2GA8A

Crystal structure of yfh7 from saccharomyces cerevisiae: a putative p-loop containing kinase with a circular permutation.
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
353
structure length
326
Chain Sequence
b'VDTHKLADDVLQLLDNRIEDNYRVCVILVGSPGSGKSTIAEELQIINEKYHTFLSEHPNVIEVNDRLKPMVNLVDSLKTLQPNKVAEMIENQGLFKDHVEDVNFQPVKYSAEETAVVARGGTANAIRIAADSINIAQIVPMDGFHLSRRCLDLFKDPQTAHKRRGSPSTFDSNNFLQLCKILAKTSLKVSTSSVFEKLSKTFSQTIPDIFVPGFNHALKDPTPDQYCISKFTRIVILEGLYLLYDQENWKKIYKTLADTGALLVYKIDIDYEATEERVAKRHLQSGLVTTIAEGREKFRSNDLLNGRDIDNHLIKVDNIVHIRNDH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical 39.9 kDa protein
publication title Crystal structure and functional analysis identify the P-loop containing protein YFH7 of Saccharomyces cerevisiae as an ATP-dependent kinase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Unknown function
total genus 109
structure length 326
sequence length 353
ec nomenclature
pdb deposition date 2006-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07728 AAA_5 AAA domain (dynein-related subfamily)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ga8A00
3B5JA 1R0WA 3FYHA 1K5DA 2RKOA 4CT5A 5EZ6B 1TPZA 1ZBDA 5C2JB 4G5GA 1MR3F 3RAPR 2BBSA 2ZI3A 3T5DA 5AUPB 5HZKA 4BQSA 3NH6A 1K5GA 4NDZA 1YQTA 4P4UA 4ABYA 1Q1QA 2ZJZA 1U98A 2VHQA 5SZHB 1DE0A 3NHBA 5DHAA 2NG1A 5H1YA 5KO2A 1ZCBA 1L4UA 4JLDA 4BWYA 1DAFA 1NI3A 1U9IA 4GOJA 3UMRA 3QXCA 3G82C 3LBNA 5JEEA 2OM2A 2VHJA 1BMFA 2HDNB 1EX7A 2DPXA 5BQ5A 2UVQA 1E0JA 1KGDA 4G01B 3X1XA 3VR5A 3D31A 1KDTA 3NBXX 4DWJA 5JMTA 1XRJA 3G5UA 4QOSA 4LYAA 5JJLA 1MH1A 5L3SB 1G41A 5TVKA 4BFYA 2J7PD 3KXLA 3DOFA 3P27A 2A5JA 3I5XA 1C1YA 1Z0JA 2QM7A 2WJVA 1OH6A 2J59A 1JAIA 1NMXA 4DLWA 2G83A 1IONA 1XNJA 4ZDKA 4R2HA 4AD8A 3H86A 2CXXA 1RRPA 1VCIA 5GVSA 4BFWA 2GZAA 3NEYA 4GBMA 4MUBA 3I1FA 2H57A 3WRYC 1TQDA 2J46A 4XTRA 3TW8B 4AYXA 2FF7A 2GZDA 4DUGD 5CDFE 3QKSA 1I4TD 3FKSD 4ITRC 4C0AC 3MUFA 4OHVA 2G77B 4HAYA 1KKLA 1LNZA 4HSEA 1YZGA 2WJHA 1IJFA 3R9XA 2VA8A 4XD7D 5DIFA 1GL9B 2DB3A 2V9PA 2OEPA 2D7CA 3NC0C 4WZAE 1NNEA 1P5ZB 2RH5A 4ZKEA 4QHYA 3UMSA 2ZXUA 4DDTA 4RD2A 1Z83A 5FPYA 4DT1A 4URWR 1XBTA 3SS8A 3ZD6A 2Z6VA 3CH5A 4NCHA 1KSJA 1XEXA 4DZZA 5K8IA 1A82A 1COWA 2R6DA 3AQ4A 3MJHA 4DLVA 2C9OA 1DELA 4QM7A 1W48A 1Z5ZA 4HLCA 3X1ZA 2PEZA 2CCKA 4PPNA 1W36C 2HJGA 2ZJBA 2AFIE 4LOAA 2SHKA 4OK3A 3RWMB 2AXNA 3WXMA 4KI0A 2QAGA 4TMXA 1HUQA 2OFXA 4D6PA 2DWQA 1CJVC 2IBMA 5D3MA 3QF7A 3TMKA 1FL9A 1R5BA 4RVCA 2IYYA 3RRNA 4BPBA 4B35A 1BKDR 3L0SA 5CK4A 1GL7A 3KQUA 1Z0KA 3NBZC 1ZP6A 4NZYA 3SJBA 4PC2A 3ASZA 1DAEA 2XJ9A 1KYIA 1NVXQ 2ZJOA 3UPUA 5FOWA 1Y63A 4ASUD 1XMSA 1KO7A 3GFPA 5C4GB 1E2KA 1P72A 1ELOA 4KU4A 3W8RA 3CBQA 3CF0A 2CHVA 2V54A 2AFHE 2YV5A 2P5TB 2OV2A 4ACAA 4D25A 2BKEA 2PBRA 4EQ6A 3RVBA 1OFIA 3EA0A 2FPMA 4QBGB 2ZRIA 4IVQA 1YE8A 3VNVA 4LX0A 3EARA 4YMWA 3B85A 3GEEA 2CL0X 1OIXA 2ZRAA 4Q4LA 5EE5B 3CH4B 1PUJA 2A3RA 3RRMA 1PLKA 4BFVA 2KJQA 1NMYA 1JI0A 1GRRA 1XXHA 1ANKA 3W5JA 4MGIR 2V7QD 1JALA 1DOAA 3RS5A 4FMCB 3GEIA 1G4UR 4DEYA 1GKUB 4JYBA 4O2RA 1R4AA 3OIVA 3QKSB 4WIAA 1N6KA 3AGQA 4Z8YA 2CNWA 3W34A 4KSBA 3AVTA 2O0JA 5FPKA 2G0NA 1XEFA 1U2RA 4HUTA 2ZVPX 4I1VA 4ZIRB 5AUOB 3CO5A 4P3YA 1KSHA 2XJ4A 3RS4A 4BLOA 3U3MA 2PCJA 4PQRA 1W4RA 4JLKA 2ZUCA 4DT1B 1IXSB 4LV5B 5FUYA 4MDFA 1XEXB 4FWIB 3NTUA 3QPWA 4V0ME 3M1IA 1VYTA 1DVRA 3B7GA 1EG7A 4S2EA 2D7DA 4TMWA 2B6HA 2O8DA 1Z2AA 4FMBB 1JB1A 4BECA 2QENA 4POAA 5F2EA 1NLZA 1NF3A 2IS2A 2PX0A 4GZMA 2QAGB 5IT5A 4CT4B 5D3MB 1TF2A 4LHZA 5G41A 5EP3A 4U02A 2G6BA 4IEIA 1YRBA 1S1MA 3B13B 2LCFA 1W4AA 2G3YA 1X8KA 4DB2A 1G18A 1XP8A 3EPKA 4TSFA 1N6PA 1QZXA 3DO6A 1TUIA 1E2FA 5FPTA 2GCOB 1CR4A 1DAKA 5KNDA 3QVVA 2ZSBA 3X2SA 3ADBA 2XTMA 1T9HA 3FMIA 1HQYE 1OLOA 1ZUNB 4ILEA 3QXJA 3RRYA 4EPTA 2HYIC 3U44A 4IVRA 2WKRA 3IHWA 3BAFA 4OHWA 4W7SA 5JSZA 2RGGA 2YC2C 3OFNA 4KYIB 4EQ6B 5KPDA 5K8UA 1JJ7A 3V4RA 4DLRA 3N2IA 1XD9A 1QHIA 1CTQA 5GVRA 4Z1MD 3O8BA 1UEJA 3GJ0A 3QUSA 3OIYA 2Z83A 1W5TA 4G5OA 2IS6A 5J47A 3R7WA 3LFUA 5LB2A 1NKSA 4D0NA 5K8TA 3VTKA 1XXHB 3AP1A 3K70C 4HB2A 3WY9A 2D4HA 1CR1A 2UKDA 4GSYA 3OAAD 3CZPA 4KLZA 3BXZA 5FBRB 1CU1A 2MSDB 1JPJA 1B0UA 3CF2A 3C4JA 2GBLA 2ZQ5A 2JLYA 3I62A 3BWDD 3LH5A 4XWKA 5EE0A 4JLVA 4L9SA 4XVRA 4ZCIA 4JL8A 4A2WA 3Q3JB 1M7HA 4N3NA 5JI2E 4GP7A 4A2QA 2BBWA 3GJ7A 1Z08A 1WQ1R 4B74A 2CLCX 2LKDA 1GIAA 3UG7A 2DY1A 4KJZA 2WM9B 3GLHA 4TLAA 4NBSA 2PCLA 2GCPA 1G8GA 4GOKA 4TN1A 2WWYA 2JATA 2QMUA 4B48A 1TQ4A 1P7CA 5EE3A 1T8TA 3VHLB 1X6VA 4RD3A 2DFLA 2GJ8A 5J4VA 1EFHA 3AVUA 4R7ZA 1ZM9A 4QJ4A 1BMFD 2O8DB 3I32A 2HYDA 4U00A 5KYKA 4FCTA 2GEUA 3U61B 4CGZA 5DH9A 1OXXK 5CJPA 3Q5EA 1D6JA 1VDZA 2WKQA 4FMDF 3IQWA 2GXAA 2FZLA 4Q02A 3WHLA 2NO9A 3A8TA 3QENA 3CNNA 3RS7A 4ARZA 1PLLA 2RHDA 3AF4A 1UFQA 1QG2A 3FHOA 1F2UA 3QKTA 5EUQB 4A6PA 2GEVA 1GNRA 3W5IA 1KI8A 3HYTA 5TDHA 1KZGB 4UNRA 2BBOA 1IOZA 4R9UC 4BASA 2ZRCA 2QY9A 4Q03A 3QSYA 3IILA 2ZU6A 3V9PA 2CVFA 3QOFA 3L82B 1JNYA 3U44B 4LGMA 5EXSA 4IFEA 2Z4SA 2YOGA 4YLGA 3ADKA 5JSZB 5AR1A 2QE7A 2GDJA 3HWSA 2PZGA 4NCKA 2ZI9A 3NXSA 2GF9A 2GHIA 3L43A 2FFBA 3CRVA 1ETUA 4XJXA 5JWHA 4OI2A 3R7WB 1BOFA 1XCPA 3FGNA 1NN0A 1YJ5A 4OJKA 3MWJA 1WP9A 1N0VC 1W0KA 1XPOA 2ZRBA 4Q9KA 2CEAA 3QXXA 4Q47A 1NG9A 1E2HA 4Q1BA 3FHTA 5JS8A 2VIIA 2JASA 3SJZA 4JLBA 1NMZA 2OT3B 4QJ3A 3MGCA 1BO6A 1OT3A 3W90A 3LBIA 1OPXA 3U6KA 4CZ2A 2VHTA 4DIDA 1IN6A 1OIVA 3QI2A 4DC9A 1COWD 4PAOA 3CWZA 2X8AA 3GLHB 1N3BA 5EE9A 4LJ6A 4QBHA 4QL3A 2IL1A 4BUJA 5FOUA 3OZXA 2FSIA 5L3VA 1S96A 1H8EA 2ONKA 4YC7A 2IUSA 2C03A 2XSZA 1EXMA 1S4QA 3M6AA 1FX0A 3I72A 4QGGA 1T6NA 1NSTA 1RRGA 1UBGA 1BIFA 5LBIA 1UF9A 2F9LA 4RD0A 2Q0HA 4PANA 4F4CA 2QL6A 1GTVA 1Q1BA 4XSHA 2XITA 5M04A 5EE1A 4IEEA 3LX5A 1E32A 2WWHA 3A1TA 4V0LA 1E0KA 3AVOA 4B3CA 3F0TA 3SBEA 2G1JA 2D2EA 5E95A 4OQNA 2B7CA 4TMZA 3QPVA 2H18A 4A36A 3UWKA 3HPRA 2GK7A 4UQOA 4L15A 1U90A 4ARZB 2CHQA 1F2UB 1GP2A 5UKDA 4F38A 1P61B 8OHMA 1GL6A 4Q21A 4PFSA 3ZVNA 5JCPA 2Q9CA 3AP3A 4D80A 3X1WA 3WBKA 1KOFA 4DDVA 1N5LA 3KTAA 4KVAA 3IIMA 3PXGA 4C0HA 1KTVA 4JSTA 2VLIA 4A2PA 3W6NA 2VYFA 3WP0A 1JR3A 3KXIA 1XTSA 4B43A 1G17A 2I3BA 4GZLA 1OF1A 3L0IB 3PQCA 4L4UA 1OFHA 4GMDA 3GP8A 2Z5FA 2NOAA 4GP6A 5LDDC 2YOFA 1L7VC 4A0RA 4AYTA 4PZLA 4TYPA 3WRXC 4DKXA 5F3WB 1ZD8A 4GNKA 3WMEA 4DLSA 2ZRJA 2NO7A 4LUCA 2CNWD 2RCNA 3H2YA 4D4JA 1G20E 3L0OA 2HXSA 1T4GA 1CBUA 1NN3A 1MRNA 1V5WA 4HAUA 1A5TA 2QRZA 4KODA 2WMNB 3T35A 2HCBA 2ANBA 1DO2A 2VF7A 2NTYC 4M21A 1CLUA 1P2SA 3HYRA 2GILA 2ZEJA 3C14C 2FSHA 2JCSA 2JLVA 1KKMA 4PAQA 2EVWX 4TL7A 2PMKA 2REBA 4PX9A 4DIEA 5CB6A 1LS1A 1W47A 2GKSA 2C2HA 4M1TA 2F1IA 1FX0B 2ODWA 2ZSFA 4OKSA 3T1TA 5F9FA 2OZEA 3BJIC 2AWOA 5CIWA 5DLQC 1NVVQ 2DBYA 4PHHA 2QP3A 2ZE5A 2EFHB 1U0JA 1Z0IA 3PEUA 3WBJA 1CRQA 4Y0AA 1E2LA 1U8YA 4TL6A 4TSFD 1XPUA 2Z0MA 3QNUA 1YZUA 4MGYR 1ZIPA 1PV4A 5JRJA 2P5SA 2P2LA 2EFGA 4PXAA 4HAWA 3TUJC 1MO5A 5JJIA 4WZ6A 1RC8A 1E69A 1KJZA 4QRHA 1Z63A 4IHQA 2ZS8A 2QMEA 3AKDA 1YR6A 3AGPA 3CIOA 4PC6A 1J99A 1LS6A 2R65A 1G16A 3VKHA 1SHKA 5FTLA 4U7DA 2BM0A 3IIKA 3OFND 4MRNA 3FOZA 1TF7A 3VFDA 2PL3A 2PX3A 1Q1EA 3KTAB 4IXNA 2IF0A 4A1FA 3O8RA 2ZRMA 1E9AA 2ODBA 4UKDA 4B71A 3BE4A 2IEZA 4Q48A 4C9BA 2XNSA 2ZSDA 5ANRB 4ACBA 4PC1A 4RD4A 4C30A 2LKCA 1WB9A 2MSEB 2O0KA 1SVSA 2J0UA 2GJSA 4TYNA 2JLZA 4Q9IA 2NPIA 3T15A 4KITB 1KJYA 4B73A 4E03A 3BC1A 1E1RA 1NY6A 4AKIA 2YNMA 4PHFA 4EPRA 4Q01A 2RGDA 1G9XA 1II9A 3K0CA 1GNQA 4IDNA 2C78A 2YINC 3KZ1E 3CNOA 2XEXA 4Q9JA 2NIPA 1FTNA 4MUAA 4JBWA 2ORIA 121PA 2WOOA 1AJEA 5EXXA 5FOVA 1F6BA 4D26A 1G5RA 3TVDA 1EFTA 1NVWQ 1YZQA 1G6OA 5GJBA 4PTLA 1ZC3A 2BCGY 4O25A 3TH5A 4DEXA 2FFAA 1E94E 3CPHA 2ORVA 5AJVB 2GJAA 2ZRGA 3N70A 4ZDIA 4YDSA 2RAPA 3IKJA 5FI0B 5FPHA 3NHAA 3A4LA 2QM8A 2A5YB 5FOTA 2V4ZA 1E98A 2Q9BA 3PR1A 2KI5A 4B44A 4LHYA 1G7RA 5G3ZA 2RGNC 1CR2A 2OCAA 2WV9A 3GJ5A 4RY2A 5BN4A 2GF0A 2J41A 4GI7A 4MH0R 3QIAA 3HU3A 3JVUA 2OLKA 1P62B 3SI7A 4DRZA 4QNMA 1XMJA 1ODFA 4AKEA 1IM2A 4BFXA 3THYA 1KDRA 4QGAA 2IWRA 1Z0FA 4CEHA 1OFTA 1LVGA 2WTUA 3KKPA 2F3TA 2AN9A 2ZRDA 3RC3A 1P2TA 4BLSA 4D82A 4RSGA 1E79A 2ZE8A 3U3KA 4A6XA 2NO6A 1CEEA 3C41J 4R2IA 1M2OB 2IYQA 5AJWA 4AG6A 1E2JA 3A36A 4C0SA 3VR1A 4JS0A 5IDVA 3DVLA 2CBZA 3GJXC 2QE7D 2WJIA 3HP1A 5CITA 4A0GA 5LD2C 4E22A 5DISB 1D2NA 4DSNA 4LJ8A 1YKSA 3I4LA 1ZIOA 3JVVA 3LA6A 4D4LA 4E09A 3FHCB 4PO8A 4X8OA 1KZ7B 3ZZTA 1UBCA 3CX7A 4Q19A 2F1RA 5HE8A 1KDPA 1JXOA 1W0KD 2VP4A 4NCJA 1IBRA 2J0UB 3B1XA 4Q7LA 1WA5A 4UNSA 2PJRA 3K0EA 2QSZA 4CEIA 4WBSA 4HLUA 1G3UA 2NGRA 4AG5A 2JLSA 3TK1A 2IYXA 4UNQA 1VG1A 4YXWA 2ZITA 1CKEA 4ZCLA 4LZZA 1RFLA 3U6BA 1XPRA 4DLUA 2D2FA 4LHXA 4ESVA 1H8ED 5IRCD 2ZR7A 2XSZD 4JLMA 1KI3A 1SKYE 5CDFA 4ON9A 1NRJB 2OESA 3U2QA 1T91A 5BWMA 3REGA 5F98A 1IN5A 3MG9A 2FA9A 3B2EA 3DEFA 1HT1E 3BFXA 4LJAA 3C8UA 2IW3A 2Q21A 3T1QA 2VP9A 3QEOA 4UJ3A 5AK0A 4LRWA 2BMDA 1KK1A 1GOTA 4WA7A 1ZYUA 2FWRA 2UZ3A 1G3IA 1G21E 1R8SA 3AVPA 4EJSC 5KNCA 3K0FA 3V00A 1QF9A 4ZCMA 4E5UA 1VG0B 3NBFA 3PUZA 2CK3A 2P3SA 4A8JC 3Q85A 3K0SA 1R0ZA 3AM1A 1G5TA 2W2TA 2A78A 3THYB 4BRUA 2C8VA 4CEHB 2BJVA 2EFCB 1M1YE 1SXJE 2FNAA 3THXA 3BGWA 2ZJAA 1FP6A 1Q57A 2GTPA 1KO5A 1SXJC 1E9RA 1ZRHA 4URZR 2WHXA 2GESA 4K81B 1AIPA 1GUAA 1G6HA 4OI1A 1JR3D 3LX8A 4FIDA 3RLFA 3ZS8A 5IF9A 3TR0A 3AKCA 1SZPA 1XTRA 4C3ZA 3SNHA 4US0R 2V6JA 4Q1AA 6Q21A 3DOEA 5BN5A 4ZIRA 1IHUA 2FE4A 3C15C 3KXKA 4IJMA 1T5IA 2ZRHA 3IEUA 2JLWA 3QEJA 2VP0A 1HTWA 3TE6A 3GLIE 3EC1A 4I1OA 1YU9A 2BKUA 4BFZA 2QORA 1U9IC 3A1UA 4LBZA 2ZREA 2QRNA 4CEIB 1E96A 1FQJA 4P33A 5EUMA 3A58B 4G0NA 1G3MA 2W6IA 2WIBA 3TIFA 5JWRA 1NIPA 2GVDC 1UKZA 1Q22A 3SBDA 2IX3A 1RZ3A 2X1VA 4CDGA 1KDOA 4FCVA 4ZO4A 2C5LA 1SVOA 1XMIA 1Q0UA 2XZPA 2J1LA 3SU8A 2MSCB 1RRFA 5EQTA 2YYZA 3ZQ6A 3ECCA 5CK5A 3HR7A 2FEMA 2GCOA 1AGRA 5SZJA 4A0FA 1OB5A 2DCUA 821PA 2R6GA 2HEIA 3AH8A 1KIMA 4Z8XA 2I1VB 4MKIA 1X1SA 1JBKA 1Z8FA 4RCZA 2RMKA 3FKQA 3LW7A 4ZV4A 3C5CA 4GRAA 3B78A 1U0LA 2GJ9A 2KBFA 3K0FB 1W2GA 4UXIA 4V0MA 2I1QA 5GJCA 2ZM5A 3IO5A 1F2TB 2WJJA 3TW4A 3KKMA 1EGAA 4Q4JA 4IOJA 4QHSA 1Z0AA 4UNPA 4Q00A 3UMFA 1W36B 4I4LA 3SEAA 5JCZA 1FPMA 1M6NA 3D7MA 1GG2A 1E2QA 1T3SA 2JDIA 1DO0A 2ZYTX 3KUCA 4BLPA 3THXB 1MO3A 1KI7A 4FMCF 4CVNA 1FNMA 4XVUA 4MKFA 4IDQA 2OFOA 1DG1G 3PEWA 4S35A 1W0JA 1UKVY 2YWGA 3F8TA 1QHGA 3PFIA 3CUEF 1X8JA 5TARA 3KKQA 2BEKA 2PZFA 5JBQA 5DNYB 1R2QA 3DL0A 1EWRA 4JBXA 4PZYA 2O8FA 2MMCA 1N5IA 2WSMA 1N5KA 2IYLD 4HLQB 4Q1EA 1CJUC 3LLMA 5CM9C 5AJZA 1GAJA 2IXEA 2HCJB 4NYMQ 1E1RD 2JGNA 4XIGS 1SQ5A 4YMTA 5DN6A 2AX4A 1VYUA 3A1WA 4XWAA 1E1QA 2BCJQ 3S1AA 3THOA 1BYUA 2QAGC 3P4YA 5HZHA 4NHOA 3IUYA 4TTRA 4JLPA 5FFMA 5TXGA 3OEEA 4UJ5A 5FOSA 1U0HC 5JHHB 3ICQB 3AVWA 4RD6A 1Z6GA 2VSFA 3BH6A 5J5CA 4PC3A 4B34A 1TQ6A 1G291 2IUTA 4TYYA 4NMMA 2WJGA 4QNRA 5CLQA 4BLTA 1SVKA 4V0KA 1M8PA 1Z6TA 3WMGA 1A4RA 3L8YA 4RZ3A 3SJAA 3EIHA 5BYKA 2JIZA 2WOJA 5C4MA 1KI9A 1Z47A 1J8YF 2FSFA 4XVQA 5DE3A 1NBME 2FEOA 1YVDA 4TT3A 4M9QA 4QC2A 4HUQA 1B23P 4Q66C 2XZOA 3VR3A 3KKNA 4A82A 4TLEA 2VH5R 1EFCA 3LLUA 1G5PA 2ZSEA 5FUXA 1W49A 3B9PA 2PMDA 4AK9A 4B2LA 5FI1B 2EQBA 2F9MA 2XZLA 4GMXA 4O0MA 4C0BA 3PEYA 1IXRC 1UBEA 3LVRE 3UXMA 3T06B 1F5NA 1N0WA 4M1SA 4G5RA 1MRSA 3KB1A 1RVDA 3IGFA 1D2EA 5JHGB 3LD9A 3Q8XB 1E79D 1OYWA 3QBVA 5CM8B 1KMQA 3RSOA 1FMLA 1II8A 4LPSA 1I4LD 4M1KA 4YDHB 4TMVA 3EXAA 2WMOB 4JJKA 4Q4JB 2ZANA 5TV2A 3SDZA 4DVGA 4YQFA 2RGAA 4HLDA 2C95A 5CYPA 4AKGA 4JLOA 5EXPA 2ZRPA 4HAXA 1J90A 2L0XA 4IKEA 4EPVA 2JJ1A 1E9EA 3BORA 3R20A 2ZAOA 1EK0A 5AJYA 1OFUX 2Q3MA 4QBFA 2PT5A 1ZM7A 2A2ZA 2QAJA 4TQ9A 4IVPA 3U60B 2XGJA 4WZBE 1ZU4A 3OEHA 5FL7A 5FPSA 4LJ7A 2ZETA 1DBSA 2O8FB 1QHNA 5JWOA 1G4AE 4G5QA 1ZUHA 4LPKA 4EPXA 3SR0A 4BZQA 3A37A 3CW2A 4JZKA 4KFRA 5J4YA 2VBCA 4PQFA 2I4IA 4NP6A 4RZXA 2H1LA 5FR2A 5HR5A 3W3ZB 1NKTA 4GFDA 4WW0A 2WWFA 3AF0A 2P6RA 3S1AB 1XF9A 3CWQA 4P31A 1VG9B 4M1YA 4PPFA 2ATVA 1OIWA 4YXWD 3KL4A 2W0SA 4EPWA 3I5YA 2W2XA 1TL7C 3PIRA 3AVVA 2W83A 4OI0A 3KB2A 3NEJA 3H1TA 3TRFA 4FCWA 1OXUA 2ZRLA 1XB2A 4M4SA 1S9HA 4YMSA 2N1BA 3VKWA 1W7AA 4O3MA 1FP7A 3BBPA 2DWOA 3EZ9A 1OSNA 2WJYA 3MLEA 4CEJA 4EKDA 1GILA 3ZZUA 1E2GA 3KJEA 1PVOA 3D3QA 2H7VA 3PG5A 4HUQB 3SOPA 3M4YA 2V8OA 2J87A 3V4FA 2QU8A 2IS4A 1HE1C 2AKYA 4LYHA 1KO8A 2VF8A 1AA9A 1EFUA 3KQLA 2CK3D 3QPUA 4A15A 4B3XA 1DAMA 1D8TA 1VECA 4IOMA 4M1MA 5BN3A 2QROA 3DMDA 1ZD1A 2N46A 1NLYA 4F92B 3TSZA 5BW8A 4HZUA 2EYUA 1N6LA 1XEWY 1E6CA 3PENA 2GNOA 1II8B 2GAAA 3AEZA 5KU1A 2GBLC 4F7WA 4DSUA 1S3GA 2YC4C 1IJEA 2WSSA 1SVIA 4OQLA 3GEHA 4IRUB 5SZKB 3VNUA 1QBKC 3B6EA 3B82A 3LXXA 3SC3A 3ZS9A 5KDDA 1CP2A 3O8CA 3D8BA 4KSCA 2OSBA 1IQPA 1YR8A 2FGJA 4HAVA 1HT2E 2D3WA 5DYGA 1KNXA 1E2DA 2E87A 1L8QA 2YKGA 1BS1A 3PCRB 1E4VA 2AK2A 4LWZA 1UAAA 5KNBA 2R6FA 1UKYA 3LBHA 3O47A 4JLNA 1AS3A 1OYYA 2GXSA 4FW9A 3UATA 1Y3AA 2B21A 2IT1A 3BFVA 4L5BA 4HYYA 4NTZA 4TL9A 4US1R 3KQKA 1IN7A 3LWNA 2QPTA 3EZ6A 1NP6A 4KV9A 2O8BB 4LBYA 3ONWA 2G9NA 2IS1A 2ODNA 4Q18A 4W5JA 1QHHA 3P32A 4LBWA 3W8NA 1S1CA 3LVQE 3Q7QA 2GVZC 2W6ID 3AUXA 1EWQA 2J5XA 2OE2A 2JLUA 4V0NA 3BB3A 4WXRA 3SE0A 3ZVMA 1DADA 4B75A 1NG1A 4HDQB 3U5ZB 1KK2A 1PJRA 1E9DA 2QGZA 2RHMA 3CPEA 4HAZA 2B8WA 4BEBA 4QXAA 1RYFA 1Q20A 1UDXA 2ZR0A 3VX3A 1N6OA 5FBWB 5L3RA 4BEJA 4YMUA 1TEVA 3K0AA 1FW6A 1XD8A 3WNBA 4Z51A 1HY3A 1XMVA 2QP4A 2ZJ5A 1P9WA 4Q1DA 4CEJB 4M0LA 3TR5A 1DPFA 1GZSA 4CW7A 4C7OA 3A1SA 3B1VA 1OH5A 1T0HB 1NIJA 3AF2A 5CB8A 4XTCS 1IAQA 4DCNA 4PZZA 5BXQC 1Q44A 1FFHA 2ANCA 1XZPA 3FWYA 1P9RA 3SZRA 3GLFE 3QVUA 2UZIR 4KVGA 4AWXA 3EAQA 2XX3A 2E9SA 3DM5A 4M22A 2BOVA 1Z6XA 2JDID 3IO3A 2CHGA 3CM0A 4HZUB 4NYJQ 2JA1A 5J40A 1KY2A 3VX4A 1ZM2A 2F7SA 2JJ2A 4LYFA 2O0HA 2ZRKA 1W0JD 3FVQA 3GCGA 1AN0A 1O3YA 4HB4A 4KAXA 2WVJA 1VCOA 4H1VA 5DGXA 5KOYA 2A5DA 4F93B 5FTJA 4R71A 4BZXA 1GKIA 3MD0A 3OESA 5FUVA 1FUUA 1ZW6A 2J3EA 3QF4A 2A7QA 1WF3A 4WOPA 3C16C 2EYQA 3C5HA 1JXMA 2KSQA 2IWHA 2BEJA 2NZJA 2GZHA 3JZMA 4NH0A 5DN6D 1II0A 1E1QD 2FH5B 1CF4A 2Q9AA 1D2MA 2PZEA 4C0JA 1P4SA 4WAUA 4OHYA 3G0HA 3OEED 1VIYA 1N2CE 2XTNA 3A1VA 5LPNA 4LJ4A 3OHMA 5L8VA 3GLFB 4RZUA 2WBLC 1JQLB 1E9CA 1QHHB 3N2EA 4BFTA 2VSXA 2ZROA 5E7MA 5FR1A 3K8YA 2ZJ8A 4K8OA 3ND8A 1T0JB 4JBYA 1XCMA 4N0EA 2QA5A 2JIZD 3RWOA 1UBFA 3O8DA 2F1JA 2C04A 4EAQA 1W4CA 3DZDA 1ESMA 1GKYA 4TT3D 5JEDA 1U81A 2R2AA 2IHBA 4AC9A 3E1SA 2VP6A 3U7GA 1JR6A 3KDSE 3K0AB 4B6FA 2RGBA 3A4MA 3RSLA 2GAOA 3B1ZA 4QBIA 4PR0A 2A9KA 1U8ZA 3ZQJA 4C7OB 2W6JA 1FMJA 1JQJC 4B32A 3OE7A 4KO8A 5IHPA 1NN5A 1G3RA 3SN6A 1E99A 4LSGA 4DHEA 1XU4A 3K09C 1R7RA 2H8KA 4Q1FA 4HB3A 3NC1C 1U8AA 2XTZA 4MA4A 4PAMA 3IPYA 1HEIA 1HQCA 1ESNA 3B1WA 4PPQA 4XSGA 2JLRA 1CIPA 4MRRA 1AZTA 1N25A 4MQBA 1KJWA 3EPHA 2HV8A 2D62A 2RGEA 4TTQA 3ZLJA 3AVYA 4TZ0A 4MYCA 2RGNA 1W1WA 2OO7A 3K9GA 2JJ1D 2GCNA 3U3JA 1TTTA 3BD9A 1E2EA 1VG8A 3AKYA 4C0KA 1MABA 1YZNA 3GMTA 3DPUA 4O2LA 5AJXA 3PJRA 1MKYA 2X19A 3OEHD 4Q4HB 5FL7D 4F91B 2NO1A 1E4YA 1E2PA 1W2HA 4GOXA 4KYUA 5AWFC 1NL3A 3FDIA 3CX8A 1WCV1 3GFOA 5GJVC 3U3OA 1GSIA 4DSOA 3QF4B 2WAXA 1AS2A 4L16A 221PA 5HKKA 1X86B 3HDTA 1SVMA 4JSYA 3MCAA 2CJWA 3DZ8A 2ZJYA 4H1UA 1NN1A 4M1OA 4PSKA 4PPGA 4MYHA 3DDCA 2Q3FA 1R5OA 1QHSA 4TTPA 5KSYA 4NKRA 1Z07A 4YONB 1QVAA 2GEDA 3BFKA 1TU4A 2GXUA 3OIUA 3RS3A 2YOHA 3EPJA 1V43A 1YHNA 1OKKA 4NYIR 4FWTA 4W9MC 4BGDA 4LDJA 3U7FB 1GRNA 1A1VA 1P2VA 1RIFA 3EPLA 2P6UA 2FJUA 1QHYA 1W46A 4MKHA 4B33A 3K9NA 1FUKA 1KY3A 3FTQA 4FN5A 4HDOB 5B2ZA 4A9AA 2YVUA 1WBDA 2GJKA 2IYWA 4II7A 4Q4AA 4B2PA 2JLXA 2ZUDA 3BOSA 5EP2A 2G1KA 2WWXA 2QP9X 4AURA 1L2TA 2IXGA 421PA 2IYVA 1VYVA 3E2IA 2V1UA 1KNQA 3DHWC 4KFUA 2ZYVX 4XH9B 3SFVA 2DR3A 1JEDA 5JRZA 4OQMA 5EZ5A 3TSOA 3UK6A 3DM9B 1I2DA 2KB0A 2ZVQX 3T5GA 1OE0A 4I1SA 1UM8A 2CMKA 2ZE7A 2G0TA 3U7HB 2IEYA 2WSSD 2ZI7A 3KJIA 1D9ZA 3C7KA 1VIAA 1H8HA 1ZM4A 4J0QA 4EJSA 3J81k 3OF5A 3T61A 3GFTA 2AK3A 3BS4A 3ZYCA 2NZ8A 2QQ0A 4A8JA 1MABB 2QUZA 2C9YA 2VQSA 4PQYA 3SQXA 3L8ZA 2BVNA 3K53A 1US8A 1OHHA 2J7KA 4TYQA 4H9GA 3B60A 1LFDB 2ZJ2A 4TMKA 3HU2A 3H84A 5E4FA 4BRWA 1SXJA 5D3QA 3QKUA 3QY0A 3LY5A 3SYLA 3OIWA 4TLCA 1I4DD 4UXHA 2OAP1 4JKIA 1AQUA 3I3SR 1GFIA 4D4KA 2V3CC 1RRCA 1QRAA 4ZI2A 3QE0A 2OXCA 3QXHA 3ZD7A 2QNRA 2CJWB 3ICEA 4D2IA 1TNDA 5GJWC 2ZRNA 1MT0A 2WPDA 3CR7A 4CRWB 5CLLA 4B47A 5KSZA 5LD2B 4RFVA 5CJ2A 4LJ9A 4M53A 1I2MA 4DDUA 1OXSC 1XD2A 2WWIA 4M9ZA 3RS0A 3KFVA 3A6PC 3I92A 2VO1A 2IYRA 1KI4A 1CS4C 5KSPA 4BLRA 5CYOA 5E7IA 3TBKA 1R10A 3R9IA 4JLJA 2HLDA 3GPLA 3R8FA 2FG5A 2ATXA 4PO1A 3GLIA 2CLSA 1XDBA 2LWIA 2EFDB 3T1VA 3ASYA 2GXQA 1QVRA 1ZM3A 2Y8EA 4OQXA 4V0OA 4WXPA 1F2TA 1HURA 1F3OA 1G8HA 2P67A 3KUDA 4NCIA 4G5SA 3BB4A 2ZTSA 4IFBA 3VMFA 4Q4AB 5DO9A 5KSOA 1KAGA 2R6CA 5GADl 3EC2A 2X2EA 3FMPB 2QBYA 1Q3HA 2H92A 2YZ2A 1SVWA 3REFA 1AKEA 1ZNYA 1SKYB 3EZ2A 4KCGA 1R8QA 1SGWA 5HPYB 4KHZA 2JLQA 2PJZA 2JJ2D 1FTSA 3QG5A 3ZVLA 2ZS7A 1RYHA 4GT1A 4JL6A 4RZ2A 3IBGA 2CCGA 4QM6A 3TUZC 4NPHA 4HLUC 3PUXA 3L0PA 2C96A 5AUQA 2A30A 4MRSA 4EJSB 1DTSA 2IF2A 5EP1A 1AK2A 5EXTA 4A8JB 3KX2A 1G64A 1KMHA 2FSGA 3RNLA 4IOLA 5G53C 1US8B 4P4TA 2ZPTX 1Q3TA 1P73A 2D74A 3M0EA 4B3GA 1JAHA 4IOKA 4MGKR 4ZDJA 2OHFA 2ZAMA 3PVSA 3GQBA 1UPTA 1SXJB 2D06A 2XNDA 4M2LA 2VEDA 2VL7A 3I61A 2JAQA 2QI9C 1UJ2A 1VHTA 4MYUA 4NCNA 3R8CA 4DLYA 1PLJA 3LRPA 3W6PA 3ZDQA 1ZUIA 1EFRA 1WXQA 1EX6A 4CF7A 4OJQA 1WDTA 3LNCA 1ZU5A 2DFKB 1XD2B 3UG6A 4ZI3A 5J4HA 4GPTA 2KBEA 1A2BA 2E1RA 4NE2A 4Q7MB 2HUPA 5B30A 1XTKA 4NYMR 5G40A 3BK7A 4W5WA 2JEOA 1T8UA 3FMFA 1VMAA 1Q21A 4X8HA 5BYJA 1XTIA 1ZC4A 2GRJA 3L2OB 2F43A 3GLIB 5AUNB 2XAUA 2J0QA 2PEYA 5B57C 2BV3A 2W6JD 3AP2A 2A5FA 1E2MA 1NJFA 3OE7D 4D0GA 1ZJ6A 2J0VA 3PEVA 5DYIA 1DAGA 3KJHA 3Q72A 4ZDWA 2IA5A 4CIDA 3LV8A 1N5JA 2OXRA 4DJTA 1A2KC 3ND9A 2QBYB 4LBVA 2RB4A 3VQTA 4B2IA 5H8WA 1E9FA 1NBMA 4ESHA 5G3YA 3AV0B 1WBBA 2FDCA 2B92A 4URYR 1Z2CA 1G8FA 4Q1CA 4F4IA 2P0EA 1KI6A 4QGHA 2ASEA 3WNDA 4M9XA 3NBYC 3PUVA 4A4DA 1RJ9A 1IN8A 1Q12A 2HF9A 2OAQ1 2QTFA 1QDEA 3TQFA 2EFEB 3Q7PA 2IUUA 3VAAA 1UKEA 1J2JA 1IY1A 2ZU0C 3KJGA 2VRWA 2AHOA 2GK6A 3I8XA 4JVMA 1OB2A 3I8SA 3P26A 4B3BA 5HKKD 1E0SA 1SKQA 4LHWA 4GL2A 2WKPA 3RDPA 1KMHB 4EFNA 2R62A 4QJ5A 4OBEA 3U7EB 2XOKA 2ODEA 4LCBA 2BWJA 521PA 1IN4A 2BJWA 3VU9A 4AIIA 1KK3A 5EP4A 2B8TA 2QG6A 3A4NA 4KFSA 4RFSA 3BRWD 1SULA 3MJRA 3H4MA 4BZPA 4W5HA 5KDLA 3I73A 4V03A 4OHXA 3U4QA 4TZ6A 1F60A 1U99A 2V55B 3EZ7A 1FQKA 1OKKD 2HJVA 4QG7A 3GJ3A 5HCNA 3WYAA 5KHOC 2PLFA 2VHUA 1S8FA 4JJZA 4LV8B 3ZVRA 3QKRA 3CR8A 1VKJA 1YRAA 1TUEA 3AB3A 2CL7X 4V02A 3T34A 1DS6A 3WMFA 2AXPA 1AM4D 2OFWA 4AYWA 1XXHE 2MMGA 1Z6AA 2F43B 1AKYA 2BC9A 2OUKA 1CJTC 3MMPA 1P75A 1J8MF 5JECA 1LY1A 3LDAA 2BBTA 4ZKDA 2WICA 1ZMXA 1K8RA 2ZE6A 2QT0A 2NPFA 4EUNA 1RPZA 1O87A 1YR7A 1VCMA 3LQRA 4ZPXA 1AZSC 1OH8A 1C4OA 1L4YA 1MOZA 4GDFA 4TL8A 3TAUA 3RHFA 3ZZ0A 1UDWA 4YMVA 4JT4A 1NSFA 4HI0E 721PA 1N6HA 2VP5A 1RE0A 2IYZA 3QXSA 3VR4A 1OXVA 2CDNA 2NO0A 5DHFA 2O8EA 2V1XA 1H8HD 3FFAA 4UNNA 2ZYUX 4DCVA 4RCYA 3TKLA 1NVUQ 5DI3A 3RYTC 5FTKA 1GRQA 1MO6A 3UIEA 2IYUA 1A7JA 1KI6B 1HE8B 5P21A 5SZIA 1WE2A 2AL7A 1QHXA 1HA3A 1HH4A 4DLTA 3NG1A 2O8BA 3GD7A 1KO1A 3SJCA 5A5GA 1OHHD 1RKBA 1RJ9B 2DWPA 3BERA 3IPXA 4EIWA 1M74A 2ORWA 1VCNA 2F3RA 1Z29A 5JI3E 1ZNZA 1SXJD 2AD5A 3F5FA 3FPAA 4P0TA 5A4JA 2QPAA 3EIQA 1WMSA 2CLDX 4XOIA 3CLVA 3IDQA 3ADDA 1XWIA 4RJLA 4U5XA 2WWGA 3LW8A 4URUR 3UWOA 4XWOA 4MGZR 2WPDD 1G8YA 4MDEA 2OBNA 1PZNA 1ZAKA 4OK5A 3FB4A 4RKFA 3K70B 2XXAA 1KHTA 1S9DA 3VU9B 1Z28A 1AGPA 4Q9HA 4FI3C 2ZS9A 1KO4A 2V6IA 4RFSB 2GETA 5J4LA 4PC7A 1OW3B 1P9NA 5H68A 3U4QB 4G1UC 3Q5DA 3N5CA 2HLDD 4IDHA 4K46A 3RANA 2FU5C 3F3YA 4E07A 4MYTA 1BYIA 3P4XA 2BMEA 4DLZA 2CL6X 3QKRB 4X8LA 3B9QA 5TY0A 4HB0A 4US2R 1M7GA 1W4BA 2BMFA 3GJ4A 3W6OA 3HU1A 1G7SA 2OCBA 3TLXA 1W36D 3QBTA 3T1OA 2HXYA 4JYCA 3SYKA 5JFGA 3EWSA 4DSTA 3KKOA 2REOA 2YWFA 3MSXA 1RW4A 3MWKA 4P4SA 2PLRA 5FBQB 4MRPA 4OL0A 1T5LA 3FMOB 4JL5A 4FMDB 3NDPA 3EW9A 1MV5A 3NIBA 4WVFA 5DSZA 5FBLB 1KSFX 2IK8A 4C0QC 3TNFA 1KI1A 4C4PA 2ZSAA 3LAWA 3THWA 3K9LA 1LF5A 1DG3A 1XTQA 2OG2A 2RGXA 2DFTA 2Z4RA 3AF3A 4DXAA 5KPJA 2EW1A 2KE5A 3GLHE 4RKEA 3UKDA 1AQYA 3E70C 2AKAB 4HEJA 3BH0A 4LI0A 5TMPA 1NY5A 1JJVA 5IK2A 3NWJA 1F48A 4CYMA 3RRZA 4IW3B 2EU8A 1LF0A 2HF8A 2DYKA 2O8EB 4NU0A 3CZQA 3ZIAA 1EESA 5JJKA 3KQHA 5DI3B 1VPLA 1IY0A 2IHYA 4TLDA 2XB2A 4OQFA 2RGCA 1TF5A 3KQNA 3VKGA 1DAHA 3ETLA 1KSGA 4TLBA 2BIFA 4DBLC 3GLFA 1DARA 5C1BA 1ONBA 2O5VA 4N1AA 2BMJA 2OCYC 3EA5A 1M34E 3EZFA 4IXMA 1SVLA 4NYJR 3P1JA 3NH9A 1XZQA 3VR2A 2XNDD 1CJMA 2A5GA 5L3QA 2BM1A 2WIAA 5ELXA 2QTHA 1XFAA 2QGNA 4MITA 3CONA 1J70A 4A0HA 4PHTA 3RC8A 1ZCAA 2Q3HA 2XB4A 3GJ8A 4DCTA 1C9KA 4FINA 1EFRD 4JIMA 1TADA 2W2VA 2X2FA 2P6NA 3D6TB 2XXAB 2C77A 5FBVB 2IXFA 4M9SA 2CE2X 3K1JA 3PUYA 2Q6TA 2QQEA 1UEIA 4LC1A 3TSWA 1Z06A 2VP2A 5J4KA 4KLNA 2ZRFA 4UXJA 3PUWA 5JS7A 3TQCA 4BLQA 3QQ5A 5LB4A 3NDBB 1XJCA 3SFZA 1XEWX 1TQ2A 2NQ2C 2OCPA 2F55A 2QZ4A 2R44A 4TQUS 5EJEA 1P60A 4AI6A 1TAGA 1WRBA 1BH2A 2J7PA 3CRQA 3EIEA 4MKGA 4QGFA 3GLGA 3SYNA 4P4SB 3BIFA 1NVVR 1ZNXA 2BHRA 2IYTA 4JKYA 4JVLA 1KAOA 1NBMD 2H5EA 4LV6A 2N42A 4M8NE 5JZVA 3THWB 4JMPA 3FE2A 4Q4HA 3R9WA 1TX4B 3DMNA 5C46F 4FXPA 2X77A 1GWNA 4R98A 4DDWA 1S2MA 3IEVA 4C2UA 3X1DA 2J0SA 4TWZA 5B64A 1JECA 1Z6YA 4PHGA 3X1YA 2PH1A 1NJGA 3P20A 2ERXA 2VPPA 2FGKA 4A92A 4NONA 2VSOA 4DUGA 1R0XA 2VTKA 1DEKA 3FKSA 2AR7A 1R5NA 4FD2A 4L9WA 3K09A 4URVR 4KBGA 4C0LA 2GA8A 3AF1A 5FH9A 3Q9LA 4LY6A 1M7BA 3VHXA 4HZIA 4XD7A 2FMXA 3MRSA 3WHKA 4AY2A 1CULC 1SHZA 2CCJA 2JJ8A 3LO5A 4EDHA 3HPQA 1KK0A 5FTNA 3TVTA 3K9HA 1OXTA 1X8LA 5B58C 4KFTA 4D0LB 2XOKD 3AKEA 3WYGA 3GLGE 5KTYA 3ADCA 2FV8A 2KWIA 1E0AA 5CIQA 3K70D 1U94A 3TUIC 1FZQA 2ZYWX 3HR8A 3WNCA 5L3QB 4IDOA 2QMOA 3HJNA 1E2IA 3W3AA 2FOLA 4HDCA 1X3SA 1GDDA 1FNNA 2J9RA 2R8RA 3MWLA 2HT1A 3QG1A 4B6EA 1ZD9A 2FPKA 2ONJA 1VHLA 2AWNA 1X1RA 2CE7A 1GM5A 1W5SA 1MO4A 1YZTA 1ZINA 3SHFA 1E3MA 4DCSA 1Z22A 2QN6A 1E9SA 1E9BA 5H70A 1DAIA 2R9VA 3EG5A 4JVSB 4LC0A 1JR3E 5FOXA 3CRW1 5KDOA 4DB4A 2C9CA 4I1UA 1ZVQA 3KFXA 1P3JA 1CRPA 2IYSA 2J45A 1XX6A 1J7KA 4ASUA 4OYHA 4IDPA 3CX6A 4PO9A 1GNPA 1D5CA 2ECKA 5K8LA 4LJYA 2C98A 1HYQA 1YZLA 3SHWA 1R0YA 1G1MA 1D9XA 2O8CA 2GWHA 1OV4A 1JPNA 5FTMA 1N6IA 1CR0A 3GLGB 5JLJA 1P6XA 2QSYA 2YHSA 3CRRA 5FL3A 4MRVA 1XTJA 4DLXA 3MWYW 5HCIA 1TU3A 5TB5A 4I99A 2W58A 4BE7B 1GITA 3AUYA 4KBFA 2HT6A 1QG4A 4Q9LA 2VHCA 4TQAA 4EFMA 2YWHA 2FX3A 3IQXA 3NVAA 2AD1A 4RD1A 4EFLA 5HE9A 1YZKA 2V7QA 4B76A 1IXZA 4QHTA 1YR9A 3UANA 3BB1A 2FN4A 2YWEA 2OILA 1G7CA 1XJ0A 3PV0A 3ZJYA 2FZ4A 4D81A 2ZI4A 4N0DA 3T12A 2REXB 2BDTA 2IC5A 5A0FA 2B7BA 3CKLA 3WP1B 1UADA 2YJTD 3VR6A 1LTQA 2OLJA 4QKQA 2EWWA 1CXZA 2QMHA 4Z54A 2F6RA 2PT7A 1NLFA 2P65A 2WZQA 3E5HA 5C18A 3LXRA 4AKHA 1XJQA 1Z0DA 5E7JA 4LK2A 2F1HA 4BFUA 3B1YA 4PSAA 3SQWA 4M1WA 1OH7A 4P32A 1KI2A 4QFMA 5F9HA 1N6NA 2R6AA 4BFSA 4C2TA 3EX7C 2FFQA 2OBLA 1HV8A 1FOEB 3CPJB 4OK6A 3EWAA 3U3RA 1PUIA 3AVQA 2OBMA 2ZI6A 1GVNB 3DKVA 2WWWA 1CJKC 2Z43A 1N0UA 2QTVB 2QEQA 3CNLA 1G8PA 5KUTA 3ZH9B 4NL4H 3IIJA 1LV7A 2DFNA 2ZUBA 2C99A 1H65A 1T3LA 3CF6R 1LB1B 2QPOA 4Q5IA 3LQQA 5DI9A 1E2NA 2FFHA 2QT1A 4L8GA 4G3XA 4TMTA 4LHVA 5L3SA 4PSVA 4OHZA 3TAHA 2W0MA 4HATA 1G19A 2ZI5A 1N6RA 3IHLA 4B3FX 4LYJA 2EWVA 2H16A 3EASA 4EPYA 3CRMA 3GJ6A 2CVHA 4D4MA 4ERNA 3JZAA 2NMVA 3IBYA 3NKVA 3CB4A 1S3SA 1VTKA 3TGPA 2O8CB 5HTKA 1T3HA 3K0CC 2WAYA 2O52A 4TYWA 1XCGB 3RABA 2ZIAA 4JLAA 3MFYA 3WYFA 5IK2D 2ERYA 4B3DA 1Z3IX 4Z1MA 1P2UA 3W9YA 1Q1ZA 1ZNWA 1G7TA 2DHRA 3QJYA 3AVXA 3ZIAD 1W44A 4Q7KA 1S0UA 621PA 1JEEA 1IY2A 3MAAC 4OI4A 4X8MA 1G3QA 4Y0VA 4URXR 2K5UA 2W00A 1K6MA 3H0KA 3PITA 5FUWA 3OAAA 4JVNA 3BH7A 4LJ5A 4I81A 3FFBA 4Q7JB 2FPLA 3RS2A 1R6BX 1AS0A 4DCUA 3DKPA 4JT2A 2G88A 4NYIQ 2H17A 3TJZA 1LW7A 2TMKA 1TEXA 3ZGXA 4KXFB 1OJLA 5E3HA 3B8HA 1TMKA 4F4JA 2ZR9A
chains in the Genus database with same CATH superfamily
3B5JA 4P93A 5AKYA 3DBRB 2RKOA 4Z7OB 5K6RA 1QIJA 5KJEA 5MFPA 3GVIA 2VSYA 3T5DA 4EG5A 3DLBA 3OQJA 1CDOA 1Q1QA 5A6VA 4X95A 3VO2A 3MJFA 3EGXA 1NMSA 2FEXA 4XYBA 1ZCBA 1DAFA 1NI3A 2VJOA 3OURA 3SJUA 4GOJA 3QXCA 3QYFA 2Y92A 4IJWA 5IJXA 4AJEA 4GZ6A 4EAAA 5JEEA 5LBTA 4IKOA 1JHVA 1HQDA 4KIFA 2OUIA 3WLQA 1UJBA 4MUMA 3LLSA 3SX4A 4QBTA 3KALA 2H4XA 1MRZA 4G01B 5CXXA 5J2UB 2NNWB 3F7NA 3VR5A 3B1FA 3WO1A 1T1SA 1RBMA 2VHZA 4JK3A 4DWJA 2HA7A 2FRDC 2VDNB 3BD8A 3P71T 5L3SB 2JG3A 2X23A 3DZHA 1G41A 4RW0A 4O08A 4IZ6A 2B61A 5CX1B 3V80A 4CG2A 3KXLA 3DOFA 1NI4A 3DE6X 4H31A 3FFWA 1XZHA 1LGYA 4L9RA 2Q1YA 1JDBC 1FU8A 1QTNA 5B1IA 3L7AA 3QE2A 4RXTA 3ST7A 1OH6A 1S8NA 3D1VA 2EP7A 3KVYA 1TZMA 1IONA 3GJYA 3ESCA 4R2HA 2WPNA 1WU7A 1FVHA 4AMUA 2AG5A 1NPTO 3H9GA 5CT5A 2GZAA 2QUIA 4GBMA 2GYUA 2MTBA 2ZIUB 2H57A 4NATA 4OB7A 1JHRA 4QQKA 1KFEB 3OT1B 4JT9A 4M0MA 1L5NA 5JJLA 1FP2A 4JEMA 3KVRA 5EPOA 4AYXA 1RQRA 3AG6A 4QDUA 2GZDA 4D02A 1DQNA 1I4TD 1F8XA 3A4IA 2R1VB 1J6UA 4H60A 1RCTE 3F3SA 3GG9A 3KQSA 2O5CA 1KVQA 4Z5XA 4QTTB 1IJFA 4ME6A 4XD7D 1Q7RA 4OMUA 3KKLA 4EYQA 2DB3A 2EGGA 4Y2HA 2OEPA 1A04A 4FDAA 1EG2A 1GYPA 2A1TS 2B0JA 1AKMA 4OV6B 4RHEA 4Z0TA 2UZ0A 5HQTA 3OSUA 2Q6VA 3H1BA 4ZKEA 5C7OO 4YACA 3UMSA 4FJ2A 4DDTA 2IXBA 2ZXUA 4H7IA 5FPYA 4DT1A 1XBTA 4YALA 3SS8A 4CQLB 4HXEB 1QONA 3MBOA 1KE1A 3U17A 2C9OA 4F6LA 4GICA 2Z3ZA 1P9OA 2ONYA 3DKRA 1W48A 4BNMA 4HLCA 4BB0A 3WLIA 2OMKA 3BK1A 4PPNA 4I14A 4C03A 5LZ4A 3ZVNA 3IDOA 4LRQA 3RWMB 2SHKA 2GJ4A 3G79A 1WG8A 2QAGA 4G0XA 4TMXA 4IDCA 2Q49A 1F9AA 4ZU3A 5G4LA 1JNXX 1IAVA 2IBMA 2QXUA 2ZT5A 3N2KB 3QF7A 1FL9A 3GNLA 2HL6A 2IYYA 3I2KA 4PLCA 4XRRA 3RRNA 1BKDR 1E1KA 5FDFA 5IJ0A 2FFRA 2WZCA 5FNVA 1LQ2A 1SU6A 1ZITA 1WZ2A 3LIPA 4NJMA 2BMWA 4LDRA 2ZJOA 1KYIA 2J07A 4ZANA 2WT9A 3ZCTA 4E12A 3C3KA 1JT2A 5C4GB 1ZSYA 1LVHA 3IBFA 1I8TA 4CM7A 3G0BA 3PTLA 2FPIA 2JKYA 3LBAA 3QI7A 4PGGA 4JXXA 1N2IA 3BRCA 1ZSVA 3GRFA 2NYUA 3S0JA 5I9TA 3U40A 3X2FA 5KEIA 3X3HA 1E1NA 3G6KA 3OM1A 3K2EA 1UDRA 2BKEA 3OHPA 2QYTA 1GXSB 3EA0A 2IHJA 2P4UA 2VF4X 2FPMA 2E89A 1JMYA 1JFVA 3EPPA 2QTBA 1IULA 3GP5A 4QDOA 3VZBA 2JHFA 3W5AA 3DZKA 2XWBF 2HX1A 1M8KA 1RJFA 4H7FA 1M8FA 3IELA 3EBOA 2EJWA 3W1VA 3ZXSA 2CL0X 5DNAA 2H52A 2B9VA 3AIMA 2ZPAA 3CH4B 5EKSA 5FLYA 2J6CA 2A3RA 2NT4A 2VDRB 4NK4A 3PS9A 3RRMA 1PLKA 4MIKA 4B3IA 4RM2A 5HJ5A 1JI0A 1Q16A 5A3RA 1N75A 1ANKA 2IYPA 3EXFA 2HFKA 2I8LA 4MGIR 1XROA 3S44A 3TLJA 3W5JA 3U5TA 1JALA 3RS5A 4O59O 4R0NA 3GEIA 1WV1A 3OMLA 4PGHA 4DEYA 2HWUA 4WHMA 4WGFA 4BE7B 1OYOA 2ZJ6A 4TWBA 1L5KA 2GCIA 3QKSB 1ZA2A 3LF2A 5JASA 1E3TA 1F6DA 3AGQA 4Z8YA 1EEXB 3LG2A 5C5EA 3W34A 3R9XB 4KSBA 4B8WA 4M83A 4GM0A 2WSIA 1Y6GA 4GPBA 2ZVPX 4DYHA 2ZK7A 1CZOA 4IH1A 2V3WA 4CETA 3CO5A 4OHKA 3RS4A 2XJ4A 2J33A 4YCDA 2PCJA 4X90A 3V8VA 1BG6A 1TRHA 4UHCA 2ZUCA 1RAEA 3H3XA 5FUYA 2PXCA 3RSSA 5HHTA 1A9XA 4IXTA 1DB3A 4FWIB 1I80A 3NTUA 4HMPA 3QSGA 4TTIA 1DVRA 4YGXB 4BNUA 3SHQA 3RFXA 1Q91A 1ZH4A 2G4LA 2NZYA 3KAKA 5HJ7A 3B7GA 1EG7A 3N8GA 4M1QA 4S2EA 1MBZA 4MVJE 3WJ2A 4TMWA 1HI9A 3T5PA 3HCRA 1PJTA 1D07A 2B6HA 3JQFA 4RKRA 4CV3A 4DM7A 1VLHA 2Q5CA 1LSOA 2XUZA 2UUBB 2DERA 4NENA 3O26A 4BV3A 4POAA 2ZIXA 1FRFS 4TSRA 1NF3A 2RB5A 5BNWA 3WOVA 3PC8A 4P2GA 5GONB 2R1ZA 3V1TC 4AMBA 2WB2A 3WL5A 5FLEX 2LIVA 2X5NA 1OI4A 5G41A 4PX5A 4U02A 1YDWA 5LVAA 1K6JA 2IRWA 1S1MA 3ORYA 2CNKA 1W4AA 3ZV6A 1I7QB 1HG0A 2NUAA 4YUAA 1XCOA 3OM0A 3PUJA 3GGGA 1QZXA 1E5XA 1KMIY 1NBAA 2ZM6B 3FNGA 2GCOB 1CR4A 4AMZA 1GZHB 4BATA 3Q8MA 1DAKA 5KNLA 3QVVA 3BTOA 4X45A 3DF9A 4I5EA 3DJYA 3LL4A 1ECGA 2W6OA 4KBYA 4KJXA 1U7HA 2GAJA 4GQIA 3QXJA 3RRYA 2ETXA 3IMCA 1NHWA 2HTFA 3G9QA 3K96A 4KO1S 4BL5A 1MPTA 5PNTA 4QXOA 1IN1A 1YOVB 2CXRA 4OHWA 3PNSA 3N8IA 1JBEA 4WD3A 2R25B 3OA0A 2XE4A 3OZSA 5CEJA 3HA7A 5JSZA 3JALA 1PEAA 4Q05A 4ENWA 4D9CA 3V4RA 4FLMA 4LY0A 3NHFA 4KXMA 1TT5A 4DLRA 2JJYA 2RBGA 1Y6RA 3B2NA 3T3EA 5IXJA 3RI3A 2XNJA 1P1IA 1L4BA 5E2IA 2PN1A 3QUSA 3GJ0A 3R3VA 4UC0A 3RJZA 3L6BA 2ABWA 2I4OA 3KE9A 5DK4A 4Z9FA 2EIXA 1DRJA 3ZY2A 5K8VA 3LFUA 1NKSA 4DCJA 1A2QA 3VTKA 1XXHB 3NUQA 3CLKA 4QE3A 3WY9A 2D4HA 4GSYA 4U2CA 3GUCA 1CU1A 2FF5A 1XTTA 3V6LA 5EJ7A 2GBLA 5I7FA 3EZLA 1YACA 4XVRA 3IKLA 3VDNB 1OGJA 3KLPX 1T9GR 2PFGA 3FLEA 3W2EA 3GJ7A 4ALLA 4B74A 2CLCX 2XI4A 5J2TF 4MA5A 4OAPA 1UJMA 4FHFA 2DY1A 4FONA 1H6BA 3PICA 3BMQB 5DCYA 4CF6A 2HIMA 3GDHA 5JZMA 4YFVA 4BMYA 2IYAA 4UQPA 1L4EA 3CH6A 1PEKE 4CKEB 1ND6A 1CPYA 1OZFA 5JVDF 3AW9A 1G8GA 3IAAA 1U8FO 2HGSA 2H2DA 2JATA 2Q5QA 2WWYA 1P7CA 2I8AA 4DMCA 5ES4B 1E8DA 1T8TA 2C2GA 3VHLB 3IMEA 1DXOA 2PL1A 1V47A 1RM0A 2HW8A 3NHWA 1L6RA 2VQ6A 3STXA 3GT7A 3BWYA 3UOWA 4MQFB 3H9BA 1ZM9A 2Q5EA 2QLFA 5G4KA 1BMFD 2P68A 1TLFA 4TKZA 2O8DB 4C1BA 3I32A 2HYDA 4U00A 4XQ9A 4C2BA 1KU0A 3NNSA 1XOIA 3JSXA 4D9FA 5J9FA 1NVEA 1ZO8A 3IQWA 1EFVB 2GASA 2LPMA 3HJTA 1L4NA 4C7XA 1MCZA 1ZR2A 4WDRA 3RYFA 4XLTA 3G9XA 3Q0EA 2Z5VA 4D96A 1JTFA 1PLLA 2RHDA 4ARZA 4O33A 3ZK7A 1UFQA 3UV7A 2F8TA 2Q5JA 3KC2A 3V4LA 1WHSA 2CNLA 3ONFA 3PD0A 4TV8B 3HYTA 4TUYA 3C8MA 2H31A 2FPGB 1CDZA 2QX4A 1KZGB 4WKPA 5HXAA 1U0NA 1IOZA 2FEPA 1KMCA 3OIFA 4ZQIA 2QY9A 1FFCA 3D2LA 2VKQA 1PSZA 4BNTA 1BX0A 4ZEWA 1FP1D 5LN1A 3DO5A 3A4TA 3U44B 5EXSA 3VDXA 4IFEA 5TT0A 2QVXX 3ADKA 2I87A 3BDAA 3HWSA 2QX8A 2PZGA 1IHPA 5FP0A 5IC6A 3UAVA 1TUBA 2NO4A 2BCEA 5GGXA 2GZMA 3KEFA 3NXSA 1AVTA 1EA5A 2GHIA 2GNAA 2I3AA 1M1ZA 1Z7BA 2AZDA 3G68A 4FOLA 4HQNA 4QTZA 1YT5A 1BFUA 3HUFA 1SCUA 4O1HA 5ESWA 3R7WB 3C70A 1XCPA 1NN0A 5K3AA 1VIVA 5EWJA 3QITA 2ZPUA 4I55B 4LVCA 3QBDA 3RIMA 1UDAA 3NRCA 2R0QC 1N0VC 1R50A 1XPOA 1EVQA 1NW9B 1YDHA 2FUNB 4HS4A 4Q9KA 3OOEA 5AVRA 2JHGA 2IV7A 3T5TA 3SXPA 3A0RB 4LG1A 2XEDA 2Z2ZA 4LXIA 3NIFB 1ZESA 6REQA 2E49A 3WG9A 4CN8A 4WERA 1NMZA 2OT3B 3OIGA 1N4DA 2JVJA 1CUCA 3PNVA 4DILA 5EZQA 2YQZA 1OIVA 2VPIA 3QI2A 1TPYA 3QWHA 4YQYA 1M54A 1GPNA 4KXVA 4PAOA 4BC1A 2X8AA 3UM9A 6PFKA 1KXJA 1OROA 5EAIA 4PV7A 5JSKA 3N74A 2G25A 3PXAA 3S81A 2ID4A 3KOUA 1WULS 5FOUA 3OZXA 3JYHA 2FSIA 4HAOA 1S96A 1NVGA 1H8EA 2JA2A 3AK4A 2FMFA 3HJCA 4HEQA 4FYHA 4DV2B 2EC5A 2J3QA 2RARA 2OYRA 4YJFA 2ZB7A 1QRDA 4FX5A 1SRQA 3OCZA 1WX1A 5P8WA 1MC4A 3JPWA 1NSTA 1UBGA 2FCAA 1ZS9A 2NACA 3NTOA 4RD0A 3ETJA 2Q0HA 3D43A 4PANA 3K6JA 1KS2A 4TSKA 1GTVA 1Z5UA 1BKSB 3Q9NA 1U0SY 4NESA 5IM5A 4P4NA 2R5NA 1O08A 1UZNA 3LX5A 4FFVA 2WWHA 4S1OA 3RUHA 3A1TA 3NHRA 1AC5A 1P81A 1FYWA 1U0EA 3AVOA 4RA6B 3F0TA 4V0LA 4YAJA 1PT5A 1NJ1A 4B3CA 4B7ZA 3LY7A 4CHTA 1MHPA 5LQCA 1SN7A 1OLXA 2UZAA 4GXQA 5GGYA 3UWKA 3HPRA 4C4TA 1VRCA 2WEKA 1VKOA 4HGPA 4KXUA 4FT2A 3UHOA 4KX5A 1N2XA 3VZDA 2VPYA 2CHQA 3QK7A 4KQGA 2GPNA 4LVUA 3V48A 4QU8A 2XDWA 2H4WA 1P61B 1T8SA 3JXEA 3ETCA 5A4IS 3KT0A 4RVDA 1H1TA 4Q21A 5EWMA 1U3CA 3LHFA 4B2YA 4GRDA 1QCDA 1ZPDA 1HX7A 3RHSA 2W6QA 4D80A 3ETDA 2PUDA 1MVLA 3KTFA 1QFZA 4FOTA 3I2YX 1WTAA 3ZHSA 5MGBA 1ZIXA 1SIWA 4HVCA 1I13A 4TV9B 4GI5A 1GA4A 2A84A 3IDSA 2YHUA 4FYMA 4DPMA 3HJRA 2EOAA 3KXIA 4AJIA 1ISSA 3CC8A 3L0IB 2X58A 3E15A 4L4UA 4DR6B 1WOMA 2HDOA 1VYHA 3IE2A 1F06A 1ETHA 5AIAA 5E6UA 4CKZA 1NFQA 3NOQA 5ADVA 3EVDA 3LT2A 1YIOA 4HRYA 2YOFA 2YYAA 4TXMA 1YJXA 4PZLA 1K9VF 4Z4CA 1LSJA 2H3HA 2YWRA 4KN9S 3T3GA 1DDOA 2HAEA 3EIUA 3IEXA 2CNWD 2RCNA 1HYGA 3MJSA 4JQSA 3N0RA 4JEUA 2FSVA 1L5SA 2HXSA 3KV3O 5HUHA 5CAEB 1V5WA 3CN7A 2UUOA 4YV7A 4B85A 2VF2A 1BJKA 2V97A 5ER9A 3T35A 4P22A 1E6WA 4DM3A 3ETGA 2VF7A 2NTYC 4TKUA 3H8WA 1A98A 3P2KA 1KR2A 2ODTX 3UBMA 4A8PA 3G0OA 2PZ8A 2DT8A 2GILA 3AILA 1LCIA 1JIIA 2FSHA 2JCSA 2QTVA 3PQ7A 1VA5A 3KT8A 2EX1A 1Y80A 3M83A 1PGPA 4JYPA 5GIPE 1WETA 5LUAA 1U6JA 2AV6A 2GKSA 2BH9A 2HREA 2H0QA 4M1TA 1MTOA 2F1IA 4OKSA 4QPZA 2I91A 4RLFA 3R76A 5F9FA 4NPCA 1RZVA 5G1PA 1U3WA 3H9UA 3RR2A 1QB7A 2N75A 5DLQC 2VRBA 3RVMA 1ZX1A 4JGGA 3H65A 2ZE5A 1V96A 1KDYA 1U0JA 5DEIA 1V4NA 1AF7A 3PEUA 4UZEA 2J9ZB 4DB4A 4QPJC 2RHTA 4Y0AA 4YJ3A 3TRJA 3U48A 4C21A 1UXJA 4TL6A 1OFUA 3AY7A 1C8BA 3AR4A 2IW1A 1QFXA 4M76B 4TSFD 4BX3A 1RR6A 1ZIPA 2O1EA 2QV7A 3DZGA 4HPXB 1LPNA 2P5SA 4WCVA 4H7JA 2QRUA 3HCDA 3R3UA 4M89A 5KNDD 2EFGA 1V8FA 1M2KA 5CBPA 4B79A 2VYVD 2GLTA 3TUJC 1ZZGA 2OQIA 2AN1A 1B14A 3TG2A 5GQSA 4MSUA 4PS0A 1J99A 1LS6A 9LDTA 1P2GA 1SHKA 5FTLA 1QVZA 1H9CA 3LU1A 4U7DA 2BM0A 3OFND 4Z9BA 1J2RA 4FTWA 3L0ZA 3LFTA 1V7CA 3A3KA 3UJ9A 2PX3A 4WLEA 3TLMA 1YRWA 2A1TR 2R48A 3KTAB 2H54A 1K7FB 1JVSA 3TSYA 3O8RA 2ZRMA 4QATA 3OFSA 4P3XA 1UXOA 1X7DA 4LF8B 2AG8A 1SKBA 2ZSDA 5ANRB 4ACBA 1BJTA 4C30A 3RAGA 2LKCA 4R41A 4DWOA 3B6ZA 5L45A 2MSEB 2O0KA 1FFXB 1BXGA 2J0UA 2YL2A 1GUZA 1I2ZA 2J85A 2ZIWB 3EUFA 3PDUA 4XCQA 4TYNA 2PKEA 3AONB 4KMOA 1E7RA 2ECOA 2NPIA 3P2OA 4FFWA 4KITB 1KJYA 1KZ6A 1SG9A 2JLBA 3CYFA 3BC1A 4MYRA 3L7KA 4RHUA 4UMDA 4PHFA 4B73A 5AVSA 4Q01A 2RGDA 1OY1A 2IYNA 3C48A 1II9A 3H42B 2XKAA 2DPGA 2PFKA 3KZ1E 3FF4A 3PEEA 4EO7A 3QUCA 1NNUA 4Q9JA 1J20A 2BEUA 2NIPA 3IA7A 1L7QA 3PNPA 2HIAA 2J6HA 3C6BA 1AN9A 5KZMB 3B6IA 2H9YA 1TA4A 4EUFA 3HI6A 4ML3A 3H9JA 5EXXA 5FOVA 4ZZ0A 2I9KA 2A14A 2PT6A 4D26A 4QREA 4OHUA 2PSFA 5E1DA 3EF3A 2IZZA 1EFTA 3OA2A 3BHNA 3IAS6 4ZAXA 3TVDA 6AT1A 1WSBA 1BA3A 1ZC3A 3H11A 3TWOA 5IDWA 3ZJTA 4HDKB 1RMQA 2B4AA 1H2BA 2BEVB 1VSTA 2O7SA 1SBCA 2M32A 4Z53A 2RAPA 3A32A 3ER6A 5FPHA 3WIUA 4BIMA 2A5YB 3DR5A 2RHGB 2DFDA 2GZ1A 4KTTE 2Q9BA 1NONA 2KI5A 1Y6QA 3JQ7A 2QG4A 3JRWA 1EH5A 2RGNC 1CR2A 3D1LA 4RY2A 5JD6A 3QV2A 2J41A 4DIBA 4MH0R 1FK8A 5IX8A 5ALKA 3C97A 4CM8A 4DRZA 3K94A 1EI9A 2XRFA 3M89A 3BIWA 4PCAA 1LDMA 3THYA 1EP1B 1NAIA 1JHAA 5DU2A 5JO0A 1GGMA 1LVGA 4BKRA 3T0FA 3N8KA 4ZYLA 2F3TA 3PT9A 4X9XA 4BLSA 2WFAA 4KH0A 1S7CA 1E79A 2VRCD 3IS3A 1SC3A 5LP6B 4NJOA 5F2OA 3UCXA 1C9NA 5EZYA 2C59A 3TW8A 3P96A 3I2JA 3MGKA 5I7SA 2HF2A 3RB8A 3UJ3X 5CT4A 1HFEL 4TRMA 5IDVA 4YH1A 5JJCA 4P82A 1SAYA 1MAHA 5BP7A 1T4CB 5KQSA 1DKLA 3NT5A 5LD2C 4IO1A 5IKPA 3F97A 2OG1A 3TQSA 1EGVB 1VPEA 3ZBTA 4XQGA 1FFYA 5CURA 3RUFA 3D3NA 1H5QA 1JEQA 2HTEA 5IVHA 5LQNA 1KJNA 3LKVA 5K05A 3R0QA 3FHCB 2NX2A 1U0GA 4PO8A 4DA8A 2XMSA 3D4LA 1A9RA 2ZTUA 3SC2A 1UBCA 3CX7A 3ZV3A 2VCHA 3A6GA 5HE8A 4V24A 1W0KD 5ENVA 4Q7LA 1I1QB 2A0UA 4M7OA 4EUEA 4L5AA 4UNSA 1PFKA 1Z4LA 5H83A 2F8MA 4CEIA 4WBSA 5CDYA 4FDLA 4BJHB 1N5OX 4UZSA 3LPMA 4I4TA 3NT4A 3FG9A 1G3UA 3W5DA 2H06A 2NGRA 4RETA 4WVLA 3OO0A 3UJCA 4D97A 3DEZA 3I3OA 2HWWA 4ILKA 4CM4A 4CV2A 2AUTA 2IYXA 2GD0A 1PS9A 2WJWA 4YXWA 4ZCLA 3WLJA 2A1UB 3JWGA 4BCBA 5LQAA 1TM7E 1TMYA 5LQJA 2GFIA 4Q4CA 1KQPA 3PD7A 4YT4A 2JFVA 4GI2A 1AKNA 2GCEA 3EHEA 4MWBA 2A8YA 3A2NA 5TS3A 5K03A 4JYZA 4CMIA 1SKYE 4HXFB 3NBQA 3DFIA 1Z15A 5BWMA 1TVMA 3NHKA 4XWYA 1LPAB 5F98A 1SO8A 1IN5A 3PXBA 1GAEO 4RLSA 3W3AH 4OHPA 1GT91 1HT1E 5H7XA 3T7SA 3C8UA 2C1ZA 4YUZA 2Y1WA 1L1QA 3HFRA 4YK7A 5AK0A 4OP1A 4KXYA 1L7AA 2NN3C 3CXUA 5T5QA 4K28A 1XMQB 1F38A 1ODLA 1R8SA 3DYVA 4L0MA 4F9GA 3O9MA 5BN4B 5SICE 5L3QB 4G4JA 5IUKC 1TYDE 4FHEA 2P3SA 3GA7A 2R7AA 5I9BA 5G02A 2AX3A 4N6OA 4A23A 1SXPA 4ZTZB 5LL6P 1R66A 2I5PO 3AM1A 4W5NA 4YRKA 2W2TA 4LQ4A 4Y3UA 2Z8ZA 2FQYA 2BY4A 1SXJE 2FNAA 2YIJA 3HKBA 2BGMA 2XUIA 3L0CA 3ULKA 5AI4A 4URZR 4D9HA 5F1OA 1HKHA 2WHXA 5T4BA 5KYNA 3HJFA 3OO1A 4M0CA 4ZOBA 1BMDA 1K5HA 3DJFA 4UHJA 2E85A 4FIDA 2ENUA 3GGPA 1JDJA 1PWYE 1H2EA 1SZPA 1X7YA 2A86A 2BI7A 1Y5IA 3AKCA 3L6CA 4UDNA 3TM5A 3TXYA 3PLRA 3DO8A 4R2KA 3QLTA 4TWAA 4AP9A 4C3ZA 2AKEA 2V7XA 2HWXA 3O74A 3ZR4B 1MJGM 1NR5A 1ZIYA 4GD3Q 2D8MA 3CEJA 1KWGA 3C15C 3KXKA 3V8PA 3IEUA 5K0TA 4LF7B 2JLWA 3NTQA 3EGDB 4O2AA 2NUTA 5F5NA 4C20A 3BKWA 1IVNA 1U31A 2SNIE 3GDOA 3EC1A 3LBFA 2V5UA 4DQKA 4LYDA 1MP0A 4XIFA 3VVMA 5ED4A 3L7DA 3OCVA 2ZREA 3MW8A 1WJGA 2YYYA 2YCLA 1BE0A 1FQJA 2J9GA 2QMZA 4PYQA 4RPJA 5EUMA 4G0NA 1D2RA 1V6AA 4GH5A 1U1FA 1CY7A 2WIBA 4OM7A 4ROSA 3S29A 1H66A 2P0AA 2AZTA 4IIJA 4K9RA 4P84A 1ACJA 3PFBA 1RKQA 3BJEA 3WC4A 2XNCA 1Q22A 3A6DA 2AMVA 3IR7A 3ROKA 3SBDA 2E4YA 4CDGA 4E4TA 2V7GA 3ORSA 4FCVA 3ADOA 3MQFA 2WDZA 2NU8B 5B1YA 1SQFA 1J2EA 3T41A 4RFLA 2V0CA 3P5BA 4G07A 2AG6A 2H1CA 2J1LA 4RIEA 4LECA 1DUIA 3R3YA 3AR3A 2O2EA 3HR7A 5KU7A 2FEMA 1PQWA 1AGRA 3FTNA 4FKBA 2XLBA 4JC0A 5SZJA 1KEVA 2FDRA 1KQOA 5K3SA 4H59A 2H29A 4ZFNA 2DCUA 3IDFA 4J75A 2ZSHA 5C1PA 3AH8A 1OB5A 1IPEA 4CKBA 3HL0A 2LXNA 4KQ6A 2ECPA 1PG0A 1C1DB 1X1SA 3EXHB 4WZAB 4RX1A 2JAOA 4QNNA 4JQYA 3JVEA 4CM6A 5A4DA 3QJ5A 2RMKA 3PGKA 3LW7A 4MV0A 4P9NA 4RHXA 3TSCA 3ZCRA 3ANNA 2BP7B 3B78A 1JR4A 3FTDA 4RYLA 1EB9A 1W2GA 4UXIA 3SXJA 1WEHA 4KRFA 1I14A 3ZH2A 4E15A 5IEJA 3EUWA 4CKWB 4A10A 1DTWB 4TLMB 2SKEA 1QQTA 2XT0A 5CVUA 3R7NA 3TKAA 1J1UA 4HWKA 2QX9A 1PZGA 2JKVA 2WIKA 4IOJA 3GT0A 4MVJA 4Q4JA 2H8GA 4Q00A 3VYTB 2GPBA 3HC7A 4W4TA 3EFOA 1A5AB 1T3SA 1EVJA 1V5EA 1DO0A 3KUCA 4BLPA 2AFIB 3THXB 2PZKA 3AFMA 3HFGA 4UDXX 1Y5NA 2AYXA 3KQOA 4C0WA 2Y0CA 3DP7A 3PEWA 3VBEA 4WKCA 4PYKA 1UKVY 1LRLA 4AO8A 1UT6A 1JN0A 2QWXA 1R2QA 1V0JA 4UM9B 1P19A 5AW7A 1B74A 1EWRA 2OXFA 3ENWA 2O8FA 4JYMA 1A0OA 4ZT7A 1Z8DA 4HY3A 1N5IA 4PZ9A 2R2GA 4AT1A 2XGMA 1JQKA 1N5KA 1DWPA 1WUHS 4LHEA 1QS0B 2IYLD 4Q1EA 1X0VA 4ZVVA 2ZTVA 3HYCA 3LPDA 4P7KA 2JVIA 4ZOLA 5BN5B 2BEWA 5JT1A 2HCJB 4NYMQ 1T8WA 2JGNA 2OD7A 4D9JA 2AYZA 5LA6B 4EUKA 3NDRA 3K15A 2BCJQ 1PNTA 5KQMA 1C41A 1BYUA 3P4YA 5DW3A 3AQIA 4LGVA 3IUYA 2Y1CA 3GZJA 4FQ8A 4M98A 5FOSA 4J16A 3ZDXB 5JHHB 3AVWA 1E2BA 4GNRA 4CM5A 3B3AA 1Z6GA 1RXEA 1G4HA 5HMMA 1Y4ZA 5A5FA 2NZWA 3ANLA 3L6UA 2YJZA 3DLTA 4PC3A 3RIGA 2D59A 4KAJA 2Q4BA 3HACA 2RDMA 4QEDA 4JB0A 1G291 1V9CA 3B6KA 3R4VA 3E22B 2Y1FA 4Q7EA 1W9MA 4KWIA 4ZRNA 3T9EA 4KN6A 4IUDS 1A4RA 1RMYA 4R3UC 3SSNA 1ZCZA 4EZBA 5DK6A 3EIHA 3O91A 5U9CA 1Z5NA 2JIZA 5C4MA 1NM5A 1TIBA 1EGHA 3R1IA 4E2ZA 4L74A 4XVQA 1ISJA 1UK8A 1NBME 2XQVA 3LDGA 1WB5A 2CDBA 2VATA 2WJ4A 3OPVA 1R0LA 4MI9A 1WCWA 2OECA 3OKPA 1RKXA 4LXHA 2V7PA 3KKNA 4WKOA 3E18A 1G5PA 4BP3A 3B9PA 3HYNA 4AK9A 3ZDAA 4KIUA 5CT6A 1GV0A 5GAJA 3FVWA 2NUPA 4OY3A 3LVRE 5BV2P 3L04A 2IEAA 2E55A 4QTXA 2GN8A 5BVHB 1L5LA 1D2EA 4DCPA 1SBZA 1PR1A 2MT9A 5JHGB 3QBVA 2QAIA 3Q2OA 3W6ZA 4L57A 3K3PA 3TVYA 1Z2OX 1I4LD 1PJLA 3VC1A 3W06A 5KTTA 2B2CA 2D2IA 3G8BA 1KAQA 4YQFA 1FRZA 2RGAA 4HLDA 1JSXA 2C95A 4RZIA 3FOAA 4R54A 1YB1A 4JLOA 1XDDA 1MGOA 4ZOAA 1KETA 2XQGA 1MHTA 1H22A 3ENZA 4HAXA 2L0XA 4Y6QA 3TLEA 1CR6A 1E9EA 4BMZA 5E6SB 2E7ZA 4ZCQA 3RKRA 1QQ5A 1VE3A 2AJ8A 2BMVA 1OFUX 1Y6FA 3I34X 3DTTA 4QBFA 1NC3A 3U60B 4MV1A 4IVPA 1RQ2A 4ZAWA 3W1EA 2XCTB 4YY3B 2QVZX 5FL7A 5KTRA 1ORVA 3W7AA 1Y3BE 2ZETA 1FS6A 3DMYA 1G4AE 1MNAA 1BQEA 2OCGA 3FNQA 4LPKA 4EPXA 2R86A 3SR0A 4B1FA 4Z4HA 2ZT7A 4KQCA 3V7YA 2PLWA 2VJAA 1N2JA 3A37A 3WZLA 3KV1A 1YQGA 1HNZB 5CNKA 5JQWA 4B6RA 2COKA 2R7NA 4RZXA 2OLEA 5A6SA 2ZUEA 4EABA 4GL4A 1QANA 3V7FA 1PWEA 3UICA 1LJLA 1Y4UA 3AFIA 3IE0A 2BFPA 2DHDA 3DPIA 3E84A 4P31A 1UXIA 1H9AA 5JS2A 2ATVA 3GK3A 3OCWA 1NA5A 2BM9A 4Y2PA 5JQGF 1OIWA 4BQNA 1WTCA 2W0SA 5CRIA 1XU7A 9ATCA 2W2XA 5K4AA 1TVEA 3A9UA 4GXRA 4PSCA 4L4XA 4Y8VA 4QXQA 2CXNA 3MT0A 1K86A 4CM3A 2IY7A 3CJTA 4KQJA 1CIJA 1W75A 4LZJA 3VO9A 1A9OA 2MR6A 4G67A 3V6MA 1LUAA 2P2ZA 1IOLA 3QTLA 4HX9A 3CZAA 1CUDA 3DDWA 3S40A 4YMSA 2QN2A 1FP7A 2DWOA 2R4QA 4B46A 4P3KA 3IESA 1SWVA 4POOA 2WJYA 1ACLA 3HCPA 3MS7A 1SD2A 3KDAA 3VVLA 2JEYA 1SBIA 1CYDA 3D3WB 4JEHA 4AY6A 2H7VA 2R11A 4OKIA 2PKWA 4PXSA 1A9QA 2G4CA 1XP5A 4FI3F 3MTBA 3HVHA 4IDBA 5KYYA 1HE1C 3PUKA 3ZZMA 3RYIB 1SUPA 1KO8A 3AR6A 3MINA 1X7WA 1AA9A 1EFUA 2MHCA 3W5SA 4GX2A 5J1SB 3KQLA 4B3XA 2QN1A 1H3EA 1D8TA 1VECA 1QIMA 3AM3A 2XUFA 1JGTA 4IOMA 4M1MA 1M33A 3A9CA 1UWLA 3MBKA 1TM2A 4EVQA 1JLLB 1H0HA 5BW8A 3DOJA 4CUZA 5IKOA 1N6LA 4PFJA 3BMOA 2JAHA 1O95D 2XUGA 1XEWY 4AJLA 2VDWA 3VU0A 2GSDA 2IPOA 1NFRA 1YJQA 2DLDA 5WRFA 3Q0TA 2CMFA 3T4UA 2YC4C 3F8SA 4EHFA 5CA0B 3PUIA 3GEHA 4DAOA 4R1OA 1VHDA 3AU8A 1QBKC 3VNUA 1MG5A 4YI3A 1QX4A 1U1IA 4NXMB 3SC3A 1O9BA 1UK7A 1ZGZA 4EVIA 3D8BA 4KSCA 4PYIA 1IQPA 1YR8A 1W7AA 1BVHA 4ZMSA 1KNXA 1TK9A 4HNVA 5JADA 1DC3A 2M2IA 3O92A 3MMSA 3TPZA 2HD4A 4J0IA 3I9V1 1L8QA 4HQKA 3FOFC 2I2FA 3PCRB 4UE3S 4V1CB 5H59A 1P1RA 1UAAA 4PRKA 2NU6B 4COKA 1QYVA 2Z56A 1MNQA 3QEMB 1MB4A 3MQ2A 1AS3A 2GXSA 4ZA2A 1F0PA 1JDSA 4FW9A 3FUWA 3SD7A 4RAOA 2EATA 3MTGA 3VSDA 4MXDA 4CR6A 3H2HA 4NNPA 3H8VA 4MK4A 1L7NA 2G28A 5KS2A 1PBTA 5IZCC 4KV9A 3TZEA 1PR4A 1DXQA 3AEKA 4LBYA 2O8BB 1SCQA 3RTDA 2H48A 2CHEA 2C83A 3OFKA 4WY2A 2G9NA 3NM4A 4RVGA 4MRMA 4Q18A 5L95A 3UNXA 4GPEA 4QLOA 4LBWA 1U3DA 1NE2A 2F3UA 2BRUC 1S1CA 3IYLW 4H1HA 3AUXA 2O4CA 4CIXA 4LI3X 2JFXA 1Q0ZA 4I7EA 1B93A 3V8RA 4V0NA 3WLLA 3BB3A 4IG4A 4P53A 4FJ1A 3ZVMA 3PQ6A 5AVWA 4IV8A 2GO1A 5JAPA 2P5UA 1B8OA 4ZJYA 2WWVD 1QXSA 2X13A 3MTEA 1YF3A 2RHMA 5K0EA 3KS9A 2B8WA 4EH1A 5I4CA 1RYFA 3E7PA 1GYRA 1R6UA 3VUEA 4WBNA 3VX3A 4AXBA 4GUAA 2AI2A 5EHQA 1AGYA 1XD8A 4MMYB 2CWWA 3WGIA 2R751 1GCGA 2D13A 1NNSA 5JNSA 4CEJB 2YIVX 2AJTA 3TR5A 1FF9A 3FPSA 2Q41A 1VKZA 4ENPA 2C57A 4HNAB 1F5SA 4IQFA 3M5DA 1TDJA 2ZYGA 3TTWA 4S2UA 5HM8A 1QKJA 1T8RA 1YB6A 1DC7A 3ROQA 3ND5A 4WLOA 4FP9A 1JSRA 3RC2A 1H1LA 1N2CA 1WPGA 2VK1A 4PZZA 4CI9A 2NP7A 3N8DA 1M9NA 1XZPA 3S8YA 3LC2O 1GNLA 4DAEA 4G89A 1CY8A 1TE2A 4KVGA 2ZBDA 4CKXA 3EAQA 1KRWA 5BN3B 2VUSA 2XX3A 2WMYA 4S3MA 4RMNA 1IZZA 4MWDA 5FKJA 3STUA 1MPXA 3GB9A 4EOGA 4NYJQ 2JA1A 4R68A 4MJ3A 4E2XA 3WL3A 5BVGB 1RHKA 1Y5LA 4RWZA 3BWCA 1QO0A 4KPGA 1W0JD 1HE4A 2PE5A 4O4LB 1TZBA 4LZWA 3L06A 4CKCA 1RLOA 5DGXA 5KOYA 1DBVO 1W4LA 5CDTA 2A5DA 1JPVA 3HO1A 1M6WA 2AEMA 1EVKA 2CMHA 4R71A 2WF5A 2EQ5A 3TLAA 1GPMA 2NT3A 4DPLA 4IH4A 4ND8A 1MA0A 1MAAA 4ZVUA 1ZW6A 4QPDA 2J3EA 4F4UA 5LMNB 4EG1A 1FEZA 2IU4A 3CX3A 4WOPA 2EYQA 3CHYA 3X2EA 3IEMA 5M29A 2RGWA 2M6RA 2BEJA 2NZJA 2GZHA 4NH0A 5DN6D 9LDBA 1G5IA 4AWAA 4BO3A 2VJYA 1L0BA 3WB9A 3K0HA 5DHSA 5BURA 1ITZA 1SXIA 4WAUA 2NQ8A 1I01A 2XGSA 4X44A 3PDJA 4XA8A 5A02A 5JSFA 4OHYA 2MIIA 4AZ0A 3AETB 3INGA 5JSHA 5C1OA 1DFGA 2BFAA 1JIQA 4UHKA 4BFTA 1QHHB 4QFBA 3KAQA 5KTSA 5KTMA 2ZROA 2H4HA 5C80A 5JH7A 4DQVA 3KZKA 1NXVA 2JFBA 4DHWA 3ND8A 1PTJA 2J9XB 1XLUA 2JI7A 3FI0A 4IJUA 4F46A 2CFRA 4LDQA 4NMXB 4F5DA 4QZVA 1XHLA 3MFQA 4N0EA 2X9NA 2XIQA 2HI0A 4X1KA 3OCJA 4LF9B 4EAQA 1H4SA 1OYVA 1Z88A 2C04A 4RPLA 1XKTA 2GARA 3K35A 4G4GA 3WWYA