1A9YA

Udp-galactose 4-epimerase mutant s124a/y149f complexed with udp-glucose
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
338
structure length
338
Chain Sequence
b'MRVLVTGGSGYIGSHTCVQLLQNGHDVIILDNLCNSKRSVLPVIERLGGKHPTFVEGDIRNEALMTEILHDHAIDTVIHFAGLKAVGESVQKPLEYYDNNVNGTLRLISAMRAANVKNFIFSSAATVYGDQPKIPYVESFPTGTPQSPFGKSKLMVEQILTDLQKAQPDWSIALLRYFNPVGAHPSGDMGEDPQGIPNNLMPYIAQVAVGRRDSLAIFGNDYPTEDGTGVRDYIHVMDLADGHVVAMEKLANKPGVHIYNLGAGVGNSVLDVVNAFSKACGKPVNYHFAPRREGDLPAYWADASKADRELNWRVTRTLDEMAQDTWHWQSRHPQGYPD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-GALACTOSE 4-EPIMERASE
publication title Dramatic differences in the binding of UDP-galactose and UDP-glucose to UDP-galactose 4-epimerase from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Epimerase
total genus 127
structure length 338
sequence length 338
ec nomenclature ec 5.1.3.2: UDP-glucose 4-epimerase.
pdb deposition date 1998-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1a9yA02
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1a9yA01
3WOHA 2PFGA 1Q7BA 1EZ4A 2DM6A 3L0DA 1PGOA 4BHTA 2PGLA 2CVQA 4CR7A 4DQVA 2D59A 5JAQA 4CQLA 1H94A 3FNGA 1ZBQA 1CQJA 2A92A 3LYLA 1C0PA 4CV1A 4RVFA 5JE8A 1B14A 4BKRA 2WMDA 4E5MA 1E7WA 3IDSA 2WE7A 5G0WA 2IZ1A 3JQ8A 3JTMA 3VTZA 4AJOA 2GZ2A 1RKXA 3ZWNA 3T4EA 4NBTA 3OJOA 3EHEA 1XQ6A 4DUPA 1VPDA 3JYLA 1LI4A 4I9NA 5B12A 4BNXA 1DHTA 3EVNA 4LMPA 4QEDA 3ZWBA 3DBRB 4QX6A 2NQTA 4OOEA 3SLGA 2NTNA 2PLAA 2EJVA 2YHIA 1PJQA 3KSZO 3PK0A 4HKTA 3RUIA 5JYEA 4RORA 3TZHA 3RASA 1SCUA 5G0SA 4BNYA 5F21A 3AY3A 1PJSA 3RBZA 3ZV4A 1YWGO 4WE3A 1DC4A 3F1LA 2HCTA 4OGWA 1RM0A 2EHDA 4FC7A 3TZKA 4CMBA 3JQGA 1VL0A 1R0KA 5JS6A 2Q2QA 3KTDA 4AL4A 1DLIA 4YJDA 4KUEA 1A7KA 5JAMA 1UZMA 4CM3A 2AE2A 1EBUA 1QKIA 2YHUA 2VHVA 4D0SA 4IDCA 2DTEA 4OSOA 3E18A 2XAAA 4OM8A 4OOFA 5JO9A 4BO2A 4MIEA 1ENYA 3PFFA 1P33A 3FSRA 1BSVA 2RIRA 3GG2A 4FOOA 1NPDA 5IG2A 3KYCB 4WUVA 4YTEA 2J8ZA 1YB4A 3E1KA 4PG6A 3IQDB 1O5IA 1PJCA 3ICPA 3JCZA 3LU1A 1SPXA 4MKZA 3F5QA 1JDJA 5DCYA 3RAJA 1AXEA 3BMQB 4CM8A 3UVEA 3AWDA 3LVFO 4IDGA 4IJVA 4HX5A 1KEWA 5TIIA 1U3WA 1CERA 1J4AA 4CJXA 4RF3A 5KKAA 1B2LA 3PWSA 2YZ7A 4O1MA 5C5IA 4EYEA 4BUCA 4H15A 2G17A 5ADHA 1T26A 3VZSA 1IULA 3JQDA 3GHHA 4KTVE 5J23A 2BF7A 3F6YA 3WYBA 4IY1A 3ZWOA 5JMPA 4ND3A 1SC6A 4BKOA 4E2XA 3IC5A 5CP8A 4B4WA 3ZNQA 4NJMA 4FD3A 2POQX 4MVJM 4DREA 2O3SA 3ITKA 2PD3A 2PR2A 2UDPA 4LRSB 3NRCA 4G2NA 4YQZA 1M6WA 3C1TA 4TSKA 3WGTA 3KYDA 5TJ9A 1ONPA 2EKQA 4Q3NA 3E6AA 3VAZA 3PHJA 3VOSA 4I1IA 2PGDA 2GLXA 4R9RA 4D3FA 1Y81A 5T6BA 5BT9A 2PV7A 4S1VA 1BVRA 4ITUA 2B0JA 1Z82A 2HMSA 1HDRA 3WNVA 3MJVA 2YV1A 4R4JA 2C5AA 3GQVA 3GF4A 1C1DA 4CPDA 4AJPA 4M86A 2D0IA 3E5MA 4J1TA 3B1JA 3GHYA 1M6HA 4ALNA 3DB2A 1YGYA 1GEGA 3DBHB 1UZNA 1V6AA 2VT2A 3JQ8B 1QV6A 4NU5A 3D64A 5ITVA 3EVTA 1U1IA 3GNQA 4LRTB 4JK3A 4RLHA 3FTNA 3L9XA 3KEQA 1LLCA 4YJFA 4RV9A 4CV2A 4E33A 1TT5A 3E8XA 3BAZA 4CMAA 1R6DA 2HRBA 4LSMA 4XYEA 3GPIA 3WGQA 2CF5A 4PIVA 3R3JA 3KBOA 4MDHA 4M55A 1GYQA 3RBXA 4DBVO 4DLLA 3CPSA 3TDKA 2OMEA 4GAEA 3WJAA 5JCJD 2YHIB 3QVWA 2X86A 1K6IA 1K2WA 4TMFA 4J90A 2E48A 1XEAA 3DMYA 5KVSA 2VUSA 3ZWXA 1S7CA 4R1SA 4AJIA 2FPPA 2GCGA 4Z0TA 4NIMA 4L9RA 5I7EA 4DIOA 4KTTE 5CG2A 3R3SA 2CDBA 3JQGB 4CUJA 3JD0A 4ILKA 2JCXA 2J5RA 4BO9A 2Q4EA 3I83A 3PYLA 4FJ2A 3ZWCA 3CZMA 3PZRA 2DTDA 4MVJH 4CODB 4IQ0A 3S2GA 5A03A 1E0DA 1PJLA 2HMVA 3JQ6A 2EGHA 4CQMA 3FWZA 1VRWA 4C7JA 3AM3A 3ANMA 3FI9A 4OO3A 4Q3BA 2ZB3A 3BMNB 4K9DA 3WLFA 3U49A 4D43A 3WYEA 1QP8A 3GGPA 1I2ZA 1LUAA 4YAKA 5BNTA 5I7SA 1Q1NA 1GUZA 1IPFA 2WD7A 4FIZA 3GN2A 3GT0A 4LISA 5C7IO 5A05A 4Z9FA 2G76A 3LDHA 4WCFC 1OBFO 3HSKA 2DVMA 3Q2IA 2NWQA 4M8SA 4MP3A 4CM8B 3TFOA 3ANNA 4JP3A 4JJGA 2NTVA 3DZGA 1E3WB 4WNIA 4O6VA 4CMHA 1ENPA 1YQXA 3ORFA 6LDHA 1XU9A 1LLDA 5IN4A 2Q3EA 2ZIZA 3OEWA 2B5WA 4UUPA 2Y67A 1E5QA 1XLTA 2C7GA 4PLPA 3PDJA 3ZHZA 2V6BA 2JKVA 3DHNA 3QY9A 2A4KA 3A4VA 5L3ZA 3CE6A 1LRLA 2EF1A 2FR1A 3BTSA 3KUXA 3NT4A 4CUKA 4XKJA 4FR5A 3PHGA 5AXCA 3ZHYA 3TPCA 4YT2A 3L4BC 4DRYA 3RWBA 2VN8A 1BDBA 3K73O 2PK3A 2WJPA 4GSLA 4LMRA 4YDRA 1XWFA 1BWSA 3K96A 4BNGA 1FDSA 4Y6PA 1DIGA 5T67A 1D1SA 4NJMB 4H7PA 2NV6A 1LA2A 4U6SA 2DBQA 1XGKA 1YH3A 3BA1A 1E1LA 1UUFA 1NNUA 2X0NA 5F1OA 1CDOA 3WGZA 1Z74A 1QYXA 5ICMA 3JQCA 2YDYA 5FFFA 1DO8A 3KYDB 4R68A 5I9MA 2OXIA 2GNAA 4R54A 5TT1A 3GDGA 1VJ0A 4NBRA 2YUTA 3GFBA 3BHMA 3KVOA 3GEDA 1DJQA 4W9NA 3U4DA 4BNNA 1I3NA 3AM4A 2E82A 4A0SA 1HETA 1CRWG 2X9NA 4BL5A 4RF4A 1PZEA 2GZ3A 2FY8A 3QW2A 1JWBB 3E48A 2R00C 5KTKA 5MDHA 1F17A 2J5KA 4U7WA 3UF0A 1VJ1A 2V6FA 3GUCA 2VUUA 2VNAA 4L74A 4ZQBA 5TRTA 3BZUA 3NV9A 3ZN2A 4CM9D 2WYUA 3CUKA 3H2ZA 2OP1A 3MJSA 1PS8A 4LGVA 1XG5A 4FOSA 1R66A 5AXAA 3BMCA 1IZ0A 1ZIDA 3B20A 2TMGA 1D3AA 3PHLA 1EVJA 4BNIA 5JDIA 3RFXA 3S55A 4YJFB 5JAIA 1BG6A 5T5QA 3GN1A 1GDHA 1TT5B 4W7IA 4IS3A 3TJRA 3MJCA 4YRBA 3AU9A 3TN7A 3UHAA 3KETA 1ADFA 3JD4A 1UDBA 4LN1A 2JL1A 2I66A 3GZNA 1E3IA 4UULA 4BNTA 5L4SA 4KMSA 1WPQA 4J3FA 4XQGA 2QG4A 1LRJA 1X7HA 1P44A 1HWYA 1NP3A 3VPXA 3NJ4A 5CPBA 2HMWA 2D8AA 1LC3A 5L7TA 3OEYA 1NX6A 2I99A 3NTRA 3L6OO 4Y6RA 1P1RA 2X0IA 4RVGA 3T7EA 3K6JA 4I9UA 3UKOA 4J49A 3DZFA 4YRDA 1E3LA 4JXKA 5ES3A 2CMDA 1XCBA 3QVTA 4IM7A 5K9ZA 2PTGA 1KVQA 1LLQA 3GY0A 4R3NA 3PHHA 5HS4A 2OL4A 3PP8A 4BO5A 4M54A 2DFDA 4MVJG 4CMKA 4R1TA 4DPKA 4UEOA 1IYZA 1G0NA 4BO6A 4ZU3A 1JA9A 4NNJA 5COAA 2C2YA 3OH8A 5BSGA 1NASA 4E30A 4M1QA 3C24A 1UZLA 1GADO 2G5CA 4NJOA 1J49A 4UVEA 1NAHA 4K6CA 5TC4A 2ZATA 3QV1A 4MO2A 5KJ6A 4TKLA 1NTOA 4J4TA 3OECA 1KC1A 3D5TA 4CLXA 3ASUA 2HJSA 4XX0A 3RC9A 3GH3A 3PI7A 4TQGA 2WM3A 2JAPA 3BMOA 2Y0DA 1QYWA 3ADPA 1ZJYA 2HLPA 2IYOA 5G0VA 5EJ2A 2X4GA 5KCZA 5B37A 1SEPA 3NX4A 3DZJA 3H3JA 4XD2A 4RZIA 1MXFA 3S2EA 5BSHA 3DMTC 4BGIA 4XWYA 1I3KA 1Z75A 4WPGA 4J43A 3H9QA 2ILTA 2LDXA 4J16A 3WB9A 2P9CA 1ZSYA 3Q11A 3KV3O 4I8XA 3A1NA 1K6XA 1SOWA 4HFNA 1PGPA 2YJZA 3EMKA 5K6AC 3RVDA 4B3HA 4PRLA 2UUPA 3PIDA 4QECA 3H2SA 1KEPA 2VRCD 2Y1GA 5CHEA 4BO4A 4RZHA 5GZ1A 2ZQZA 3GR6A 1B3RA 3H9JA 2NU7A 2FMUA 3GRKA 3QHAA 2HMTA 1NWHA 3C3XA 3RUEA 3GNSA 4XGNA 5I8WA 4KDFA 3TL3A 3DBLA 4FW8A 3V1YA 1LC0A 3V2HA 3DOCA 4QXMA 1RYEA 4XYBA 3H7AA 4XIYA 2AMFA 2AQIA 5HWSA 4CLRA 2DQ4A 1HDGO 2VYNA 4JN6B 4DVJA 2F00A 2ZB8A 3ZCXA 2J3JA 4BKPA 2Q1WA 2Q50A 4QUKA 3QA9A 2W2LD 3HZZA 1GR0A 1FK8A 1Q0QA 1X0VA 3L4SO 1R4MA 1NQOA 3NT5A 2Z1MA 3Q3CA 1U8FO 1TA4A 4E5NA 1EDOA 1EVYA 4W6ZA 1V9LA 1H2HA 2C59A 3UUWA 4HFMA 2J3KA 1GL3A 1XR3A 1QYDA 1W6UA 3WBBA 2ZK7A 4GGPA 2I65A 1JU9A 3HB5X 2VZ8A 5KJEA 3IAHA 4BKQA 3VHRA 4FFLA 2JD1A 2NU8A 2FP4A 1J6UA 4JIGA 1DRUA 2AEMA 3GGOA 3WDSA 4MVJI 3I23A 4IQ8A 4ZRNA 1ZUD1 4AICA 3HFSA 1SB8A 3FR7A 3VKVA 1N1EA 1XKQA 3ZNPA 2AE1A 5ENVA 1WXDA 2PKQP 4U5QA 4DL9A 2NVWA 1NVGA 6ADHA 1TB4A 3DZKA 4ZRMA 1ZKMA 3BTVA 5A02A 3WICA 3SC4A 4Y8VA 3OFSA 2XOXA 5KIAA 4GQAA 1DIHA 5A9RA 1UJMA 2X0JA 4DBZA 4J91A 2BI7A 5F1KA 3SLKA 5C7OO 3G49A 4Q39A 3STHA 2IEDA 1TXGA 4TZKA 2D5AA 1JN0A 4DQUA 1GQYA 4JQCA 1ORRA 5A9SB 4BO3A 3BTUA 1F06A 2CF6A 3LF1A 1NR7A 3VPGA 1VKOA 5C3MA 2QYTA 1DC5A 4WNCA 4BS9A 3GC6A 2JJYA 2CY0A 4G65A 4RPLA 1VJTA 3EUWA 3BMOB 2J3IA 3PQFA 1LDBA 4PCVA 3LZ6A 4DWVA 4ZN6A 1LDNA 3JYOA 3PQEA 1HSZA 1U5CA 4B8WA 2CFCA 5EIOA 2X22A 3OSUA 3TSCA 5BSFA 4HWKA 3DQPA 1EQUA 3JQAD 3KLMX 4XYGA 3P5SA 3QWHA 3DXFA 1M67A 1H9BA 3PYXA 3JD3A 3F9IA 3COSA 1R0SA 4JJIA 1E7SA 1GPDG 3VH2A 3WGOA 4A03A 4B4VA 4DPMA 3SBOA 2E49A 3PHIA 4R5MA 1DOHA 2HK8A 2WWRA 2VHWA 1M66A 1AE1A 4GL4A 1E5LA 3QWIA 4BO1A 5K0ZA 1HYHA 1XDWA 3FBGA 4WCFA 3WSWA 1EK5A 1YONA 2CVZA 2P5UA 3GK3A 1ZVMA 1P1KA 1P1FA 4K1LA 2IZZA 4NQZA 3EY4A 4YAIA 3AY7A 1X13A 3RC7A 1GFSA 3SJUA 5G4KA 4E4YA 3VTFA 5IZCA 4GPD1 3D5QA 3ONFA 3TZCA 5L7YA 1G1AA 2JCVA 3JQ9C 4IIUA 3DBLB 1JAYA 1O89A 3PLRA 3GG9A 3OQBA 4P4NA 4M49A 3C8MA 4TRMA 1DPGA 1X7GA 2YFHA 3EW7A 3ONEA 3WGYA 4CLRB 2DPHA 3JQ7A 1ZK2A 5IXSA 2NLOA 5AXBA 1B8VA 1SZJG 4NFSA 1HDOA 3K8ZA 3L4BA 5U1PA 3W8FA 3W6ZA 2B4QA 4XEHA 2B5VA 2O2YA 4KWHA 2HDHA 1CYDA 4RDIA 4WECA 5KNLA 2PA3A 4MIOA 4NK5A 3H65A 3VKUA 3TL2A 5JMWA 4N5LA 2NU9A 1DXYA 4A2CA 4PG7A 1EUCA 2JFHA 1Z6ZA 3E82A 2RHCA 3WMXA 1MXHA 4XJTA 2Y1CA 5CDGA 2QHXA 4AFNA 4P4GA 2LDBA 1W0CA 3I9MA 1IB6A 4IDAA 3R0IA 4IJWA 3IP1A 3G17A 4K26A 4EBFA 1E7RA 4RL6A 5B4UA 2I76A 4CMJA 3ON5A 4FGSA 4J4HA 3H4VA 2C29D 3FNEA 1V3VA 2R00A 2V7PA 4RLSA 4PG4A 3S8MA 4EDFA 4CLOB 1NHGA 2PD6A 4DLAA 4IGEA 4J1SA 4TZTA 5DULA 4BB6A 1PQPA 3DOJA 2JD2A 4YJHA 3W4IA 5A06A 4IDFA 1XYGA 4F3YA 2I3AA 2Y1EA 1C1XA 4PLHA 3ADOA 5AYVA 1LBEA 4ND4A 2O48X 1ZMTA 3MOIA 1U7TA 3B1FA 1F14A 3SEFA 3LSYA 5TT0A 3TZQA 1LLUA 1HDXA 1SMKA 3W8DA 1O0SA 5DBGA 1Q2XA 2J3HA 4CM5A 1DB3A 3L6EA 4D3SA 4UUNA 1W4ZA 2GN4A 4ZA2A 4XZ3A 5JPIA 3TF5A 3EZLA 5KJFA 1MC4A 3HB4X 3G1TA 4OXYA 4GI2A 5I8ZA 4ID9A 2W4QA 4G5HA 4B7CA 2GYYA 4CMEC 3V1TC 3NGXA 4FQ8A 4NU6A 5L45A 3A06A 2Y0CA 3ETGA 3LT2A 3WS7A 3PLNA 1HLDA 3ITDA 4A27A 2UYYA 2B36A 3LC1O 3KLPX 3ZHBA 4YAEA 4UEKA 4UVIA 3IOYA 5COQA 3DZBA 3WXBA 2ZTVA 3D3WA 4P4LA 4E2YA 2ET6A 2EEZA 3DZIA 2DTXA 3HDQA 2HMUA 1R37A 1GY8A 1NPYA 2FWMX 1YXMA 4RVDA 2H63A 2FPIA 2CUKA 1P45A 3WTBA 1CF2O 1I36A 2IEBA 3FCOA 3WWZA 3O26A 4YXFA 4YYZA 5F5NA 4WEQA 4QO7A 3RU9A 3OQ1A 1EK6A 4PZEA 3AOEC 3QRWA 4CR8A 3HUDA 1Y8RB 4GLOA 4BB5A 5G4KB 1IOLA 2PY6A 1Y8QA 2NTJA 4IQGA 5DF1A 3WFIA 5DBIA 2X1HA 4IDBA 1FDTA 4CV0A 3I9KA 1RWBA 1BVUA 4ZVVA 1LJ8A 1Q0LA 1VM6A 3DMTA 3F4LA 2FR0A 4Q3AA 3RSHA 5KWEA 3JQ7B 1ULSA 2CNBA 1MG0A 2EJWA 3R1IA 1V3UA 5CPFA 4PZCA 2OHXA 3WWYA 1EQ2A 4W99A 1E6WA 5EMHA 1JKJA 2OP0A 5CAEA 3X2FA 2PNFA 3ROPA 3RIHA 1I8TA 2X9VA 1JVSA 3V5NA 1ISGA 1V0JA 1SOVA 4XCVA 1TEHA 2I67A 1DIBA 4CQLB 5G4LA 1F0YA 4LCEA 1JW9B 2C20A 5A3JA 2QIOA 4K28A 3NTOA 1DHRA 5IDWA 3GVIA 4QQRA 4B3JA 4FFRA 3WFJA 3VPFA 4NBVA 1PR9A 4KP7A 1O8CA 1JKFA 3KYBA 3PTZA 4JJFA 4W82A 3WSVA 3I52A 2VZ0A 5F3RA 4XYLA 3PEFA 1H6BA 4Y9DA 3UN1A 4BQRA 1GAEO 3KHUA 1MV8A 3TNLA 2GASA 3ASVA 2VYVD 3ULKA 1QV7A 1R0LA 2OBNA 1LDGA 4FPXA 4CLHA 3NGLA 1PJ4A 4RVSA 1ZNQO 2Q1TA 2VT3A 4UVGA 1OFGA 3BIOA 3ZNNA 1MFPA 1K6JA 2BLLA 4YJHB 1UP7A 4BNKA 1E92A 2AW5A 1N2SA 2AXQA 2G1UA 2O3QA 3QVOA 3JV7A 2Y93A 4MVJA 3LQFA 4PFJA 5THKA 4GKBA 9LDBA 1UXJA 2JHFA 1C1XB 4FJ1A 3PJGA 4N5NA 3DAPA 5ILOA 2OUIA 3DAFA 4OJNA 3WJ7A 4BQPA 5JDCC 2R2GA 2W2KA 2ZTLA 4PLCA 2YQ4A 3UW3A 5CDUA 2WYVA 2OORA 2YDXA 1V35A 3QVXA 2I9PA 2C0CA 1B26A 4IBOA 3GVPA 5IAAA 4YR9A 2WSBA 1C0IA 1DC3A 3PWZA 1P0CA 4A10A 2CD9A 4WGGA 4OL9A 1M75A 4YB8A 3F46A 3I1JA 4YA6A 1FF9A 2XPCA 4JGBA 1FDUA 3INGA 3WTCA 4Y6SA 1MLDA 2C2XA 2ZB4A 2D4AA 1Z7EA 2ZYAA 1N9GA 3AI1A 3DO5A 1ZMOA 1LEHA 3JYPA 1GU7A 1DLJA 2O3TA 1KEVA 1L7DA 3I3OA 4FB5A 3CMCO 4XR9A 3L9WA 1X0XA 5IZ4A 1LDYA 4H16A 2RHRA 3C1OA 4CV3A 1T1RA 1LDMA 4EUHA 4U0JA 4EUFA 1Y7TA 4TVOA 2EKLA 4AJ1A 2AEFA 1K0UA 1X1TA 3D3WB 4JBGA 5G2OA 2D5CA 4RDHA 4RPHA 1ZSNA 3C7AA 3RUFA 1R12A 3CZRA 4R9SA 1KOLA 3RC2A 1NM5A 3G79A 1IPEA 2RAFA 3CMMA 3WIDA 3W4JA 2HSDA 5FWNA 4TRNA 2X5OA 3RFTA 1QYVA 3H9EO 1ZEMA 5FF9A 4BGUA 1H93A 3OA0A 1FMCA 4TWRA 1WLYA 1PJBA 4MVJF 3TOZA 3ST7A 1PS9A 3LC7O 5F1PA 3VPHA 3I6IA 5LDGA 1UP4A 1Y8QB 4GX5A 2OFPA 1GZ3A 1T2FA 4E12A 4YCAA 4BNHA 4EEZA 3PQDA 2GERA 3OA2A 1PGNA 1OC2A 1E1KA 4TRRA 3OIFA 1FJHA 2V6MA 5A9TA 4IINA 3MTGA 5I7FA 2O4CA 4YWJA 1Y9EA 1KYQA 2O50A 4L8VA 2AEJA 3EZYA 2BH9A 3PJFA 2Q99A 3IKTA 4B8ZA 1D7OA 4GVLA 1I2BA 2B69A 3RROA 4QFCA 3H9GA 3FBTA 1C1DB 1QORA 1PTJA 2EP7A 5B4VA 2E4AA 1Y9AA 2EW8A 5IJZA 2BI8A 3N7UA 1QLHA 2A9FA 3BXXA 5EN4A 4B7XA 5CDYA 2X0RA 1X15A 2EG9A 5A04A 1FDWA 4FJ0A 2DAPA 1J0XO 1P77A 3WX0A 3JQ9A 4PLYA 4B79A 2IODA 4ONEA 1U9JA 3Q0EA 4MJLA 1A4IA 3ZWVA 1FXSA 1MUUA 3FPCA 3I6QA 3I9LA 3VH4A 5IDYA 2VWPA 3MTJA 3C7DB 4DLBA 3KB6A 1UAGA 3T7CA 3VH3A 5JC8A 1T2DA 5AXDA 4Z9YA 2VWQA 2HU2A 2X58A 4BGEA 5C7LO 2RCYA 2BFPA 4IDEA 3ZV3A 4BO8A 4ZQGA 2HKIA 1CEQA 4TKMA 5CG1A 1WMAA 3D3EA 4BNUA 1BXGA 4BGVA 4EGFA 4DIFA 5L40A 2IXAA 2ZCVA 1EEHA 3M2TA 4BNFA 1IHYA 3OM9A 2Y99A 4PLZA 4B7UA 5AVOA 2SCUA 2E37A 3HG7A 2O2SA 4M89A 2X9GA 1ZJZA 3C1AA 3WMWA 2EP5A 5L7WA 1YBMA 3OP4A 2C07A 3UH1A 4HV4A 1J5PA 4F46A 4CQMB 4II2A 4CM1A 4HBGA 3K9QO 3U62A 3QE3A 3JYQA 4L73A 2Y66A 4E31A 4XQCA 2GR9A 5IDQA 5JAZA 1F12A 4FDAA 2X23A 3IJPA 3ZNOA 4A7PA 3VDQA 3F4BA 1JWAB 4OYRA 1QG6A 1N9GB 4CM4A 4KUGA 1MX3A 2ZKLA 4F6LA 2WD7B 3NDJA 3ETDA 4YEDA 1WWKA 4LW8A 1WP4A 5BQFA 1YRLA 1I10A 3TZ6A 3V8BA 4AJ2A 5TLSA 1KBZA 1A72A 4BMSA 3EYWA 4LCJA 4BO0A 3K31A 3QJ5A 4N54A 2IRWA 4XB2A 2RH8A 1YL7A 2WTBA 1B16A 3HHPA 4BNMA 1GEEA 3ZW9A 3E9NA 4DC1A 1MC5A 4ALLA 1T2AA 3RCBA 1NYTA 3M6IA 4JBHA 4PZDA 4OXNA 4D44A 4XB1A 5F5LA 2UVDA 4PG5A 4XRRA 3B70A 5GZ3A 1BW9A 1WZEA 1VLLA 1GCOA 4XGIA 2NSDA 2Q46A 3FRJA 4GMGA 2B35A 3H8VA 3V2GA 1GYRA 3U4CA 3ICCA 2AG5A 5TNXA 5BNIA 1RM4A 4IGFA 3EC7A 2O4UX 4CMEA 5DN9A 1AUPA 5KVQA 2ZCUA 1YBAA 4AJJA 3ZW8A 1HRDA 2X5KO 1IL0A 5FI3A 2Y1FA 3K2BA 4XR4A 4JCOA 4PVDA 3JQFC 4D45A 1SEVA 2NM0A 2PZKA 3GNTA 4J0FA 1F8FA 3L6DA 4C7KA 5IF3A 3MEQA 4HADA 4ZHSA 1U3TA 1XA0A 4DMLA 5ITWA 3RD5A 1EMDA 3GMSA 1GQQA 1UH5A 3MZ0A 4MKRA 2QRJA 3UCFA 4PLVA 2ZTUA 4JNKA 1T2EA 2HK7A 5T8KC 3CXRA 4MVJP 3QLJA 3VZQA 2D3TA 3PGJA 1HF3A 1BHSA 1PJ2A 3S2FA 4O59O 2Q1UA 1X1EA 5IN5A 5KJCA 3PZBA 4R01A 2O7QA 3P7MA 4FFNA 4OQZA 2Y1DA 3WQSB 4MIYA 1HTBA 4MOWA 4QSMA 4CM6A 2BFAA 7ADHA 2VWHA 3I9NA 1VSVA 3AOEA 3LT0A 1H2BA 3BMCB 1GV1A 1T4DA 1LSUA 4R41A 3VC7A 3U0BA 1P3DA 4D79A 1O95A 1NQAO 4BNJA 2VNSA 2UUOA 2ZJ1A 2DFVA 4UREA 1H6CA 3JQEA 3ZGYA 4CQMD 3W1VA 2P91A 3VH1A 3AJRA 1DFIA 4HUJA 1LSOA 1E6EA 1O6ZA 3O8QA 4IDDA 1GQ2A 1D4FA 3GZNB 1QRRA 1EFLA 1U3VA 1ZW1A 5DP2A 2Z5LA 3KOUA 1C14A 3OIGA 3ZWYA 3MJTA 1G6KA 5IFLA 3MJ4A 5GZ6A 1E3JA 3MJEA 4GH5A 3PVZA 2NNLD 2OZPA 3UFXA 4BNVA 1YB1A 2IDZA 1L1FA 3AI2A 4YRAA 1Q0HA 4WK6A 1PEDA 1ADGA 2RH4A 2Y0EA 3O4RA 3UAGA 3LT1A 3AW9A 3IUSA 3AM5A 1T2CA 2Q4BA 3LK7A 3GVHA 1P1JA 1OOEA 1JVBA 3H5AA 1YJQA 3AFNA 7MDHA 4IZIA 3HN7A 3DBRA 1Y6JA 4GX1A 4HXYA 5U4QA 4OSPA 1CWUA 3GGGA 4GLLA 4GVXA 4PVCA 3I4CA 3SVTA 5DBFA 2I5PO 4IXTA 1D8AA 1I3LA 1K3TA 4PLGA 4URFA 4J1NA 2VCYA 1CQIA 2O3RA 3ONDA 2EERA 2WEKA 1NFQA 3FHLA 2WD8A 3C7CB 2PH5A 1P31A 3K2EA 1GYPA 4J7CA 4E32A 1U3UA 3GEMA 3GPDG 1N7GA 1LU9A 3OJFA 4FFOA 4H3VA 3ZDFA 5JDCA 1XQ1A 2GF2A 1B0AA 1OZAA 3AUAA 1WAMA 5EQDA 1ISFA 5A3VA 1HDZA 1MA0A 3EGOA 3RJ5A 1MFZA 1BXZA 3HE3A 4U8GA 2DBVO 2EWMA 1JTVA 4KUHA 3KM0A 2A35A 3CINA 4CMCA 1JAXA 2W98A 4Z6KA 4N18A 4WEOA 3DFUA 4RQUA 1H6DA 1KIFA 1DFHA 1BW9B 4OAQA 2GZ1A 5A5FA 1PGJA 3UCEA 5ILGA 1OC4A 4AJHA 4Z3KA 4RO0A 1OMOA 1WMBA 5L51A 5JCJA 2PGJA 3AUTA 1IE3A 2GN6A 4NZ9A 1PQUA 1TLTA 3P19A 4HFJA 2HO5A 3IKVA 3BYZA 1X7DA 1DAPA 1VSUA 1E3EA 1Y5RA 3K5PA 3G0OA 1LDEA 3PJDA 1ZO8A 2B4TO 4F45A 4CMGA 3P2YA 4J7UA 4JX8A 3WR5A 2V6GA 3AFMA 2PZJA 2QW8A 3ROKA 1N8KA 3M1AA 3ZU5A 2WYWA 4FBGA 1NQTA 4CUZA 5BNFA 2EGGA 3GDFA 5BSEA 1OAAA 3ETEA 4MKXA 3B1KA 4NR0A 2VOJA 3KZVA 3IS3A 1MGOA 5B4TA 2YY7A 1HYGA 2CDCA 2DUWA 4Z0PA 5HBRA 2CVOA 1A9ZA 3NUGA 3U09A 3AU8A 2AA3A 4CMIA 1TVEA 1ENOA 3I9JA 4YPOA 3OQ6A 1R4NA 5DDIP 3HDHA 4IXWA 1FDVA 1AXGA 4MP8A 3ZV6A 5KJ1A 1R4MB 1DRVA 4GWKA 3ZZNA 2UV8A 1MP0A 1NWCA 2ZQYA 4J2HA 4IZHA 2GN9A 1GV0A 1E6UA 1CIVA 3MOGA 4MPDA 4CLEA 3KSUA 1YOVA 4GWGA 3HNPA 3D7LA 3W4KA 3WQQA 1RYDA 2YV2A 3QP9A 5EINA 4ALMA 1JQBA 5HS6A 4DYDA 4ZQFA 2XXBA 2GUGA 3PPIA 1ULUA 1VL8A 2QZZA 5A1TA 5GY7A 4IUYA 1DRWA 5LC1A 2VOEA 3R6DA 4Q9NA 3K30A 5TQVA 3DBHA 4UAGA 2AQKA 4K6FA 1MG5A 1ISMA 1PZHA 4LSWA 4ZICA 4WLUA 1U5AA 3HQ4O 2VTDA 1DSSG 4N5MA 1E3SA 2H5LA 1XSEA 2NVUA 2PH3A 2PKQO 3QWAA 4WLFA 1KS9A 3I9OA 1M2WA 2QQ5A 4E2WA 5COBA 4DXHA 4J9VA 4LVCA 4JLWA 4BNZA 5JY6A 1VC2A 1UDCA 1B15A 4O63O 1ADCA 2F1KA 2P9GA 1KVUA 4KWIA 9LDTA 5KVCA 4DGSA 3DFZA 1TT7A 1AN9A 2P2SA 1B8PA 4R1NA 3M2PA 1ZEJA 4UEJA 3WGGA 3H5RA 3HDYA 4Q3DA 2VHYA 4CM9A 2GRAA 4WLEA 1SBYA 1P74A 3GA0A 2ZB7A 4UUOA 2AHRA 4RF2A 1QR6A 3HADA 4FS3A 5IDXA 1V8BA 4A26A 1T4BA 5JY1A 3JYNA 3DTYA 2QX7A 2VTEA 3BTOA 3ZWPA 3F1KA 5THQA 1B3BA 3OJEA 2GGSA 3ZV5A 5EQFA 1HE5A 4NBWA 1HT0A 4PLFA 1KERA 1PIWA 4A73A 4L4XA 3BMNA 4BV8A 3QWFA 2BRUA 4GGOA 3D1LA 3I4FA 1ZXLA 3AK4A 4QT0A 4O0LA 2Z1NA 4Z0HO 1NAIA 4XYMA 3W6UA 2VYND 3PWKA 5CEEA 3UGKA 4LK3A 3EK2A 3WLEA 5AQ1A 3GRPA 4IMRA 1GUYA 4ALKA 1I33A 1DFGA 1ID1A 5JBIA 4WCDA 4PG8A 2QRKA 1Q7CA 4WCFB 4ZQHA 4BNLA 4E5YA 4R16A 3RC1A 4ALIA 3NTQA 1E3WA 2DPGA 1BGVA 4TRJA 4HNGA 4PRKA 3SX2A 3CTMA 2B37A 4L4RA 1YJ8A 1PL7A 3IP3A 4BKUA 2P9EA 3FNHA 5G0TA 4M87A 3RUDA 3OJ0A 4YACA 3WIEA 3LT4A 4E13A 5TJHA 3TQHA 3D4PA 2B83A 1XELA 5B1YA 5DP1A 3OBBA 4C4OA 2GD1O 4EZBA 1ZH8A 1DIAA 2VQ3A 2O23A 2J6IA 3INRA 4BOYA 1WZIA 4IS2A 1JLLA 3PGXA 4R1UA 5DOVA 4P8RA 4OQYA 1WNTA 3KO8A 3D0OA 4Y67A 5K6AA 4CMIB 1E7QA 1H9AA 1R4NB 1SNYA 3CH6A 1U4OA 4CR6A 4DMMA 1S6YA 1Y1PA 2FN7A 4N7RA 2FHSA 4I5DA 4KOAA 4YAJA 2O3JA 3P2OA 1DAOA 1LTHR 1TI7A 3JQFA 1UR5A 2E6UX 3CEAA 2BFOA 3LLVA 2AQ8A 4FGWA 2IE0A 2BGLA 3QIVA 3HWRA 1ISIA 8LDHA 1YOVB 1JKIA 4YAGA 4YT4A 1A4UA 4BVAA 4XIJA 5T8KA 5DNAA 1IZ9A 4E0BA 3PRJA 1BRMA 1A27A 1I24A 1A7AA 1HE3A 5JFOA 1A5ZA 4BNWA 1P1HA 3GAZA 2XF8A 1UP6A 3JD1A 5TF4A 3RUCA 1SO8A 1I32A 1K5HA 3D4OA 1ZSVA 4S3MA 3RQSA 4BV9A 1NPTO 2XXJA 1XHLA 3OMLA 5CFZA 3DR3A 2VRCA 4RPJA 3D4NA 2DUUA 1YQGA 2FSVA 4MVJE 2GPTA 2NVUB 4GMFA 1BXKA 3N74A 1EE9A 1Z45A 4DTIA 1SB9A 4R5HA 4YJGA 3E03A 1D1TA 2GSDA 2FR8A 2QZ9A 3DEYX 5L4NA 1YS4A 1HLPA 1BDMA 1IHXA 2ZYGA 4Z9XA 3RUAA 1R16A 2JFGA 3Q9NA 3WBFA 3QVSA 4GX2A 3HN2A 1C0LA 4WOKA 1EUDA 1UXKA 1ML3A 1PU2A 2YFQA 3NJ8A 3N58A 4EJMA 3FWNA 1ISJA 3DONA 5HM8A 1BTOA 2CSUA 4LVUA 3GVXA 3PYMA 4P22A 3NDIA 2VRBA 3QSGA 4ZQEA 4EEXA 1IUKA 1KC3A 1SAYA 3K92A 5DCUA 3DAGA 5G0UA 2W2LA 3HFGA 1DC6A 2BGKA 3GVCA 1G0OA 3RFVA 4FCCA 5ENDA 1YL5A 2VWGA 2HK9A 4NK4A 5ER9A 2EV9A 2FOIA 3AOGA 3F5SA 4Y98A 5AOVA 4PN3A 2NQ8A 5LDHA 3DDNA 3FPLA 5H82A 5ER6A 1YQDA 4AVYA 1N7HA 3IIEA 1NVMB 3MWDB 3UXYA 4RF5A 3MWEB 2G82A 3BHJA 4EW6A 2QYSA 5BR7A 5JYDA 4B4UA 4QTZA 3VVBA 1ONOA 4AJNA 2YYYA 3OHSX 2W8ZA 1RM5A 5JSFA 2H1SA 3S2IA 3WGIA 3U4IA 3JSAA 1KY5A 4ND5A 2X5JO 3FD8A 1YO6A 1A71A 1H6AA 3F47A 3Q2KA 2NVBA 1X14A 3M1LA 1B8UA 4KQXA 2O3UA 2YQ5A 3JQBC 4F6CA 1PX0A 2CDAA 1UXHA 5IZCC 2V65A 1GZ4A 3RI3A 2WDZA 1HE2A 1PGQA 4OKIA 1PJ3A 1Q7GA 4CLDA 2G0TA 5HRUA 1AHIA 1UXIA 2A94A 3U3XA 2JCYA 1P1IA 1GUFA 2UAGA 4J1QA 3U5TA 5GMOA 4IIVA 3U9LA 3GEGA 3VDRA 5FEUA 4RCVA 3AUSA 4RGBA 5JO0A 1A9YA 1ADBA 2D1YA 4WOJA 1NFFA 5DOZA 3ZWAA 4OXKA 1L7EA 1UDAA 3UOGA 3IL2A 2FRDA 1BMDA 4PGFA 1YDWA 4ROSA 4O5OA 4EJ6A 1W8DA 3KRTA 4UVDA 1I30A 2OBYA 1E77A 1N92A 1PQWA 4WLNA 4A5OA 2GN8A 3LC2O 3RUHA 4XRGA 4NI5A 3ABIA 4JP2A 3NT2A 1NHWA 4DYVA 5L4LA 1E7MA 2BMAA 4AG3A 1HYEA 1LNQA 1YL6A 2I3GA 3FN4A 4L0QA 3SJ7A 3GLQA 1AHHA 2HUNA 1QMGA 2GO1A 1U28A 5TX7A 4I08A 4D0RA 3WG9A 1HZJA 3JQAA 4E3ZA 4D41A 1H0KA 2D2IA 1GPJA 1HKUA 4DQXA 3Q9UA 3PXXA 1NXQA 3UCXA 2BFMA 4Z3DA 2EXXA 1ZXBA 4XA8A 1LSJA 4PLTA 1XIVA 3DZHA 1V3TA 4RJTA 1NBOA 4RQTA 5L53A 2WE8A 4YT8A 2HAEA 3DHEA 5JC1A 2BELA 4I5GA 1N5DA 4J2OA 5H83A 2OOSA 2ZYDA 4NDNE 1T25A 3H9UA 1ISHA 1RJWA 3FNFA 4EI2A 2JFFA 3GUYA 1EE2A 5H81A 1GCUA 2NACA 2PZMA 3ENKA 5MGBA 2ZJ0A 4BO7A 4NH4A 3WNQA 5EERA 3V1UA 3OICA 4YJGB 3GOHA 2C54A 3GFGA 2IXBA 2W2KB 4NG5A 4RPGA 3NDRA 3U4HA 4I5EA 1ZZEA 2QRLA 4G81A 1MB4A 4FN4A 3OETA 1QLJA 3PIIA 4GKVA 2B4RO 1I2CA 3SC6A 3RBVA 4HNHA 5I9NA 3GDOA 4XQ9A 3RU7A 5TS3A 2Y05A 4J6FA 2BKAA 2Y68A 4WASA 2YW9A 1T1SA 3ROMA 4OHUA 1M76A 1KY4A 4HY3A 2HJRA 1DDOA 3X2EA 1QXSA 3AY6A 1U2DA 2DT5A 5T57A 4WJZA 5JCXA 5EPOA 4J9UE 1O94A 3ZHXA 4WLVA 3AUUA 2AG8A 1LQTA 4MINA 2Z95A 1EVIA 4NFHA 1VKNA 3L07A 4ZJUA 1HZZA 2CZCA 3B6ZA 2Q49A 3H6KA 3NKLA 3OJLA 4CM7A 2NUAA 1VE9A 2Q2VA 3KXDA 3I5MA 4NMHA 1KVSA 1O9BA 1QSGA 3ENNA 4OMUA 4BMVA 3O38A 1U2GA 1KVTA 2FPGA 5KOIA 5A9SA 5L9AA 1YBVA 2HQ1A 4ALJA 3MCVA 2X8LA 1UXGA 3VZPA 3E5RA 3S1LA 3H5NA 2PD4A 4TVBA 1WVGA 1DJNA 3DL2A 2VZ9A 3TRIA 5JXWA 4HP8A 4YBZA 5I7VA 1HE4A 3NYWA 2H6EA 2FSSA 3PDUA 4ND2A 5DCWA 4QO8A 4DC0A 2VHXA 3C85A 4YVFA 5FYDA 2IZ0A 2DKNA 1OI7A 5HA5A 5A4DA 1I01A 5A5EA 5DZSA 1CETA 1U7HA 2FZEA 4WKGA 3RJ9A 1HDCA 3TFQA 3NAQA 5HTOA 3KEOA 3GZ4A 1LQUA 4IJUA 4Q3EA 4XDZA 2C5EA 4ZD6A 3GMDA 1QYCA 1XU7A 4RVHA 4MP6A 3O9ZA 1DBVO 4BIIA 3DC2A 2HRZA 1HXHA 2W90A 1EUZA 3A14A 3EAGA 2C7VA 1AGNA 4MVJD 3RKRA 2P5YA 3F3SA 3ZU3A 1U8XX 3IUPA 5TSDA 4E21A 3TOXA 1VI2A 2NADA 3FF4A 4INAA 1LRKA 2O7SA 5LCXA 4E5PA 2BHLA 2JAHA 1Z73A 2J5QA 4FFMA 3ANLA 3OIDA 2BD0A 3JQAB 4FFPA 4J0EA 4J7XA 1IY8A 1PS0A 1PL8A 1NVTA 3O03A 5JW6A 3ROQA 3WGHA 4D7AA 2AQHA 1B7GO 1WDKA 3HJAA 4HFRA 4OKNA 4X54A 2BGMA 5C37A 2EKPA 1WDMA 1PZFA 4XGKA 4XJSA 1PL6A 5EL0A 1HSOA 2JD0A 3HDJA 1PSDA 2OO5A 4RPKA 2P4QA 3CIFA 4ND1A 1VL6A 2DU8A 1P0FA 3ZWMA 4U0KA 4D46A 2PZLA 1GZ6A 5I9LA 3QQPA 1BXGB 1Z7BA 3VPSA 1RM3A 1RPNA 1EBFA 1I5RA 1Y5MA 4B3IA 4EUEA 2YV3A 3DOOA 4KDEA 1LXCA 3Q1LA 1C0KA 5EESA 2ZTMA 4DIBA 3LLSA 3DBVO 1ZCJA 4L4SA 3LF2A 4DPLA 1U4SA 2EIHA 3A28A 4GX0A 4U6QA 3JD2A 4R3WA 4J4BA 4AJ4A 3RKUA 3NEPX 3BHIA 1R15A 1NR1A 4FSHA 4IJKA 4UUMA 3OF2A 5CEFA 4CL8A 5T64A 5CDTA 4CLOA 1PR3A 3ZU2A 2DC1A 4E2ZA 1DEHA 1LSSA 4GSKA 1KEUA 1E1NA 3IMFA 3L77A 4JROA 2Q2WA 2R6JA 2TMDA 3EDMA 3V2UA 4EITA 1NQ5A 1ENZA 4DA9A 4CM4B 1HL3A 2RBEA 4XQEA 1EFKA 4II3A 2JHGA 4AJEA 3FTPA 4GBJA 3KSDO 1NFRA 2PKRA 1F8GA 1ZK1A 2DBZA 2P68A 2Q45A 2Q1SA 4ESOA 2IYPA 3E9QA 1ONNA 1W73A 2OGUA 3IJRA 1C3VA 1GTMA 3INTA 4JBIA 4UVHA 4D3DA 5DT9A 4L76A 1ZK3A 3WQRA 5ICSA 4RVUA 1K89A 3ZWWA 1E1MA 2NU6A 1ZK4A 3TWOA 2H9IA 4OH1A 4R69A 2VYVA 5CEJA 5IXYA 4ZGWA 3DTTA 3GAFA 4IMPA 3PFWO 3DWFA 4NHEA 1N1GA 3ZH2A 1YDEA 8ADHA 2X6TA 4IPTA 2I6TA 4XDYA 3VZRA 3CKYA 5JNLA 1YVEI 3H3FA 4E6PA 4OIMA 1YB5A 3KYCA 1PWZA 1E7YA 4KZPA 3QWBA 2GDZA 1EDZA 1HDYA 1GD1O 2DLDA 3UICA 1LX6A 5FI5A 3VVCA 4AJKA 4KQWA 3Q6IA 4B4OA 3BMQA 3WYCA 4FC6A 4QFDA 1PWXA 4CL3A 1ZFNA 2P4HX 1YE3A 1DIRA 1KETA 5JLAA 4D42A 3CSDA 1ZK0A 5U9CA 1EVZA 4I9HA 4Q3CA 4W9NC 1HEUA 5L95A 1PJTA 1H5QA 4P38A 1ARZA 4TROA 4WLOA 4YT5A 4R51A 4W4TA 3PJEA 1T24A 3ZU4A 4I5FA 3T4XA 3AI3A 1P9LA 2FZWA 2VUTA 3DHYA 2Y1OA 4PLWA 2EW2A 1I3MA 3SXPA 3A9WA 3JQBA 4L75A 2DBRA 1WDLA 1Y8RA 4EJ0A 4AJLA 4E5KA 1UAYA 2VHZA 3ZI0A 4NPCA 3W8EA 5TGDA 5JDIC 1PZGA 1YKFA 3G1UA 4BMNA 3E9MA 5KVVA 3FR8A 1WW8A 4YQYA 4NFYA 1CJCA 5CDSA 1KVRA 1I0ZA 4NBUA 3G3EA 2C82A 5KKCA 2X7HA 2PWZA 3O8QB 4W7HA
chains in the Genus database with same CATH superfamily
2GB4A 4OHMA 1GNVA 3UMJA 1JG6A 3FHTA 4B84A 3L0DA 1PGOA 4BHTA 1N2CE 4LBWA 2PEYA 1YRBA 5DFAA 3UXEA 4PAOA 4F6LA 1V1MB 3OLYA 2VEOA 4TUYA 3W5CA 3LYLA 3D3JA 2D00A 1T9GS 2WILA 1U3GA 1E60A 3QPDA 1ZITA 3WVNA 4AWBA 3VKHA 1IUOA 2Q6VA 2WMDA 1KE1A 4E5MA 5JROA 2W6JA 2QXUA 3O8DA 2V98A 3JQ8A 4DKXA 5K0FA 4UPVA 3MCWA 1FMFA 4R2IA 4C4YA 3NWPA 2CMGA 2OOKA 4NBTA 1KJWA 2CD7A 4QLAA 4D4MA 3MWKA 1AF7A 3AUKA 3NP7A 3ND7A 4F86A 1Q7TA 3ZHOA 3JWHA 4ZCPA 4LGMA 1AXRA 4NDZA 4QEDA 5DX0A 1U7XA 4QX6A 3EG9B 2I55A 4ZYZA 4XWAA 3RRNA 1E61A 1OXVA 1QO7A 4KI0A 4FNAA 1NXSA 3A6KA 1U31A 4XFDA 3KZKA 5DN6D 2YHIA 1FNBA 2CVPA 1UM9B 2HW8A 2DJIA 3KSZO 3UV6A 1CQIB 3CVXA 4RORA 3SJAA 3TZHA 4GFDA 4D8YA 1ZD3A 1UFVA 3C8UA 1YULA 4HPJB 2M2IA 1HOXA 2LE0A 2NO5A 3OY7A 4LJAA 3AY3A 1PJSA 5F21A 4BNYA 2I78A 3OPNA 1ZKDA 2W2NA 1KKMA 2F67A 3HN6A 1RM0A 2EHDA 1FIUA 4CMBA 1KZ4A 3TLXA 4GNKA 2YYAA 1AC5A 3GRCA 3QPUA 2D2FA 4M76B 5AICA 4AL4A 4IV0A 1UEXC 1DLIA 3LUGA 2V5AA 1CQXA 4KUEA 2XOKA 4BVHA 1A8SA 4F96A 2F9LA 2WICA 2CDRA 4CM3A 4M9ZA 2YHUA 2LGJA 4DJAA 3OQMA 4IDCA 2DTEA 4MLZA 4OB7A 3SDSA 2XNHA 4OSOA 2C84A 4OM8A 4OOFA 4PIPA 4UHHA 3G13A 2G09A 4J16C 1ENYA 4PHCA 4WWHA 1F4PA 2JJMA 3FSRA 5DHRA 1JI3A 3GG2A 3CPEA 4AN0A 3VR6H 4B3TB 1NPDA 5IG2A 5JASA 2OCKA 4TS4A 4QFBA 3KYCB 4YTEA 1W6RA 3T3MB 5LU9A 1HDEA 5JQWA 3A25A 4GOMD 4YRKA 4TUYF 1O5IA 2XT6A 1WY5A 2OHJA 3V1NA 4MKZA 4PPYA 5JLJA 1JDJA 3T54A 1AXEA 3L7NA 3V7UA 3AQ4A 3P94A 4CDNA 2OCPA 1EAMA 2VDJA 2D1SA 4ZCIA 2FUCA 5EJ6A 1J4AA 3C4VA 2ZUUA 2XB9A 2OGZA 4Q12A 5C5DA 1B2LA 1XD2B 2Q07A 4LZJA 5EWJB 3KQLA 1ZR4A 4IKPA 1JAZA 5ADHA 1IULA 5J23A 4CEIA 2BF7A 4DYHA 3F6YA 2JIDA 4OQQA 3WGLA 4QGSA 2W6MA 2DWOA 3UTCA 1D2HA 4GP9A 1G2OA 3M49A 4IY1A 2VK8A 3P4XA 1R5OA 1XVAA 4V0QA 3F5DA 3LFHA 3LYAA 2ZZMA 5KSZA 4DV7B 5CP8A 3M8KA 4X7BA 1JT9A 3DVRX 1ZA2A 3BGSA 3HYNA 2BGWA 4ZEXA 2W0SA 3B9QA 1NVKA 4CL2A 1J8FA 2ZUSA 3VOAA 5ITZA 2WWHA 3CJQA 1SD2A 2QBYA 2O3SA 3HZRA 1O2DA 4RSGA 1ZD1A 1LPOA 2WUWE 4KSBA 4PRZA 3TLEA 4YQZA 3C1TA 5JAUA 3PUVA 4PYRA 5JD4A 3VAZA 3C3BA 1MH1A 4NYIQ 2PKYX 3VOSA 1W96A 2Q0SA 1PLKA 3EASA 1V41E 1MEEA 3V4ZA 4YCJA 4OHOA 3DR5A 2PGDA 2Z2IA 4PN7A 2WT9A 1GPNA 3EVZA 2Y1KA 5T6BA 2FFHA 2GCOB 4S1VA 5BT9A 2QZPA 1MEJA 1RRKA 5K05A 2YRWA 2LVBA 3FYSA 2PL9A 4WSOA 3GQVA 3N75A 1JJ7A 1ZMRA 4Q34A 1R9JA 1CNEA 2NG1A 1ZL0A 4M86A 2ERCA 1FVHA 1Y42X 3H04A 4J1TA 4TUYB 3B1JA 3HCFA 2L19A 4PHTA 1N2GA 5ESDA 3HNOA 3TKAA 4P2GA 1K88A 1K8RA 3QX7A 4ALNA 1J2RA 1J2YA 1JJFA 1SIWA 4JLUA 5HW0A 1V6AA 4MPTA 4NX2A 2AJLI 3CT6A 3EFOB 3JQ8B 4U9IS 3SYMA 3AVOA 4O02B 2PKWA 2Y6UA 1ZGGA 4NU5A 4BVLA 1A4XA 3FNIA 4QU5A 3KIPA 3GNQA 3PL5A 4LDAA 4JK3A 3TVYA 1UBEA 4UM9B 5BYAA 2GPSA 1LLCA 5AK5A 1U11A 5HVNA 2H2HA 1IWPB 2XYPA 1RKUA 2VHUA 2GBCA 2ZI9A 3DVQX 3MCTA 3Q5EA 1Z68A 4LX0A 3ZDZB 5K0TA 2IWRA 1T5IA 3AKCA 4KFSA 1IRIA 4LSMA 3GPIA 4DIMA 4EHDA 2GXAA 5HKOA 1INLA 2WNIA 1M33A 3EOZA 3QVVA 3R3JA 4RWZA 2VBIA 3EMVA 3MQ4A 3WK9A 1QONA 1W2GA 3C70A 2H1WA 3VC3A 4DBVO 4D9FA 3WK5A 2A0XA 4IQ4A 5J40A 4DLLA 5KTPA 4GAEA 4NQRA 1ZM3A 3IAS6 2UYOA 5JCJD 2YHIB 3HJCA 2ZM5A 2Z4SA 3L0PA 3WGVA 5KREA 1K2WA 2E48A 4NPHA 1DEXA 1RMYA 2ZJYA 3DMYA 1WO8A 2A57A 5KVSA 1BN6A 5LP6A 1C9YA 1ZJJA 4KV9A 1OB5A 5J1TB 4BCBA 1R10A 4JEMA 5EE0A 4Z0TA 2DQKA 4L9RA 5BR8B 3HBFA 3EXG1 3OIVA 4JA0A 5CG2A 4ZT5A 3WL7A 1WSAA 4DCOA 1V4VA 3JD0A 3ZKWA 1YB6A 2HWUA 1U0NA 2Q4EA 3DMDA 4QYIB 1A88A 5E38A 1F8UA 3IOMA 2DTDA 1H3NA 2QQ0A 4MWCA 4HDAA 2ZJFA 4HC4A 5A03A 1E0DA 4P32A 3V8EA 5JSQA 1FP4B 1K92A 1UMDB 3I2FA 5JJCA 1VRWA 4C7JA 4MUMA 4OO3A 3FTEA 3DV0A 1XRNA 2JGRA 3H8SA 3T4PA 2QQFA 1GNRA 1FTQA 4N40A 3NCTA 5CLJA 2B6HA 1NMXA 3L7MA 4JLPA 2WQZA 4ZCTA 1HI9A 2GDJA 1KFKB 4L8FA 3TW8A 3ZL9A 5I7SA 1I4TD 1N5KA 2WD7A 2XB8A 3ELDA 3S7ZA 4ER0A 3DWIA 4YYEA 4LISA 5F7XA 5ALMA 1QK5A 5A05A 2BGGA 3CGGA 3LDHA 3RSCA 1VCMA 4UUAA 4M8SA 4RUKA 4S1WA 3TFOA 5JPCA 1X1CA 2Z5VA 4MW9A 5D5QA 4IW3B 1O7JA 5CFNA 3B1YA 1DO0A 2DY1A 3EVBA 1W48A 4HB3A 5ALDA 5IVDA 1JHRA 5IT0A 1JILA 4YRIA 3ORFA 2ST1A 5G40A 1T9CA 4OU4A 2ZIZA 1IG3A 3EJWA 3L04A 3T0FA 6Q21A 1E5QA 3GJ4A 2IHJA 2JJ1A 4V1CA 2IUFA 4R84A 3ZHZA 3I4LA 1TTPB 2WJHA 4YR7A 3A8TA 3A4VA 3QKRA 4ER3A 3R9KA 3BRSA 1V45E 3HJGA 4M8KA 3DMHA 4A82A 1NW8A 1T0IA 2Z0MA 1RS0A 5D87A 4U7DA 4QPJC 2G70A 1YZUA 3JWPA 1XOIA 1OXKB 4YGXB 1D0SA 3OEEA 5EIFA 5AXCA 4AG5A 1QJ4A 3DE0X 1BDBA 2IYRA 1GP2A 1JLLB 3PU6A 3RLFA 1JX6A 9GPBA 3K96A 3ILXA 1TECE 4Y6PA 4RY9A 1DIGA 3IILA 4RAOA 1DJLA 2WA1A 1S2OA 1PT8A 5T67A 3W5JA 3G2OA 5BQ3A 1DAIA 5ITZB 1LA2A 1KS2A 2DBQA 1U9CA 3BA1A 3EDYA 3K16A 2I1QA 1E1LA 1SC9A 1UUFA 4HQLA 1NNUA 5FO1A 5G3YA 4YP1A 1Q57A 2X0NA 3KVYA 4PQYA 3L4KA 1QYXA 2BEVA 3DVLA 1SIOA 2YDYA 4WN3A 1DTEA 1E1RD 2ONYA 4KGZA 4MS4A 1GPLA 3GDGA 1IQUA 1VJ0A 1Y3HA 3GFBA 4IIHA 3QIAA 3GEDA 4QNRA 2OMKA 4RHEA 4BNNA 2AR0A 2E82A 2X9NA 1OLSB 1MAAA 1DOAA 4DEYA 3DAYA 4EPWA 1JPUA 3QW2A 1JWBB 2UKDA 2R00C 3UGJA 3RS8A 1PQ4A 3RVNA 5AHXA 5AVWA 2K4MA 3NBMA 4PXYA 2C83A 2O2CA 1SIBE 2HA0A 4L3VA 1T3SA 2CLCX 4B74A 1ESEA 3CJTA 4NEGA 3ZBPA 2JFWA 4ZQBA 2DULA 2G0AA 5C51B 2ODWA 3L0OA 4JQSA 2WYUA 1OWMA 2OP1A 2GETA 2O7NA 4LGVA 2QN7A 1YUMA 3CUSA 4QPNA 2JGDA 1KR2A 1UPAA 2FYTA 3B20A 4AY4A 4YJ3A 1T5BA 2TMGA 2YWRA 2RHDA 1L7BA 4ARCA 3DFMA 3OLXA 3PHLA 4PCLA 4A1FA 1FE8A 3S55A 5EQTA 2QUZA 1QFJA 1PE0A 3O8OA 2AXNA 2AMVA 5JAIA 3OFNA 4LHVA 1N5JA 1NBWB 2W43A 4PXAA 3RWOA 2JRLA 5B1DA 1Z6AA 4JWKA 1R7RA 5JWHA 1YU6A 3TN7A 3FLBA 5JYCA 3KETA 1N5MA 3B60A 4PE5B 1Z5GA 4A0HA 4ZAZA 4BAGA 2AFHE 3P9PA 3PCXA 5C9ZA 3ZZUA 3WXMA 5KS2A 4DJEC 2ZAOA 1OPXA 1ZIYA 4H7HA 3TZLA 5FXMA 1OSNA 4LFAB 1G9XA 1WPQA 2WKSA 3IT3A 1P44A 3VPXA 3IEUA 4HQ6A 4OK5A 3RVOA 4L1KA 1AKUA 4MUIA 3D8UA 5LP6B 3DYIA 2I99A 3NKVA 4NECA 4HLCA 3O8BA 4YV7A 1C7ZA 1QK4A 2X0IA 4RVGA 1Z6PA 1O9HA 3HU1A 4NNOA 5ES3A 1VLJA 1XCBA 1X9IA 4GI3A 4FHCA 1JJBA 2APJA 2HIAA 1LLQA 1H4VB 4HK4A 1UC5B 4YH1A 4JB0A 1VQ1A 5CBPA 5H70A 4EA8A 3U17A 5BVHA 5DNYB 4M9CA 3MS7A 4IQFA 5GM2A 3GJ0A 1IHPA 1DBIA 4RVOA 2XIQA 3LBIA 2GEVA 4O3FA 3DV0B 4UEOA 1JA9A 1ZM2A 3G5UA 4JMLA 3AUFA 1P5ZB 4ZU3A 4NNJA 1DAGA 2HGSA 5D3QA 2FSFA 3U3DA 3HHEA 4M1QA 3C24A 2O2HA 1ZM4A 3DT6A 3EIUA 3SYTA 4UBJA 3ZHQA 4CDMA 2G5CA 1MJGA 4FFBA 2F3UA 4UVEA 4EI9A 1NAHA 4KXVA 1DARA 4I1UA 2RJNA 4KHZA 4I7EA 2K7FA 1TYCA 4MO2A 4CFZA 4TKLA 1GAXA 1NTOA 2HJWA 1W2HA 2W6PA 3FIJA 3PNOA 1R2QA 4YV2A 5GQSA 4X61A 3KBBA 1B6SA 2C9YA 4RMNA 3IYLW 1QIIA 4TQGA 1RIIA 1C0EA 1EWKA 1TADA 3BMOA 3GUZA 3LWBA 4KH0A 3WBJA 4A2WA 1QYWA 2IYOA 1G21E 2C2ZA 4JP5A 4NH0A 4KGDA 4TMZA 2NYUA 4YJ3F 5K0GA 5DCLA 3DP7A 5B37A 1NX9A 4RHFA 4O29A 2RH5A 1JV2B 2Q28A 2IDKA 4IFBA 2W71A 1G18A 2PSDA 2R60A 3QKRB 4IV8A 1PFYA 4TM8A 3S2EA 5JD6A 4G2TA 3SZGA 3IHWA 3BCSA 5HYVA 4BGIA 3U7IA 5CIWA 1J0AA 1Z75A 2H5JA 4HQ0A 3OX3A 4EKDA 4J43A 3W6PA 1S1CA 3H42B 3H9QA 3C5HA 3H2BA 3TEFA 3L1HA 2XVMA 4I8XA 3A1NA 1K6XA 3GPCA 1KFCB 1PGPA 3D81A 3EDCA 3Q3JB 5EHGA 4BC0A 3LGXA 3RVDA 3SR0A 1LPMA 3IAFA 2UUPA 3T7DA 1BKDR 3A6LA 4WXEA 5B7QA 3PIDA 4YP5A 3EISA 2CYCA 4HN2A 1YR7A 5FTKA 1JFRA 5D5HA 1M1YB 3ACDA 2O2EA 4X7PA 2IP2A 3EIFA 4NF2A 1RJFA 3DEAA 1T1IA 4RZHA 4D9GA 2Y76A 1CJMA 3S7TA 2WQ6A 1XDSA 4MS4B 1W8IA 3EGXB 4G63A 2PJUA 2HADA 2FMUA 3GRKA 1KY2A 2RONA 3QHAA 3EIOA 1NWHA 3RUEA 4C7BA 2IUYA 2ZT5A 5I8WA 2UZIR 4RD2A 4LMAA 1LC0A 5ELMA 1N3LA 3V2HA 2PSSA 4PNEA 3V4LA 1E8DA 4LJ8A 4MMYB 4XYBA 5FPYA 4I3GA 2FN9A 5H8WA 2CMFA 1WD5A 4CLRA 2MT9A 1Z7GA 5E1BA 2DQ4A 1HDGO 4EVRA 2ZWVA 5EJIA 2YZKA 4DVJA 1ZONA 1JZTA 1SHZA 4WDRA 3O8NA 4LRUA 3M4XA 4P7GA 1RKVA 2Q1WA 2Q50A 3V8MA 5E8JA 4FGJA 2UYGA 3CRMA 2NYRA 2JGDB 4TLLB 1CR0A 1CY0A 1AKWA 1ZVKA 1XLUA 2G36A 4YJ3B 3TQOA 2IOFA 1Q0QA 4CW7A 1COZA 2QAGB 4NY1A 3G82C 3AVYA 2G08A 5BW5A 4K9OA 4QOFA 2CXHA 3U3RA 1W5BA 4MPRA 1GZVA 5K6TA 1V8ZA 1D4AA 1EFUA 1EVYA 1HEIA 2Q8QA 2XCUA 3BSFA 1RWWA 2OORC 2C59A 1V9LA 1YRWA 1F2DA 3SDZA 2C4WA 4INOA 2OYCA 3T5AA 1Z29A 4M0LA 2B4KA 1W6UA 2A8YA 1NVVR 2D62A 2ZK7A 4H2DA 4IVPA 3T3NA 4GGPA 2J0EA 3OFVA 4XB6B 1JU9A 4JB8A 5CXSA 3IAHA 5HIIA 5KPDA 3VHRA 3AHHA 4I36A 4UD6A 1MO4A 3GPBA 3PDCA 4RC9A 2FP4A 3GL9A 2WG1A 4D99A 3GGOA 2I7XA 4LDZA 1A77A 4ARSA 3WDSA 3QX8A 2OLJA 3SX0A 3OPYB 2R6FA 2VK1A 3I23A 3FSGD 3ZDXB 1P91A 3QOWA 2VF5X 1Z2PX 3KB2A 4INZA 4JDPA 4O1IA 2A1TR 4AICA 1SB8A 4INJA 4YRGA 5HOQA 1N1EA 1Q0TA 2AE1A 3OQJA 1O57A 3HJNA 4U3JA 4RTRA 4U5QA 2ZM6B 2ZIUB 4B7AA 2MIIA 1VYHA 3BULA 5FNVA 1T36B 3MMSA 3C4QA 2J5XA 1EP2B 3DZKA 2B4YA 4HH4A 3BTVA 5BVHB 4QOEA 3SC4A 4Y8VA 2O1WA 3NG1A 5CVJA 3RM3A 5KNCH 5A9RA 1UJMA 5BQPA 3R8CA 3NAZA 4J91A 5C7OO 3EFHA 1JDVA 3FF1A 4Q39A 3STHA 1YVUA 2IEDA 5B1IA 2R1TA 4FFBB 4UMVA 2J4CA 1CUZA 3RYTC 3BFJA 1NM5C 4CF6A 3UUGA 2NT4A 1ORRA 4JC0A 3LGAA 1XZKA 2V7TA 3JASB 2CF6A 3JRNA 4LZWA 4N65A 4PU0A 4C0AC 5CVTA 1QRUA 4HNUA 1Q21A 5EI5A 1NW9B 3OM8A 4U2DA 4RNDB 4ZANA 4WNCA 3KOXA 3MGKA 4RK7A 4WOCA 2JJYA 4G65A 3KHTA 4AYXA 3NBQA 3TZEA 3ZLTA 4WXRA 2Z8XA 3LUKA 5AIBA 2NW6A 1WNFA 1YQ9A 3BMOB 1AY0A 2HQSA 4RK6A 3CLVA 4IIDA 1QQ5A 1M9NA 2J3IA 3C97A 1LDBA 4YRJA 2PWBA 1N33B 4ZN6A 4DHEA 2Q2NA 3SXUA 4CTKA 1TQ2A 4KH1A 3VR4D 4FYWA 1GRNA 1AO3A 1NN0A 3N07A 1R18A 2ERXA 5BWMA 2CFCA 3Q0TA 2X22A 3TSCA 4HWKA 3KLMX 5LYYA 4KYVA 3LFTA 4D9KA 3IUQA 2BL4A 1Y9JA 3N8GA 3ORSA 3OWXA 2WJ6A 1IC6A 1K06A 1T3GA 3QE4A 5JUWA 4FNOA 1A8IA 1MH9A 4N12A 4N0EA 4JYPA 5EKDA 3ZDAA 3WGOA 4FWIB 3PE6A 2E49A 3D6TB 3PHIA 1OFTA 3Q3EA 3FOWA 4OQ4A 4GL4A 3KZMA 1E5LA 3QWIA 5DRYA 1JVNA 2FV8A 1JHDA 4WL0A 3P0JA 2NP6A 1DG1G 1TGYA 5HZKA 3FBGA 3I04M 2HSZA 3WSWA 2P5UA 1X1RA 1CNFA 4JJKA 2LCQA 1H05A 4KGVA 5LPNA 3LBHA 1P60A 3EY4A 4QLOA 3NJRA 4HDQB 4Y2JA 3AY7A 5TPZA 1ECFA 3CZQA 2MINA 4DJFC 5G4KA 3AR5A 5K45A 4BEWA 4BLWA 1U9IA 1G1AA 1T5OA 4B3SB 5FNVF 1UZAA 4OGLA 3CX4A 2I8LA 1TOAA 3ABZA 2C2KA 1F1BA 3THXB 1OVMA 3CX8A 3P96A 4CTJA 3R20A 1DPGA 2GKOA 1U7UA 2VP5A 2IYFA 2ODBA 2YFHA 3WGYA 4CLRB 3R4VA 2IHYA 1HLFA 2HM7A 2QMHA 1RABA 3JQ7A 4DG9A 4TSFA 2NZ8A 1SZJG 3M4JA 2ZRCA 3T61A 1NDQA 1HDOA 2YWHA 2BTQA 3OI7A 5U1PA 2WF6A 1L4UA 2RGGA 5F77A 2COUA 1XK6A 4MITA 4UU7A 3GLGB 5EIXA 4GKJB 3LQRA 4CDGA 2WIBA 3ZJ5A 4FGKA 1ODTC 4RDIA 1CDDA 4WECA 1PFGA 5KNLA 4Q7LA 3U9TA 4M1YA 2QM7A 3BIXA 3C6KA 3LDFA 2YMMA 3TL2A 4H31A 4N5LA 5JMWA 4PG7A 1EUCA 3K9CA 2JFHA 3E82A 4MV5A 1RXUA 3L7JA 4M0EA 3IQGX 4XQ0A 1KRXA 3OUZA 5CK4A 4AFNA 4IDXA 1W0CA 1AHNA 5F7ZA 4KL8S 4V0KA 4M1EA 4EBFA 4D97A 4RL6A 1NY5A 2I76A 3EQ6A 2EFYA 2HSGA 1X9HA 2X8WA 2R8YA 1YZNA 2HU7A 4FGSA 3TZBA 3UAOA 1LK5A 2R7LA 4MMZB 3NOQA 1NSTA 2C29D 2I7VA 2XA2A 1V3VA 2QUBA 1GTZA 2NZXA 2X8JA 2P65A 3MT7A 4HDOB 4RJIA 2IHVA 4DQLA 1BC5A 1JYFA 2BUCA 2CHVA 2CUTA 2ZS8A 5IBRA 4KPUB 3R0ZA 2HLDD 1Z7YA 1CULC 4BWGA 3AHDA 1PQPA 5A06A 2JD2A 4DB2A 1IK6A 1EZ1A 1SIUA 4PQEA 3X1DA 2D6FA 4ND6A 2W2VA 2YV5A 3NVAA 4F3YA 1JBKA 2I3AA 4GLFA 1C1XA 2GMWA 3L2OB 1E20A 4EVQA 4WUTA 1EFRD 2O07A 1OT3A 1WKBA 4IJMA 1RWPA 5CVVA 5FLYA 5AYVA 4ZRDA 4CZ2A 1GVNB 2AHOA 3H87A 2NP7A 1F14A 2HPVA 2DR0A 4GD3Q 1M5TA 5GGYA 3P20A 5A3SA 1U2RA 3FNQA 4MJ3A 1I1OA 3H8WA 4ZIRA 1II8A 2IC5A 3LSYA 5I9IA 4UBKA 2YWGA 2IU3A 2N0SA 1O0SA 2EKZA 3QUSA 4IG4A 3W8DA 4WXPA 3WNCA 1I4EB 3AEKA 4MWBA 2R1TB 3VNVA 1KJNA 3W0LB 4FGUA 4UUNA 3IO5A 4YRLA 2V6IA 2YWBA 4PC2A 1LJUA 3ZDYB 2IZOA 2L2QA 5FWYA 3QUTA 2PT5A 5G53C 1HURA 4DDWA 3I45A 4X8OA 1X7XB 4QLBA 1U65A 1MC4A 3L0CA 4DV2B 2XH8A 4YAWA 3DTNA 5KWJA 4Y1RA 4G5HA 1TVKB 2XRFA 4UAJA 4UFPA 5GAJA 5DV9A 3BA6A 1JFLA 2TECE 4D8TA 3DBIA 2ZTHA 2NO9A 2P6MA 4N76A 2XYGA 5IEJA 3LT2A 2CXSA 4JKYA 3RVPA 3WS7A 2ZUVA 4EHJA 1HLDA 3ITDA 4HGQA 3KUUA 1J06A 5FR2A 3SXUB 2IP4A 3M5DA 1TYZA 1ITZA 3HWX1 4MKFA 3MINB 4P58A 4A27A 4XGQA 4ZV9A 2JLXA 3G2NA 2VAVA 3BKXA 3KELA 2ODQA 3DDOA 4PO9A 3D5EA 1VLZA 4FFWA 4LSZA 3WLTA 2IITA 4EGQA 3KLPX 3ZGOA 1YAJA 2IKSA 3DL0A 4LQ4A 4UEKA 2A33A 4MYCA 5C32A 3HLTA 3WXBA 3QNWA 2JLSA 3O2QB 1W4RA 3DZIA 1OF1A 2IEYA 3HDQA 2FWMX 5LMNB 5EMLA 2WIKA 1GARA 1J39A 2ZDGA 1F2TA 3GT7A 4UBIA 5CYGA 1UT6A 2FPIA 2ZWPA 1G20A 5EJ8A 2RBKA 2CUKA 2E21A 4JJZA 4Z9BA 4CTMA 1DQZA 3IVCA 3EC2A 5AHKA 4IVQA 3FCOA 3C8HA 4ZAXA 4DFDA 1ZAYA 4RVCA 2PUCA 2XTNA 1J9ZA 2W6ZA 3SQXA 1FNDA 4YYZA 1RYBA 4LOLA 5ALNA 3A6FA 2H16A 3TGLA 4ZV7A 1E8MA 1EK6A 2VG8A 4CR8A 1FNCA 1ICEA 3C3MA 1RXYA 1Y8RB 1U0BB 1Z0DA 5G4KB 3FA2A 3ZK9A 5KDOA 3AEYA 4MGIR 1MHTA 2ZJZA 3WFIA 2NO1A 2ONZA 1JAIA 2X1HA 4B87A 4IIEA 1FDTA 3SD7A 2OBFA 1Q2UA 5DTEA 2G88A 3SF0A 4CV0A 1WXGA 2AX4A 2YC4C 2ZRDA 2QLNA 3GJQA 1D6MA 2RJ3A 1WDTA 3Q6NA 2CUNA 1H0HA 3CBGA 1VM6A 3U3JA 3V8NA 3F4LA 5LZ9A 5KWEA 3JQ7B 3UMMA 3ZG6A 3WWYA 3NBAA 3PUXA 1WVMA 3ZQKA 5ECYA 3KTFA 4MWDA 3DJFA 2DY0A 3EPRA 4NAHA 2AJBA 4BLUA 4AKIA 3SIXA 1JKJA 5LZ8A 3K15A 4NEHB 4QJ4A 5D7BA 1QS0B 2A6PA 3X2FA 4A92A 3ROPA 4AAYA 2UYHA 2X9VA 1CFJA 1JVSA 2IYTA 3LX4A 2AKYA 3V5NA 4B34A 1KOGA 2NZWA 3HBAA 1FP2A 4MUAA 2P6UA 5G4LA 1CQJB 5JQGA 2HJ9A 1JW9B 4B5KA 5KQLA 1IK4A 3V9PA 1HE8B 2A1UA 5IDWA 5JEEA 1AKRA 1KZ9A 5T3YA 5C8ZA 1RHQA 4DR2B 4B3JA 1YOBA 1WDWB 3SPXA 4JSYA 3VPFA 1PR9A 1JG7A 1NQVA 2H4FA 3AR2A 4RM3A 2IV3A 1Q20A 3PTZA 3KYBA 4JJFA 3THRA 3AI7A 2EQBA 4NRDA 1PDOA 5FD8A 1A9XA 1I2DA 1FTSA 1GAEO 1PEYA 3C45A 4YMWA 1HE1C 4OQEA 2F3PA 4NNPA 5IYZB 2VYVD 1G60A 3ULKA 2QAIA 2RI1A 1R0LA 1XMIA 5TQ2A 1UBHS 1XZCA 1A9RA 3D1JA 4FPXA 3TRJA 4CLHA 4ISBA 4EI7A 1ZNQO 2GH1A 2QKYA 3KSRA 1DELA 1T3TA 1YV9A 3BIOA 3PUHA 1MFPA 1FUIA 2GO7A 2Q5IA 3BOSA 4OB8A 2P9BA 2GCEA 2AW5A 1MIOA 2I2XB 2JHPA 1UXJA 1WETA 4F3NA 1ULAA 2JHFA 1C1XB 3ABQB 4QOIA 4C9BA 3DAPA 2XYHA 2OUIA 3B3JA 3QEJA 4L6CA 4BQPA 2C4VA 2A5GA 2Q4DA 5IJ0A 4W1RA 3FYTA 3NZEA 2X0DA 2XVXA 1U7ZA 4JOCA 1E5XA 1QO0A 1L8XA 1VJ5A 1UPXA 4GZMA 4YXWA 5I01A 2I91A 4MDFA 1TEZA 3E0QA 1ZESA 4LBVA 2YQ4A 4BKMA 4ZIRB 1M1NA 3U4MA 2HPZA 2H1HA 3DS8A 2C5GA 2YDXA 1CZKA 3W2HA 1NA5A 5K4AA 5UKDA 3RRYA 2J09A 3AEKB 3IDAA 2VDVE 4U7HA 4C7MA 2W48A 5HE8A 1C0IA 1M0EA 5FWYB 1IN6A 1O6BA 2OG2A 3COYA 3KVNA 4WGGA 4OL9A 1YC2A 1ABEA 3I1JA 4YA6A 1IZ7A 4YIHA 2DECA 3I8XA 2NV0A 5A5VA 3CEPB 3K0AA 4MQMA 3WMGA 1MLDA 1GUAA 4Y1RB 1CRLA 2C2XA 4I1YA 2ISCA 5EWMA 3H05A 4IH4A 2C8KA 3RYFA 1U2QA 2D4AA 2ZYAA 1N9GA 3QXXA 2YIMA 3U7HB 1KK1A 2HWWA 2WVGA 4PWZA 3PNQA 4S1NA 1KEVA 5DSZA 4FB5A 3QXSA 1K4KA 8MHTA 3DNPA 8ABPA 5SY6A 1VI6A 2GJ4A 1CP2A 3BXFA 3P8ZA 1QF6A 1GTJ1 1LDYA 4H16A 4AZSA 4C3ZA 3C1OA 2FPKA 1T1RA 1LDMA 1YNOA 2IVFA 5LYJA 5LB2A 3THWA 5KU7A 2VFAA 4DMKA 1J2TA 9ABPA 5I4BA 4ANFA 3HCAA 2G9VA 1X1TA 1TYEB 4GXRA 5IABA 1ZSNA 2XVYA 3T7TA 4WNAA 4FYYA 1Y0BA 1YS1X 1EM6A 1D4ZA 3QLTA 4H1HA 1F2TB 3G79A 1SXPA 2FPIB 5IVPA 1G20B 2RAFA 2G1JA 2HSDA 3GYGA 1WZNA 2YCBA 2CBXA 3DOUA 3R44A 3QE2A 4BGUA 1H93A 1P73A 1FMCA 1F5NA 1QGAA 1AGXA 1PJBA 2EFJA 1Z13A 4IEIA 4IWXA 5A7FA 2P4UA 2MMGA 3GT4A 3VPHA 2W6JD 1HQDA 3FRHA 4NONA 5LDGA 3UHJA 1GN9A 4F4CA 2HA3A 1RBQA 4GX5A 1E58A 3F0TA 1T2FA 1KI4A 2R4QA 4E12A 3HL0A 4IEEA 1P18A 3VJRA 3QM1A 3PQDA 2GERA 3PC2A 3CG0A 4B40A 5C8DA 1J0DA 1JDPA 1FJ2A 3ZW7A 4DM7A 4KXYA 3TAUA 1J5EB 1MIHA 4RZ3A 1YR8A 1HQCA 4YWJA 4ZDIA 3NXSA 5CLGA 4Y3UA 5SY9A 4EO7A 1Y9EA 2FWPA 4L5AA 4B4DA 2O50A 4C2UA 2BR5A 2R84A 3A6GA 2AEJA 4NVRA 4X6UA 2BH9A 1Y6ZA 2WYHA 3T3HA 3VJMA 1JHVA 4B8ZA 1RI2A 4L4UA 1EESA 4LF8B 1JSLA 1P29A 2I4LA 3H9GA 3FBTA 1C1DB 1OYYA 1QORA 4C6SA 3LIPA 3QBEA 4FYKA 4DLVA 5JQGB 2E4AA 3X3HA 1VIMA 1BRTA 2EW8A 2A1UB 1HNWB 4DDVA 3WLQA 4HLQB 1QFYA 1UWCA 5TMBA 4A6DA 4ZYYA 5HBGA 3AC0A 3RANA 4DJ5X 2QSJA 2JAUA 3LA8A 3MRXA 2Y2UA 2XWPA 3TQTA 5SYNA 2GZHA 5C3UA 4Y7DA 1JRLA 3FMVA 1DVRA 4JB2A 1A76A 2XOKD 2WZBA 5DM60 4G1EB 1MT3A 5JHHB 1BJRE 1FYFA 1OZ0A 3I6QA 4UD2A 4I4IA 4YLGA 1YU9A 2FEAA 5TQ2B 1XNGA 2H57A 3T3OA 3C7DB 1TF5A 2O1XA 1UAGA 3VH3A 2NV2B 4AZTA 2X58A 3SZMA 1J70A 1NZFA 2RGBA 5C7LO 2JNWA 2P77A 2RCYA 2WIAA 2ZSFA 3ZV3A 4PQGA 4DCMA 4BO8A 3B3GA 3COJA 4KN6A 4CNBA 4V38A 1IOZA 1K7FB 2HKIA 3W5UA 5LBUA 4GYYA 6ADHA 2R8PA 1WMAA 4CIVA 4BNUA 1Q0SA 1S7GA 2NXEA 4QYTA 1ECBA 2HRRA 4JP8A 1DZIA 1J2UA 4PX2A 1GLGA 3SZRA 5IJ0B 1IZ8A 5AH0A 5EJ7A 2OESA 4FKMA 4EB6A 1U0OC 3FHCB 1QH8B 1WSDA 1TF7A 2QS9A 3OM9A 3BPSA 3LW7A 1KYXA 3CF6R 4HMOA 1OHHA 4WFIA 1KH1A 2WT4A 2B2XA 5AVOA 5FLXA 3HG7A 5C53B 5AUNB 1Q6YA 2H2AA 2QV7A 2X9GA 1ZJZA 3RAPR 2EP5A 1W4LA 3NRBA 2PGNA 5CJJA 5CT6A 4ETMA 3FZQA 1L5NA 1E59A 3ORYA 2VJCA 5LMUB 1E9AA 1QHIA 5JU6A 4HBGA 1FTWA 3K9QO 3QYFA 3M0EA 5CYFA 2BRUC 4ZOQI 2R96A 5MN4A 3PHBE 5JXJA 5KTNA 3ZHSA 3K0AB 4KLNA 3TNYA 3QKSB 3VDQA 1UQTA 1P2UA 1UFQA 2FCRA 3IAS1 1II9A 3WAJA 4KXXA 1N9GB 2ON6A 4CM4A 3TPZA 5C80A 3CRRA 4WW0A 4F04A 5ALSA 3H83A 4AS3A 3L8EA 1KZ6A 2FXVA 3LUJA 4K8RB 3AEZA 4YJKA 3QE0A 2YNMA 1USWA 3E7FA 1FQWA 2JFVA 1KBZA 1RPJA 2NZYA 1XTPA 1ZJ4A 2QL5A 1E2UA 1O96B 2KE5A 5LYJB 4PWYA 3A7EA 1VMKA 4IGIA 4C2BA 4XB2A 3THWB 3HHPA 3OTWA 4J29A 1QVWA 1U1FA 2BJWA 4WBXC 5ARCA 1EGHA 1GEEA 1DBRA 1QOPB 2IK8A 2QJFA 2EJCA 6AT1A 4P0QB 4QGHA 3H1PA 1D4OA 1MC5A 1Z18A 3MWFA 2NXCA 1RIFA 3K9LA 3M6IA 2CKDA 4JBHA 4PZDA 4TWIA 4U7TB 2IU4A 2UVDA 1NMZA 4WNAB 3KKPA 5C52B 3B70A 5GZ3A 3GEBA 1BW9A 2ZI7A 4XGIA 3FRJA 4BFWA 3JPWA 4C7VA 1VI5A 2HIMA 3IV6A 4GMGA 5FBKA 3V2GA 2VDRB 3U4CA 4B6FA 2A4MA 1KMMA 2HZBA 2WUVA 1CUIA 1QWSA 4RKYA 4CMEA 1SUAA 1S4MA 1NUSA 5LLDA 3UJNA 2CNKA 1HFWA 2ZCUA 3R7BA 2H2FA 2OM6A 2OR3A 3TTYA 1VPWA 4U9HS 1HRDA 2X5KO 4AT1A 4KE6A 2J6HA 2WI8A 4C78A 1ID8A 2JLVA 5CB4A 3K2BA 4I9GA 4I14A 4ENVA 4H1WA 4XR4A 4X60A 2HH9A 2ZWIA 1LCIA 5HKLA 3OZDA 2EW1A 4TLCA 1TJ3A 3KX2A 4ZDJA 2PZKA 4FKZA 3GFQA 4FYXA 4C7KA 1IY0A 1W9HA 1YQWA 2CZGA 3SYKA 1GSIA 3W9YA 5ITWA 1RVV1 4H1VA 3RD5A 1NRJB 1GQQA 3UCFA 3F74A 1PJRA 2ZTUA 1DG3A 4V0NA 4LZNA 5T3UA 3ML1A 1UXOA 1W87A 1IAVA 2B8NA 3RHFA 1U9YA 3LTEA 1P0IA 3I30X 2ZR7A 2WUDA 1JHMA 1ULBA 1RVDA 5IN5A 1P9RA 3SSAA 5CFLA 3PZBA 5HSGA 2O7QA 3P7MA 5EHXA 1BNCA 1FU4A 4BEVA 4MOWA 4QSMA 4EPXA 5EXXA 2VCEA 3UNXA 4DXDA 3DO8A 2VWHA 3NBFA 3I9NA 1VSVA 5BQOA 3U1VA 5FKJA 5CNMA 3BMCB 4YN3A 1T4DA 2WIGA 1J23A 1JDUA 4UZFA 3P5BA 1P3DA 3ZY6A 1URPA 3KKOA 1O95A 1UWVA 2I6FA 1Z2EA 2I1WA 3BEOA 2RC6A 3QMWA 3GMIA 2H7YA 2UUOA 3G9TA 1EIWA 5DM2A 2XRYA 2FR8C 4KYUA 4KPYA 1U2TA 2IYYA 3RQIA 1DFIA 3BK2A 4KJXA 4HUJA 1VG1A 5AM4A 1E6EA 3O8QA 4FDMA 4IDDA 4OJYA 3T15A 3TLGB 1QRRA 3TOCA 1U7OA 5A2GA 2O8BA 3HXPA 4FCVA 4J75A 2FX5A 4N7JA 1L2TA 3ZWYA 2XLCA 2JF0A 4PC6A 5IFLA 3PUJA 4PAGA 1YA4A 1QCDA 3BE8A 4H7IA 4BQOA 3C5WP 1UZUA 5HTKA 3T3IA 5K3BA 2B1JA 2DETA 3D1VA 3DLCA 2IDZA 1NJGA 3A32A 3GLTA 3SFTA 3RG8A 3FHOA 4A23A 2QJWA 5ES4B 1GTSA 5JNSA 4B5LA 2N47A 3LT1A 2ZSUA 1EXMA 1JQKA 2ES4A 1CUUA 2YC2C 4QUEA 5JZOA 2VBGA 4DCCA 2W58A 3U19A 3GVHA 3PDWA 3EF0A 1VKJA 4Z3OA 2ZP1A 5I7RA 3TQQA 2Z8ZA 3LKDA 3HN7A 3DBRA 4MVXA 3LY9A 2B20A 4HXYA 2B7LA 4RIHA 1XYYA 2PWAA 5B7NA 4JLJA 1CWUA 4GLLA 3DCNA 5CH8A 1SOUA 3SVTA 3AYXB 2GKGA 2R1ZA 3OEED 5J4HA 1K3TA 4F0JA 2YVUA 3BH7A 2VPIA 2R7AA 4URFA 5BW4A 2FMHA 1W2WB 3BB1A 4ZAWA 4IXDA 4C01A 1C1YA 4GM1A 3LP6A 4ADSG 1FTGA 3QFRA 4YUXA 2ZBEA 5CNJA 1P31A 3K2EA 4G4SP 3AHGA 1HRKA 4J7CA 4F5ZA 4W5JA 1QCZA 3GEMA 3QG5A 4FFOA 4H3VA 4K2HA 4XX0B 1VPVA 4EH1A 1EJBA 2YKGA 4TXJA 4LPKA 2PZAA 3LHSA 4A0RA 4C3UA 2VLIA 4IFEA 3G0GA 1P2FA 1VXOA 2AOXA 3DEZA 3L8GA 1E9SA 1HDZA 2WSIA 4PZYA 1WBJB 4IDUB 2IS2A 1Z8DA 1C5KA 1GLVA 3ICOA 1J7JA 4HRAA 1V5WA 2V3WA 3D7MA 1E9EA 3SHOA 1MV5A 1SJ9A 3BVPA 4QUIA 3RCBA 2PKCA 3IX7A 2BIFA 1MR3F 3I6BA 1BW9B 3W7VA 4B44A 5A5FA 1PGJA 3NWEA 2XYVA 4K03A 3UCEA 2GPWA 3ZCQA 1FW6A 1CDEA 1ESDA 4BDSA 2R3SA 3LPNA 3VPBA 4ARVA 2CNLA 1NLUA 3MGCA 2DF8A 1YR9A 1C2TA 1NKVA 4Q1FA 1IE3A 3IQHX 4NZ9A 3VU9B 5B64A 3MS2A 1RHUA 3V7YA 3P19A 1HOTA 1MA3A 1X7DA 3WKEA 5CLLA 5CB4B 3PJDA 1KP3A 4LOKA 4NLLA 2VA8A 4FHFA 2XF2A 1DAHA 4JOBA 3WR5A 2KPOA 4JX8A 3LYUA 3RAFC 4EY4A 4DR6B