2GA8A

Crystal structure of yfh7 from saccharomyces cerevisiae: a putative p-loop containing kinase with a circular permutation.
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
353
structure length
326
Chain Sequence
VDTHKLADDVLQLLDNRIEDNYRVCVILVGSPGSGKSTIAEELQIINEKYHTFLSEHPNVIEVNDRLKPMVNLVDSLKTLQPNKVAEMIENQGLFKDHVEDVNFQPVKYSAEETAVVARGGTANAIRIAADSINIAQIVPMDGFHLSRRCLDLFKDPQTAHKRRGSPSTFDSNNFLQLCKILAKTSLKVSTSSVFEKLSKTFSQTIPDIFVPGFNHALKDPTPDQYCISKFTRIVILEGLYLLYDQENWKKIYKTLADTGALLVYKIDIDYEATEERVAKRHLQSGLVTTIAEGREKFRSNDLLNGRDIDNHLIKVDNIVHIRNDH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and functional analysis identify the P-loop containing protein YFH7 of Saccharomyces cerevisiae as an ATP-dependent kinase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Unknown function
molecule keywords Hypothetical 39.9 kDa protein
total genus 109
structure length 326
sequence length 353
ec nomenclature
pdb deposition date 2006-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07728 AAA_5 AAA domain (dynein-related subfamily)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ga8A00
3HU2A 2GVDC 4DSTA 2XSZA 1WB9A 4R2HA 4A0RA 1XCPA 1E0SA 1SKQA 4MYCA 4PPFA 4TL7A 4NYMR 2WPDD 3EZFA 1XFAA 2QM7A 2WVJA 1CULC 1CU1A 1CXZA 1G3MA 1Z8FA 2VHJA 4A82A 4DKXA 2UVQA 2CNWA 3QKUA 4KLZA 4US2R 5TXGA 2BBSA 3I8SA 2R6FA 3EIHA 2VYFA 2IYVA 2L0XA 3OEHA 2WJIA 5EUQB 2QENA 4PANA 2BMJA 3IBGA 2VSOA 4CT4B 3U44A 4JZKA 4Q9LA 1E6CA 4ZDKA 2WWYA 4I81A 1VMAA 2NO6A 3SNHA 3IEVA 1KI6B 3VFDA 1LF0A 4IXMA 1X1RA 2ORVA 4YMTA 4D2IA 3FFBA 1E2IA 3TSOA 4HDCA 2WJVA 4Q1EA 2IYLD 2QMHA 4Q9HA 3DOEA 1KK3A 1FZQA 4O2RA 4IRUB 5DYGA 1BH2A 2WWFA 4QXAA 3RS2A 2SHKA 5KO2A 1G19A 4JMPA 5LB4A 2CK3A 3AEZA 4HDOB 3D8BA 4MRVA 2W6ID 1W36B 4EPRA 3WRXC 3K0AA 2IXGA 4EPWA 3U44B 4M53A 4Q4HA 4A0HA 1D2NA 4A8JC 4DBLC 2QZ4A 1OB2A 2F1HA 4Y0AA 5BN4A 3G82C 1TU4A 3LW7A 4LRWA 3R9IA 2WJYA 5E3HA 1XBTA 3IDQA 5L3VA 1VHLA 4TYNA 2VF8A 3GLGA 1AIPA 2ZI5A 3LFUA 4BZXA 1S96A 1YZGA 2BWJA 2XTZA 3CW2A 4V0ME 1LW7A 2GAAA 2GWHA 5JZVA 1I4DD 1ZMXA 3RRMA 2VSXA 4QGGA 1E1RD 2EFGA 3IO5A 4TSFA 5FBVB 3B85A 3L0IB 1E9CA 1XZPA 2ZJYA 1UBEA 1Z07A 3LV8A 2XXAA 1C1YA 1Q12A 2J7PA 2PMKA 3CNNA 2XNSA 2QP3A 1AN0A 2BV3A 5CDFE 1KDTA 5TVKA 4AYXA 1CEEA 2P3SA 3SN6A 2FSFA 2AKYA 2WKPA 2HXYA 4UNSA 4XWAA 4B74A 1DO2A 4XVUA 3C5HA 3LY5A 3FKQA 3EXAA 5KPDA 2HEIA 5HCIA 3FMOB 3C41J 4LI0A 4URZR 1R0YA 1XJCA 2Z4SA 2Z6VA 4ZPXA 2AR7A 3CO5A 4MGYR 4C0KA 3QY0A 3EARA 4JIMA 1E2QA 5L8VA 3VNVA 1COWD 5CJ2A 1R8QA 4QOSA 2OAQ1 1JXOA 1XD2B 2ZRHA 1ZM3A 1FX0A 4HAWA 4B48A 4B71A 4OI2A 4IDHA 3A1VA 4Q03A 5JI2E 3K8YA 4KYUA 2RB4A 3BH7A 3O47A 2FH5B 5JCZA 4F4JA 5B30A 2W6JA 3EG5A 3NXSA 2Z4RA 2EWVA 2WV9A 4P4TA 3WP0A 5E7IA 5AUNB 3I62A 2XTMA 4V0KA 2ZYWX 4HLCA 4M1TA 3ND8A 1Z28A 4M0LA 4BGDA 5CLQA 4DDUA 2Q0HA 2AD5A 1N6KA 1YU9A 3N2EA 3QSYA 1FMJA 3QBVA 3BFXA 3FTQA 4DRZA 4TZ6A 4JS0A 4Q4AA 4WAUA 1HE8B 4URWR 1G5TA 2QORA 4HLQB 4BFSA 2GRJA 4DDWA 1D2EA 4B2PA 2OUKA 4LHXA 3MWLA 3ZDQA 1AQYA 1YQTA 2WOJA 1EG7A 3NEJA 3CH4B 4G5SA 2JJ2A 4ESVA 3CF0A 1K8RA 4Z8YA 1IN4A 4IOMA 3UMFA 4B6FA 4EAQA 5LDDC 1TQ2A 1D6JA 2W83A 4LWZA 5L3SB 4Q00A 4DEYA 1IY1A 2JATA 2RKOA 3F5FA 1XPRA 2H8KA 3Q72A 4QHYA 3AVXA 5P21A 4ZIRA 4ITRC 1OXXK 1EFTA 1MRSA 3K9HA 4CEIA 4BFWA 4M22A 4B3CA 3TE6A 1X8LA 4US0R 1OXVA 2YV5A 3WBJA 3HR8A 1KI1A 4LCBA 5IT5A 3QNUA 4M1YA 4K46A 1FQKA 3REGA 2UZ3A 5EXSA 3UMRA 2XB4A 3AVQA 1OH5A 1G8HA 2ZR9A 5CK5A 2FE4A 3GFOA 3PG5A 4ZI3A 3ICQB 1AS0A 3ICEA 4KBFA 2VSFA 2CE7A 5UKDA 3RAPR 5FR2A 3KQHA 2I1VB 4RJLA 1NJFA 1UKEA 2E87A 4E22A 3B1WA 1U8YA 2XEXA 1E1QA 4PHTA 3NHAA 3T61A 1G291 4NBSA 4HUQA 2D2FA 2X8AA 1XEXB 2GZHA 4KXFB 2J46A 4FD2A 2JLVA 3OHMA 1NNEA 1A82A 3B2EA 2ZYUX 1EFRA 1GFIA 4UNRA 2PLRA 3ZS9A 1ZD1A 3I3SR 4MKGA 1UF9A 4MYHA 3X1ZA 4Q1CA 1ONBA 2UKDA 3S1AA 4OL0A 3RC8A 3H1TA 3IHLA 3QKSB 3V9PA 2AHOA 3ZQJA 3ASZA 1IN5A 4P3YA 3BFKA 3A1UA 1G8YA 3AKCA 1SGWA 1ANKA 4JKYA 3DL0A 1N5KA 1D2MA 2QBYB 1E2PA 3CONA 4J0QA 4KCGA 1L4YA 5ELXA 3R7WA 2DB3A 2G83A 1EXMA 3GQBA 2ZRCA 1HE1C 2IYRA 5AUQA 2J0UB 5B2ZA 4C30A 5CK4A 4NH0A 2OESA 1TAGA 1Z3IX 4LV5B 3NBZC 1OIVA 2GCOA 1ZIOA 4Q18A 2KBEA 1P9WA 4GNKA 4DT1A 2ZVPX 2PJZA 3T12A 1MO6A 1TX4B 1KK0A 4MKIA 2Q9BA 1AS3A 2JLWA 1UBGA 3X2SA 2C99A 1VCNA 1E99A 2KE5A 3QKSA 4IEEA 2WKQA 4PC7A 4Q4LA 4RD1A 3DHWC 4AYWA 4XJXA 3VR5A 1E4VA 4EPTA 1HURA 3ND9A 4QFMA 3NC0C 2IEZA 1OYWA 2ZE8A 2FG5A 2ZE5A 1QZXA 2ZJBA 1Z6AA 3UK6A 4LX0A 1A4RA 4YXWA 4U00A 2HDNB 3WNCA 4LYHA 1U98A 1HT1E 2ZQ5A 5JECA 4X8LA 1G4UR 1XDBA 4E07A 2H1LA 2IBMA 3AF3A 2OBMA 5AJXA 4IOKA 4N0DA 2CLSA 4ASUA 4XH9B 2OCYC 3NWJA 4TQUS 4TLCA 2AX4A 2CL6X 3CX8A 1E9BA 3KJHA 3QF4A 1E2NA 4TYWA 5K8UA 4X8OA 4JLAA 2XNDD 2VHQA 2C2HA 1ZP6A 4EPXA 3NIBA 1ZCBA 3IHWA 3SJBA 4CVNA 3AM1A 4M1SA 4DLUA 1DTSA 1NN5A 2CHGA 3P1JA 5FOXA 2B7CA 2PLFA 4NP6A 4RD3A 4C2UA 2ZSDA 5J4YA 1NN1A 3HP1A 2ZR7A 3T1TA 1YRBA 3IKJA 2HYDA 4OYHA 5AJVB 2RGXA 2OM2A 2OE2A 1Q3TA 1E2DA 4BFZA 4B3DA 2PX3A 2GETA 5EQTA 5TV2A 3GLHE 3DVLA 3GCGA 3B1XA 4OKSA 2EYQA 5IF9A 2WPDA 4LYFA 4LHWA 3OEHD 3VU9B 3MMPA 1ZBDA 1SVOA 4AG6A 1KGDA 3RC3A 1QHHB 2B6HA 3RRZA 2CXXA 4PHFA 4YMUA 1MH1A 3I1FA 3E5HA 4LY6A 2GNOA 1KY2A 2OG2A 2PZGA 1ZAKA 4EFNA 1Z0IA 4G3XA 1KI7A 2FOLA 1GRNA 2QM8A 3EZ2A 4RZ2A 2MMCA 1ELOA 1Z6YA 3EW9A 5DO9A 1E9SA 3ASYA 3TUZC 3AVPA 2JJ1A 1Q22A 1U0LA 2OAP1 3BB1A 1P72A 4HAUA 4D80A 2Z43A 3ADKA 3DO6A 1EESA 1XXHE 4JJKA 4OHYA 4JLKA 1SKYE 5HE9A 1PUJA 3W8RA 2X77A 2ZJ5A 5K8IA 1Z2CA 1P61B 1TMKA 3MWYW 5DHAA 2CJWB 3RVBA 2KBFA 1QHHA 3BJIC 1RFLA 2I4IA 3OE7D 1Q0UA 1Z22A 2C77A 5BYKA 4NCKA 1XEFA 2EFEB 2P65A 3GP8A 1Z29A 1K5DA 3I92A 4DCUA 4WW0A 1JAHA 4EUNA 3V4FA 4O25A 5JJKA 1VHTA 2REXB 1E96A 3K0AB 1P2VA 3GLFE 3ADDA 2IW3A 2GKSA 1ZNWA 1TEXA 1LS6A 1JEEA 3OIWA 1S1MA 2ZYVX 1R2QA 3M4YA 5HPYB 1W4CA 1AKEA 1LNZA 3CPEA 5FL7A 1FOEB 3LBNA 1VCIA 1L8QA 4PSAA 2F1RA 1GL6A 1Q21A 1KAOA 2IX3A 1NSFA 4M4SA 3K70C 1HYQA 4QC2A 1S3GA 4IOJA 4RKEA 3RSOA 4NYMQ 4Q21A 3MCAA 2A78A 3OEED 4IEIA 4Q5IA 3QG1A 4L4UA 4WOPA 1K5GA 2BOVA 4BLSA 3CRQA 4B6EA 3L0OA 2XXAB 4FMDB 2NPIA 1AJEA 2OLKA 1GM5A 4TYPA 1HY3A 2FFBA 3OZXA 4NTZA 2RMKA 2UZIR 3SHWA 4QNRA 3A37A 3AUXA 1E94E 5FBRB 1II8B 2PZFA 3PUVA 3UIEA 2BBTA 2DFNA 1NSTA 2VLIA 1NVXQ 5E4FA 3A58B 4RCZA 3NH6A 3FE2A 2HJGA 1JECA 1GSIA 5EE3A 4UKDA 1UM8A 2IHYA 4Q02A 3U7EB 1M6NA 1R8SA 3ADBA 3LBIA 3PUZA 3L8ZA 1AS2A 1PUIA 4YC7A 2QQ0A 2QAGC 1BMFD 4FW9A 4CRWB 1UKVY 3PCRB 4JJZA 2Q3FA 3NEYA 3OAAA 2WWHA 4AD8A 4MA4A 2JAQA 3AVWA 3QXCA 3IIMA 4RFVA 1IHUA 5IK2A 2HT1A 5J47A 5JSZB 2FSIA 3RWMB 5JEDA 1GP2A 3KL4A 1CIPA 4YMSA 1SVSA 5HZHA 3NG1A 3FMIA 4XSGA 2OSBA 1NN3A 2YINC 2D62A 3W8NA 4A36A 4G01B 2J1LA 3E2IA 2IYWA 3A1WA 3MWJA 4TT3A 4I1UA 1D9ZA 4DLYA 2X2EA 1NBME 1YZNA 2IYXA 2JA1A 4FMCF 4TL6A 3C7KA 1MT0A 2J5XA 1JBKA 2WJHA 3AGPA 1W4BA 2NO0A 4N3NA 4PHHA 1NN0A 1G20E 3N70A 1ZU4A 2Z5FA 1YR9A 2K5UA 1W4AA 1YR6A 1IONA 5J40A 3ZVRA 4AYTA 2HF8A 2OBLA 1RE0A 4JT2A 1T0HB 2NZ8A 1Z0KA 3DMDA 1LB1B 1JPNA 3W6PA 3SQXA 2IYZA 2GXUA 4EJSB 1E98A 2AXNA 4C0HA 1OFIA 3R9WA 3CUEF 3U7HB 1BYIA 5KDLA 2FPLA 4QKQA 4NHOA 4MH0R 1DELA 2CDNA 3E1SA 1KNQA 3CB4A 3SJZA 2D7CA 1B0UA 1CRPA 4JSTA 1QHYA 5JMTA 5FTKA 4HAYA 1W0JA 5FTLA 2IXEA 1E3MA 4QM7A 1Z47A 4YMWA 5G40A 3AF4A 3OESA 3DZDA 5FOUA 2OCPA 1MR3F 1R5BA 1IQPA 4CEJB 5E95A 5HR5A 1ZC3A 2DY1A 4M1MA 3DKVA 3JZAA 2ORWA 2JLUA 4ASUD 1FMLA 5DSZA 2H92A 3LVQE 2V4ZA 5DHFA 3RHFA 3KJGA 2ONJA 1WMSA 3X1DA 1T3HA 3LDAA 4IDQA 4U5XA 5EE9A 1LV7A 4DCVA 1G7TA 3QVVA 1T6NA 3Q8XB 5F9HA 4FCWA 1MOZA 2EQBA 1NG1A 3SYNA 2ZAMA 3HWSA 2BEKA 3QVUA 1YVDA 3TAHA 2XJ9A 4LJ4A 1N6PA 4HSEA 1VCOA 3PUXA 4LGMA 4LV6A 2KB0A 4A8JB 1OB5A 4EQ6B 5JEEA 1KO7A 1TNDA 2A5YB 4M8NE 1E1QD 2F1JA 2O8CB 1OE0A 3GLGE 1E9AA 3U5ZB 5B57C 2YKGA 3CR8A 2G6BA 5DH9A 3FHTA 1EK0A 1XMSA 5EXTA 1IBRA 1TF5A 3HYRA 4TLAA 5J5CA 3B1YA 3RS5A 1ESMA 2HF9A 3EZ9A 4JT4A 5BXQC 1KMQA 5KSOA 4QBGB 1Z5ZA 1E1RA 1P3JA 3ZQ6A 2PEZA 3G5UA 5D3QA 4W7SA 3T1VA 4KLNA 1FTNA 4PAOA 3IIKA 2YVUA 3QJYA 5GJVC 2PL3A 1XB2A 1QDEA 4GOXA 1T0JB 4PFSA 4Z54A 4EQ6A 3BORA 2WSSA 2NO7A 1Z83A 4KFTA 2OO7A 3L82B 1F5NA 1CP2A 4G1UC 4PQRA 4XVQA 4AKEA 2O8CA 1F3OA 4GBMA 1Z2AA 1JJVA 2F3TA 3PUWA 2WM9B 4HAZA 4OHWA 1UFQA 3PUYA 2N42A 4US1R 3VTKA 5FUXA 2NGRA 2X19A 4KVAA 2J0SA 2AWOA 1PVOA 1U90A 2JJ2D 5DIFA 1U0HC 4IVPA 4XIGS 4A6XA 4YXWD 5JCPA 4UXIA 2C96A 2DWQA 5EP3A 4KV9A 3SC3A 1SZPA 3K0EA 2IUUA 4I4LA 2C98A 1US8A 4HYYA 1L2TA 4C0BA 3KB1A 2ZI6A 4B2LA 2J7PD 1R6BX 4YMVA 2W0SA 2GK6A 5FOVA 3GJ6A 1Z63A 2WBLC 4S35A 4TSFD 3WYFA 4Y0VA 4M1KA 2KWIA 4TMWA 4D25A 4MKFA 3ZZ0A 4B3GA 3GPLA 2IT1A 2OFXA 3IGFA 2RHDA 2ANBA 3HYTA 3D3QA 1JR3E 2J45A 1U0JA 1Y3AA 2DBYA 2XTNA 5KNCA 4Q66C 3K9GA 4W5HA 3P4XA 3BBPA 3U3RA 4AWXA 4B3FX 1NMYA 4DEXA 1UKZA 4DIEA 1CTQA 4KFRA 1E9EA 1XD9A 3RSLA 3VR4A 3M1IA 5EE0A 1G4AE 2ZSAA 5GVSA 3RYTC 2V7QD 3TW8B 2OFWA 2V1XA 2JLZA 2DYKA 1XX6A 3P32A 4D4JA 4E09A 1YZTA 3W6NA 4GMDA 1U9IA 4WBSA 2QSZA 5DYIA 4BECA 1HUQA 1TF7A 2Q21A 3T1OA 1DAMA 4NDZA 2JASA 1UBCA 1Z08A 4LJ6A 2CCKA 5JWOA 4PHGA 1LTQA 2ZRMA 3LQQA 4MYUA 5FL3A 2VP4A 3AQ4A 1OJLA 5JHGB 3I61A 2ZRFA 4UJ3A 5EJEA 3TR5A 5KOYA 3KKNA 3LAWA 4NYJR 2HXSA 2ZVQX 1M8PA 1T8TA 1U99A 2O0KA 2FZ4A 1GKYA 5FPYA 4IW3B 4DC9A 2A9KA 4XTCS 3QENA 2IYTA 4QGAA 4I1OA 3UXMA 2OHFA 5JS7A 2ZRGA 1XNJA 2VO1A 3I32A 4BEJA 2AFIE 2XGJA 1FQJA 3AB3A 3B5JA 3SHFA 4A0FA 3SQWA 4H1UA 2H57A 2HLDA 2DFKB 3EWSA 3ONWA 2KSQA 2O0JA 1F48A 3GLIE 4QHTA 2ZRNA 3PEVA 3WYGA 3ZVLA 1GNRA 2WIBA 5KSPA 4BFYA 1RRGA 1GOTA 1ZINA 3CPJB 3MSXA 1ZNXA 3VX3A 1F2TB 2YC2C 4TT3D 3RRNA 3U3MA 1ZD9A 2JCSA 3EAQA 3U3JA 4LC1A 3FHCB 3EPLA 4MGKR 1KKMA 4BZPA 2QMOA 4F38A 3B13B 5K8LA 2QP4A 2AD1A 4P32A 5FOSA 3ZIAD 1GVNB 3TH5A 2ZS8A 3PITA 1EWRA 2IUSA 2EYUA 5L3QA 2P2LA 3P20A 4MDEA 1GIAA 2R44A 3KFVA 1YZUA 1P75A 4GP7A 4TQ9A 5GVRA 5EE1A 621PA 3AUYA 4L16A 3A1SA 3THYB 1BYUA 1XTSA 3GJ5A 5H70A 2XZPA 2NOAA 4XWKA 3THXB 3LBHA 1YR7A 3FOZA 4QJ4A 1JB1A 2AN9A 1PJRA 3T06B 4URXR 4OQFA 3CX7A 1IY0A 1G6OA 2Q3MA 1TADA 3NBXX 4XD7D 1N6RA 2IHBA 2JDID 4HZIA 3TIFA 4MUAA 2ZS7A 1WA5A 3I8XA 4RVCA 4JVNA 1KNXA 1BO6A 1XEWX 2Z0MA 1LS1A 2P5TB 4BPBA 1IN7A 3CF2A 1DAGA 4FWIB 4O2LA 3VHLB 4D82A 1YHNA 3A4MA 1DBSA 1VYVA 1O3YA 2C03A 3A36A 2IF2A 3BIFA 2D3WA 4TMTA 5CDFA 1KSFX 3T34A 2WTUA 5L3QB 2ANCA 1YE8A 2AKAB 2CK3D 2PT5A 2DHRA 2V8OA 2IXFA 4Q48A 3D7MA 2NTYC 2ASEA 1VCMA 2JIZD 3W90A 2LWIA 121PA 3L0SA 4LBWA 5FTMA 3TVDA 3F3YA 3HPQA 3K0FB 2ZRLA 4WZAE 3B8HA 4PO9A 3BERA 2IYSA 1IJEA 1FFHA 2BJVA 3BAFA 4H1VA 3GJ8A 2IA5A 2GF9A 4LJ5A 2GVZC 2WMOB 2ZYTX 3A4NA 5CJPA 2REOA 1QHGA 3P4YA 1WBDA 2BMEA 3LW8A 1T5IA 4Q7JB 1JALA 1CJUC 1BKDR 2J9RA 1XZQA 2W2VA 3LX5A 5FBQB 3RS7A 4E5UA 2RHMA 2NO1A 1SXJE 1UAAA 2IS1A 3AP1A 1M74A 2C95A 5EUMA 2ZRIA 3MWKA 2PBRA 3C16C 1DADA 2PMDA 3WP1B 1G3UA 4MKHA 2NQ2C 4L5BA 2KJQA 2R6GA 3K0FA 3KXLA 1S1CA 3VR3A 4R71A 4ILEA 2W0MA 1R4AA 1TEVA 3BXZA 2Q3HA 2X1VA 2ZAOA 3K53A 1Q3HA 3OF5A 4RKFA 2O8FB 4W9MC 1KI6A 3PVSA 2XSZD 2F43B 3OE7A 3LA6A 1IXRC 1DG1G 3EIQA 1T8UA 1FP7A 5JJLA 2MSEB 1SHZA 2DFTA 1G8GA 2C5LA 4IDPA 5G41A 3LQRA 3FMPB 1X8JA 3GJ7A 4G5QA 1DVRA 2Y8EA 1DAHA 2ZSBA 3LLUA 1OPXA 2GZDA 5AK0A 3LNCA 3EPJA 4ARZB 1PLKA 4JL6A 4B75A 5CIWA 2NG1A 2ZTSA 4TLBA 5FPHA 3AVVA 4KSCA 1KMHA 3D6TB 1XXHB 4HZUB 1OV4A 4EJSA 5FPKA 1KI2A 5JRZA 2XZOA 1ZUNB 2GEDA 2OILA 2W58A 1PZNA 2PZEA 3RNLA 4DDVA 1M34E 1ZIPA 3Q7QA 4NYIR 2ZUDA 1XTQA 3KTAA 2PCJA 2NZJA 4I1VA 1NI3A 1Z0JA 4TN1A 4EDHA 4UXJA 2GXSA 2AK2A 3TSWA 3X1XA 1GRQA 3BGWA 5DN6A 2IK8A 4HUTA 2H18A 4U02A 3NVAA 2GK7A 4GOJA 4P31A 5AUOB 3EPHA 4CEJA 2FEMA 1RVDA 4GZLA 3RLFA 4LHVA 1RYFA 3I5YA 3UKDA 1N2CE 2EFHB 2ORIA 3EC1A 2ERXA 3QEJA 1W44A 3PEYA 1RYHA 5H68A 4QGHA 2OZEA 1QF9A 3DM9B 4FI3C 2TMKA 1YR8A 2R62A 4HB3A 3O8CA 1NG9A 3MD0A 4GZMA 4E03A 4IKEA 4X8MA 1AZTA 4A0GA 4MRNA 3LRPA 3TGPA 5JLJA 5A5GA 1HTWA 2JEOA 3QUSA 4DVGA 1E2LA 3EA5A 1DG3A 1XMJA 3I72A 2IWHA 2H7VA 2ZRDA 4DCTA 2XJ4A 2ODEA 3QEOA 3HU3A 1PLJA 3CH5A 1KO1A 221PA 4NONA 4ON9A 3H86A 2JJ1D 2WIAA 4EIWA 1DEKA 4Q4HB 4C4PA 3A6PC 4GL2A 1C9KA 1Q1BA 4O0MA 4KODA 4KU4A 4P4UA 5EZ6B 5F2EA 3RRYA 4NCJA 1JR3D 3TSZA 3PENA 4DCNA 4A1FA 2IYYA 3KXIA 3B9QA 2IS4A 2J0VA 3UWOA 3LXXA 4DLRA 3K0CC 3K09A 2C04A 2BEJA 1T91A 1TTTA 1Q44A 1KYIA 1SXJA 4V0LA 2WOOA 1R10A 1PV4A 4XOIA 4CZ2A 4V0NA 4PC2A 3KKOA 4XD7A 1E2HA 1S4QA 4IJMA 3EPKA 5AJZA 3AKDA 4MRRA 2FFQA 4RFSB 2O8EA 4JYBA 2GJ8A 4LSGA 4P0TA 2V9PA 4BE7B 1JEDA 2HCJB 3SYLA 3EX7C 4A15A 4WXPA 1MO5A 2V1UA 3TQFA 3CX6A 5FUYA 2QMUA 1M7HA 2XX3A 2ATXA 5L3SA 2EW1A 5J4HA 1GG2A 4FWTA 4CEHA 3CRMA 4JLMA 1I4TD 4OHVA 3WY9A 3DPUA 2BM0A 3LD9A 2FEOA 1EFCA 2YWHA 2ZU0C 3OAAD 2ZJAA 4DLVA 1Z0FA 3WYAA 2O5VA 1OXUA 5AJYA 5JRJA 1SXJB 4LBYA 4DHEA 1ZJ6A 1NKTA 4UNQA 4B34A 4JLJA 4AY2A 3V00A 1VG1A 1YZLA 1QBKC 3GD7A 2ZEJA 4FIDA 1UJ2A 4PC6A 1Z0DA 4KFSA 2ZU6A 3CF6R 1T9HA 2WKRA 4RFSA 3N5CA 1FX0B 4C7OB 2O8EB 1Q57A 5K8TA 1G18A 1RJ9B 1W5TA 2FN4A 1J8MF 2R6AA 3RABA 3THOA 5DNYB 5C18A 2YOFA 2ZJZA 2GCPA 3AF2A 2NPFA 5GJBA 1DARA 1XD8A 3FPAA 5KSYA 4CEHB 1JQJC 4OK6A 1KAGA 2E9SA 2FZLA 2I3BA 2V55B 5FPTA 4JLVA 5KSZA 1TQ6A 1OKKA 2YC4C 3CKLA 2B8WA 3QOFA 4M9XA 4NYJQ 4QG7A 3SJCA 2QAGA 1NVUQ 3HDTA 3E70C 1MRNA 5SZHB 3UG6A 3M6AA 3SS8A 3RS0A 2J0QA 2IYUA 4WZBE 2ZI9A 3FKSA 1YKSA 2BIFA 3U4QB 2V3CC 1H65A 1N5JA 1UKYA 5E7JA 3ZVMA 3NTUA 3B9PA 1VKJA 4JLNA 5J4KA 4MRSA 3C5CA 3AVYA 5CIQA 4QBIA 2JIZA 2JLQA 3CZQA 1CKEA 1HQCA 1N6OA 4Q19A 2ZJ2A 4KVGA 4ZCMA 5FTNA 1QG2A 3LXRA 5CM8B 1ETUA 1Z06A 3T5DA 1G41A 1ZCAA 1E2GA 2J0UA 1KSHA 3U2QA 3CWZA 2G77B 3TK1A 2D4HA 1G8FA 2QAGB 3KKPA 1GL9B 2R65A 5B58C 1F2TA 1AQUA 4DB4A 5BN3A 1EX7A 2RCNA 5EXPA 4DSOA 4PPGA 2C9OA 2ZANA 3KQNA 1J90A 3PQCA 4G5OA 4ACBA 4B3XA 2GJAA 3QKRA 4IXNA 4LBZA 4MRPA 4GI7A 1AA9A 2F6RA 1IN6A 2GHIA 3ZVNA 1V5WA 3CM0A 3GEHA 4LJ9A 2XB2A 4NZYA 4JVLA 4YQFA 3GJ0A 2CCJA 4JKIA 3VX4A 1AK2A 3THXA 5LB2A 2AWNA 3CRRA 3NBFA 4M9SA 4DLWA 5H1YA 2VTKA 3AVUA 2ZRJA 3H84A 3LO5A 3ZIAA 1I2MA 1G3RA 4DUGD 2REBA 3WRYC 2P6RA 1NIJA 4FMBB 4AKGA 4TLEA 4GP6A 1R7RA 3W3AA 3K70B 4TMKA 1HH4A 2WAYA 1P7CA 2YOGA 3MAAC 3Q9LA 4JLPA 1RRPA 2PH1A 2OXRA 2VHCA 1OIWA 4YONB 5CB6A 2ZE7A 2IF0A 2G0NA 3PR1A 3R20A 3AKYA 1EFRD 1G16A 5C4GB 1TU3A 1FUKA 5EP4A 1II0A 2RGNA 3KKQA 3WMGA 4JL8A 3R9XA 4LPSA 1E9DA 1DAIA 1P6XA 3JZMA 1N6LA 2FPMA 2XOKD 2F9MA 4R7ZA 3REFA 3W34A 4TMXA 4D26A 2O8BA 1F2UA 5D3MB 5IDVA 3U6KA 3LWNA 1E4YA 3OFNA 2QT0A 3MLEA 2OBNA 4JVSB 3TNFA 3ZLJA 2FF7A 3VU9A 4C0SA 2OEPA 2IS6A 1CF4A 4F7WA 2JDIA 2ZM5A 2ATVA 3DZ8A 1FL9A 2DFLA 1GAJA 1KDRA 5FH9A 3FDIA 1FPMA 2PX0A 1P62B 1W46A 2GBLA 4C0JA 3OFND 5KNBA 4KITB 5AUPB 2N1BA 1NRJB 4DDTA 1Z0AA 3KKMA 5HKKA 1CLUA 4HAXA 3W3ZB 5EZ5A 4EKDA 4F91B 4P4SB 4V02A 4AK9A 4KHZA 2KI5A 4MYTA 4MQBA 1KO4A 1E0JA 2FSHA 1ZVQA 5L3RA 4DXAA 4XTRA 2GEUA 1IM2A 3TJZA 2OXCA 4PZZA 2GTPA 2V54A 3IIJA 2YOHA 2EFCB 1KJYA 1NY6A 2F43A 4PTLA 2F3RA 2QTHA 1W0JD 5HKKD 1H8HA 2QA5A 1WBBA 3BE4A 1F6BA 4ZV4A 1U8AA 2QU8A 8OHMA 1TUIA 4LYAA 4M1OA 4D0NA 1FW6A 3T35A 1NBMA 4PQFA 1VECA 3T1QA 1IXZA 1G6HA 4ARZA 2ZE6A 5EE5B 4HEJA 4F4CA 4P4SA 4KYIB 1XPOA 3DDCA 3R8CA 2VRWA 1I4LD 4PAQA 2W6JD 4TYQA 2CE2X 3LLMA 2ZUBA 5DISB 1RRCA 3OIYA 5TARA 4A9AA 3KTAB 5CYPA 2YJTD 3U3OA 1N0UA 1SVMA 2ODWA 1U8ZA 2AK3A 1E79A 1MO3A 4POAA 4F4IA 2D74A 4NCIA 4U7DA 1TUEA 2B21A 3L0PA 2JJ8A 1CRQA 1XCGB 2GEVA 4V0OA 4B73A 1EFHA 1E0KA 2JGNA 3GJ3A 3QXJA 3I5XA 3AGQA 4WA7A 2QTVB 5CLLA 3Q7PA 1COWA 1XF9A 3H2YA 1XU4A 1XEWY 1XD2A 3IPXA 1XTKA 3IQWA 3NC1C 4II7A 2FU5C 4BLRA 5GADl 1E79D 5C46F 5B64A 2FWRA 1AKYA 4Q1AA 4PC1A 4W5JA 1DE0A 4HLDA 3SI7A 1UEIA 3VR6A 3VR1A 3EZ7A 1ZNYA 4MGZR 4Q7LA 4B2IA 4L15A 2YWFA 3VR2A 1II8A 1W0KA 2R6CA 5HCNA 2C8VA 1UDXA 4Q9JA 1DAKA 4OQNA 1XTJA 2VL7A 3AF0A 3CNLA 4TL8A 2CHQA 3BC1A 1NVVR 2NO9A 2QQEA 2WWWA 3CBQA 4B47A 1D8TA 4TTRA 4BQSA 1M7GA 4ERNA 3MJHA 1CR2A 2H17A 3IBYA 1OH8A 1P73A 2NMVA 4KSBA 3QPUA 4TMVA 5KHOC 1A2KC 2A5FA 4O3MA 1TPZA 3NBYC 3ZZTA 2ZS9A 1VG9B 4PZYA 4D0GA 1GTVA 2RGGA 1VTKA 5SZIA 1JNYA 4OQLA 4OK5A 1O87A 2XAUA 5FOWA 4NPHA 1KJWA 2VEDA 1NLYA 4MUBA 1IJFA 1N6HA 1Q1ZA 3QE0A 3VKHA 2BKUA 3B7GA 3NH9A 5E7MA 1WXQA 1M7BA 4MITA 4UNNA 4URUR 2H16A 3EWAA 2WHXA 4M21A 4CEIB 4CDGA 4RZXA 5DI3A 4DSUA 1AM4D 2RGEA 4IDOA 5AR1A 3ADCA 1P2UA 1SQ5A 2WSMA 2GJ9A 5FTJA 5FUWA 3BWDD 3MGCA 5HE8A 4AKHA 4ZDJA 1E2JA 2QL6A 4NE2A 4ZDIA 3K09C 1E69A 1B23P 3DKPA 3QXSA 1OSNA 3LH5A 4KFUA 1GWNA 2V6IA 1EGAA 4JVMA 5KDOA 4OQXA 1UPTA 1W36D 1KZGB 2DCUA 2QRNA 1TQ4A 4DJTA 4HUQB 1XEXA 4EPYA 1U2RA 5J4VA 1G21E 2C78A 1GNQA 4PO1A 3U6BA 5TDHA 5CM9C 3WXMA 4JL5A 1OF1A 1G3QA 5DI3B 4RD0A 1DO0A 4P33A 2HV8A 4K8OA 5BN5A 6Q21A 2G0TA 3I73A 3A4LA 5A4JA 4WIAA 3HJNA 1J70A 1NJGA 1HV8A 1G7CA 4TL9A 1TF2A 2WZQA 3QPWA 1OFHA 1S8FA 1KTVA 1YZQA 1W7AA 1RJ9A 4ZDWA 1MV5A 1JAIA 4DLSA 2X2FA 4IDNA 3MUFA 3SE0A 2Q9CA 4C0AC 2P6NA 4DZZA 1L4UA 2VP9A 2HYIC 2IYQA 3RANA 5JSZA 1W49A 3ZYCA 4W5WA 4Q1DA 4GOKA 2VHTA 4K81B 4DLZA 1N6IA 3TUJC 4ZIRB 2QPOA 3TW4A 2H5EA 3SDZA 3FMFA 4QGFA 1P2SA 2ZJ8A 4HB0A 1N0WA 2QT1A 2CHVA 2A5JA 3RS3A 5TMPA 1NIPA 4WZ6A 3RWOA 4A4DA 4QRHA 3FHOA 1WDTA 2MMGA 4ZKDA 1S0UA 2A7QA 3BH6A 2N46A 4G5GA 1VIAA 3U4QA 5JJIA 1KI9A 3BFVA 3DEFA 2QSYA 2V6JA 3MFYA 1N5IA 2CCGA 2O8DB 1DPFA 2RAPA 4M9ZA 2ZITA 4QL3A 2QGNA 3U3KA 3UPUA 4FMCB 3SU8A 4BZQA 2WWIA 1JPJA 2CVFA 1G7RA 4LV8B 1QHXA 3IO3A 3WNBA 4ZI2A 2Q9AA 1UBFA 1OT3A 2VP5A 3GLHB 4PO8A 4TTPA 1RPZA 4AC9A 1W5SA 4UNPA 1KIMA 5C2JB 3GLFB 2A2ZA 1G9XA 2EFDB 4XWOA 4CGZA 2FSGA 1W2HA 4BLTA 3R8FA 3SFVA 1J99A 4KAXA 3O8RA 4BASA 1GUAA 2VP2A 2MSDB 3TUIC 1XJ0A 4RD6A 2ZREA 3Q5DA 4TWZA 4OK3A 2YHSA 1DS6A 1D5CA 2QEQA 4PR0A 2J7KA 4GDFA 1QHSA 3VHXA 1W47A 1VYTA 3QKRB 4XSHA 3GEEA 1VG0B 4TTQA 3ZH9B 2OFOA 5EP2A 3X1YA 4GPTA 3KDSE 3EA0A 2QMEA 4OI0A 1ZYUA 1RZ3A 3ZZUA 5IK2D 1ZUHA 4JYCA 2JLSA 3WBKA 3MG9A 3GLHA 4NCHA 1NF3A 4R98A 1KI3A 5HTKA 1NMZA 1Q20A 1ZM7A 1BS1A 3A1TA 5EP1A 4R9UC 3GLFA 3SZRA 1N5LA 4B76A 2ODNA 3SOPA 3GMTA 3SFZA 3M0EA 2CNWD 2LKDA 1W1WA 1G1MA 3LVRE 1X86B 4A8JA 3ZD7A 3CNOA 3W9YA 3PFIA 1KDOA 4AURA 4BFVA 4OHXA 2EU8A 4HB4A 2FGKA 1QRAA 2ZSFA 1F60A 2VP6A 2VIIA 3PV0A 2WICA 2WMNB 4FMDF 4QBFA 2R2AA 5AWFC 1P2TA 2WJJA 1QVAA 2DR3A 2QE7A 1GRRA 3BD9A 1OFTA 1CR4A 4QBHA 4TZ0A 3CRVA 4B35A 1MABA 1HEIA 3BRWD 3O8BA 1EFUA 1ZNZA 2ECKA 3C15C 3H4MA 1XTRA 3K70D 1T5LA 2O8BB 1F2UB 5D3MA 4WXRA 1X1SA 3BS4A 2QE7D 4IOLA 3K1JA 4LJ8A 4D4KA 2RGAA 4JBWA 1CS4C 4RD4A 3DMNA 3C4JA 1YRAA 2CJWA 2P67A 3NDBB 1IN8A 1R0XA 3TBKA 1E2FA 3RS4A 4URVR 1XCMA 3L2OB 3FYHA 3WHLA 4QM6A 1QHNA 2VBCA 3QI2A 1KI4A 4H9GA 1MKYA 4PZLA 1QVRA 3QXXA 3KJIA 5CITA 5HZKA 1XTIA 5A0FA 3A8TA 1EWQA 4L9WA 3TQCA 5JBQA 1MABB 1US8B 1WQ1R 1LFDB 5CYOA 3NHBA 4LYJA 3GJXC 1JR6A 4A6PA 3FB4A 4LOAA 5KUTA 2IC5A 1DAFA 1NVVQ 2ZR0A 2IS2A 1RC8A 2QPTA 3HU1A 2QRZA 5BW8A 2F7SA 4QJ3A 3Q85A 1FTSA 5DI9A 4HLUC 3CIOA 4QHSA 4OHZA 2W2XA 2FDCA 3UG7A 1X3SA 1E2MA 3DM5A 4ABYA 2QN6A 1ZM2A 2FPKA 821PA 1ZM9A 4EFMA 3BB4A 1G17A 1IAQA 1N25A 4PPNA 2WJGA 4OQMA 3J81k 4N1AA 1W4RA 3ZGXA 1Q1EA 4EFLA 1E0AA 3N2IA 2ZJOA 5FPSA 3AV0B 3KJEA 1AGPA 2MSCB 4FXPA 4NKRA 3X1WA 1WE2A 2AXPA 4GSYA 5FR1A 1JXMA 3NKVA 1XJQA 3K9LA 4L8GA 1RIFA 3EZ6A 3KXKA 2GBLC 5AJWA 5G3ZA 2R8RA 3IUYA 3L8YA 4C0QC 3QG5A 1G7SA 4DWJA 1NMXA 4GFDA 1A1VA 1WF3A 1ZD8A 3K0SA 1FNMA 1FP6A 4EJSC 2GF0A 4ZCIA 2GILA 3ZS8A 4Z51A 1NP6A 4V03A 4DLTA 1UADA 3KFXA 2QNRA 3GEIA 3KQLA 2HUPA 5BYJA 1P9RA 2WWXA 2ERYA 3EC2A 5LBIA 2BDTA 1DAEA 1T4GA 2O0HA 1VPLA 3CPHA 4NMMA 3PIRA 1R5OA 4LK2A 4IVRA 4OI4A 5FBLB 4ESHA 2DPXA 1NBMD 1SVKA 2VA8A 1G64A 4KBGA 5KYKA 1PLLA 4M9QA 5DE3A 1RRFA 3CLVA 5F98A 3Q3JB 1KSJA 2JLYA 2GAOA 4A92A 3GLIB 1SVWA 1JQLB 2B92A 4LBVA 4DUGA 3PJRA 2F1IA 1U9IC 4Q7KA 3W5JA 5JFGA 1JJ7A 4RZUA 4IVQA 1VDZA 2IWRA 4FN5A 4Z1MA 2HCBA 1JI0A 4ZKEA 5FI0B 1G8PA 3UANA 4BUJA 2CBZA 4PPQA 3TR0A 2ZRBA 2HJVA 1FUUA 521PA 4Q1FA 4KO8A 1AGRA 1OHHA 3IILA 3F8TA 4JLOA 1ZUIA 1BOFA 1G5PA 5KNDA 1LY1A 1OFUX 1VG8A 3VNUA 4V0MA 3KUDA 2QAJA 2E1RA 4PX9A 4JLDA 2OLJA 2WAXA 1XWIA 4YDSA 1AZSC 5BWMA 3MJRA 4LHYA 4M1WA 3KQUA 1Q1QA 1CJVC 1GITA 1QG4A 4MGIR 4ZCLA 3KX2A 1P4SA 2FNAA 1J7KA 2QGZA 5H8WA 2OCBA 2XOKA 3KUCA 4DSNA 2CLCX 1ZRHA 1EX6A 1J8YF 3AVOA 1I2DA 3CRW1 3T5GA 2PJRA 4I99A 4D0LB 3FGNA 1W0KD 4EPVA 4AI6A 2CEAA 1YZKA 1NLFA 4JBYA 2IEYA 2GXAA 3P27A 4AIIA 4YDHB 4LJAA 4JBXA 4A2QA 1X6VA 4Q4JA 1XP8A 1P5ZB 4UXHA 2D06A 5TB5A 4AKIA 4D81A 1NVWQ 1R0ZA 1GDDA 2EVWX 2LKCA 4UJ5A 4C3ZA 1VYUA 3CR7A 2NIPA 5SZJA 4CF7A 4MDFA 2RGCA 4Z1MD 3WNDA 1ESNA 2R6DA 1RKBA 3ZD6A 1CR1A 1P60A 3GJ4A 2F55A 2JLRA 1KO8A 4Q9KA 2OV2A 2BCGY 1U81A 1KKLA 3DOFA 3SJAA 2BCJQ 4G0NA 4IFBA 3BK7A 4CT5A 2GZAA 1HQYE 5FUVA 4LJYA 1XMVA 1OKKD 3BB3A 5JWHA 2BVNA 5GJWC 3QBTA 3KZ1E 3SBDA 2P6UA 3HPRA 5F3WB 1KOFA 1OHHD 3BOSA 3CWQA 2YZ2A 1OH7A 4JLBA 4Q4JB 3IQXA 3TLXA 1N6NA 4QNMA 5M04A 1S2MA 5JI3E 2P5SA 5JHHB 1RW4A 4RD2A 4DIDA 2FV8A 2Q6TA 4LDJA 1Z6GA 4BRUA 4RY2A 1KDPA 3D31A 1R0WA 3HR7A 1NL3A 1SXJD 2OCAA 4CW7A 3THWA 4RSGA 2EWWA 2G9NA 2HT6A 2P0EA 1BIFA 2ZXUA 3GLGB 4B44A 1H8HD 2QY9A 1E9FA 1U94A 4LHZA 4DB2A 2O8DA 1DOAA 1FNNA 2Z83A 5FOTA 4R2IA 4NU0A 1IOZA 3C8UA 1ZW6A 5LPNA 3ETLA 3UMSA 4Q01A 1L7VC 1GZSA 4DLXA 3L43A 2C9YA 1OXSC 2ZUCA 1KMHB 1XXHA 2V7QA 2GA8A 1VIYA 2A30A 5ANRB 5BQ5A 2VHUA 3QF7A 1ZC4A 4AG5A 1BMFA 1W48A 4B33A 4YLGA 1SHKA 1KK1A 1K6MA 2VPPA 3O8DA 4XVRA 4BEBA 3THWB 3QIAA 1SVIA 3KQKA 3TAUA 2B7BA 1OIXA 4N0EA 1T3LA 4TMZA 1E32A 5KU1A 2QROA 4C2TA 3VAAA 4BFXA 2ZI3A 3G0HA 5DGXA 3K0CA 1CJTC 4NYIQ 4D6PA 1OLOA 1R5NA 5FL7D 4OI1A 1WP9A 2G1KA 3I4LA 3TMKA 2VP0A 3C14C 5TY0A 3AKEA 5JS8A 5G3YA 1SULA 5LD2C 4QJ5A 1Y63A 2W6IA 2BC9A 3UWKA 4BWYA 1WRBA 4ZO4A 5GJCA 4F92B 3PEWA 1UDWA 3UATA 2ZPTX 3W6OA 1N3BA 2BMDA 1SXJC 1OH6A 5C1BA 1ZM4A 1NKSA 1A7JA 3RDPA 3TKLA 5DN6D 4B3BA 4B32A 4X8HA 2GJKA 1S9HA 1M1YE 3WMFA 2CLDX 4Q9IA 1KO5A 4JSYA 4DCSA 1Z6XA 3FKSD 2PT7A 4TLDA 4L9SA 3VKWA 4B43A 4Q4AB 4OJKA 4UQOA 3GFTA 4HDQB 3AP2A 2J59A 3B60A 3JVUA 2YWGA 4BFUA 3SR0A 5KDDA 3AF1A 1GKIA 2YNMA 5KPJA 2AL7A 2YWEA 4A2PA 4GMXA 3B1ZA 2ZI7A 4I1SA 4D4LA 1GILA 2PCLA 3KB2A 5IHPA 5CB8A 2GXQA 3U60B 1E9RA 1NLZA 4RZ3A 3P26A 2C9CA 1TQDA 1CJKC 4IFEA 5SZKB 2G3YA 1E2EA 4FINA 1OYYA 2W00A 1J2JA 1HT2E 2GDJA 2RH5A 3SBEA 4M2LA 1SVLA 3QXHA 4OJQA 3OIUA 3QKTA 2GJSA 4HB2A 1XRJA 2WSSD 4A2WA 2J3EA 2ZRKA 5LD2B 2G88A 4F93B 5G53C 1W2GA 1S9DA 2IL1A 3CZPA 1KZ7B 2D7DA 4PSVA 3QPVA 3SYKA 3EASA 4GRAA 3TRFA 2FMXA 1II9A 2QTFA 2A5GA 2J87A 4PC3A 4NL4H 2WWGA 5EXXA 1KI8A 2QUZA 4HATA 4PAMA 2FA9A 3Q5EA 4FCTA 5KTYA 5F9FA 1W36C 3THYA 1QHIA 3H0KA 3SEAA 4LZZA 1A5TA 2ZIAA 3EIEA 3B6EA 1CJMA 1XPUA 3S1AB 1E2KA 2CL0X 1A2BA 1MO4A 4C7OA 3QQ5A 3V4RA 3IEUA 1LF5A 2FFAA 4LC0A 4GT1A 1CR0A 4LJ7A 1H8EA 1H8ED 2BMFA 4C9BA 2QBYA 1KSGA 4PQYA 1X8KA 2GESA 2QP9X 3NDPA 3R7WB 4OBEA 4BFTA 1KJZA 2AFHE 2ZRAA 2CL7X 4WVFA 3JVVA 3AVTA 4RCYA 4BRWA 3ECCA 4PXAA 1M2OB 1KK2A 3B82A 3FFAA 2XITA 2ZSEA 2OT3B 3FVQA 4Q1BA 2JLXA 2FGJA 1T3SA 2FJUA 2GCOB 4ACAA 3U7GA 3B1VA 4DT1B 3LX8A 3WMEA 1HA3A 1GL7A 2IUTA 1KHTA 2XNDA 2BJWA 3AP3A 3FWYA 4G5RA 3WHKA 4TYYA 1Z6TA 1NY5A 2ODBA 2RGBA 3B78A 4HAVA 2QG6A 5FI1B 4BLPA 721PA 1UEJA 5DLQC 3OEEA 3K9NA 2BBWA 2FFHA 5FFMA 3T15A 1LVGA 1ZU5A 421PA 2A3RA 3W5IA 1G5RA 4KJZA 1YJ5A 1C4OA 4URYR 4Q47A 4S2EA 2DWPA 2G1JA 2F9LA 5J4LA 2GCNA 3U7FB 3PEUA 2CMKA 4HI0E 2YYZA 1V43A 2D2EA 2O52A 2W2TA 3F0TA 1GKUB 4CYMA 2QPAA 1CBUA 2A5DA 1IXSB 2PEYA 4LPKA 1G3IA 4BLOA 4BLQA 2BHRA 2FX3A 4Z8XA 3GLIA 4FCVA 1S3SA 1XMIA 3IPYA 4NCNA 1SKYB 2ZI4A 3PXGA 4C0LA 4CIDA 2O8FA 2VF7A 5IRCD 3QF4B 1OXTA 4D4MA 1IY2A 1WCV1 3VKGA 1D9XA 2HLDD 1OW3B 2J41A 2VH5R 5C4MA 2LCFA 4IHQA 2B8TA 3GFPA 2R9VA 4KI0A 1JR3A 3VMFA 3OIVA 2ONKA 3ZJYA 3VQTA 1ODFA 3TVTA 5FBWB 2I1QA 4TQAA 2BKEA 2RGDA 4LUCA 3AH8A 3MRSA 2BBOA 2QI9C 2ZETA 3U61B 5JWRA 2BM1A 4Q7MB 2VQSA 1P9NA 4HZUA 2ZRPA 1KY3A 4HLUA 2XZLA 2CVHA 1TL7C 2RGNC 1GNPA 2DWOA 2ZROA 1N0VC 3BH0A 4PSKA
chains in the Genus database with same CATH superfamily
2W71A 3F6RA 1SR8A 4LMAA 1L5VA 5CNKA 1WB9A 4DN6A 3BX1A 4R2HA 1EIZA 4Y2XA 3G1TA 2WB2A 2MR6A 2WIFA 2ZIUB 3FLAA 3QMWA 3AZPA 3OJFA 4PPFA 4QAJA 4QULA 2X3YA 2Q62A 1Z8FA 1G3MA 4A82A 3QKUA 4LJRA 1R9GA 4CMGA 4US2R 5TXGA 3I8SA 2HWKA 2R6FA 2FZ5A 4LF4B 1R9MA 1Z25A 2VWPA 2X13A 4BU0A 1QH1B 2H0QA 1BE8A 2WJIA 3FZQA 4JT8A 3DBRB 4A3SA 1YR2A 2JFXA 2QENA 5JAHA 5LP6F 1FIUA 1GNLA 4LDRA 1ZI6A 2J9ZB 4Q3OA 4PYLA 4YTEA 2DTEA 4ENQA 3U44A 1WZIA 4Q9LA 1PG0A 3Q8LA 4MPPA 5D01A 3HO1A 4L73A 2HPVA 4I81A 3JQ8B 4N6OA 3IEVA 3I23A 4HL6A 4L72A 3AVUA 4MX8A 4BNWA 4AFNA 5HIJA 4GX2A 1EM8B 5CNMA 3RWBA 4HGRA 5DHAA 1QRRA 4NMHA 3C3WA 4AZ0B 2SKEA 4JBNA 3HUTA 4RENA 3ZY5A 2IYLD 2QMHA 3GLUA 3SIRA 1FZQA 2ZYGA 3LUJA 3LVBA 5DYGA 3KTOA 3I8OA 2WWFA 4QU5A 4NR0A 2EP5A 3RS2A 2SHKA 1WPQA 3NHMA 4JP1A 4JMPA 3JQ7B 3NHYA 1JLRA 3HI4A 3FN4A 2CK3A 2QQFA 4HDOB 3T7RA 2J31A 4MRVA 2W6ID 2WUDA 3P0IA 4EPRA 5AVYA 3U19A 3K0AA 2D7JA 1OLUA 3WGZA 3L4EA 4M53A 4Q4HA 1JFSA 2AEJA 1D2NA 1F0KA 2FK7A 2OV6A 2P9TA 1HDCA 1V7QA 4Y0AA 3H5AA 1USIA 1BGWA 3LRXA 5JNWA 1TU4A 4MIEA 5KAPA 4G25A 3ZHVA 1XBTA 1Y7HA 3IDQA 5FOQA 1VHLA 1PJBA 3LDGA 4GM4A 3JRNA 2PLAA 2I4RA 2V6BA 5KMGA 3GLGA 1YZGA 1WO8A 2YHIB 3EAFA 3PIDA 1LW7A 4CDMA 3V4PB 2W8ZA 1HNXB 4N01A 2JEYA 1I4DD 4YUYA 3RRMA 5ALJA 5FV4A 3BILA 1H2FA 1W4ZA 1E1RD 1RRVA 2EFGA 1EFLA 2DQZA 2HBYA 1ZSYA 2VH2A 3AJAA 3KEMA 3BL6A 4O5OA 5ENDA 1T4BA 1C1YA 2QTAA 4WCFA 3CNNA 4CCYB 3THXB 2QP3A 1JNXX 1RHUA 3FSGA 2V5VA 2P3SA 2FSFA 1K6XA 1RXYA 4L22A 2FRDC 2HXYA 1TKAA 4UNSA 1WUYA 1P2FA 2H2DA 3PWZA 4R8SA 1DO2A 3C5HA 3IBSA 3FKQA 3AR2A 3EXAA 3ESQA 3NX4A 5KPDA 1YA4A 1SAYA 3C41J 3WXBA 4GWLA 3WWZA 3ZE9A 3WA7A 4QBTA 1XJCA 4BV2A 4EO7A 2GHTA 4NJMB 5B3AA 2Y77A 1TTQB 3GGDA 3U5TA 1MAHA 3S40A 2GN9A 5A3QA 5L8VA 1NUQA 1ZMTA 3BJMA 1E6UA 2QW8A 3EGXA 2MU1A 1R8QA 3D0RA 3AB7A 2ZRHA 1JXOA 3F71A 4PVCA 1L5FA 2OSVA 3E48A 2ZOSA 4HAWA 2NUAB 3FTEA 3A1VA 4LN1A 3JX9A 4Q03A 3K8YA 1DXYA 4EKEA 4I8DA 1IBLB 3G8YA 1NXOA 1KR2A 2Y6VA 2G07A 1Y82A 3OY7A 2Q5FA 4R0NA 3BZBA 2OAGA 1ENZA 2GPWA 2EWVA 2HH9A 2OK8A 3V48A 3WP0A 4DNFA 4RTNA 4OCZA 1H9BA 4ITUA 3HJUA 1L5HA 1QIHA 2ZYWX 4HLCA 4TWAA 3EEIA 5CLQA 3QVGB 4MQ6A 1EVJA 3N0WA 1YU9A 1YOVA 1Z13A 1Z56C 4GX1A 3CZCA 5DHQA 1XCOA 2VJKA 3QBVA 2HOQA 2XNHA 3BFXA 1DUSA 2G17A 3M1LA 3OCYA 4DRZA 1LU9A 4FYMA 2BP7A 2P3QA 2PS3A 4URWR 3P96A 1SY7A 2WJPA 3CLTC 2QORA 4K9KA 1XAHA 1D2EA 1WNTA 1KFEB 1RC0A 1JP7A 4QIHA 3WQQA 3T7IA 2OCLA 4CDRA 4EZBA 5JQWA 4NCAA 1BXGB 1U2QA 3GD5A 4JVOA 1AMUA 2WOJA 1V48A 5K4GA 1SG0A 1K0UA 2QUAA 4G5SA 3Q1LA 4HK4A 4BO2A 3E3MA 1NOJA 3CF0A 1VPWA 2AQIA 4ZI7B 5LDDC 4FJ2A 1PQUA 2L69A 4DPLA 2FK8A 2W83A 3PQFA 4IJ6A 3AETA 1BX3A 2CLHB 1TKCA 3KWLA 1SU6A 2W2KA 3KHKA 3K94A 3ONVA 4A27A 2YV4A 1QPBA 3F5FA 2DBVO 3L93A 2P41A 4TMYA 1XPRA 3KTFA 3A14A 1QNFA 1XEAA 2HPHA 4ZIRA 1D8AA 1GPJA 3ZI4A 1XV5A 1MFZA 3AEUA 1QV7A 2HFKA 1IBKB 4N7JA 3R75A 3K9HA 4D9EA 1RLTA 2GFHA 5I5GA 4CEIA 1SCUB 1UJBA 3KR2A 4M22A 4ODIA 3W2FA 2Z2IA 5IMBA 3KBBA 1QCYA 5BN3B 5TQ0A 4L07A 5GM2A 1U31A 5IT5A 3IAM1 4FI3F 4H0FA 1CUVA 4M1YA 2YASA 2WT4A 4K46A 4L8FA 2UZ3A 5ALPA 3AVQA 1VYHA 3HCOA 1RTTA 2BN4A 1G8HA 2ZR9A 3I5UA 3HO8A 3O1IC 4JCCA 5DWDA 2FE4A 4BO0A 4ZI3A 5H02A 3ICQB 4ZAWA 4JB0A 2JPDA 4KBFA 4BO9A 4Y6OA 1N7HA 3SNKA 2QN9A 4C6RA 5ICEA 4FUTA 3GG9A 3ZK8A 4JOQA 3KQHA 2I1VB 4G0YA 1NJFA 5IVIA 2QSUA 3B1WA 2WUWE 3WMRA 3Q2OA 3DAGA 4P7BA 3DVRX 4PHTA 5GQSA 1RQNA 1HDZA 1JYEA 2D2FA 1NT2A 1EGVB 2FPXA 4NBSA 2HKIA 4XIYA 3F2VA 3C24A 1KPIA 2JLVA 2IP2A 4E11A 1A82A 2RBKA 3B2EA 4IIEA 4UNRA 4B7CA 2DOKA 2PE5A 3AG6A 2W6PA 1OFUA 1ONBA 1UMDA 1ECBA 4TS1A 3S1AA 4B7AA 1WQ3A 4C4XA 4ARIA 5ESXA 4FFNA 5JCOC 1KYQA 3GUVA 2IU4A 3AILA 3IHLA 4YRCA 3ASZA 4D9GA 1IOVA 3W3AD 3DDNA 5CEFA 2GVNA 1YBHA 1D0SA 3A10A 4OA8A 3HM2A 4XDHA 1JG1A 4YQZA 3AKCA 4U9IS 1V3UA 3GVCA 1HDYA 2M6SA 4J76A 4RULA 1DQYA 4IX1A 4J0QA 4BP1A 4D9CA 2HEGA 1L4YA 1X15A 2J3QA 5IJWA 3R7WA 1UKAA 4R81A 5IWAB 2O7NA 5E6UB 4HBZA 5SICE 3DYVA 2IYRA 3HCCA 2BFCB 3FZGA 3GAAA 1RWKA 1PGNA 2HSWA 3ED1A 3KOXA 4E3ZA 4YAKA 1CUXA 2MYNA 2O6HA 3KD3A 4PS1A 1UPFA 4MW5A 5LMZA 1QANA 1TAGA 3HCAA 1YCGA 1OIVA 4MWZA 2UUOA 2E4AA 3BPSA 1U1GA 3HBMA 1HXHA 2B36A 2NW6A 3AEQA 4GNKA 4KR2A 2ZVPX 3QH4A 4F5ZA 4YMGA 1QKKA 3BJZA 2Y68A 1U04A 3TSYA 5B4VA 2VPZA 5TX7A 2Q9BA 1AS3A 3FSRA 2YWCA 3X2SA 1JG6A 1BQ4A 1VCNA 3QKSA 1VPEA 1D1QA 4CMEA 2EKZA 1N9ZA 4PNHA 4RD1A 5EN4A 1OWMA 3F4KA 3PDHA 4XJXA 1O5IA 4ND7A 3CJTA 1I7PA 3BXFA 5KJCA 1HURA 2ZVJA 3ACDA 2IEZA 3VOBA 1XRPA 4EFDA 1C8KA 4E6EA 1L4EA 4LVUA 3HGQA 2W4IA 1SCJA 3IAM6 2H06A 5LZ5A 1CDEA 1A4RA 1DZIA 2HU2A 2JBWA 4YXWA 4Y2RA 3RTAA 1IG3A 4LNHA 3F7MA 3WNCA 5LKRA 4GVLA 2ZQ5A 3RC2A 4WKGA 3D2LA 4X8LA 4EI9A 4WK4B 1X7WA 3LCUA 4QYWA 4UHFA 4CCAA 3AF3A 3UJ9A 3U49A 1BWSA 4L2IB 5AHWA 4RK5A 5J23A 5BMVA 1MC8A 1JBQA 2AX4A 4LI3X 1TK3A 1NZJA 2WTXA 3KJHA 2NXNA 2YV3A 4ZHQA 2XTAA 3NYRA 4CKYA 4E7OA 1KH2A 5K8UA 4B82A 1R0LA 1V41E 3H05A 1I6WA 3ELWA 3N1UA 3T7SA 2XKKA 2REQB 3AM1A 1DTSA 1ZLXA 1QUEA 1LLUA 2AC4A 1P7WA 3GRUA 4GZ3A 5DX8A 2PLFA 3H2HA 1ZEJA 2F3UA 4J1NA 4RD3A 1KFJB 5ECYA 5CVVA 4TUYA 3T1TA 1JHAA 3IKJA 3OJLA 4NV0A 2ADMA 2O5CA 3WGYA 4OYHA 1GCUA 4QO8A 3MTEA 1E2DA 5DEIA 4PRLA 2Z4TA 3OG9A 2PSHA 1L9KA 2EATA 3DMTA 3MRXA 4EDFA 2NT3A 3GLHE 2V03A 3W6ZA 4RPIA 5DV9A 1NUSA 4B9EA 2FW0A 4OKSA 3EQZA 2CF6A 4H4CA 3KO8A 3OUUA 3ZBQA 3MMPA 1YXMA 2NV0A 2XE8A 1ZBDA 4RF3A 1SVOA 1YH3A 2JGIA 1E3TA 3WIOA 3KDPA 4N0PA 2RB5A 3RJ9A 3S99A 1QHHB 4PCAA 4PHFA 4OATA 1RAAA 1BA3A 1QCCA 1L7QA 4KG7A 3EHDA 4CR8A 4DUZB 2ZBFA 2AIRA 3WK7A 4C14A 2FHPA 3V1TC 2OVBA 1YS4A 3DEAA 4HRAA 4IEFB 5IN4A 4ZVRA 3FPFA 4INAA 1Z0IA 4G3XA 1KI7A 2ID9A 3O1HB 2QM8A 3ICWA 4F6RB 3EZ2A 2NXWA 2GHQA 1DIHA 4BKMA 2IUFA 2BSXA 2LDXA 3AVPA 1YE3A 4KQ1A 4NRDA 4EUHA 1PG2A 3KR1A 1PDVA 3VUFA 3EIXA 5AKKA 3VSBA 2BMAA 2Z43A 3ADKA 3DO6A 1EU1A 2HL6A 3FRHA 1XXHE 3MOGA 5GWXA 1DJMA 1EESA 1PUJA 1TMKA 4EKGA 4Q3AA 1VQ1A 1YKFA 2GYUA 3RASA 1RFLA 3QQPA 2P7IA 1Q0UA 1W59A 5I7RA 4Q15A 2C77A 1M5UA 3QU9A 4NCKA 5AW9A 5SY9A 2EFEB 3ZWMA 2I3DA 3UJCA 4YVFA 3W9UA 1Z29A 4EHHA 4OLAA 3SG0A 1H4TA 3X2EA 3DAHA 4EHDA 3TPFA 3D8RA 3JVEA 1JAHA 4RIIA 4BGIA 3V4FA 5H7XA 2YH2A 4O4LF 5HMMA 3BMOB 1NW8A 2REXB 4PZPA 1WU8A 3BL8A 4ZPJA 4AJ4A 4DDMA 1ZNWA 1JEEA 3OIWA 1S1MA 4IS2A 1W4CA 4EI8A 1LNZA 1G6KA 3CPEA 5FL7A 3FNIA 2OXIA 1JKMA 4O4LB 3V8BA 1H23A 3E22A 3HVHA 3IUQA 5A1TA 5LZ4A 4DCCA 4KBGA 1E4OA 2HWWA 3SC4A 1IVSA 1FSFA 2G9ZA 2JF0A 1WTCA 1NSFA 3C97A 3F2IA 5DWQA 4ECEA 5IFKA 2OB1A 4QU8A 3RSOA 4OREX 3BWBA 2XE6A 3E82A 3FR7A 3KD2A 5KSWB 5FWYB 3KU1A 2A78A 3OEED 1WUTA 2E49A 4L4UA 3BQ9A 3H3XA 4MLPA 3ZBPA 4DCMA 1QVWA 2APJA 3ZY6A 4BLSA 2FMUA 4GXTA 5FBKA 3L0OA 3SQDA 5TR9A 1GTZA 4HLNA 4WBXC 2C8LA 4FMDB 1J42A 2D0PB 2WNIA 4RABA 4NU6A 4U7PB 3TG8A 2OLKA 3NBQA 4HD8A 1YL6A 1CEQA 1FJHA 3IBFA 2FFBA 4NTZA 3OCXA 4B09A 3MHPA 4GOND 4BVGA 3SHWA 3W1WA 3HP7A 5C81A 2D5IA 4M98A 4COKA 4DC1A 4HQKA 1OX4A 3A9VA 3F6BX 2PZFA 2WJZB 2DFNA 2QT9A 1EH5A 1ORHA 3DDZX 1NRIA 4RTJA 1J23A 3GXOA 3RAEC 1VJCA 3NRBA 2FVYA 2I29A 4QOIA 4RCZA 1GG5A 3NH6A 4MHSA 3DFZA 1WF6A 3FE2A 3CVWA 2M6LA 2ZWIA 4RHYA 5EE3A 4UKDA 1S2DA 3OZTA 3RS8A 4FOPA 3BGIA 2IHYA 3BWYA 1NXTA 5FPPA 2V7BA 1M2FA 1CW2B 3HJGA 3RBAA 3LBIA 1WETA 3L8ZA 2B34A 4HX2A 1AS2A 1DT3A 3EE6A 3GRVA 4YC7A 4J6EA 4V24A 3RJTA 3N76A 2QUBA 5EKTA 3WB1A 1CUJA 3V46A 3D7LA 3HSYA 3PCRB 1EKXA 3R0ZA 4X24A 2I80A 2Q5IA 4CN9A 4AD8A 2AJLI 3FOBA 2DERA 3QPDA 2IJGX 2GM9A 2R5FA 2G1AA 2OZLA 2PZKA 2HT1A 5J47A 1ZGZA 3L9XA 1PFKA 4UHEA 3KG2A 2WU3A 1BZYA 4FYKA 4NG5A 3UJ7A 3VVLA 1CIPA 2Q49A 4X60A 1SVSA 1M1UA 3BMCA 3NG1A 1FC0A 1FDUA 2QVZX 2V97A 3ODGA 3N8GA 4IP0A 5BSTA 3H16A 2FSUA 2OSBA 1NN3A 5EIEA 2ZSKA 3LPMA 1UJ6A 2XDQA 3SDBA 1YBVA 1ONPA 1GSAA 4PYRA 1FDRA 3A1WA 3PC8C 2JK1A 2AB0A 1R27A 4K6GA 2X58A 3KQMA 3F97A 3PEEA 1XSEA 3NWEA 3UMCA 2IYXA 3OURA 2Z5VA 4M54A 5ER9A 4Q3CA 1MT0A 5CGZA 1JBKA 1QO7A 3QNMA 4YROA 5I7FA 4D42A 3GRPA 2JFFA 3N70A 4XLTA 3KP1A 1XZLA 1W4AA 3O90A 3S2YA 1EWTA 4EHJA 3ZVRA 4DMMA 3HQ4O 8ATCA 4AYTA 2HF8A 4TXJA 2ZPUA 3E9ZA 2NT4A 2PH5A 2BH9A 1UINA 2WU1A 1L7DA 2W2KB 3O8QA 2G67A 3OICA 4X3OA 3GGPA 3DMDA 5D87A 3WBFA 3DJYA 3JR7A 3B1KA 1BMTA 3O3NB 3HXKA 3PB3A 3UFXB 3KSDO 2H6EA 1NI5A 2AXNA 1H93A 3NWOA 1WB4A 4KN8A 2PJUA 3RYFA 3WYCA 1BYIA 2X4LA 2YMPA 4ZV7A 4UCXA 3P52A 4V3BA 3EXIB 1Y48E 3E1SA 5T41A 5DBOA 5T57A 1B0UA 2M1ZA 1M1YB 1R1DA 4JSTA 2FUNB 5BNIA 2JIMA 1RQRA 2NVUB 1GZHB 1TVKB 3DJFA 1GO2A 1UIRA 3MYYA 3AJ9A 4QM7A 4D9BA 3AF4A 3OESA 3DZDA 5FOUA 8MHTA 2J4CA 4BB0A 4E2FA 4DHWA 4KRGA 1R5BA 2PY6A 3NORA 1K0FA 4Y7CA 2AZMA 1DBPA 3DKVA 2H1WA 4H7DA 1YUBA 5TC4A 2WU8A 4JP3A 3H1PA 5DSZA 2V4ZA 4I5EA 3KJGA 1IRIA 1WMSA 1TK9A 1T3HA 1IMOA 2BW0A 2VTVA 4FFLA 1LV7A 3JAKA 4U5XA 5EE9A 4DCVA 4JXXA 3HL0A 3VXKA 2QV0A 1T6NA 4MV4A 5CDYA 5D3ZA 5KNDH 4IHJA 1FRVA 1OI7A 2EQBA 2FN7A 2XKAA 4F8JA 5ALHA 2UZAA 1YVDA 3TAHA 4BS9A 4I66A 4LFCB 1N6PA 3WL6A 5ALWA 3PUXA 1UP7A 3FRIA 4FXOA 1ZZEA 4RSHA 3SXUB 1TZ2A 2GJ4A 5I7SA 2H7XA 5I3ZA 1OB5A 2DUNA 4RKWA 1KO7A 2A5YB 5K0FA 3TW6A 3WO1A 5K8VA 1T4DA 1MA0A 3JQDA 2Z98A 3PQEA 4WFQA 5TGDA 1G66A 1N2SA 4X63A 2RJNA 3PICA 3SZUA 2YKGA 4D8XA 1I2BA 1UK6A 3CR8A 3QEMA 2WUVA 2YN0A 3IVMA 3LA8A 4NWIA 4QYXA 1QF7A 5DH9A 1H6CA 1CETA 4RHTA 3JQBA 1L7RA 4XB6B 3HYRA 3LWBA 4AUKA 3WTBA 3RS5A 1C1DA 3B1YA 2V7GA 5BO5A 1N77A 3QLVC 4ZOBA 1Z5ZA 3TX6A 1IEWA 1P3JA 4YH1A 3HBJA 3VGJA 2A9VA 2H11A 5D3QA 1XYGA 1C9YA 2NU8B 2EDCA 3CKKA 2QPLA 4LYGA 5EZYF 4AAYA 4PAOA 4WV3A 3GARA 5GJVC 2PL3A 3IP1A 3O31A 1JHMA 1I4EB 3AIOA 3CVYA 3HKBB 2MWMA 1U0TA 2JCXA 2WLTA 5K3FB 4JI5B 5FA5A 4OBXA 1PJQA 3N5KA 1ZY2A 4FGSA 1LA2A 1Y34E 4RPKA 3HGTA 1F5NA 3B51X 4NEQA 4RMNA 5B1HA 1J2EA 1YDHA 4AKEA 2O8CA 3L7MA 3RG8A 2F3TA 1B76A 2WM9B 3O92A 3PJFA 4MVJP 4HAZA 5IC6A 1PX2A 2N42A 2C2OA 4UUOA 4XB1A 1GHTA 3S4YA 1OBOA 2AWOA 1PVOA 1QAMA 1RKXA 1JL3A 3AJRA 2TRSB 1A8PA 4P5PA 4YXWD 5JCPA 3D59A 4X90A 4XDZA 3EMKA 2BZ1A 2IUUA 1JTEA 3GP5A 4HYYA 2HRQA 2Q2WA 3VDMA 2FUCA 2J7PD 3V4VB 4B2LA 4HXGA 3DTYA 2W0SA 4JGBA 2R00A 3GJ6A 4FSHA 4GR4A 2WBLC 2WFLB 3OIFA 4TSFD 3RFXA 2KWIA 1HX7A 3UJAA 2NLOA 4N12A 4PN7A 2PA0A 3WLMA 2CZCA 5L4LA 1KYZA 2RHDA 6PFKA 3VPDA 3TDKA 3EVBA 2FZKA 3HYTA 3HKCA 1C0IA 3MWDA 2YBDA 4WEQA 1JR3E 2WSLA 1AMNA 3GFRA 3V9AA 1WBJB 2H31A 5LC1A 4EF6A 2N1MA 1Q50A 2VTDA 3DE0X 1QVVA 4WKBA 4OLHA 4AKSA 4B3FX 3P4XA 3PHLA 3R5XA 5FJJA 4WK6A 4YRDA 1UKZA 2CBGA 2H2GA 2FJ0A 1E9EA 1XD9A 3LQ2A 4KFRA 4PLZA 4JYMA 3SZOA 5GVSA 3OTOB 2PSEA 3ZTTA 3RYTC 3O9VA 2PA3A 2OFWA 1U7OA 2DYKA 3P32A 1L8XA 3QITA 4H1HA 5A9SA 2J3MA 4TYMA 1U9IA 1TUBB 4O2AA 4L51A 4BECA 1BCSB 1TF7A 4IDDA 2BGMA 2Q27A 4NMXB 1OV6A 5I9TA 3E6AA 4RMJA 1PEAA 1UBCA 1Z08A 4XYBA 4HR7A 3WKCA 4JHLA 3G59A 3G7SA 2HNKA 2GM3A 4MYUA 4HS9A 4CFSA 5DVZA 3T0GA 1PYGA 5JHGB 1CIVA 4I5GA 1U3WA 2ZRFA 3I61A 2LIPA 3D02A 3KKNA 1IDOA 3GT3A 4Y67A 3VPFA 3WLHA 5CVCA 4MP8A 4BUCA 1IHYA 1LRKA 1QE5A 2O0KA 2FZ4A 3O1JC 5KYUB 4FC6A 5FPYA 4DC9A 2DKFA 4XTCS 2HDWA 2GYYA 3QENA 5DJ5A 3HXQA 1LI7A 4I1OA 3N6XA 4ZWNA 3H1FA 4ZAXA 1LLFA 3SR4A 5C8DA 3I32A 4AJEA 1G21A 2E6UX 2WM2A 4A0FA 1RR6A 4YY3B 2H57A 1E66A 3DWEX 1OROA 1JLSA 1P45A 5DHSA 1KEZA 1Q77A 2XXBA 4HDRA 2DWUA 3E9YA 3WYGA 4ZVPA 1PT6A 1RWWA 2K87A 4EGQA 1WW2A 2EBHX 4NE9A 2YC2C 2I67A 4RHUA 3U3MA 3U4HA 2AJTA 1NPYA 2K6GA 4LC1A 3EPLA 5BWLA 2QTRA 4FE3A 2QMOA 4YMLA 2ATIA 4F38A 2WMYA 1GTSA 5ENVA 1U1FA 1CQJA 2NYRA 4G0VA 2FE1A 1YUNA 2AJDA 2H1HA 4O4JF 1SIWA 5FOSA 3ZWBA 1FFSA 1IEVA 3O74A 2ZS8A 4OYRA 4QBKA 4R7TA 4E2ZA 2ZSUA 3PGVA 4RUKA 1ZONA 3LUPA 1UC4B 2JD1A 2NSJA 3H19A 4PZ9A 2P2LA 1MVLA 3P20A 2V59A 3PUKA 4P38A 3MM4A 1U1EA 4ESOA 4GP7A 1TPYA 4H1TA 4MR9B 4TQ9A 5EE1A 4RTQA 1X70A 1OA0A 1BYUA 1T2AA 1LK0A 1HZZA 1XTSA 1T1RA 3R4VA 4NATA 1MC5A 3VH2A 4B9AA 1YR7A 1RHQA 3FOZA 1X87A 2BGIA 2E1PA 3KAJA 5B7NA 2AN9A 2A9OA 1V11A 2CW5A 2VUUA 3C6KA 4PYNA 1NW5A 3DZBA 3EYWA 4J8PA 1U2GC 4XD7D 2GPTA 4JJ6A 2IHBA 3OX2A 2QM3A 4BNFA 2ZS7A 1AKTA 3OFSA 4CG0A 3HEMA 1LS1A 1VPTA 2PLWA 4WZZA 5EWMA 4ZEOA 3X1JA 3KLBA 1DAGA 4FWIB 5LP6C 1GQQA 4F85A 1NNI1 3VI4B 4KQKA 4B85A 1DBSA 1RAGA 1VYVA 2A7XA 2C03A 3I76A 1HDXA 1XRSB 1RKQA 4JJ8A 1KSFX 2VHWA 3T34A 2HQSA 3IDAA 5BSGA 2WTUA 4K0KB 1Z4QA 2J6HA 5L3QB 1YDFA 1YE8A 4WKCA 3KYCB 3DE4X 4D92A 1N32B 4UEQA 5LP6B 1C7IA 4Y9SA 3F46A 4DMLA 3A6LA 1UCFA 3W90A 1VCMA 3L6BA 4EELA 2VDUE 121PA 3L0SA 3LCCA 4LBWA 4IV8A 5FTMA 2FAXA 2N75A 2AN5A 3IBCA 5L7WA 3RIGA 3ZDFA 1TC2A 2L18A 3B8HA 3OOJA 4PO9A 4R6WA 4N49A 4QQFA 3WK6A 1SCDA 2IYSA 5ESRA 3DUFB 3UC9A 3WO0A 1IJEA 5BV1A 4WD3A 5CTJA 1NDUA 4X62B 2X2PA 3GJ8A 3NOQA 4LJ5A 2EHDA 3G7NA 2WMOB 1I30A 2ZYTX 4HEA6 4M46A 3P2KA 2XUJA 3A4NA 1IK6A 3DMPA 4MINA 4URFA 5CJPA 3UMVA 1WBDA 1THZA 2DAPA 1P77A 3DYIA 3HB4X 3IJEB 4Q7JB 4QNNA 1J1UA 1Z4KA 3ZBTA 2W2VA 2IE8A 4I3FA 2XYPA 3RFCA 4G5FA 4CPDA 1UBNA 5KYWA 3A05A 3DO5A 2C94A 4OP1A 3PUHA 2XGSA 5IARA 5B6JA 5I45A 3AP1A 4G4IA 3KJXA 4L6CA 2ZRIA 3MWKA 2JKYA 2PBRA 4QECA 5GM1A 4YMHA 5AQEA 5BQ3A 1DADA 1XZJA 3VZCA 2JFHA 3EZGA 1E92A 2OYRA 2QVBA 3W04A 2KYRA 4ARAA 4Y1EA 4MV1A 1IXKA 4MIYA 5CCBA 2KM1A 2P9QA 1RQ7A 3BXZA 2O8FB 1Q3HA 1W76A 1PR3A 1EVEA 2B5OA 4YAWA 4EW2A 3OE7A 3LA6A 4LXXA 4GIBA 3FDJA 4I4TB 3B89A 4N7BA 5JNVA 1FP7A 5EMHA 5MDHA 1CNEA 1G8AA 1G8GA 1Z5PA 2H51A 2VXBA 3ANSA 4IR7A 4OFXA 4ZOQI 1OWLA 3LQRA 4XPIB 3L7AA 1YDEA 1DVRA 2PBZA 3O8NA 2PM8A 4U9UA 3O94A 2JVKA 3OZWA 1C14A 4ARZB 3EPJA 4QUIA 3DBLB 3P19A 3HZZA 2ZTSA 3DYBA 5CIWA 5DCYA 5FPHA 4LWOA 2OO5C 2O14A 2P0AA 3D6TB 3N59A 4KSCA 5FWAA 3X3HA 3MB8A 4HAIA 4K8RB 4KXUA 1KI2A 4DAOA 4M99A 5IPFA 2PX4A 3PC2A 4GUAA 3WDLA 1ZRNA 2PKWA 2W58A 4DDVA 1T4MA 5TIIA 4LIPD 1K4YA 2CXRA 2WF5A 2PV7A 2O20A 3HCWA 3Q7QA 4Q3DA 5BN4B 4DNOA 3OJ0A 2WLSA 4BVKA 3P0JA 3BD8A 4DV5B 3RC1A 5JU6A 5HFNA 1WZUA 1AT1A 4R05A 3OLXA 4UXJA 1T2VA 1Y9AA 1TVKA 1Y3IA 4AUNA 2ZULA 5AUOB 3RJMA 3U0BA 4P84A 3BGWA 5DN6A 3ULKA 2GPJA 4BX8A 5IEJA 4C1BA 3GEMA 3V6LA 2FEMA 4YP0A 3T8YA 2N3ZA 2ISSD 1ISFA 2Y2UA 3OZFA 3HBLA 4ILKA 1KVRA 5AICA 2ORIA 4E2WA 4MEJA 4EGAA 2OR3A 1H2YA 4NSNA 5DM60 3PEYA 1I01A 4X20A 4S1NA 5H68A 2JC3A 4YV1A 4IHJB 1W30A 2GPYA 3AHCA 2R62A 5CHYA 1NG9A 5BSKA 3QV2A 4H7FA 1DDOA 1SCIA 3OVMA 4FUQA 4IAOA 5LA6B 4A0GA 2WWVD 1FVHA 5BUZA 3BMQB 4XYLA 1GPBA 5JLJA 1A76A 1CJCA 1RPNA 2E21A 3DP7A 5FRDA 4E70A 4FEGA 4DCJA 1UDBA 5K0ZA 1EGQA 1QH0A 2Y0PA 4ZQHA 1MP0A 2NACA 1XMJA 4H2DA 1RQPA 1J0AA 1JVSA 1YQDA 1O0BA 2F48A 2B4AA 2XJ4A 4I7EA 4UC0A 4F86A 3HJHA 3DD1A 3OJEA 2JCBA 1GEEA 4EKNB 4NXMB 4BQFA 1UZLA 2J48A 3NBKA 5FD8A 3RTCA 1PJ3A 5AKIA 3NHFA 4BNVA 1X3LA 2YIDA 3WICA 4EIWA 4YHBA 1NA5A 4Q4HB 2HLNA 1C3OB 3DL7A 4JSRA 4OBBA 4KU4A 4P4UA 1EVIA 1XGKA 3ZWQA 3LUGA 3HO6A 3NHPA 1XTZA 5C5DA 4CTJA 2B2NA 1LWOA 4X6XA 2JKVA 2J0VA 2IS4A 1SIBE 4YRMA 2C04A 3A9TA 3QWFA 4JUDX 1QJ4A 3IB6A 1Q44A 3F9CA 5AI4A 5TEVA 2DC1A 2WOOA 4HNQA 4C06A 1DX9A 4CZ2A 3SJUA 3KKOA 4A6EA 3CUTA 1OR8A 3G88A 4D99A 3UFBA 4TWBA 5AJZA 5DOVA 3L84A 4K1LA 5C1OA 3AKDA 4MRRA 4RFSB 2O8EA 4KR0A 3A1NA 2V7XA 3I2IA 3MIZA 3VSEA 2VJMB 4E46A 1GKLA 1KYXA 2V9PA 3QE3A 4P0TA 1DBQA 2GNAA 3EX7C 1MO5A 2V1UA 3TQFA 5AKJA 1Y9JA 1AH2A 4I9NA 4NLLA 1ZSNA 2XX3A 4RVOA 2X5NA 5E38A 1DKRA 3F7NA 5IBPA 5J4HA 2ZG6A 3AR3A 2PGXA 3CRMA 4DL9A 4JLMA 3WY9A 2X86A 3DPUA 2BM0A 5CFPA 3LD9A 5HJ7A 3BWMA 4R7GA 1R66A 3TFOA 1EFCA 2YWHA 2ZJAA 5B7PA 4DLVA 4BMYA 1P4AA 3COPA 2O5VA 3CVJA 1YRLA 5AJYA 2VK2A 1H94A 2J6CA 2PG3A 3LHSA 3AI7A 4LBYA 3R7LA 3TLAA 4EFKA 1NKTA 4AY2A 4MI9A 3JQGA 1XP5A 3SQOA 1OAOA 3JARB 3GD7A 2A0FA 3OT4A 1O03A 2VNKA 4XM2A 4L3VA 2NXJA 3ZHSA 4PC6A 4KFSA 5ITSA 2VZEA 4R1UA 1T9HA 1UWCA 4JU8A 4ZYXA 2JRLA 3FVWA 1V3VA 4N5IX 1G18A 2PANA 3FTDA 3L7JA 4MWGA 4IGFA 4Q6BA 4BNDB 5DNYB 1I3LA 1PJTA 1RFGE 1WUIS 1WKCA 3VM6A 4MR8B 4OFZA 2H2HA 2YOFA 4FGKA 3D3WB 2FJPA 3GUYA 3ZNOA 5JVDF 4EF5A 3AO0B 3AF2A 3T3MB 4JIGA 2SNIE 5GJBA 3FPAA 1JQJC 5HQ3B 4P35A 2FZLA 2ZYSA 2HF7A 2V55B 2WHPA 4O2AB 5FPTA 4HJXA 5A1JA 3H2KA 5CVUA 3SPXA 2IEAA 3ETNA 1YC5A 5TF4A 1LLCA 1MIHA 1ZJ5A 2AFIB 3P9KA 9ATCA 4NYJQ 4R8VA 2EERA 1JAYA 2Y4OA 1MRNA 1CD5A 5C3UA 4CNBA 2NZXA 2IYUA 2HDOA 3H3FA 2RBEA 1TCUA 3HP4A 2GD1O 1EJBA 2PSSA 2AV6A 3N8KA 1IWBB 1UKYA 1BXGA 3LBAA 1ML3A 1QGED 5J4KA 4HYEA 1IWPB 1W85A 2XAAA 5ICMA 4QBIA 3JTMA 3PGMA 3SVTA 4ZK2A 2B8JA 1HQCA 4KZPA 4Q19A 3WZ2A 3FZYA 1Y8RA 5GAJA 4ZCMA 3RU7A 1B8NA 2D0DA 2GD2A 1QG2A 1ZOPA 4LS3A 3W78A 2HSGA 2UZ0A 5A4MS 4LZWA 4M38A 2AEMA 1JG7A 3NCTA 4GD3Q 2VCHA 3U2QA 3CVUA 5JBNA 2WA1A 3TK1A 3O26A 2FPWA 4ETIA 1EK1A 2GLTA 3C7DB 5D84A 1EVKA 1KPGA 3MF4A 2J09A 2R65A 1R6UA 3GGJA 3L6RA 1UANA 2EDAA 1JR2A 2PBLA 3PL1A 3RSHA 3ORRA 2F64A 5BN3A 5H59A 3HY4A 4I1YA 1EPUA 4LY3A 5DTEA 1MB0A 5EXPA 1Y8CA 2RARA 3E84A 3TIGA 5K0LA 3ZE2B 1WXWA 1VGVA 3DV0B 1AC5A 4UBJA 4MYRA 4HDNA 4ACBA 3PJDA 4DLNA 1Z33A 1OT5A 2C2XA 2DUJA 4UU1A 3GJRA 5FADA 4H7JA 3WADA 3ZDEA 2GJAA 3DXZA 4B3XA 5IUJC 5JCXA 1HNWB 2IGTA 2R7KA 3U17A 4DW8A 4YUAA 1MORA 2DFPA 3QMMA 1NE7A 1OZAA 4L8YA 4LJ9A 5DP2A 3W5SA 3JQPA 3OBIA 2XB2A 1TYEB 2ASVA 4MUXA 2ARKA 2C3PA 4NZYA 2BEVB 3GJ0A 3HADA 2P2YA 4JKIA 1AK2A 1XDDA 5BT9A 4Z7NB 2C2KA 3KKZA 4W9NC 1E58A 4F84A 3QLEA 2PX6A 4DDHA 5E1OA 2C4HA 4GR9A 3LO5A 3C4VA 2VJAA 1HG0A 1GGNA 4R1QA 5CT4A 2Q7OE 4QVIA 1M2KA 1NIJA 4FMBB 5IJZA 4AKGA 1JHDA 3SOZA 3EGOA 3ZE1B 1R7RA 3Q8MA 3W3AA 2IYFA 2Q3LA 3U0VA 4J0EA 2WAYA 2AFRA 3MAAC 2IX3A 5CB6A 1RRPA 1BDMA 1NFFA 2OXRA 3OD1A 4CQJA 5EXDA 1PX0A 2I8AA 3WLTA 2RI1A 3MLBA 1VP3A 3VR4D 1KC1A 1SCKA 3BIWA 1QGAA 3FI9A 1I3MA 1CYDA 1NF9A 1FUKA 4TUYB 3DBOB 3P45A 4D6XA 3CO0S 3KKQA 4PN3A 1I0ZA 3SHQA 1FFXA 5D1HA 2HMAA 2QVGA 4RVNA 3UHOA 1DUIA 1WHTA 2FPMA 1LZLA 2DPLA 5DNWA 1B43A 4MV5A 4R7ZA 3REFA 1MN6A 1UIMA 1IUPA 2ECOA 3W34A 3ZGNA 2FW6A 1LNQA 4IGAA 5KC9A 1KVQA 2O8BA 1F2UA 1VRCA 1NYTA 2XGOA 4MCJA 3U6KA 3D0QA 3EH1A 3LWNA 3NCHA 3OFNA 1X1EA 2OBNA 3R3YA 4LXHA 3EBLA 3ZLJA 3VU9A 3O7MA 5CT5A 1LGYA 4Z0PA 3NT2A 2AOXA 1FK8A 4E1VA 1HSZA 1VXRA 1PQ4A 3SICE 3G6KA 5LQCA 1KDRA 1WXEA 3RUAA 2VYCA 5ALMA 2EZ4A 5CM2Z 2D4AA 5KNBA 4WN3A 4X93A 2VJBA 4GKVA 1I7SB 2EQ5A 5AUPB 2W90A 4MW2A 5CBKA 1NRJB 2XF2A 4DDTA 2VT3A 1CLUA 1DJPA 3G2HA 5D1NA 2A35A 3I9FA 5DTIA