2GA8A

Crystal structure of yfh7 from saccharomyces cerevisiae: a putative p-loop containing kinase with a circular permutation.
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
353
structure length
326
Chain Sequence
VDTHKLADDVLQLLDNRIEDNYRVCVILVGSPGSGKSTIAEELQIINEKYHTFLSEHPNVIEVNDRLKPMVNLVDSLKTLQPNKVAEMIENQGLFKDHVEDVNFQPVKYSAEETAVVARGGTANAIRIAADSINIAQIVPMDGFHLSRRCLDLFKDPQTAHKRRGSPSTFDSNNFLQLCKILAKTSLKVSTSSVFEKLSKTFSQTIPDIFVPGFNHALKDPTPDQYCISKFTRIVILEGLYLLYDQENWKKIYKTLADTGALLVYKIDIDYEATEERVAKRHLQSGLVTTIAEGREKFRSNDLLNGRDIDNHLIKVDNIVHIRNDH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical 39.9 kDa protein
publication title Crystal structure and functional analysis identify the P-loop containing protein YFH7 of Saccharomyces cerevisiae as an ATP-dependent kinase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Unknown function
total genus 109
structure length 326
sequence length 353
ec nomenclature
pdb deposition date 2006-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07728 AAA_5 AAA domain (dynein-related subfamily)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ga8A00
1TQ6A 2H92A 3B60A 2C95A 4NL4H 1H65A 1Q44A 2GCNA 1KAGA 2QEQA 1CS4C 2W2VA 1YR8A 1AS0A 1U0HC 3AKDA 1A4RA 1E9CA 4BFXA 2ZSDA 1LS1A 4IW3B 4FCWA 2XSZD 2ZE5A 1E2FA 4PC2A 2JLRA 2WTUA 3PXGA 4QBIA 4Q9LA 3I92A 3K0AB 1DO2A 2BCGY 3EPJA 1IAQA 3SBDA 2EU8A 4QBHA 4DXAA 2D4HA 1Z06A 4Q02A 2IYWA 4B48A 5D3QA 2VSOA 3I8SA 2D06A 4RZ2A 3LFUA 3IO5A 2R65A 4A2PA 2YC4C 3PEVA 3LW8A 3AP2A 4UNRA 1E0SA 1CRPA 5HZHA 5UKDA 3QKSB 3GJXC 4HATA 1P2TA 4D82A 3GLHA 4AYXA 1Z0DA 4ON9A 1Q20A 2KJQA 2YYZA 3GFOA 4D25A 3FHTA 2JATA 3K9NA 1I2MA 1R6BX 3UMFA 1L2TA 2C04A 1W5TA 1X1RA 5IRCD 1S3SA 2IWHA 3E70C 3VTKA 2CJWA 2OE2A 1HV8A 1ZUNB 3QENA 4NMMA 3WBJA 5FOTA 1M7GA 1XTRA 4R2HA 2GNOA 1K5DA 2FEMA 1CXZA 3PUVA 4UJ3A 1D2MA 1E98A 2BIFA 3I32A 3I73A 3NEJA 1P5ZB 3LWNA 5JS8A 3CRW1 3MAAC 5DLQC 3C41J 5C18A 3QKTA 3KQLA 2DBYA 1OLOA 4BZQA 3TW4A 5K8IA 3ZQJA 2O8FA 1EFTA 2GAAA 3A1UA 4P31A 3BH6A 4OHVA 4X8MA 1NMYA 5B64A 4BFTA 3W8NA 3ND8A 3O47A 4BFSA 5KNDA 4UXIA 1NNEA 2D74A 2ASEA 4V0OA 4E5UA 5AJVB 1L8QA 3WNDA 2FOLA 4ZKEA 1S9DA 2ERXA 2GBLC 1E2JA 1Z0JA 4NCKA 3IBYA 3FTQA 1FTSA 3AF0A 2J7PD 2CK3A 1XB2A 3WNBA 1W0KA 5AUQA 2ZJ2A 1LFDB 3NBFA 1XXHB 1S9HA 1XTQA 4MRRA 5FL7A 4OHWA 1CJKC 3OIYA 2BM1A 2ZR7A 3LXRA 4RZUA 1ZD1A 1NI3A 2F43A 4L5BA 2ZITA 4LJ6A 2ZSEA 1JXOA 5CB8A 1T91A 1WB9A 1XD2A 1ODFA 5JMTA 2A5JA 2CHGA 4JLAA 4D80A 2FDCA 5G40A 4A0GA 1QHIA 3EA0A 5DN6A 3ADKA 4YC7A 1OW3B 2ZYVX 1RRPA 3RS5A 5CYOA 3DM5A 2NGRA 2IYSA 1XCPA 4Q9KA 3NHAA 1BKDR 1MH1A 1E9AA 1G20E 2WWYA 2CNWA 4FD2A 3C8UA 4WXPA 3RS0A 3X2SA 4FXPA 4EFLA 1JQLB 4HAUA 4LY6A 2FF7A 3MCAA 2QRNA 3P20A 3FPAA 3OAAD 3AGPA 3SFVA 4IXMA 2OZEA 5L3SB 1U0JA 4Q4HB 2HLDA 2V8OA 3QJYA 5EP4A 1G5PA 1EFRD 3B5JA 3ZGXA 1CTQA 1OXUA 2AK3A 1OIWA 4QHSA 4A8JA 5JHGB 3THWB 5DYGA 3VFDA 3M6AA 2VP6A 3K0CC 2XAUA 2QM7A 3WP0A 3K09A 3OE7D 5AJZA 1ZRHA 3UG6A 3AUYA 1TUIA 1ZM7A 4NCHA 1T0JB 1MO5A 1EX7A 2C5LA 2IBMA 2XTMA 2HCJB 5BYJA 3CF2A 2R2AA 1SVOA 1UPTA 3RRZA 3U4QB 3PCRB 1XEXA 1A2KC 1DO0A 1K5GA 2ZI5A 2JAQA 3A36A 4IOMA 1E79A 2GZAA 2PMKA 1F60A 1BIFA 2A78A 2OAP1 2JEOA 2OILA 3T34A 1YZKA 2DPXA 5P21A 3CB4A 3F8TA 3R7WB 5JRZA 4JYBA 5KSOA 1IY1A 2GXAA 4DLTA 3ZYCA 3EWSA 1Z0IA 3B1XA 3ND9A 3OIVA 1GTVA 4DKXA 4YXWD 1ZC3A 1Z6GA 3DHWC 4M21A 1SVKA 4OQLA 3W8RA 3CW2A 5DIFA 1E4YA 3BS4A 2REBA 2ZTSA 2NMVA 1U98A 2QQEA 1HYQA 4EDHA 2VF7A 1IN5A 3M0EA 4QFMA 2IF0A 3REGA 1D2NA 1WA5A 4B3BA 1YZGA 1U0LA 2WVJA 4TL9A 4US1R 1MR3F 1IHUA 4B35A 5EZ5A 2D7CA 4BQSA 2ODNA 3PUZA 4DDWA 3N70A 1E6CA 4HDQB 4NKRA 4Q18A 2Y8EA 2FX3A 2CLSA 3C5HA 3QKUA 1OB2A 2WMOB 1AGRA 2IUSA 4D4LA 3UKDA 2E9SA 4GOXA 4HAVA 5AJXA 4JZKA 3X1WA 2JJ1D 5GVRA 3VR1A 4JBXA 1TU3A 2PZEA 1ZYUA 5KYKA 2Z83A 4XJXA 4M1SA 2JJ2D 3QKRB 1NY5A 3THXB 5KSPA 5LD2B 1BOFA 1E9DA 3DEFA 4KFRA 3G0HA 1NSTA 1KI7A 2YOGA 3SJZA 2F1JA 4KVGA 3QOFA 4Z8XA 2A5DA 3D8BA 2VO1A 4PANA 4OHYA 2DWQA 5CLLA 3TUJC 5EQTA 2QE7D 5C4GB 1KOFA 2ZI6A 4Q1DA 3U3KA 2G0TA 4HB4A 3THYA 4BLQA 1DPFA 3GFPA 4B73A 4QRHA 3GJ3A 2W6IA 3AEZA 3UWOA 4W9MC 1VG8A 1PLLA 1N0UA 2FNAA 3QSYA 4KBFA 5BW8A 1XEFA 5B57C 3GMTA 4A9AA 2R6AA 4W5JA 5KDOA 5BQ5A 3K0SA 1VKJA 1G8YA 1JJVA 1S0UA 4JT4A 2IUUA 2V9PA 3RC3A 3T61A 1G64A 2WMNB 3WMGA 2HYIC 4Q03A 1XTIA 4ZV4A 3U3JA 2J3EA 2H5EA 1KI4A 1RYFA 2DR3A 3E2IA 1YZNA 3U3OA 4CEJA 2ZS7A 2WOJA 4HLQB 2J46A 2PBRA 1M7BA 3C16C 3H86A 4BEBA 4LI0A 2RGBA 4RD6A 3U7EB 2CDNA 1MO6A 1GM5A 4HI0E 1ZNYA 2D7DA 1HTWA 3L82B 4NZYA 2ATXA 4G01B 1KJYA 1COWD 3BB3A 3KTAB 5JEDA 1ZD8A 4Q1BA 3SZRA 1E1RD 5FOUA 3ADBA 3CNNA 4DLVA 3P4XA 2F9LA 2HXSA 3EASA 2WJGA 1PZNA 2EQBA 1EWRA 2VHQA 2ZQ5A 4CZ2A 3FMFA 1QHHA 2AFHE 3BAFA 1Z07A 3IEUA 1SXJA 4YONB 3IQWA 2RGNC 4LJ5A 1KSHA 4M9XA 4FW9A 3GCGA 5AK0A 2ZRMA 5EE1A 3R9IA 3CNLA 3QF4B 2Z4SA 5ELXA 4TYWA 3DL0A 2ZU6A 3KKNA 1U9IC 1NG1A 3MGCA 2FJUA 4D26A 5TB5A 3KDSE 1MABA 1KO8A 4IXNA 1G3QA 4KCGA 2VQSA 2ZSAA 1EGAA 1BH2A 1VG9B 3NTUA 1IN4A 5FI1B 2H16A 2ZRNA 4Q4LA 3VU9B 2P6NA 3EXAA 1IM2A 1GOTA 3ONWA 1N6LA 1T5LA 1WXQA 2WSSA 2XX3A 1F2TA 5KSYA 3F3YA 4UNPA 3H0KA 1Q22A 2OEPA 2IHBA 1AKYA 2DWPA 4GL2A 1E1QD 4PAOA 3A4MA 2V6IA 5LD2C 4K46A 4A36A 1GWNA 1JR3D 2P5TB 2QT0A 2ZJ8A 1NY6A 4DLSA 1F48A 4UXJA 4KU4A 3REFA 2FFQA 3WNCA 3I62A 4URYR 1TUEA 3PV0A 2GA8A 1OIXA 4W7SA 2GXUA 4AK9A 4HAYA 1FUUA 2ZUBA 2XB4A 2JLYA 3OF5A 2VP5A 1UEJA 3P4YA 2QBYA 2W58A 3EZ6A 3LRPA 1VTKA 3K53A 2QZ4A 1OHHA 2CLCX 1XTKA 4Q1EA 4LJ9A 3KXIA 2EFEB 1LF5A 1R8QA 4B43A 4EUNA 5JI3E 1KI3A 5CJPA 1CIPA 4I1VA 3A4NA 5JJLA 1AQUA 4KYIB 3O8BA 4WVFA 1NKTA 4CT5A 3L0SA 1BS1A 3C5CA 2Q3HA 3RAPR 1HEIA 1P2UA 1S1MA 5E3HA 4DB4A 2XXAB 2WBLC 1MKYA 3DZDA 1J2JA 2J41A 3AVUA 5FPSA 5J4KA 1P7CA 3A6PC 1P2SA 4M1KA 2XTZA 1EFHA 5TY0A 1P3JA 2NPFA 2ZRBA 2G9NA 3WHKA 4B34A 3T1TA 3AVVA 1W0JA 2A30A 2QY9A 1XTJA 1GL6A 2YOHA 4DLWA 1Z28A 2AK2A 4KI0A 3RSOA 3OIWA 3CUEF 2WPDA 5HCIA 3ZJYA 1DAGA 3TH5A 2OUKA 2NO0A 2GF9A 3FMPB 5JBQA 4BASA 2O8BB 1E9EA 1TTTA 5FR1A 3GLIB 2EYUA 821PA 5G41A 5DI3B 4S2EA 3TR0A 3RANA 3FE2A 4YMSA 2FPKA 5HKKD 2MMCA 2J0UB 5F9FA 1W48A 1XPUA 3CRRA 2ZI7A 2ZJ5A 4B44A 3QUSA 4PHGA 1ZNWA 1HT1E 3CIOA 3GP8A 4MDEA 3V00A 4P0TA 1IONA 3F5FA 4NCNA 3MJHA 3ICQB 3EG5A 3IPXA 4U5XA 4H9GA 4DUGD 1BYUA 2JLXA 2BCJQ 4JLBA 3VR3A 1KJWA 3T06B 4POAA 1XX6A 3KQHA 4B75A 2WKQA 4BRUA 2RKOA 4NTZA 3ICEA 2F6RA 4A2QA 1A2BA 4IEIA 4F7WA 2XOKA 3U44A 1Q21A 2FZLA 3ASYA 3W6PA 2C03A 1DTSA 2RGXA 2QTFA 5D3MA 1P72A 1F2UA 5FTLA 3EA5A 4TT3D 4ESHA 4GT1A 4US2R 3I1FA 4HUQA 4JLNA 4B6EA 2FFAA 5IDVA 1G1MA 4F4CA 4FWTA 1P6XA 4C0QC 1KDTA 1NBMA 3SU8A 3FWYA 1RJ9B 2WIAA 5FUWA 2CHVA 3GEEA 5F2EA 3TSZA 3CX7A 2ZIAA 3GLGE 4ZCLA 4NYIQ 2FFHA 1S3GA 4XOIA 3Q7QA 2OG2A 2QU8A 2IS2A 4MQBA 2WWWA 2O8EA 4F4IA 3CONA 1SKQA 3ZDQA 3Q9LA 1LNZA 4IDNA 3KB1A 4PC7A 1AGPA 2OT3B 2XEXA 3ADCA 2G83A 2ZS8A 3AH8A 3EIHA 4IHQA 5EE3A 4HYYA 2WIBA 5GJCA 2E1RA 4JVMA 2QPOA 2GRJA 1R5NA 5FTMA 4WAUA 2XNSA 2C9CA 4DHEA 1KO4A 3AKCA 3QEJA 4IOKA 2IUTA 4KODA 1FW6A 3EPLA 1SULA 3LO5A 1SHZA 1CR0A 1R4AA 2VH5R 1NLZA 1FNMA 4C0BA 5CK4A 1Z5ZA 3HR8A 1IQPA 1A1VA 1IBRA 1X1SA 1KK1A 1XFAA 4OJQA 4UNSA 3TJZA 3K0AA 1VCMA 2YINC 1ZAKA 1KGDA 2ZRLA 4PHFA 3BE4A 4I1OA 4JBWA 2QNRA 2OLKA 3I8XA 3PUXA 2XSZA 4LC0A 3QI2A 4V0KA 5FUYA 4BZPA 2BBOA 3ZZ0A 4IDHA 3OHMA 3B7GA 4MGIR 3PJRA 3MWYW 2NO1A 2D62A 3NDBB 1UJ2A 3TQFA 1NVVR 1WBDA 3U61B 3BRWD 1FMLA 4XVQA 4O3MA 4M53A 2PLRA 4KITB 3NVAA 3K0CA 5FOXA 4Q4AA 1JQJC 1UM8A 4PX9A 1OYWA 3GEHA 4JJKA 4ZCIA 1VYVA 2WKRA 4LUCA 1G8GA 521PA 4OL0A 2J5XA 3CF0A 4KFTA 3AB3A 1WCV1 1OIVA 2I1VB 3I3SR 4AKIA 1D2EA 4GOJA 4CF7A 5IK2D 1A5TA 2J0QA 1S2MA 3SQWA 1Q0UA 2BM0A 1GKIA 4ZDKA 2OAQ1 3L0OA 2AN9A 4MYTA 3ZS9A 3KXLA 5SZKB 3GLFB 1MRSA 4JSYA 4P4SB 1G5RA 3SN6A 2XB2A 5HTKA 1G19A 1NN0A 1YZUA 1V43A 4LK2A 5L3QB 2VL7A 1W36C 4M1TA 3C4JA 1EFUA 1KO5A 4Z1MA 1ZM4A 4EIWA 4BFWA 2RHDA 2J7KA 4MGZR 1U2RA 2WWFA 4XSHA 2NO9A 2P67A 4QGGA 5KUTA 5CDFE 2OLJA 1OYYA 2A3RA 2YV5A 1P9WA 1W2HA 4HZUB 3BBPA 3QVUA 2AWNA 4R71A 1CP2A 3QNUA 4NHOA 1P9NA 4IVQA 5FI0B 5FBWB 3GLFE 2ZRIA 4TZ0A 2RGDA 4JYCA 2J7PA 5AWFC 4IDQA 5J47A 3K0FA 4BWYA 5E95A 4CVNA 3RS4A 3IIKA 5JCZA 3EWAA 2B21A 5EP3A 4R2IA 3UK6A 5JJIA 4B2PA 2CLDX 2IXEA 5KNCA 1OH6A 2JIZA 4A0HA 4IFBA 2HCBA 2MMGA 4FMCB 1XNJA 4LBVA 3EIEA 1P9RA 4AIIA 1FX0B 1XJCA 2GVZC 4GMDA 2JJ8A 3L0PA 2GEDA 3IGFA 4OQNA 2OESA 3CRVA 1ETUA 4URUR 1OPXA 2WOOA 1XP8A 1BO6A 1TQDA 4Y0AA 1GZSA 4A6XA 1CULC 5A5GA 2Z4RA 3LVRE 5EXPA 2V3CC 2PCJA 1D5CA 4Q4HA 3CF6R 2WWXA 3AP3A 2XJ4A 4AI6A 1MO4A 4PR0A 3VMFA 2H7VA 4KHZA 3KFVA 2ZAOA 1M8PA 3OAAA 3THWA 2MSDB 4BFZA 2ZXUA 4GI7A 3K9LA 3QG5A 2CMKA 1ZBDA 1EFRA 2VHUA 2HEIA 3FMOB 1E2KA 4EQ6A 1BMFD 1D9XA 2VRWA 5FBVB 3QXJA 2B8TA 5DE3A 4TLEA 4OI0A 4QHTA 3PENA 3OE7A 1AM4D 2P6UA 1E9SA 4IFEA 3U4QA 4AG5A 2PT5A 5EP1A 2ZR0A 4QBGB 4JLJA 3KUDA 2QMEA 1G17A 2YNMA 3R7WA 1GDDA 1J90A 4DSTA 1XDBA 2WWIA 2Q6TA 1X86B 1XF9A 3DPUA 1GRQA 2HYDA 2IHYA 2XTNA 4QJ4A 1M74A 3U5ZB 2R8RA 3KFXA 4JL8A 1YHNA 3P32A 3LX5A 4Q01A 1IN7A 4N0EA 4CYMA 4LYAA 2ORIA 3GJ6A 5E7IA 5CLQA 2REOA 3CM0A 4YXWA 4BECA 1QVRA 3QXCA 1GAJA 4PQYA 3EZ2A 1Z22A 2GJKA 4TSFA 3ZLJA 3TR5A 4KFUA 4GDFA 2RGNA 4LX0A 4Q66C 4FMDF 2DWOA 1KDRA 1AN0A 3W6NA 1DADA 3SI7A 4HAWA 3GJ8A 2X2FA 1U9IA 3CZPA 1T8TA 1CU1A 4WOPA 1T5IA 2PJRA 2VLIA 1KSJA 2OCAA 2GJ9A 3RS7A 2WAXA 1FP6A 1Q3TA 5DI9A 4QM6A 4KLZA 4DSOA 1Q1ZA 4AYTA 1H8ED 2GVDC 3D3QA 1IJFA 4D2IA 2WV9A 4I4LA 2ZI3A 3CWQA 4YLGA 3TE6A 3QBVA 5BYKA 3GQBA 1LS6A 4TMKA 2AFIE 2KI5A 1L7VC 1II8A 3NG1A 2JJ1A 3QG1A 4BLSA 4EFMA 2CXXA 3MG9A 4WZ6A 4Q47A 4PSKA 4PXAA 2JJ2A 3DMDA 4LHVA 4XVUA 3EZ7A 1RC8A 4QNMA 5AUNB 3ETLA 1NIJA 5LBIA 1E0JA 1II0A 1RE0A 3K9GA 1QBKC 4HZIA 1ZD9A 4Q9JA 5K8UA 1SKYE 4GMXA 2ERYA 1ZCAA 1KO7A 1R8SA 4G3XA 2QE7A 4F93B 4BUJA 2GKSA 1XCMA 2OO7A 4KJZA 4QGAA 4MYHA 1Z0FA 4QJ3A 4FCTA 4FWIB 4FMCF 2CL0X 2PL3A 3B1YA 1RRGA 5C1BA 1IN8A 4I1UA 3MWLA 5KPJA 1RKBA 1SHKA 1LY1A 2CHQA 4C0JA 5JWRA 2WM9B 5EJEA 3QE0A 4ERNA 1E2HA 1PLJA 1DAHA 2DHRA 2WHXA 1T0HB 3UIEA 4JLMA 2NO7A 4DBLC 2WICA 3SHFA 3X1ZA 4CEHA 2JCSA 3UG7A 4DEXA 3VAAA 2EWWA 2BBSA 3R8FA 3TUIC 3HWSA 1FZQA 4JLKA 3NH9A 5G53C 4C7OB 4LOAA 4XWOA 3SDZA 3FB4A 2QG6A 2QP9X 2IX3A 3MFYA 5TDHA 3F0TA 2O0HA 4RD3A 3L2OB 3ZVRA 3KTAA 4ZDJA 5CIWA 2RGAA 5FTJA 5AJWA 3RRMA 4S35A 1XEWY 3BB1A 4MITA 2XZOA 2QMOA 3CX8A 1KI2A 1COWA 3BFVA 4TMZA 4RFVA 2F3RA 3HU1A 2O0KA 1E1RA 2C9YA 121PA 3CZQA 2ANBA 4NONA 4DCUA 3AM1A 1L4UA 2J1LA 5J5CA 2KSQA 2F7SA 3OESA 3QPWA 4KSCA 5E7JA 4WA7A 2QM8A 3AP1A 3QF4A 2FPLA 2XZPA 5TV2A 4D0NA 5F9HA 1GNRA 4TQAA 1GUAA 1Z83A 2G77B 2ZE6A 4Z8YA 1OFIA 5TXGA 2IYVA 1RYHA 4F91B 2FGKA 4HDOB 1CRQA 3FKSA 1OH5A 3VU9A 1OSNA 2UKDA 2O8DB 2NIPA 3TUZC 2WJJA 1N6RA 1T3SA 3DMNA 4Q1AA 4F4JA 2V7QD 3IIMA 2W00A 3GJ5A 4M1WA 3Q72A 5DISB 2JGNA 1E3MA 2DYKA 1YU9A 2ZJAA 3K0EA 3FGNA 1GVNB 3Q5EA 1WF3A 1C4OA 2N46A 2BC9A 1E1QA 3LQQA 3AF1A 1NLYA 3O8RA 1E2IA 1JR3A 4JSTA 2AD5A 3ZS8A 1KZ7B 5HR5A 1P62B 4MRSA 1HQCA 4JLVA 3ECCA 3GLHE 4ASUD 1N6KA 2C96A 2H17A 3EARA 3L43A 3IHWA 2A9KA 2W6JD 3HYRA 1TU4A 2YC2C 4UXHA 2NZJA 3NHBA 4UNQA 2AR7A 4PPNA 2IXGA 2P5SA 2ZJZA 3IKJA 5K8LA 2QT1A 3BFXA 2QMUA 5DSZA 3TSOA 4D0LB 4AC9A 5KSZA 2UZ3A 4KAXA 2W0SA 2XXAA 5HE9A 2BMJA 1RZ3A 2FPMA 3I4LA 4WIAA 4TLDA 3HR7A 2GF0A 3HDTA 1JECA 4LRWA 2ZI9A 1LW7A 5FR2A 1FQJA 1QHYA 4Q00A 2DCUA 4RD0A 2ZM5A 2I1QA 4IRUB 2IL1A 1E2GA 4RJLA 5KNBA 1U8AA 3NKVA 3W5JA 5DYIA 5L3VA 3I5XA 3TQCA 3WYGA 2X2EA 2VP9A 1EK0A 3B2EA 3QPVA 5DI3A 4WZAE 4HB3A 4MRPA 4BPBA 4I99A 4WBSA 4RD2A 1ELOA 2CNWD 4YMTA 4X8HA 4PPGA 5F98A 3L8ZA 4U00A 1RPZA 4JKIA 2QTVB 2VSXA 5FUVA 5LB2A 2O52A 5LB4A 2EW1A 3TIFA 5HKKA 1NJGA 4KFSA 2ORWA 1QVAA 4IOLA 2ECKA 1XBTA 1NIPA 1NMZA 2QA5A 3TAHA 1G6OA 3QF7A 2H18A 1TQ2A 2EVWX 1U99A 1KK0A 2CE2X 2J45A 2ZAMA 2ZRPA 1NKSA 1RFLA 4OI2A 1AKEA 1U90A 1VG1A 1CR2A 3N5CA 2FV8A 1GFIA 4BFYA 4B6FA 4A15A 4A8JB 2N1BA 3U7HB 4KVAA 3W3ZB 2Q21A 4LPKA 4G5QA 1E9BA 4O2RA 1J7KA 3W5IA 1QG4A 3A4LA 4TLAA 1KDOA 1YRAA 4P3YA 5EXTA 2AWOA 4AD8A 1FPMA 1AJEA 4LJYA 2JASA 1YRBA 1HH4A 4OJKA 2F9MA 1R0ZA 4CEIB 5EUMA 2IC5A 4RSGA 4TMXA 1I2DA 3B9QA 3W3AA 4HLUC 3VQTA 1Q57A 3WY9A 4EJSB 2V6JA 3U3RA 5HPYB 2C99A 4TL8A 4MRVA 1KI8A 4B3CA 1NP6A 2WSMA 3CH5A 4RCYA 4TT3A 3VNUA 3H4MA 5CIQA 3GFTA 4OQXA 1VMAA 1T6NA 1YZTA 2CVFA 2QP4A 1JALA 3K9HA 3LBHA 1PV4A 2DFTA 1JAHA 2HJVA 3BH7A 2GAOA 2PLFA 1JEDA 4N3NA 3V9PA 2YHSA 3SOPA 1ZNZA 3S1AA 4PO8A 4RD4A 2BHRA 3VKWA 1KI6A 3VKGA 4EAQA 1O3YA 3LW7A 1N0VC 4P4TA 4XSGA 3OEHD 3RVBA 1W46A 3ZH9B 2JLWA 3KXKA 4NBSA 4JVLA 3VKHA 4ZI3A 1XD9A 4U7DA 3PITA 4FIDA 4LBWA 1ZU5A 4QJ5A 3IO3A 4P4UA 4BLTA 2LWIA 3ZVNA 4ILEA 2RHMA 4AYWA 4QOSA 1W47A 2ZETA 4BEJA 3QIAA 3BH0A 1G3RA 2HT6A 1KMQA 5JWHA 2BEKA 3NBYC 4NU0A 4V02A 2GCOB 4IKEA 4L15A 4ZI2A 3SYNA 4DSUA 3W6OA 3I5YA 5FBLB 3MWKA 1DAMA 3OFNA 2QORA 4TZ6A 3IEVA 3DKPA 3B6EA 4TN1A 2J0VA 5GJWC 1VDZA 2YZ2A 4K81B 1U94A 5SZIA 2AL7A 1X8KA 1Z3IX 1ZVQA 3PG5A 4IJMA 3SBEA 3UANA 3IILA 2FSHA 4TMWA 3RWOA 2OXCA 1WQ1R 4MGKR 2Q9CA 3KKPA 1UBFA 4L8GA 5FTKA 1Z0KA 2P0EA 1GKUB 1VPLA 2VHTA 2ZRGA 5H8WA 3VR2A 2GWHA 4HB2A 1KZGB 2G88A 3R9WA 2IS6A 2LKCA 1N6NA 1E94E 1GL7A 5CITA 1OXSC 2QQ0A 5JJKA 3AF3A 1OKKD 4XIGS 1R10A 4OKSA 1SZPA 3KKMA 3E1SA 4C0LA 1R5BA 2KBFA 4ITRC 3U2QA 2YVUA 3THYB 4TMVA 2DFKB 5FOWA 2CL7X 4E09A 4YMUA 4B33A 3K8YA 4PO1A 1ZUHA 3UXMA 4BFUA 1I4TD 1Z6XA 4DLXA 1KDPA 5EZ6B 5C4MA 2MSEB 3TAUA 1BYIA 2K5UA 1AZSC 3LVQE 4ZDWA 4DLUA 5JFGA 4PQFA 1E2DA 3PEUA 2NQ2C 3NEYA 1G21E 2FE4A 4QG7A 3IQXA 5EUQB 3U7FB 1R7RA 2BWJA 1U8YA 4M22A 4ZDIA 3BD9A 1TEXA 5B2ZA 1NRJB 1HE8B 1VCIA 3TLXA 2EFCB 3H1TA 4CEJB 3EW9A 1D6JA 2D2EA 3GLGB 3AGQA 3R9XA 4JVNA 2ZPTX 3AVWA 3I72A 2X77A 2ODEA 4GP6A 1US8B 3RWMB 2C98A 3CBQA 5LPNA 1KNXA 1KI1A 3NDPA 5CYPA 4YMVA 4DWJA 4A1FA 2ZE8A 4TMTA 1KJZA 2XGJA 1B23P 1Z63A 4P4SA 2SHKA 3LNCA 1VG0B 1D8TA 4WZBE 1EFCA 5GJBA 1LF0A 4RVCA 2VHJA 1VYUA 1FQKA 2QAGB 5L3QA 3EPHA 4DT1A 4QNRA 1JBKA 5A0FA 2RCNA 4RFSB 4KSBA 2JLZA 1E69A 2CBZA 4PC1A 1QHHB 3P1JA 3FOZA 3BOSA 5TMPA 2AKAB 4DDUA 3B82A 3KKQA 3BFKA 4V0MA 4HZUA 2QPTA 1G3MA 3CKLA 4ZO4A 2KE5A 1JPJA 2V55B 5DGXA 1XCGB 1E2PA 1DBSA 4J0QA 3JVUA 3ASZA 4Q19A 3TVTA 2WSSD 3A1WA 3KL4A 1UKYA 1NN5A 4LYFA 3ZVLA 2A5YB 1AK2A 4X8OA 2QPAA 5TVKA 1F3OA 1LTQA 2VBCA 4IDPA 2C8VA 2ZEJA 3LBIA 4FMBB 4EPVA 4IEEA 1SGWA 1TL7C 2FSFA 1WMSA 1XPRA 1W7AA 1ZIPA 3KJGA 1KO1A 3VX4A 4BZXA 2A5GA 1G9XA 2HXYA 4BE7B 2AX4A 3KJHA 4NH0A 3IDQA 1SXJE 1E32A 1KTVA 4W5HA 3CRQA 4FN5A 3QPUA 2QROA 4JLOA 5HE8A 1TMKA 5C2JB 5K8TA 2ZJOA 4DCTA 3ZD7A 1ESNA 1ZW6A 2EWVA 4XD7D 1XZQA 2NTYC 3RS2A 621PA 2FSGA 4LWZA 2YJTD 3HJNA 4ESVA 4NPHA 2N42A 4B3DA 1DOAA 2GCPA 1GSIA 3SEAA 2G3YA 4IVRA 3TW8B 1K8RA 2HF8A 2WJVA 2BKEA 4OHZA 4NYJR 5HCNA 3K1JA 4LSGA 4LJAA 4WW0A 2EFDB 5CM9C 3TGPA 3FYHA 1E99A 1IXRC 1E4VA 1AS2A 1JEEA 2DFNA 1OF1A 1N6OA 2ZS9A 4DVGA 2IYUA 1XRJA 2IWRA 1BMFA 3QKSA 5DHAA 3AQ4A 1E2EA 2PZFA 3B13B 1MO3A 2AHOA 4DZZA 4LHZA 1FOEB 1D9ZA 2PEZA 2OCPA 1NVWQ 1GP2A 2OSBA 1ZM9A 4UQOA 2BBTA 3AF2A 4B76A 4AKHA 4LPSA 4DCSA 2Q3MA 3CO5A 2I3BA 3RYTC 3N2IA 1PJRA 2TMKA 2IEZA 4DJTA 3U6BA 4D0GA 3CNOA 4R98A 4Q7KA 4XWKA 1E2NA 8OHMA 1TQ4A 2RMKA 4PPQA 2BMDA 4JS0A 4GSYA 1ZNXA 1G8HA 5AR1A 5KPDA 5GJVC 3AVTA 4Q4JB 5EE5B 1JB1A 1OXVA 1SVMA 1IJEA 1UEIA 2VIIA 3QXHA 4FMDB 4B2LA 4E07A 4A2WA 4UNNA 3WYFA 1DG3A 1CLUA 2PX3A 3B1VA 3B1WA 4ACAA 2VF8A 1LB1B 3OEED 4Q9IA 1H8HD 1OXTA 1WBBA 3C7KA 2Z43A 1FTNA 2WJHA 1OV4A 2FN4A 2BDTA 4MKIA 3KB2A 3L0IB 2IYQA 2X1VA 5EP2A 4DB2A 5KOYA 2XOKD 3N2EA 2ONKA 4LJ7A 1E9FA 4M9ZA 3EC1A 5J4LA 1KY2A 2ZROA 1G3IA 2ZRHA 4HAZA 1KK2A 3A37A 1UADA 4G1UC 1QHGA 2WZQA 1T3LA 1FMJA 1KK3A 3A58B 3IUYA 1H8EA 4O2LA 4G5SA 1W2GA 5JHHB 2MSCB 1NN1A 4XVRA 3GPLA 4G0NA 1M7HA 2IF2A 1KSGA 1UF9A 1XXHA 5JECA 2QGZA 1ZIOA 2IT1A 2Z6VA 4XTRA 1NG9A 1N2CE 5H70A 2XJ9A 3RRYA 4PHTA 4OK5A 4JT2A 3LLMA 1E2MA 1CKEA 1OT3A 2IYXA 2ZRCA 1SVIA 1E0AA 4OK3A 1GKYA 3ZZTA 3OIUA 4CDGA 3M1IA 2NG1A 3AUXA 4RKEA 2F1IA 1G8PA 1KNQA 1XJ0A 3HU3A 5FUXA 3SJCA 4LBZA 3AKYA 3RRNA 1OE0A 3GEIA 5KDLA 2VP4A 4N0DA 4PSAA 3FHOA 2CEAA 2V1UA 3SYKA 5FPTA 5L3SA 2HJGA 4A0RA 4D4KA 1KMHB 5KDDA 3E5HA 4DIDA 3CR7A 4UJ5A 1EX6A 3TVDA 1QHNA 4F38A 2FFBA 3SJBA 4P33A 2BMFA 3SR0A 2OFXA 3WMEA 1UBGA 2QUZA 1NBME 2REXB 4BLRA 1F6BA 4C7OA 3ZIAD 4V0ME 4CRWB 4NE2A 1VHLA 3EC2A 3PEWA 1FL9A 4II7A 4HB0A 1NVVQ 4M0LA 1C9KA 3ZZUA 2GTPA 4HLDA 2BEJA 2WAYA 4QHYA 3J81k 1E96A 3TKLA 4OHXA 4TL6A 3WHLA 3GJ4A 1Q12A 4PZLA 1N6PA 3IPYA 3AVXA 1GNPA 4MUBA 3EPKA 2X8AA 1FFHA 4GNKA 2QN6A 2QL6A 2C2HA 1RRCA 4PC3A 1YE8A 5FFMA 1N5KA 2KB0A 3AKEA 5F3WB 3CLVA 1QG2A 1UFQA 2Q3FA 2OCYC 1TX4B 3QQ5A 3QVVA 2OBLA 1J8YF 2NZ8A 1FUKA 1TF5A 1T9HA 1UDXA 3BK7A 4TTQA 3U3MA 2XZLA 4JL6A 1AA9A 3T35A 4L4UA 3D7MA 1SVSA 2O8DA 1CF4A 3U6KA 4GRAA 4Q4AB 1Z29A 2J59A 3IIJA 1S96A 2ZYWX 1JJ7A 5FTNA 2Q9BA 4ARZB 3V4FA 1VCOA 3MD0A 4CIDA 4UKDA 2Z5FA 1VHTA 5JSZB 1G4UR 1DEKA 4QC2A 1Z8FA 3QBTA 1R0YA 1S1CA 3G82C 4HLUA 2V7QA 3PR1A 1T8UA 1W49A 3HYTA 4N1AA 4PSVA 2P65A 1SKYB 2R6FA 3SC3A 1XMVA 4OI4A 3C15C 5TARA 1YKSA 2WJIA 5IHPA 3O8DA 1WDTA 3SJAA 3CWZA 4HSEA 5IF9A 3LY5A 2ZVPX 1I4DD 4Z1MD 3T12A 2F1RA 3QKRA 4G5GA 5M04A 2FU5C 4C0KA 5AJYA 2WKPA 3THXA 3EZ9A 2DB3A 2H1LA 1TAGA 3T5GA 5JLJA 3W90A 1G7RA 2O8CB 1JI0A 2IYZA 3LAWA 2ZRJA 4LBYA 4PZYA 1JPNA 1NL3A 4TQ9A 2IYYA 4GOKA 4ASUA 5EE9A 4OQMA 4PFSA 1QDEA 1TADA 4LCBA 2W6JA 5KHOC 1UDWA 1HQYE 1ZMXA 1IOZA 2B92A 3NXSA 1L4YA 3A1VA 3THOA 4TTRA 2FA9A 4BFVA 1X8JA 3RC8A 5FPKA 3DOFA 2B7BA 2IA5A 1GNQA 2L0XA 2W2TA 4HUTA 1XWIA 2JDID 4C0SA 1DVRA 4ZIRB 1HURA 3TRFA 1WRBA 2JIZD 3K0FB 1XD8A 2ZREA 3UATA 1J8MF 2P3SA 2ATVA 5E7MA 2F55A 2XNDD 1DAKA 3PEYA 5DO9A 4Q21A 4B74A 2YOFA 1RRFA 3TBKA 3VNVA 1N5JA 2W83A 3SHWA 5SZHB 4AURA 2PMDA 4MDFA 1QHXA 1W4CA 1Z6TA 2H57A 1G41A 2IXFA 5EXSA 5EXXA 3WMFA 4LJ8A 4EPYA 2GEVA 3VR5A 2CL6X 5H1YA 4MH0R 2IYLD 5J4YA 1HT2E 2G6BA 1G7TA 2ZRAA 2QAJA 5JI2E 4JVSB 3FDIA 1XXHE 4AG6A 1GRRA 4DC9A 4GZMA 4E03A 3MLEA 3AVOA 1HA3A 1DG1G 2YKGA 3AF4A 1P75A 2OXRA 3WP1B 1VCNA 3X1YA 4TYYA 1TPZA 2RGGA 4R7ZA 4G5OA 4LHYA 3UPUA 2BJWA 1G18A 2B7CA 3PUYA 3SYLA 4EQ6B 4C0AC 2G1JA 1Z2AA 1KKLA 4YMWA 4CEIA 2GILA 2GK6A 2X19A 3MJRA 5KTYA 2OFOA 1Y63A 4EJSA 4M1OA 1PLKA 2G0NA 1II9A 1R0XA 2FG5A 1OXXK 3KQNA 3GLHB 4MA4A 4EPTA 1A82A 4OK6A 1HY3A 2D3WA 2I4IA 2CVHA 2QENA 4KLNA 4RZXA 4TYPA 3TNFA 2QSYA 4Z54A 2ZE7A 1P60A 5FH9A 1W4RA 2R9VA 2JLQA 1CJVC 3A1SA 2PCLA 4KV9A 5FPHA 4LJ4A 2ZR9A 4PQRA 5JZVA 1SQ5A 2CJWB 4K8OA 2E87A 4LC1A 1S4QA 1ZC4A 2CE7A 2ZUDA 2YWEA 2JLSA 4C2TA 2W0MA 4TSFD 2ZYTX 5AUPB 2BBWA 2C9OA 1DARA 3H84A 3G5UA 4AKGA 2R6GA 2FZ4A 4A82A 4QM7A 2RH5A 1AZTA 3KUCA 1GRNA 4LV6A 1XMIA 4DEYA 1GG2A 3Q7PA 1A7JA 2D2FA 1KAOA 4CT4B 3DDCA 2PZGA 4GP7A 4KYUA 4NP6A 3Q85A 4EPRA 5J4VA 3OEHA 3Q8XB 1E9RA 5JRJA 2YWHA 2KBEA 2O8FB 4YDHB 3AVQA 2GCOA 5CB6A 2GDJA 1WP9A 4KO8A 4M4SA 3K70D 2XITA 3EIQA 1YZQA 3BB4A 3DKVA 4R9UC 1R2QA 4EPWA 1UBEA 2CK3D 4NYMR 4V0NA 1QHSA 3RNLA 1UKZA 1W0KD 4PTLA 4LZZA 4LV5B 2ZJYA 4LGMA 4JKYA 4TYQA 2JLVA 3K70B 4M9SA 3MRSA 2OBNA 2GJSA 3LV8A 1ZP6A 2OCBA 5CJ2A 3B9PA 5FL7D 3SFZA 3TSWA 4B3GA 4GBMA 1N6HA 4IDOA 1MV5A 4MGYR 4ACBA 1DELA 4OBEA 4C3ZA 3AVPA 3PFIA 1AIPA 1NSFA 1II8B 3GD7A 1CJTC 4XWAA 3U7GA 2IS1A 3RLFA 2F43B 4D4JA 2PJZA 5DHFA 5DN6D 3NIBA 6Q21A 4V0LA 4B2IA 3KJEA 1X8LA 1XD2B 1XEWX 2O8BA 3GLIA 3FFAA 2LKDA 1IN6A 1NJFA 1W4BA 1DE0A 4QXAA 1YVDA 1B0UA 2EFGA 1Q1QA 4M2LA 2NOAA 3B8HA 2J0UA 2F3TA 4C30A 1ZJ6A 1OKKA 4E22A 3AV0B 3IBGA 5KU1A 4TTPA 2UVQA 4MUAA 2QRZA 4CW7A 2PEYA 1OJLA 3BC1A 4GFDA 1IY0A 5G3ZA 2ONJA 4XH9B 3WRXC 5IT5A 1IXSB 1NLFA 4URXR 2P6RA 2HLDD 1CEEA 2OHFA 4Z51A 1N3BA 2BV3A 3A1TA 4MKFA 1J70A 4JJZA 4MKGA 3NC0C 2VEDA 3PVSA 1Z2CA 2IW3A 2DY1A 3P26A 4CEHB 3QEOA 4LYJA 4AY2A 3GLGA 4DUGA 4WXRA 2W2XA 2C77A 4EFNA 4DIEA 3HP1A 3WRYC 2GJAA 3WBKA 1NMXA 1US8A 4MYCA 4TLCA 5BWMA 3GJ0A 4OYHA 2RGCA 1G7CA 1ZCBA 3TK1A 3B78A 1OH8A 4RY2A 1YR6A 4DLRA 3NWJA 1E79D 3X1XA 3L8YA 5ANRB 4AWXA 4Q7LA 3CRMA 1EESA 1LVGA 2J9RA 2QAGA 2CCGA 2FH5B 5FBRB 2VYFA 3HU2A 1XEXB 4H1UA 4NDZA 3FVQA 1G5TA 3LXXA 4BGDA 5JCPA 2YWGA 4RFSA 2OV2A 2QGNA 1I4LD 3KKOA 2Q9AA 1PVOA 1KIMA 4JBYA 1YZLA 1RJ9A 5J4HA 4NCIA 1RVDA 2JLUA 5DNYB 4QKQA 3FKSD 4DLZA 4Q5IA 1KYIA 4BLPA 4DLYA 1S8FA 4PAQA 4C4PA 4M1YA 3UMSA 2P2LA 2G1KA 3KQKA 1Z6YA 2BMEA 3Q3JB 4B47A 1OFTA 1DS6A 1KY3A 1DAIA 1ZM3A 3K70C 5BN5A 1JNYA 5FBQB 1YJ5A 3EAQA 3P27A 1QF9A 3DO6A 5FOSA 2GXSA 1FNNA 3WXMA 3NH6A 4IOJA 4NYMQ 1TEVA 4PHHA 5L3RA 2AXNA 4FI3C 4HEJA 2WWHA 2HV8A 4NYIR 3ADDA 1N0WA 2OBMA 5E4FA 4JL5A 2ZJBA 5JS7A 4QGHA 4DDTA 2V54A 3PQCA 2ZRFA 5JWOA 4JMPA 1WE2A 3V4RA 1HUQA 3NBZC 1XTSA 2CCKA 4URWR 4RKFA 3LA6A 5FPYA 5GVSA 1MRNA 4HAXA 2GETA 4I1SA 3T1OA 4F92B 1W5SA 4XD7A 1K6MA 2GZDA 1GL9B 1G16A 3RABA 4ZPXA 2UZIR 1E2QA 3UMRA 1SVLA 4A4DA 4RZ3A 1VYTA 2OM2A 5AUOB 2RB4A 3KX2A 3KZ1E 3FHCB 2W6ID 1JXMA 4H1VA 3GJ7A 2ZRDA 4Y0VA 4M9QA 4LYHA 2ZU0C 3T1VA 3BWDD 1OFHA 1AS3A 1ZM2A 3SE0A 1XZPA 2RAPA 4L9WA 1E2LA 4MYUA 4A8JC 2FGJA 2VTKA 3CPHA 2AD1A 3VX3A 1OH7A 1Q3HA 2R6CA 3D31A 1T3HA 1JR3E 4D81A 3MUFA 5L8VA 2GHIA 4LHXA 3K09C 2HF9A 1GILA 4FINA 1NF3A 3Q5DA 1T4GA 4PPFA 3BERA 4Q7JB 2BOVA 4M8NE 4KBGA 5CDFA 1TF2A 3BORA 1G3UA 1QRAA 3LDAA 4RD1A 3FKQA 3VHLB 421PA 4JLPA 4EJSC 1ESMA 3LQRA 2ANCA 2HT1A 4Q4JA 1N6IA 1M6NA 2BVNA 4XTCS 2ODBA 5DH9A 1CR1A 5IK2A 3GLFA 3QXSA 2ZVQX 1C1YA 1LV7A 2J87A 3DZ8A 3JVVA 5JEEA 1XMSA 4GZLA 1EWQA 3QXXA 3JZMA 1E0KA 1CJUC 2ZUCA 1SXJD 3OEEA 4DDVA 1H8HA 3CR8A 2VPPA 1F5NA 3NBXX 3PIRA 4Q9HA 3U60B 2O5VA 3GLIE 3DVLA 3T5DA 1SXJB 2R44A 4O25A 5BXQC 1MT0A 2IEYA 2DFLA 3O8CA 4US0R 1N25A 4OQFA 4QL3A 1OB5A 4C2UA 1MABB 4B71A 5KO2A 2H8KA 1KHTA 1KKMA 4LV8B 4NCJA 2LCFA 1G7SA 1O87A 3LBNA 1IY2A 1NN3A 2A2ZA 1Z0AA 1N5LA 2FSIA 1XJQA 2IYRA 3BIFA 1P61B 1Z47A 3HPQA 1Q1EA 4P32A 3CX6A 3RDPA 1CBUA 1VECA 3ZD6A 3MWJA 5LDDC 1RW4A 1W36D 2A7QA 2GXQA 1Y3AA 1F2TB 3W34A 4JLDA 4PZZA 2ORVA 2Q0HA 3BJIC 4O0MA 3EX7C 3KJIA 3A8TA 2ZYUX 1FX0A 2VSFA 1W36B 4PAMA 3TMKA 3FMIA 4BRWA 3S1AB 1YR7A 3SQXA 1KI6B 2IYTA 2BJVA 4W5WA 1M1YE 2IK8A 2BKUA 4A0FA 4A92A 2IS4A 5H68A 2AKYA 2O0JA 1Z6AA 1P73A 3ZQ6A 2VP2A 2GBLA 1KMHA 1OHHD 4OI1A 1XPOA 1R0WA 3PUWA 2V1XA 2QBYB 3B1ZA 2RGEA 1TNDA 2QTHA 4TL7A 4X8LA 3BXZA 4C9BA 1JR6A 4Q1FA 3OFND 4MKHA 3KQUA 5SZJA 1EG7A 1U81A 1CR4A 2GEUA 3VR4A 2PX0A 1X6VA 5G3YA 4D4MA 4EKDA 4TLBA 5FL3A 4MRNA 4YQFA 2ODWA 3B85A 3ZIAA 1EXMA 1W0JD 3OZXA 2FMXA 1IXZA 2C78A 1NVUQ 1W44A 1ZU4A 3QY0A 2QP3A 3LD9A 4HDCA 3EZFA 3RS3A 4D6PA 4TYNA 2WPDD 2AXPA 4TWZA 1KSFX 4AKEA 2NO6A 3SNHA 4U02A 2ZRKA 1GIAA 3T15A 3WYAA 1PUJA 1DAEA 4TQUS 5C46F 4PO9A 3AVYA 2A5FA 3VR6A 3DM9B 2WJYA 3LLUA 1G291 1TF7A 2GJ8A 1P2VA 1MOZA 2VA8A 2QMHA 2QAGC 1U8ZA 2WWGA 4HLCA 4DRZA 4GPTA 4EPXA 4ZKDA 721PA 2JA1A 1QZXA 1ZINA 4JIMA 3M4YA 1YR9A 3CPJB 2PT7A 1YQTA 4ZCMA 2QI9C 1DAFA 2EFHB 1M2OB 1SXJC 4ARZA 2F1HA 1KI9A 4QGFA 2FWRA 5JSZA 4Q1CA 2ZI4A 3R20A 4L16A 1CJMA 3BGWA 3JZAA 5A4JA 3X1DA 2VP0A 3T1QA 3LX8A 2GESA 1AQYA 4LDJA 1UKVY 1ANKA 1NVXQ 4PC6A 4A6PA 4Q7MB 1X3SA 3VHXA 1UBCA 4URVR 2HUPA 4L9SA 2VHCA 3W9YA 3U44B 3D6TB 1JAIA 3NC1C 2Z0MA 1G6HA 1GITA 4C0HA 1R5OA 5D3MB 4BLOA 4QBFA 1F2UB 221PA 2NPIA 2ZSBA 2EYQA 3CH4B 3HPRA 2J0SA 1VIAA 4KXFB 1V5WA 2O8CA 1ONBA 1VIYA 3FFBA 4DT1B 1NBMD 4HUQB 4G5RA 1Z08A 1PUIA 4I81A 1SVWA 3SS8A 5FOVA 1XU4A 1RIFA 5EE0A 3RHFA 4CGZA 3R8CA 2OFWA 1FP7A 5B58C 2B8WA 5GADl 1G8FA 3MSXA 1XMJA 5BN4A 1W4AA 3I61A 1UKEA 4B3FX 4DCNA 3H2YA 4M1MA 1N5IA 3DOEA 5CM8B 1J99A 5B30A 3MMPA 4V03A 2B6HA 2ZANA 2O8EB 1M34E 1W1WA 2V4ZA 4LHWA 4ZIRA 2KWIA 5CK5A 2CCJA 3LH5A 4IVPA 4DCVA 4DSNA 2QSZA 2R6DA 4YDSA 5J40A 5HZKA 2HDNB 2GZHA 2JDIA 4FCVA 3CPEA 4B32A 2R62A 2GK7A 1Q1BA 1OFUX 3IHLA 1G4AE 2YWFA 3ZVMA 1P4SA 3C14C 2FEOA 1UAAA 2PH1A 4NYJQ 3RSLA 4URZR 5BN3A 4B3XA 2XNDA 3UWKA 1ZUIA 2ZSFA 1HE1C 4ABYA 4Q48A 4RCZA
chains in the Genus database with same CATH superfamily
4I3GA 1TQ6A 4KQMA 2VQ6A 2C95A 4AZ3A 5ERGB 1DDIA 2XUKA 4XLTA 3CC8A 5IVPA 1O03A 1KAGA 4Q3OA 1NXSA 5TVGA 3L0CA 4K9MA 1QYXA 4PRKA 4EGJA 1Z36A 2FZGA 3ETDA 5FRDA 1OVMA 1UWVA 2AF3C 2C2ZA 1E9CA 2EGHA 2JFXA 3KYDA 4XZ3A 2NTVA 4C0WA 1I80A 3OX2A 4IW3B 2HHCA 3ZI7A 1M3SA 4I8IA 2V6FA 5CNKA 1YB2A 3RTDA 5JDIC 3PCTA 1HE3A 3L0BA 3WRXA 2VWGA 3K0AB 4EHAA 5C3MA 1KS9A 4ZAFA 1PZMA 5LXTB 4E5YA 5JMPA 4KP7A 1DEHA 2Y05A 3SBDA 3LKDA 1G1AA 1OZAA 1XRQA 3NONA 4KO2S 2D4HA 4L7QA 1E5XA 4QBHA 5TQ2A 3TWOA 3HEMA 1GA6A 3UA3A 1BXRB 5D3QA 5B12A 1KERA 2PWPA 3WYGA 4A10A 3GRVA 2VCYA 2PUTA 4AZTA 1A88A 2RC6A 1VSBA 3H16A 2CNBA 2EX4A 2WF6A 4ZOLA 5LYJF 4IDCA 1E0SA 3UJCA 1NR5A 5JZ9A 4MTCA 2VNHA 3EXHB 1PGOA 2JL1A 5JQWA 2YRFA 1AKNA 3OTGA 1ECLA 1JT9A 4CLEA 1Q20A 2KJQA 2YYZA 3OLWA 3GFOA 1ZCJA 1OTHA 5AH0A 4YHBA 4DYDA 3K9NA 3UMFA 3X1KA 3P2IA 4ZOEA 3DE6X 4JLWA 1W5TA 3VTKA 2PRJA 1N9GB 2CJWA 3U3ZA 1QIIA 1TMOA 2EKQA 1ORVA 1N34B 3GBSA 4LDNA 1S4MA 2YVQA 1KQPA 1RI2A 4R2HA 2PUVA 3PGA1 3T94A 4X90A 1S2OA 2PXAA 3TQIA 2V7XA 3PNKA 1D2MA 1YOBA 2OQRA 1TIKA 3I73A 2P62A 1FP1D 1AF4A 1PNVA 2V5VA 1JDVA 5AI6A 1WUYA 2FPPA 3TCNA 2B4YA 4DTIA 5C18A 3VU3A 5CT4A 1S89A 4ZAYA 2GUWA 1P0MA 2DBYA 1U2GC 3A9RA 2QRHA 4FD3A 1V8DA 4BP1A 3R77A 3BM5A 2K7ZA 1Z82A 1JE0A 1Y9EA 2HSEA 4WKOA 2B78A 3KNZA 2GTHA 4YAEA 2OYRA 2O8FA 3FSGA 1EFTA 1VDMA 1Y1TA 1TMGE 2WSYB 3OQ1A 1R5JA 2YMQA 4DIUA 1KP2A 2QK4A 1MT3A 1VIVA 2ZQZA 3O47A 2ZUEA 5KNDA 1KMNA 4AP5A 2V7GA 4MVYA 5CCBA 1XL0A 4B46A 4PYIA 2PTGA 4I2NA 2XZTA 1HNWB 3EEFA 4NMWA 1TB4A 1MAUA 3ZTTA 1Y7PA 2GBLC 4G0UA 3IBYA 4K0RA 4BJ1A 3FTQA 3Q6MA 4BNFA 1TMYA 2J7PD 1C1XB 2CK3A 4M60A 1XLTC 3WNBA 1W0KA 3UW1A 4CV1A 4P3OA 3WIVA 2YHUA 1EQAA 1W1IA 1JKXA 4UBNA 3EXIA 4U7FA 1NC1A 1G55A 2G8LA 4KRYA 5T6BA 1JTEA 4OHWA 1XZ8A 3OIYA 2BM1A 4OGKA 2HMSA 2CYAA 4L5BA 3EEQA 3OU7A 3B53X 1KAMA 1V1RA 2ZSEA 4LJ6A 3S0JA 3VXKA 3DDOA 1XD2A 3OHSX 4HAIA 3LUAA 3I2IA 4RC9A 5JMTA 4UC0A 4JLAA 1KYVA 4D80A 5HOEA 1U2ZA 3E7PA 1QHIA 2GARA 3KVOA 4XX0A 1GGVA 3H9BA 4YC7A 3OX3A 5J63A 2BF4A 4PCUA 3ZGVA 1YA6A 2DERA 1RRPA 1UFRA 5EIBD 4HJRA 1JILA 4RHTA 1J97A 1KPGA 2F4VB 3VTFA 2X8LA 4DYHA 3BMOB 3F9RA 3RB8A 4NRDA 3DFMA 1BKDR 3HU5A 3NHAA 4ZYYA 1BHJA 3C8UA 4WXPA 3RRJA 1Q0RA 4I1YA 4NEHB 3WLRA 4FXPA 5CH3A 3X2SA 4HAUA 3PC7A 1JMKC 4ND7A 3MCAA 3P20A 3AGPA 2Z8ZA 2YYAA 3SFVA 3DNFA 3H6GA 2P0AA 3W04A 1U0JA 5D01A 2QTTA 1SKUA 2MHCA 3E22A 2VFAA 1W88B 4M83A 3RYFB 2VJYA 1EFRD 4K7JA 4BFLA 4FEYA 5AM5A 4A8JA 1M0WA 4RL4A 2ZJ7A 2EQAA 1OLUA 3LBAA 3COYA 1BU8A 4X61A 5IVIA 4N12A 2A0KA 2GF2A 5AKXA 5GOTA 4QDOA 3K0CC 1K63A 3WP0A 4FZJA 4HTFB 5EJ8A 1DFIA 1NXWA 4KSYA 1CJCA 4FYWA 5AJZA 4IUDS 5LXTF 4TPKA 2LPMA 1U8TA 1XZFA 4NCHA 1VE7A 1T0JB 4KPUB 1MO5A 1ZIYA 2IBMA 5JLAA 3ZWYA 5AKJA 3T9FA 4CM4A 2HCJB 4DFDA 1C7RA 1Q11A 2YNMD 3RTEA 5WRFA 3MXOA 3RRZA 3S44A 4PM4A 1OT5A 3PCRB 4RTLA 1A2KC 1K5GA 2BFWA 2ZI5A 3A36A 3N0VA 4IOMA 1T4CB 4BTLA 3DDSA 1E79A 4G41A 4ODIA 2OILA 1U11A 3L8DA 3T34A 1XYYA 4D4HA 1MAVA 1O94D 5JRZA 4PXYA 2E55A 4BKRA 1I6LA 5JZBA 2L42A 1ODSA 2G7MC 3EWSA 1Z0IA 2FDRA 3GFSA 4OSPA 4C20A 1GTVA 5BSEA 3H13A 3BSYA 4ZCSA 4FQ8A 5LZ4A 1RRVA 1I7PA 2WG0A 2CLLB 4D57A 1SKAA 1IK4A 4W9RA 4CODB 2UUCB 3CW2A 3OI7A 4DR5B 4RADA 3TBFA 3HGMA 3N2LA 1PEDA 1P0CA 3A9SA 1X7GA 2EGGA 2WMDA 4L78A 2A9RA 2BGJA 3JW8A 4FE7A 3IAS6 1RAGA 4NZOA 3ZCVA 2B4TO 2ZJ1A 3Q6IA 4UFPA 1GA1A 1U98A 2VPXA 5F4ZA 4F9GA 2QQEA 5L53A 1Q15A 3D3NA 3RG2A 1VMKA 3VTZA 1IN5A 3MJVA 3SFTA 2B4RO 3LYHA 4OHOA 3HFSA 4DA7A 1YOVA 1KXZA 1QNFA 4UUOA 1YZGA 3REGA 4B3BA 3T7KA 1XDWA 1SVUA 4L4SA 1OYVA 1XQXA 2C2WA 1IHUA 2PZJA 3H1EA 1FS6A 1YMUA 3ENWA 3I2GA 3ROKA 4RGQA 4TMFA 3SS7X 3MRXA 1PJSA 3KPUA 4UTOA 3N70A 4HDQB 5DBIA 2ZJ0A 2ZTMA 2CLSA 3C5HA 4X6LA 4ZHQB 4AG3A 1AGRA 4IL5A 1P0IA 1XKQA 4URFA 5F1PA 1DXYA 3KC2A 3KB8A 1CZNA 3VR1A 1IMJA 3OPVA 4G85A 1AF7A 1TU3A 2A84A 3IYLW 1WXFA 2XD9A 5KYKA 2Q6VA 2Z83A 3QKRB 4ZK2A 1LWOA 1NY5A 4PZUA 1RAIA 1VGQA 4ZZIA 3THXB 5BR7A 3VZPA 1OFVA 1E9DA 3VNRA 2HA2A 3ZLUA 1A77A 4UOZA 4CU5A 4YREA 4KVGA 4MW0A 3V2HA 2A5DA 1QTIA 4P08A 2WT8A 4IQFA 4ZRNA 1GLGA 2DWQA 4MI9A 2MSLA 3OCUA 4WKGA 2QE7D 1ULTA 5EQTA 5FHRA 3NVMB 2C8LA 4B0OA 1KOFA 2ZI6A 3PXUA 3IDZA 2W6MA 4Q1DA 1X0VA 3A9WA 3PP8A 4BLQA 1B0ZA 2FFJA 3GFPA 4FB4A 3UT6A 2BFDB 3UWOA 1KEEA 1VG8A 3C6QA 1CUJA 3A2NA 2KHZA 3DH0A 3QSYA 3KSAC 4UVHA 5BW8A 3UB4A 2HLPA 1HOXA 2V9CA 3HKEA 3WI7A 1WDWB 4W5JA 4BC1A 2OXIA 1G8YA 3HUEA 1QFJA 2OTCA 3OSUA 2X8WA 4JT4A 4N5NA 2V9PA 3RC3A 5L45A 1XTIA 1Y7HA 3G0CA 1RYFA 1B2LA 1KI4A 1WZIA 1ZSYA 1DT5A 1TT5A 1YZNA 2AOVA 2DR3A 1KE1A 3MQ4A 1R6UA 3FRJA 1A9OA 3H2JA 3H86A 1E6UA 3HS3A 4LI0A 2RB5A 1GM5A 3HCWA 1I5RA 2GWRA 5CFZA 3E4DA 2D7DA 4NZYA 4YH1A 2OR3A 1J9ZA 1WG8A 2CNKA 5T4HA 3N86A 2DFDA 1GYRA 3ZCXA 3LTEA 4Q1BA 1IL0A 3A14A 3CNNA 2P11A 5HCUA 4DLVA 3P4XA 3C70A 1FJHA 3T4XA 5K9ZA 4MS3B 2LIVA 1RCFA 3BCRA 5E6RA 2ZPUA 1EWRA 3CVXA 2I3DA 3CNHA 3K1ZA 3CX3A 3IR6A 4KKVA 1JLHA 2BGRA 2DJ5A 3IEUA 4NQZA 4Q3KA 4WCVA 3RUAA 3P8ZA 4WE3A 4YONB 4N48A 3IQWA 1J56A 4LJ5A 2QYHA 1T3GA 2GZRA 1RXEA 2PWYA 4FW9A 5AK0A 5ALRA 1JLSA 2Z4SA 1L5FA 1P7WA 2VZEA 1C0PA 3GPCA 4Z86A 2EKLA 5K01A 2JIMA 4BXOB 4RK1A 3LKBA 2FJUA 5TB5A 5HQ3A 2GNAA 1HQDA 1SOAA 4QFDA 1H5UA 1K7FB 1YDGA 3AWIA 3QRWA 3F6BX 1BGVA 2W4QA 2YHIB 1P6UA 3WA6A 1IN4A 4OLBA 4MW6A 2WD9A 2ZRNA 1RWWA 4Q4LA 3EXAA 5EKDA 3VU9B 1IM2A 4F5ZA 2C7QA 3AHHA 3D3KA 3WA7A 1H2RS 3LUKA 5E1MA 2H0QA 1JB9A 3FSJX 2EZ9A 5ICGA 5BQFA 3ZCTA 2WYOA 3DEAA 1N77A 5AI5A 4Q6WA 2OZPA 3KAQA 1Q22A 1Y81A 2E4VA 1AKYA 2VHEA 2FUG1 3G3EA 3IOMA 1E1QD 1AOXA 4GD3Q 4GL2A 4EARA 3PDHA 5IC6A 5A02A 1RJEA 1YH3A 2XV1A 1JR3D 2P5TB 3DZBA 4HR7A 1NY6A 2VYVA 1IDN1 4BNXA 4OCZA 1R4MA 4KDCA 2X8JA 4BMNA 4CLOA 2JFHA 1ZITA 4YWJA 3VDRA 1UZUA 3D6MA 5T57A 2GXUA 2ZFUA 4ZHQF 1WBJB 4GI5A 3OF5A 1C80A 4XJSA 1ODLA 1WF6A 3KSMA 3KPVA 1U3TA 4X91A 4ZEMA 5BWCA 2X0FA 1Q3KA 4R2JA 1VTKA 1VJ0A 2WUFA 4J3FA 2CLCX 3MCTA 1XTKA 3ZE2B 3BILA 4M1EA 1L7EA 2EFEB 2VUTA 3K05A 3GGDA 1KI3A 1X74A 3CNBA 4OQPA 3X2FA 2W71A 3OMXA 1C3OA 4AZSA 4E4TA 5CW1A 4GZ5A 1U0BB 1J39A 2H7YA 3L0SA 2ZW9A 5FLEX 1HTTA 3KIPA 4V38A 5DBEX 5ERYA 1NMSA 3DZDA 4LDQA 2J41A 4ZYUA 2VDOB 4Q7EA 5FPSA 2I6QA 3VSCA 5J4KA 3A6PC 1XZCA 2XTZA 1JIIA 1NI4B 1P3JA 3K4QA 2G9NA 4B34A 5AOBA 4QOEA 5HBRA 2QB5A 5TGDA 1X1QA 1XTJA 3DONA 4DLWA 3KKLA 4G0VA 3PXEA 4Y3UA 5K3DA 3UVEA 4Y1RB 1BKYA 1DAGA 3F6CA 4MB6A 3IMCA 3ZEIA 2NO0A 5DLEA 1DL5A 4R1NA 1P9LA 1O9GA 5JBQA 1DDOA 1QH8B 1MVNA 5DLDA 821PA 3INRA 3R7DA 3MJEA 2X9QA 3FE2A 4TZKA 2FPKA 3IIIA 4HYQA 5HKKD 2QXUA 2WLTA 5F78A 1V7ZA 1XPUA 4LDZA 3CRRA 5JDIA 4FZRA 3QUSA 2VUIB 2R2GA 3CLTC 3DLCA 4B8ZA 3PWSA 3HYLA 4BNGA 4NXNB 2V74B 1ZIXA 3CXUA 4P0TA 1JMVA 4O5AA 1IONA 1G2PA 1K9SA 1V6AA 4QPPA 1E61A 1WZNA 3DV9A 2Z3ZA 4NCNA 2RH8A 1B6SA 1JS1X 1PNOA 1BYUA 1UT5A 4LQ4A 4DUGD 3NV9A 1E6MA 4EA7A 2IU0A 1X19A 3T9EA 1HDXA 1KJWA 1GGMA 5EJAA 4POAA 3KUKA 3KQHA 3RSFA 4BRUA 4XR9A 2JAHA 4YECA 2NTEA 3GFGA 1S2GA 2WJWA 3C7AA 1A9QA 3G0BA 3TLKA 5JQGA 4ZOQI 2JH8A 5IW8A 5TEWA 3QLJA 4IKPA 5B2FA 3I0ZA 4B7UA 2H1FA 1Q21A 2BEUB 3FCXA 5DHUA 4RLFA 3W79A 2IH5A 2CHEA 1LPBB 3EVAA 4BBPA 2QTFA 1BU5A 1F2UA 3U49A 1R50A 4IGAA 2RGWA 3F47A 4L4RA 4NAHA 4C4RA 4LTNA 3GRAA 3SK0A 4ZVPA 4TT3D 1KR2A 5IBQA 2J31A 4RJIA 4Y2PA 1H2WA 4B17A 4US2R 2NW6A 2R5FA 3DC7A 4IAOA 2C7OA 2J3JA 3DYIA 3OJCA 4DILA 4FWTA 1P6XA 4ER5A 5AW8A 2I3GA 1NBMA 3F6SA 1U1GA 1U2GA 3L4KA 4L0QA 2J4DA 2WIAA 4CU2A 3GEEA 4LQCA 4YB8A 5F2EA 4ZVTA 2P9QA 4EABA 1B1CA 4ZCLA 2BISA 5EJIA 3KPWA 2FFHA 1S3GA 1VE9A 2YWDA 4OXYA 3G13A 4G1FA 4XGQA 4FYMA 2WWWA 4F4IA 5IN4A 1L8XA 1O4VA 3U16A 1NPDA 4XWGA 2WILA 1FFCA 3Q9LA 2X5KO 4JEUA 3KB1A 3ZK8A 1PFQA 1AGPA 2VZLA 5JDCC 1IN1A 2G83A 2ZS8A 3AH8A 3EIHA 3NLLA 5D6OA 3IVCA 5AMXA 5EE3A 1R4ZA 4HYYA 5IXYA 5GJCA 4TTVA 3LGAA 3EEOA 1XLTA 4BDSA 4JVMA 4OQZA 4D3YA 1ZOSA 4G84A 2QPOA 5BN5B 3AM5A 3TQQA 3DHEA 1TJYA 2B8EA 4KH0A 5P8WA 5IEJA 1AA6A 2UUOA 5E3IA 4IOKA 3TIIA 1PT5A 2IUTA 1E4EA 2BEVB 3ACCA 3HRIA 3RKUA 4M6WB 2R6ZA 3EVFA 5AKHA 5FF9A 4BL5A 1GQSA 4XM0A 3C2QA 5LBUA 3LO5A 1M72A 4EF5A 1NLZA 1XAJA 3DDUA 3HR8A 4QOGA 5CB4A 3RGGA 4JI6B 1HQKA 2Z9BA 1XFAA 1B42A 4PZDA 3DMTC 1U7XA 4OJQA 4Y30A 5F1YA 5AXBA 4B6GA 4D8VA 1G2OA 2QRGA 3G9UA 1Q6YA 3TJZA 3SKYA 4OLHA 1AK1A 2PO5A 3BE8A 1BE0A 2W48A 1Y1SA 1ZAKA 1KGDA 3BE4A 1H2FA 3T41A 1ZGAA 4V0KA 4BZPA 1EE1A 3IOCA 2WM8A 1XKXA 3WYEA 4NMHA 1PO7A 4IGFA 2XA9A 2ZTHA 3MWYW 5CX4A 1NQOA 2NO1A 4MQFA 3AI7A 1TM5E 4MCIA 1FBTA 1Q17A 2XVZA 4NENA 4E3WA 1FMLA 2HDOA 3SAJA 4U63A 2GKOA 2FCRA 3MHTA 2AFIA 3K0CA 4CL2A 4P53A 1OAKA 3LA8A 3FCOA 1PTKA 1YHYA 4ARVA 4DWOA 3GEGA 3CZCA 1VYVA 4F9EA 3IVXA 2FZVA 3M6FA 4K3VA 1G8GA 2PD4A 2J9XB 2OXTA 3CIFA 3UFXA 1RWPA 2J5XA 4CKEB 3ZU6A 1K7SN 2I1VB 4G56A 4YNBA 4CF7A 4Y2TA 4NJEB 3ORHA 1IEWA 1ULSA 2IYNA 3U48A 1Z37A 1I3NA 2GEJA 4R7TA 4XEUA 1OZ0A 3TLEA 1JX6A 1OREA 4YUYA 1SC6A 2YHBA 3QYFA 2AN9A 2WJ3A 2DGDA 1V1MA 2J4FA 1ZHHA 1TO6A 1SBYA 3AI1A 5DF1A 3IP1A 1F2DA 4R01A 5FNVB 3KM0A 1LSJA 1MB3A 1NN0A 4TTIA 1RE1A 3VC1A 4LK2A 2VL7A 2EHDA 4HO1X 1WHTB 2FSVA 3BJZA 3G9XA 4M1TA 4Z1MA 1KO5A 3W1WA 2Q3LA 1IEXA 2IXAA 4Z9XA 3G2NA 2J7KA 3SQDA 2YY7A 3QITA 4MGZR 4MW1A 3L8GA 2BKVA 3V33A 4YCMA 2IXBA 2WWFA 2XA1A 4OA8A 5KUTA 1QCZA 5HDQA 3UGKA 5CDFE 3AUAA 2D1QA 1EUDB 3G6KA 4QREA 3PC8C 1P1JA 1KA9H 2XW6A 3DF7A 3EMDA 4HZUB 4MJ3A 3BBPA 1G2QA 5I51A 5LQAA 5ALFA 1RZRD 1M5RA 2AWNA 3COPA 5C7OO 1CP2A 1L1QA 1V37A 5AM1A 2O7SA 1H66A 1JIKA 1FDRA 2QYOA 4PYMA 3FA2A 1XKLA 4DR2B 1WVGA 4FYIA 3T5PA 2J7PA 5AWFC 4BGVA 3UCXA 4JZYA 5J47A 1EFVA 2H1SA 2I8CA 2P2YA 2HBQA 4G5FA 4CVNA 3IIKA 3K2QA 4FDVA 1OXMA 2WHEA 1X0XA 4I9HA 5JNUA 1WO8A 3I9KA 3EWNA 4L5CA 4B8YA 4BX8A 4XLLA 4A0HA 5CYFA 1XWWA 1DC6A 2IP1A 4P98A 2HHJA 4HCJA 4RVFA 4FMCB 3LI2A 5JMOA 3CJTA 1KRXA 2VPYA 4LBVA 5C52B 3OTWA 3FUTA 3K5PA 1N36B 3K7EA 4E5SA 1I5EA 2CBGA 2HJRA 2H2GA 2JJ8A 3GJTA 1ID1A 3L0PA 4UM9B 1QTQA 2EL9A 3KQVA 5JTTA 2DPLA 4JU9A 3QLEA 1QWOA 1XP8A 1BO6A 1UKAA 2PGOA 1ZONA 2A0YA 2K2QB 3A9VA 3L77A 4XSVA 3RS8A 4A5SA 3ZHVA 1G66A 1ECFA 1NYLA 2DT5A 3VV2A 3OFJA 4P4LA 3F8WA 5EXPA 1UT6A 2FHPA 4ROSA 3JZIA 1D5CA 1UMCA 1T3TA 2P9GA 4FKBA 3AP3A 3GDOA 4AI6A 3M6UA 3QK7A 3VMFA 3KFVA 4L4XA 4V24A 2W2MA 3JRWA 4ID9A 5LCXA 4EJ6A 3FWNA 1H2BA 2H4FA 4GI7A 4QYIB 3E5RA 3D6NB 4E5KA 3UT5A 2CMKA 3IAHA 2BUAA 4EM6A 3ZJ5A 2Q2QA 4ZICA 3TGLA 2M6RA 4R8VA 1EFRA 4GQIA 2X4GA 3N7UA 4IWNA 4MVWA 2HEIA 3WB0A 1P7PA 1RBQA 5JY1A 1GUBA 4EQ6A 1D9XA 1JHQA 2VRWA 1VMIA 3M4NA 1K66A 2VK4A 2UZ1A 3ORSA 4TLEA 4ZPJA 3T5AA 3PENA 4B3SB 5ALNA 4KXXA 3A11A 4IFEA 4P4NA 4YRFA 5E4TA 2G4VA 3SSOA 4TOIA 4Z7NB 4X97A 2ZR0A 3DXYA 4TX1A 3ESDA 3L06A 3UBMA 1ZGHA 4HDAA 2E6UX 2QMEA 3ENZA 3G79A 3N2GB 2YNMA 5F76A 2BGTA 1GDDA 2QRJA 1WXXA 1N4AA 4DSTA 1Q91A 2WHYA 1PBTA 3TZHA 2AFRA 2Q6TA 1UC5B 1W52X 2DTXA 3DPUA 1QV6A 3OQNA 2AJBA 1L9KA 1EAYA 3HZRA 3QFFA 4ZYXA 5JAIA 1JG4A 1WM1A 1L3BA 1O94A 1IHDA 2V3WA 4QU9A 4JL8A 1YL7A 2C1EA 4NJOA 4UCFA 1FEZA 4X71A 4M9UA 7ABPA 1U1IA 1IN7A 1GADO 4LRYA 4N0EA 3UAOA 2GO7A 3AW9A 4R0VA 1Y1QA 3BEOA 5FUBA 1SELA 3IUEA 4KACA 4BECA 1KOGA 3WSVA 1QVRA 4Z53A 2YCBA 2AH5A 5A4IS 2GJKA 5A4MS 1XRNA 2RJOA 3D7RA 1FLAA 1UL1X 2BELA 2P3LA 1N57A 3N87A 3NTRA 3TR5A 4LX0A 5KCZA 4QSMA 4GDFA 4HDKB 5NLLA 2DWOA 4RSRA 4G23A 1AN0A 3H2IA 3JQGA 1DADA 4W1QA 1YGPA 2VDQB 1JF8A 3GUHA 2CZQA 5EERA 3V1MA 3OJWA 2VLIA 3A6EA 4RULA 4U2CA 3RS7A 3ABSB 4GQAA 4PVCA 1FP6A 5FNVF 3I30X 5M34A 2DBQA 4KLZA 4DSOA 2H5JA 2H52A 1DHRA 3UN1A 5JH7A 3GELA 4TGLA 1NMQA 4J1TC 1ABFA 4Y2YA 3D3QA 5IM5A 1Y8QA 1DMRA 3ZBTA 4I4LA 2ZI3A 4YLGA 3DBLB 4MKRA 4DDHA 4YYZA 2VXCA 3GQBA 3OJ0A 1NBHA 1T2UA 4FFBA 1K6JA 2NV0A 3PXXA 4TMKA 4QLOA 1QDLB 1UPCA 1EWYA 1TC1A 4QOIA 1W96A 3LMKA 3HB4X 4ND8A 3VJMA 1L7BA 3U39A 4LHVA 1Y80A 3J7TA 3P5BA 1T1JA 2G67A 3TOSA 4XVUA 2FX2A 1RC8A 2Q8PA 4BU1A 5F4BA 3ETLA 5LBIA 2OV6A 4Y8VA 2PYZA 2ZJFA 5AUNB 3Q8LA 3O1HB 2JIOA 3MWGA 2O20A 1ZD9A 4HZIA 4PS0A 5DZSA 5AKLA 3MWEB 5BUZA 1R8SA 4HEQA 3WLMA 2QE7A 1RI5A 3QVTA 4B3HA 4BUJA 4GPD1 1QK3A 4GVPA 4DQVA 4GR5A 1L9XA 1RC0A 3MERA 1TUBA 3ICOA 3OIFA 4FMCF 4MTLA 2ISCA 1GU7A 3PHJA 2FSPA 2QTRA 5I48A 4I1UA 2W2KB 1CCWA 5DNEA 3N8HA 4HN2A 1RKBA 2G82A 5A06A 5K0EA 3Q11A 4PNEA 3KT8A 1H2XA 1J0XO 1L6IA 2V0CA 2WM9B 2YVAA 3QE0A 5BQOA 4EHLA 4KVFA 4ER7A 1E2HA 2F4NA 2BE7A 2PRSA 2WHXA 3FPEA 4YP1A 4JLMA 3SHFA 2DR2A 4HDMB 4YCDA 2DRIA 2QDKA 1CWUA 1HDOA 1W19A 2NQTA 4LZNA 2R84A 4CLDA 3O7WA 2NZWA 3H8JA 2V45A 3TUIC 4C4ZA 3HWSA 1FZQA 1D03A 2X15A 4JLKA 4C08A 2JAWA 3NH9A 4PSCA 4LOAA 4RVNA 3SDSA 4C7OB 3FB4A 1GPWB 2QG6A 4KK4A 3MWDB 5TDHA 3UMJA 1BWQA 2IX3A 2W70A 3R0XA 4RD3A 4K28A 2RK6A 3ZVRA 2OWDA 3W4JA 4CETA 4WNAB 2QZPA 4HT3B 1PV1A 4NU8X 4AZ0B 3SR3A 4ZDJA 2G9ZA 2EF1A 3FF4A 3W5SA 1Z7BA 1X3LA 4R54A 1LLQA 4G09A 4ZQCB 1O2DA 1MZVA 3S2YA 1K4MA 5EHGA 3HU1A 4OQ4A 4EG0A 1V0JA 2C9YA 4NECA 5BWBA 121PA 3EGCA 3GGJA 3IESA 3K15A 5FI3A 3UXHA 1YB5A 2H85A 4YDRA 4CMKA 2ZSUA 4XPZA 4FBMA 4LXIA 5A9SA 4KMMA 3T1HB 3PZRA 1YONA 1FX1A 1RQNA 2KSQA 4G5XA 4KSCA 4WA7A 1ZD2P 3QF4A 4TV9A 1Q0HA 1JJIA 2HMUA 1C7FA 4N5IX 2FN3A 3L46A 3IKLA 3MPOA 4Q0MA 5DM2A 5C7LO 1YHZA 2EATA 2GZSA 5TXGA 1TM2A 2VCEA 4HWKA 3QMPA 4WFQA 2FGKA 3JQAD 4GICA 1YFJA 2UKDA 2O8DB 5KYUB 4PLYA 3GMIA 1FNBA 4IDDA 3TPZA 2BFMA 3DMNA 4Q1AA 1SU6A 3JQ9C 3EDMA 2V7QD 3IIMA 4CDNA 5ITVA 3CUUA 3I58A 2HA7A 2M1XA 1ZJWA 1H9AA 1QIGA 4RH3A 4FOLA 1XP5A 3KU1A 4IM7A 5F21A 1E3MA 1R0CA 3K0EA 5BOSA 4R1MA 5LLSA 3KSZO 3HCOA 2G5GX 4XOUA 5JNLA 3PSHA 4GO1A 3AJ8A 1E1QA 1ISFA 1SNYA 3AF1A 1NLYA 1QPGA 3GZJA 1E2IA 1JR3A 3IT1A 1T34A 5DTQA 1IY9A 1P62B 2NXNA 2W2QA 2BFBA 1G21A 3HJGA 1G42A 3G0GA 3GLHE 4AY4A 1N6KA 2C96A 5IASA 2PUBA 3HN2A 2Q5OA 2QTBA 5B53A 3AIIA 2XQJA 3FTEA 5AVVA 4RPLA 3NNSA 2P35A 1TU4A 3L6UA 3LX6A 4DJFC 4F7DA 3NHSA 2GHRA 2IW1A 3I9NA 2VXYA 1H22A 1MC4A 5A7HA 3JQRA 4AECA 5TRTA 2Q5EA 2IXGA 2P5SA 4QTXA 3N2KA 4NARA 2QMUA 4QOJA 2QW1A 4G8CA 4NOKA 5DSZA 3TSOA 2R7MA 2XADA 2PGJA 3W77A 2W0SA 1VJGA 4UM5A 2XXAA 1QO0D 3C8ZA 5EIEA 2BMJA 2F1OA 4KQGA 3AIKA 1IBMB 2FPMA 4XGKA 4XA8A 1RQPA 2GF0A 2V9ZA 2NSHA 3HDTA 1F9EA 3BD7A 3E35A 1NVFA 1C7JA 1EFAA 2HDWA 1GDHA 3DBRA 4PGAA 4RK5A 2TMGA 3WIBA 4H31A 2J9FB 1VLJA 2QN3A 4IRUB 4PICA 4QEZA 1CHDA 3DMFA 1H05A 2EARA 4MO2A 1U8AA 3FM9A 3P97A 1XZAA 3CCBA 1GPBA 1ML3A 1YBFA 3HADA 3BK2A 2O8VA 3EIXA 2AFHB 2LVBA 2X2EA 2OV4A 2PR7A 4UMEA 3VR5D 1EK0A 4FLMA 3DVAB 5DI3A 3ZDZB 4LWPA 5CCEA 3VDQA 5IC4A 4WZAE 2PUDA 3DMTA 3HRHA 1B3RA 2QYSA 1S01A 4GGPA 4RD2A 2CNWD 3KEQA 5F98A 2I03A 4JKIA 5SY6A 1K5PA 4BNVA 3AEKA 2Z95A 5ILGA 5HKKA 3UA4A 3NAQA 1XRRA 4KFSA 4RMNA 3D8SA 4GYWA 4IX1A 1JMYA 5FWYB 2FK7A 3IVAA 3OZGA 1XQVA 5AI8A 4P82A 5SYNA 5JAOA 2SECE 2YZGA 4XASA 3PQ6A 5CT8A 5H3CA 5H3LA 4B7AA 3O0DA 3W0LB 3OD1A 2EVWX 1U99A 4C76A 1EP9A 1OZFA 4DNPA 2CE2X 2J45A 2ZRPA 1DJLA 2EJBA 5A4AA 1CYDA 4OB8A 3WTCA 1U90A 3VI4B 1CR2A 5JCJD 4EJ0A 1OXKB 1PGJA 1JBQA 4Z7QB 2D0OB 4KVAA 5BVGA 2PV0A 1U63A 1ZOOA 1YASA 4GR4A 3UK1A 4AW9A 1UZLA 1XAHA 1XLVA 2AWOA 4AD8A 2JASA 1HH4A 1PJAA 4I55F 4QDKA 4RBNA 4CIAA 2FR0A 3A04A 1Z26A 3DUFA 1DTWA 4BMOB 2DPYA 2P9BA 4R68A 4AJ1A 4MI3A 2VJDA 3P0HA 3PRJA 5CVVA 3MRVA 1N1DA 4EEZA 4ENUA 1M76A 3KK0A 2V6BA 4HH1A 2DQYA 3CH5A 3D64A 4RCYA 5B6IA 2AZXA 4WN9B 4TT3A 4OH1A 5KTRA 4DG5A 3VNUA 3H4MA 2PU7A 2X14A 4O3FA 1GQRA 3JD0A 4F56A 1T6NA 1K98A 1E1YA 1XUOA 1YZTA 2QP4A 1P9OA 3PQDA 4D3ZA 3K9HA 3DSRA 3LBHA 4PLGA 3CGWA 5ITZB 1PV4A 4LZOA 3H2KA 1HETA 3AUUA 3H05A 2GAOA 1P3DA 1JEDA 1TGYA 2WU0A 5JJ5A 1BXGA 2P3QA 3NBMA 3RC7A 1TPYA 3FNHA 4X1IA 3VKWA 2UYOA 3PNVA 3ZDRA 4PZEA 1H1LA 1LBEA 5A1JA 2GM5A 3MBKA 1N0VC 3RIEA 5INTA 2HMTA 4LXHA 4LTDA 1XD9A 3PITA 1ZU5A 5DBGA 3PC8A 4L95C 4PLPA 4DQXA 2J3DA 1T2DA 4BLTA 1IVNA 3U4GA 1YJXA 2VQFB 5JASA 4RQUA 8MHTA 4FFOA 4BVKA 1W47A 2EQ5A 5ALZA 1J4AA 1MX9A 3QIAA 3OP4A 2HT6A 1KMQA 3TLAA 1JDBB 1S2DA 3GPBA 3L04A 3LHFA 4ZI2A 2BHSA 4QTYA 5KTKA 3TG8A 1FC0A 3AEYA 1ZIDA 2J6HA 4WOKA 4AMZA 5ALOA 2QORA 2WNIA 4PAGA 4IJ5A 1RTKA 1ISMA 2QKYA 5GJWC 5I9NA 3WQBA 4A73A 4OJMX 4CM6A 5SZIA 3SBEA 3IILA 1B6RA 2A7XA 2AC2A 3G9TA 3QU7A 1TCAA 3BN3A 4QT4A 4MGKR 5JFGA 3KKPA 3WGQA 1UBFA 3BIXA 5LOVA 2ZRGA 3GFRA 4K6OA 4TM8A 2GWHA 3IQFA 5BUQA 4HSGA 9ATCA 1JVBA 2EBFX 1BFDA 1DZ3A 2OGWA 2QJOA 4KYTA 1N6NA 5A6SA 3JRNA 4KLCA 3EAGA 2PV7A 4E2WA 2HCFA 1PQ4A 3AF3A 2DSNA 2XUHA 1QH9A 4XIGS 1R10A 4UUAA 4OKSA 4FOTA 3KKMA 3RTBA 5JD4A 1R5BA 2OO5C 4ITRC 4CM9D 4TMVA 3BTVA 5FOWA 2GCIA 4YUVA 3K8YA 4PO1A 1ZUHA 1N2EA 3NQ41 2MOKA 2QJFA 4PBRA 3QTBA 2X7HA 1KDPA 5EZ6B 5GY7A 4EG7A 1LTHR 1RYBA 4CHTA 3KEOA 1KRHA 1GXSB 2FPIA 2LRHA 2X22A 3FDFA 4IIEA 1EYZA 4WNIA 3S5JA 3DEZA 2PBLA 2RBKA 4AO6A 1E2DA 4MUIA 3NEYA 1JFVA 2WF8A 3AY0A 3GRPA 3LQ4A 3UAYA 3MAGA 2XCTB 2FQYA 4J3JA 3IMGA 2R7NA 5BNFA 4C29A 3JASB 3KR2A 5FUMA 1HE8B 3TLXA 3TLBA 3RBZA 5JANA 4H7EA 3CUWA 1P2BA 3ORRA 1XZNA 3R9XA 2QRLA 5BV8A 3I72A 1QGDA 1P91A 1K7XB 1NYRA 4O2BA 5LPNA 3BWYA 4QRDA 2WIJA 1V16A 1WEKA 5CYPA 3ZDYB 4YMVA 2ZE8A 1KJZA 3KB6A 1NPTO 3F5QA 2J3HA 1B23P 4UEQA 2EFYA 4CM7A 1QCCA 2FPXA 4C2BA 4EATA 1D8TA 4G4IA 3PUHA 1ODIA 3U56A 5J2UB 1FQKA 1JP7A 5L3QA 4E7PA 1IE3A 1HORA 2HREA 4XIJA 4REMA 1WKBA 4O1HA 4HX2A 1JBKA 3A32A 2B94A 5CAEA 1S02A 1IDOA 3W2TA 4OMDA 3RSQA 2QMQA 3CUYA 1CY8A 1XQ1A 1QMGA 4RFSB 2HAEA 5DXAA 2PUHA 2JLZA 1OZGA 4YEDA 1NULA 2PRZA 3HL4A 3MXTA 3HI4A 2AKAB 5LIPA 4W8OA 3C5EA 1VE1A 3AEXA 1JKJA 3KKQA 3DNMA 2QPTA 4L76A 4LRSB 4ZO4A 3V4VB 1XQ9A 5DGXA 4U7PB 1E2PA 5C8XA 5J2TB 2P77A 3D4BA 2WJZB 1O95C 1AUVA 1Z35A 3H9EO 4JJ7A 1LWNA 4RS4A 2FJ0A 2Q50A 3ETJA 3JVUA 3ASZA 2R7LA 2ZWAA 4Q19A 4EEXA 1RZRA 5ADWA 2WSSD 4J16C 1J49A 2GN4A 3KL4A 1ZJYA 4J1TA 5K8VA 3GFFA 5CPBA 3W9UA 5TVKA 4QLBA 1X15A 1Y4DE 2D6FA 1WZ2A 1V3TA 5E2IA 1EX1A 1N9KA 3TEFA 1ZIPA 1EUCB 1DTEA 4GPEA 5ED0A 2DM6A 3K20A 3M6VA 5U1PA 1NZJA 3NW9A 2B2NA 3QE2A 4BKMA 4BZXA 5E1BA 5DBFA 4NLLA 2NU9A 1X7XA 4N49A 1SXPA 3R0JA 3KJHA 5H4GA 3IDQA 3LY9A 4TRRA 2PUEA 1CUDA 5ILOA 4R3WA 4W5HA 1NXXA 1E0DA 1VL2A 4G24A 2AT1A 3GGPA 3PPVA 3DL2A 5D3KA 3ELYA 4JLOA 4K5QA 1TMKA 2Q4TA 3HCNA 3ZLBA 5K8TA 5KU7A 4EA8A 2AA3A 2H6EA 3RSZA 1AX9A 3PPWA 3K2IA 1AQNA 2NTYC