1A9YA

Udp-galactose 4-epimerase mutant s124a/y149f complexed with udp-glucose
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
338
structure length
338
Chain Sequence
MRVLVTGGSGYIGSHTCVQLLQNGHDVIILDNLCNSKRSVLPVIERLGGKHPTFVEGDIRNEALMTEILHDHAIDTVIHFAGLKAVGESVQKPLEYYDNNVNGTLRLISAMRAANVKNFIFSSAATVYGDQPKIPYVESFPTGTPQSPFGKSKLMVEQILTDLQKAQPDWSIALLRYFNPVGAHPSGDMGEDPQGIPNNLMPYIAQVAVGRRDSLAIFGNDYPTEDGTGVRDYIHVMDLADGHVVAMEKLANKPGVHIYNLGAGVGNSVLDVVNAFSKACGKPVNYHFAPRREGDLPAYWADASKADRELNWRVTRTLDEMAQDTWHWQSRHPQGYPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Epimerase
molecule keywords UDP-GALACTOSE 4-EPIMERASE
publication title Dramatic differences in the binding of UDP-galactose and UDP-glucose to UDP-galactose 4-epimerase from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
total genus 127
structure length 338
sequence length 338
ec nomenclature ec 5.1.3.2: UDP-glucose 4-epimerase.
pdb deposition date 1998-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1a9yA02
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1a9yA01
1N9GA 2YV1A 3H4VA 2VHYA 4J9VA 3H9JA 4MINA 2BFAA 3T7CA 2Y1CA 4EW6A 4RF4A 4ALMA 1E7MA 1DLJA 1SEVA 3QV1A 3FWZA 1V8BA 4UEOA 1I3LA 3ONFA 5FF9A 5DN9A 4AJEA 4EUEA 2BI7A 1DJNA 2AMFA 2IZ1A 4UUOA 3DAFA 1YS4A 4MVJE 1QG6A 4RO0A 1Y7TA 2TMDA 1NQ5A 4R1SA 1C1XA 2H5LA 1CETA 3GPDG 2I67A 1SMKA 2C29D 1DHTA 4B4VA 1NPDA 3U9LA 2YV3A 4TRNA 5EL0A 4YT2A 4GGOA 9LDTA 1Q1NA 1ZCJA 3SC4A 1QLHA 1VE9A 4YYZA 3MJCA 1C0LA 3JQFC 2D59A 2GN6A 3DBRA 3LVFO 2HAEA 3VTZA 4MVJI 1QXSA 3PYXA 1TI7A 2PNFA 4IINA 1H9AA 1E7WA 4QX6A 2WTBA 5DBGA 2Q4EA 1VL8A 3W4KA 2NWQA 1PWZA 2BF7A 4R5HA 5ENVA 1GEEA 1I30A 1XKQA 3HWRA 1GZ4A 3EVNA 4XYGA 5A05A 4BKOA 4DTIA 1X15A 4PFJA 4RVSA 3U0BA 4XRGA 5B12A 1NM5A 4BNXA 4XR4A 3RFVA 1HE2A 1E3LA 3T7EA 3INGA 3LT4A 2YY7A 5COQA 3V2HA 3TZQA 4XYBA 1YDEA 4PLWA 4HXYA 3UW3A 4BO9A 4RJTA 1S6YA 2VRCD 3L4SO 3TOZA 3WTBA 2EW2A 3PLNA 1P1KA 1P1HA 4NBRA 2PD4A 1UZMA 4IDBA 4PLFA 1Y9EA 5JO9A 3L6OO 1P3DA 1QSGA 1X13A 3MTGA 3PIIA 4KOAA 1D1SA 3JSAA 4G81A 5DOVA 1LSUA 4E0BA 1DPGA 2GLXA 3GFBA 1IY8A 1KIFA 2DC1A 5LCXA 3MCVA 1L7DA 5B4UA 2FZEA 5DBIA 3INTA 5L7YA 1PJQA 3F1KA 3BYZA 2GASA 5AQ1A 1JW9B 2NVBA 3LF2A 2W2LA 4GWKA 4Q3EA 2BH9A 3LC2O 3JCZA 3DZFA 1YKFA 2Y1DA 1YL6A 4R51A 1ZH8A 4E2YA 2Q1TA 3E9MA 4XQEA 4J3FA 4BO2A 5F21A 5K6AC 4RL6A 3IUSA 1PGJA 2C2YA 3ZWXA 4D41A 3H3JA 4QO7A 1E1LA 4PLHA 1IYZA 1YJ8A 1PS0A 4R16A 3WJAA 5TJ9A 1AHIA 1JQBA 5HTOA 1C3VA 5JCJA 4J1NA 3BHIA 4XGNA 3WG9A 4YWJA 4CL8A 1LSJA 1T26A 4E31A 2VUSA 3I9NA 1RJWA 2OFPA 5IZCA 5DP2A 4U7WA 5H83A 4CLRB 2NQ8A 3U4HA 4DPMA 4M1QA 4NI5A 3WGZA 2VCYA 1EFKA 2OHXA 3DMYA 3ZWCA 4NU5A 1BDBA 1ISHA 3TWOA 4D42A 2EKLA 3HB4X 1YJQA 3PPIA 3WTCA 3WOHA 1VI2A 2Q2QA 2GGSA 1ZFNA 1LTHR 3GUCA 4CM5A 1DAPA 3OICA 3L0DA 3V2GA 4JBGA 4TRRA 1I2BA 5TIIA 2X22A 4ALLA 4HV4A 5I9NA 3BHMA 3BTVA 3DFUA 4QTZA 5COAA 3GG9A 1IB6A 5KKCA 4B4OA 3FTNA 4MP6A 4CLEA 3BXXA 2PTGA 4WCFA 5FYDA 1XCBA 2GUGA 2PKRA 4D3DA 5L4LA 5ITVA 3ADOA 2RAFA 2PKQP 2VN8A 3G17A 2NVUA 5JO0A 3RASA 1PGQA 4MIYA 1R4NB 3LQFA 5ES3A 3L4BA 4TVBA 1ORRA 3ULKA 3UOGA 1PJBA 2E82A 4L74A 3DO5A 2Y99A 2GDZA 5CDTA 4XRRA 5A3VA 1UP7A 3UUWA 1XWFA 1EQ2A 2A92A 2HK9A 3Q9UA 4YQYA 1K6IA 2VTDA 1ZXLA 5A06A 1I2ZA 3B1KA 2NTJA 4A2CA 3JD4A 3W4IA 3A06A 1E0DA 2C5EA 4HP8A 1VPDA 3CH6A 4OO3A 3RU7A 1BWSA 3OQ1A 4ID9A 3FNHA 1B15A 1KC1A 2Q50A 4KWIA 2ZB8A 4UUMA 1H0KA 3FR8A 3GVXA 1WZEA 2YFQA 4OSPA 1GV0A 1FDTA 3JQBC 4OQZA 1XGKA 2F00A 4MVJA 3H3FA 1MA0A 1ONPA 3HUDA 4OM8A 4BQPA 4BS9A 4NFYA 1V35A 2NTNA 2ZTMA 2V6BA 2O2YA 4ZQHA 4HFMA 2BD0A 1I8TA 3I6IA 4OXKA 3RUAA 3RUEA 1ADBA 1P74A 5IZ4A 3WGQA 1TT7A 3MJSA 4OJNA 4L75A 4F46A 1JLLA 3CKYA 2Y68A 2QW8A 4GWGA 2X9VA 1EBFA 3E9QA 5KJ1A 1UR5A 4EJ6A 1LQTA 3OBBA 1FDVA 3G3EA 2X4GA 4RZIA 4E5NA 2C7GA 4JBIA 3NEPX 4PG4A 3HE3A 4S1VA 4WEQA 4DQUA 3FRJA 3IIEA 4B7CA 2JL1A 3SXPA 4X54A 1P9LA 1IE3A 1PQUA 2Y0CA 5T57A 5BSFA 4BKPA 4F6CA 4WOJA 4BO4A 2YW9A 3CZMA 1TB4A 3HG7A 3ZHYA 4IBOA 4DGSA 7MDHA 1VL6A 3VDRA 1YQGA 5THQA 1PZFA 5U1PA 1QYCA 1B3RA 3KEQA 4ND1A 1PZHA 4IXWA 1QYXA 1EUDA 5KTKA 4H3VA 4JX8A 4QO8A 4E2WA 4JXKA 1GR0A 2J5KA 2CDCA 2EERA 3RC7A 3K31A 2EF1A 4FGWA 7ADHA 1PS8A 3D4NA 2VOEA 4F45A 5G0VA 3VH1A 4OGWA 1K5HA 2D1YA 1YBAA 3C8MA 2UVDA 4FW8A 2FHSA 4UVDA 1I36A 1MXHA 3FF4A 4OXYA 2DQ4A 5G4KA 4DL9A 3FN4A 3PP8A 2IRWA 3F3SA 1YL7A 2H1SA 2HRZA 3VZQA 4WNIA 3RC1A 4FR5A 1QYDA 4CQMB 2I65A 1GY8A 1K6JA 3ETDA 2HJSA 2VNAA 5A4DA 1HE4A 3PGJA 4D45A 4ZQGA 5KJEA 2VNSA 5JSFA 3ROPA 1B14A 5BQFA 3EW7A 5I9LA 1LDBA 5THKA 5C3MA 2AA3A 4MKZA 1E92A 1HT0A 1FDSA 4YJHB 1U7TA 3RBXA 3RUHA 3NDJA 3KYDB 5I9MA 4XZ3A 1YRLA 4KUHA 4XGIA 1JWBB 2Q4BA 4LCJA 4MP3A 3MJEA 3MEQA 4EBFA 4BNMA 3VKVA 1G0OA 1GEGA 3RKRA 1NP3A 3EGOA 3GHHA 3BTUA 3OIFA 3F46A 3QIVA 3KV3O 3S2FA 3S2GA 2QG4A 1E7SA 2WSBA 3TZCA 3ZWOA 1B26A 1BRMA 4E6PA 4KWHA 3NJ8A 4JN6B 4OOEA 4HWKA 1E1NA 1H6DA 3IC5A 4E5MA 1E6WA 3E9NA 3DHNA 4XIYA 4BNZA 4E4YA 4XJTA 5IFLA 3L6DA 2OOSA 3LU1A 4QECA 2VHZA 3D5QA 3P2OA 2NU7A 3LC7O 1DIBA 1GUFA 3GQVA 2W2LD 3Q3CA 3TJRA 1E3WA 4UUNA 2V65A 4E30A 4D79A 4LCEA 2J3HA 4QFDA 3RAJA 4RQUA 3LT1A 2QHXA 5FI5A 2AXQA 4YAGA 3DAPA 1UXIA 5G4LA 4OKNA 2C20A 2PGLA 3DZKA 2I6TA 3TPCA 1ZSNA 3RFTA 5I7VA 2NU6A 1BSVA 4MVJG 1H9BA 4FC6A 4CMEC 4JIGA 2NU8A 4PLTA 3ZWYA 5JCJD 3VH4A 2P5UA 2Z95A 3B70A 4CM1A 4R1TA 3ZNNA 4FFLA 1N5DA 3SVTA 4LSWA 5EINA 4HY3A 3AFNA 3UAGA 3UKOA 3VH3A 3WMWA 4CM4B 3ZHZA 3COSA 4J7UA 1WMBA 4RVDA 4DYVA 1A72A 3WDSA 1YWGO 4F3YA 2P91A 3DZIA 1U5CA 1PL6A 3WMXA 1R12A 1U4OA 3JQGB 2CZCA 4BVAA 1BXGA 4P4LA 4H7PA 1TEHA 3FBGA 2JFFA 3GZNB 3AFMA 1OZAA 2GZ2A 4FJ0A 4GX0A 1XHLA 3GRPA 4DBVO 1HSZA 3QVTA 3DOCA 1MG5A 1H6CA 2WDZA 4NU6A 3K2BA 4MVJF 1NWHA 4JROA 4LMRA 4RVFA 3ZWBA 3M2PA 2IEBA 3P19A 1VLLA 1EVIA 3JD2A 1O89A 2RH8A 4FJ1A 2A94A 4WUVA 1J49A 1B16A 3I52A 1GQYA 4PGFA 1LU9A 3PHLA 2CVZA 2O50A 4OIMA 5CDUA 3EZYA 1YE3A 4WKGA 4TVOA 3GHYA 3QQPA 3WWZA 3UCEA 4AVYA 5U9CA 3KLPX 4WK6A 4XYEA 4DYDA 4WPGA 2X5JO 1U28A 4HADA 3IJRA 3QP9A 4UVIA 2W90A 4R3NA 4ZD6A 1AE1A 3VHRA 3IL2A 1HSOA 3DZBA 1I3MA 3V1YA 1T1SA 1EEHA 5DOZA 1CJCA 1X1TA 2JJYA 2IZZA 4XYLA 2DPHA 3P2YA 1DC6A 4JJIA 5F5LA 5C7IO 1DBVO 4IDEA 4DREA 3TQHA 4CLXA 2FPPA 1PJ3A 2O4CA 3CINA 4ROSA 4MVJD 8ADHA 1L1FA 3MWEB 1RM5A 2GO1A 4YT4A 1KYQA 3R1IA 2JFGA 4TROA 2OZPA 3L77A 3G1TA 1A9ZA 4EDFA 1LRLA 1BVRA 2ZB7A 3ANLA 4GKVA 3OP4A 5IDYA 4O1MA 4DC0A 4KTVE 4FFPA 5EN4A 1WW8A 3KO8A 1IPEA 1M76A 1ONNA 2FR8A 1F14A 1NAHA 3RBZA 3GN1A 5COBA 1E1MA 4LN1A 3H2ZA 3AY3A 1SB9A 4CMIB 4FCCA 1GADO 1LRKA 4B7UA 3D7LA 5LC1A 4AJNA 1ZUD1 1LDYA 4CV3A 3ZU5A 1R15A 1M6HA 2QIOA 4G2NA 3R3SA 2Q1SA 4RLHA 2CUKA 4B3IA 3I9MA 1O0SA 4G65A 3ZV6A 2ILTA 5FWNA 3KUXA 4WGGA 2A4KA 1DJQA 3HQ4O 2C54A 2BFMA 2VYNA 4UUPA 2EP7A 3IJPA 4LRTB 4WLVA 1ENPA 3ZU3A 1NPYA 1E3SA 4YT8A 2WE7A 2DFDA 3HB5X 3VPHA 3WYCA 4OKIA 1DC3A 1VKOA 2NVWA 3WS7A 3BMNB 4IZIA 3GY0A 4DWVA 2UDPA 3JQEA 3ZWPA 2D0IA 1PJCA 3M6IA 1Y1PA 1MFZA 4XWYA 4IZHA 1V9LA 3PDUA 1LSOA 2XF8A 1IPFA 3UF0A 3PZRA 2P68A 4DXHA 1Y9AA 4CMJA 1EBUA 1I33A 1MP0A 4IJWA 1WZIA 5A9SB 2EWMA 4KUEA 4BGUA 1X7DA 2PZJA 2EJVA 2R00C 4FC7A 2BFOA 4YPOA 1MC4A 1E6UA 1NFQA 5HBRA 4BNVA 4IGFA 3D5TA 2B4RO 1ISMA 1ZBQA 1DFIA 3NT5A 1MXFA 4FOOA 5BSGA 3IOYA 5I7EA 3DBLB 1HXHA 3ZNPA 1IULA 5LDGA 3GDFA 1VJ0A 4U6SA 4B3HA 1DIAA 3VKUA 3WWYA 2PK3A 3Q1LA 3W8DA 1I01A 2BFPA 4CLRA 4E3ZA 3FNGA 3OJFA 1HE3A 3D4PA 4Y98A 1HKUA 2YYYA 3BA1A 3NUGA 5EQDA 4I5GA 3BMQB 3WFIA 4EITA 5JCXA 1W73A 4PG5A 3WGHA 4NHEA 2GYYA 4AJLA 1AUPA 1WAMA 4GKBA 4DC1A 3QA9A 1R0SA 3DC2A 3DBHB 5KCZA 2WM3A 3VPFA 4N54A 3RSHA 2I9PA 3MJ4A 3QW2A 2I5PO 2J3IA 5H81A 4FS3A 3AI1A 4CV0A 1ULSA 4P4NA 5JYDA 3D3WB 1LI4A 4BO5A 2Y05A 4NK5A 2JD1A 5BNFA 5IZCC 5A9RA 1R4NA 3OQBA 1M67A 3LK7A 2HMUA 3DOJA 3UN1A 1YONA 1CWUA 1MC5A 3F4BA 2AG8A 4JP2A 3UCFA 1I3KA 2EHDA 2GZ3A 4O5OA 4ITUA 3UICA 3HZZA 5TT1A 3FPCA 1DOHA 4RDHA 1IHXA 3ZN2A 2I3AA 3KLMX 4JGBA 4CL3A 2FPIA 3PYLA 3I1JA 1GPDG 3JD1A 3D0OA 4JCOA 4XEHA 1U3VA 3LLVA 4A0SA 1CEQA 1NAIA 3M1LA 5A9TA 3RQSA 2HK7A 1GUZA 3Q9NA 2AG5A 3WQSB 1GTMA 1ZEJA 3ITDA 3Q0EA 3RC2A 5AXCA 4WCFC 2OP0A 3P5SA 5TNXA 2OP1A 2AEMA 3AWDA 1Q2XA 4BO1A 4I9HA 5DP1A 3MZ0A 5JE8A 4YA6A 2FWMX 3L4BC 4Y67A 4IS3A 1G0NA 4QUKA 2CVQA 1QKIA 2VZ8A 4WLNA 5T67A 2FPGA 1QV6A 2X0IA 3ZCXA 4U8GA 4PVCA 2I76A 3F1LA 3O8QB 4TZKA 3ZWNA 3L6EA 2HMWA 3ORFA 2B36A 1CQIA 3ONEA 1X7GA 1U3UA 5AVOA 4ILKA 1TXGA 4PRKA 3KYBA 3AM5A 1O8CA 1N7GA 4N5LA 3AW9A 3C7AA 4CM3A 3S2IA 1T2CA 2D3TA 3AU9A 2ZQZA 1ZW1A 5TQVA 4BO7A 5K0ZA 4JJGA 4CR7A 4Z9YA 4OSOA 2PZKA 4IDDA 3MJTA 2V6FA 4WLFA 1C0IA 3AOEA 3I4CA 4ND2A 3IKTA 1Y5RA 4E12A 4I9NA 2JHFA 2CMDA 1X0XA 3W8FA 1XU7A 2IYOA 3F5QA 4YTEA 3RUDA 4EJMA 5IAAA 4CM7A 1PS9A 3RJ9A 2UYYA 1LLCA 5T8KA 1JAXA 4YJFB 4NPCA 5CG1A 1A71A 1PGNA 4MPDA 1N8KA 2FR0A 5EQFA 1FF9A 4C7JA 2IODA 4RPJA 1SNYA 1LDMA 3B6ZA 3GOHA 4RDIA 3VH2A 1LBEA 4OH1A 1ADCA 4Q3BA 4BNUA 1GCOA 1J0XO 1EK5A 3PTZA 3U5TA 5GMOA 4MVJH 2ZB4A 4LVUA 3CTMA 4NNJA 3C1OA 1PL8A 3AJRA 3GAFA 3WNQA 4J2OA 1UP6A 1LNQA 1ZJZA 5KJCA 1EUZA 3I9LA 4U0KA 3U4IA 1ISFA 1YBMA 2VHWA 1KVTA 4R54A 2C2XA 3UHAA 4AJOA 1JU9A 3PHHA 1Q0HA 2HSDA 4CQMA 2Y0DA 3E03A 3ENKA 1GQQA 1QYVA 2JD2A 1P31A 4EI2A 3KEOA 4J1QA 1UP4A 3H5NA 2P9EA 4BB5A 1P45A 1T24A 2O4UX 1E3JA 1WVGA 1N1GA 4ND4A 4AG3A 4BB6A 5JDCA 3FR7A 2AQHA 2HJRA 2PR2A 4YJHA 3JQ9C 1Y81A 1CF2O 3KYDA 4CUKA 4DQVA 2DBZA 2I99A 3PK0A 3SLKA 2YFHA 1YB5A 4YBZA 2Q2WA 2OORA 1D8AA 4ALKA 2PA3A 2CDAA 2PY6A 1JAYA 2GN4A 2X0NA 1DFHA 2EKQA 3GVCA 3OEWA 4DIOA 2NM0A 1ZK2A 5TLSA 1ZK4A 4J4TA 2ZQYA 1TVEA 4GL4A 3QWAA 2PD6A 3BMOB 1F12A 2FP4A 4UVHA 4WECA 3VTFA 3PYMA 3ZW9A 1S7CA 2HRBA 1JVSA 3PEFA 3C1AA 4B8ZA 3PQEA 1LDNA 5JS6A 3WX0A 1A4UA 3FWNA 3DMTA 4RF5A 3GGGA 2W4QA 3WJ7A 2DLDA 3HJAA 4IUYA 2C82A 3G79A 3WNVA 4MO2A 3GNQA 1NFRA 4FB5A 1LDGA 1U8XX 2EW8A 1H94A 3H6KA 2G76A 2Q3EA 2NU9A 4HNGA 2YZ7A 1E3IA 1WPQA 1K0UA 3Q11A 3AUUA 3HN2A 1CRWG 3K6JA 1LC0A 3WB9A 3C7CB 1R37A 1VM6A 3LF1A 5CG2A 1W8DA 4AJ4A 1I32A 1NQTA 2HCTA 2JCYA 1ZK1A 1NYTA 3F4LA 4GGPA 3UVEA 3ZHXA 3ZWAA 4GLLA 4HFNA 4CLOB 3ICCA 4P8RA 4XA8A 1A27A 3GPIA 5EPOA 2HKIA 5DBFA 1U7HA 3PJGA 4BGEA 3CPSA 4PLYA 4CV1A 4BNLA 3RC9A 1DAOA 3PHIA 1GCUA 5CFZA 5CDGA 5BNIA 3RWBA 3EYWA 4CM4A 3AUAA 4NK4A 4XB2A 5DDIP 4N5NA 5B4VA 2JHGA 5CPBA 3VZRA 4NG5A 4EUHA 3CEAA 3JQ7B 1KVQA 2RHRA 2Y93A 5DZSA 2V7PA 2P4QA 3H65A 3QRWA 4E5YA 3TNLA 3JQGA 1T2DA 3OF2A 4CMHA 4ZRNA 2GNAA 5TRTA 2YHIB 2RIRA 3EY4A 3GZNA 4INAA 1C1DB 2WE8A 1NVMB 3OH8A 4L8VA 2X58A 1RKXA 3VDQA 1JKIA 2WYVA 5FEUA 3JQFA 4D7AA 1WDMA 5JMWA 2NTVA 3G0OA 4J49A 2QZZA 2FSSA 1WP4A 3CZRA 5IN5A 3TF5A 3OA0A 1GZ6A 3JQCA 1BTOA 5JY6A 4WASA 2DT5A 3WGYA 4FFNA 1LDEA 4JP3A 4L9RA 1KOLA 4PLGA 2OBNA 1ENYA 3DQPA 4Y8VA 1F8FA 4Q39A 1RWBA 4W82A 4R01A 3C3XA 4J7CA 1UDBA 1C0KA 1E3EA 5DULA 1CERA 1UAGA 1UAYA 4YEDA 2R6JA 3VAZA 4FFRA 4BKQA 3I3OA 4MJLA 3TZHA 4A7PA 3GN2A 2DAPA 1XQ1A 4W7IA 2VUUA 5L40A 2AE2A 2VTEA 3GDGA 2GRAA 4Y6PA 2ZYGA 4IJVA 3MTJA 2ZTUA 5KIAA 4H15A 3DDNA 1U3WA 1HDGO 1DEHA 1YDWA 2P5YA 4KQWA 4NFSA 1U4SA 4Z3KA 1D7OA 4FN4A 1Z75A 3PHGA 4ND5A 4BNKA 4TKLA 3TOXA 2CNBA 4ND3A 5ILOA 3AK4A 2NUAA 2SCUA 3QWFA 3DL2A 2VUTA 3ZH2A 4BNTA 2WD7B 3H8VA 5IN4A 4KP7A 1ZK0A 1A9YA 5B37A 4NJMB 3LZ6A 2V6GA 3H9EO 4MDHA 4NFHA 3I5MA 1K2WA 3FBTA 1SBYA 5JAMA 3FTPA 2YV2A 1DHRA 3DTTA 1DRWA 4YACA 4P22A 3ZWVA 3B20A 4CMIA 1YO6A 2DFVA 4W6ZA 2C0CA 3I9JA 4WNCA 3FPLA 4I5FA 4MKRA 1JN0A 5AYVA 3S2EA 1SC6A 3T4XA 2ZK7A 3PHJA 1IOLA 3HFGA 5I7FA 4EEXA 5CHEA 1LEHA 1O94A 1RM3A 5CDSA 3PJEA 2IE0A 1SOWA 4O0LA 3ROMA 3RFXA 4IMRA 1PZGA 4J9UE 4OHUA 3WR5A 4B8WA 1LUAA 4CLDA 1HZZA 4EGFA 3BMNA 1VJ1A 3WIEA 1RPNA 3GRKA 1K6XA 1AXGA 4NH4A 4R5MA 3ZW8A 4YVFA 2O3JA 4BO8A 5KWEA 2Q1WA 1H6AA 2Y1GA 3RJ5A 3S8MA 5A9SA 1ML3A 4TWRA 3K30A 4QFCA 1R6DA 4B7XA 4YRBA 3HNPA 2RBEA 2GCGA 4BMNA 4LW8A 3NGXA 4E33A 3SX2A 3NTRA 1E6EA 3DAGA 1ZMOA 5A5EA 3JQ8B 3SJ7A 4GSLA 4KMSA 4M8SA 5AOVA 1ZXBA 1B2LA 2Q49A 4N18A 5BSHA 5EERA 2VWGA 5L4NA 3O03A 4HFRA 2E49A 2P9CA 1YXMA 2C5AA 2D2IA 3DBLA 1T2AA 5EESA 5L4SA 1M2WA 3GGOA 4U0JA 1EE2A 1ISIA 3PIDA 4EZBA 5EJ2A 1E77A 3ZI0A 5IDQA 1U3TA 1FDWA 2ZYDA 3V2UA 3DXFA 3VZPA 1LC3A 1HDCA 1KBZA 4PLPA 5TS3A 1Q7GA 3HFSA 3MJVA 3ZWWA 1UXHA 4Z9FA 4J6FA 2E4AA 3QVSA 3BMQA 3EVTA 3ITKA 4BV9A 3V1UA 3RD5A 2PLAA 2PFGA 3WGOA 1P77A 2Y67A 1ZMTA 1TT5B 1IHYA 3GEDA 4FFMA 5FI3A 1KEUA 3UH1A 3DBHA 2Y1EA 1GDHA 4D3SA 2O23A 2JAHA 1I3NA 1NQOA 3NTQA 2HUNA 3PGXA 4IY1A 2AE1A 3DTYA 3E18A 2DUUA 2YUTA 1JA9A 4IXTA 1FJHA 1O9BA 2VWHA 3ZDFA 3D3WA 4YCAA 2AQKA 5CEEA 3TL3A 1ONOA 3GEMA 5HWSA 3B1FA 3FSRA 5KOIA 4UEKA 3C24A 3H9UA 5F3RA 3GF4A 1BW9B 3JYQA 1Y8QB 4GLOA 1GQ2A 4M55A 1UUFA 2WEKA 5L53A 1QYWA 3TZKA 4MIEA 1CQJA 4RF2A 2J3KA 1NFFA 3RUCA 2VHVA 4FBGA 1ADFA 5CAEA 2IZ0A 5I8ZA 1PU2A 2CY0A 5JAIA 1R0KA 3WQRA 3JYPA 1VL0A 5ER9A 1T4BA 3OA2A 1NPTO 1ZVMA 2X6TA 3DZGA 1IL0A 4J7XA 2FR1A 4IQ0A 2HDHA 1XDWA 3ABIA 2EIHA 1CDOA 4CM8B 3WYBA 2HMSA 1OAAA 4DLAA 2DBQA 3GFGA 4PLCA 2ZCVA 4MVJP 3U4CA 3VC7A 1DC4A 1D3AA 3GK3A 3GUYA 4WOKA 1DFGA 2CVOA 2OO5A 1EDZA 4UREA 3NT2A 3ZU2A 1PX0A 3GGPA 1T2EA 2CF6A 5FFFA 4NBWA 1RYEA 5G2OA 3VVBA 3O8QA 1N92A 3NDRA 4XD2A 5EMHA 1ZK3A 1MLDA 2G0TA 2ZTVA 4JNKA 1QLJA 4E5PA 2J6IA 4II3A 1HDRA 2R2GA 3DHEA 3BIOA 5A3JA 4TQGA 4ALJA 4R9RA 4DPLA 1H2HA 2B5VA 3H2SA 4R1UA 3U3XA 1F06A 3V1TC 3IP1A 3PQFA 4J0EA 4D44A 1Y8RB 3OMLA 1KVRA 3X2FA 4J1TA 5JY1A 2VYVA 4GBJA 1V3UA 4GPD1 5TGDA 3JQAB 1LA2A 3NT4A 4ZJUA 3WSWA 1I0ZA 2D5AA 4GMFA 3AY6A 2GN9A 1BDMA 1R66A 3BHJA 3EHEA 5F1OA 5F1PA 4CMGA 1IUKA 4YJFA 3EUWA 4R9SA 3IQDB 1T2FA 2DTEA 3TFQA 2I3GA 4W99A 4B4UA 2YDYA 5JC1A 2EXXA 4CM9A 1BXZA 4QEDA 4NJOA 5A1TA 1WDKA 1V0JA 4J43A 4RPGA 4BGVA 1Q7CA 3JD0A 2BMAA 2PGJA 1H6BA 5DNAA 3QWIA 4TZTA 1ISJA 3DR3A 1A5ZA 5I8WA 4OAQA 2DBVO 3K9QO 3KSZO 2G82A 1XLTA 1NX6A 1KEWA 3ZZNA 5DCUA 3AOEC 3CMMA 4IQGA 1KVSA 2VWPA 3IDSA 1BXKA 4ZQEA 1G6KA 3I9KA 4NBVA 4BNYA 1PWXA 3JV7A 4RPHA 4PCVA 4C7KA 3RCBA 2UAGA 5HS4A 3HDHA 1NVTA 3OJ0A 1D1TA 3I23A 2X23A 3PQDA 5T8KC 4P38A 2EP5A 1HLDA 4GVXA 2J3JA 1LSSA 1ID1A 3KB6A 2DTDA 1C0PA 4GQAA 4AJHA 3GA0A 1EZ4A 3ON5A 2JAPA 3LT0A 1HWYA 2DVMA 3PZBA 3KYCB 3QWHA 1ADGA 3ENNA 1EUCA 4LVCA 5B4TA 4Z6KA 2RCYA 2LDXA 1WXDA 2O7QA 4NMHA 1JWAB 3WGIA 2PZLA 2QX7A 1NASA 3BMOA 1OBFO 4K1LA 2FRDA 4YT5A 1D4FA 2WYUA 3ADPA 3WBFA 3BTOA 4AICA 1DRVA 1SB8A 4CMAA 2QRLA 2UUOA 2J5QA 5ICMA 3IS3A 1JDJA 4DLLA 5JDIA 1PL7A 4GX1A 4NBTA 4TRJA 3C85A 1EQUA 5JDCC 1L7EA 1GD1O 4W9NA 1MX3A 4UEJA 2PH5A 4FIZA 4Y6SA 4J0FA 1EVJA 5JFOA 3LT2A 1DIRA 1M6WA 2ZB3A 2BELA 3MOIA 4J4HA 3SLGA 5KVSA 5KKAA 2X8LA 5G0TA 3D1LA 4PN3A 3GDOA 1NR1A 2BHLA 2J5RA 2FSVA 1E7RA 3JYLA 1M75A 1ZSVA 4OQYA 3R3JA 1NR7A 4EJ0A 1F17A 3E48A 3QVOA 4J1SA 2W8ZA 5T6BA 2JCVA 4CLOA 4AFNA 4YXFA 2Q1UA 1H5QA 3TRIA 5ILGA 1XIVA 1PQWA 4WE3A 2BGMA 2DKNA 1GPJA 2ZTLA 2WJPA 3PFFA 4MVJM 4Q3CA 2O7SA 3DMTC 1EK6A 5KVCA 4BMSA 4ZA2A 3CE6A 4BO0A 3U09A 2PH3A 2A9FA 4CUJA 4MOWA 3HDQA 4DVJA 1ZEMA 2POQX 2Y1FA 5GZ3A 5MDHA 3JQ7A 1KEPA 3U49A 4P4GA 3PJDA 4A26A 3FNFA 1E1KA 1CYDA 3BMCB 2O48X 4RGBA 4HKTA 4J4BA 1ARZA 2YHIA 3FNEA 1IZ9A 3IKVA 4XIJA 4XX0A 1C1DA 1FK8A 5A03A 3UXYA 2HMVA 2NACA 2ZCUA 4NZ9A 4NR0A 4E13A 3JYNA 3I4FA 3LLSA 1MV8A 1DSSG 4FPXA 5TJHA 4EYEA 2W2KB 4RLSA 4IMPA 5DF1A 1PJTA 1GYQA 4M49A 2C07A 2W98A 5L7WA 3JTMA 1BVUA 2DU8A 3A4VA 4PIVA 3TFOA 2PGDA 1QRRA 3GMDA 3KSUA 4DRYA 2FY8A 5IDXA 3TZ6A 2JFHA 1NTOA 3ANNA 3W8EA 4DBZA 1X14A 3DONA 2PV7A 4EEZA 1P1FA 4Y9DA 4ZN6A 4GMGA 2BLLA 5U4QA 3KZVA 3IAHA 2G17A 5KVQA 4R4JA 4D43A 5AXBA 4R69A 3H5RA 5T5QA 1GYRA 1P33A 2AW5A 4YJGB 4I08A 3WBBA 3A14A 1R4MB 1A4IA 1MB4A 2X9GA 4LISA 1KS9A 4YDRA 4DMMA 4JBHA 3AUTA 2IXAA 2VZ9A 5JAQA 4Q3AA 3E82A 3KSDO 2VZ0A 3PWZA 3O4RA 3RI3A 3D4OA 1MGOA 1ENOA 2GD1O 5F5NA 1A7AA 2QYSA 2WD7A 4XDZA 4OMUA 4K9DA 2AHRA 3HN7A 1ULUA 4NJMA 3GH3A 1FDUA 1DO8A 3SEFA 5CP8A 4O6VA 5JLAA 1EMDA 3TDKA 1VC2A 4RCVA 3IP3A 3NRCA 4BMVA 4RQTA 2R00A 4J90A 5A04A 4CR6A 3FCOA 2OXIA 3P7MA 4G5HA 3VVCA 3CMCO 2QQ5A 4IS2A 4LRSB 4LSMA 2RH4A 3ANMA 3RUFA 3SJUA 1U8FO 3JYOA 1B3BA 2YJZA 4ZVVA 4CJXA 2HO5A 3G49A 4GX5A 5BR7A 3SBOA 4L0QA 2YQ4A 3FI9A 4BUCA 4FD3A 1P44A 3DEYX 3QVWA 1DB3A 3HDYA 3T4EA 2NLOA 4F6LA 5C7LO 2B0JA 1NNUA 3Q6IA 3TL2A 1LLQA 1WLYA 2VYVD 2OUIA 1U2GA 4RVUA 2DUWA 2OBYA 4BKUA 1B0AA 4RF3A 4Q9NA 1E7QA 1IZ0A 2EGGA 1UXKA 1ZO8A 2G5CA 1XYGA 2QZ9A 3GZ4A 3E6AA 3U62A 5L3ZA 2VYND 2JKVA 2XAAA 3I9OA 3JD3A 4PG8A 4S3MA 4Z0PA 1ISGA 4XKJA 5BT9A 2GR9A 4TRMA 1ZNQO 2NSDA 4CM9D 2FOIA 2EJWA 3ZWMA 2QYTA 1EVZA 2Z1NA 2GSDA 4WCDA 2IXBA 4OXNA 3PWKA 1K3TA 4ESOA 1B7GO 1WMAA 3PLRA 4RPLA 4GSKA 5AXDA 4CM6A 1NHWA 3JQ8A 1RYDA 4LMPA 1FMCA 2OL4A 3I6QA 5GZ1A 4FGSA 3BTSA 3GG2A 2X0RA 5K9ZA 1HDYA 3SC6A 1WWKA 5JXWA 3NAQA 3GNSA 4IM7A 1R0LA 1LRJA 4MIOA 5IXSA 2WWRA 3K8ZA 1P0FA 1PSDA 3LC1O 2DTXA 2EKPA 4BIIA 3WLFA 4BNFA 1W4ZA 1YOVB 4DPKA 4OL9A 3NX4A 3ROKA 1LX6A 1PIWA 3ICPA 4I5EA 4FJ2A 1I2CA 4YB8A 4AJ1A 1ZIDA 2AQIA 2YQ5A 4AJIA 3OETA 2CSUA 3AI2A 3PDJA 3AU8A 1U5AA 1PJLA 3QHAA 3Q2IA 4E2XA 3F9IA 1SCUA 3RVDA 1T1RA 4YAKA 1X0VA 3EMKA 4DA9A 4O59O 5IXYA 1XEAA 1SAYA 4JJFA 3AY7A 2X5KO 1TT5A 3A9WA 3CUKA 3I83A 3V5NA 4GAEA 4BV8A 1MG0A 3RU9A 3QJ5A 4CPDA 2XOXA 5L45A 4AJ2A 1YGYA 2X86A 3ASVA 1B8UA 1I24A 1PQPA 3KRTA 3KTDA 3KHUA 1X7HA 3PRJA 4NDNE 5HA5A 4B3JA 2GPTA 2X1HA 3DB2A 3DZJA 4JLWA 2VRBA 1CIVA 3LYLA 4MP8A 1RM0A 4E21A 2HLPA 3RKUA 4AL4A 3X2EA 1PJSA 3NTOA 1BW9A 3LSYA 1Y8QA 4D0RA 1HF3A 3MOGA 2Y66A 4CQLB 1N2SA 5JPIA 2O2SA 3E5RA 3EZLA 3WIDA 1N9GB 4BKRA 1HEUA 5L95A 2PZMA 2IDZA 3ETGA 3GVHA 5DT9A 1Z73A 4H16A 5CEJA 4JQCA 2LDBA 3DWFA 2D4AA 4DQXA 1BHSA 3B1JA 5F1KA 5KJ6A 3GVIA 4TKMA 2YDXA 3OFSA 4U5QA 3N7UA 5T64A 5TF4A 3OQ6A 4MKXA 3ZGYA 4GI2A 4HFJA 2B4QA 3ZV3A 4A27A 4E5KA 3BZUA 3OM9A 5AXAA 1KY5A 3STHA 1TA4A 2EV9A 3GR6A 5ER6A 4CM8A 1DRUA 2Q99A 4RVGA 4WJZA 1C1XB 2Q2VA 4AJPA 3OSUA 4IDGA 3FHLA 3WGTA 3F47A 1GU7A 3GLQA 4PZCA 4KQXA 4CR8A 4HX5A 1ZKMA 3INRA 4KTTE 3EK2A 3EDMA 4IJUA 1U2DA 2OGUA 3DBRB 5J23A 2BGLA 2H6EA 2O3TA 3NJ4A 1EDOA 3JQ6A 4KZPA 5ICSA 2FZWA 3H9QA 1KVUA 1B8PA 3GEGA 5G0SA 1NQAO 2UUPA 3MWDB 4ZQFA 4XQGA 3ZV4A 4BOYA 3TSCA 1P1IA 3K73O 3ZNOA 4YAEA 4ZRMA 3CIFA 3K5PA 4J91A 2H9IA 5EIOA 1VSVA 2WD8A 4R1NA 3UFXA 1PZEA 4L4SA 5BSEA 3RBVA 5JW6A 1PJ4A 2XXBA 1AGNA 5TT0A 1Y8RA 3ONDA 5GZ6A 3OIDA 4W7HA 3L9XA 3JQ9A 1U1IA 3JQAA 4XR9A 2ET6A 5K6AA 3F5SA 1OI7A 1C14A 2ZIZA 3ZV5A 1LXCA 4DIBA 3A1NA 1WNTA 3OIGA 4ZU3A 1P1JA 1Z74A 4R68A 1KEVA 4XJSA 4IGEA 1KETA 2NV6A 1LJ8A 1M66A 3F6YA 1HYGA 4IDAA 4J16A 4ALIA 1YH3A 5C7OO 2QRKA 3AI3A 2VHXA 2Y0EA 4AJKA 3PFWO 3ZU4A 1Z45A 4NIMA 4ZICA 4UVEA 1UDAA 1GUYA 4KUGA 4RORA 4DLBA 1H2BA 4M86A 1K89A 2AEFA 1SOVA 2F1KA 5JAZA 4I9UA 1JKJA 1XQ6A 2FN7A 1GAEO 1O5IA 1PR3A 1YB4A 2EG9A 4D0SA 2BGKA 3EAGA 4D3FA 4BO6A 3HHPA 4C4OA 1YL5A 3ASUA 4K26A 4L4RA 4W4TA 3WGGA 2E6UX 5JYEA 4I8XA 5A02A 4A73A 1YB1A 1KY4A 3CSDA 1AXEA 3FD8A 3KETA 2PWZA 3GMSA 3KVOA 3GC6A 3OJOA 1QV7A 1KC3A 4Z9XA 3WFJA 4XGKA 4XYMA 1OFGA 3KBOA 1XSEA 2CD9A 2G1UA 3WSVA 4CQMD 4YAJA 5CEFA 4ALNA 3DHYA 3W1VA 2JCXA 1Y5MA 4IIUA 2IYPA 4M89A 1V3TA 2VOJA 1HRDA 1OC4A 2HU2A 3KYCA 2J8ZA 3WICA 4BHTA 1OOEA 1Z7EA 1W0CA 2A35A 1NXQA 1DDOA 3IUPA 2O3RA 2P4HX 1HTBA 1EVYA 3IMFA 3KXDA 3G1UA 3PWSA 1DIHA 4R3WA 4U6QA 4URFA 1EE9A 2VT3A 3E1KA 2WYWA 1PR9A 1J6UA 1I10A 3UCXA 5JMPA 1DC5A 2C59A 2HQ1A 2P9GA 4PZDA 1GL3A 1HDOA 4PRLA 4I1IA 1HETA 3O38A 1GFSA 1NVGA 4QQRA 5CDYA 1JTVA 1AN9A 4L76A 1XELA 1Y6JA 2ZJ0A 3JQBA 2I66A 4YRAA 3KOUA 2O3QA 3K96A 5IF3A 1BGVA 4WCFB 2PKQO 5G0UA 2CFCA 3M2TA 4FOSA 1PGOA 2D5CA 3L07A 4QXMA 1F0YA 1XU9A 5ADHA 2NVUB 4I5DA 1B8VA 1HZJA 5TX7A 6LDHA 2XPCA 4XB1A 5ITWA 4II2A 1E7YA 2JD0A 4QT0A 3CXRA 5DCWA 4IDCA 2B5WA 3NYWA 3W6ZA 5KVVA 3OEYA 2BRUA 1O95A 4XDYA 4E32A 2HK8A 3E8XA 5IDWA 4ZGWA 3QY9A 4K28A 4CMKA 2PD3A 1I5RA 1LQUA 4PZEA 4IQ8A 1WDLA 3JQDA 3UGKA 3QSGA 4B4WA 6ADHA 1OC2A 3PI7A 5JDIC 2CF5A 4YR9A 1P0CA 1DXYA 4W9NC 4N7RA 5JBIA 1YVEI 4N5MA 3PJFA 4NBUA 4M54A 1Q0LA 3RROA 4GX2A 4DIFA 1RM4A 3VPGA 3BMCA 3OJEA 3AM3A 1T25A 4CODB 3HDJA 4L73A 4BNJA 3GAZA 1VRWA 1HL3A 1J4AA 5MGBA 2Q45A 4CMBA 4Z0TA 5JC8A 4PG6A 1BMDA 4B79A 3VZSA 1H93A 2B35A 3K2EA 1Q7BA 3PXXA 2W2KA 4BNHA 1XA0A 3AOGA 2OMEA 4YQZA 3LDHA 3OHSX 4EUFA 3DFZA 1VKNA 3L9WA 1NBOA 4IIVA 1GZ3A 1HYEA 2B83A 4A5OA 2YHUA 3H5AA 4BQRA 4BL5A 1VJTA 2O3SA 4M87A 4RVHA 4LGVA 2VRCA 1ZSYA 4Y6RA 1GV1A 3ROQA 1HYHA 1OMOA 3GVPA 2E48A 3W6UA 2WMDA 4ZQBA 3NGLA 4LK3A 3U4DA 5TSDA 1O6ZA 3D64A 4RZHA 3S1LA 4YJGA 3H7AA 2BI8A 1HDZA 3R0IA 1ZZEA 1R4MA 5HRUA 1GYPA 1PJ2A 2V6MA 4CV2A 5I7SA 3OJLA 5HM8A 1R16A 4UVGA 4L4XA 1SPXA 1QP8A 4BO3A 1XR3A 1X1EA 2ZJ1A 5LDHA 1JKFA 1QR6A 5IG2A 1E5QA 4GH5A 2NADA 2TMGA 5G4KB 3M1AA 1J5PA 4HNHA 3V8BA 2D8AA 4UAGA 2E37A 1Z82A 4Z0HO 4UULA 1LLUA 1AHHA 3AUSA 4BNWA 1YQDA 1QORA 3QE3A 4ZHSA 3Q2KA 2C7VA 3VPXA 3DOOA 1UH5A 4WLUA 4CUZA 4GVLA 2X7HA 3RIHA 2Z1MA 2H63A 3ZHBA 3D3EA 4TMFA 3WXBA 1HE5A 3O9ZA 1G1AA 4KDEA 3WYEA 4OYRA 2P2SA 4QSMA 2VQ3A 3BAZA 1FXSA 3C1TA 4WLOA 5C37A 2Z5LA 4A10A 1LLDA 1BG6A 1U9JA 1MUUA 2VT2A 4ONEA 1TLTA 3OECA 4RPKA 8LDHA 5B1YA 1SEPA 4K6CA 2ZKLA 1UXJA 3H9GA 3JQAD 3NKLA 2QRJA 2GZ1A 2Y1OA 4DMLA 4XQCA 4BNNA 4Q3DA 4FSHA 4R41A 3ZNQA 1NHGA 1UZLA 3TN7A 4CMEA 1P1RA 2X0JA 1HDXA 2B4TO 4YJDA 4XQ9A 5CPFA 2XXJA 2DBRA 4PVDA 1V6AA 3RUIA 2ZYAA 4DUPA 3A28A 1KERA 3W4JA 4HBGA 1UXGA 2GF2A 5C5IA 5DCYA 4AJJA 1EFLA 1UDCA 4IDFA 2GERA 3AM4A 4Q3NA 1N7HA 9LDBA 1ENZA 3ST7A 4CMCA 4FDAA 3HADA 1NWCA 2UV8A 4BNIA 4YRDA 3R6DA 3S55A 1E3WB 1Z6ZA 3NV9A 2DPGA 1JVBA 1UZNA 4Z3DA 2BKAA 5KJFA 5L7TA 3C7DB 1SO8A 5GY7A 4K6FA 4HUJA 2O3UA 4RV9A 2GN8A 3QVXA 4NQZA 5A5FA 5IJZA 1VSUA 2AQ8A 4IJKA 2EEZA 4E2ZA 3DZHA 2HMTA 1ZJYA 4IPTA 1YOVA 2ZATA 1A7KA 3VPSA 5G0WA 3WLEA 4PLZA 3GT0A 4PG7A 1PGPA 1N1EA 5H82A 3DBVO 2RHCA 5L9AA 4YAIA 2Q46A 3K92A 4OOFA 1F8GA 1DIGA 1XG5A 2X9NA 3KM0A 3QWBA 1YQXA 4CLHA 2DM6A 4FQ8A 4TSKA 3GNTA 4XCVA 1SZJG 1Z7BA 3PVZA 4A03A 3WQQA 1V3VA 1YBVA 3N74A 3QLJA 4PLVA 1T4DA 5BNTA 4D46A 1PEDA 2CDBA 3N58A 5JNLA 4KDFA 1BXGB 1E5LA 5KNLA 2FMUA 4WLEA 2IEDA 2B37A 4WEOA 4J2HA 2NNLD 2NQTA 1PTJA 3O26A 4O63O 5HS6A 1QMGA 2EGHA 4JK3A 3ETEA 4BNGA 2B69A 3HSKA 2AEJA 5L51A 5ENDA 1W6UA 1Q0QA 4BGIA 1HLPA 3NDIA 1UJMA 3EC7A 4CQLA 3E5MA 3VOSA 1DLIA 1MFPA 5TC4A 4FFOA 2VWQA 2X5OA
chains in the Genus database with same CATH superfamily
1X9IA 3LLCA 4Q03A 1PDOA 2L2QA 1YK1A 3H4VA 4KIWA 4M0FA 5DLYA 4MINA 1NVEA 2BFAA 4G1FA 4BQEA 1D03A 1SXQA 4UDYX 2H1FA 1GSHA 3DL0A 4QM7A 4ALMA 4WSOA 3ETNA 3QVGA 4L8GA 3HCCA 3NIDB 4LRYA 1NU6A 3EVGA 3ZUPA 3GRZA 1E3TA 5H5JA 4DMCA 3I6MA 2BI7A 2IZ1A 2PA0A 2V7TA 2Z2JA 1KZYC 3DXXA 2GZMA 4WZAE 3IEIA 5I4KA 1YS4A 2Q1YA 1QG6A 1U8EA 3NH9A 4GZLA 4QGBA 4UNSA 3WMEA 3CRW1 3SWWA 1Y7TA 3DF7A 3UHOA 4R1SA 4TLLB 1RMYA 4IJ5A 3G5TA 1NLYA 5FJIA 3R74A 3KQQA 3GPDG 1FUYB 2YWRA 1MQAA 4O2AB 3LBHA 3CUYA 1PVDA 3OTWA 2JKYA 2P4UA 3T3MB 3AEKB 5HHTA 1Q1NA 1X1DA 2GCIA 2J9XB 3NH6A 5I7UA 1SU6A 3MJCA 5LA6A 1KWGA 1E3DA 3KDPA 2CV0A 1ZWLA 3JQFC 3DLCA 4KGDA 2QQ0A 2NT4A 1GGKA 3JZAA 1SKQA 4K6KA 4JBYA 3OJXA 1JDTA 5LKAA 1JG6A 3OE7A 2I62A 2NZYA 1H9AA 3MWDA 2W22A 4HAVA 4QX6A 1H2AS 2Q4EA 1VL8A 3AQ4A 1ZD8A 3NFRA 5GIOE 3R7SA 2NWQA 1C7IA 1EGQA 4HK4A 4R5HA 2N0SA 3R3WA 1GEEA 5K20A 3ENVA 3L8HA 5T4BA 1TVKB 1Y89A 4XYGA 5A05A 5BOVA 3RVQA 4DTIA 3EPKA 4U2FA 2HLHA 1NYRA 1XWIA 3U0BA 5B12A 3VC3A 4NICA 2WU3A 4L5YA 4XR4A 5L3QB 4RY2A 1J8VA 2QJRA 5B2FA 1QK4A 5K0SA 2XQJA 5ALYA 3KR2A 3K15A 2GI4A 4Y7CA 3L6RA 2QE7D 3RT9A 3WZMA 5F9FA 3AETA 4EX6A 4KLZA 2FNAA 2XDYA 1E1YA 4DIMA 1S6YA 2P1DA 2VRCD 1Z5VA 3HKEA 4JJKA 1WXHA 3PUZA 3DE0X 5H9VA 3DCNA 1E32A 1P1HA 1U2DC 1TCBA 3HUTA 3U3KA 3E8MA 3JASB 4U7PB 3BF7A 1I5OA 4N8EA 2E4YA 5HIMA 2AFVA 4DARA 5K05A 4BLWA 1CW2B 1Y37A 3P9CA 5JO9A 3L6OO 1P3DA 3SZOA 5GONB 5D85A 4G5YA 4LYEA 1E6LA 4K9PA 2BYTA 3JSAA 1RVV1 2XJ9A 3Q7TA 3CGGA 2IUSA 1ZN8A 2YY5A 1IY8A 3GFBA 3OM1A 1L6IA 2HRQA 3E1SA 4LYYA 2DC1A 4WADA 3R7NA 4NNOA 1DWPA 3MCVA 5GOZA 1W87A 1HNZB 1TE2A 3T94A 3ZZ0A 1XBTA 3C3AA 4DJTA 3INTA 1PJQA 3UB2A 2FN4A 1SHUX 2NYVA 2XB9A 1OKKD 3A11A 4LYGA 3V8NA 5HYVA 1Q6ZA 1JW9B 2PGOA 3GI1A 2W2LA 4R3UC 3TRHA 3CWQA 4L4YA 1PJ8A 1PUJA 2BH9A 2ZVPX 2PCJA 3DZFA 2ZAOA 3DYVA 3W34A 1E96A 4FX5A 5KQRA 4E2YA 2Q1TA 4F2PA 2WTMA 1JR3D 3K3PA 5TMPA 4EJFA 4RL6A 2Q2OA 1QHYA 5CVJA 2C2YA 1FYWA 1Z0IA 3A6KA 3B82A 4H3HB 4INOA 1P6QA 2VK4A 3IELA 4KX3A 4HGYA 4KN5A 3UJ9A 3WJAA 1O6BA 1YQQA 1CK4A 1J7JA 2BFCA 2B8JA 2UZ3A 2ZJ8A 5JCJA 2AJBA 4J1NA 2WTEA 3RS9A 5KTTA 1BJKA 1A4RA 4I4IA 4EMBA 2AMVA 1T5HX 1LSJA 4CL8A 3OE4A 4F2DA 4JT2A 4RA9A 3VPCA 5HFNA 2IVFA 3FKSA 4U7WA 2R8BA 4CLRB 3O83A 1FNCA 3SDZA 5DTEA 1YIOA 4PCLA 3UJ7A 5CB4B 2OHXA 4EP1A 4M1WA 3DMYA 2IYUA 3UJBA 5L6MB 3ZWCA 4NU5A 3L46A 3M81A 1N6PA 3MWJA 1M8GA 1ZNXA 3QEMA 4ZEOA 5IARA 4F3YA 5JQGB 5KC8A 4NZNA 1SUFA 4OP1A 1CY0A 1NMYA 1SVWA 3IAM6 3QPBA 1BVYF 1PBNA 3PPIA 3TE7A 4LDZA 3WTCA 2R86A 2Z6VA 4CEIA 1DUSA 2CFTA 4AKEA 3WL4A 2O14A 3BBPA 3HS3A 2A67A 1LTHR 3EGEA 4JS0A 4YWHA 5LJLA 1AUQA 1DAPA 1HOXA 3RHFA 3WISA 5KNBH 3ADCA 5TIIA 2BUAA 4BEJA 3FUWA 4MICA 5AKIA 3Q40A 4JKIA 1KZ7B 1JG1A 1W49A 5TPZA 1YC5A 2A59A 2OSVA 2QRHA 3DFUA 3IUEA 4QLOA 4ZAXA 2DWQA 1IB6A 4YYEA 2MDTA 3KQTA 4OCZA 4RSMA 4F71A 1KI7A 2PTGA 3EFOB 4LNAA 3STUA 4YMVA 2BMDA 1IUPA 3BKWA 1TUIA 3H13A 3VO8A 2ZJYA 4ZJYA 3B8EA 3IILA 1EE1A 2V7VA 4GBMA 3G17A 2IITA 4M7RA 3ER8A 2NVUA 2GYVA 3DVQX 1K7SN 5H59A 4TVBA 1KJNA 2YJ5A 3ULKA 4KR7A 1WCIB 1MB3A 1P7ZA 3BRWA 3DO5A 5KKCA 1FFSA 3U7JA 1P3JA 4JLUA 1JTEA 2JJ8A 2GHQA 3OCUA 1CB0A 3P20A 4JC8A 2MYPA 4O4JF 3A32A 4WACA 4R6XA 1V7QA 1W5SA 4OFWA 2VTDA 3N2IA 4NBNA 5CCXA 3IDFA 4O4IA 1R9GA 5FD8A 4BY9E 3CZ5A 3PX2A 3SZ3A 4HS4A 2P9JA 2QD3A 4ETMA 4MHTA 5LLDA 1E0DA 3BEDA 3C3DA 4GHWA 2POCA 3GBVA 4NJEA 4P58A 4YO8A 1KK2A 1NBWB 5E1MA 1QO0A 4L50A 4UDOA 3OQ1A 1U3DA 4D9NA 1FFHA 3ORYA 2V7WA 5BPHA 1Q7EA 2ZB8A 4YNBA 2IYVA 4FWIB 2GA8A 3CHYA 3FFAA 1DCFA 2ZBUA 3FR8A 3TSZA 1USKA 4OSPA 4OLAA 4I3GA 4DQ0A 1Y9DA 1DAMA 4MVJA 3UJCA 3IQWA 4HYEA 1MA0A 3HUDA 4YLGA 4X1YB 4OQ4A 3MC1A 3TG2A 1FQOA 4DCCA 1RC8A 3I1YA 2IL1A 2GZSA 3ZY6A 1H1LA 2Z5GA 5IBPA 1VGVA 5HF9A 4FTWA 5T4FA 3RUEA 3ZCRA 3Q3IA 1A2OA 2UXBB 2ZIXB 4MRMA 4MVCA 1Z6YA 4PV7A 2Y68A 4ND7A 3CA8A 3E9QA 1X1AA 3CH7A 5KJ1A 1UR5A 3MVEA 4FXPA 2XR1A 1YCHA 4I66A 3TNFA 3TTXA 2F43A 3LDFA 3UUGA 2JLXA 4S1VA 3NHRA 4P5EA 5JWOA 3GH1A 3RTAA 4K2HA 2IWHA 3KU4A 3G8CA 3AB3A 3NDBB 1IE3A 4O02B 3CISA 4DQKA 1UK9A 1SIWA 1RTTA 2PHZA 1TOAA 4C21A 2XMPA 3MB5A 4BO4A 1T8TA 2VYCA 2P35A 3DUFB 4P3XA 2F1RA 4LJSA 5K4HA 1Z4LA 3KV1A 3B13B 4UM9B 3OF5A 1IONA 3K0BA 5FADA 4I4TF 4PBRA 3F5DA 2QQFA 3ZGOA 2GCNA 5U1PA 1N5LA 1BU5A 4Q1EA 4XTRA 4ZZ1A 1BS9A 4U2CA 3EUEA 4IXWA 1QYXA 1XX6A 4QDUA 4RYLA 5FBRB 3OT5A 1N5JA 3HA7A 1WZCA 1UKAA 2CZGA 2I2XB 3FZYA 4Z9BA 2Y8EA 4E2WA 5IPFA 4OHRA 3PUKA 3AUFA 1ZX1A 3NTVA 5I6DA 2J5KA 4CT5A 4QOJA 3RC7A 3K31A 7ADHA 2K7FA 1Z12A 3DM9B 3C45A 2OAEA 2F64A 2WKQA 3ZHOA 2JRCA 1LS6A 1T5DX 4LJ9A 2R79A 3M83A 3JX9A 2UVDA 4B6RA 4NWIA 1DBRA 1BN6A 5I8PA 1J90A 1UPCA 3VR5H 5JSZB 3TAHA 3LRXA 2QUKA 4ZAWA 2OM6A 6AT1A 3FN4A 1LV8A 2C2BA 4PHCA 3ROEA 4MUFA 4G4SP 2HRZA 3VZQA 3L41A 3LY5A 3EZXA 4WNIA 3RC1A 1K9SA 1QYDA 3EBLA 3N28A 1U3GA 3IFSA 1NL3A 5DT2A 4AZ0B 3E84A 1K6JA 3ZDZB 1T8RA 1C2TA 3KKLA 3NWBA 5A4DA 4U7DA 4FOPA 3T0IA 1DS6A 2R1ZA 2WJWA 2ZJOA 4EG5A 1KOGA 5KJEA 1PHPA 2DULA 1B14A 3KPYA 4ZP1A 1SCQA 2JI7A 4D2IA 5BQFA 4OBXA 4G63A 4XVCA 2AA3A 4MKZA 3B1VA 3ZKAA 3RUHA 1U7TA 2E7ZA 4REQA 2ZSDA 4F84A 1S7GA 1Q20A 1JR2A 1U8TA 3ONNA 1C9KA 1I0LA 3RT1A 4YCDA 4L15A 2J08A 4JWKA 1LD3A 2FUCA 4XZ3A 2VDMB 3VBCA 1TF2A 2Q4BA 1DDGA 3IE0A 2FDXA 1YZTA 5IKXA 2R0QC 5ECDA 4DDUA 4QXQA 2KJQA 2XSZA 3W77A 1ISRA 3LO8A 4MUGA 3VKVA 3D6TB 4LGYA 4D9KA 2HWYA 3EGOA 2ZS7A 4MQEA 4RHYA 3V4LA 5ESWA 4FLFA 4ZYTA 3QIVA 5ECYA 4GYYA 3TBKA 4KVZA 2QG4A 1TAQA 2WSBA 2FP4B 1MT3A 4AWAA 3QVMA 4E6PA 1DE0A 5KQMA 4BMPB 5LFAA 4K9RA 5CR9A 3EIHA 2O5EA 1QAMA 1H6DA 3IC5A 5F2NA 3E9NA 1SPBS 4XIYA 1C9DB 2QXYA 5A62A 1QZXA 3BIWA 3CG4A 4X0EA 4XJTA 3RRMA 2VATA 1XDDA 1KI6A 3IT3A 3M4ZA 3GT7A 3LS2A 2OOSA 4ZEVA 4OYLA 4RKQA 3ND5A 2J3LA 3D5QA 2OQRA 2NU7A 4H7JA 3PKJA 3H05A 1DIBA 1GUFA 1L8LA 3VSBA 3WB0A 2HA2A 3ZDQA 3FWPA 4JOBA 4FZRA 5HIIA 4HWRA 1YTLA 2BMEA 3TJMA 2PUEA 2QHXA 4FZ5A 3MCWA 3ZZTA 1KK0A 1RT9A 4UBKA 3A1CA 1NSFA 4L3OA 3NIFB 4FE4A 4QYMA 1UXIA 3B5IA 5IWAB 4B7AA 1VQ1A 3TPCA 3HU2A 1YS7A 1JFLA 2P0YA 3MGAA 1BSVA 4CMEC 1PEKE 1XJ5A 3QH4A 5AW8A 2I91A 3LZDA 4UE6A 2XA2A 5HUHA 4KVFA 3A3PA 4Q4JB 2F9FA 2WSMA 4CM1A 2I6XA 2X2FA 4IG9A 1GQFA 1BE6A 1V4NA 4R1TA 1N2CB 1QHGA 4G3XA 3PEWA 5KCMA 3UJ6A 2JLCA 3NZEA 2BHRA 1NT2A 4EPVA 4HY3A 3DLBA 3V1LA 3CNQS 3UKOA 3VH3A 4CM4B 1F6BA 1A5AB 1RJ9A 4MUJA 3PE3A 5DGTA 3GUZA 3LE8A 1U5CA 4YCBA 1PL6A 4MPTA 4O4IF 3WMXA 5AKXA 3Q0TA 1U0SY 4NARA 4ZT5A 5A71A 2OHIA 1Y6ZA 3RYIA 3ZY4A 1H1TA 3LYAA 1CUSA 2GEVA 2C7QA 1P4JA 2CZCA 1GAWA 3R41A 5CB0A 4YCNA 1M8KA 4EHBA 4OI0A 3D6VA 3H3XA 3FBGA 3GZNB 2WKWA 2VZEA 4PZLA 4CWAA 1N8SA 2WPDA 2BTEA 1OGJA 4EMTA 4EKGA 2ZWAA 4EGAA 4GE0A 5JD3A 3I1FA 3WP0A 3FJYA 4MVJF 4WDQA 3IT2A 3MUOA 2WHXA 2NVOA 4ZC8A 4AP9A 4O2BA 3RS8A 4FJ1A 1QRDA 2D1RA 2CJYA 2ZI6A 3QFCA 3V4PB 1HNWB 4WUVA 1LKZA 1J49A 1U8AA 1B16A 1J9EA 3COWA 5TGTA 5EGNA 1CUDA 1L5SA 3H5TA 3QX8A 5CYOA 2NO1A 3ESYA 1QK3A 1WPGA 4KEAA 3U13A 1IOVA 4AX8A 4KV9A 4WKGA 1QH1A 4TVOA 3GHYA 3QQPA 4AVYA 3UCEA 4CQNA 3KLPX 1R00A 3EEFA 3UJHA 1DRKA 5LN1A 1FYEA 4WPGA 5JBNA 1NW5A 1QK5A 1PP4A 3F7TA 1AE1A 1HG0A 5HQTA 1TFUA 1ZH2A 1I3MA 2D3WA 2EX1A 2GCPA 1EEHA 3HCOA 3NBUA 2B5OA 4KBFA 1RWOA 1X1TA 2W43A 3K1YA 3FOWA 1DG3A 4BUZA 2JJYA 2IZZA 1Q16A 4B0PA 1NMZA 4DA7A 4YV7A 3U7EB 2BDTA 2HGZA 1GWNA 3TD6A 5F5LA 3Q9SA 3DYIA 4DT1B 1QDLB 4DREA 1VBNA 2YINC 1PJ3A 2R44A 4S1PA 4OI1A 2O5CA 8ADHA 2H51A 1L1FA 1C8LA 2DR0A 2SCUB 4IUCS 4BVJA 2IY9A 4K87A 3H1AA 7REQB 2OEPA 2PL3A 1BVRA 1SG0A 3C4QA 4GKVA 3U9TA 2AXPA 3ZQJA 1O1YA 1M2GA 4FFPA 5EN4A 4GLBA 2JLZA 2P9FA 1VHDA 3IRVA 1CFJA 1M76A 1ONNA 1BXRA 3RBZA 1TUEA 2O9JA 5COBA 1DG9A 2HIGA 4LJKA 4ZOLB 5AK4A 5HF5A 3SF8A 2P8JA 4EB6A 4RTNA 1MW8X 5IH3A 4DSZA 2XQGA 3H2ZA 2ZUTA 4JYBA 3AY3A 3ZCQA 3QBVA 2V54A 3QF7A 3HYSA 4AJNA 3U7FB 1YS2X 2INGX 3ZU5A 1GVNB 2OBMA 4RNDB 5KYUB 3TVYA 3BQNB 3H83A 4IDNA 4B3IA 2PT9A 3I9MA 4JH0A 1O0SA 4PZUA 3ED1A 2ILTA 1P81A 4PZYA 1L5OA 2GPWA 1IQ0A 2JJ2D 1RPZA 3ZX5A 2CVPA 2BGJA 3HYCA 4LJLA 4B46A 1DJQA 4P34A 2EP7A 3IJPA 3AJEA 4LY0A 3R2JA 4WLVA 4V0RA 5IVIA 1ENPA 4UAUA 5E6RB 5K2MA 4C0XA 4EKIA 5BWMA 1Y6GA 3AHFA 3TQSA 5EUBA 5H9WA 3WYCA 2ZITA 1T0BA 3B6KA 3WS7A 1FUIA 1YJAA 3BMNB 4DLSA 4MI1A 4EGQA 4MGYR 1T36A 4E1VA 3JQEA 3JYHA 2D2XA 1U7XA 1PJCA 1SKAA 1F1JA 3IE2A 3QXXA 4UKDA 1MFZA 4MR7A 1AURA 2BSAA 3P32A 4WKCA 1X77A 4AUMA 3A6FA 2MIIA 4AN4A 4LXQA 4GSYA 2O8EB 4BWYA 2IV7A 3MINB 3PITA 4DXHA 1Y9AA 1XZBA 3JQQA 5AUNB 4QPPA 3CLUC 5AW0A 1ILEA 1J1ZA 3CXUA 2OLEA 1M0TA 2EWMA 3HKCA 4KUEA 3E3MA 1C80A 3RAGA 3CVJA 421PA 4JVOA 4FE7A 1L7PA 3ZTTA 2AOVA 4HGOA 4ARUA 1VIYA 3A27A 4EFNA 2HY7A 2R00C 3TR6A 3UYKA 2L17A 2HF9A 4TMWA 3ZJUA 2BFOA 4KODA 4TOIA 1US8B 2FFAA 3KTAA 1T43A 2XMDA 1T35A 1PR5A 1EI9A 4EQ6A 5K45A 3F7OA 3U3DA 5L3RA 4I1VA 3U3OA 1ISMA 4B3DA 1NVAA 3DDSA 3NT5A 5E6SB 3KNZA 1LX7A 2AUMA 2QTVA 3ZNPA 3ONVA 3DOFA 5CYPA 1QQBA 4K3UA 4B3HA 2AJDA 3SKVA 5IP5A 3VKUA 4QOFA 3ZW7A 2IXEA 1DO0A 2NUTB 2X0KA 2IPNA 3WGUA 4FXOA 1PSWA 3SC2B 3D4PA 3IALA 4Y98A 1IY9A 2W2VA 1CUXA 3P4XA 1WU7A 5B53A 5JSKA 4E1BA 3KD2A 5EQDA 1W5FA 4X44A 1IH8A 1LQ2A 1Z0DA 4I5GA 3B6JA 1BWRA 3R0XA 4LCBA 1YZHA 4KYUA 1NNSA 3X1DA 2QMUA 4BVLA 3ZQ4A 2VJYA 4NHEA 4A3SA 3H1EA 1UMDB 3IBSA 1CSEE 2VO1A 5D00A 2HO4A 3BULA 3P96A 5KX5A 3ZCUA 3HFJA 1UKVY 4MV1A 4FN5A 2D54A 5CLIA 1Z4PX 5G53C 1N4AA 4F12A 3COJA 3C5VA 2CFRA 1XV5A 2X41A 5SY4A 3D7RA 3OQIB 2OBLA 2GQ0A 2PL9A 3HDGA 4Y2PA 5TQ0A 3W5BA 4C6SA 3LTNC 2IYXA 3QBDA 3R0JA 4B9EA 3CLRD 3AI1A 4CV0A 4NS4A 5JYDA 3L7JA 2BFEB 2PMDA 2PMWB 3DVSX 5GV8A 1L4YA 4MUHA 1N6NA 5A9RA 1VA5A 1B74A 4QTYA 3S5JA 1IG3A 1IN4A 1K1EA 3DOJA 4FYPA 3SQLA 1CWUA 4JP2A 4TYPA 4HMPA 1I3KA 2NAPA 4UAJA 3UCFA 3WGVA 1Z7YA 5JZOA 1DAEA 2QN8A 2GWHA 2MYTA 1FZQA 4TKZA 5DEIA 5TT1A 5IF9A 4HEJA 4CQJA 2VQFB 2C9ZA 2HHAA 1JVNA 1R0CA 4R0VA 2FEKA 4L27A 1ORWA 2PBRA 2FPIA 2P8SA 4L51A 4CL3A 4BECA 4I4NA 1N2CE 2X40A 4FD2A 3TFWA 4IIBA 1GPDG 3JWJA 3LLMA 2C00A 5CX1A 4XEHA 4DWWA 4JL8A 4O2BF 3BCUA 1N2IA 4KQJA 1OH8A 2FLKA 4UD2A 2C42A 1NAIA 3KR9A 4ZVMA 5A9TA 1E1RD 3BILA 1GUZA 1DKUA 1Z28A 3FPSA 3HNOA 3QF4B 1GTMA 2RGXA 4X7BA 2ORIA 3I37X 2XWPA 3SEZA 1OZ0A 2Q3DA 2JDIA 1PR4A 3DH0A 3DO6A 3N5KA 3RTDA 3ZXSA 2QLMA 4R6WA 3P5SA 1I9GA 2FFHA 5TNXA 1PZMA 2OP1A 3DKKA 4B33A 4N01A 2YMMA 4BO1A 1QGED 3UJ8A 1GR1A 3V32A 1VG0B 1GUAA 4YRFA 1TTPB 3L4BC 3TGWA 2QVCA 4Q3LA 3L4EA 2C4WA 1ZI6A 4QUKA 5JPCA 1DQYA 2B9VA 3G5UA 4WLNA 1N6OA 2V58A 4M6WA 1A88A 2ZGVA 2I76A 5KTYA 5JH7B 2XCUA 3N87A 3O8QB 4MJ7A 4N0PA 1MPXA 3L6EA 1A9TA 1FLVA 4C88A 1DEAA 1CQIA 1H0HA 2QRNA 3ONEA 2VSXA 3Q0IA 5AVOA 4DCJA 1TXGA 4O2LA 1JQLB 1CUGA 1PWYE 3NM4A 5FHRA 3BIJA 1O8CA 3D8HA 1H2ZA 4ZVKA 4CM3A 1HQKA 1H3EA 2YCBA 2WAMA 4J7AA 4Z7JA 2ZQZA 1VLQA 5LNK6 1PO7A 1X8XA 1Z8FA 1RHKA 3A0UA 4OSOA 1LH0A 3WWPA 2QXTA 3DMGA 3EYAA 3NCHA 5I7AA 4OHBA 4J1JA 5FBVB 4F7DA 4RKYA 4EYOA 4G0OA 1BE8A 1Y5RA 4IG4A 3MTDA 5ESXA 4CT0A 5DM70 2OCBA 1X0XA 3K70B 1DXQA 3W8FA 1XU7A 2IYOA 2GZHA 1EJ2A 3EA0A 4EVRA 4RSGA 4CM7A 3RJ9A 3LMKA 5BSMA 5T8KA 1JAXA 3PV0A 4W9RA 4GOKA 1JAHA 2Z4SA 1A71A 1L7OA 1A9QA 1OZHA 1N8KA 1PGNA 1Y42X 2FR0A 3E35A 3GX1A 4UUBA 4Q1FA 1IJEA 1GPMA 1SNYA 2LCIA 3R7AA 1J25A 4LFAB 4RJKA 1LBEA 4YASA 1T5TA 2VDOB 1GCOA 2ZBRA 1EFCA 1AMNA 2KBEA 4MVJH 3ROZA 3CTMA 1EP3B 1V8FA 4NNJA 1SVSA 1PL8A 3GAFA 3IDQA 5DLDA 4BC1A 5FNVB 3X0DA 5KJCA 4IIYA 1EUZA 2R8RA 3I9LA 4HDSA 5EJMA 3WY9A 1TYAE 4R54A 4GPAA 3KPJA 4I81A 4IHAA 4M9SA 5FOVA 4HLUC 1JU9A 1F4PA 5IJXA 3AVYA 3V42A 4CQMA 1Q0HA 1WEHA 2HSDA 5ICCA 3E03A 1C7ZA 3OFKA 1NC3A 2PCLA 5AM5A 4DVGA 1U1FA 1Q21A 3GQBA 1JG3A 2QD4A 2Q7XA 4EI2A 2XTMA 5AUPB 5F2KA 3KEOA 3WYNA 1QG2A 5ITSA 3ESQA 4AWXA 4QREA 2IYEA 2Y9PB 5JECA 4OBEA 3P0IA 1CZOA 5E4FA 1NF9A 4BLRA 5A3QA 4ND4A 3OM8A 4AG3A 1AV6A 1GPKA 2HJRA 5EG5A 5I9SA 2VSOA 1Y81A 1UMKA 3QMPA 1ATIA 1UT6A 1KQGA 1K5GA 3N5CA 2QK4A 4YBZA 1P19A 2Q2WA 3T7AA 2XE8A 3CY6A 3OTGA 4XWGA 5J2UA 5K99A 1I2DA 2PA3A 4ALKA 2OR3A 4IIJF 4J16C 1JAYA 2GN4A 4RA6A 1N75A 2O8FB 2EKQA 3TLXA 3U2QA 5EE5B 2GK4A 3W2IA 5HMMA 3OEWA 4AS3A 3KQNA 1QQ6A 1ZK2A 1OHHD 1XNGA 2IYZA 4H4EA 1ZM4A 2PD6A 5AM2A 3KEGA 3BMOB 4KIGA 3FPJA 1GN9A 3DAYA 1P2DA 3IQEA 2C2ZA 1ZGHA 4IFIA 1M5TA 1PCXA 1GUDA 3E0XA 3I72A 3ZW9A 4B6JA 2II6A 1OXUA 2YFKA 1JVSA 5DCLA 1R88A 2Z2IA 1BFUA 3PQEA 4HDQB 2P3QA 1AM4D 4FW9A 1DUIA 8OHMA 5BSVA 1E2JA 3WX0A 5K0BA 3DMTA 1VP9A 3ANYB 1GZUA 1VDMA 2Q21A 3CF4G 5CLGA 4MUXA 3CW9A 3JVIA 3TGPA 4IV0A 2C82A 3D1VA 3V8QA 2J1LA 3G79A 4LXIA 1BKSB 2DY0A 2IPAB 2ZUCA 4HAYA 1BGXT 2H16A 2GKGA 2ERYA 3ISTA 4PONA 4ZT2A 3H6KA 1I1OA 1I1QB 2EQBA 4U3JA 1RAHA 4HNGA 2VNKA 1E2LA 5KX5F 1E3IA 1C50A 1E2NA 1E2HA 1K0UA 2OB1A 1PD0A 2JIPA 2Z2YA 3HEAA 3HN2A 2AWOA 1U1DA 3K6JA 1LC0A 2Z30A 3LDAA 4N7MA 4XGQA 3UPUA 1N2ZA 3C7CB 16PKA 2VAMA 2HCTA 2JCYA 4CHTA 4OXXA 5BR1A 1JB9A 1QNLA 3SVZA 3LDUA 3ICCA 2X5XA 3GPIA 3A9RA 3L8YA 3OMXA 2PEYA 3PJGA 3KT6A 4BGEA 4PLYA 4WKBA 5JASA 3H84A 5JNUA 1DAOA 3PHIA 2CUZA 4MW7A 3RH0A 5K3DA 1W85A 3TIVA 4TPKA 1IN6A 3KZXA 1HE8B 4TXJA 3BWYA 3RF6A 1X38A 1USVA 4DOMA 4R8VA 3OQOA 2IGBA 3BRQA 4XB2A 3SXUA 5DDIP 1P29A 5B7GA 4C9BA 4LJRA 5CPBA 1XZEA 3VSCA 3A6GA 3REFA 2LE0A 3OP1A 3WKAA 1E6MA 3QRWA 4E5YA 3RRBA 3ZVKA 4CMHA 3AWIA 4OH7A 4ZRNA 2GNAA 1W34A 2NV0A 5TRTA 2RHOA 3CN7A 2GAOA 1H9CA 2H2AA 1Y4SA 1GL9B 2J09A 1I3CA 1NVMB 2WE8A 2ZSUA 3DNPA 3EXAA 3F49S 3HP7A 4PYQA 5E0KB 3RWMB 5BP7A 3JQFA 4D7AA 5BVHB 1J00A 3Q5EA 4OP3A 1ZRHA 2NTVA 3EA5A 3UMCA 1JG7A 3N2LA 2QJWA 3ND7A 1UODA 3FOZA 1BE1A 3Q4GA 4Z99A 1VE5A 2RG7A 2JHAA 3K1AB 3KHTA 5DO9A 4AQ7A 4H6WA 5IN5A 3TF5A 1JFRA 3JQCA 1EFHA 2EATA 1KZHA 4B71A 1GU0A 5JY6A 5EEGA 3ZVRA 4ETNA 5KTPA 2CHQA 1YQEA 2HEGA 1U6KA 4FFNA 4O08A 4JP3A 1KOLA 1JPUA 2OBNA 2AFHB 2C1XA 3DQPA 1IUNA 1CEXA 1O6FA 1S8OA 1XTBA 2RGWA 4IP0A 1RWBA 3RIMA 3FGPA 3ADBA 3ZGNA 2F62A 1YZQA 2OC9A 1D1QA 1CRLA 1UAGA 1UAYA 1XTSA 3ZG6A 2B8TA 1EXVA 4HH1A 5FHQA 4BKQA 3I3OA 4QGFA 1WF6A 2ZJ2A 4MV9A 3TZHA 4QXPA 3GN2A 2DAPA 4A7PA 3NWJA 3OCWA 5SYAA 1XCJA 5F23A 4QU9A 1IBRA 1UQRA 1GXSB 2ZTUA 2CL5A 5KIAA 1RI3A 4Z0NA 1Y5LA 4DRXB 3DDNA 2JF0A 1YA6A 4AY3A 1YDWA 2P5YA 4JEMA 2DHCA 1U4SA 5CFOA 3L0IB 4FN4A 3SAJA 3MRTA 4PC3A 3E58A 3S1SA 3PHGA 4ND5A 3VQTA 4XWTA 3AK4A 2GJ8A 3MWEA 5WRFA 2FZ5A 3DL2A 1Q50A 2Z56A 4DLXA 2VUTA 3C1UA 3QE4A 1V4BA 1ZK0A 3OI7A 4XVHA 1KPGA 1PKXA 4NJMB 4CF7A 4MDHA 1RADA 4NFHA 1L7AA 1ZBDA 4P7JA 4HXEB 2YV2A 4P7GA 3D1JA 4C07A 4GUAA 5F9MA 3QE0A 3O84A 5BQOA 1RYHA 2GILA 1KEZA 3BCHA 2DRIA 5ELXA 4UE3S 3DGFC 2G70A 3OESA 1D6JA 2VJAA 2JBWA 4QATA 3PGMA 3NX4A 1OFUA 3CF2A 3GFRA 2DFVA 2QT1A 1KEEB 1YRQA 4Y3UA 3FNQA 3UT0A 4BE7B 3ZD6A 2BDEA 4MKRA 2GVZC 2PAFA 1GFWA 1YDHA 2H92A 2D2FA 3DGEC 4I3HA 2YIMA 4LMAA 1EG2A 3HJFA 4MQ4A 2Y71A 1Z0SA 3MAAC 4AMYA 1XK6A 3K09C 5CDSA 2QRPA 1XE3A 3CR8A 3B1WA 3RFXA 4YUVA 3L2OB 2O20A 5FUVA 2EL9A 2X7JA 4M88A 3BIXA 3WR5A 1BA3A 1U7WA 1TZMA 4RFVA 1RP1A 1GARA 2APJA 3TW8A 1G8HA 1H4VB 5FFNA 3A25A 1SBNE 2XKBA 4C04A 1QUFA 3N3AC 2EWWA 4JLPA 3UXEA 1AXGA 1MU0A 1SR8A 1JR3E 3ESBA 3K5HA 2ST1A 3AT1A 2YC4C 5IC5A 1EH5A 5IKOA 3ZW8A 1EGHA 1S4QA 4Q9KA 4YVFA 1CY6A 3SHFA 2V6JA 1O2DA 2Y1GA 1NJGA 3Q2OA 2UZ1A 4BLOA 4HUTA 2VK2A 5FOWA 1JPJA 1ML3A 1SRQA 2C9MA 3LKBA 4K9QA 1L5HA 5K03A 2GAFA 2IXFA 2WAXA 3LP6A 1ST3A 4TGLA 3DE5X 3SNKA 4ZQIA 1TTQB 2AI1A 1VMDA 4LW8A 4CI0B 2HFJA 1VLJA 3H2YA 2ZREA 3NTRA 3ESZA 5C4GB 3W5SA 4EM6A 4O4HB 4PU0A 4JLNA 2Z58A 1II8B 2GBLC 2I7VA 4CFYA 1ZXBA 1G2QA 3BDIA 1NYLA 2PSSA 4JCCA 4GRIA 3WIVA 4DMUB 4ZKDA 1LPPA 3U48A 2P9CA 4MYTA 3GGSA 3STWA 3HVRA 1SELA 3M4XA 2D2IA 5EESA 1T2AA 3GJ4A 3DT9A 5F77A 3CEPB 3EPJA 1EE2A 3FJ1A 1CRZA 2V74B 3LX5A 4NZZA 3LOQA 1L3IA 4MW5A 4LHZA 5EE3A 5EJ2A 3ZI0A 2BVNA 2ZYDA 4L6IA 4UHBA 3W6NA 4DIKA 4AB1A 1WA5A 5BORA 1E8MA 1SU7A 2PBZA 1A9SA 2Z2XA 4GNRA 2VR1A 1P1BA 2P9YA 2XNJA 3T3PB 2H1CA 3L7CA 3AEUA 1A5SB 1KBZA 2IIVA 3NEJA 4RUKA 5D3ZA 3PFIA 4YMLA 1UKBA 4Z9FA 1MD9A 1T15A 2E4AA 4TMKA 3EVTA 4TT8A 2W6CX 4MWOA 3T41A 2G28A 3V1UA 2OPHA 3LOPA 1WV0A 2PLAA 2PFGA 3WGOA 2QL5A 3I12A 1TRHA 4D9BA 1P77A 2Y67A 1TT5B 1IHYA 3GEDA 4LV8B 4UBMA 5EIFA 3FKSD 3CX7A 3FYUA 3NHWA 3MT9A 3SS9X 2Y6VA 2XE4A 3THOA 4EVSA 5BQXA 3DBHA 4P33A 2Y1EA 1PFUA 4MWTA 3K8OE 2O23A 2JAHA 2JGLA 2ZPAA 3ZE9A 1J1IA 1QHIA 5EIBC 3NTQA 2AOUA 2HUNA 3PGXA 3F6PA 2HV8A 1VPTA 3DTYA 1J42A 1SHJA 4AO8A 3GCXA 2O05A 1JQKA 2ZWMA 4Q34A 3TS1A 4EG3A 1A2BA 1SZPA 3SU8A 3UKJA 2FFRA 3ZDFA 3MGKA 4UARA 3PL1A 3A26A 3TL3A 5JJCA 1OE0A 3CRRA 4QJ4A 4UEKA 4WBNB 3HCBA 5A0VA 3GF4A 4B3GA 1UKCA 4GLOA 4B35A 4PXAA 4RX1A 1OAOA 2FFQA 3I5UA 4M55A 4XFJA 4M83A 4OX9Y 4J0CA 2W0MA 3IR5A 5KMGB 2WEKA 4TTVA 2BHSA 4I9GA 1GQOA 4C5AA 1CQJA 4RF2A 3IHKA 4JJ4A 2EJCA 3UV3A 1RW4A 3E2IA 4QDZA 1ZD4A 4QAQA 3RGGA 5CAEA 1P61B 3R7LA 1U0HC 3IVRA 1N6RA 1PU2A 2XT0A 4YMSA 4IR7A 5I8ZA 1ZL2A 3TBFA 2HJHA 2Q5OA 1YZNA 1JRLA 2PVCA 1VL0A 3N8DA 1T9AA 3C3WA 4ZV7A 5M04A 1NPTO 2HLDA 2DHDA 3Q7IA 3DZGA 1FS6A 2WINI 2FR1A 3EEBA 4IQ0A 3NBYC 3QVUA 6REQA 4DLYA 1CDOA 3SZGA 4YI5A 2V5UA 2Y3IA 3GJ0A 2GYUA 4JC0A 5SV2A 3WYBA 5KWSA 3AHIA 3WNBA 1P39A 1F5SA 1G8YA 3QEKA 3GFGA 4RD2A 5EXXA 4PLCA 4LJ5A 1T0UA 5K51A 1NJ2A 2EL7A 3QKSB 1N7JA 3IXMA 2BDUA 3O1IC 3VU9A 3L4JA 5FQNA 3FMVA 3VC7A 4ML3A 1D3AA 3LXUX 3SYNA 1G5TA 3GUYA 4F0JA 1PTJC 1XHEA 2R8XA 1XYVA 2OO5A 3N0TA 1O0CA 1P0MA 4I6EA 3T3EA 4PPYA 2AJTA 2CF6A 4JUBA 4NBWA 4OJTA 3FOFC 3G2HA 4LXGA 1F3LA 5FULA 3SEQA 1J09A 2MYNA 5EMHA 1EDBA 2OK8A 2G0TA 1B2RA 4JNKA 4BQSA 1Q0UA 5CD1A 1R2QA 4II3A 4PZZA 3PEEA 4UHFA 3DNMA 2V7BA 3I04A 3ID6C 4RJLA 3BIOA 1KARA 2MCFA 4PX9A 3B7GA 4TL7A 5F35A 1SXJA 4ALJA 4EEKA 4ZYXA 1GNLA 2XAUA 4UJ5A 3OX2A 2G9NA 2DR2A 1H2HA 3KT3A 3L93A 1CVRA 1ELOA 3U3XA 2AFHE 1FLNA 1EGMB 1W19A 1CS4C 3VZDA 2CN1A 3PQFA 3RIGA 3TQIA 1KVRA 2VYVA 4KJXA 2IVZA 3P2JA 5EIAA 3JQAB 4MHSA 4YGYA 1ZI8A 2QLFA 3NT4A 1AG9A 1QHSA 4MRVA 2C04A 5KNCA 2VL7A 3LQ1A 2KI5A 3BHJA 1BDMA 3EHEA 1BN7A 1J5XA 4X84A 3EUWA 1RLOA 2OZLB 3LQQA 3PCXA 4R9SA 5ALWA 2DJ5A 1OFUX 4C0AC 1QPZA 3ESDA 3TFQA 4JDPA 1YI1A 3GLFA 3BL6A 4B4UA 2YDYA 3H5LA 1EEXB 3W8NA 4WL0A 3PA6A 1QQ7A 2Q4OA 4QEDA 3PE4A 4NJOA 4BGVA 5IJ9B 4OPMA 5KAMA 1RHMA 4RTLA 2BMAA 4DF3A 4OHZA 3UG6A 2Y9MB 1JKJB 3LSTA 4N3NA 1ISJA 1UM8A 4MRRA 2J87A 1QFXA 4F6RB 3ZH9B 4JAVC 1SFRA 4MR9A 5KYXA 3T4UA 4G01B 4E15A 1L1RA 3KSZO 3FKJA 2OV8A 5DHRA 3ERCA 4WZZA 2V6IA 4GOLD 3DEKA 1G9XA 1KEWA 1H85A 1MDFA 5IAKA 3ZZNA 3HY3A 5CYGA 5DCUA 1X39A 3MWYW 1BCSB 2ONJA 3CMMA 4IQGA 1YFJA 5SZJA 3B52X 2PU7A 3D2BA 2ZJZA 2VQDA 3H7IA 2OXFA 3JV7A 4KMRA 3DP9A 4Q4HB 4O5AA 5EUMA 4V0MA 1S89A 3HDHA 5BN5A 1NVTA 3T5TA 3I23A 2X23A 3L6BA 3PQDA 4BP9A 5JC8A 4EFMA 4AXBA 1GNSA 2EP5A 3HA5A 5SZHB 5KSZA 4XJXA 3G85A 4KW7A 4OB6A 1ID1A 5DHAA 4UHEA 2HFKA 1KWKA 3AVPA 5DRYA 2OCXA 4AJHA 1EKXA 3V9AA 1XJ0A 3RARA 5LQUA 4HGNA 3MERA 3JR7A 1M2FA 4KNVA 4P81A 3VA7A 3OM0A 3UENA 4V24A 1T2VA 4ZZ2A 1EUCA 4ZO6A 3WYGA 1O94D 2RCYA 5FBLB 2GLTA 2LDXA 4IOKA 1SURA 2YN2A 1VKRA 2SECE 1K8ZB 1OBFO 1NG1A 1CY8A 4K1LA 4A16A 1XJCA 5JATA 3IAAA 4YT5A 4GYKA 4YIHA 5GADl 3AR3A 1BQEA 4G1VA 2BGGA 3ADDA 4FYXA 3WBFA 3BTOA 1ODKA 2QRLA 4E3WA 2J5QA 4ENPA 2OC4A 1N2JA 4O33A 1RAEA 1T6NA 2EC5A 3IS3A 1N9KA 1UJCA 4U9UA 3CNLA 1FTYA 2F6RA 4UTZA 4KMMA 3L1KA 4ZOBA 5AVSA 2XJ4A 4CFZA 4P0PB 3KIPA 2CLKB 3KUUA 1GD1O 4FT4A 1WTCA 1A2QA 4Q18A 4UHDA 4Y6SA 4DHEA 5IM4A 1EJ0A 3AIKA 2P2CA 4OQDA 1QOQB 4EB3A 4G5SA 3HO1A 1LPOA 3P9NA 3VHLB 1EVJA 3MLBA 1DIRA 3VV3A 1M6WA 4HB3A 4TN5A 5EPEA 3MOIA 4LFBB 3IA2A 4V3BA 4UZSA 4MI9A 4H2DA 1KY2A 2BM1A 2FN9A 2QD5A 3E7PA 3ILSA 3KD3A 4OM7A 4BLQA 4F2WA 1OD6A 3HM9A 1QS0B 2PYIA 1E7RA 3JYLA 2ODEA 1H05A 1YR6A