1A9YA

Udp-galactose 4-epimerase mutant s124a/y149f complexed with udp-glucose
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
338
structure length
338
Chain Sequence
MRVLVTGGSGYIGSHTCVQLLQNGHDVIILDNLCNSKRSVLPVIERLGGKHPTFVEGDIRNEALMTEILHDHAIDTVIHFAGLKAVGESVQKPLEYYDNNVNGTLRLISAMRAANVKNFIFSSAATVYGDQPKIPYVESFPTGTPQSPFGKSKLMVEQILTDLQKAQPDWSIALLRYFNPVGAHPSGDMGEDPQGIPNNLMPYIAQVAVGRRDSLAIFGNDYPTEDGTGVRDYIHVMDLADGHVVAMEKLANKPGVHIYNLGAGVGNSVLDVVNAFSKACGKPVNYHFAPRREGDLPAYWADASKADRELNWRVTRTLDEMAQDTWHWQSRHPQGYPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dramatic differences in the binding of UDP-galactose and UDP-glucose to UDP-galactose 4-epimerase from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Epimerase
molecule keywords UDP-GALACTOSE 4-EPIMERASE
total genus 127
structure length 338
sequence length 338
ec nomenclature ec 5.1.3.2: UDP-glucose 4-epimerase.
pdb deposition date 1998-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1a9yA02
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1a9yA01
2IDZA 5AYVA 2QG4A 3ADPA 1EMDA 2Y0DA 3JYQA 4KUHA 3ZHBA 1P1IA 4RVGA 4J90A 2RIRA 4L73A 3HB5X 4RVSA 2UVDA 2BF7A 2GRAA 3VPSA 3INRA 2H6EA 4NU5A 3WBFA 3NX4A 1KYQA 1IB6A 4H15A 4J0EA 2Q2WA 1MGOA 3IUSA 4CMGA 1P1RA 4CM1A 2E49A 5HWSA 2PA3A 2X86A 2NTNA 2BGKA 3QV1A 4IJWA 3JQAB 4J4BA 1KEUA 4NK4A 4O0LA 4J7XA 1AXEA 2W4QA 3LT1A 3TF5A 2FZEA 1B8PA 2AQ8A 2VWGA 4RO0A 3ZNOA 1PS9A 2DPHA 4CM4A 1B0AA 2A35A 4BS9A 3FPCA 4FB5A 4AG3A 5IZCA 2YDYA 2EJVA 1PEDA 3PQFA 3KSUA 2GSDA 3SLGA 4WPGA 2C7VA 2VYVD 3OBBA 2PD3A 4N7RA 1U3WA 1QMGA 2QZ9A 4DXHA 3PQEA 3DHYA 3K73O 4W4TA 3AW9A 4R51A 5THKA 1YB5A 3VZRA 3HQ4O 5ENVA 1XWFA 3Q3CA 4WOJA 1EQUA 3KYDA 3ROPA 4A5OA 2HCTA 1G1AA 3DTTA 3ADOA 2O7QA 3JD4A 3QWFA 2I66A 2EWMA 1BWSA 1I0ZA 1DEHA 2RBEA 1SPXA 1ONPA 4WLEA 4BNTA 1E3LA 2PNFA 3AOEC 1H9BA 3S8MA 1EFKA 4GVXA 3ZU3A 3GOHA 5TQVA 2JHFA 4W99A 2HDHA 1DHRA 1P31A 1P9LA 3RFVA 4HFJA 5EN4A 1BSVA 4XQEA 4PG7A 3BYZA 1O6ZA 5BSFA 2JAPA 3BAZA 5KVQA 3QWHA 4ZICA 5DCWA 4G2NA 3LVFO 5HS4A 1MX3A 5DULA 4IMPA 4YJGB 4OQZA 2YHIA 4WLOA 5TSDA 3PFFA 1Q0QA 4XB1A 4PRKA 5JO9A 1MP0A 1WNTA 3O26A 3RUAA 4ALJA 4CMBA 4RF3A 3KHUA 2PGLA 4R5HA 4YA6A 2DFDA 4QTZA 1VJTA 4NI5A 3N7UA 4R3WA 4F6LA 3CKYA 4XQCA 3S2IA 3RC1A 4KUEA 2EG9A 5F3RA 2EJWA 2HSDA 1PL6A 1E3JA 1GCUA 4R9SA 5IXSA 4PLHA 1R0KA 2I67A 4UULA 2AG5A 3SLKA 4CLDA 3EAGA 3TL3A 4YT5A 1H9AA 2AG8A 1T1SA 1U3VA 4M8SA 2NU9A 1M66A 4R41A 4WJZA 1IUKA 4E0BA 3P2YA 3GMDA 4W7HA 1YQXA 1VSUA 1A9YA 1GU7A 4YPOA 4IDAA 3LT4A 3K2BA 3WDSA 3JQFC 1V6AA 1V3TA 1UJMA 2B4RO 1M67A 1SB9A 4ESOA 4YAKA 1B3RA 4YQZA 5HBRA 5ADHA 1JTVA 4RZIA 4TZTA 3ZWXA 4U8GA 3IP1A 1YS4A 5EJ2A 3L4BA 1I32A 3OEYA 1ML3A 1PU2A 3DFZA 5AXDA 3H5NA 2HK8A 2X23A 1QYWA 5TNXA 5I9MA 4A7PA 5DBGA 2WDZA 3DBVO 4ZRMA 3KLMX 1HDRA 3H5AA 3OMLA 1KERA 3GRKA 4X54A 1VJ0A 3S55A 4Z9FA 1BW9A 5KKAA 4KDEA 1U28A 5DF1A 5I7VA 3QHAA 4DPKA 3HDYA 1B7GO 1PJTA 1SMKA 2X9GA 2C29D 3TQHA 1LUAA 3LDHA 1BG6A 4PG6A 3WYBA 4BO3A 4TWRA 4KDFA 4BNLA 1HYEA 1PR9A 2ILTA 2W2LA 1HT0A 3UAGA 2OGUA 1E7QA 4GI2A 4NH4A 1GQQA 1E6EA 3DZFA 1DRVA 5A04A 1DIGA 2NTJA 3AI2A 3F5SA 1XGKA 3WWYA 4TROA 1P1FA 1G0OA 3PHIA 4IJVA 3QVXA 3DZHA 1EDZA 3DBHB 2DAPA 4N54A 1CQIA 2B5VA 4B8WA 4UEKA 1OAAA 4DTIA 2EKQA 3U4HA 3GG2A 4CM4B 4CMKA 5JNLA 2D5AA 4BMVA 2DTXA 1F17A 1H0KA 1UUFA 1W6UA 2WTBA 1X14A 4Q3BA 5B4VA 4OL9A 4ZU3A 3ANMA 4WNIA 4LISA 2IRWA 3JYLA 3PIIA 2POQX 4W7IA 3WTCA 4AJKA 4R54A 5KVSA 4UEJA 2O3UA 2BELA 1L7EA 1FMCA 4N5NA 4WKGA 4DUPA 2JL1A 2GR9A 4BNIA 3FHLA 3PZRA 3GUCA 1LLCA 2HK9A 3ZCXA 2Q1WA 3RUEA 1UDAA 2V65A 2ZJ1A 2OBNA 2GD1O 4KTTE 1DC3A 4OAQA 1SOWA 3ON5A 5EL0A 4W9NC 1K2WA 3DBHA 1LXCA 2Z1NA 2E4AA 2OL4A 1R0SA 3OICA 5CDGA 2WWRA 1DDOA 3E6AA 5B37A 2NQTA 1E92A 5IZ4A 3HFSA 2WJPA 4Q3CA 1X13A 1U4SA 1N1EA 5BR7A 4CLOA 1ZJZA 3VH2A 3GT0A 4FPXA 1R6DA 2BMAA 4JLWA 4NNJA 3PYMA 4YQYA 4WECA 2I76A 2Q2QA 1UDBA 1JVBA 1YDEA 5CG1A 4CLRA 2PH5A 1JQBA 2FSVA 4RQUA 3DL2A 1LBEA 1PTJA 2O4CA 4HX5A 4GSKA 5TT0A 4DA9A 4R1TA 1WVGA 4FDAA 5J23A 1DSSG 3HZZA 4NPCA 4E5YA 3DONA 2DVMA 4BNFA 5HRUA 2Y1DA 1PJLA 2PZJA 2Z1MA 4GL4A 5AXBA 3GUYA 3AWDA 1ZH8A 3GEDA 4E6PA 3GVIA 3GNSA 2OXIA 5L95A 2FWMX 4IXTA 5LDHA 1RPNA 5K0ZA 2X5JO 3QWIA 3QVSA 1EVJA 4D46A 4PZCA 3RU7A 3UCEA 4Y9DA 4EDFA 1HDOA 5JYDA 1GZ4A 1DXYA 2YV1A 4JIGA 1P0FA 1JVSA 1MXHA 3PYLA 2C5EA 2FRDA 4XJSA 3IIEA 3LQFA 2WMDA 5T8KA 4M54A 1M2WA 2OBYA 1YXMA 4MVJG 3W8DA 3WJAA 4EUHA 3OIGA 1DAOA 1GZ6A 1PGNA 4FJ0A 4ZJUA 5CPBA 1CWUA 3UFXA 1DB3A 1C1XA 3WQQA 1VC2A 4L4SA 3PTZA 1E5LA 4MKXA 3WMXA 3ZGYA 4E5NA 1I24A 4DMMA 4TVBA 4CMEA 1I3LA 1YOVB 2DLDA 3IJPA 4E21A 1CJCA 3UW3A 4J91A 5F21A 4YJFB 5A5EA 3D1LA 3ZWOA 4Q3EA 4KTVE 3RWBA 4R1NA 5DP2A 2CDCA 1ARZA 3ANNA 4GLLA 4R68A 1U5CA 3RVDA 2IYOA 2VZ9A 1GUYA 4J9VA 1UXHA 3WBBA 1U2DA 3AU8A 4FW8A 4QX6A 1HXHA 2PV7A 2OFPA 1HYHA 4GVLA 3K9QO 5F1PA 3VVBA 1F12A 4DC1A 1SZJG 1H6DA 1EUZA 4LRTB 4PZEA 1Q7BA 3W1VA 3QJ5A 4J43A 4F6CA 1HLPA 5TT1A 1VI2A 4UVDA 3RC2A 1JDJA 3GF4A 3IP3A 5KJCA 3PDJA 5LCXA 2OO5A 1GTMA 1C1XB 3L4SO 5I7SA 1YB1A 3H5RA 4JGBA 4CM8A 1GYRA 3ENNA 5JY1A 2O7SA 3V1YA 2FR0A 4DQUA 5A03A 1YOVA 1A5ZA 2HMVA 5DT9A 4FD3A 5C7LO 2NVBA 1P77A 4MIEA 3RBZA 4CLRB 1XR3A 2G76A 3CMCO 4UAGA 9LDTA 3C7CB 4Z9YA 4A10A 5IFLA 3R0IA 4UREA 2GPTA 3WGZA 1LRLA 2YYYA 2VHYA 3AOEA 3GR6A 3LC7O 1E6UA 1HYGA 1R4MB 1R4NB 2AEFA 3H6KA 3IJRA 3RIHA 4OM8A 3GPIA 4OXYA 3GN2A 3BMCA 2Q99A 4NDNE 4XIJA 1YRLA 4XRRA 1QSGA 2O50A 4I5DA 2OP0A 5U9CA 4NFHA 1K6IA 1N8KA 3I6QA 4RVUA 2ZTVA 3GNTA 4DBVO 1EDOA 4YACA 4JNKA 5IDYA 3EK2A 5G2OA 4CR8A 3M2PA 3TFQA 4CR7A 3OQ6A 3ULKA 3DBLB 3PLRA 5C37A 6LDHA 1UH5A 4BKOA 2OUIA 3IOYA 3KEOA 3D3WA 2AMFA 4E32A 4IJUA 3PGXA 1O89A 2EERA 4RV9A 3RUFA 1LEHA 1UXIA 1GD1O 5T57A 1JWAB 1GR0A 3EHEA 3RUCA 2J5KA 1NX6A 4HFMA 4CM9A 1LSSA 1LDMA 3OA2A 4GAEA 3D7LA 4MPDA 2VCYA 4EJMA 2GLXA 4BB6A 2C54A 2QZZA 4RDIA 3U9LA 3AUSA 4LMRA 2IXAA 3ETGA 3H3JA 9LDBA 2BFPA 4L76A 4IS3A 4O5OA 1ZNQO 2Y1FA 4WLVA 1K6JA 1AHHA 2DUWA 3ROQA 1ZK1A 3DBLA 4R5MA 3ROMA 1YL6A 5A9TA 1KC3A 4MP6A 3F5QA 4JK3A 2J5QA 4EEZA 3GK3A 2O2YA 2BGLA 2PGDA 3HN2A 4TKMA 1QV7A 3LT2A 2C2XA 1YJQA 3R6DA 5F1OA 1QYDA 3HADA 1Q7GA 5MDHA 3K5PA 2AEMA 4ZVVA 1W0CA 4MIOA 4FC7A 5DCYA 1HDYA 1H2HA 4DQVA 3DB2A 5H83A 4J7CA 5GMOA 4HNGA 4ZA2A 1RJWA 1ZSNA 5KVCA 2NACA 1YONA 4ZQHA 1NBOA 2EV9A 3QP9A 4NQZA 4FFOA 5CDTA 2DTEA 3SBOA 1Y8RA 2O23A 1LDBA 3OFSA 2P91A 5T5QA 4LVCA 2AQHA 1O95A 5KJ1A 1PIWA 2DTDA 4ALMA 1AUPA 3H8VA 3JQEA 4PLWA 3WIEA 5EPOA 2ZQYA 3KYBA 2WE7A 2I6TA 2JFFA 2OZPA 1HE3A 3NGLA 5A05A 1E1LA 4ALNA 2JJYA 2YFHA 3HE3A 5JPIA 3H65A 3ONFA 4ND2A 2D1YA 1N9GA 1PJBA 2GO1A 3ONDA 1B15A 3T4XA 1FDSA 3CPSA 3UUWA 4BGIA 1ENPA 3ZHYA 1JLLA 1J4AA 1UR5A 4GX5A 4DYDA 2DPGA 1T2EA 4UVGA 4A26A 3S2FA 3H9UA 3ZWVA 4M89A 1U7TA 5LDGA 3FF4A 4BO4A 2DQ4A 2UDPA 3F4LA 3V8BA 5CEEA 3C3XA 2DBQA 4E30A 2AE2A 3PHJA 3WS7A 4G81A 1LQUA 2WSBA 1PR3A 4L74A 4K26A 4NJMA 4NBWA 5F1KA 1WMAA 2Y99A 4DRYA 1HETA 5IZCC 1UDCA 4R69A 4YRBA 1T4DA 2Q3EA 4LGVA 4RF2A 5G0SA 1IYZA 1I3MA 2RHCA 1E77A 1HDZA 3ZV6A 2UUOA 4EW6A 1MFPA 3LC2O 1LJ8A 3I9NA 3TZCA 4AFNA 4ZD6A 2B37A 3H2SA 3DZGA 2HMSA 3BXXA 4KP7A 5A3JA 3JQ8A 3DOOA 1EE9A 3GHHA 4H16A 2WD7A 4QUKA 4M55A 3WMWA 2PD6A 4KUGA 2I3GA 1IULA 1FF9A 1F8GA 1XYGA 1PL8A 2IZ1A 1ISMA 3VZQA 3LYLA 2B69A 4CL3A 4BNKA 3RJ9A 1JA9A 4FGWA 1X7HA 2FZWA 3W6UA 4TRMA 7ADHA 1YDWA 3RKRA 4CV3A 3EY4A 3TZQA 3OJFA 1EVIA 3CZMA 3KETA 1SB8A 2ZYDA 1KY4A 1DIAA 3M1AA 3WNVA 3IKVA 2CFCA 2P4HX 1FK8A 3L0DA 1DFIA 3PJDA 5KKCA 3LZ6A 3BHIA 1PZEA 2W2KB 5CP8A 3D5QA 5BSHA 5MGBA 4CPDA 3I1JA 1HZZA 2R2GA 5KVVA 1M75A 4K28A 3PRJA 1XDWA 1V3VA 1LDNA 1U4OA 1M6HA 5EIOA 1T2CA 2D3TA 1Y1PA 1U5AA 5ICMA 3MOIA 2BH9A 5KCZA 8LDHA 3VZPA 1GPJA 3K2EA 1YO6A 2H5LA 1V3UA 5CDUA 1DAPA 1GY8A 2QYTA 4IQGA 2IE0A 3JQ7B 1O0SA 1FDWA 5BSGA 3AI1A 2A92A 2IEDA 2HMUA 5B4TA 1ONNA 1LSJA 3UGKA 1LLUA 1RM5A 4OO3A 1ULSA 1L1FA 4J4HA 5DCUA 4E5KA 1CRWG 2D0IA 3F9IA 3QQPA 3VH4A 3EVTA 2W2KA 2YUTA 5AXCA 2P68A 2GZ2A 1PSDA 2I3AA 4JROA 4RVHA 4U5QA 3AFMA 5T8KC 5C5IA 4Y6SA 4WLNA 2EXXA 3V5NA 3OETA 1RWBA 1LU9A 3Q1LA 3HB4X 3DR3A 3FTPA 3VTZA 3GQVA 4BMSA 4E5MA 1LX6A 1LC0A 1E1KA 4QXMA 3H9EO 4CQLA 5TRTA 2P2SA 5DP1A 5IN4A 1C1DA 4P4LA 1HSZA 4ZN6A 2NQ8A 4ILKA 2DC1A 2C07A 5FF9A 3PZBA 2A9FA 1J49A 3E5RA 1DC5A 4YAGA 5A9SA 1NHGA 3M6IA 1Z7BA 4C7KA 3RCBA 1XEAA 2ZB8A 4YB8A 5ITVA 3QIVA 5BSEA 5AOVA 3WLEA 4NK5A 4FOSA 2JFHA 4YJDA 4YBZA 5ITWA 1U3UA 4QO8A 3KXDA 1CERA 2RHRA 1PQWA 1GV1A 4OSOA 5TX7A 1X0XA 4MJLA 2YV3A 3UKOA 1TEHA 3GDOA 5HA5A 1VJ1A 1P3DA 4BNUA 2J3KA 1H94A 4BNYA 2QRJA 3DBRB 3HUDA 4I9HA 2GN9A 3T4EA 4GKBA 4JQCA 3G79A 4I5EA 4B4WA 2C82A 4GWGA 1K6XA 1OFGA 5B1YA 1ENZA 2JAHA 4S3MA 3ZV3A 4QSMA 1ZMOA 4FFLA 2B35A 3EZYA 1X15A 1Q0LA 3WOHA 1ENOA 5JSFA 1X1EA 3NTRA 4XYMA 2D8AA 1U1IA 1OOEA 4E13A 4TSKA 3SC6A 4AJ4A 1PJSA 3AM3A 5EINA 4PLZA 2HAEA 4CM5A 3GGGA 1SAYA 3G1TA 4B3JA 4BQPA 1X7DA 3WX0A 3ZW8A 2C2YA 3A4VA 4XWYA 5KJFA 4K1LA 4B4VA 4LRSB 2BI8A 5TJ9A 3JYOA 2NV6A 2VHVA 4KQWA 2C59A 2VRCD 3TNLA 2I65A 4BKUA 3DZJA 3RKUA 4MIYA 4R4JA 4AJHA 3DBRA 3MJ4A 3DMTA 4B7CA 2A94A 1ISFA 4PLPA 2UAGA 1N7HA 4AJ2A 3BHMA 4DC0A 1C0IA 5CAEA 4N18A 5CDYA 4MVJA 5FEUA 3GPDG 3AOGA 2FPIA 3VOSA 3PQDA 3FR7A 4YAEA 4P38A 5L7TA 4BNWA 1UXKA 4IQ0A 2X7HA 3H2ZA 4R16A 3H7AA 4U7WA 4L4XA 2ZB7A 1PJ2A 3JV7A 5TC4A 1BGVA 3ONEA 4L9RA 4WNCA 4IDEA 1ZXLA 4YT8A 2NVUA 1PS0A 4RCVA 2DM6A 1JU9A 2Q50A 1HZJA 3ABIA 3ICPA 4BNMA 1GPDG 4L0QA 3DC2A 1DJNA 3C8MA 3PXXA 1U9JA 1Z6ZA 2FR1A 3WSVA 5A02A 2VHWA 3CEAA 1HKUA 4H7PA 3UH1A 4IIVA 1YBMA 1RKXA 3RUDA 1S7CA 1KVQA 2CSUA 3ZHXA 4I9UA 1A7KA 1X0VA 1Q7CA 1E6WA 4BNHA 3L4BC 4P22A 3TJRA 1LLDA 5JAZA 1T1RA 2D2IA 4WASA 4JP2A 3P19A 2JKVA 4CMAA 4IDFA 3VPXA 3K92A 3KSZO 2XXJA 4PG8A 3W4IA 4FOOA 2EP7A 1KVTA 4MVJE 3V2GA 3H9GA 2OHXA 1GUFA 3KTDA 4WCDA 1YGYA 3MJCA 4XQ9A 3RUHA 3TFOA 3GA0A 3VKUA 4JJFA 4OYRA 1MB4A 2WYVA 2X5KO 5A1TA 2R6JA 4UUPA 1GEEA 1LNQA 3GG9A 1WW8A 2R00A 1UP7A 4JBIA 4GKVA 3I83A 4MO2A 1ZK3A 5JE8A 2WYWA 4BKQA 1YBVA 2EW2A 5A9SB 4J49A 3H9QA 4IZIA 3O9ZA 4DIOA 1ZVMA 1YBAA 1Z73A 4AJLA 4KWIA 4BV8A 2V7PA 2NVWA 1DIHA 2O3SA 1P74A 3BMCB 1T2DA 2ZTUA 3JQAA 1M76A 3BMOB 1NM5A 1KOLA 1XSEA 2BHLA 1AGNA 2UYYA 3FWNA 4FCCA 4AJPA 1E1NA 4HFRA 1EQ2A 4IY1A 2VNSA 1G0NA 4M87A 2RH4A 3DDNA 4I5GA 2Q1SA 3MJTA 4RF4A 2FN7A 1R4MA 1ULUA 1MLDA 2WE8A 2ZB3A 2HU2A 2IYPA 4YJFA 2IEBA 3KBOA 3E9NA 1NHWA 3WGTA 3GHYA 4CM8B 5IDXA 3I9OA 1Q1NA 1F14A 3IC5A 3WTBA 4BO1A 1X1TA 4YXFA 3E1KA 1WWKA 1T4BA 5THQA 2VYNA 2ZK7A 2V6GA 4FFNA 5GY7A 2P4QA 1KETA 4URFA 5LC1A 4RDHA 4Z6KA 4YWJA 2P9EA 1NAHA 2PR2A 4PZDA 2VUUA 1I30A 3JQCA 1VKNA 2AXQA 1ADCA 1IHXA 4CMHA 1XELA 4O6VA 3EDMA 2PWZA 4IGEA 3RC9A 3T7EA 4HBGA 4JXKA 5TIIA 5CG2A 3ZV4A 2J5RA 4Q39A 3S2GA 2PKQP 1ZKMA 5L51A 3AI3A 4PG5A 4J6FA 4LN1A 2DT5A 3KEQA 3WGIA 4JP3A 2P9CA 1R66A 3INGA 3TOZA 3KZVA 3CXRA 1PZGA 3I9LA 1BTOA 3PJFA 3FNGA 4FQ8A 4CMJA 2A4KA 3PJGA 2YQ5A 4CLOB 1I2ZA 1PZFA 4L75A 1Z45A 5A06A 3I4FA 1OC4A 2PKQO 2YY7A 4MKRA 2QRKA 2ZYAA 4ZQBA 1K0UA 4HNHA 4LW8A 5GZ6A 1PS8A 3C1AA 2G1UA 3QA9A 1AE1A 4FS3A 4GBJA 3NEPX 1DC4A 1NFQA 4U0JA 1JKIA 5EESA 3F47A 5ER9A 3O8QA 1C0LA 3DWFA 2G82A 1Y8QB 5KTKA 4XGNA 1JWBB 4XYGA 3DOCA 1K5HA 3G49A 3U4DA 4WLFA 2BLLA 3I9JA 4QT0A 3QVOA 1EBFA 3VDQA 2X58A 4F46A 3ORFA 3NYWA 4WCFC 1PWXA 2QW8A 1PQUA 3BMQB 3MJVA 4BVAA 1QYCA 3CSDA 3C1TA 3AK4A 3OA0A 4HV4A 2CVQA 7MDHA 1HRDA 1H93A 2R00C 3BTSA 1MA0A 1E3WA 4UUOA 5B12A 1BMDA 2PTGA 4PLTA 3NTQA 1U2GA 1NVTA 2D59A 3V2HA 4R01A 1O8CA 1DFGA 3ZWYA 2BKAA 1WDLA 4XQGA 4XCVA 2YHUA 3WGGA 4XRGA 1SO8A 1H5QA 5EMHA 1EVZA 3GN1A 1N92A 5ES3A 4PLVA 4FJ2A 4CMIB 1D3AA 1QYVA 2X4GA 4HP8A 1U8XX 1NFFA 4PVDA 1Y9EA 3L07A 4DIBA 1DJQA 1JW9B 4FSHA 3MWEB 1OZAA 1EBUA 3R1IA 1T2FA 3R3SA 4EI2A 2FR8A 2EKPA 2UUPA 1JKFA 3JQBA 1RM4A 3LK7A 1CDOA 3RQSA 4BO6A 3NJ4A 3ZNPA 2JD1A 1UXJA 4G65A 1YJ8A 3IDSA 3T7CA 3GFBA 1XIVA 5JO0A 1QXSA 2C20A 3RJ5A 4DGSA 3ZWBA 3NDRA 5CEFA 3L9WA 3R3JA 3NT2A 4MP8A 5ER6A 4OIMA 3ETDA 1B3BA 2WD8A 3A9WA 4MVJH 4JJGA 5EQFA 2NU8A 4A27A 3FNHA 5L45A 1P1JA 4FR5A 2XOXA 1ZSVA 2X6TA 1FXSA 3G0OA 4XR4A 4WGGA 3GY0A 4O1MA 4IPTA 4TVOA 4J3FA 3CUKA 5JAIA 3GVXA 5COQA 3RBVA 4CR6A 1R37A 3UOGA 3TSCA 1UAYA 4K6CA 3F3SA 3PGJA 1JAYA 3UF0A 5DNAA 5K6AA 1R4NA 2GF2A 1E1MA 4ZRNA 2ZIZA 1A71A 4OGWA 1NASA 4E33A 3ICCA 2QHXA 1ZEJA 3I4CA 3LF1A 3L6OO 3TOXA 1C14A 2GNAA 3VTFA 1TT5A 1IE3A 4CMCA 3VPFA 1M6WA 4BMNA 2X0RA 1QKIA 1J0XO 1KVRA 1YH3A 2BI7A 2CF6A 3KYCA 4FFRA 1DC6A 5L4NA 3H4VA 4QFDA 1Y7TA 4K6FA 4OOEA 4P4GA 4E4YA 3JQ8B 5IAAA 1MUUA 1WXDA 1LTHR 2HRBA 2XPCA 4J9UE 1ZCJA 2G5CA 2HMWA 3CZRA 2VNAA 4HKTA 3UN1A 4CQMA 1QV6A 1KVSA 4BHTA 2Q4EA 2Q4BA 5TLSA 3BTVA 4HFNA 4CJXA 3VC7A 2EW8A 1YVEI 2CDAA 2PZMA 4XR9A 2CVOA 3D3WB 2P5UA 3JCZA 3QY9A 3ZNQA 3GVCA 3MJSA 4J1SA 6ADHA 2QX7A 4NG5A 1XQ6A 1A27A 4GMFA 1EK6A 4Z3DA 2EF1A 3AU9A 4JBHA 4NZ9A 3M1LA 3HDQA 5IJZA 3OQ1A 4Z0HO 3D4PA 1VKOA 3MWDB 1IZ0A 3BTOA 1Y9AA 2BFOA 2J8ZA 4Z0TA 4R9RA 1WPQA 2HJRA 1J5PA 2J6IA 1XHLA 3WFJA 3SC4A 3VVCA 4RQTA 4WEQA 2HO5A 5FFFA 3PP8A 4RVFA 3IQDB 2O48X 1B2LA 1EEHA 2Y67A 2YQ4A 4P4NA 4MVJP 1W8DA 1LSOA 4J4TA 3OJEA 2BD0A 2WYUA 1XQ1A 3LT0A 1N1GA 1TA4A 4PFJA 3DFUA 1ZK4A 3KOUA 5JLAA 1RM0A 3B6ZA 3U4IA 2J3JA 2YW9A 4YT2A 4B4OA 1QP8A 4DLBA 2AQKA 4E2XA 4BUCA 1X7GA 3WWZA 5L7YA 4M1QA 3NUGA 3K6JA 3ZWCA 1VSVA 2WEKA 4YR9A 2B0JA 1P1KA 1ONOA 1RM3A 3HDJA 5G0UA 3S1LA 4FFMA 4BQRA 4PG4A 3X2EA 4QEDA 3ZH2A 1JAXA 4D79A 2X22A 1IHYA 4KWHA 4PLYA 3ENKA 2XAAA 4NJOA 3Q2KA 3PEFA 3U49A 3BMNB 2V6BA 3E82A 3UICA 3CE6A 1PL7A 1XU7A 5GZ3A 3MCVA 2X9VA 2O2SA 3WNQA 3LLSA 2XF8A 4BKPA 4MINA 4LVUA 4UUMA 4B4UA 4E31A 4CUJA 4ZGWA 1XG5A 1WAMA 1ZZEA 3D3EA 1UAGA 3Q0EA 1VE9A 3B1FA 4Y98A 1DRWA 1OC2A 2HQ1A 3ZWPA 1AXGA 4A2CA 4D45A 2YJZA 1NP3A 3AJRA 1T26A 4FBGA 1O94A 3PPIA 2GN8A 4QFCA 3WGOA 4DQXA 1E7MA 3DQPA 2GZ3A 1H6CA 2X0JA 3RU9A 4CV1A 3UHAA 1FDUA 5DDIP 2Q45A 5FI3A 3A14A 4ROSA 2Z95A 4Q3NA 3RC7A 4M86A 4C7JA 3VPGA 3ZHZA 4EYEA 2NM0A 4MOWA 5BQFA 4E2WA 1DIBA 5G4LA 1ZSYA 3HSKA 3DEYX 4OMUA 2VZ0A 1UZMA 5JBIA 1TI7A 4WCFA 3RAJA 1ZMTA 1BXGB 2FY8A 1A4IA 3HG7A 2EKLA 3NGXA 2PH3A 4CODB 3UCFA 1LI4A 4BO5A 1C0KA 1SEVA 2E37A 4ALLA 1KIFA 2IODA 1PGPA 1EVYA 4OKNA 2GASA 2NVUB 1SNYA 3D4NA 3E9QA 3TPCA 1TT7A 4H3VA 1KEPA 4AVYA 2IZZA 1GEGA 3EUWA 1HE5A 1CEQA 1KS9A 4CUKA 2LDBA 3DHEA 1AHIA 1BVRA 3FCOA 4P8RA 3VPHA 2VWHA 1H2BA 1AN9A 3BMNA 1YQDA 4KMSA 1TXGA 2HKIA 2NSDA 3WQSB 5BNIA 4Y6RA 2Y68A 4RJTA 4MVJD 3W8FA 3AUTA 3QVTA 2W98A 1PJQA 2LDXA 2DBZA 4FGSA 4B8ZA 3MTGA 4DIFA 5CFZA 5IXYA 4DWVA 4FN4A 4CL8A 3OECA 1OMOA 3GH3A 1QORA 1UP4A 1W4ZA 4BIIA 3FNEA 1LC3A 3ZW9A 4NBVA 1EK5A 1HF3A 5JYEA 1QRRA 1SOVA 1ZEMA 3TZKA 1G6KA 4CM3A 4OKIA 2NUAA 1EUCA 3LF2A 4IMRA 3HNPA 4RZHA 2ZJ0A 1BVUA 4J7UA 4RF5A 2PD4A 4NFSA 1KVUA 4RPHA 1S6YA 1GQ2A 2CNBA 3SJUA 1K3TA 4MVJI 4ZQEA 1CQJA 5I7FA 4I1IA 2YDXA 3JD2A 4CQMD 1LLQA 2HMTA 4E5PA 4BNNA 1KEVA 3DZIA 4CLEA 1IZ9A 4TRJA 4YJHA 5ILOA 1GUZA 1ZK0A 1J6UA 4IDGA 5BT9A 4EGFA 2EGGA 5JCJA 3F46A 2ZKLA 2NTVA 4NFYA 4PLFA 3PI7A 3DZBA 4BL5A 1I8TA 2PZKA 4II3A 4YRDA 1PGQA 3O38A 3I9KA 3JTMA 3DAGA 3F4BA 4LSMA 5KNLA 1HWYA 5KJEA 2HJSA 5JY6A 2O4UX 3VAZA 1ZW1A 4BNGA 3CH6A 3COSA 3PFWO 5K6AC 1XCBA 4IDBA 5JMWA 4D3DA 2CDBA 4XYLA 4D7AA 1YKFA 2JD2A 2HRZA 1UZLA 2OOSA 2VWQA 2Y0EA 3WLFA 4DL9A 2PGJA 4NU6A 2CUKA 5ILGA 1QG6A 5U4QA 1NQAO 2H9IA 4GX1A 1WLYA 4HUJA 2Y66A 3K8ZA 4RPKA 4TRRA 4E12A 2H63A 1TLTA 1Y81A 1NPTO 3WG9A 5JAQA 3WQRA 4J2HA 4XYEA 4WE3A 1VPDA 1GL3A 4EITA 2I5PO 4D42A 2VHZA 1CIVA 3NDIA 4AJEA 2Z5LA 1GAEO 2VWPA 1IPFA 4NBRA 3ZU4A 5C7OO 5F5NA 4GQAA 4L4RA 3DMTC 3LLVA 3A06A 3BTUA 5L4LA 3I52A 2W2LD 3H3FA 3JQBC 4MP3A 1ORRA 4W82A 2CD9A 3O4RA 4NR0A 3P7MA 3OSUA 2VUTA 2RAFA 1I2BA 1E0DA 4MVJM 1QLJA 1VL8A 1LDEA 4UEOA 3D5TA 4RVDA 4DBZA 2NLOA 1HE4A 1NYTA 3TRIA 4KQXA 3KRTA 2ZCUA 4LCJA 1I01A 5L53A 1I36A 1F0YA 4UVIA 5L9AA 2EHDA 1O9BA 3KB6A 4AL4A 1QYXA 2P5YA 2YZ7A 4ND3A 4CV0A 2ZTMA 1NNUA 1ADBA 5JCJD 2Y0CA 1HLDA 2RCYA 1TT5B 1RYDA 3KVOA 3Q9NA 2X9NA 4I5FA 3JQGA 3TZHA 3IS3A 4ITUA 2W8ZA 2X8LA 3ZWWA 3ASVA 1ADGA 1C0PA 4RL6A 2VHXA 3OHSX 5I7EA 3NV9A 4A0SA 1P44A 1RYEA 3EZLA 3RD5A 5BNTA 3GVPA 3N58A 3V1TC 4YT4A 2XXBA 4ID9A 3D0OA 3I23A 1DHTA 4YJGA 1O5IA 3FPLA 1C3VA 1ID1A 4XYBA 5U1PA 3SVTA 1NR7A 4PLGA 1UZNA 3UVEA 4EUEA 3B1KA 1PWZA 5CDSA 5EQDA 5FWNA 3KYCB 3IMFA 5L3ZA 2NU7A 3I9MA 3LU1A 5G0WA 5L4SA 2C0CA 1LA2A 4J0FA 2EP5A 1E5QA 4WEOA 3WR5A 2DU8A 4D44A 2CY0A 4NHEA 3ITDA 1DRUA 2PLAA 2JHGA 5JC1A 1Y8RB 4GH5A 2B36A 3WFIA 1ZXBA 3C7AA 4R1SA 3GFGA 5JXWA 2Y93A 4LSWA 3S2EA 1DFHA 2C7GA 3L6EA 1D1TA 4J16A 1PGJA 5I8ZA 1ZBQA 3AM4A 2I99A 1I2CA 4N5MA 1ZIDA 2BRUA 4OOFA 2Q2VA 1NTOA 1VM6A 3OIDA 4B3IA 4G5HA 3VDRA 2QIOA 3PHHA 3DXFA 4BNZA 1SC6A 3W8EA 3X2FA 4YAIA 2FP4A 4YAJA 3B70A 5JCXA 3FSRA 3K96A 1MG5A 1B26A 4Z0PA 2FMUA 4XDYA 1Y6JA 1YE3A 3OJOA 3QVWA 1LRJA 3LC1O 2VOEA 5B4UA 1JN0A 1VLLA 4BO8A 1EE2A 2W90A 3EYWA 1HDGO 3FNFA 3EVNA 2Y1GA 1SBYA 2BFAA 4C4OA 1HDCA 3QW2A 4N5LA 4YEDA 4IZHA 1LDYA 3FI9A 1BDBA 3QWAA 1NPYA 2Q1TA 2EIHA 1ISHA 5H82A 5I9LA 3RFXA 3E9MA 2AE1A 1Z82A 4PLCA 2VTDA 2AQIA 3AY3A 2B83A 3BZUA 1GQYA 5ENDA 2D4AA 3C7DB 4HADA 5G0TA 4GX2A 2Q49A 3GZNA 5L40A 3PWZA 4FFPA 2GN4A 2VTEA 1BRMA 3DO5A 3ZWMA 3QE3A 1P0CA 5TF4A 4IM7A 5COBA 4INAA 4NBUA 3DAFA 3I5MA 4JBGA 1R0LA 4R1UA 3HWRA 4XD2A 3AY7A 4ND4A 4DYVA 1A9ZA 4TQGA 1WMBA 1YL5A 2TMGA 2ET6A 1GDHA 1OBFO 2X1HA 3HFGA 2ZCVA 4PRLA 4AJNA 1FJHA 1R15A 5T67A 1T2AA 4Q9NA 4RPLA 3OF2A 1HTBA 4DLAA 2IZ0A 4CUZA 5JMPA 5IDQA 1ISJA 4FC6A 4NMHA 3SEFA 4AICA 2ZYGA 4CM9D 2AW5A 5COAA 3ZN2A 3VH1A 2PY6A 3MJEA 2NWQA 4GMGA 4DREA 1E3SA 5EERA 3Q6IA 1LSUA 3U3XA 3MZ0A 5C7IO 1V0JA 3GC6A 1XLTA 1MG0A 4WLUA 3TZ6A 1NQTA 1I33A 1WP4A 2Y05A 3G3EA 1HE2A 4OJNA 3ETEA 5BNFA 3PYXA 3WYCA 1PX0A 2TMDA 2AEJA 3JYNA 1VL6A 4ZQFA 3QLJA 4II2A 5DOZA 4IINA 4Z9XA 2J3HA 1C1DB 4OH1A 2NNLD 3MOGA 4FJ1A 3GVHA 4WOKA 3AUUA 4AJ1A 4BGUA 2Y1OA 4D0RA 1ENYA 1QR6A 3JQFA 4LMPA 4IJKA 2GGSA 4RGBA 5A9RA 4CM7A 3Q2IA 2DKNA 3JQDA 4CLHA 3G17A 4J1NA 2PKRA 1KC1A 4WK6A 2VUSA 4XZ3A 3FD8A 3HDHA 1ZFNA 1IPEA 3O03A 3K31A 1IOLA 1V9LA 3VHRA 2FOIA 3DHNA 4ND1A 1NAIA 1LDGA 2G0TA 4UVHA 3ZDFA 4HXYA 3C24A 3JD3A 4RPJA 4BO0A 3EGOA 3HN7A 3ST7A 4BV9A 3NT5A 3RBXA 4WUVA 3KM0A 1E3WB 5JDIA 4R3NA 1LQTA 2FPGA 3KSDO 3PDUA 3L6DA 1N2SA 2O3TA 3ZI0A 1I3NA 4HY3A 4NBTA 2BFMA 1V8BA 2ZQZA 2GDZA 4MKZA 1NWCA 4OQYA 5DBFA 2EEZA 2X0NA 3UXYA 3GDFA 4BO2A 4U0KA 4Y8VA 2QRLA 5T64A 2G17A 3A1NA 3E8XA 3Q9UA 4OSPA 3KO8A 3OEWA 1NQOA 1HEUA 2RH8A 4XJTA 1U8FO 2X0IA 3PVZA 4GGPA 1NFRA 4RPGA 4BO7A 2P9GA 2VZ8A 1FDTA 2YV2A 4EEXA 1R16A 1N5DA 3KUXA 5CHEA 1U3TA 1ZO8A 2OMEA 3EW7A 3MEQA 4YCAA 3OJ0A 1ADFA 5JDCC 1GFSA 1N7GA 2DFVA 5G0VA 4D41A 2NU6A 3Q11A 1EUDA 2E82A 3PWSA 4XA8A 4Q3AA 3RFTA 3SXPA 3PIDA 1E7RA 1WZEA 3DTYA 4BOYA 4PCVA 5DOVA 3RSHA 1B16A 3K30A 4E2YA 2JD0A 1Z74A 5JS6A 3BHJA 2HUNA 2FSSA 4GX0A 2F1KA 3NDJA 1ISIA 3JQ9A 1GYPA 4HWKA 2I9PA 4U6QA 1BW9B 3V2UA 1LRKA 3GEGA 4BGVA 1N9GB 2H1SA 2GERA 1MFZA 4Y67A 5IN5A 1Q0HA 3OJLA 5AQ1A 5K9ZA 1CYDA 4XGIA 2VRBA 3ZV5A 3V1UA 5JDCA 3FTNA 3U09A 5G4KB 4DMLA 4DVJA 3ZWAA 2DUUA 1B14A 3ZWNA 3H9JA 4IIUA 2B4QA 2VOJA 2WD7B 2CMDA 4PIVA 1IY8A 1PZHA 1WZIA 4F3YA 1XKQA 1W73A 2JCYA 2VT3A 3W6ZA 2QYSA 1QLHA 4EJ0A 3A28A 3GAFA 4YVFA 3ZU5A 2ZTLA 3L9XA 5L7WA 1F8FA 4J1TA 4B3HA 3I3OA 5DZSA 3NAQA 2ZATA 3OH8A 1YWGO 3WGYA 3OM9A 4O59O 1T25A 3P2OA 2JFGA 3GGOA 3VZSA 4DPLA 1D8AA 3CMMA 3FBTA 4YDRA 3AUAA 3PHLA 1NQ5A 2Q46A 2Q1UA 1P33A 4I08A 5JC8A 4YTEA 3PK0A 1GZ3A 4B79A 3QSGA 3M2TA 3LSYA 4B7UA 1MC4A 2CF5A 3KLPX 5CPFA 3QWBA 4GGOA 4D3FA 4XKJA 4S1VA 1L7DA 5KWEA 2GZ1A 1HDXA 1UXGA 5KJ6A 3TL2A 5TJHA 3FN4A 4XDZA 3GGPA 5ICSA 3JD0A 3BMOA 2VT2A 3FBGA 4TMFA 4QECA 3PWKA 3WICA 4L8VA 2VQ3A 3WGQA 5JFOA 4XIYA 1B8UA 4CM6A 4YJHB 4BNJA 1ZJYA 4J1QA 4QQRA 4CMIA 3PJEA 3OIFA 5IG2A 2B4TO 3WJ7A 4Z3KA 1NPDA 4PN3A 1FDVA 2Y1CA 5I8WA 4CQLB 1GADO 5DBIA 1JKJA 4O63O 5A5FA 5KIAA 4NJMB 3JQ9C 3TN7A 2FHSA 4YRAA 1BXKA 2VYVA 3D64A 4TKLA 3FWZA 3CINA 3GZ4A 5G4KA 4BNVA 1VL0A 5JW6A 1HL3A 3DAPA 4LK3A 5HTOA 3G1UA 1PJ3A 1VRWA 1WDMA 1R12A 5F5LA 3U4CA 1NVMB 3ANLA 3WXBA 1NR1A 1ZK2A 2AHRA 4XGKA 3FR8A 4K9DA 4W6ZA 3WIDA 3MTJA 3JD1A 1YL7A 4TRNA 1Z75A 4ALIA 1DIRA 3RASA 3WSWA 1IL0A 1BXGA 4D43A 3CTMA 5FYDA 3UCXA 1PGOA 4JN6B 1Z7EA 5IF3A 3GMSA 3JQGB 4BO9A 2OORA 3L77A 3GAZA 4B7XA 3ITKA 1E3IA 2Y1EA 2DBRA 1A4UA 2O3QA 1TB4A 4U6SA 4JJIA 2VYND 4AJIA 1GV0A 3F1LA 4J2OA 4MVJF 3FRJA 3E48A 3ZNNA 4IUYA 4NIMA 1E7YA 2V6MA 4RLSA 3TWOA 3IL2A 4A03A 5AXAA 4RORA 4EUFA 5A3VA 1E3EA 4UUNA 5JDIC 4AJJA 3DOJA 1ISGA 1V35A 2B5WA 1NVGA 1I3KA 3PLNA 2GN6A 1WDKA 1E7SA 4AJOA 2VN8A 4QO7A 1NXQA 3RI3A 1XU9A 5I9NA 4PGFA 5HS6A 3DZKA 3C1OA 1Y8QA 4GLOA 4IDDA 3P5SA 1D4FA 3GZNB 4LCEA 4PVCA 4Q3DA 3BA1A 3JSAA 3WB9A 4A73A 4TZKA 4BB5A 2JCVA 3KV3O 4WCFB 2CVZA 1P1HA 1MV8A 4YYZA 1Y5RA 1BXZA 3OP4A 4IBOA 1B8VA 5IDWA 4CMEC 3F6YA 2X5OA 3JQAD 2YFQA 3BMQA 1OI7A 2J3IA 1KBZA 4XEHA 3RROA 1DPGA 1YQGA 3AY6A 3DMYA 5HM8A 3JQ6A 2GYYA 1A7AA 4XX0A 3TDKA 4UVEA 5TGDA 4CV2A 4JCOA 2DBVO 1SCUA 3U0BA 4Y6PA 2OP1A 3HHPA 1I5RA 2NADA 3IUPA 1HSOA 1KEWA 2ZB4A 1BDMA 1MC5A 5KOIA 2JCXA 4IGFA 3VKVA 3GNQA 3I6IA 2GUGA 4D0SA 3STHA 4IXWA 4BGEA 2CZCA 5H81A 1E7WA 3VH3A 4CLXA 1GCOA 3NT4A 4DLLA 2AA3A 4IDCA 3OQBA 3B1JA 4BNXA 1PQPA 1Q2XA 1ZUD1 1EZ4A 5JAMA 2F00A 3IAHA 1KY5A 1UP6A 1DO8A 1MXFA 3INTA 4EBFA 2HK7A 4F45A 4ZQGA 1K89A 2IXBA 3C85A 4JX8A 1I10A 5T6BA 3SX2A 8ADHA 1XA0A 3W4KA 4IS2A 3AM5A 1F06A 1TVEA 2SCUA 1NWHA 1DOHA 4GSLA 2HLPA 4GWKA 5FI5A 5A4DA 1YB4A 3O8QB 4KZPA 2PFGA 2VRCA 4MDHA 1BHSA 1P45A 3E03A 4W9NA 1H6BA 3BIOA 3EC7A 3GDGA 4EJ6A 3NTOA 3ZU2A 5AVOA 3NJ8A 1DLJA 3IKTA 3SJ7A 2GCGA 4XB2A 4IQ8A 3WGHA 4BKRA 1PJCA 3F1KA 4E3ZA 4OXNA 3EMKA 3JYPA 1D1SA 2WM3A 2PZLA 2QQ5A 2V6FA 3CIFA 3B20A 3ASUA 5DN9A 3W4JA 1CF2O 4FIZA 1DLIA 2D5CA 1U7HA 2O3RA 5C3MA 1EFLA 2PK3A 4I8XA 2E6UX 3PHGA 5CEJA 1PJ4A 3GRPA 4DPMA 1T24A 4ZHSA 3U5TA 4OHUA 4CQMB 2O3JA 3ROKA 3QRWA 4M49A 1CETA 3D4OA 3KYDB 3E5MA 4ND5A 2UV8A 3NKLA 4D3SA 3N74A 4KOAA 5GZ1A 2E48A 3HJAA 4RLHA 4OXKA 4E2ZA 4ALKA 1A72A 5TS3A 1H6AA 4GPD1 2YHIB 3JQ7A 4EZBA 3ZZNA 1D7OA 2EGHA 1SEPA 2C5AA 1DBVO 3NRCA 3GEMA 2FPPA 3RUIA 3GLQA 3WYEA 4I9NA 4ONEA 3U62A 3E18A 1GYQA 3AFNA 2BGMA 1Y5MA
chains in the Genus database with same CATH superfamily
1ZISA 1ND5A 5AYVA 3SD7A 4BCBA 3ADPA 1TCBA 1N6KA 4KITB 5KSOA 1GZHB 3T1YB 4PX5A 1TCCA 1DJOA 4FE7A 1NUTA 3H19A 2PGNA 4FR0A 1BA2A 2ODAA 2PWYA 2RIRA 3EQ2A 1Q74A 4RVSA 5CJPA 5BT8A 2W2VA 2OQ2A 2ZE6A 4J8PA 4QWWA 1Y7LA 1U90A 4AKIA 1SCQA 3MS7A 1MB2A 3NX4A 1SBIA 1UQTA 4FHZA 5KEIA 1SC9A 1XPJA 2D2XA 2ZJ2A 4HQNA 4OXIA 2E49A 3ZDYB 5CFLA 2PIAA 3EZ6A 3MELA 4PC6A 1S2IA 4GVPA 3GB9A 621PA 3JQAB 5H0IA 4J4BA 1KEUA 1GP2A 3L7YA 1A4RA 5BV0A 2UZ1A 1CDDA 1MX1A 3LT1A 2PO5A 2AQ8A 1C29B 3P52A 4YDSA 4EHIA 4DDWA 3J7AC 4ILEA 1VMDA 3T94A 1LWNA 1B0AA 3A1TA 4H60A 3CWCA 4KG7A 4BB0A 4BFSA 1RP7A 3P96A 4WQMA 5EAIA 4AG3A 3W5AA 3GLRA 2EJVA 1SRRA 1ZN9A 5DHAA 2WBLC 5LP6A 1XZJA 4RXUA 3SLGA 4L3VA 4HYQA 1FTGA 3OBIA 2UU9B 2IOYA 2PRJA 1XEXA 4IKEA 3H13A 1U0RA 3K73O 1CRQA 4WNYA 1X6VA 4W4TA 3AW9A 4R51A 3DL4A 4DCOA 3IULA 5IAKA 1U8UA 1N33B 2DWUA 1NBWB 1MJFA 2XQVA 2XYGA 1C8KA 1G1AA 2HCTA 2JASA 1LBTA 1XJWA 2O7QA 4PN7A 1ZONA 1WXWA 2WFZA 5EYPA 1UJ6A 1DEHA 3TLAA 4WFKA 4CYMA 2PNFA 3AOEC 4HN4B 2ZRHA 3C97A 2Q3CA 1ORWA 1Z5ZA 2ZS8A 3U7QA 1MOSA 4B33A 5B36A 4Q19A 1D6SA 3UT5A 2HDHA 3P94A 2ZI6A 3KG2A 4CU2A 3AR5A 4X3PA 1SKAA 1TRKA 4B2LA 5JVDA 5KQLA 2JFWA 4K9MA 1ESZA 1GKLA 4GXNA 3AEQB 2JAPA 4LZNA 2QTAA 5AWFC 4HRAA 4K86A 3QWHA 1C8VB 2NO5A 4ZQIA 1A5AB 3HBFA 4YXWA 5M34A 4YJGB 3CU5A 3A31A 1L7BA 1TCVA 4G4IA 4B17A 3PFFA 4PRZA 3FKSD 1Z0KA 1Q0QA 1U8AA 2GEDA 1GZDA 5IUJC 1V2HE 4EHJA 3QNWA 3LP5A 2QEQA 4QYIA 2Q6OA 4IO0A 2WUWE 1ZIYA 3L8ZA 4FMPA 2PJDA 4RF3A 4LF7B 1SQ5A 3MTDA 4QRIA 3E7WA 1W94A 2QGZA 4NMMA 1NRWA 1P81A 2X2OA 2NYUA 3N7UA 3UT6A 3CKYA 5L6LB 1KE1A 3LT5A 5J5AA 2EG9A 1NP7A 3D3QA 2XXAB 4QDTA 2HSDA 4YMSA 1E3JA 3DV9A 3WGKA 3BRQA 3CRNA 3PNSA 4WSOA 4OREX 3MGGA 5IXSA 4B3DA 4I19A 4UULA 3NTUA 3SLKA 3A1SA 1Z28A 3RYFB 1ZGAA 2AG8A 1U3VA 3LSTA 4M8SA 2NU9A 1I6LA 4U4AA 4W7HA 4L9SA 2J7PA 3OIYA 4JU9A 2AD1A 3ZUPA 1TZCA 5IAEA 3II6X 1XPOA 1VSUA 1A9YA 3KSBC 2AOTB 4QODA 2E5FA 3HZOA 1RKBA 4WZ6A 4BQEA 1QO0A 1VCIA 4DARA 1XL1A 2GYVA 5A62A 3LT4A 3MWKA 2V7TA 2IHYA 3TSOA 1MJGA 1V3TA 4LRXA 3TB4A 2B4RO 1M67A 1SB9A 1QWSA 2PLWA 3TMAA 4ESOA 1RAFA 1XBTA 5EIFA 4YAKA 4YQZA 3OO0A 3GLHA 3JY6A 1PV2A 3S1AB 4Z7NB 1I4WA 1FS4A 3I28A 3VDXA 1E8DA 2GYUA 2DQZA 5IEBA 1NNLA 4DMUB 1RXWA 1J25A 3L4BA 1I32A 3NTLA 5IKMA 1PU2A 5TGTA 3DFZA 4C3ZA 4DNOA 2V3WA 4C2AA 4F3RA 2QX9A 5LB4A 4RU1A 3TJZA 2WKPA 1QYWA 5TNXA 4AN0A 2FPLA 3FYUB 5SZIA 3DBVO 4ZRMA 4DLZA 4F6RB 1ZL2A 1Q19A 3M5WA 5IFKA 1HDRA 1NLFA 2AWOA 3D6UA 3OE1A 3OMLA 1OU0A 2P4UA 4X54A 1CY0A 1BW9A 1RKVA 1UL1X 4JI3B 2JI4A 1U28A 2GHQA 4KFUA 4Y1FA 1RPJA 1W88B 2ZRQA 3QHAA 3HJGA 4R2LA 4XWGA 3KHKA 1PJTA 3FWKA 5AI9A 3TQHA 2E6KA 1QE3A 1BG6A 1RKQA 4PG6A 1EJBA 3WYBA 1V1MA 3LXUX 3NVMB 5ELLA 4TWRA 2AXPA 4QPNA 3WL3A 2R97A 4KQ1A 2MYUA 3LVQE 3M4YA 2H07A 3DT8A 3LVBA 1HT0A 3F96A 2O2JA 2OGUA 1E7QA 4GI2A 1E6EA 1KU0A 4LV5B 1DIGA 3K94A 4R2IA 3MVEA 3QOYA 4H35A 4HSEA 4LHVA 5IRCD 4AK9A 1G8SA 1EGMB 1NRXA 3F7MA 1T3GA 1NXTA 1XTKA 1ZX1A 2IUFA 2OV3A 3QVXA 4QD3A 5AP9A 4IF4A 3LV8A 3DBHB 2F1IA 3EJ6A 2E4VA 5BWNA 2B4AA 1OAAA 1GL6A 1ZIOA 1XVLA 1C9YA 1SQ6A 1GPKA 2EX0A 2LNDA 3NATA 4JBWA 1JIJA 3T5TA 2VUIB 3IUEA 4YI5A 4BMVA 3GZJA 4LXHA 2WTBA 1QDEA 4TKZA 3PRHA 2P75A 2CMKA 3CCBA 3NRBA 3TLXA 2ZLBA 1LF5A 1V11A 4CIVA 2X3FA 2WV9A 4S2EA 5E0KB 1U8EA 4J2TA 1B74A 2VSFA 1EGQA 1T4GA 3PIIA 3WWEA 2XDWA 4EG3A 2JANA 4ZP1A 1AC5A 1O95D 2BLNA 2PHZA 1H4VB 4TSFD 4UJ3A 4UEJA 1J9GA 3SIRA 4X64B 4BYGA 1L7EA 1KJIA 3V9AA 3B13B 5TPZA 3MG9A 4YREA 1T3TA 1YBHA 4N5NA 2GR9A 3CUTA 4BNIA 2F43B 1OHHA 1XLWA 1RAAA 1GL9B 1SZCA 2AKAB 2QLJA 5ECGC 2W58A 2A9KA 1UDAA 2C88A 1PEKE 3HUFA 2YIDA 4PNPA 3O4GA 4UU0A 2GD1O 2XGSA 1GUAA 2XYQA 2J08A 4D4IA 5IUKC 4Z4GA 4OAQA 5DLYA 2Z8YM 2HHHB 5EL0A 2FEOA 2NPOA 1WCWA 4G3XA 5TS2A 4GO1A 4L9WA 1F6DA 1VL2A 3IA7A 4KNWA 3OICA 5JYCA 5KC8A 3DTVB 2VS1A 4PF1A 3ZPXA 2WILA 3E6AA 3KJZA 3TQCA 2NQTA 5HKOA 3ER6A 5IKEA 5IVPA 1YDHA 3L43A 4GZ3A 4TXJA 1KZ6A 1U4SA 1Q0RA 2FRVA 1N2CE 2E87A 4P7JA 1U1FA 5BR7A 2V7UA 2AOWA 4MCIA 4QU5A 3GT0A 3LD9A 3RSGA 5J5VA 1GFZA 4FPXA 3NBUA 4Y9UA 2BMAA 2J3QA 4Y6OA 4RXMA 3AWIA 3MWJA 2C2KA 1JT9A 1DG3A 2G0AA 3ESQA 3PYMA 2Q2QA 5EMKA 2Q7XA 2YS6A 3L7IA 4KODA 1R3UA 1RYNA 2R4QA 1JQBA 2V98A 3UMSA 4PPYA 1JR6A 3DL2A 1PTJA 4GSKA 5TT0A 3WIOA 1IPHA 3BJMA 1O96A 2HA7A 2MSLA 3T3HA 3GEBA 3S1SA 1ZZGA 2WINI 5J23A 1DSSG 2HO4A 3HZZA 4RD6A 3THOA 3LP6A 3TR6A 3VKFA 5HZMA 1MVLA 1KKMA 1NI3A 4IGKA 3DOHA 4OQ4A 1JEOA 4EM6A 2Z1MA 1F2VA 3AB8A 1ZH8A 1HC7A 2OCLA 4RWEA 1T9GS 5L95A 2H5JA 1RPNA 5K0ZA 3NU1A 4L5JA 1W5EA 3QWIA 3TLEA 1EVJA 3O8NA 4XJXA 3R5JA 3R6WA 5KAPA 1XYYA 2AYXA 3NWOA 1EQAA 1WUJS 5ALFA 3RU7A 3LHSA 1WD7A 3GLKA 4NY1A 1WXGA 1U0HC 1N3LA 3AEUB 2V9PA 2JJMA 3I45A 1Q44A 1Y5NA 3PYLA 4XJSA 3KT3A 1AOXA 4PANA 4XUDA 4IWYA 3QVGA 4M54A 3AHEA 2EATA 2R1VA 5EYPB 5F98A 5K3FA 3WJAA 1Z4IA 1DAOA 3CSSA 2XUOA 1E3TA 5DT2A 2CJWA 2VTVA 5CPBA 5GWXA 1RBZA 4GXQA 3UFXA 4J75A 4G5YA 3ZH9B 1VC2A 2WUVA 3FPEA 1TFUA 2BKUA 3MN1A 4Y2VA 4PIPA 3U7IA 1OW3B 4CEHA 3OMXA 1IJEA 1D0VA 1OXBB 2C57A 2ZT7A 2DLDA 1L3CA 4KU4A 2E1PA 3IJPA 1KZHA 4E21A 1D4OA 1ZIPA 1JSRA 2DGDA 4RYDA 2O8CA 2BV3A 4FYMA 3IH5A 2WJHA 4YJFB 5A5EA 1GSHA 4MROA 3PXEA 1N6OA 2AEEA 4M37A 3ZWOA 1FSPA 3O3OB 4F5WA 4IHAA 4X6UA 4IX1A 4R1NA 5JS7A 4R68A 1OWLA 3P4UA 4GLLA 3OD1A 3RVDA 5FNZA 4Y2SA 4J9VA 1UXHA 1YIAA 1JB9A 1LPNA 3LCRA 2EWVA 3AU8A 1G8MA 2GF0A 3UPTA 1G8HA 4PBTA 3K9QO 5F1PA 1CFZA 3VVBA 1F12A 4ZAXA 2CV1A 3PUVA 5BQ3A 1KJYA 1SZJG 1ESNA 4DRXB 2XKKA 2XRFA 4PZEA 3TLBA 5BQXA 3BSWA 1HI9A 2W71A 3IDZA 1Q0UA 4UVDA 1TGYA 1JQKA 3FDJA 4AT1A 1JDJA 2WIJA 5JQGA 2MMCA 4PBRA 3LM8A 1S89A 3LPCA 3QF4B 4MA0A 4DMFA 1GTMA 1XTUA 4UU8A 1FXWF 1GYRA 3ENNA 5BOSB 4H7KA 4RHFA 2O7SA 2HK6A 4IIDA 3V1YA 3ZBTA 5C1OA 5ADVA 2BEUB 2B34A 4F3CA 5C7LO 1FMFA 2HLNA 1N2CB 2G04A 1P77A 2G25A 2NVBA 2CXQA 4EELA 2PYZA 4RK4A 4BEVA 2G76A 4NE7A 4CLRB 9LDTA 1N3BA 1TOAA 4D8XA 5K8VA 3C7CB 4Z9YA 2XX3A 2B2XA 2ZSUA 4WFJA 1QPBA 1IY9A 5ALHA 1LRLA 3B1WA 1SBHA 2Y1XA 4WMLA 3AOEA 1E6UA 3FYUC 1JNYA 2VL7A 3W6NA 1A95A 3ZQUA 1Y6ZA 1KNXA 2AEFA 1IN4A 1Z8HA 1TYEB 5KOYA 4HZIA 1BFUA 3GPIA 4ZODA 3GN2A 4ZV7A 1JHMA 4LQCA 1Y8AA 4K6HA 4QQ8A 1BYUA 3JS5A 2EJTA 3MGAA 3PD1A 5EGSA 1QSGA 4ICIA 2I7VA 3IBGA 4I5DA 2CFTA 2DYKA 4LMAA 1K6IA 3Q10A 1T3ZA 3PU6A 2YYSA 1UBRS 4RSRA 4LF9B 3GNTA 3BWVA 4C6TB 1EDOA 2LCIA 4YACA 5FWAA 4JNKA 5IDYA 3G8CA 5G2OA 1P19A 1XAJA 3WA6A 4I1RA 4CCYA 1UBKS 4CR8A 4YIKA 3ULKA 2OWDA 1OH5A 4MKFA 3ZYZA 3BWEA 4C6SA 5IPFA 2OUIA 5J40A 1E99A 1O6BA 3HGQA 4CTKA 2HMAA 5EJ8A 5ALKA 3L4EA 1IN8A 3AFOA 2J6HA 1QPGA 4YALA 2EERA 5LMUB 2FQQA 1JQ5A 1ZOIA 2XEXA 3HC7A 5D5PA 1JDPA 5BWCA 2F8SA 1JJ7A 1MPXA 4DLXA 1HY3A 3DE4X 2VAVA 3TO5A 1JWAB 4ETWA 2P67A 2O5EA 1P6XA 3EHEA 4D4KA 2J5KA 4D26A 2V9ZA 3GFFA 3L49A 1LDMA 4UDXX 5KDOA 4HR7A 3W2FA 5BR4A 4JOSA 1RT9A 4ZJZA 2EL9A 3D7LA 3H2IA 3GEPA 3QLUC 5AJHA 1E1QD 4GFDA 4D9KA 2QBYA 1IHDA 4MGZR 2VCYA 5TY0A 2GLXA 4AX4A 3WLOA 4OJMX 4BMDA 4RDIA 2VNHA 2IV2X 1GGFA 3SMVA 2VKTA 2IXAA 3ETGA 2PMFA 4JI1B 2BFPA 2ZWIA 9LDBA 5A7HA 1DZ3A 2POCA 3MJRA 2B5OA 4KR9A 4AUKA 2RC6A 2GXUA 3HI4A 1AXRA 2N1BA 2PBRA 2V5AA 1TO6A 4UMDA 2BTQB 4WLVA 5F77A 3T99A 1ZK1A 2QW1A 2I6UA 5JFGA 1QZXA 2APJA 1P9WA 2XCLA 1YL6A 3BXGA 4R5MA 1USVA 3ECAA 1GDDA 2GAFA 3ZIUA 1POWA 2C5SA 5C51B 3I62A 2J5QA 2J9FA 2ZI7A 3HKEA 3Q3HA 3B5JA 4EEZA 2EHJA 4XSGA 1JSCA 5LOVA 4RZ2A 3DGEC 3C6YA 3JXEA 3NH6A 1LVHA 1QH9A 5CUQA 1SHJA 5HUQA 1QYDA 3EQ7A 3SYRA 4DIUA 4MTLA 1GPLA 1VYVA 4RL4A 5CTAA 2YCBA 4XUEA 4ZVVA 1W0CA 2OILA 4MIOA 5EWJA 1QTRA 5DCYA 1WSWA 4A5SA 4URVR 1ZD9A 2XZTA 1OASA 4JA0A 5GMOA 2V4UA 3RGWS 5HJ5A 4ZO9A 3LUCA 2BEKA 4ZQHA 1NQVA 3TBKA 2WF7A 4FFOA 5CDTA 4B32A 3TM5A 2O23A 4R8MA 4CKZA 5T5QA 1YNSA 1XN1A 1O95A 2AQHA 2LRHA 3P8ZA 5AKYA 4F4FA 4L02A 2GZDA 1AUPA 1W36B 4OYYA 4PLWA 1E9BA 1NKVA 4DBLC 4KKVA 2I6TA 3NGLA 4PGAA 1HE3A 1CNFA 2OZLB 1F0KA 3KQQA 2ONJA 4R40A 4I3HA 2OD9A 1DTSA 1SIBE 3SR0A 3NB0A 5JPIA 3VPDA 3H65A 4ND2A 4EMSA 3HPQA 2D1YA 2ODWA 4GLBA 1Y9ZA 2C98A 3ONDA 3TAUA 4DG5A 1B15A 1DQPA 1IDOA 2CNLA 2YWFA 3CPSA 4GOXA 3L46A 4HT3B 2XCSB 4BGIA 2HCRA 1OGIA 1SXGA 1ENPA 4OJKA 3ZHYA 3T06B 1JLLA 1UR5A 2VBGA 2XB8A 1NDUA 1KZ1A 1VHWA 1T2EA 2I80A 2OO5C 3OE7D 4UVGA 4XVHA 4OEHA 5JISA 4TS3A 4M89A 3TSWA 4BNDA 5LDGA 3ZGXA 3FF4A 4BO4A 5CEEA 2QN9A 3C3XA 4KVZA 3L06A 3IKJA 1X70A 3NHUA 3FX2A 2AE2A 2PGIA 4KN9S 3U3OA 4LVNA 3AI7A 1PR3A 2WQZA 1G17A 4UD2A 2VJLA 2DKFA 5B3KA 2QVZX 4ZXFA 3R7DA 1UKCA 4DRYA 5JJKA 1V16B 2DOKA 4MAFA 3GJ5A 2AI2A 2IUEA 4GW3A 4KQMA 3VX4A 2R87A 5JBQA 2Q3EA 4LGVA 4RF2A 4JY7A 3DLHA 1IYZA 1AX9A 5ALWA 1RYHA 5JEDA 3ZQJA 2HSGA 1FP1D 2MWMA 2ZBVA 4G0NA 1E77A 1HDZA 3ZV6A 2UUOA 3ENWA 4Y9SA 1MFPA 2XJ9A 5DLEA 4FQ5A 3GP8A 2XI4A 3TZCA 3QXCA 6CHYA 4OL0A 1G4UR 2XRYA 2EFDB 4I50F 4HWGA 3M3HA 4LJRA 5J2UB 3KSRA 5FTMA 1QG2A 3DKVA 4JLSA 4U2CA 5FHRA 3BOSA 4EKIA 3TR0A 2SHKA 3JQ8A 3KKOA 1AQIA 3JVVA 4OHPA 3P2KA 4HAZA 5EMJA 4M55A 5LN1A 4MW9A 2C4UA 3AJEA 1ZVKA 2BGIA 3F49S 4U2FA 2I6FA 2X8AA 3MWYW 4LJSA 5HF5A 1FF9A 1F8GA 1XYGA 1PL8A 2IZ1A 3PR1A 1YTUA 3O83A 4AO7A 2AG1A 3VZQA 3C5HA 3E4CA 2XDAA 4FKBA 4UU1A 5ARCA 5A6SA 1E9SA 3DEZA 3NWPA 2B69A 3RJ9A 1L8QA 1JA9A 3HXLA 4IXMA 3A1WA 5SICE 3SFVA 4TRMA 1HH4A 4YMWA 5A4IS 5IU6A 5EWMA 1YDWA 3NWEA 3NTVA 4KR6A 2REOA 3STXA 1M7GA 1EM8A 3WGMA 3EY4A 4L7VA 3I92A 5DGCA 4CV3A 5DCLA 3GLIA 1QVWA 5FBQB 2NTYC 5E8RA 3KETA 1BE6A 1JDVA 1SB8A 2ZYDA 4OMCA 3M1AA 3W9SA 4GF5A 5ECDA 4QYXA 3OCZA 3T5AA 2CFCA 4FYVA 1ZD8A 3NHWA 1FK8A 3L0DA 1DFIA 2B4KA 5CP8A 4G0UA 4F3KA 5F2OA 4IVRA 5DMXA 3VSAA 2GFIA 2K5UA 1DWOA 4ZHQF 3O8RA 3I1JA 1T9CA 5K0LA 4LEIA 5FULA 2FSIA 2B9EA 3PT5A 4N82A 2J1LA 2ONCA 1V41E 1G2OA 1GTG1 1R8SA 1I4OA 1V3VA 2ONYA 4C0JA 1E3MA 4IILA 3W6OA 3B7PA 1T2CA 1VRCA 3QX3A 2D3TA 4JSRA 5ARDA 3E7FA 1TQ4A 3GIWA 4ZCMA 5ICMA 1N0VC 2QVGA 1KJWA 5G3YA 8LDHA 1GPJA 4C3UA 1WQ4A 5K0FA 3ZDDA 3LCVB 4DZZA 1QVVA 5JOQA 5K6RA 5IF9A 4L0CA 3JQ7B 4GM0A 5B2ZA 5DK4A 3TUIC 1FDWA 3LGAA 3U48A 5BSGA 4NP6A 4O2AA 3C87A 1XXHA 5KB3A 3GJYA 1OXSC 2VUHB 1U9CA 2NYVA 4HVLA 1LSJA 5KOHA 1T6ZA 1LLUA 1RM5A 1UJNA 3ED1A 3P0HA 3EMVA 1XPUA 5LP6F 3A4IA 2JAWA 2Q5IA 5DCUA 4ECAA 2R7NA 3WDMA 3THYB 3HCBA 3GFTA 3BBPA 4MB0A 2V5VA 2YUTA 3CO0S 2IW3A 3ICOA 1SA0A 1R9JA 2GZ2A 1TW3A 4QUGA 2G7MC 2V58A 3WKAA 4EUKA 2WYHA 2HU7A 1I2AA 4PQGA 4ASUD 2RB5A 4ZAVA 4LFCB 3V5NA 2VPIA 3TECE 3OETA 3Q9SA 1O4WA 2OXEA 3P9QA 2GXSA 4AXXA 3EW9A 4BMSA 2Y8EA 4QXMA 5J5CA 3F71A 4HGYA 3H9EO 1J07A 1T43A 4DCSA 4BWGA 1G3UA 2Z08A 3KFVA 2RKWA 2BDEA 2AMJA 7REQA 5B64A 1B6RA 4WKPA 3I58A 4ZN6A 4ILKA 1CT9A 4JNCA 4CKYA 2HXSA 2GHIA 3E5RA 1D2AA 3ZVLA 5A9SA 1JL3A 2X9LA 2DP4E 1RBQA 4G37A 3IIJA 3TB6A 4FMDF 1BRTA 3VC1A 4G1EB 1Z7BA 3UOWA 5AUNB 5HRAA 5DHTA 2QW0X 3O92A 2CL5A 2H2FA 4P9NA 5HOQA 3EZNA 2IV3A 5BSEA 1J2EA 4MKHA 1JFFA 4YJDA 3NJRA 2CNWD 4XWKA 2PUEA 1Q57A 3PC2A 4Q93A 5J4VA 5BUSA 1RFGE 4KNVA 2HRQA 2K6GA 4OSOA 5A6VA 5FPSA 2AZ4A 4HNRA 3UKOA 1TEHA 3PFCA 3T1NA 1N5LA 1C7ZA 2OFFA 4AKEA 1W85B 4GPZA 3A9UA 1E2PA 1R6TA 2OGWA 3E9CA 3RODA 1P3DA 3DJFA 3N0VA 5DRTA 3SKXA 5B3LA 1ZRNA 4BNYA 4Y2TA 2QRJA 3A9VA 1M34E 2LP4Y 3M70A 3UMGA 4ZFNA 3FCCA 1PEAA 2GESA 2QMZA 4GKBA 4JQCA 2ZRLA 3G79A 4B4WA 2C82A 1BU8A 4HDRB 3FB4A 4DWOA 2I1LA 1PYDA 3GNLA 1OFGA 3RRYA 3LUKA 1IXKA 2ZT8A 4ACBA 1E0KA 3K53A 4QTXA 3UK6A 4ER7A 4Z1MD 4JI8B 3AHIA 4M0FA 2AG0A 3M81A 4M8IA 3MBOA 1MW8X 1VLQA 4NCKA 4GLFA 4MJ3A 4RKQA 1EX7A 1FE8A 2PLNA 3FY4A 4KJXA 4QJBA 4DKXA 1ZICA 2I6XA 2I6SA 3WRVA 1EI9A 3WYNA 2ATXA 4E13A 2A0WA 5B7GA 4AJ4A 3AM3A 5EINA 4EF5A 1MHPA 2E4YA 4PLZA 4CM5A 1YS6A 3FIUA 3B7WA 3GGGA 3G1TA 2D2EA 2NZJA 1ZVQA 2PAFA 1UFKA 2W43A 2XIQA 5CJJA 1II0A 1ZGHA 3M82A 3FTQA 4GE3A 3SBEA 1J5XA 3Q41A 4XWYA 4K1LA 1IBRA 4B4VA 4JFRA 4LRSB 4ZOLB 3HLTA 3JYOA 1SR8A 4KQWA 3H6GA 4RVOA 2C59A 4EY4A 4DM7A 3HBLA 4PO9A 5K3AA 3DZJA 1H5NA 4MIYA 3AKYA 4R4JA 1L6RA 1XCLA 3CBGA 3DBRA 1C9EA 4QLBA 2QVYX 3DMTA 1SRQA 2H4FA 1KRHA 3NAMA 4KN8A 3I0ZA 4M1MA 5EI5A 5JARA 1OXMA 4PIMA 2G7ZA 4XLTA 1LPOA 3KOWA 1LKZA 4S12A 4AJ2A 3ZY2A 4DC0A 1QK3A 4OQFA 2WOOA 2QD4A 4YRKA 3U6BA 2ZJ8A 1G7CA 3Q8XB 5BV2P 3IOBA 1YS1X 3KQYA 3PEVA 1ZRHA 5DX8A 4YAEA 1XDDA 4OFBA 1XRQA 4MPPA 1UZAA 2O2EA 4R16A 3N5KA 3L2OB 1QHNA 4EHBA 2H2WA 2ZB7A 2CCGA 3JV7A 4EJFA 5TC4A 4IIJA 1XTPA 3IEMA 1EINA 3MLBA 4ZDIA 4IDEA 1ZXLA 3S29A 3BGDA 4RCVA 3CPJB 2BGRA 4CIXA 4PV7A 1EVEA 1JYEA 4TL6A 5BV1A 4LX0A 3RYCA 1EP9A 3OZAA 2G71A 4HJRA 1VB5A 4ID3A 1Z0AA 4OHCA 3UB2A 5EMNA 4YYEA 3R0ZA 5ALNA 4MPRA 2VZEA 2QLLA 2WF8A 3ZCPA 2HFJA 2IZ6A 3B51X 1CQZA 2B3TA 3F3KA 3PCXA 4LS3A 3UH1A 3ZK7A 3DXXA 3OUUA 1Y4AE 4A2PA 3W79A 3EVZA 3JRWA 5C18A 1RKXA 4RS3A 5MN5A 3RUDA 3W5SA 1KY3A 1QZ3A 1QVRA 1S7CA 4Y1EA 3UY4A 3H42B 4JYAB 1FX0B 1KVQA 4BC1A 2X8JB 1TF5A 3LPDA 3ZHXA 1KEEB 3L6BA 1E6WA 5TR9A 6Q21A 2PANA 3EVDA 1KAEA 2BOVA 3TJRA 1L4NA 1M8GA 2G9VA 4EHHA 2HNKA 1TM4E 2D2IA 4WDQA 4GR5A 3H6HA 1B8OA 1V96A 1QGUA 4HDKB 4IDFA 1MV5A 2GM4A 1KFKB 1WEKA 4FS8A 5CT5A 4PSAA 1GT91 1KVTA 3HR8A 3H9GA 4XQ9A 1P61B 1VKHA 3HXKA 1B0UA 3X43A 2JFQA 3F2IA 3RYTC 4OYRA 1NXXA 3R41A 4DCUA 1NIPA 2IIBA 1RQRA 3O47A 4URHA 1LNQA 1WW8A 3A1DA 1CV2A 4KDRA 4RH3A 5E4YA 3RU3A 4KN5A 4GKVA 5FTNA 1ZK3A 1Z68A 4UTRA 4YRZA 3E23A 4BKQA 1YBVA 4L15A 5A9SB 2ZJ7A 4UZFA 2JI6A 2Q7OE 4EQ6A 5CU7A 2YRFA 3QX9A 1Y8ZA 4P5DA 1JE0A 4RMHA 3ZXIA 4D96A 4YUZA 1UT6A 4JQYA 1KIAA 2O3SA 3BMCB 1P74A 3F2VA 3U13A 3G9UA 5K51A 5BVHB 1UCFA 2WNSA 1EWQA 3Q40A 1NM5A 4JJ4A 2HUPA 4F5ZA 1XJ5A 3HCDA 3MLEA 2UYYA 4XIIA 4OHMA 3IVRA 3JAMA 5F2KA 4ZEXA 2RHWA 5EXTA 2FZLA 4NPAA 1E1NA 2LPMA 1IVSA 3MAGA 2QNRA 4O2LA 421PA 1BDJA 3D6AA 4Y2UA 5SY4A 4Q6BA 1V4VA 4QA9A 1W30A 3D6VA 3O9MA 4M87A 4XVUA 3DDNA 4HLUA 2Q1SA 2NUPB 4J6EA 3R2JA 5D85A 4QC2A 4DCCA 1R4MA 1XXHB 4XGQA 4BB9A 2O5CA 3LYAA 1ZNWA 5FOUA 3OCUA 4CCAA 2ACKA 4K9OA 1QAMA 1ZJJA 1K66A 3TLZA 1N0IA 2IEBA 1ZR4A 4BLSA 1Z37A 3I8SA 5BXQC 2B82A 3EQZA 1Q17A 4FNMA 4PYKA 4UHFA 3Q8MA 2FPXA 1Q3KA 1WWKA 2YL2A 2EW1A 3CIOA 5IYZB 4Q7QA 4HCJA 4K81B 3ID6C 2OC4A 2VHEA 3F7NA 2OVFA 3B3JA 5D6NA 4O3MA 3VR2A 1AJEA 2H0RA 1DCKA 2OVBA 3BJZA 4Z6KA 3ZGVA 1TCAA 2XCUA 1NAHA 2WIBA 5BSTA 3EPPA 1SJ9A 2Z6VA 2P0AA 5CFNA 2DMRA 1ADJA 2FDXA 3KKPA 1XNQB 1PW7A 1C7FA 1VKNA 1XELA 1U99A 2WK1A 1GWNA 4LSGA 3RC9A 3IAS1 3T7EA 2QP9X 5A0FA 3PKJA 3UM9A 2R8RA 1T8PA 3A3KA 4BTVA 2PKQP 1ZKMA 1TPYA 1AKYA 1YZYA 5IM5A 3TOZA 1D2GA 3LLMA 1I7LA 4J6FA 2VXCA 3WGVA 2GH1A 3I42A 3KEQA 3KLOA 1RXUA 4AS2A 4JP3A 4DLPA 3INGA 2H31A 5EZ6B 4ER5A 2AJLI 3BC1A 1VBMA 3VU9A 4GR9A 3WDLA 2O57A 1ESEA 3A9TA 3P45A 4US2R 5AVTA 3MHTA 2WUDA 1BTOA 4B2YA 1EB9A 1LFAA 2EJCA 3HBAA 3SR4A 5IULC 2WSYB 2YQ5A 4CLOB 1XD8A 1YC5A 1I2ZA 1RPTA 1ZXXA 1Z45A 2RGWA 2WU1A 3LUJA 4L75A 5A06A 1AK2A 5B1DA 1QQ6A 1BCRA 4FVTA 2AFHB 1JGTA 2W5UA 4MKRA 3VKWA 1X1CA 3VPBA 1JQAA 1U7UA 5GV7A 4Y9RA 4RGYA 4LW8A 1FTWA 2D1TA 1D0IA 1NV9A 2WJ4A 3NP7A 5G1NA 1RXEA 4HRYA 4A3SA 3MPUA 4MWOA 3ZZUA 3NEPX 3NDPA 1BU5A 1NFQA 4GKKB 3ELDA 4KL8S 4YASA 3HP4A 2GDJA 2PZ8A 5ER9A 5GV8A 3HVRA 2HHAA 1MO4A 4FP9A 5GZ1A 2OGSA 2GSWA 4JIMA 2NMVA 4ACAA 4V0LA 2JKZA 3O91A 3OAAD 1M72A 2HCJB 4P33A 1DKUA 1OA1A 2G4LA 2GLUA 2QYOA 1JWBB 3KAPA 4FFSA 4OHZA 2ZSJA 5ALZA 2ECKA 1NQWA 2BM9A 3C4JA 2PO7A 4DCVA 5BMOA 3G49A 4QREA 3GAMA 5E3JA 3I9JA 3AVQA 2OECA 1M2HA 3QVOA 4QT0A 3SQOA 3RJZA 1E79A 3L7DA 3M9WA 4WCFC 3HB7A 3IP7A 1XMPA 5DLPA 3UXMA 2QW8A 3V8MA 4AY3A 4ZDJA 3D3KA 4C06A 4BVAA 4MGHA 1QYCA 3C1TA 5FOTA 3PB3A 2HIMA 4ER6A 7MDHA 1GTSA 1KPIA 4B48A 3DE0X 3TSAA 3WVNA 3QFSA 1K7YA 1QQBA 4KO1S 4L95C 4AI6A 4MUKA 4UUOA 1U2GA 1NVTA 5C8DA 1HURA 5B3JC 3V1NA 1R5JA 3GT3A 4QBGB 2Z56A 3LA8A 4AIRA 5FUMA 1DS6A 1WDLA 1NN5A 1CS0B 2A5GA 2YHUA 2JI7A 2TYSB 1H5QA 3FPBA 1N32B 1Q1AA 5F4ZA 3UV3A 3N8IA 3QEKA 3X1KA 3K4PA 2RAPA 2D13A 1SUWA 2FGJA 4JDPA 4BAZA 2FG5A 3HR4A 2FPKA 2RARA 4RZQA 2ODBA 3HACA 4MA5A 1EBUA 3MWLA 1T2FA 4EI2A 4S2UA 1WY5A 3V7NA 3OZEA 1H2FA 1RLJA 5AHRA 2W8BA 3T41A 2HA6A 3DP9A 3LK7A 2VLIA 3D0KA 5D2CA 3NJ4A 2F7SA 4KN6A 1IN6A 1YUBA 1U63A 2ZAYA 2RONA 4G8JA 4LZWA 3S70A 1AIPA 1FNMA 1YJ8A 4YDQA 3DZDA 3FTEA 4ZWNA 5ELXA 2JLVA 3T7CA 1SKBA 3N0RA 1ZCBA 4KO4S 1F8UA 2FFBA 5HQTA 2ZXFA 4DGSA 2AT1A 4K9NA 2ATEA 2DWCA 2NN3C 3O3CA 4HBZA 4MP8A 1JA0A 1H0RA 2YVAA 2ZR8A 1D9XA 4N5DA 2M6LA 3DVQX 1B3BA 1QFMA 4MVJH 4YRMA 1VMAA 2R6FA 3RIGA 1L5HB 2VP2A 1GNQA 3FNHA 1ZRMA 1P75A 4PZLA 4NLLA 1JDTA 5FBRB 1OZ0A 3Q7QA 2UUBB 5IDVA 4XPIA 4DDHA 3O1LA 4IPTA 2XB2A 3WV5A 3ZY4A 5AM3A 3IXQA 4DXAA 3TXYA 3O4JA 4UHEA 3RBVA 1ZGCA 4CR6A 2DUJA 3Q72A 3WP0A 1U0FA 3F3SA 4QJ5A 5H80A 3FUVA 1R4NA 4QJ3A 1JXMA 2DHQA 3I53A 3JALA 3I1YA 3VVCA 1NASA 1C30B 5ALXA 3SVLA 4KWCA 4RGQA 1ZEJA 3I4CA 4J03A 2G36A 2A78A 1C14A 1WPXA 1Y1QA 4CW7A 4PR0A 5C52B 3KJHA 1VYTA 3KYCA 2BI7A 4FFRA 1WMSA 1DC6A 4ARCA 4DSOA 4QFDA 2P78A 3UWMA 1X8JA 1SUDA 4K6FA 4QNNA 3BWDD 4G97A 4E4YA 3JQ8B 1NVXQ 3QKRA 3ZQKA 4EDHA 1SVNA 1MUUA 2DY1A 4MUFA 2VYCA 3ZBUA 2XPCA 1GVNB 3FZYA 4Y6QA 4G5GA 2NU9B 3ILSA 3E3NA 3F6BX 4ZVPA 5T4BA 2VG8A 4W5WA 4JC8A 2P90A 1Y89A 2IKSA 3WBJA 4NAHA 5TLSA 3VNAA 4JFAA 4G25A 2ADOA 2QTVB 4UPEA 4L5AA 5AM4A 3DAHA 2EW8A 3G8DA 4WBNB 1YVEI 1PYGA 1WSBA 2QQFA 4WH0A 5DIFA 2ANCA 3D3WB 3JCZA 3QY9A 2BGJA 2DR2A 2XOKD 2RGEA 4MWGA 3SKYA 2IL1A 3R3ZA 3MXTA 1YJAA 2ASEA 3OF5A 4NG5A 4UM9D 1RHKA 1Z4NA 3H5IA 4X7RA 3LUGA 1A9QA 5KSPA 2X4DA 4NZ9A 4JBHA 4RVCA 3UJHA 5AVKA 3M1LA 2FRDC 3AUJB 4URYR 1VDZA 4ZVOA 5K2MA 1MBZA 4OB8A 3EMBA 5E3HA 2ZAOA 3OQ1A 4Z0HO 3AEKA 3IUNA 2IXGA 4M0KA 4RZSA 2P9QA 1SU6A 4XAQA 3MWDB 1E5VA 1KZYC 1KH2A 1QB7A 4YONB 3VTKA 5BSVA 4TTTS 1TX4B 1HEYA 1ODFA 2BFOA 4A91A 5FUQA 5JD4A 5K3OA 2J8ZA 4R1MA 4Q3LA 4LJ7A 4COOA 5DEOA 4JOCA 4ECEA 4JI2B 3NFYA 2ZAGA 4Q15A 5FFFA 2Z5GA 3BD7A 4NHOA 2GK7A 3VNRA 1JG2A 1KY2A 2H51A 2O48X 3EC2A 1B2LA 1Q0SA 3A32A 2JVJA 5JH7A 1XZ8A 2Y67A 4LQ4A 3FUCA 1W8DA 2WP8J 3K6KA 4J4TA 1AVTA 4A0HA 3G59A 3U2QA 5MGBA 1FYFA 3SSNA 3U1BA 3E05A 3K8YA 3S4YA 1U6IA 1K8QA 4Q4LA 1CQWA 3UAXA 1FDRA 4YAFA 1KJQA 2AQKA 2P9JA 2XE7A 3CFYA 4B4OA 3WWZA 1J90A 2QWXA 2JBAB 4M1QA 3X2SA 2CYBA 1VSVA 1A7UA 2WEKA 5EE5B 1WE2A 1XO1A 3O1IC 3PR2B 1RM3A 4OHRA 3SQMA 4EUSA 4PG4A 3IAUA 1NUAA 2DPMA 4H1TA 4QVIA 2QY6A 5HIJA 1BWQA 4V0RA 4D79A 4DDTA 4RE6A 2R8EA 1RQGA 1CUDA 5D87A 1W96A 4PLYA 4J1TC 2XAAA 4KXMA 4NJOA 4UZSA 1HFWA 1ORVA 2C9YA 1DINA 3PEFA 4NAVA 2V6BA 4ZC1A 3UICA 3G2LA 2HA2A 3CE6A 4CN8A 2P6PA 2V4ZA 3SHQA 1CYEA 3TW8B 1J22A 3R9IA 2O2SA 4C4AA 3WNQA 3ADCA 4BKPA 2XF8A 2CLSA 3ZWQA 1RAEA 4E31A 4ZGWA 5EHXA 3WJ1A 1KL7A 2PCJA 4D6XA 3BBLA 2HYDA 5BYBA 8GPBA 1WR8A 3B1FA 1SCJA 1OC2A 2HQ1A 4WXMA 2G06A 3R75A 5JROA 5HJ2A 1XTSA 4A2CA 1CZRA 1HMYA 1NG9A 2WABA 3IAS6 2F9FA 3E2PA 1DJLA 4F4IA 4ZI7B 3L79A 5BO5A 3D8SA 1XFDA 1B00A 1E7MA 1BN7A 1C1YA 1GQFA 1T0HB 1GSIA 5LVAA 3MT9A 4TLLB 3UHAA 3PCRB 2DY0A 3ES9A 5DDIP 4DVGA 3KL2A 3K1TA 2ZSAA 2KBEA 1U2GC 4RYLA 2ZBDA 4HTAA 4IWNA 4F3NA 4F56A 3FETA 2PU5A 1I7SB 3PQ5A 2Z95A 3AIMA 3Q8LA 1QKKA 5IKPA 2ATCA 3GYGA 3ZHZA 3UUEA 4C7JA 4Q9DA 4B84A 2NM0A 4PSVA 3GT7A 2HA5A 3W5JA 4B3FX 5KYUB 2WJIA 5MF6A 1M1ZA 1QIJA 1X1DA 3TMYA 3MFYA 1K5GA 2FP4B 2OCPA 3OZTA 1O3YA 4TSFA 5JBIA 1I3OA 1CRLA 4QZVA 5C46F 5L3QB 5EIAA 1E2BA 1TI7A 3R0XA 3I5AA 4GC9A 1A04A 3HHEA 4B83A 1G3QA 1A4IA 3CG0A 2B30A 4JENA 1YHYA 4HAWA 4TMYA 3UCFA 4BO5A 4CODB 4IGIA 4RZ3A 1SEVA 1X80B 2E37A 3H87A 4KREA 1L4KA 3NH9A 4OKNA 3PFNA 2GASA 3FOEC 3PPYA 1SCNE 2AC4A 3BSYA 1EXWA 4JBLA 3QVLA 3TW6A 1SBTA 4KV7A 1O0BA 5EUCA 4AVYA 3RVJA 3TLYA 4DZTA 1G4AE 4QASA 1PUJA 4RD3A 3R5HA 3RVKA 3ZE2B 1NW4A 2Z6AA 1A9XB 3NIDB 1ZJ6A 4F1JA 1ONBA 2O0MA 1SUSA 2Z43A 2ZU6A 2FOXA 2NSLA 3U19A 2VWHA 4B87A 1H2B