYEA 1PZEA 3OETA 1KC3A 2G1UA 3ON5A 3UCEA 3I9NA 5DOZA 4JK3A 1LDBA 1WNTA 4U0KA 3BXXA 1XIVA 1P1JA 1SBYA 1XQ1A 2X5KO 1MFZA 2X0IA 3ZHZA 2NVBA 1O9BA 3WQRA 1YE3A 3Q0EA 4J49A 4N54A 2YQ5A 3BZUA 4E2WA 3LF1A 4EEZA 3BTUA 4IJVA 5HS6A 3AFMA 1MC5A 3I1JA 3WICA 1UJMA 5CFZA 1C0PA 1I30A 4W9NA 3RC2A 4EYEA 1LSSA 3VKVA 3KRTA 1YL6A 1P0CA 2HKIA 2NQTA 3H9QA 3BHJA 4DGSA 3ZWCA 1K6JA 4RVSA 1CDOA 1W8DA 1EMDA 4HX5A 6ADHA 4FN4A 3FR8A 3BMNA 3E9QA 4XGKA 4CMBA 4TKMA 1Q0HA 2HK9A 4JJIA 3FD8A 4YDRA 4YAEA 4AJOA 3PYMA 1P1KA 3AOEC 3TN7A 4A7PA 4FC7A 2O3RA 1HZZA 1DIAA 2EGGA 4R1UA 1P3DA 3ZCXA 2J5RA 2AEMA 4HFNA 3JQ9C 4OSPA 4U0JA 3DZBA 4U8GA 4Y98A 4EJMA 4UUOA 5CDUA 3VZQA 4DBZA 4S3MA 4L9RA 5T67A 3E5RA 3PVZA 3DWFA 3GOHA 1T2DA 5THKA 4UVHA 2I66A 4XYGA 1LRJA 1UXKA 4GGPA 4J1NA 4OM8A 3L4BC 4AJPA 5K6AC 2CY0A 1GCOA 2NU6A 2ZB8A 1SMKA 3OECA 1U3TA 2YY7A 1DC3A 3H5AA 4BO0A 4LCJA 3C7AA 4B7XA 3F47A 4FGWA 5T8KC 3IAHA 3JQ6A 3FBTA 1E3LA 4PVCA 4BNKA 4RQTA 3HSKA 4HFMA 5I8ZA 1I5RA 1DLJA 3JQDA 4CQMD 2X9NA 1GYRA 2X9VA 3DHNA 1E3JA 5A5EA 2FN7A 5TQVA 3H2ZA 5CP8A 3IC5A 4XA8A 4GSKA 8LDHA 3WTBA 2QYTA 3KVOA 2PD3A 3UXYA 1BWSA 2ZJ0A 3IKTA 4JGBA 2EKPA 3TL2A 4BGIA 3VPXA 3GA0A 9LDBA 3IUSA 3GMSA 4IZHA 1WVGA 5KJ1A 3WQSB 2ET6A 1U9JA 5L7TA 4YA6A 2P5YA 1VM6A 4YBZA 2OBYA 4JN6B 1NWHA 1I2CA 2FPPA 3DMTC 1XKQA 4XYLA 1B8UA 5DBIA 4ZVVA 2J3KA 4WNCA 5G0TA 1O5IA 2X86A 1Y9AA 4CLHA 3SX2A 2VWQA 4YJGB 3DBLA 3KTDA 3GGGA 4FPXA 3IP1A 1X1EA 4UULA 4GLLA 3PYXA 4RF2A 1Y8QB 4XKJA 2DPHA 3RKUA 2NLOA 3ROPA 3RD5A 1AHHA 1P33A 4LVUA 4HUJA 1E3EA 2J6IA 3E1KA 3JYLA 5K6AA 2GN6A 4Y9DA 4NJOA 3LF2A 4EDFA 5F5LA 1QV6A 1E77A 5DBGA 2AMFA 1FDVA 1SEPA 3QSGA 4CQMB 3EYWA 4M89A 1X15A 1CERA 2WD7B 3E03A 4TRMA 2BFPA 3MJEA 3BHIA 3R3SA 5L53A 1O0SA 3ZHXA 4FW8A 2UV8A 1E6UA 1NNUA 2VWGA 3K2EA 2YV2A 3I9MA 3DZHA 3U62A 3RBXA 2NVWA 3G1UA 3K92A 3NUGA 5A3JA 4L75A 1KEUA 1PQPA 3M1LA 2E82A 1V8BA 5L51A 3NT2A 3GVIA 3QHAA 1YVEI 2OMEA 1RYEA 3FN4A 4WLEA 3PHGA 1UDBA 2CD9A 3L77A 1NBOA 4YQZA 1ZJZA 3ADPA 5HS4A 1YJQA 3OH8A 2O50A 5TJHA 1DIRA 5CG2A 2C5EA 4UREA 4IUYA 3KLPX 3MTGA 3AY6A 3GPIA 3JSAA 3PQEA 2FMUA 3DMTA 3SC4A 1K2WA 3VOSA 5A9RA 1T4DA 3FHLA 4TRJA 4K9DA 3RUCA 3WJAA 3ZNNA 5B4TA 2VQ3A 1Y8QA 4Q39A 4MIYA 4RGBA 3LSYA 1MC4A 2IXAA 1CRWG 3RFXA 1KEPA 3OFSA 3TFQA 4AJIA 1NHGA 5F1OA 3GK3A 5BSFA 4BMSA 4WGGA 2DT5A 3D5TA 1LA2A 4QTZA 4CQMA 2CUKA 3HB5X 2WD7A 4CUJA 3DFUA 4MVJE 4E5MA 3VVCA 1D1TA 5BNTA 4Z9XA 4YVFA 1Y7TA 2G76A 4FFRA 4B79A 4LVCA 4XR9A 4ALIA 3HG7A 1PZHA 1XLTA 4ALLA 4Q3EA 1KVUA 3MOGA 4RVFA 1E7MA 4KUEA 3LLVA 4M86A 4G81A 1HDYA 3RUEA 3OM9A 3OJLA 1RM0A 2E49A 2UVDA 4YPOA 1KVRA 3KV3O 3DBHB 4WLOA 2RHCA 5G0VA 1VI2A 1YB1A 3H7AA 4J7UA 4YTEA 1PGOA 3LQFA 4WASA 2NTVA 1ISHA 2D0IA 1QYCA 3ICCA 1UZNA 1E6EA 2PV7A 3WOHA 1AUPA 4WUVA 3K5PA 1ULUA 4CLRA 1GY8A 4W7IA 4CQLB 4I5DA 1DFHA 2ZTVA 3PZBA 3QWHA 2C5AA 2XAAA 4U6SA 1QR6A 4Y67A 1GAEO 4NDNE 4BGUA 3OICA 1LDEA 2QG4A 1A7AA 1T26A 1CIVA 3A28A 5K9ZA 5JDIC 4EUFA 4PLHA 5HWSA 3BMOB 3ZWBA 3U9LA 3UHAA 4CL8A 2RBEA 3IDSA 5C3MA 2D2IA 4RVDA 1LLQA 2B35A 1E7RA 4B7CA 4A0SA 4K26A 2GYYA 3MCVA 2EP5A 2VRBA 4CMAA 1W4ZA 3I3OA 2ZB4A 3WR5A 3JQFC 5JCJD 4F6CA 1Q7GA 3PEFA 4H7PA 3ZWNA 2YV1A 3AM3A 4JXKA 3AUTA 3D4NA 5IAAA 2E4AA 3RUHA 1XGKA 1Z75A 5LDHA 1Z74A 1PJ3A 4DL9A 1SB8A 5IDQA 1VE9A 1AN9A 2YHUA 4CMCA 5KOIA 3DBHA 3CH6A 4E32A 2NU9A 3ONEA 3L9WA 4MIOA 4RPGA 5F5NA 3RJ5A 3ZV4A 4NR0A 2AG5A 4NNJA 1P74A 2DAPA 2YDXA 3IUPA 4MP6A 3I9KA 4P4GA 2JFGA 3B70A 3G3EA 3WGTA 5DF1A 2BH9A 2AXQA 2WYVA 3FNEA 4UUNA 2VTDA 1OAAA 4DYDA 3KOUA 4CR8A 4L4RA 1K5HA 5EL0A 4CQLA 2IYOA 6LDHA 4RQUA 1O94A 5B4VA 4HXYA 3QE3A 1BDBA 5JO0A 3WNVA 1DXYA 4IQ0A 4J16A 1GFSA 4IMRA 3AI3A 4JROA 1E7SA 1OI7A 1XU7A 4CM9A 3BMOA 4BGEA 2ZJ1A 3GNSA 4KZPA 3CZMA 2NV6A 4MVJI 3E48A 4R41A 5KKAA 2J3HA 5JDIA 5IFLA 3ANLA 4ZHSA 4ZQEA 1LTHR 2Y67A 2NVUB 2JKVA 5U9CA 4NQZA 3NTOA 4FDAA 4WE3A 3IS3A 4IZIA 1HYHA 3JQFA 4XRRA 5JYEA 3GQVA 3CKYA 4E5PA 2EG9A 5BNIA 4Q3CA 1U8FO 3R1IA 3ZU3A 4DMLA 2IRWA 3ZW8A 2PKQP 2Y0DA 4MVJH 4LRSB 1QLHA 4JJFA 3K31A 3WGGA 3T4EA 2NTJA 3ZNOA 3QJ5A 3HN7A 2Y1DA 4FJ0A 4MVJG 4XR4A 5ILGA 2J3JA 4XDYA 1QKIA 2O3TA 3RKRA 1GDHA 4NK5A 2FPIA 1GUZA 1YL5A 2ZYAA 1I3MA 3LT1A 2IEBA 3OIGA 5I8WA 3I83A 2VYVA 1TA4A 1D4FA 3GVHA 4HNGA 3GGOA 1QG6A 4BQPA 4R3WA 3VVBA 1D3AA 3MOIA 3AWDA 2POQX 5A9SB 3MWEB 3KYDB 3PHHA 1F12A 1DFIA 4LGVA 2GPTA 4OIMA 2QQ5A 5CPBA 1S7CA 4J7XA 3UUWA 5DCUA 3EGOA 1E3SA 4PFJA 3I6QA 3NGLA 4WCDA 4QFCA 4KUGA 5JCJA 2HO5A 1WXDA 4YRAA 4MP3A 3N58A 2NVUA 3LU1A 4QX6A 1DOHA 3WXBA 1YQXA 2DBRA 3I23A 3NT4A 3DBVO 4W4TA 3RC9A 2B4RO 2QZ9A 4NJMB 3ZWVA 4I1IA 5A06A 2V6FA 4P22A 5U4QA 2DLDA 1R6DA 3VC7A 4OMUA 4MP8A 1KC1A 4NZ9A 2AQKA 3GR6A 2Y99A 3PHLA 1CYDA 3EMKA 1MG0A 1Z6ZA 1YKFA 5B4UA 4R5HA 2ZQYA 2H5LA 3PGXA 1A7KA 4LMRA 4BO6A 1C0IA 2BGLA 2O3JA 1NPTO 2ZYDA 4XYBA 1ARZA 4FC6A 1DC5A 3LC2O 4AJNA 1T2AA 1GV0A 1I3NA 1IPEA 5I9MA 4AFNA 3PPIA 5A9SA 5MGBA 1DAPA 1EE2A 1KS9A 5L4LA 1ZW1A 3UH1A 2Y66A 1OOEA 2I9PA 2Q99A 2BFAA 3KYDA 4IBOA 4MPDA 4PG5A 3TQHA 3VAZA 3VDRA 1MFPA 1ADFA 1GZ3A 4I5GA 3ZWAA 2PH5A 3B1KA 4TRRA 2HMVA 3RFTA 4E3ZA 1H94A 1KEWA 2V6BA 1WW8A 3RUAA 1EE9A 3JQAD 1Y6JA 2HMWA 7MDHA 2GASA 2R00C 4PCVA 4XD2A 4WEQA 3S2EA 2E48A 5IDYA 3GEMA 4CM4A 4UEOA 4NFSA 1L1FA 4EEXA 3VZRA 1Z7EA 2X23A 1LXCA 2I3AA 1YB5A 3NJ8A 4KTVE 3GPDG 5L40A 4WOJA 3G79A 2Q45A 2GZ1A 3H9UA 1NXQA 1R0KA 5COQA 5GY7A 2O3QA 2OXIA 3ZHYA 2I99A 4NJMA 1VL6A 5FFFA 2YFHA 3S2GA 3TOXA 1U3VA 4CM6A 1K89A 4BQRA 5I7VA 1S6YA 4RLHA 5HM8A 3RASA 3CSDA 1UXGA 2GCGA 5HA5A 1M6WA 3AOGA 1HSZA 4N18A 1V35A 1EK5A 3L07A 3ROQA 1IY8A 1KETA 4AG3A 1YS4A 3QP9A 5ITVA 4GMFA 4D45A 4CMGA 5U1PA 4OQZA 1JKFA 1G0NA 3STHA 2Z5LA 4BO2A 1Z82A 4QEDA 1I3LA 3CEAA 1E6WA 2DM6A 4IDAA 4EITA 1EK6A 4R3NA 2PD4A 2ZTMA 1PS9A 2CZCA 4ZA2A 2VHWA 4B8ZA 4B8WA 2DBVO 3JQAB 4ALKA 1PJQA 2C0CA 2X6TA 3W6UA 3GRPA 2E37A 4J3FA 1H93A 3ULKA 1I24A 2AW5A 4PG6A 1E3WB 2HDHA 1E0DA 1EQ2A 1NTOA 1EFKA 3GUCA 1XELA 2HJRA 1ISGA 2JAHA 1YO6A 1RM5A 2VN8A 5IN4A 4TVBA 4NBRA 1C0LA 3FBGA 3IKVA 3NTRA 4BO7A 5KIAA 1ADBA 3DBRB 4DXHA 4FSHA 2QRJA 3BTVA 3LT4A 4F45A 3A14A 2WM3A 3K9QO 4MO2A 4D79A 4NFHA 2OOSA 2NU7A 2P4HX 4WECA 1DC4A 1JKJA 1KIFA 3PLRA 4M8SA 3U4HA 3NT5A 2D5AA 3PK0A 3RAJA 3CMCO 1PWZA 4P8RA 4A73A 1TI7A 2D1YA 3B1FA 4AJLA 4EUHA 4BNUA 3M2TA 1EUZA 2QRLA 4J91A 2EGHA 1O8CA 3TJRA 1ZIDA 3GFGA 5JYDA 3QWBA 4PLGA 2SCUA 3SLKA 4WCFC 5MDHA 3GFBA 1Z45A 2VOJA 2VZ0A 3VTFA 1KY5A 4I9UA 2DFDA 4RV9A 4WCFB 1DRVA 3JQAA 1IULA 2O2YA 3GAZA 2VRCD 3WLEA 3L0DA 4EGFA 4PRLA 2WMDA 1YQGA 2ILTA 4CMEC 4JQCA 4UAGA 4YRBA 4E2YA 1R12A 2PGDA 1E3WA 1UP6A 4R16A 3MJCA 3H3FA 3RVDA 3FI9A 3GN1A 4LISA 4OL9A 4O63O 4Z0HO 4CLXA 1JA9A 1GTMA 1FDSA 3DBRA 1E1NA 3DDNA 4FBGA 4B3JA 4J0EA 2AE2A 3B6ZA 4CM9D 3PJDA 5F1PA 3OSUA 3WSWA 2V65A 1ZMOA 2YFQA 1X0VA 2Y93A 4B3IA 1GEEA 3GZ4A 1U7TA 3DXFA 4P4LA 2UYYA 2Q1WA 4ESOA 3GZNB 2IODA 3AUSA 3KB6A 2OZPA 4FB5A 4GWKA 2B36A 3NX4A 1N9GA 5IN5A 3GHYA 2VZ8A 4FFMA 4ND5A 4RDHA 4UVEA 1UP4A 1ZVMA 3HADA 3C1OA 4BO1A 4MKXA 3Q2KA 4BMVA 2F00A 1M75A 2HMTA 5JC1A 2OL4A 2WSBA 1WAMA 4ZICA 3OEWA 1AHIA 5I7FA 4WCFA 1OFGA 3OA2A 2FR8A 4MJLA 4IINA 2AQHA 3MWDB 4GX1A 1NFRA 1Y9EA 2WE8A 4QQRA 2XOXA 3F1LA 1MXFA 3HDQA 1C1XB 1XG5A 1UDCA 2BI7A 5FYDA 2LDBA 4GX0A 4CMEA 5IG2A 4BV9A 3D4OA 3O4RA 5B37A 1YONA 2HUNA 4DIOA 4NBUA 2YV3A 3LT0A 3B1JA 4E2XA 2X7HA 1CJCA 5JW6A 3KM0A 5CEEA 1ZXBA 4JCOA 4KP7A 5L4NA 4PZCA 1DRUA 5DT9A 1DAOA 3PHIA 1DSSG 3RQSA 4ZQGA 2PZJA 2ZB7A 2JL1A 3GZNA 4BNZA 3HDHA 4KWHA 2BHLA 3HUDA 2VT2A 3PHJA 3HN2A 4XX0A 5T6BA 1W6UA 2PR2A 1Y5MA 4I5FA 1P44A 1DHTA 4IIVA 4AICA 3FR7A 3UCXA 2ZCUA 2VTEA 4XEHA 2DTDA 4BO9A 1I2ZA 4J9VA 1D1SA 3FTNA 4X54A 3IIEA 4P4NA 3LLSA 4M49A 2VRCA 2Y1OA 3DTTA 1GPDG 2VHYA 4RZIA 2UAGA 5C7LO 3JQBA 1ZXLA 3AU8A 1WPQA 2D4AA 4IDDA 2AHRA 3FSRA 1C1XA 1G1AA 2BFOA 4DQXA 2IE0A 1E1KA 3INRA 2A9FA 2GN8A 1MG5A 2GNAA 1WDKA 2QYSA 3QQPA 1XA0A 1B3BA 1JAYA 3MEQA 4Q3BA 4R69A 2QIOA 3OBBA 3B20A 3PI7A 3PZRA 3SXPA 4AJ4A 1YGYA 4TZKA 3TPCA 1NVMB 2DBQA 2O7SA 3NDIA 2VNAA 3E9NA 5G2OA 1LJ8A 1IE3A 3DHEA 5JC8A 5JAIA 3H6KA 2C2YA 2PKRA 3ZWYA 4GI2A 3RC7A 3ZV3A 4QUKA 4PLZA 1OBFO 4YJDA 1FDWA 3VZPA 4JBGA 2CFCA 3C1AA 4YWJA 1TT7A 1OZAA 1KVQA 4R4JA 2WEKA 3HWRA 2VT3A 5KVQA 4HV4A 3GHHA 3QVTA 3WYCA 2JFHA 2A92A 1VL0A 1FJHA 1PGPA 2NACA 2QHXA 4FR5A 4ZD6A 1U1IA 1E5LA 1LRKA 2FHSA 4MINA 4G65A 4AL4A 3VPHA 3WBFA 1KERA 1LRLA 3EDMA 4E4YA 5JXWA 5KNLA 3WB9A 1B7GO 3CE6A 4NBVA 4HP8A 3VTZA 4BIIA 4IS2A 4KOAA 4F46A 1BTOA 4PVDA 1DB3A 1ONOA 2CF6A 1LUAA 4Z0TA 1HDRA 3JQCA 2VUUA 3L4SO 4J7CA 2VWPA 1EVYA 1B26A 4E2ZA 3KO8A 4YAKA 4XRGA 4MOWA 4DLAA 3PGJA 3E5MA 4QFDA 4WEOA 4R1TA 4OKNA 5FWNA 3ANMA 1H6BA 1DRWA 3ANNA 4XGIA 3NYWA 1PL8A 3OHSX 1NFFA 2TMGA 5DULA 3RUDA 3KLMX 4PLFA 4WLVA 5A02A 2CVQA 1XDWA 2I6TA 4DIBA 1RYDA 2FP4A 4YT2A 3WWZA 2W98A 3G1TA 5B12A 1PGJA 3HB4X 2BKAA 1P9LA 2P4QA 3DEYX 1D7OA 1PL7A 1U2DA 4WJZA 1NWCA 3ROMA 5IZ4A 3CXRA 3H9GA 4YJGA 1NPYA 3S55A 1PTJA 3JD2A 3V2UA 3WJ7A 3RBZA 2NNLD 2BGKA 3IJRA 4Z9FA 2WJPA 2I5PO 4ND2A 3INGA 3K6JA 2Q49A 4QECA 1IYZA 1Y1PA 3BA1A 4O5OA 4DC0A 3I6IA 3LC7O 3W8FA 1MXHA 5AXBA 2DFVA 4YRDA 4C7JA 4GBJA 3BMQB 3JQGB 1C14A 1LX6A 1FDTA 1I10A 3PLNA 4Z0PA 3EZYA 1V3TA 1ZKMA 3KEQA 3PQDA 1IUKA 4BNWA 4Z9YA 3GUYA 2X0NA 2IYPA 3GLQA 1M2WA 4XIYA 4J1QA 5IXSA 2Y0CA 1WZEA 1GU7A 2Q46A 4OHUA 3F6YA 4B4VA 4TWRA 3RI3A 4J43A 5DCYA 2C59A 1PR3A 3AUUA 1V6AA 4CM8B 3PP8A 4E0BA 4J1TA 3F5SA 4DYVA 1FDUA 2X8LA 5DBFA 5KVSA 1E7WA 2HQ1A 4OQYA 1EZ4A 5AXAA 3M6IA 1J6UA 2IZ0A 3QWAA 4KDFA 5ER6A 3U0BA 3GNQA 2WTBA 3FPCA 1GADO 2C82A 1GZ6A 2CDAA 4RLSA 4TKLA 2Y68A 3V1UA 4RL6A 2BD0A 2VYVD 1XHLA 1Y5RA 1KVTA 3GDOA 3UICA 4Y6SA 1NQOA 1PZGA 3DZFA 3P19A 4GVXA 2FSVA 3P7MA 2O4UX 3C8MA 1JWBB 5EERA 2X22A 5DP1A 3MJTA 2Q4BA 2HJSA 3EZLA 2NADA 5KTKA 4F6LA 1HRDA 4JJGA 1IOLA 2GZ3A 1N2SA 5I7EA 4FFNA 1LLCA 3NDJA 4INAA 4U5QA 1KYQA 4IXWA 5F21A 1D8AA 5CDGA 4XGNA 3SBOA 1JVBA 1R37A 1X14A 4NBTA 3WFJA 3U4DA 4D43A 1BXKA 5I7SA 3GEDA 5AXDA 1I01A 1EUCA 2EP7A 2O7QA 3MTJA 1U4OA 4WLUA 3I9JA 1T1SA 2HRBA 5CEJA 4BB6A 5KJ6A 4MKRA 3F1KA 4I08A 4NK4A 2O48X 2P5UA 3DTYA 3OQ6A 3PXXA 4XQGA 3ZWXA 2OGUA 1UXIA 4QXMA 3WG9A 4CODB 1WZIA 5THQA 3LT2A 4HFJA 4D42A 2CMDA 2OFPA 2B0JA 5GMOA 1EVZA 1K6IA 2X58A 4GX5A 5G0SA 5KCZA 1MUUA 3V1YA 3GDFA 3P2YA 1DDOA 4RVUA 1HE5A 5CG1A 2D3TA 4R9SA 2DPGA 4DBVO 2FZEA 2JFFA 5EN4A 3SJUA 5TT1A 4E30A 3Q9NA 3VZSA 2RH4A 4Y8VA 2IZ1A 5EMHA 1G6KA 1CWUA 5TC4A 3M2PA 5DP2A 1B14A 4RORA 3WBBA 4CM1A 3W8DA 1A27A 3UN1A 3AU9A 3SC6A 4MIEA 1XQ6A 3RU9A 3FPLA 1ZJYA 2PZLA 3DZKA 4MVJD 3C1TA 4BNMA 3ETGA 1HZJA 3QA9A 2EXXA 4E33A 3KSZO 4K6CA 3JYPA 4D44A 3TDKA 3AFNA 1C3VA 2PLAA 1N92A 4PGFA 4ILKA 4R51A 3F9IA 3NKLA 1Z73A 4ROSA 4CJXA 1WDLA 3X2FA 3PDUA 4Q3DA 1O95A 5HRUA 2Q50A 1P1IA 4CMHA 1UP7A 1QP8A 3HE3A 4DA9A 3VH2A 4Z3KA 4R1SA 2JCXA 3BYZA 1ID1A 1OC4A 5LC1A 3RIHA 3FWZA 4BNYA 3A4VA 4ZU3A 2NWQA 2O2SA 5JY1A 3JD3A 4G2NA 3TNLA 4DVJA 4DMMA 2O3UA 1N1GA 2BFMA 2EERA 2BF7A 1K6XA 3AI2A 2FZWA 2Z1MA 2D5CA 1EEHA 1JU9A 2UDPA 1DHRA 3W4KA 4BO8A 3K2BA 3CTMA 2JCVA 2P9EA 1BVUA 4BNJA 3KEOA 2GZ2A 1GEGA 3WDSA 3ZV5A 4RJTA 5JAMA 1EDOA 3E9MA 4YAGA 3ZWWA 1MGOA 1HETA 1JLLA 7ADHA 3SJ7A 4IXTA 2FR1A 1MX3A 2W2KB 3A1NA 1U4SA 1FK8A 1GQQA 5TF4A 4D3SA 4IDEA 4KQXA 4LMPA 3S1LA 5EESA 3SEFA 4CL3A 4DLLA 4DIFA 3DHYA 4ALJA 1B3RA 2B4QA 2CDCA 1N7GA 3HJAA 5TJ9A 3WGYA 1EQUA 3V8BA 4BNLA 3VPSA 2ZIZA 1ZK0A 2PWZA 4EI2A 4UVIA 4NMHA 4CR7A 1YL7A 5JMPA 1UAYA 2C29D 3QVWA 4D0SA 1YJ8A 3R0IA 3OQ1A 3GMDA 2OORA 2CVZA 1SPXA 2EW2A 1R16A 2NM0A 4JIGA 4UVDA 3F46A 2GN4A 2NSDA 2RAFA 3GN2A 3HZZA 3FRJA 2I65A 2J8ZA 5DZSA 1OMOA 2GN9A 4Q3AA 3UGKA 4CMKA 4PZEA 4YJHB 5KKCA 3VKUA 1ADGA 1GUYA 2PTGA 2B4TO 5AQ1A 1B2LA 2G82A 2DQ4A 1M66A 3GVXA 4DLBA 3OJFA 1X7GA 1U5CA 2GDZA 4RPLA 3WMWA 5BSEA 4EBFA 3WYBA 4MVJA 3F5QA 4GPD1 4ND4A 5F3RA 3DC2A 2W2KA 2J5KA 4GKVA 1VC2A 3W1VA 2FPGA 3A06A 4PN3A 3K30A 4D41A 1BXGB 1CQIA 2FWMX 3PTZA 3EK2A 5LDGA 2BELA 4GKBA 3AUAA 1AGNA 2YHIB 3DB2A 1MB4A 3ITDA 4KWIA 1NVTA 4W7HA 4RVGA 1HXHA 3OP4A 3LVFO 2CNBA 4A5OA 3EUWA 3IQDB 3IJPA 2Z95A 3HHPA 1NYTA 3KYCB 1HEUA 2OHXA 3DOOA 5EIOA 1LNQA 3D5QA 5GZ3A 5JMWA 1GQYA 3U09A 2JCYA 3ITKA 3JYQA 4EUEA 3JYOA 3KHUA 1ZSYA 4NHEA 1LSJA 3O38A 2WD8A 4RZHA 3ZN2A 2O3SA 3EC7A 4PZDA 4ONEA 4FFLA 5IDWA 2Y1FA 1GL3A 2J5QA 5L7YA 3DFZA 3FWNA 4CV0A 3TSCA 4YJHA 3IMFA 3L6EA 3GEGA 3RU7A 4OO3A 1BG6A 3I4CA 1BW9B 1DBVO 1I8TA 2PGLA 5H83A 1HE3A 1ZSNA 2AG8A 4WPGA 4YXFA 1TVEA 3DAFA 2R2GA 3QW2A 1NQTA 3ZDFA 5IXYA 1NHWA 4D3DA 1HF3A 1RM3A 5JBIA 5ER9A 1NM5A 1U7HA 3JCZA 2YQ4A 4IDFA 1ZCJA 2QRKA 4L76A 3FNHA 4L0QA 1UDAA 4FS3A 3TWOA 3RUIA 1A4IA 4PLYA 1HTBA 5ADHA 4F3YA 4HFRA 5IDXA 1BXGA 1UZLA 2EJVA 2X4GA 1NQ5A 1Q7CA 2YHIA 1YB4A 1NAIA 4OOEA 5KJCA 5TLSA 3ZV6A 2PZMA 4XYMA 3KZVA 1F0YA 2PK3A 1I33A 3KYCA 1F06A 1JTVA 1PQWA 3QLJA 1V3VA 5EQFA 2JD0A 3AY3A 3I9LA 1PZFA
chains in the Genus database with same CATH superfamily
2OV8A 1BX3A 2WUGA 1K1EA 3IOEA 2QT1A 4JP3A 2DCMA 4XCQA 5C5IA 4RZSA 4PC2A 2QJTA 3M6UA 3U3XA 3VDMA 3DVAB 3KUDA 1TADA 5HCIA 2O8FA 4RCVA 3DUWA 1LPAB 5TQ0A 2WF6A 4YAIA 1QFZA 2A9RA 4DPMA 3C5EA 1T2VA 2QW8A 3EIQA 4YRLA 4XGQA 1KY4A 2WF8A 1JDUA 2XV1A 5I45A 3L7AA 2I67A 1M8KA 1QHFA 1T0IA 1GZ4A 4JLKA 5D5PA 4D92A 3NOVA 3PJEA 4GO1A 2XB2A 3ZW9A 4PLVA 1ZK3A 4LF8B 2Y6UA 3EBOA 5JFGA 1S3FA 4EKNB 3MM4A 1B8OA 4H4EA 1W48A 1X77A 4KR9A 5C5EA 3R5SA 2OG1A 1HOTA 1KXZA 1QQ6A 2FWRA 4DDKA 5E3JA 1CQWA 2ZYSA 3G2KA 4U00A 5DI3A 3WOVA 5KU7A 1E1LA 3STWA 4GVLA 3T8YA 1V1MB 3GYGA 2EKQA 2YBEA 3D0QA 3N87A 3BZWA 3UB4A 5AIBA 3DL0A 3CJQA 2GFQA 1RKUA 3CV3A 3G2HA 4Y18A 2NXJA 2PMWB 4G4IA 1ISRA 1WTAA 1GPUA 1CE8A 1MR3F 1QR2A 2REXB 2PT6A 2X2EA 3FVWA 1DO8A 5DI9A 2NOAA 5ERGB 4TYNA 4HDAA 5B7QA 1CJTC 1KH2A 2QJFA 4OGWA 1TKBA 4Q1EA 4QT0A 1NUPA 4U2GA 2H1SA 3Q9SA 4RKQA 2OLEA 4LX0A 5ELLA 4D7AA 3FMPB 2XTJA 1KI1A 9ATCA 4GOLD 1QHYA 2F48A 3GLFB 4JLNA 1ECLA 4JJ6A 4UATA 5EEGA 5DTQA 1OFIA 4J8PA 5K0LA 2WPNA 1OVGA 3EZGA 4LOJA 4RK7A 1WCXA 1G4AE 2V3VA 4RPCA 3TOSA 5JJ5A 1E2DA 3U9SA 3FZGA 1JAIA 3MBIA 1PK9A 3R3ZA 5TS3A 5LD2C 3BTOA 4YJ3B 5DCWA 3OZTA 3BMCA 1VBFA 5ELMA 3T3NA 5K01A 1KZ1A 1PG2A 3EA4A 3FTQA 4B2IA 4J6FA 3MMPA 3SIWA 1FDOA 3AWIA 4DBLE 2FHPA 1RZRD 1ZHOA 2CCJA 3O3MB 2GCIA 2UUCB 1DCFA 1RXSA 4B6RA 1U28A 5KU1A 4E21A 1M6HA 3BEDA 4HN2A 3LZDA 4RENA 4Y2RA 5TF0A 4EFNA 5FI3A 5CFLA 5BT9A 3VPGA 5B3JA 3CLRC 1G19A 1Z88A 1JAXA 1N33B 3ST7A 2K7FA 5EQJB 4E12A 4NXNB 1RFLA 3CPHA 1ONSA 4DNOA 2GD2A 4FBLA 1EX6A 2BFFA 1XTVA 1Y8RA 2W42A 2I7TA 1WETA 5EG5A 4YRKA 5T3YA 3S40A 1A3CA 1YRBA 2V0NA 5J2UF 3NMUF 1ORRA 3IAUA 2Q8NA 2OKGA 3K6RA 3T9FA 5L95A 2Y76A 5KWIA 3RE1A 2ODBA 4X93A 4TN5A 1YB2A 1SO8A 4P0TA 3RS5A 3K71B 1I94B 2C2ZA 3HJHA 1GLGA 2QW1A 1Z5WA 1SEVA 3VMFA 4N7JA 1NF3A 5EPUA 3UTDA 5JVDF 1YKGA 3ASYA 1H2BA 3ETHA 1V5GA 2CNOA 4OYLA 4UVGA 5B7GA 4MH0R 1P9WA 1JR4A 4O1MA 2REQA 1VSUA 5MN6A 4D9NA 1VE3A 3HY4A 2PANA 3OIWA 1YBFA 1X80B 4JYAB 2JHGA 4EH1A 3PVSA 1PV2A 1RMTA 2H1CA 2FMHA 4MPJA 1I32A 4XX1A 2FUCA 2G9RA 4QASA 4JVLA 2C4KA 4XLTA 3MSCA 1O4WA 3IMKA 1COZA 6Q21A 1AU9A 1XJ5A 3GZJA 2PH1A 4QGBA 4C4ZA 2G63A 2IU4A 4IIUA 2C4HA 3SAJA 5EIBC 1WPRA 3R7FA 4CTMA 2OZKA 3C3AA 1K9VF 2C07A 4LHSA 1IVNA 3HBFA 4PXAA 2HW8A 4OV6B 1J0BA 1M2EA 1A9PA 4II2A 3SLGA 1H42A 1XT6A 5JTTA 4OX9B 1TTTA 4OP2A 3PUVA 3WGZA 3DBLB 2XE6A 2IJGX 4QDJA 2F6RA 4LJRA 3ONNA 3WXMA 4OAOA 4NBKA 4TTVA 3RCBA 3UENA 2YY6A 4X1KA 4BASA 3RYCB 1WZNA 1ZJWA 3DFFA 4ID9A 1IJKA 2JAOA 3A4LA 2X0RA 3CLHA 4G67A 3ZNQA 1SXPA 1G63A 1A04A 1R0XA 2HUPA 3PR3A 3MT7A 1ONPA 4BVAA 2Q5EA 4JA0A 1ZGGA 1P0MA 1BU5A 1WZ2A 2DERA 4G0ZA 2GD1O 4O6VA 3PRJA 1CZUA 1T0JB 3OJXA 3SMVA 1SY7A 1GV1A 2HF8A 1FUKA 3QFTA 4AC9A 2XUOA 1IPHA 2ZWPA 4NU0A 4QOJA 2NUAA 4FJ1A 3DEJA 4L2IA 3GNLA 1SUEA 3H8WA 1YRWA 4FHZA 4AYWA 5ICGA 2ECQA 3OU6A 4M1QA 4M9QA 1IOZA 2FUEA 1Q7EA 3GAAA 3OF2A 4TLMB 3RQIA 1F8GA 1BOFA 1VSVA 5JDCA 3JD0A 5AJZA 5E8JA 3U4GA 4OHZA 3FFXA 2ZUTA 1NX9A 2VQSA 3SIXA 1WWKA 3LD9A 1HUQA 2K7ZA 2VJMA 4JJAA 4EPRA 2BKUA 1N3IA 3EXIA 5FUXA 1ZIOA 1KQFA 3OD5A 1T24A 2QBYA 3KKKA 3CVJA 4IJWA 1M0WA 1ZKDA 2GSWA 3GD7A 5IBPA 2QX7A 3C41J 2B83A 3QBTA 3TW8A 1R4MB 4KAAA 4OHYA 2POCA 3BXGA 3RROA 5JSUA 6NULA 3MWFA 4PQRA 5H82A 1KQGA 1RYYA 5J2TA 1NY5A 5CD1A 4K9MA 4FI3C 3KEGA 1U0OC 4G86A 4LXIA 1VG8A 4I99A 2H4JA 4MA5A 5EKUA 4D9GA 3GY0A 2HHCA 3QFSA 4Z4FA 1UIRA 1ZICA 1XCBA 4L0MA 4O2AB 4TVOA 2HXYA 3A9TA 3KTAA 4WMLA 3KT8A 4JP5A 3THYA 4KVFA 2ENUA 1G17A 4MTLA 1QUEA 4ENWA 4CKEB 3GDWA 5BV2P 2XDYA 3P27A 4QG7A 4BFXA 5LBUA 1M8PA 1H0SA 4DJFC 3RS9A 5AVSA 3RGWS 3M33A 4H0NA 1EFDN 4PFSA 2YR0A 2HAEA 3JVEA 1LPSA 3A1UA 1CEQA 5EY5B 1CT9A 3EG9A 3JR3A 1RQPA 4BFCA 1LBEA 1MB3A 2P11A 4H7HA 3UAZA 2ISQA 4HXGA 5TX7A 3ONDA 2FFQA 2ANBA 3FHOA 2AFIA 4M8IA 4MKFA 4NZNA 2QD4A 4Q4AB 1XMIA 1Y9JA 1Z5GA 2OENG 4M6WA 1I9GA 3N7UA 5T8KA 1JG4A 3MGAA 3HVRA 1PT8A 3DL2A 4M1ZA 1PGQA 3GLIA 3FDZA 3HXTA 3BDAA 4Y2GA 2Q27A 2VPQA 2UU9B 4F56A 1PVDA 2C2BA 1F2DA 4MYTA 2ZSUA 4MQEA 2PZFA 2G9QA 2NUTB 3D31A 1HURA 3A1VA 1IL0A 2WHXA 2ZJFA 4DR4B 3QEJA 4H15A 2AFHE 1I7PA 2Z3VA 3BS4A 3V2GA 3PEUA 4HQRA 3I34X 3SOPA 4E5DA 4XQCA 4PPNA 4D80A 4E6PA 4ALNA 3I73A 3PYLA 3FYDA 4LWQA 1W4RA 3E22B 5EZYA 5E7JA 3LUCA 3R3HA 2C2GA 3JD4A 2EKZA 4UQOA 2NPOA 4BLWA 3KPUA 4EUNA 3KSUA 1GTJ1 1WCV1 1ENYA 1L4KA 1BKYA 1PFQA 4AECA 4B4OA 1X74A 3AYXB 3QY0A 1QX4A 5JY6A 2GAIA 1ODCA 1K8YB 1SU6A 3ZGNA 5CITA 3AL3A 3SZLA 1LK7A 3PJFA 2PUBA 1TGVA 2BKVA 4EKYA 3QU7A 1X9HA 4IDCA 2HF7A 3BXZA 2RHWA 3DOIA 5IVKA 4NJEA 2P4SA 1XLWA 4FQ5A 1PJSA 4W63A 3EZ6A 2FEWB 5HEKA 4K9QA 1G4HA 4IV5A 4B45A 1Z83A 4ISCA 1Y37A 3TQSA 5A1TA 4LYFA 1EZ1A 3L41A 2JA2A 1OGYA 2V7WA 3LYUA 3ENVA 4G5RA 4RPHA 3COPA 1JTFA 1V1RB 3BRWD 1YDEA 2QZZA 1VCMA 3MLAA 4OHKA 2EQAA 2WTEA 1G7TA 2CLLB 5KCMA 2VSFA 3IVMA 3OT5A 1DQZA 4QATA 1R4NA 3MJSA 2G5TA 2H6EA 2YN0A 3ORFA 5JVDA 1U2PA 4EATA 1P18A 1YCGA 3H19A 1XCGB 3AC0A 1ML3A 4IFIA 5LXTF 4YV1A 1N3LA 4DUGA 5JNSA 1ENZA 1YR7A 3ZDZB 4BHTA 2J1LA 4UFNA 1GNVA 1IJEA 1E2LA 3FOAA 3HZHA 1I36A 1M1YB 1JHPA 3TNJA 4A6DA 2DVMA 1XSEA 3QGMA 2CGEA 3MRTA 5IM5A 4WTOA 1MA3A 1HT2E 2JRCA 4JD5A 3HHEA 1T9DA 4QO8A 5F1KA 3UT5A 1EFPB 3IE2A 4QWWA 3Q2OA 3ETNA 4RD1A 2WYUA 4QKQA 1T9AA 1UBSB 4G07A 4I1RA 1VZ3A 2B1JA 2Q3BA 3SJAA 4BUCA 1N5KA 1EBFA 3MLBA 3ECAA 2ZBPA 3L7OA 3LGXA 3RADC 3NHZA 5ILOA 2Z30A 1ZEMA 4QOHA 4MLZA 1TYBE 3LW7A 2HBZA 4MQ6A 1R7RA 4F6RA 1KU0A 1FSPA 1HGXA 4FKMA 4BBAA 5FUBA 1YBMA 4I4LA 1IXRC 3DW3X 2XOEA 4G4GA 2Q1SA 2XGJA 3TEMA 3VKHA 4JC5A 3M5DA 2Q2QA 3DA8A 3AI1A 2A8YA 3Q11A 3WP1B 3RHSA 5FEMA 3GDHA 1ZOIA 4RJKA 1DBPA 4RF5A 4M54A 3AB7A 3JARA 4ZRMA 1Z13A 3F6RA 4QXPA 4B48A 3T1HB 4Q7JB 5DW3A 1XPRA 1EUDA 4JDUA 4PC1A 3FUTA 1T3ZA 1NYRA 4BGPA 2RHDA 4KMSA 1TEHA 2D7JA 3IEVA 4E13A 3VSAA 5CDTA 5HE8A 4CM8A 4D74A 4J07A 1KAOA 2XLCA 4PZ9A 3WWEA 1XZQA 3EGWA 2FJPA 3RSZA 3E3MA 5LQAA 1M34A 4N7BA 1A8UA 2C99A 4Z4CA 3TKYA 3VHRA 5CB8A 3QVSA 4E1AA 4NNPA 4MVJM 3QNMA 2G67A 3EZ7A 2R8OA 4RXMA 2HYDA 4AMUA 4X90A 4KWEA 4TXMA 4YDQA 4Z4EA 2LRHA 3FOEC 2W0SA 4XIJA 4DCVA 2ZBRA 1XFDA 2D13A 2BRUA 4FFPA 5JH7F 5B1IA 3KETA 1SOVA 4CCWA 5JS1A 3AZOA 1DGQA 3QJGA 1Q1ZA 2Z9DA 4OI1A 5HK8A 2QLNA 4EGAA 4GG1A 1IDOA 1C9MA 1I3OA 4KLRA 3WIDA 1PTKA 3WYDA 5KVVA 2D1RA 1OFUX 1FVXA 3MHPA 4FQ8A 3K7EA 1FPMA 4WIAA 1E62A 1Q92A 2J7KA 5IYZB 2D6FA 1E1QD 5SYNA 1GNSA 3CCBA 3A11A 1C30A 3NP7A 4E31A 5HSGA 4AJ1A 4NBWA 1JXMA 4BGVA 3FFTA 3FCEA 2IOHA 4JWKA 4L6IA 3CNHA 1Z2DA 2P8JA 2PY6A 4NEGA 5J1SB 3HXOA 1Z39A 4GD3Q 3RJTA 4LC0A 3P0EA 5FBQB 4D6XA 1U2GA 2GM9A 2Q1TA 2QL5A 4DKXA 1FMCA 4EG3A 1QU3A 3SDBA 3RIMA 1ND6A 5L45A 3WAGA 2QE7D 1W29A 2W6PA 4ZI3A 3V4LA 3H6GA 4LYYA 1E1MA 1PDVA 3NBAA 2R8BA 1SIBE 1J06A 1RWOA 2O20A 2QLBA 3DAGA 3KKZA 5HBGA 2O7RA 3RIXA 5KTOA 3KKQA 2ZRHA 2ECKA 1RZVA 3BL8A 3VHLB 1J0EA 1Z7BA 2QRMA 1NULA 3UOAB 3WGIA 3HXMA 2J9YB 1PL0A 2V9PA 4NE2A 1Z36A 1O96A 1S2NA 2FRDC 3KCQA 1QRRA 2PMCA 1A5ZA 3EY4A 6CHYA 4LSWA 3EXEA 1WMBA 2ZR0A 1QJ4A 4FMCB 3HLTA 3CNEA 4KQGA 5CDSA 1A4UA 1K6MA 1GQFA 4P84A 5EJEA 4EYKA 5TGDA 1EK0A 5ALPA 2JFUA 2ONKA 4ZQFA 4IUDS 3C24A 3UGTA 5BR7A 1WXHA 3R77A 1N75A 3PUWA 3ADDA 2AFHB 3KWLA 1VHTA 4CBVA 3LQ4A 1R9NA 5A2QA 2UXCB 2JH9A 5CM8B 4FP9A 1XMJA 3FZYA 1T1RA 2O0HA 3IOMA 4PYIA 2GCPA 5EHXA 4A8PA 2QZJA 1D4AA 2MSNA 2J5XA 2NYRA 1FS6A 1USWA 1U1FA 5LQJA 3ET4A 2ABWA 1UDRA 3ZD8A 4JJZA 1ZYUA 1AKNA 4CM5A 1A5AB 2OCDA 3F96A 5AYVA 2IYEA 3W2TA 2AOXA 2DMRA 1G0OA 2EFYA 3EY9A 1XVIA 3R5KA 4UHCA 1ADCA 1H4VB 2BV3A 5BNZA 1KJQA 1G20A 5IH3A 1Z2OX 1EXNA 2PZKA 3H8VA 4XPZA 1LC0A 2QYOA 2QNBA 2W6MA 3L8CA 4YO7A 3TM4A 3CUWA 4YJ2A 3Q40A 4MYSA 1NMSA 1X0XA 1DEHA 4K2HA 2FP3A 4FSDA 3WA6A 4MUFA 3THRA 3SS7X 3WWPA 1V7ZA 1RPNA 4HXFB 4HGNA 5ALXA 5DX1A 3VDQA 2QRGA 3ZZMA 1NG9A 3PC3A 5H81A 4OF4A 3TMAA 1EM8A 1PV1A 5ABPA 1DUVG 2XW6A 3VR3A 4CFSA 4HKTA 2XCLA 3FSGA 3GLTA 4PSUA 1E92A 1JIXA 2BCJQ 4YB8A 5A3VA 3W5VA 4JUFA 1TTPB 1VG9B 1YOBA 3L1IA 1EDBA 4K8OA 3SEZA 3QE9Y 1USVA 2QI9F 2GZRA 2VIIA 4MWCA 3D8TA 4AUMA 3TF5A 1H0HA 1NI4B 4X1IB 4WNIA 2AW3A 4J4TA 2IEAA 3VR4D 4D9MA 5C7IO 5JRZA 4GOOD 5FKJA 3T9AA 2D1SA 5KDDA 3ZD7A 1H5QA 1M6YA 1BXZA 1PWYE 1QIFA 3G02A 4IMJB 3DLIA 4IV0A 4AVYA 2FWBA 2IY8A 4J0IA 4XCVA 2OXFA 3HDYA 3WS7A 5IF9A 5KPJA 3LIPA 3A05A 3QVLA 1ZM4A 3B1ZA 3RSHA 3WSVA 5TQ2B 4HB4A 2IZ7A 2P67A 4P53A 3IT0A 3CUVA 4PYKA 4R8SA 5EPOA 5TMBA 4HDQB 1J4AA 3K73O 3MTAA 2VLIA 5HIAA 1JQKA 2WUEA 3GFFA 4HYYA 2VS1A 4V3CA 1U8XX 5JNLA 4I4CA 2J9XB 1XX6A 3ASVA 3S5UA 5F9FA 2YZNA 3KJHA 3BL5A 4O4JB 4JU9A 2V4ZA 2AN1A 3G0BA 3OPYA 4DMRA 3OZSA 2G25A 1E69A 5IT0A 1V2GA 3FUWA 5HKAA 2Z6QA 3KAPA 3K0CA 3G2NA 3BD6A 3IBCA 4RD0A 3JVUA 4REMA 1REQA 4QZVA 3R3JA 2QUHA 2P2SA 2I6GA 1ZMRA 1XL1A 4IJUA 4AF6A 1IVSA 3V4ZA 2R9VA 3JSXA 3QEBZ 2AV6A 3QUBA 4S2UA 1WKVA 5CTJA 2OP1A 4A26A 1D8TA 1UUFA 3DPUA 3OFVA 3A9VA 4QU5A 2LVBA 3VM6A 4KR2A 4JCCA 3U60B 1Y3IA 1XJQA 5JAZA 5DE3A 1V1JA 1PJBA 3C4QA 2JLSA 1EK2A 2KLBA 1FF9A 5ICSA 1R6XA 1IHPA 2UZ4A 1Q0TA 4PG7A 5M2QA 1JN0A 1PT9A 1Q0LA 1YNOA 3MZ0A 3ND9A 3I58A 3OTGA 3OJ0A 3G5LA 4K5QA 3KC2A 2ZQZA 1UJBA 3DD1A 3JQ8B 3Q9LA 4HWPA 1CTQA 4GI3A 1IXZA 2LV8A 3CS3A 4P9NA 1BEEA 4CIBA 3EW7A 3GROA 1VL8A 2HCRA 3ZLBA 3I1YA 1RJEA 4H27A 2XY4A 2H4XA 5AHWA 2FEOA 3I32A 3HNPA 3PUXA 2R7MA 3I0NA 4FZRA 2CC2A 1R3DA 1KY3A 1ISIA 1J97A 4D82A 3F0TA 2DOKA 3HM9A 1Z7YA 2BSAA 2RH8A 2FSGA 1FFCA 2VRWA 4J3JA 4TROA 3TNFA 2F2TA 3PWTA 3WL5A 5JH7A 2L0XA 5C4MA 5T57A 3QOYA 5KHOC 3HDVA 2FN3A 4F8JA 1LX7A 2YW2A 4K87A 5A6VA 1MW9X 2C9ZA 2WWXA 3AX6A 2JLRA 3IQIX 4L5BA 3STTA 1TCCA 3DMRA 3ZDAA 3NNSA 3QLVC 4OBWA 5G4KA 1PBTA 3OE7A 4EARA 3BULA 5LKRA 1FMTA 4Z2AA 2ZATA 2QM0A 2XMRA 1PNOA 1XR3A 2CHQA 3KB8A 3VR5H 1XD2B 4FINA 3SNKA 1TM1E 3D8NA 1GL6A 3SS9X 1RJFA 5NULA 3PR1A 4F96A 2QOEA 3X3HA 1LW7A 2YUTA 2HHJA 4XDHA 1KO1A 2JBHA 4PLWA 3MYYA 3UJ3X 2WU8A 1U3WA 4FWTA 4N0EA 4ERNA 1M54A 4N5LA 2I2BA 3HH8A 1CZKA 3BB4A 3OM1A 3KUUA 2EEZA 2BMAA 1USUA 4Q18A 1F14A 4AZVA 2QTFA 1RDFA 1GUFA 3GRKA 4KPUA 2O4CA 3C3KA 4AMBA 4FZVA 2YMMA 5BSHA 1ABBA 2O8BA 2AKYA 1JI3A 5LOVF 1JQLB 4BLRA 1OGJA 5IUJC 2PUHA 4N76A 5I7AA 1CULC 3SC2B 2C7GA 2PRZA 5FJJA 3U7JA 2X7JA 1E9RA 2HV8A 3NTLA 3HWSA 5FUQA 5BXQC 5I01A 1T5TA 4IGFA 4QQNA 3IRUA 1ORTA 4HGRA 2O2EA 3MOSA 5LYJB 4GQBA 4WJLA 1KI6A 3NHJA 5DH9A 4CKWA 1F2UB 1M2HA 1PUJA 5K2MA 4JI6B 3UY4A 4A8JA 2ZE7A 4KQMA 4U39A 5TMDA 3GG9A 4IM7A 3TAHA 5BR8B 1SZPA 2JZCA 1AX9A 3Q7PA 3A4NA 4KN8A 4BC0A 5FORA 2BF4A 4IVNA 5AIAA 4CW7A 3W9YA 1KP3A 3HCOA 5I9NA 3PE4A 3L5OA 4NCJA 1E9EA 3GP3A 5KMGB 2CZGA 5AOVA 1HO3A 1M8GA 3RBVA 4KRGA 1PGNA 2BMVA 4KSBA 2ZREA 1UK9A 2F67A 3CINA 3UMVA 1BHO1 1N3BA 2XUQA 1N9GB 1JA1A 1GPKA 4HWKA 5LP6A 2ZPTX 2VH5R 3CSSA 3EC1A 1JHQA 2PDAA 1VG1A 3VR6H 2EW8A 3EH1A 4Q1DA 4Q7KA 4ZYLA 1O6FA 2DU8A 2VK2A 3DOCA 2XXBA 4I46A 4BC1A 3U80A 2OHFA 1N0UA 1SVKA 4A0QA 3SKYA 2AQIA 3KZCA 1PJLA 2Q3HA 2VHCA 4FEGA 4R2LA 5JS2A 3TX6A 3ADOA 3I62A 1BRTA 4C6RA 1P0FA 1KYZA 2ZAYA 4CDGA 3RANA 5CAEA 4UQPA 4OGFA 2Q4OA 2FPLA 1KYXA 3GGPA 5TSDA 3QFRA 4F85A 2ODTX 1RLIA 3IQXA 4OLJA 1WY5A 3WKDA 2GD6A 4GXRA 3UB2A 1CQJA 3L8FA 3FTDA 5EZ6B 4EHHA 2GUGA 1YS9A 1G291 3QWFA 4FDLA 1IAVA 3JRWA 4FOTA 4J2HA 2O0MA 4MROA 1YUNA 1B8VA 3RBAA 1X7HA 8OHMA 2PRJA 3BWVA 3F2VA 3MS7A 2H1WA 5D1NA 4MHTA 2A3RA 3H5WA 3SKVA 2PKWA 4FUQA 5ESRA 5DM60 1G5FA 3PXDA 2GGSA 5L3SB 1KK3A 4QYTA 3PJRA 2AD5A 3IAS1 4JB3A 4QXRA 4DPLA 4PO9A 1B1CA 2YS7A 3HCFA 5F9MA 1RC8A 1FW8A 2A0KA 3ILYA 2A94A 2C8LA 2WYWA 3LCVB 3FHTA 1ENOA 5IKMA 1HOXA 3G0OA 5EXXA 5TARA 4BFVA 2XMSA 4P5DA 3L43A 4RPJA 2A6PA 1KI9A 2JIZA 3MS4A 3ZU2A 1C29B 1RM4A 2JK0A 3ILHA 4ND6A 1CUYA 4N12A 2FWIA 5DGHA 3ICEA 2QTAA 4UEWA 3X1YA 4A27A 5KAMA 3E15A 1FFGA 2ZYGA 2VDKB 4RKRA 3WYEA 5EIAA 3H5IA 1TK3A 2V1XA 1QGUA 1U1DA 4NIMA 1ZCAA 3F7TA 4D0LB 2VKTA 1DELA 4M8KA 4XJTA 1TYCA 5FPSA 3ZGVA 3JAKB 1RHJA 1LBHA 2ZTHA 2VDLB 4NFYA 2H8GA 1HYEA 4UUQA 5EMNA 4ZT7A 1Z06A 4EG8A 1TQ8A 1ZJJA 2BIFA 3UCEA 2AVDA 1H8EA 4FBMA 3BE6A 4BQSA 4Z7QB 2LTAA 1HDIA 1AUVA 1BYUA 1LDBA 2GBFA 2PN1A 3F3YA 4JKYA 2QAGC 4LV8B 1L7MA 1P1JA 1XQ1A 1AS0A 1WXQA 2D3WA 2Q3CA 1MFZA 4P3NA 1FU7A 3OE5A 1JDVA 4ROTA 3NNNA 3EPHA 1SHKA 4GP7A 5LIRA 3WL8A 3TYXA 2RD2A 4ZC1A 4TYYA 3HJRA 3HXLA 4E2WA 1N6RA 5HS6A 4FZ5A 4TV9A 4MRVA 1H2EA 3WICA 4AY3A 5CFZA 4PX2A 4HAOA 4KLCA 1G8SA 2J9GA 3U7EB 1C0PA 1U2ZA 3G1WA 4W9NA 3Q8WA 2NZUG 1QHNA 2XA2A 3E7FA 5E38A 3RC2A 5KWSA 3F9CA 1TECE 3KRTA 5GPBA 2ZU6A 3U44A 1P0CA 2HKIA 2NQTA 2GPBA 3H9QA 3SEAA 1D2RA 4DG8A 3ZWCA 5H9VA 2J9RA 3T3DA 10MHA 2B9EA 3PC7A 5IJWA 6ADHA 4OH7A 4MJ3A 3L1HA 1CUFA 3ME5A 4FN4A 2CXTA 3FR8A 3HYNA 4CMBA 4PC6A 4YDRA 4YAEA 3NATA 4OQLA 4OQXA 3LXRA 2F1HA 2GYUA 2PO5A 1TD9A 4NMWA 5C2JB 5J4HA 3AOEC 1C7ZA 4DV6B 4UJ3A 5K0BA 4FC7A 4I1PA 4GXQA 1DIAA 2EGGA 2J6BA 1P3DA 3ZCXA 1QCYA 3ZOZA 1F6BA 2YCBA 2XZPA 4DLWA 5K0TA 1DJPA 3JQ9C 1TVKA 2D06A 3EGXB 4G8JA 3TE6A 5FH9A 5L8VA 5YASA 2YNMD 3IBGA 3M5PA 4D8YA 3BJEA 3VZQA 2AI2A 2PSSA 1CUWA 3RR2A 4HNVA 5DTRA 3TXYA 1Q44A 2V7XA 4KK4A 4NH0A 5DLYA 4EO7A 4Z54A 1FMLA 3G5TA 3E5RA 1BNCA 1HQDA 1T2DA 2HPVA 4N7MA 4XYGA 4DE5A 3VGJA 1Z8HA 1NVDA 3PQ2A 1ZS9A 1JXAA 1XJ0A 1QLWA 2CUTA 3ABZA 3L4BC 4OM8A 4BP9A 5K6AC 2NU6A 2XQFA 1JG2A 1FU4A 1DBQA 2ZB8A 4FT4A 1QRUA 3D8BA 1U0GA 1BFDA 1EFUA 1QF7A 1SMKA 4QHTA 1U3TA 1D1QA 1QHSA 3DYBA 2QTGA 3C7AA 2ZSAA 3TINA 4B7XA 5K0FA 5KSOA 4Q3KA 1Q0ZA 3I6ZA 1QIGA 2FLVA 2W9XA 4ZU1X 2ZZNA 4ETNA 3MQ4A 1EDEA 1E5TA 4YAFA 1RIIA 2OVBA 1UM8A 3DXXA 4RQTA 1RLOA 2I2AA 5IVPA 2TSYB 1EFTA 3HSSA 4MVWA 3ZIAD 4BZZA 3RVLA 2VTVA 4WN3A 4O08A 2V9CA 1TJ3A 3MUNA 5TQVA 2OB1A 3WMEA 4PSAA 5KNCA 5CP8A 1G66A 2NZXA 4C03A 2JI4A 1ZX1A 1VGQA 2ZGVA 3PC8A 4XA8A 8LDHA 2FG7C 1Z8DA 3KVOA 5BO5A 2BFNA 2GOYA 3A6GA 4DQKA 5CT4A 2VJDA 2Z4SA 4HTFB 3TL2A 2BOVA 1R8XA 3UGQA 2B30A 1G2OA 3GA0A 3N2LA 3IUSA 3GJ8A 1E4EA 5TEWA 1B23P 2JJQA 4YA6A 1Z28A 1IQ0A 1RYFA 1VM6A 2OBYA 1I2CA 3ABSB 1MOPA 5F7JA 4Z7JA 3WL4A 4QC2A 1IY2A 3U7QB 1W36D 1GPLA 2NZJA 4XYLA 1B8UA 1T4CB 1UBNA 3MA0A 1AG9A 1RXYA 2H0RA 1TM3E 5DX8A 2B92A 3GWZA 1KU6A 1MC8A 2J9ZB 4YJGB 3MINB 5HP4A 4FEEA 2IS1A 5FT9A 1U8ZA 3V8QA 2FMTA 1CDEA 2CBZA 1IN8A 1JG3A 4RF2A 4ND8A 1YJBA 3P9YA 2DPHA 4KODA 3RKUA 4ZYTA 2PT9A 1AHHA 3CM0A 1PJAA 2DQKA 4YCJA 2PIDA 5HUQA 1OVMA 4ARIA 1EX9A 1JG1A 4D0NA 2AMFA 3CVWA 1SEPA 3QSGA 1FVFA 2LIVA 1OLSB 5L3QB 1SUPA 4M89A 3WYFA 1X15A 1CERA 2HCFA 2WD7B 3E03A 3R3SA 3BHIA 2JGEA 1M1XB 5AUQA 1QG2A 4G6ZA 1O0SA 4M0MA 2UV8A 4DSZA 1E6UA 1THMA 1Y3CE 3I9MA 2TECE 3FYCA 5CVVA 1X7ZB 3RBXA 3EB9A 4IXNA 1Z6TA 2RH9B 2Q7OE 4L75A 1SA0B 5LZ5A 4AKSA 1PQPA 2WU4A 2Z8ZA 3UMYA 1AT1A 3JZDA 2BFBB 4TL7A 4TTJA 4F1JA 1YVEI 1W96A 3FN4A 2PWPA 4G1BA 5KOJA 1Z4OA 1ZNZA 4ARZA 1NBOA 3TNDA 2HC9A 1ZJZA 3QMWA 5J63A 1IUPA 1IVYA 3UJBA 3IBSA 1MQ8B 3W5BA 4CCSA 2VUIB 3KCNA 3TLGA 4TZ0A 3HO1A 1DI0A 2FUG1 3KLPX 3MTGA 1YHNA 3GPIA 3PQEA 1KE2A 3W5SA 3DXZA 3RFCA 3SC4A 3FMGA 2HSZA 2VPWA 1RRFA 1N8TA 3ROZA 3ZCUA 3B6JA 4M83A 3VOSA 4LOKA 1JEJA 4JLJA 4BQEA 1QGZA 1ZJ4A 4TRJA 2PEYA 3SJZA 2GEJA 3RUCA 3GLGE 1SCBA 4Q39A 1QE3A 4KPEC 1MAUA 3PNBA 1D09A 2YYAA 5MHTA 1Z17A 2IXAA 1CRWG 2DHRA 3RFXA 1GRVA 4C5AA 2G36A 3U5ZB 1E20A 1KEPA 1O94D 1NOIA 4D98A 4H35A 3E5HA 2F9MA 2PX8A 3NWPA 4F7WA 1EWYA 3QYAA 4WGGA 1LA2A 3DE1X 4HUQA 4QTZA 5F78A 4CQMA 3S8YA 3OY2A 4ZI5A 4WAUA 1J2UA 3VVCA 2BH2A 3NV7A 2GA9A 3ONWA 3CPJB 3QF4A 4YVFA 5C81A 5KNBH 1UT6A 1T6BY 4FNOA 3ZDYB 4LVCA 2JS7A 4B79A 3GFPA 1XLTA 4JFAA 4RVFA 1SCQA 1EHCA 1XDBA 2XQJA 3SQMA 3BSWA 2ZIGA 3LLVA 1DCTA 5E4YA 2XCTB 4EK9A 3R9XB 1P39A 1XA3A 2LWIA 4QNRA 2E49A 3F6PA 3D6NB 3R7BA 2UVDA 3K05A 1EWRA 5F4ZA 4YPOA 5AI8A 5C9ZA 1GJRA 2VXCA 4WLOA 1U0LA 1GSAA 3L79A 3QUCA 5DM1A 3DEAA 5G0VA 4E09A 5F7OA 2GA8A 3H7AA 1JH9A 5DSZA 1RCTE 1MGPA 4D6YA 5J47A 4WASA 2J0VA 1D2MA 3QKRA 5AQEA 5ULLA 3K0AA 1ORWA 1QAMA 1RKBA 4NRDA 3HCBA 1L7VC 2D0OB 3T9BA 1EE1A 2W93A 4HMPA 1GN9A 2WT9A 3NEJA 5I48A 5K20A 3BN3A 4XSVA 4H6WA 4C2TA 3WOHA 2ZVQX 4WUVA 3UKJA 2FPRA 2I8LA 2LKCA 3CXUA 1LF5A 3BF7A 4AQYB 1GY8A 3AUFA 4W7IA 2B2XA 1DFHA 1SU7A 2ZSBA 2C5AA 3DWGA 4YV0A 2FLKA 3SZMA 5P21A 4NDNE 1IBMB 2I7VA 2XNDD 4BGUA 3OJCA 5T41A 3RAFC 4JU8A 2WB2A 1LDEA 1XTJA 2QG4A 1T26A 5A6SA 2QVXX 3LVQE 1ILWA 1AV7A 5TS2A 3VYVA 4NARA 4B71A 4KH0A 3EASA 2Q6TA 1ETUA 2O2CA 5C3MA 4QUHA 1E7RA 4A0SA 1L7XA 1RABA 4GP9A 4K26A 4JYPA 5E7MA 2AR9A 3MCVA 4CEHB 1S8FA 2EP5A 1W4ZA 3I3OA 3K1ZA 5EFZA 1ZUIA 2OCAA 3O4GA 1Z6QA 4KKVA 3PEFA 1F9EA 1BGWA 1DKNA 5AI0A 3ZWNA 1QONA 4DHEA 2GJ8A 2HY7A 5CHYA 1TYAE 1THTA 3EGDA 3DKRA 2Z2IA 3MN1A 4BLUA 1XGKA 2G28A 4BCCA 5LZ9A 3T7KA 3K6SB 4K03A 4DL9A 2PXCA 1SB8A 4P7BA 2DPXA 4GEGA 4YIKA 4LNHA 4KQCA 4MI6A 1ZN8A 1VG0B 1PWHA 1J8QA 4YYEA 4QJ3A 4OP3A 4DV2B 4KQEA 5BWBA 4HQ0A 3RRFA 4W1PA 3ZV4A 2N42A 1OXXK 1OYOA 5AWFC 2A5DA 2R6FA 2WHQA 4P4GA 5INTA 1V7PC 3DZDA 3PITA 2P75A 3B70A 4HLNA 4MTCA 2BH9A 3AJDA 4IUCS 2AXQA 2WYVA 4UUNA 4XVQA 3BWDD 4EDHA 5IBCA 2JLYA 4ENRA 3TLXA 3SGLA 2EQBA 1OBVA 1LQ2A 2RAPA 2X8JA 3NAZA 2XRMA 3P2MA 4TQUS 4GHWA 4TYMA 4Z0NA 5B7PA 1L4EA 4IGIA 1OB2A 2P90A 1G5PA 2FZKA 3P8ZA 4RA9A 4RQUA 1N5IA 4Q34A 4PZUA 1JQAA 2VPIA 1VJ5A 3LRTA 4PX9A 1K92A 2EZ8A 5C8DA 1BEZA 2QLMA 4V02A 3FPSA 1DVRA 4LBYA 4IMRA 3CZAA 1FQOA 1P2GA 1KJYA 4KMOA 1RP1A 4G09A 4B6OA 2ZJ1A 3GNSA 2PH7A 2IQIA 3AEKA 3K8QA 3E48A 3OQIA 3PGA1 4KZPA 4R41A 2BAGA 5KKAA 4WCVA 5E4JA 4RULA 5DMHA 4ZQEA 2EX0A 1LTHR 4L51A 1QHEA 2OZVA 4YASA 2NVUB 1VECA 3H7IA 3PGVA 3LHSA 1FNNA 4WSOA 5CVEA 1UDWA 5EXPA 4WE3A 1HYHA 3JQFA 1G8FA 1ZH6A 2WINI 1VZ2A 2WWWA 3TTXA 5JYEA 2AMLA 1QIHA 5MFZA 2I3ZA 1OKKA 3HKEA 4M1EA 1QKKA 3A4YA 5BNIA 2LBPA 1JPUA 2MR6A 2W48A 3R1IA 4X84A 3ZBTA 1RLJA 1GZHB 2IRWA 2P2NA 3A4TA 3GFVA 4DMLA 3O4HA 4LRSB 1QLHA 4HH3C 3C15C 4AURA 4ZMBA 3WGGA 1D2CA 1C81A 1I0IA 2JF0A 3RVSA 3UMRA 1YE8A 3ZNOA 1KZ9A 3M1IA 4MVJG 4XR4A 4XDYA 1H5UA 4M1WA 1GLVA 4NCKA 4RY8A 5D1HA 2FPIA 3R3WA 4Q9JA 1PNTA 1IN5A 1OD6A 1R0CA 1TVMA 4X71A 5EE3A 3R7NA 3SHOA 3V00A 5I8WA 3HK2A 4JJ8A 2VYVA 4B3TB 1NZDA 3M4NA 3GVHA 1PR2A 4HNGA 1QG6A 5IKPA 4R3WA 2VZEA 2X42A 1E4VA 1W49A 4MX8A 3ICVA 1S96A 2IYQA 1JBKA 2CNDA 1PLKA 5FL7D 3RAPR 3T7JA 5A9SB 3GLGB 3MWEB 1FX1A 3RHTA 2JJMA 2OSBA 1AURA 2Q4RA 5GINE 2JFYA 4LGVA 4HLQB 1PDOA 3P9XA 5IARA 4NQRA 1WW3A 5CPBA 2IOFA 3C6KA 4OG2A 5HF9A 3SDSA 3EGOA 3GJ7A 1FXUA 1XTBA 2IP1A 1JEYB 1J1IA 1NLMA 3I6QA 4X65B 3L1KA 4KUGA 3F2IA 4HDCA 5FNVA 1YZKA 4IRXA 5IJXA 2OBMA 3ZV7A 5JXJA 3HXKA 3N58A 1XKLA 4IHJB 3WADA 1TU0A 3CF2A 2QTWB 3WGMA 2E21A 3ESXA 3UAVA 1RI5A 5DK6A 4P32A 4A0GA 1VL2A 1MORA 3RC9A 3GJQA 3ND8A 3T95A 2EFGA 5DLEA 1U63A 1JT9A 4AMVA 3VSDA 4D2IA 5A06A 3NHWA 2V6FA 2WAAA 2OV4A 4QGGA 3NO4A 2RARA 2JJ8A 2J32A 4LJ9A 2R6HA 4KO4S 1JSRA 4M8LA 4DLVA 1R6BX 1UWLA 4TWBA 3IOCA 1Z4QA 1RQNA 3N86A 1Z6ZA 1PZNA 3FVTA 4FHFA 4R5HA 3VJKA 1QIJA 1TJPB 1D2GA 3FNBA 4MPPA 3RB8A 5KDOA 4Q6BA 1ZHHA 4LMRA 4WXMA 4M2LA 1DEOA 3GRAA 1M1UA 3ICOA 4MR8A 2P5SA 4XYBA 2IU0A 1CLUA 3AP3A 1GAWA 1KFBB 2TMYA 4FC6A 1UC4B 3S6JA 3TUIC 1QJCA 1EG2A 4AJNA 3IPAA 5ITZB 1IPEA 3ZDDA 3MTBA 1Z34A 2II6A 3VR4H 3VYWA 5MGBA 2BE9A 4Y2SA 4Q02A 5IC4A 2C3MA 1NGSA 3OEHA 2Q99A 2BFAA 4NCNA 2O6HA 3VAZA 3ESZA 1ADFA 3PENA 4GMKA 1U8AA 1GIAA 1YB7A 2HJHA 2QN6A 4IEFB 2AXNA 2UZIR 2V6BA 1IXKA 5E7QA 3JQAD 2HMWA 5JAPA 1O1YA 1ZOOA 2B9VA 4DCPA 1V11B 3LBNA 2ZQ5A 3S2EA 2KSQA 2ADMA 2GBIA 3SICE 3PHBE 1GFIA 1DIOB 1WU7A 3M81A 2WHEA 1VDMA 3LUDA 4S0XA 4UEOA 4V3BA 4YRFA 1Q20A 5GM1A 3AESB 1JEQB 4RIFA 3VX3A 3U7FB 5C18A 2X23A 4PYJA 3LHIA 1ZY2A 4W5JA 3T7AA 3R76A 5CBPB 1AF4A 3VXKA 3AHDA 3GPDG 4WOJA 1QOQB 2Q45A 4CT4B 2FMXA 1NXQA 3U3DA 1W2HA 2O3QA 4BFLA 5EMJA