2GA8A

Crystal structure of yfh7 from saccharomyces cerevisiae: a putative p-loop containing kinase with a circular permutation.
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
353
structure length
326
Chain Sequence
VDTHKLADDVLQLLDNRIEDNYRVCVILVGSPGSGKSTIAEELQIINEKYHTFLSEHPNVIEVNDRLKPMVNLVDSLKTLQPNKVAEMIENQGLFKDHVEDVNFQPVKYSAEETAVVARGGTANAIRIAADSINIAQIVPMDGFHLSRRCLDLFKDPQTAHKRRGSPSTFDSNNFLQLCKILAKTSLKVSTSSVFEKLSKTFSQTIPDIFVPGFNHALKDPTPDQYCISKFTRIVILEGLYLLYDQENWKKIYKTLADTGALLVYKIDIDYEATEERVAKRHLQSGLVTTIAEGREKFRSNDLLNGRDIDNHLIKVDNIVHIRNDH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and functional analysis identify the P-loop containing protein YFH7 of Saccharomyces cerevisiae as an ATP-dependent kinase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Unknown function
molecule keywords Hypothetical 39.9 kDa protein
total genus 109
structure length 326
sequence length 353
ec nomenclature
pdb deposition date 2006-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07728 AAA_5 AAA domain (dynein-related subfamily)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ga8A00
1U90A 2ATVA 4MKIA 3MD0A 4TYQA 3LW7A 2XGJA 4P33A 2QRNA 3QIAA 4LV6A 5G3YA 1W2GA 3QXJA 4POAA 2GF0A 3DZ8A 4JS0A 4O25A 1KI1A 2H5EA 3KKMA 2C9OA 3IKJA 3FGNA 4WZ6A 2HJGA 3RRMA 2JJ2D 2W6JD 4EIWA 2OCYC 1OJLA 4KLZA 1E4VA 5BXQC 1PJRA 2IXEA 2JA1A 2KJQA 5EP4A 3PUYA 4WVFA 5FUVA 1W36B 4RD6A 2ZJ2A 2RGAA 1W7AA 2CK3D 4HDQB 3SC3A 2ZTSA 3BK7A 5GJCA 5H8WA 4UXHA 3MWYW 1XTQA 4BWYA 2OILA 2BV3A 3OHMA 3D8BA 4P4SB 5DLQC 4TLAA 2XAUA 4CVNA 1O87A 1DVRA 4B2IA 3LW8A 1YZTA 4FIDA 4LPSA 4D4JA 1NLYA 2OM2A 4MYTA 3PFIA 1MR3F 1CJUC 4NL4H 2BMFA 1E9RA 2ORVA 4TYPA 1AS2A 1DELA 3CR7A 4LY6A 5KTYA 3QUSA 3KB1A 2B8WA 2C04A 1L4YA 4PSVA 3NBFA 2G77B 1FUKA 1SXJE 1ETUA 2ZYUX 2BOVA 2ZETA 2AN9A 2EVWX 1R0WA 3NKVA 1JAIA 4KI0A 5JEDA 1E1QD 1S9HA 1DAGA 2RAPA 4EUNA 1AA9A 4AG5A 2G88A 3R7WB 3C14C 5ANRB 4TLEA 1Z5ZA 3DL0A 1GITA 3FMPB 4RD3A 5GVRA 1M7GA 2PX0A 5LD2C 3K9GA 4E5UA 4TSFA 3ASZA 1G7RA 4F92B 3B9PA 3CLVA 2GJ8A 3UG6A 4PHGA 4N3NA 1NMZA 1COWA 5AJXA 1UBFA 1GKIA 2JEOA 1JAHA 4HAWA 1E2IA 4LHYA 1VYUA 5BN4A 1JXMA 2ZYVX 2FGJA 3A4NA 1Z3IX 4PO9A 1T5IA 4QFMA 1MO3A 2CNWD 3MCAA 2D62A 3GJXC 1HA3A 4TL8A 2CHGA 5C4MA 4F4CA 1VDZA 4YDHB 3P1JA 4GOKA 4MRPA 1XEXB 4TTRA 2YV5A 1CULC 4DCVA 3KQLA 3L2OB 2W0SA 1R5OA 1SKYB 2IUSA 1M6NA 3PIRA 3A36A 2EYUA 4PAQA 1UDWA 1S3GA 2ZANA 4PPQA 2BWJA 1FMJA 2V3CC 1IQPA 1FOEB 1RJ9B 1TNDA 1VYVA 3H0KA 5DNYB 3E70C 4HZUA 4R7ZA 1Z0KA 4AC9A 4OHZA 1W4AA 3GLIA 1XD8A 3A1SA 4PC7A 3Q7PA 5JECA 2YC4C 5FPYA 3HU1A 4KBFA 5A4JA 5JWRA 2O8EA 2QQEA 5EUQB 5J4VA 2BC9A 3RDPA 2R9VA 4JVLA 4YQFA 1WE2A 1KMHB 1TX4B 1JB1A 3CR8A 3RS3A 1NVVQ 4MRNA 1YRAA 3TH5A 1D8TA 4JBWA 3O8RA 1XTRA 2VTKA 4TLBA 5FR2A 4TYYA 5GJWC 1G3IA 2IYZA 4Q7KA 4LHXA 1KMQA 5DHFA 4GDFA 2ZVQX 3SJBA 4NCKA 3LD9A 1W0JA 2IL1A 5JS8A 1U9IC 4M1YA 4HAZA 2YHSA 2IS6A 1N0UA 1T3HA 2VHTA 2QQ0A 4I81A 1G16A 2CL6X 2XNDD 2FH5B 4Q1CA 4CT5A 1TF5A 1AIPA 1IN6A 3RC3A 4QM7A 2YYZA 3VNVA 3HPRA 2D74A 2OZEA 1P62B 3CKLA 1KSGA 1JR3E 1P3JA 2VHUA 4OQFA 3U44A 4I1SA 2F1JA 3AF2A 4LOAA 2B7CA 1KO7A 1N5LA 1KMHA 4Z8XA 1TQ2A 4L4UA 1G5TA 2A5GA 1XPUA 1RIFA 4G5GA 2ZAOA 3LVQE 4JL8A 4C4PA 2WJVA 1XJQA 4AG6A 5BYKA 1N6KA 2AFHE 4QHSA 1SKYE 2O0KA 4ZDIA 5FTJA 4EJSA 1R0XA 2XTNA 1CJVC 4OQXA 3AVYA 1AGPA 3BRWD 1U0HC 2C77A 2VSXA 3HR8A 3W3ZB 4Q00A 2ZYWX 3EWAA 3QQ5A 3VMFA 4LDJA 1KSFX 1FPMA 4HB0A 1P72A 4DWJA 2ZR9A 1MABB 4A0RA 2B7BA 2Q3HA 3U3RA 3LBNA 5C4GB 3PEWA 1CEEA 1T0JB 3DVLA 3B60A 1IN5A 2A3RA 1S9DA 1ZCAA 3CWZA 5FOXA 2JLVA 4FMDF 1T91A 1E0SA 2C95A 5DHAA 1T9HA 1GIAA 4BLTA 2JASA 1ZYUA 2RGXA 4OYHA 3FKSD 1DTSA 1WB9A 1R0YA 3U5ZB 1QHSA 3RS0A 4GSYA 5KOYA 3BORA 2F3TA 3HU2A 5CJ2A 3T1TA 3AF4A 2CCJA 3CZQA 4NYIR 5EXSA 3LX5A 2R6DA 2FEOA 4FCTA 5HKKD 2HV8A 4MRVA 3R9XA 3PUZA 2LWIA 3MWLA 2EU8A 1E1RA 1P4SA 3WY9A 3F3YA 4CZ2A 1YZGA 1Z22A 3B1VA 4TTPA 1SVOA 3HPQA 4DLVA 4A8JA 3RS2A 3GEIA 3TJZA 4E07A 5CLLA 5DYIA 2QBYA 1NBME 2C03A 5HZHA 3GLFB 1NF3A 2QUZA 2YOHA 3EZ2A 2Z0MA 4RZ3A 4AIIA 4LBZA 5CIWA 2ZSBA 4NCNA 4V0ME 3BIFA 1AS0A 2ZRPA 5TY0A 2FA9A 4LBVA 1E1QA 3EAQA 4BLRA 1UF9A 1RZ3A 4Q5IA 5EXTA 5IDVA 1Z07A 1HV8A 3AVUA 3LNCA 2BMDA 5B2ZA 3U60B 4DT1A 4URVR 4JLJA 4UNRA 3GEHA 3UK6A 1TTTA 3FE2A 1AN0A 1OXVA 4C2UA 5JJIA 3U61B 1BYUA 4GZLA 1JEDA 2FWRA 1KDRA 2V54A 3RRYA 4N0EA 5CM9C 2NPFA 4V0NA 4LJ7A 2VL7A 3KKPA 4PAOA 2ONJA 4W7SA 3P27A 1J99A 3MG9A 2JLWA 5F2EA 5EQTA 3H4MA 4A8JB 3KTAB 1G7SA 4XWKA 3K1JA 1TAGA 4FCVA 4Q4JA 3KKOA 1RYHA 1XPOA 2ZIAA 1D2NA 3CRRA 2AWNA 4B71A 1QHHB 4EAQA 2AXNA 3C5HA 4QXAA 3DOEA 3W6PA 1EFTA 1OH8A 3LX8A 4BFWA 4XIGS 1KAGA 1QHNA 1ZUHA 3AUYA 4F91B 4AY2A 4JL5A 1KI2A 1W49A 5K8UA 2VYFA 1JECA 3TUZC 1HQCA 2ONKA 4QL3A 2IS1A 3OIUA 1S3SA 1KDOA 1SQ5A 2NO7A 1MO6A 3RYTC 4G5RA 1JNYA 1P9RA 2WSSA 4U02A 2XZLA 1OF1A 2HUPA 4NCHA 1DAEA 2GTPA 4BEBA 2IS2A 4OJKA 5FTNA 1VCMA 1OW3B 1D5CA 2CEAA 3CBQA 3CUEF 1OIXA 4N1AA 1WRBA 2QPOA 4JKYA 1E0KA 4ZCLA 3QF7A 2VSFA 1BKDR 2OXRA 4DB4A 2WKRA 4NONA 2H7VA 5JBQA 1WCV1 1WMSA 1EFHA 5EZ6B 5DO9A 2E87A 3TBKA 1PZNA 1G8HA 4FN5A 2V6IA 2QN6A 1DG1G 3AKEA 1LFDB 1QBKC 2VO1A 3VR4A 3DDCA 2QMEA 2OV2A 3K9LA 4HB3A 5AJVB 3UKDA 4DSNA 4B44A 4M4SA 5GJVC 1OFIA 2JJ1D 1Z0AA 4V0MA 2J0QA 4RFSA 4RZXA 3IGFA 4HAXA 2IEYA 5JI3E 2A5YB 1XCMA 4A92A 3BERA 2WJGA 5TVKA 1A7JA 2F1RA 1JJ7A 4BEJA 3TIFA 3L82B 1WDTA 1HY3A 2W83A 4O0MA 3BB1A 2Q3MA 3HU3A 3OFNA 3OESA 1XX6A 3JVUA 3TW4A 2GZDA 5AJZA 4CRWB 2A9KA 4DLZA 3K8YA 3U6BA 2JIZA 1FL9A 2NO9A 3GJ7A 3T1QA 4ZDJA 2V6JA 5B64A 1U2RA 3THXB 1VG1A 3KTAA 1FTSA 1CJKC 2DWPA 3QF4A 2NIPA 4OK6A 2CJWA 4QBFA 2PEYA 2QAGB 4JLDA 1P9NA 2Z6VA 3JZMA 3FKQA 5FTLA 3U4QB 3K70C 4NDZA 2FZ4A 4KFTA 2W00A 3NDBB 4L9WA 1N6NA 3CONA 1OH7A 4RD1A 4BQSA 1LS6A 1CR0A 2WBLC 4G01B 4PPNA 2ZJBA 4WOPA 4DLRA 2Z83A 4PC1A 3CO5A 1X3SA 1XTIA 3NDPA 4URWR 1Y3AA 2ZUCA 3T61A 4Q4LA 2GZHA 2H57A 5EE3A 2XXAA 3BS4A 3AH8A 2HJVA 1PUJA 1GDDA 3DKPA 4LCBA 3B6EA 1CP2A 1KIMA 2N1BA 4DCNA 1FQKA 1E9SA 4B35A 1Z6YA 4LV5B 1S2MA 3QF4B 2ZREA 2V7QA 1KO4A 1OFTA 3FKSA 2JLXA 3MFYA 3NBXX 1Z06A 4LZZA 4U7DA 4FW9A 1OB2A 1BOFA 3GFOA 2GVZC 3E2IA 3SHWA 1KY2A 3D31A 3CRMA 2GVDC 1G291 3W8NA 3K53A 2GJSA 2GEUA 4DEXA 2DBYA 3VAAA 3BFXA 1QDEA 3AB3A 3MWKA 1PLJA 2GEVA 2CVFA 4ZKEA 2FPKA 1F60A 1E1RD 4HAUA 2WAXA 5DI9A 4Q1AA 4KVGA 2OCBA 1YKSA 2ZYTX 2V1UA 2OESA 3TMKA 3M0EA 4PZYA 5DN6A 1RRCA 2BBWA 3NTUA 2EW1A 5CJPA 3AVVA 3QG5A 2OXCA 4B34A 4C0QC 2WWGA 4C2TA 3QJYA 3PEYA 1TL7C 3REFA 4B33A 2ZRAA 2P3SA 4QJ4A 2A2ZA 1G3UA 1KHTA 3QXHA 4QKQA 2ZJOA 1SXJC 3EIQA 2QGNA 3RLFA 4UNSA 3MJHA 1ZMXA 4B6EA 4I1UA 4Q9JA 1R6BX 4QGAA 4XSGA 1Z63A 3W34A 5J47A 2GK7A 1YZNA 1WBBA 4O3MA 4RZ2A 4A1FA 2RH5A 4WA7A 4IKEA 1GILA 3CRW1 2JLYA 1VMAA 3TAHA 1FNMA 4JZKA 1GTVA 1N2CE 2WWYA 1QVRA 4IEEA 5FOSA 2FPLA 3FHTA 4TMVA 1G4AE 2XNDA 3C4JA 2CL7X 5A5GA 1E2MA 2P6UA 1ZD1A 2QP9X 2ZAMA 4C0LA 1P5ZB 1Z6AA 3H2YA 4PQRA 4Q48A 4NYMR 3WP0A 3S1AA 2AFIE 2DWOA 3FMFA 1KK1A 4M1TA 5EE9A 1ZIOA 3KQKA 2IWHA 1QZXA 2JDID 5J4KA 3KKNA 2DYKA 1NY5A 2MMCA 5BN3A 1L2TA 1Z2CA 2BCGY 4M1OA 2ZI4A 2KBEA 3OIVA 1G4UR 2HYDA 2YKGA 3HYTA 1TQ6A 3THXA 2BVNA 3UPUA 3TR0A 5UKDA 1MRSA 4QGGA 2OO7A 1R10A 3MLEA 3MMPA 1NN1A 4XD7A 3G82C 4Q4HA 3NEYA 4B3FX 1E79A 5FOVA 4GZMA 3D3QA 4KBGA 3GJ3A 2UZIR 1EG7A 3GQBA 3PV0A 2PZEA 4GP6A 2RGGA 4KCGA 4OHWA 4Q4AB 5DISB 1TU3A 3CM0A 2WWXA 4GMDA 4LJ9A 3QBVA 4A36A 1US8A 3ZJYA 1G9XA 4URYR 4Q1EA 3SYNA 1IXSB 4W5HA 1LS1A 5IK2D 4V0LA 1Q22A 2WWFA 2W2TA 3SFZA 1YU9A 3TE6A 3GJ5A 3KKQA 3SJZA 3VKHA 1DBSA 1CRQA 1E99A 3ND9A 4TN1A 2ZRDA 4OQNA 1IJEA 3GLHA 1FUUA 3KUCA 1F6BA 4JLAA 1XTKA 4D25A 1Q1ZA 2Z43A 4MGIR 3TW8B 5JCZA 3E5HA 4LC1A 2VHQA 1FNNA 1G6HA 3DPUA 3KFXA 4G1UC 4BFYA 2PT7A 3R20A 3ZZTA 1N6PA 4LYJA 2JATA 2REXB 3J81k 1UKVY 1HUQA 3PITA 4JLVA 4KO8A 5FTMA 2PMDA 4ABYA 4JVMA 3GLFE 1FP6A 3LQQA 2OHFA 3EX7C 3D6TB 2OT3B 4D80A 1B0UA 3B13B 4FMCF 4URXR 4X8HA 2AK2A 2O8BB 1W5TA 1P6XA 1NIJA 3K09C 2VPPA 2YVUA 3M4YA 3CRVA 4BASA 4UNNA 1N6IA 1XMSA 3B2EA 3W9YA 3T5DA 3JZAA 2G0TA 1G20E 2NO0A 3RSOA 2ZI6A 1Q0UA 1EWRA 3WMEA 3F5FA 3K9NA 1F3OA 2XOKA 1ZD9A 4NKRA 5EXPA 5J4YA 3LRPA 2P65A 3CNOA 5CDFA 4D26A 1YZQA 1A2BA 3A6PC 2N46A 3ADCA 2D06A 3C16C 4MKGA 2QBYB 1F48A 2KWIA 1SVWA 2IWRA 3VHXA 1YR6A 5CITA 2QTHA 1Z6GA 1S96A 3SZRA 3LV8A 3BE4A 4A2WA 1KJZA 1FW6A 3ICQB 3DM5A 2IC5A 2XITA 5FOUA 3UWKA 4DEYA 5KDDA 2YOFA 2OLKA 3TUJC 5BYJA 3U6KA 4LBWA 3WMFA 4NBSA 1FZQA 1HE8B 3Q85A 4N0DA 4UNQA 1SHKA 3AP2A 3NBZC 2QENA 1WP9A 2CE7A 1MO5A 2QM8A 3PUVA 3LO5A 4MRSA 2TMKA 4Q4JB 3SJAA 2CHQA 1H65A 2ODBA 4Q03A 3CNLA 4QRHA 3P26A 3CF2A 1OXTA 4WXPA 5FUXA 3ZVRA 3B85A 5EE0A 1R4AA 3EIEA 4CW7A 4PZZA 4EPRA 1JPNA 4LHZA 4TYWA 3ADBA 1K8RA 3CH5A 3DM9B 3PR1A 1VCNA 4LJ4A 2NPIA 1L7VC 1ZNZA 2R6CA 3CWQA 5DI3A 3REGA 3GMTA 5EZ5A 3PUXA 4WZAE 3UMFA 1GNRA 5D3MA 1XD2B 4HATA 3GLGA 1AKEA 2GXQA 3B1WA 4B2LA 4JLMA 5A0FA 4NE2A 4ZCIA 3SQWA 4HI0E 2ZUDA 3KXKA 1E9CA 3B7GA 3SBEA 1W4RA 1G1MA 2NG1A 3OE7A 2EQBA 4PR0A 5E7JA 3KQNA 1CRPA 3BGWA 1UKEA 3A1TA 3A37A 4OHVA 3TR5A 3T1OA 4XWOA 1ZM9A 4ZPXA 4E09A 3PCRB 4Q4AA 4TZ6A 2QTVB 2P6RA 4BLQA 1MOZA 3WXMA 3P4YA 5FTKA 2PT5A 1GRNA 5D3QA 1OKKD 4LYHA 1A4RA 1P2VA 3BOSA 5FH9A 1MRNA 1KSJA 2ZPTX 2UZ3A 1ESNA 4TYNA 2ZSAA 3QI2A 1A5TA 2OLJA 2ZE5A 4B3GA 3O8BA 2WSSD 2IYTA 4DKXA 2XSZA 3GLIE 2XNSA 4W5JA 1LF0A 3IIMA 3OEHA 2XJ4A 2W6IA 4HDCA 2P67A 1JPJA 4KHZA 4M8NE 4BFXA 4DSUA 2NZJA 1BMFD 5DI3B 4CEIB 1GWNA 2EYQA 4HUQB 1NNEA 1UKYA 2R62A 5FR1A 2HCJB 3CX8A 3EWSA 1VG0B 4ASUA 4ARZA 4R2IA 1XJCA 1GOTA 2IYQA 4LJYA 721PA 2OEPA 4L16A 1DE0A 1GKUB 3KJGA 2LCFA 4GMXA 1MO4A 4B32A 3OE7D 3K0CA 4G3XA 1E2LA 4KU4A 4D4LA 2RGNC 1JR3D 1RFLA 5IK2A 4K81B 2ZRLA 3F8TA 2W58A 1H8ED 1I2DA 1HE1C 2EFDB 4LC0A 4M9SA 2HCBA 4XOIA 4TLCA 4YMTA 621PA 3WNDA 4OHXA 1OKKA 1PLKA 2KI5A 5FPSA 1IN7A 5KO2A 4H1UA 4QHYA 3BAFA 4RKFA 3U7HB 4JT2A 1E0AA 3QOFA 4ZI2A 1D2MA 1OH5A 4D0NA 1S0UA 1X8KA 2YWHA 4LI0A 4UKDA 2O8DB 4PXAA 2E1RA 421PA 4M1KA 3LQRA 4M9ZA 4DSTA 3LA6A 4UXIA 5F9FA 4B47A 2DPXA 2OBLA 1SVSA 4DLSA 2OAP1 2ZJAA 5JLJA 3K09A 1BMFA 4TT3A 1XU4A 4GP7A 4Z8YA 3VNUA 3FPAA 3GLHE 2RGBA 3K0CC 1P61B 5L3SA 5FBVB 4DIDA 3SQXA 3RS5A 3GJ6A 3Q72A 3TUIC 4OI0A 4XJXA 4NYJQ 4AURA 1S8FA 4RKEA 3K0SA 1G8GA 1E9BA 5IRCD 1E69A 5TARA 1QG4A 3HR7A 5HE8A 1Q21A 2BEKA 1XBTA 2DFNA 1T3SA 2HXSA 1AGRA 4A82A 1Z29A 1EWQA 4TTQA 2PLRA 1N5KA 4MDFA 4JKIA 1UEIA 1EFRD 3LVRE 4JJKA 1DO0A 3QXSA 2KBFA 4JSYA 4BFSA 2ODEA 5HE9A 2O8DA 1U9IA 4NU0A 5F3WB 4CEIA 5K8LA 3RRNA 1KK3A 1F5NA 2NO1A 1KI9A 3G5UA 1G8PA 1Y63A 1ZBDA 2C96A 3L0OA 4R98A 3NC0C 1UM8A 3NBYC 2VH5R 3A8TA 2QG6A 1NVWQ 1N6RA 3PG5A 1GKYA 2IXGA 3C15C 2IYRA 1KK0A 3R8FA 4DCTA 4B2PA 2XZOA 4CEJA 3ICEA 2ZU6A 3TSWA 5KDOA 3LLUA 4TT3D 3ZVMA 3U3OA 4QBIA 4H9GA 4DLYA 3VR6A 2DCUA 4TMZA 2PBRA 3VR1A 2IYLD 5TMPA 3RS4A 3WMGA 1JBKA 4PQFA 4ASUD 3RNLA 5G53C 4CDGA 1L8QA 1XFAA 3FVQA 3GFPA 2OCPA 3TLXA 1KTVA 3IEUA 3AGPA 4NCIA 4Z1MA 3W6NA 2XTZA 1YHNA 2H16A 3ZZUA 4PSKA 5H1YA 2FMXA 4TWZA 4FMCB 3CZPA 1W5SA 2A30A 2ZI3A 3CRQA 2C9CA 1JR3A 2WMNB 5BQ5A 1GG2A 4MYUA 5LD2B 4IOMA 2W6ID 1IBRA 5HTKA 1CXZA 2HLDD 2NTYC 4KITB 2J59A 4Q47A 2BJWA 3AEZA 1F2UB 2DFTA 1P2TA 1BS1A 1ZJ6A 2GA8A 2IT1A 2VF7A 5KDLA 821PA 2OAQ1 2W2VA 3CIOA 1AJEA 1ZVQA 1C4OA 1W47A 4GOJA 5JZVA 2JGNA 1NG1A 2ASEA 1MT0A 3UXMA 2N42A 1J8MF 1W4BA 1ELOA 1DOAA 1YQTA 3UG7A 4MYHA 2W2XA 4BE7B 4PX9A 4I1OA 4EPTA 2QP3A 2GCOB 1UDXA 4NZYA 1IY2A 4C0AC 3LLMA 2XSZD 4YMSA 1NG9A 2ANCA 2BHRA 4OKSA 2IBMA 1XEXA 3OEHD 4KSBA 5HZKA 1H8EA 1H8HA 3GLGB 2GESA 4EJSC 2C8VA 1NN0A 2ANBA 5IF9A 3RC8A 2GKSA 2GK6A 2YNMA 3VHLB 2UKDA 1NMXA 2WM9B 1M1YE 5AUOB 2QI9C 5J4HA 1UEJA 2CLSA 2VQSA 4RFSB 1ZC3A 3VX3A 2WPDD 1FX0B 3EZ7A 3P20A 3U44B 4B76A 1N5JA 4DUGA 2R2AA 5LB2A 3MSXA 4MH0R 1XMIA 4DZZA 2VSOA 3QVVA 4NTZA 3FTQA 2PMKA 1XCPA 3FB4A 3ZZ0A 4Q01A 2G83A 1XD9A 2GAOA 2MSCB 1LNZA 4EDHA 5BWMA 5JFGA 1XXHE 4OI4A 2AL7A 3EC2A 4QM6A 1FQJA 2IYXA 3KUDA 5CK4A 3EW9A 1DS6A 1T8UA 1NLZA 5TDHA 3BFVA 2O8FA 5EJEA 4CIDA 4V02A 2ODWA 5B30A 1U0JA 2RHDA 4PSAA 4EPWA 2QEQA 4NP6A 1SVIA 4XWAA 3U2QA 2XXAB 1T0HB 1G3RA 3LWNA 3TSOA 4HLUA 2RCNA 2KSQA 2GEDA 2UVQA 4LHWA 3AQ4A 2RHMA 4CEJB 4WIAA 2GNOA 3PVSA 1TUEA 3AF0A 4DDUA 1DADA 1MABA 3HYRA 4KAXA 1QHHA 1U98A 1T8TA 2QAGC 4IRUB 3W8RA 4AYWA 1NRJB 2QL6A 1U8ZA 1OH6A 1IXRC 1GL7A 4PHTA 1OPXA 2FFAA 1SXJB 2JLQA 2WSMA 2JLZA 1D9ZA 4A0HA 2I1QA 1G17A 2O8FB 1E2KA 2EWWA 3V4RA 3FDIA 1OFUX 1E6CA 1QVAA 3CX6A 4QGHA 2YWEA 4MGKR 1KGDA 5LBIA 1XF9A 2YZ2A 4M53A 2PCJA 4H1VA 3TAUA 3K0EA 4JIMA 3TRFA 4DVGA 4DDVA 221PA 1FFHA 2BBOA 2OBMA 2WHXA 5CYPA 5HPYB 1NVXQ 5B58C 2ZS7A 4JYBA 3IBGA 4I4LA 3UMSA 1COWD 4UJ5A 2ZEJA 3B1XA 3C41J 5P21A 4IOKA 4IEIA 3EA5A 1W46A 4UJ3A 3ZVNA 5FBQB 5KNCA 2GBLC 4QG7A 4XVUA 2J3EA 1NL3A 3SFVA 3ZVLA 2EWVA 4OK3A 3W5IA 1W0KD 3B8HA 3DOFA 5D3MB 2BBTA 2ZRMA 3B5JA 3Q3JB 4BRUA 1WF3A 4IVPA 3H86A 1JJVA 5AJWA 5DSZA 2J0VA 1YRBA 4JVNA 1G7TA 3O47A 5HR5A 3SE0A 2V4ZA 1NSFA 4GBMA 1G18A 3THOA 1LY1A 2F43A 1ZIPA 2EFCB 2XTMA 3OAAD 4OBEA 2C78A 3AVPA 1I4LD 1OT3A 1U99A 2JJ2A 2W6JA 4ITRC 4US2R 1G3MA 1ZC4A 3T1VA 5JCPA 1KI8A 3K9HA 3BH7A 1ZD8A 1AZSC 3TKLA 4HLQB 5JSZB 1HT1E 1MKYA 1ZM2A 3S1AB 3RRZA 3AKYA 3ND8A 3DMNA 3QE0A 5EE1A 5FL7D 3V00A 3U7GA 2AD5A 2WMOB 1KOFA 1XEFA 2QPTA 4M1WA 5E7MA 5FI0B 2X77A 4DB2A 5JWHA 5CM8B 4R2HA 3GJ4A 4S2EA 1SVKA 3WRXC 3VKWA 1S1MA 2FOLA 2ZRHA 4PFSA 5EP1A 3RANA 2ZJ8A 3W90A 1TEXA 5AK0A 3MUFA 1SGWA 2JCSA 1GFIA 3ADKA 3LAWA 3GEEA 3R8CA 3EPHA 2O8CA 2GBLA 1QG2A 2CXXA 3PENA 2NGRA 4D2IA 2ZUBA 4CYMA 4XTRA 1D9XA 3FHOA 4MYCA 3KXIA 3SS8A 4J0QA 2AK3A 4DHEA 1QF9A 2WJJA 2PJRA 1RW4A 2VP5A 1UBCA 4EPYA 5C46F 4OQLA 2PEZA 3FFBA 3AVWA 4BFTA 5KU1A 2D7DA 1DG3A 3Q7QA 1ZM4A 4Q7MB 5C2JB 3EPLA 4PHHA 2I4IA 4M9XA 3U3JA 4B48A 3V4FA 2B92A 1KZ7B 3UIEA 1FX0A 1E2PA 2QROA 4HLCA 1A2KC 3HJNA 4ZDKA 1CKEA 3OIWA 3SI7A 4TZ0A 2PH1A 3MRSA 4QHTA 4RJLA 5G3ZA 2FDCA 521PA 3ASYA 3PUWA 3X1WA 1Q1EA 4IVQA 4RD0A 4OQMA 3BFKA 2IS4A 4D0GA 2O8CB 1ZM7A 1U8AA 3NHAA 4TMWA 2XX3A 1Q12A 2ZRGA 4I1VA 3WP1B 2D2FA 1US8B 2BM1A 5DYGA 5J40A 1XMJA 1LB1B 2QA5A 3JVVA 4URZR 4BECA 2CL0X 4MGZR 4TQAA 4C30A 5LB4A 1X6VA 1E2FA 1VYTA 3LH5A 3AVQA 1G3QA 4D0LB 4WZBE 2QRZA 1QHGA 2F9LA 3NEJA 1E2DA 1T6NA 2Z5FA 2DY1A 4YDSA 4JBXA 2WICA 3O8CA 2FFHA 2YWGA 4XSHA 1XTSA 4M22A 1Q57A 3SOPA 3SU8A 2WIAA 3PQCA 3THYA 3ZQJA 1VHLA 4RCYA 3THYB 4AWXA 1IJFA 3OZXA 4EPVA 5F9HA 3QVUA 2BJVA 4TQ9A 1Z2AA 1RVDA 1P9WA 2REBA 3I3SR 3ZQ6A 4O2RA 2AD1A 4YMWA 1KI4A 2P2LA 3QKRB 5KSZA 2ORWA 1CLUA 3NH9A 1SXJD 4V03A 4F93B 3SBDA 2Q0HA 3L0PA 4L8GA 5ELXA 1EK0A 5CB8A 2F9MA 3BB4A 2ZSDA 3KJIA 1M7HA 4A6XA 3IO5A 4FCWA 1ZU5A 2PX3A 2RGDA 2AR7A 4QGFA 1IAQA 1II9A 4Y0AA 4A2PA 1IM2A 4W5WA 2IUTA 2CCKA 4LJ5A 3OF5A 3LFUA 2WOOA 3AVOA 2DFLA 2WJYA 1P60A 3T35A 1YZLA 1KDPA 2V55B 3ONWA 4BLSA 2HT6A 1R0ZA 1PUIA 5FFMA 3FFAA 2FSGA 2ZQ5A 4ZI3A 4QC2A 4NYIQ 5HKKA 3KB2A 4JSTA 1C1YA 1OB5A 2D2EA 1E9EA 4NHOA 5CLQA 3K0FB 2GJAA 1SULA 5GVSA 1UBEA 3D7MA 3MGCA 5KHOC 5KNDA 1OXXK 4B75A 4Q1BA 4DBLC 3SEAA 4IFEA 3DEFA 1XJ0A 3VU9B 4LJ8A 1OLOA 2F55A 1E2QA 1KKMA 2ORIA 3AVTA 2MMGA 5BW8A 4BLOA 4KYIB 3ZDQA 2FU5C 4P4TA 2Q9BA 5FPKA 1TPZA 2IUUA 4PQYA 4ZDWA 2GETA 1CR2A 2C5LA 3N5CA 2J0UA 121PA 4D6PA 5LPNA 1DPFA 3AUXA 1E9AA 4GOXA 4GNKA 2GF9A 3HWSA 1QHXA 3U3KA 4FMDB 1KKLA 3R9WA 5L3VA 4PAMA 4YC7A 5AJYA 3VKGA 1P2UA 4IDQA 4JLNA 2H17A 2OE2A 2GJKA 4JVSB 3C5CA 2O52A 2J41A 2IA5A 2PL3A 2FFQA 4F38A 2ECKA 3C8UA 5L3SB 4ESHA 4XH9B 5L3RA 3MAAC 3IQWA 3GPLA 2NMVA 1VG9B 5G40A 3TK1A 1TEVA 1WA5A 2FN4A 5DH9A 1GNPA 2VP0A 2ZI7A 3QXCA 3SHFA 2JJ1A 3KXLA 2GRJA 2XB4A 3BH0A 3ECCA 4AI6A 2XEXA 1B23P 4WXRA 1P7CA 2G1KA 5IT5A 3H1TA 2P5TB 3CW2A 2EFEB 2JLSA 1QHYA 6Q21A 4WW0A 1GNQA 2ZI9A 3Q5DA 4WBSA 5CB6A 5L8VA 4PTLA 4MDEA 2J0SA 2ZVPX 1AZTA 4YMUA 2I1VB 3E1SA 3GJ8A 4OJQA 1X86B 3O8DA 2CK3A 4MGYR 3R7WA 3AGQA 1F2TB 4IXMA 1D2EA 2IYWA 4CT4B 4ON9A 1OYYA 1WBDA 1KK2A 5JEEA 3CPEA 4U5XA 4P32A 1ZCBA 1II8A 1XZQA 3B82A 2CDNA 2QSZA 1Q3TA 4RZUA 5EE5B 1NVVR 1XEWX 3VFDA 3B78A 4PC2A 2QE7A 3LXRA 2XJ9A 3CH4B 3Q9LA 5E95A 3N70A 3RS7A 1KO8A 5C1BA 5GJBA 4E22A 4M1SA 2PJZA 4DIEA 4LJAA 2YINC 3QEOA 4UXJA 1YR8A 2FSIA 1ZNXA 2ZE6A 3U3MA 2G0NA 1BIFA 3KDSE 1E0JA 3RHFA 3OFND 1I4DD 4K46A 4EQ6B 2GCNA 1F2UA 4XVQA 4DSOA 1IN8A 1DAKA 3SYKA 3AF1A 3SYLA 2WOJA 4A0FA 2PLFA 3CPJB 4LK2A 4YLGA 3UMRA 3Q5EA 1HQYE 1ZNWA 4ZV4A 1VHTA 5KSPA 5SZIA 1TUIA 3EASA 3T15A 3T06B 1Z83A 3GP8A 1XMVA 1RJ9A 1R2QA 1M8PA 1X8LA 2V7QD 1J7KA 1K6MA 2GXUA 1I2MA 4TLDA 2VP4A 3A4MA 1YJ5A 4JYCA 2EFGA 1T5LA 1XXHB 2PZGA 1E9FA 2WIBA 4PANA 4WAUA 1VIAA 3U4QA 3RAPR 5FUYA 3WBKA 4MQBA 3X2SA 1NBMA 1OFHA 2CJWB 3OIYA 4KFUA 1SVLA 2ZRCA 1R8QA 5K8IA 1GRRA 2C2HA 4LJ6A 4S35A 1VECA 1PVOA 4P3YA 4TL9A 3BB3A 2QMHA 2PCLA 3CF6R 4FD2A 1CIPA 1JXOA 1RRPA 2AX4A 1T3LA 3QNUA 3DMDA 1R5BA 3U7FB 2AKYA 2YC2C 1Q3HA 4Q02A 2QMUA 2HYIC 1N25A 4U00A 2CVHA 4P4SA 5JJLA 2IYSA 4US1R 3ZYCA 3CF0A 1G5RA 1S4QA 1RC8A 2E9SA 3P4XA 2VHCA 2ZE8A 2ZJYA 5TV2A 4LGMA 2JAQA 2F43B 4F4JA 4HYYA 2OFOA 1XXHA 1P75A 4IDNA 4BFUA 2ZSEA 3IO3A 2ZJZA 5JRZA 1CTQA 4TMKA 2K5UA 3EZ6A 4HZIA 4G5QA 4V0KA 4ARZB 3LXXA 2ZSFA 1XD2A 2LKCA 2QAGA 3NH6A 4UQOA 1KZGB 3L0IB 2HXYA 1ONBA 3OEED 4MKFA 4Q9KA 4C9BA 4EKDA 3WRYC 1W0KA 1N6HA 2FF7A 2Q9AA 2B8TA 5JJKA 2H18A 1E3MA 4YXWD 2YWFA 1HT2E 4EQ6A 1GRQA 3NVAA 2RGEA 1YZKA 3BC1A 4A2QA 4FMBB 4LBYA 3ZS9A 4AKIA 4NYJR 1P2SA 3WYAA 3CNNA 2O0HA 4PZLA 1TMKA 3QBTA 2ERXA 1XDBA 2CLCX 2P0EA 2A78A 3KZ1E 3UATA 1ZUNB 3ADDA 2GZAA 1HTWA 1DAHA 2RKOA 4AD8A 1IN4A 2BCJQ 4Q1DA 4HB4A 1E9DA 3KQUA 2HT1A 5EXXA 1IONA 5JI2E 2ZRKA 4M0LA 4GFDA 4C0BA 1NJGA 1O3YA 4CEHA 2J7KA 1ZRHA 1OYWA 4K8OA 1II0A 4KVAA 4LV8B 1EESA 1XP8A 4ACBA 1W0JD 4Q7LA 2IF0A 1P73A 5CK5A 3TVTA 1OHHD 1G64A 2BEJA 3EARA 3IQXA 3MJRA 1KSHA 4JBYA 3VQTA 4JLBA 4X8OA 2B21A 1Z47A 2ZS9A 5CYOA 2FV8A 3CPHA 4DRZA 2D7CA 3QENA 3PEUA 1G6OA 4YXWA 4BZQA 3L8YA 3RWOA 2VBCA 4FINA 2KE5A 4I99A 4KXFB 4YMVA 5BN5A 1UFQA 2J45A 2MSEB 2A5FA 5AUNB 5E7IA 4TL7A 5KNBA 1XPRA 3A4LA 1C9KA 2QU8A 2GILA 4CEHB 2G3YA 1SVMA 4QNRA 3SDZA 3L43A 2D4HA 4AKEA 3BJIC 1Z0JA 1NMYA 3WBJA 1OE0A 5TB5A 1GZSA 3NWJA 2YOGA 1V5WA 1SZPA 4NPHA 2WAYA 4OI1A 1EFRA 1CR4A 1LF5A 4C7OB 3BXZA 2VHJA 2W0MA 3V9PA 1VCIA 2QGZA 1Z0FA 2QP4A 1NKSA 2V1XA 2R6AA 1Z28A 2BKEA 4F7WA 3I8XA 1Q1QA 4IVRA 4BUJA 2FFBA 1ZUIA 5FI1B 1N0VC 2ZM5A 4GI7A 4B73A 3K70B 2ZRJA 5EP2A 4DT1B 4Q9HA 5GADl 2VP2A 2HEIA 1CBUA 4NYMQ 1VTKA 1G7CA 4ILEA 2GXSA 3PXGA 2QT1A 1II8B 4LHVA 4AK9A 1KJYA 2LKDA 2RGNA 2RMKA 2BMJA 2ZS8A 3GLFA 1E94E 3RABA 3LBIA 2IYYA 1AQYA 1KNQA 2FSFA 2SHKA 3Q8XB 4DJTA 4HLDA 4Y0VA 4IW3B 1RRFA 4Q18A 3THWA 1OIWA 2ZRNA 2CE2X 1NIPA 2DWQA 4BLPA 1J70A 3A1WA 5HCNA 2G1JA 1N6OA 3IBYA 5K8TA 4GPTA 2F6RA 1G41A 2A7QA 2QZ4A 4Z51A 4IJMA 3CB4A 1GVNB 3B1YA 4RD4A 3AP3A 5M04A 2VP6A 1KAOA 5FBWB 1TQ4A 1ZNYA 2IF2A 2JDIA 2X19A 2J87A 1UADA 3B9QA 2CHVA 4G5OA 1XRJA 5DE3A 4ACAA 1VPLA 1N3BA 1TF2A 3KQHA 1Z8FA 1ZP6A 3NHBA 1BO6A 3DHWC 4AKGA 1L4UA 4E03A 3QKSA 1K5GA 1E2NA 2NO6A 2HF8A 2WKPA 5AUPB 1A82A 3PEVA 2XZPA 4LSGA 4QBHA 2ZRBA 1J90A 2ZR7A 3NC1C 2ZXUA 4QBGB 4LUCA 4XD7D 5JHGB 1M34E 4TMXA 2WKQA 3I5XA 3I5YA 4LYFA 3KL4A 2R8RA 1V43A 4IFBA 4HAYA 2ERYA 2FEMA 4KYUA 5CIQA 3VR3A 4C7OA 3EXAA 1XZPA 5FUWA 2V9PA 4G5SA 3PJRA 3W6OA 3THWB 1Z6XA 4HDOB 1T4GA 4RCZA 2Q6TA 4PC6A 2QAJA 4ZIRA 4KSCA 1H8HD 5KSOA 2AKAB 3I73A 4B3CA 4C0SA 1Q1BA 1CF4A 1Q20A 2CBZA 1AM4D 2AWOA 4L5BA 3N2IA 4AYTA 4KODA 4IOLA 2WV9A 3BBPA 4MUBA 3X1ZA 5L3QB 5JHHB 3DO6A 4A0GA 4FWTA 1FP7A 1PLLA 2QM7A 3K0AB 4UNPA 2WVJA 3AF3A 1RKBA 3GLGE 2WWHA 4IDPA 3IDQA 4B43A 2Q3FA 1ZW6A 2VIIA 4HEJA 3FYHA 5LDDC 1W1WA 5DIFA 3AP1A 4FXPA 5H68A 4BPBA 4CGZA 4ESVA 2J7PA 2O5VA 5E3HA 3QSYA 2OG2A 1R5NA 4EPXA 1F2TA 3GD7A 1VCOA 3IIKA 1DEKA 2I3BA 1KYIA 2Y8EA 4Z54A 3WHKA 2ZU0C 4LYAA 1SHZA 2O8BA 4RVCA 2QT0A 1UAAA 5JWOA 4ZIRB 5J5CA 4QJ5A 3QKUA 5SZKB 1KI6B 4B3XA 2WPDA 3W3AA 2IK8A 1EFCA 1EX7A 1Z0IA 3QXXA 1U8YA 3M1IA 3QKSB 4DDTA 3FMOB 3K0AA 3LY5A 1X1SA 4LPKA 1OHHA 2BMEA 2H1LA 2ODNA 5L3QA 2X1VA 1M7BA 1GL6A 5KYKA 1Z0DA 2OCAA 2HF9A 4Q9LA 3G0HA 1CJMA 5SZHB 2WWWA 3ZLJA 5DN6D 3AKDA 2DHRA 4JL6A 4GT1A 1UPTA 2VRWA 4W9MC 1YVDA 3BWDD 2J1LA 3L8ZA 3BD9A 1TU4A 4JMPA 4EFLA 2O8EB 5JSZA 1W44A 4PPFA 1Z6TA 2H92A 5CDFE 2OSBA 3ZIAA 2QY9A 2QSYA 4Q21A 2J7PD 4DLUA 3T12A 1N6LA 4OI2A 3RWMB 4AKHA 2J0UB 1G5PA 2DR3A 2G9NA 1GL9B 1JI0A 2FSHA 3I92A 3LBHA 4KLNA 4Q1FA 4TSFD 4A6PA 2DFKB 5KPJA 1CU1A 2IW3A 3SNHA 3IPYA 1G19A 2Z4SA 1NSTA 2MSDB 3VR5A 3H84A 4BZXA 2VLIA 2OFWA 4PO8A 4QJ3A 1HURA 5E4FA 2XOKD 3SR0A 3HDTA 1X1RA 3TVDA 4PHFA 4Q9IA 4HLUC 3TSZA 2GDJA 4JLOA 3VTKA 1CS4C 2FJUA 1VKJA 1XWIA 2F1HA 4IXNA 1SKQA 3L0SA 4CF7A 5G41A 2ZE7A 4LRWA 5TXGA 2BDTA 2AXPA 5FOTA 1MV5A 3ZD7A 1GSIA 2WJHA 1LV7A 4KFSA 5JRJA 4C3ZA 1M2OB 1XEWY 1E96A 4R71A 1S1CA 2FGKA 3SN6A 3KFVA 4DLXA 1AS3A 4B74A 3TQCA 2GHIA 2IHBA 2O0JA 2DB3A 1IY0A 3T34A 1I4TD 4DCSA 3K0FA 2EFHB 4TMTA 4V0OA 2ATXA 4MA4A 3ZIAD 4ERNA 2WJIA 1E2JA 1IY1A 3N2EA 1E2EA 3IHWA 5AWFC 2GAAA 2YJTD 2IHYA 2Q9CA 4MKHA 3A1UA 2ZRFA 4QOSA 4JLKA 2JIZD 1D6JA 1K5DA 5FL3A 3DKVA 4DLTA 1E79D 1JQLB 3EIHA 1IXZA 2WZQA 2IYVA 4II7A 5J4LA 4GL2A 3GCGA 2RGCA 4A4DA 1MH1A 1E2HA 1DAFA 2OUKA 2VF8A 1XB2A 3AV0B 5F98A 5JS7A 4IHQA 1G21E 2NOAA 4BZPA 1U81A 3OAAA 4XTCS 2BKUA 2QNRA 2R44A 5AUQA 1G8FA 2CCGA 2P5SA 4QNMA 5HCIA 1E4YA 4O2LA 3EC1A 3X1DA 1M74A 1AQUA 2C9YA 2HLDA 3AKCA 2H8KA 1DAIA 4BFVA 2IX3A 1GP2A 1JQJC 1UKZA 2JLRA 4NH0A 2X2EA 2BM0A 4L15A 4DXAA 1VIYA 3TNFA 1EX6A 1G8YA 4Q4HB 4A9AA 1U0LA 1KI3A 5IHPA 3I61A 3IHLA 3QKRA 1W2HA 4LWZA 5FL7A 4M2LA 3TGPA 4Q7JB 2J9RA 3VX4A 3WNBA 3UANA 4Z1MD 1CR1A 4RY2A 1KI6A 1Q44A 1SXJA 3EZFA 1CJTC 1XCGB 1E32A 2A5DA 1ZU4A 3IIJA 1VG8A 1XNJA 5FOWA 3IEVA 3I4LA 2L0XA 2NZ8A 2QPAA 1LVGA 2FNAA 4F4IA 3ZS8A 1R7RA 4Q19A 4M1MA 3QPVA 3I62A 1LW7A 2HDNB 1NBMD 3CX7A 3GLHB 1OXUA 3FOZA 3EPKA 1XTJA 1NLFA 3LDAA 2RB4A 1NN3A 1YR9A 4EFNA 1LTQA 4NCJA 8OHMA 3NXSA 3QG1A 1HEIA 1IHUA 2NQ2C 5KPDA 3KX2A 3T5GA 4XVRA 1W36D 1ANKA 2G6BA 3QPWA 4P31A 1KY3A 4Q66C 1W36C 2FZLA 4KFRA 4PO1A 3QKTA 5C18A 1KJWA 2D3WA 3C7KA 5EP3A 3WYFA 4D4MA 4M21A 2V8OA 2OFXA 3GJ0A 1DO2A 2C99A 4KV9A 3UWOA 3BH6A 2GWHA 3VR2A 1FTNA 3FWYA 1RPZA 1NJFA 3EG5A 3WHLA 4D82A 1E2GA 1OV4A 1OSNA 2ZI5A 4A15A 1JR6A 1KNXA 5KSYA 1NI3A 2GCPA 4RFVA 4JJZA 3SJCA 1KI7A 4KJZA 4C0HA 3ZGXA 2WTUA 4IOJA 1TQDA 5JMTA 1X8JA 1EGAA 2VP9A 1KO5A 1KDTA 3NIBA 1NVUQ 4AYXA 3WYGA 3AM1A 3GFTA 2OBNA 3OEEA 5FPTA 2Z4RA 4DC9A 1YE8A 1UJ2A 1J8YF 5B57C 2JJ8A 2QORA 1BYIA 5KUTA 4HAVA 1YZUA 1NY6A 3A58B 3EA0A 4HUQA 3X1YA 1WXQA 2GXAA 4DDWA 4HB2A 1EXMA 1W4CA 1Z08A 2R6GA 3I8SA 4EFMA 1QRAA 2FG5A 3HP1A 4A8JC 3IPXA 3KJHA 3EPJA 1R8SA 3GLIB 2REOA 1PV4A 1BH2A 1HYQA 1NKTA 1RE0A 2ZITA 3U7EB 3K70D 1TF7A 1FMLA 4DUGD 3M6AA 3A1VA 2C98A 5FBRB 1OIVA 5DGXA 3FMIA 5SZJA 2ZRIA 2FPMA 2F3RA 2WWIA 4DCUA 2QTFA 1GUAA 2Q21A 1KO1A 2J5XA 3ZH9B 2AHOA 5H70A 2IEZA 1ZM3A 3ETLA 1OXSC 4JLPA 4IDOA 3I72A 4C0JA 4ZCMA 1W48A 3I32A 4TL6A 3IILA 1AKYA 1ESMA 1J2JA 2R65A 4EJSB 2J46A 1UBGA 2ZJ5A 4PPGA 3W5JA 4TQUS 4RD2A 2VA8A 2ZROA 1NN5A 4BFZA 4B3DA 4BRWA 4DLWA 4OHYA 4D81A 2P6NA 2KB0A 3EZ9A 5EUMA 1DAMA 1RRGA 1JEEA 2JLUA 4HZUB 2IXFA 1IOZA 1RYFA 1HH4A 2FE4A 2CNWA 1N0WA 4ZO4A 4FI3C 4X8LA 1GAJA 2F7SA 4OK5A 1NP6A 1JALA 4P4UA 3R9IA 4HUTA 3VU9A 4BGDA 4G0NA 2BIFA 4B6FA 2B6HA 3QPUA 2GCOA 1EFUA 2QE7D 2VEDA 4L9SA 3ZD6A 3I1FA 1QHIA 3IUYA 1AK2A 4FWIB 2XB2A 4URUR 2A5JA 4US0R 4IDHA 4PC3A 5FBLB 3DZDA 2F1IA 1ZAKA 1DARA 3KJEA 3AVXA 2QMOA 1ZINA 1U94A 2R6FA 4C0KA 3RSLA 1ODFA 1YR7A 4YONB 2X2FA 2CLDX 3P32A 3WNCA 3FHCB 1TADA 1WQ1R 4R9UC 2ZR0A 2IYUA 4HSEA 4B3BA 2PZFA 1A1VA 4OL0A 3B1ZA 3MWJA 1N5IA 2FX3A 2X8AA 4NMMA 3QY0A 2GJ9A 3RVBA 4P0TA 3NG1A 3TQFA 4D4KA 4MUAA 2CMKA 5AR1A 5FPHA 3F0TA 3QEJA 4LX0A 4RSGA 4ZKDA 3X1XA 1GM5A 4X8MA 4M9QA 1E98A 4GRAA 4MITA 2BBSA 4JT4A 4MRRA
chains in the Genus database with same CATH superfamily
2QXUA 1R12A 3ILVA 2AUMA 1KERA 3QMWA 2PGAA 3ELDA 4OP3A 4TYQA 1LRLA 1M2HA 1O94C 1W6RA 3L7LA 4HVAA 1RM5A 2J9XB 4P33A 2BF7A 1PG5A 5HF6A 1W2GA 3B6KA 4POAA 1PQ4A 4R81A 1FU7A 2H9AA 2X9NA 1CUGA 3DZ8A 4JS0A 4O25A 4UEOA 5F64A 3SY8A 4QO8A 1S8AA 3PFWO 2NZ2A 1XKLA 3DT8A 3MUNA 3RRMA 5IFKA 1M2VB 3UAZA 4EYOA 3KZCA 4MI9A 1Y7IA 5JIBA 1OJLA 1A95A 5BXQC 1BDIA 3O95A 2C7OA 4RD6A 2RGAA 5BQXA 2CK3D 1FDVA 1XAGA 3JSAA 4L2IA 5DVZA 4DMLA 3SC3A 1TZJA 2C0CA 4UXHA 5KX5B 1XTQA 2PX2A 2QVZX 3U40A 2OILA 1YULA 4HAIA 1DFHA 5IARA 4PLTA 3V4OA 3D5QA 3P0JA 4FDLA 3HA7A 3CXUA 4B2IA 3W6UA 2XF2A 4FIDA 4OTZA 4D4JA 3GX1A 3AUFA 3K6RA 3QUAA 1OFGA 1QOZA 1JPUA 2OM2A 3SIPA 4D9CA 2F1KA 3HCCA 1UXGA 4DCOA 3OT5A 3QVKA 4NMWA 3L0YA 5KWVA 5KYVA 4H4CA 1AS2A 5K0FA 3F5QA 5T67A 4CCAA 2GYUA 1FRVA 5THXA 5KTYA 3QUSA 1XQXA 3PNLA 4O4JF 2B8WA 1ZVKA 3AZQA 5JCOA 1M10A 3CW8X 3HFJA 1YJXA 1SXJE 5JS2A 4NDNE 2ZETA 3WLKX 1YFLA 1A1SA 1XAJA 1GU7A 3NKVA 5CVDA 1JAIA 2Z5GA 1IZ8A 4KGZA 3HQ4O 4EYSA 2GM4A 5FX2A 3AOEC 5KX5F 3C14C 1LC0A 2YV4A 4TLEA 1Z5ZA 3FMPB 1GITA 1JDBB 3DDOA 1T34A 4E5UA 1KC1A 5ILGA 1WW8A 3ASZA 3H2BA 3IV6A 1RQGA 2XDWA 3ILXA 4X92A 2HQ1A 4UHEA 4PHGA 1YBVA 4I4TF 3JU3A 1ULZA 5AJXA 1YDFA 4CTJA 1JAHA 3DNFA 2GD6A 4AS3A 4FEYA 2OCLA 3PK0A 3MAGA 4LHYA 1VYUA 1E3JA 2ZBRA 2FPIA 1RAIA 2HIHA 2EJTA 2Y67A 5KTMA 4C4OA 3JR7A 2BTEA 4PO9A 2Z56A 3O9MA 1NRWA 2O19A 4PG8A 5EKTA 4P3OA 3SWWA 3HEMA 1TM3E 5J5AA 1SAYA 3W1VA 4CV2A 4X54A 3HLKA 3A3NA 4A3SA 1K9SA 1RBMA 1Y1LA 4OV6B 4V1CA 3ZNPA 3P1JA 4ZZ1A 1XEXB 3HGMA 2EZ4A 3PHIA 1NULA 1O6GA 4TTRA 2C3MA 4U5QA 5G0WA 2JL1A 4LMBA 1J8FA 4JQSA 5A9TA 1G98A 1KFKB 3L2OB 3PUIA 4YV2A 1DC4A 1USKA 2W0SA 5IC6A 2AEJA 4X3CA 2DJ5A 2R5NA 4DEVA 1KFBB 1UDWA 3QLUA 1FMJA 2H1SA 2V3CC 1FOEB 3LFHA 4TLLB 2OCKA 1TK9A 1Z62A 4R7ZA 2TMYA 2XRFA 4O2AF 3L7KA 5A3QA 1W4AA 3GLIA 1PUXA 4R7GA 3OP4A 3OPXA 4EW2A 2QMQA 2X7HA 1L5KA 3Q7PA 2RHHA 4YMGA 1IEXA 1P5FA 1QG6A 2YC4C 2EJUA 2QRGA 3IODA 3O4IA 3LT4A 4HQFA 2FZEA 1YA8A 4KBFA 4PRYA 4G0MA 1GTZA 4CL3A 1NI5A 2A94A 2BLLA 4KVZA 3WRYA 1FXWA 4LTDA 1WVMA 1W76A 3CR8A 1TX4B 5ALEA 4W1QA 2M9MA 4JBWA 3SBXA 2I6XA 1DKUA 2VTKA 4H7EA 3GD5A 3FOWA 2WRZA 4OJMX 5FR2A 4UHFA 1JX6A 4LQCA 4BO7A 1I7LA 2B98A 4FE7A 4JLSA 4MP8A 1ODSA 2F9FA 2VJNA 3NHMA 3SJBA 1NW4A 1W0JA 1DJPA 1XK6A 3KU4A 4JGBA 4ZEXA 3A1CA 5KYUA 3UAYA 4PYOA 3JQFA 4BX9A 2H4FA 2IPMA 2Y0CA 5HMLA 4CKXA 1N0UA 4WFKA 4B6SA 2VHTA 2G4VA 2QQ0A 3DVRX 4Y7CA 3UA4A 4YAIA 2YJ6A 3I9KA 4N5IX 4HUJA 4JI7B 3K4PA 3I9FA 4A1OA 3DDUA 4G1MB 2X9QA 2Q6KA 3FOBA 1H2FA 4NFSA 3A05A 3HPRA 1T9GR 2OZEA 1SB8A 3FUUA 3PVCA 1P62B 3F49S 3KYDA 1KSGA 1K1EA 5KTKA 1L9XA 2C7QA 4ZAGA 1WUHS 4B4UA 5NULA 4M98A 2B7CA 1KO7A 1P7WA 3HJAA 5G1PA 3DEZA 2BZ1A 4Z8XA 1TQ2A 3BCSA 3C3KA 2QXYA 4ZCPA 3REOA 5B4TA 4BXOB 3UJ6A 2A5GA 1XPUA 4R1TA 4DDHA 2PWBA 2ZAOA 4MLZA 5IN5A 2VPTA 3ZLTA 4RE5A 1U6IA 1H94A 2YFQA 4PCLA 5AKGA 2HGZA 3CFYA 4BZWA 2YYSA 3USCS 4FOSA 2O2HA 2ESRA 2BCEA 4UW9A 3AVYA 1UDAA 2EGHA 1LPOA 1UPAA 2C77A 3FY4A 1YMVA 1Z6ZA 4IX1A 3WHIA 1UOPA 3TFOA 1DDIA 4LJLA 4ZC8A 4BV9A 3NEPX 1KSFX 4B3MB 4KE9A 4FNAA 2ZR9A 2D0OB 4RK6A 1MABB 2SKDA 1MX5A 3ZCXA 1SXGA 3EFOB 1ENOA 1DQNA 2OV6A 3LC1O 1EP1B 5CYGA 4KQIA 5CHYA 1Z5NA 1ENPA 1V5EA 5A4FS 4JAVC 4R1OA 3L1IA 4EJMA 3CWZA 1CR6A 3UHFA 2JLVA 4FDMA 5K3EA 4JR2A 3R5TA 1T9HA 1GIAA 4LOIA 3SFTA 1PNRA 3WIEA 5JDCC 2ZBVA 4MW9A 3OZWA 1ZMRA 4B1FA 2UZ4A 1Y8QA 4BHTA 5CYFA 1IHYA 1W9MA 1D0IA 2FZKA 3WYDA 4UHHA 1M2JA 1C7RA 3HU2A 5CJ2A 1J25A 2JGJA 4EA9A 1J7JA 1NPDA 3PJGA 4BNTA 3Q9SA 5K8VA 2H2GA 5EXSA 2D2VA 3WIUA 4A23A 1PYDA 3I04A 2FJPA 4Y9DA 3R9XA 1MORA 1E9VA 3PUZA 4MQEB 3ROEA 2EU8A 2QVYX 3PR2B 4ESOA 3QLUC 2YR0A 4CZ2A 1YZGA 1Z22A 3LI2A 1EGMB 5DT9A 1P74A 5IAJA 3WK8A 3LY7A 1SVOA 3N7AA 2XBUA 3HPQA 3HY6A 3AHFA 4XWYA 3T3NA 2HSZA 1VJTA 2VDJA 1SUWA 2JW5A 3GEIA 3GNLA 3PD0A 3RS2A 3UTCA 3WJ1A 4TRMA 2ZXEA 5HP4A 2QBYA 1YL5A 5AI5A 2H1VA 5JCJD 3HB1A 5D8DA 4MV4A 3H1PA 3I6IA 4PLCA 1A9YA 2YOHA 3EZ2A 2Z0MA 4RZ3A 1FNBA 2FFJA 3ZE2B 4AIIA 3BCRA 4LBZA 4GSLA 4V0ME 2C2XA 3BIFA 2ZRPA 1ZO8A 3NHLA 1IULA 2JGIA 2WE8A 5L3ZA 4TM7A 4ALMA 4DV6B 4MVJH 1CB7A 1SA0B 3EAQA 1UWCA 1UF9A 1SCAA 4C22A 3QNWA 5ED0A 1NUTA 3ZOZA 1L7EA 2RKBA 4K26A 4AMUA 3L6CA 3C6BA 4MQFB 1KBZA 1QWSA 2BMDA 4ZAZA 4FGSA 3R40A 1AHNA 4QA9A 4JLJA 2CDCA 2V98A 1HDYA 3VSCA 2FP4A 4EECA 1EGVB 2FPPA 3DFFA 4PGMA 3FE2A 4R05A 1QTQA 3AJEA 4E5PA 1OXVA 3MGAA 3N8HA 4F71A 4GZLA 2HQSA 1QFJA 5KTPA 1L4BA 2V54A 4RLSA 3RRYA 4MX8A 3TDMA 3VVMA 4DQLA 4V0NA 4OA8A 3KKPA 2ZIGA 4GOND 4PAOA 3IUBA 4WE3A 2GCIA 5AICA 3G88A 1J99A 3MG9A 4HNUA 2PX4A 2VC2B 1KHHA 3CB2A 3N59A 4W9NC 3VU1A 4DIUA 2RARA 4NSNA 3KKOA 3A9SA 2ZIAA 1C1DA 1D2NA 3CRRA 2A3NA 4IQ4A 4MA0A 3EXFB 3UN1A 4B71A 3M82A 1HL3A 4LE1A 1E1LA 2ACKA 3WYCA 3C5HA 3COWA 4YR7A 5HUQA 3JQAA 3EPRA 2D3TA 3W6PA 2JGMA 3IFSA 4H1TA 4YUXA 1KAGA 1QHNA 1E5DA 1ZUHA 2PS3A 3DEYX 2FE1A 3LOUA 5HCUA 4JL5A 2QIPA 4AIRA 4AY2A 1ZRNA 2O2XA 4IUCS 3SXPA 1SXHA 5K8UA 2VYFA 3TUZC 2QD1A 3G7UA 3CVYA 3ACDA 3HYLA 5IYZB 3OIUA 2Q5EA 3GRPA 1OXKB 1S3SA 1QGOA 1Z7GA 2X3YA 4RHYA 1M5RA 2A9QA 3KQPA 3BD8A 2WSSA 1P9RA 1BE8A 4LXHA 4NENA 4Y6OA 3RYTC 1OF1A 4CQLA 1DAEA 3B20A 1BNCA 2JF0A 4OJKA 2DCMA 5EGSA 1NTRA 1OW3B 2HUNA 5IJZA 1UMBB 2JHAA 1DCFA 4LZNA 4N1AA 2Q28A 1WDKA 3GL9A 4GYWA 3WRVA 1PEKE 2QPOA 1EFVA 2WC1A 1EHIA 2HLHA 3HO6A 3P9SA 1ZNQO 3E8SA 5K2OA 4EHIA 4R9SA 1KWKA 3BIJA 4L5CA 2J32A 1VI2A 3GUYA 5JBQA 4LGVA 3DT9A 1WHSA 4E4TA 5EZ6B 3CEAA 5FOQA 4YB8A 3B2NA 3D4LA 4ZALA 5FFFA 2PL1A 4FN5A 3TBKA 4E51A 3IAS1 1KH3A 3AKEA 1JPVA 2A0UA 1YUNA 1LFDB 1QBKC 2M1XA 2QTVA 3D7NA 3KJZA 4NI5A 3DDCA 1V96A 5AW4A 5AJVB 3KAPA 3L7JA 1WSBA 2IOHA 4B44A 1Y5IA 2WDPA 1SK8A 2H54A 2Y3IA 1L3BA 3EDQA 5GJVC 1S89A 4RAOA 1QU2A 1IWPB 3IGFA 4MS4B 1GGMA 3AZPA 2A5YB 3HSSA 4A92A 5T4HA 4KFCA 1CJCA 3DMRA 3GA7A 3RYIA 4GQAA 1T26A 2WJGA 1YBFA 2ZLBA 4C20A 5AKJA 3KWMA 3H5LA 3HUUA 4HRVA 1WF6A 5C8VA 4TXLA 1RRVA 1HY3A 1HXHA 2W83A 1S3FA 3ZU6A 2ZTLA 2B99A 2A8YA 1FFDA 2Q3MA 3BB1A 4DWOA 5A0VA 3OESA 3CJRA 2QX8A 5FWAA 4CKEA 3G0IA 2GZDA 4ZVQA 4DLZA 2AT1A 3A2MA 4XFJA 1O5IA 2JIZA 4MRMA 4JR0A 1PCXA 1RZUA 3GJ7A 1CWUA 1Y4UA 3M6WA 4NV3A 1AKNA 3N76A 4QQKA 4ZDJA 3LPDA 5LQMA 4N41A 3FOCA 1VJ1A 2I2WA 4UPEA 4F85A 4UEQA 2NIPA 1SKAA 1QFXA 1SCUA 2CJWA 4QBFA 2R2GA 1HDOA 4IIVA 4UU8A 2PEYA 5AOBA 4DIFA 1X13A 1YQDA 1P9NA 2QAGB 4EATA 4D8XA 4J0GA 5C3MA 5FTLA 1X7YA 1WMBA 3TLAA 3NDBB 4G85A 1N6NA 3GRFA 3ZWWA 3G02A 1CR0A 2WBLC 4G01B 4PPNA 2ZJBA 3EZGA 3T3DA 1SUAA 1Y1SA 1F1BA 4FM9A 1EM8A 4Y2VA 1JZTA 3PDHA 4EYKA 3SF8A 1X3SA 1XTIA 4URWR 1IUPA 1YB6A 2BM8A 2YIDA 4G1CA 3T7JA 2P9ZA 3OLXA 3FNBA 4XWGA 1SHLA 4RIGA 1FXWF 2GZHA 2WT9A 3ACCA 1EDEA 2FPIB 2GBCA 1ECCA 1PI3A 3B6EA 1CP2A 4O3FA 4QARA 4YCLA 4B7ZA 2WUEA 1X1EA 4FYMA 4DCNA 4C3UA 1K3TA 1E9SA 1WZEA 1DZ3A 1ZH6A 2NX2A 4RUKA 3OA0A 5BQ3A 5CFLA 1KZHA 3IYLW 1IRIA 3QF4B 3TRJA 2I80A 1JT2A 4N7MA 4RSRA 1EQ2A 1Y7HA 2WZDA 1W59A 4S1OA 3KE8A 3RVQA 3OEWA 3EHEA 3EC7A 3MTIA 1XNGA 1G291 1RJDA 3K53A 1HE2A 2DT5A 4IYRA 5FD8A 1QDEA 1RWNA 2H9YA 3C87A 2C7PA 1Q19A 3GDGA 4DAEA 2DLDA 2VTBB 1E1RD 2YWJA 3L0ZA 2CLHB 5D6NA 4KVGA 2FUNB 2VK8A 1TAQA 2BFDA 1W1UA 3A0RB 3M0EA 4PFQA 4U2GA 4DPLA 2P1RA 3NTUA 3QYJA 1Q7CA 5CJPA 5DV9A 3MBIA 3CY6A 3NCHA 1J1IA 1RIIA 1XVLA 4RXUA 3AVVA 1JIJA 4M1EA 4PNZA 1M2FA 2H06A 2WWGA 2YV3A 3O26A 3QJYA 4Y18A 1Z5OA 1SCKA 2JGEA 3OQOA 1TL7C 3DWIA 3OFSA 4G4SO 2P3SA 4OHKA 1Y1TA 2ODAA 1FJ2A 2XB6A 3AY3A 1G3UA 3EMDA 4J91A 3RH0A 3UC9A 3VZCA 4DSZA 1JXQA 2MR5A 4O4LF 2XCRB 1NONA 2P2ZA 4QGAA 4XSGA 2ZGVA 4ZVLA 3ZY4A 2ZSIA 1VJCA 2IEIA 4O3MA 1H1LA 2E6UX 1U1DA 3KOZA 5K0JA 2PIDA 3GARA 3UGJA 3Q8LA 1X80B 4J0HA 4B31A 5JXHA 2VBGA 2JLYA 2OBBA 4KTVE 2VTBA 2NUTA 5B7NA 2WIJA 3C3YA 1FRFS 1AE1A 1BN6A 5ESRA 5JW6A 3FNQA 2P9JA 2HWYA 3H6KA 5D5HA 3AY7A 2VYND 2ICAA 3ME5A 5AVZA 3BCUA 2YJGA 2X7XA 1UOQA 2NWQA 2CL7X 3AFGA 4IG4A 1PDVA 2IIBA 1E2MA 2P6UA 2QP9X 2P2DA 2ZAMA 1X7DA 2W2MA 3ZHRA 4C0LA 3H2YA 3KYIB 4Q48A 4NYMR 1J5PA 2AFIE 3FMFA 4M1TA 1RQLA 5EE9A 1RBQA 3TLGB 3WGTA 4FP9A 2E4YA 2AOTB 2JDID 2J6IA 3KKNA 3L0BA 1AUQA 1H2ZA 3Q11A 4J3NA 4BV3A 1O03A 6YASA 4QNNA 4II3A 2KBEA 3OIVA 1ICIA 1KFJB 5J5VA 4X1YB 1Q11A 3ORFA 5LA6F 4NZZA 3WG9A 3UPUA 3HZOA 4U2CA 3H2HA 1A96A 3QEAZ 4E7PA 2IW1A 4Y2XA 4AZTA 3MLEA 1UKBA 4AL4A 1ZJ4A 3MMPA 4B17A 4R0NA 1JRLA 3JQQA 4JUDX 4DCGA 1E79A 1V6CA 4H35A 3D3QA 4HEHA 4S1WA 4WEQA 1IEQA 3GQBA 4R6XA 2PZEA 4UBJA 2I3DA 4AF6A 5I4IA 5K4GA 3TQQA 4ZAWA 1Z26A 3SQDA 2GKOA 4R01A 5AXCA 5BNFA 3ZJYA 2NYAA 1QGED 1ULHA 3P0HA 4PU0A 2RG1A 5IK2D 4KQJA 1GNLA 1PV2A 2FI1A 2WWFA 2ZIXA 4A8HA 4E5MA 1YT5A 1OAOC 2YY7A 4C5CA 4KZPA 1YKFA 3R3UA 2VDRB 4YT5A 2JFWA 4ME6A 3TE6A 1DBSA 5B55A 2CT8A 2O3SA 2FMIA 2OL4A 1E99A 3A70A 4QOGA 4Y6GB 2LW7A 2ZRDA 4OQNA 3C48A 4A26A 4CWAA 2J9FB 3GLHA 9ABPA 4JZYA 1F6BA 3NHFA 1XTKA 4JLAA 1RM3A 1UFRA 3TW8B 2Q3JA 3EFOA 3CZRA 3D6AA 4LC1A 2ZBUA 5E0OA 2VHQA 2PFKA 4J16A 1PL6A 2VAMA 3WLFA 1IQRA 2NU6B 4GEGA 3R20A 2Y92A 3I6BA 3DFKA 5DBIA 3ZZTA 1N6PA 4ZGBA 5LA6A 3ASVA 1FA9A 3O4GA 2HB6A 4JLVA 1N2ZA 4KO8A 1W96A 2PMDA 3BM5A 1IUOA 3E15A 2VPXA 3IUPA 3QWBA 4JVMA 1FNCA 2OHFA 4OYLA 8GPBA 2OT3B 1G8MA 4FMCF 4HNQA 4LF8B 1PZGA 5IJ0B 2PKEA 1GSAA 5K09A 3NHUA 2O8BB 3STYA 3NAGA 3M4YA 1NIJA 3JVIA 4JHLA 1LD3A 3TXYA 4PN3A 2DX7A 5AXAA 1XMSA 3GRCA 4GKJB 4BN0A 3L7NA 3IUEA 3CUTA 3BRQA 1E4OA 4HXYA 1PBNA 3NJ8A 4ZGGA 4N9WA 2NO0A 3HDQA 4YQZA 4D6XA 3GAMA 1WULS 4X64B 4CCWA 1XLWA 1JYFA 1T2DA 3T5TA 5LQKA 1F3OA 2AJTA 1ZD9A 2ZAYA 4GRIA 5EXPA 4YAGA 1XLUA 3GRAA 3LRPA 3OWOA 1FYVA 1VZ2A 1RI3A 3HGQA 4I50A 3ZGVA 5CDFA 5B7PA 1YZQA 2QOEA 2BEWB 3OOHA 4GYJA 4HZGA 1W34A 4PBSA 2W7TA 3UMGA 3I9JA 5LZ5A 1SVWA 5AVTA 3ZXUB 1RE1A 1YR6A 3EVDA 3IAFA 4C05A 5CITA 1O95C 1XTZA 1Y6JA 1H4VB 1HI9A 4L8FA 5CHEA 1PP4A 3C3CA 4DTIA 1HTBA 3WOHA 4S05A 2IC5A 1FW6A 3ABIA 4DEYA 1KXZA 1A8QA 3V32A 2P77A 1A69A 2J9GA 3FJOA 3UT5B 4LXGA 2AQKA 5CBPB 3RYCA 3JD1A 1N57A 3EIOA 5EC8A 1SCQA 1IXKA 2X4GA 3VR5D 4BATA 2GYYA 4UNQA 3DJFA 2NNLD 4R2WA 4J0KA 1WPXA 3E9NA 3SJAA 1H65A 1RBYA 2CUZA 3H16A 4Q03A 1IFXA 4ZEOA 3DF9A 3G9XA 3CF2A 1TAUA 1FLDA 3WB1A 2XLBA 4WXPA 5FUXA 2H9IA 3D6UA 2H4YA 3EIEA 3QYPA 2JZNA 3F9IA 2Y68A 4PZZA 2Z1DA 1Q1NA 1B2RA 1K08A 3M81A 4YBZA 3RR2A 4BQFA 3OQJA 4YQEA 3TZKA 2B4YA 2BF4A 3K32A 4MCHA 1L7VC 2HF2A 2IVFA 2QLBA 4UUAA 4E5NA 5B6PA 2P79A 1WD7A 1M2GA 1Z35A 5B3JA 3V8RA 4Z2AA 4IJVA 1UJNA 5U4XA 2UUAB 2W2QA 3EE6A 3KDAA 3L5KA 4WKPA 1XD2B 3U39A 1VBKA 3LIPA 1SVNA 2XUJA 3B1WA 4I7EA 1QO0D 4JUAA 5A0FA 4CQMB 1R6XA 3ZK8A 2H1HA 3GZTB 3TG8A 5DOVA 2GPBA 2ZUDA 3P9QA 3KXKA 1E9CA 4L4SA 1H4TA 3UK1A 3ONNA 2NG1A 3OE7A 4DMGA 2EQBA 3DH0A 3OOJA 1J5EB 3ZU5A 2P11A 3BGWA 3A37A 2XUKA 2GA9A 3HUDA 3R4CA 4PSUA 2G9RA 3TR5A 1ZM9A 4ZPXA 4R0MA 4XWOA 2R7AA 2QTVB 5B58T 1G5QA 3L05A 2OD2A 3UKOA 4RV4A 2PT5A 3H1BA 1JAZA 3NTOA 3K0BA 2FG7C 1AXEA 3QX3A 2XKAA 3QA3E 1NAHA 1P2VA 1GQOA 1NVMB 3DMFA 1CD5A 1MRNA 2ZPTX 4LYHA 4AF8A 1N36B 4JI0B 3QI2A 3IA2A 2WHPB 5A0TA 1A5TA 2ZE5A 1ILWA 1NC1A 3O8BA 3KLPX 4DKXA 2XNSA 3R7BA 1LLUA 2V7UA 4W5JA 3RYCB 1TLTA 1D5WA 3OEHA 2BJHA 2QRJA 2PZBA 1MC8A 3NT2A 3IL2A 1HO3A 1MW8X 5F77A 4D9KA 2NZJA 4JJGA 4RVUA 3NAMA 5DI3B 4CEIB 2Z8ZA 1Q91A 4M6WB 5DCWA 2R62A 3K1AB 4JJ6A 4QSHA 3WSTA 2C97A 5EEHA 1YFJA 3EWSA 3U4AA 4G0VA 4M8KA 3F67A 1IE3A 4MVJA 1XJCA 3OPYB 1BWPA 4LJYA 1DKRA 1P9OA 4CF6A 3IAM1 1A8HA 1MDFA 2BKLA 2W43A 3MJVA 2CUTA 4PYQA 3SZMA 4GLBA 4OQQA 1GUFA 3E9RA 4L16A 3G1TA 4HADA 4NJMA 4C29A 2QRMA 4Y2RA 2GB4A 2OCDA 2LCFA 3QBDA 2C54A 4LDPA 2ROQA 3EVEA 5HUJA 4X63A 3OE7D 1E2LA 2L42A 2P4SA 1LK7A 2WHEA 4Y2UA 1G20A 4IJQA 4QBKA 3G8DA 2FW1A 3KWJA 1M6VB 5SYAA 4RH1A 4DF3A 3K7EA 1M5TA 5ALRA 2WNIA 3VZPA 1H2YA 4XOIA 1GTL1 2HCBA 4MVWA 621PA 3GFGA 4LK3A 2V58A 1TUBB 4EGAA 2PLWA 1D2RA 3LUAA 1IN7A 2G1UA 4JU8A 3F7NA 2I7TA 4QHYA 5G0SA 1GFZA 5A4DA 2CLKB 1F06A 3ESZA 3QBJA 4UE2A 1Q3KA 4ZI2A 2YWHA 4GP9A 3B9RA 4BVAA 1MLDA 1QZZA 1N5MA 1KMIY 1PWYE 1YIOA 3D3NA 3E7XA 3HCEA 3NETA 1EK2A 3R3XA 1NM5C 4HWSA 4M1KA 4PGGA 3MJCA 4GOLD 4ZCSA 1M2VA 3W2IA 4DR2B 4WK6A 3G2OA 2NYRA 2ZJAA 4PYMA 4TT3A 5JLJA 4XI9A 1XU4A 4GP7A 4XIJA 4M8LA 3D59A 1XC7A 4OXKA 2GFQA 2RGBA 2WF8A 3R2JA 1LPSA 4XB2A 2DKNA 3OA2A 3RWBA 3GJ6A 3TUIC 2Y27A 5HKOA 4OI0A 3EFEA 1B6SA 3NRBA 2F3UA 4LWPA 4DCJA 4JQYA 3W77A 5EXDA 5IZCC 1E9BA 1KAHA 2G28A 2DKOA 3HR7A 2YFYA 4H2DA 1Q21A 1YOVB 4Z9YA 3ZHYA 1T3SA 5KVCA 2XCSB 3CVXA 1EUCA 4OPMA 1Z29A 2IXTA 2NZWA 2DGDA 2PGJA 3AQIA 3GFSA 1N5RA 2PLRA 3LY8A 3QVOA 4LVUA 1VKNA 5FO1A 4BY9E 4MDFA 1MNQA 1QGDA 3K1YA 1B1AA 1WUKS 3RTCA 1BDJA 1T1EA 2WJ6A 3UYKA 3VYRB 1GKKA 2C4MA 1I0ZA 1GGHA 1Y48E 2CDRA 3QXSA 4WLNA 4R41A 1O6CA 3DOUA 2O8DA 4HPXB 5BSWA 3WGVA 3AIMA 2AGVA 3FZGA 2AZMA 5KCMA 1FFXA 5EVJA 4BGUA 5F3WB 3LCRA 3HR4A 4DJ5X 4DB4A 4LXYA 1F5NA 3PFBA 4Z0HO 1PDOA 2QX6A 2R751 3G5UA 1G8PA 1R9NA 1Y63A 2C96A 3L0OA 4S1PA 1MFPA 1V37A 4GMHA 3NC0C 3ZTTA 3NBYC 3X3HA 1RMTA 3I45A 4TZKA 4V3BA 5GWXA 3RJMA 3WYEA 4DNOA 3H2ZA 1ECPA 3PG5A 3GQBB 2IXGA 5KC8A 5GZ6A 3K8ZA 1Z2NX 2ZIEA 1GCOA 3VPHA 4C07A 4DCTA 2H4JA 1W85B 5IJXA 3NGXA 4MQ6A 4F0JA 3NIDB 3Q7IA 1EK5A 2QYSA 4HWTA 3ZVMA 3HG7A 1HMYA 1T5BA 1XRMA 1UBJS 2GYWA 2HCFA 3DTNA 3IAXA 4H9GA 4QBIA 4DLYA 3D4PA 2QYOA 4ZT7A 3TI7A 4D5GA 5JSKA 2PBRA 1RYBA 2BP7A 2I7VA 3GHYA 3VR1A 4N5DA 4DREA 4B7CA 4H3KB 2ON6A 3RS4A 1JBKA 2V74B 1IQ0A 2V0NA 3ICPA 4PQFA 4UVIA 5JAOA 1PR0A 1C7IA 1AXRA 2IXDA 5JSUA 1Q2UA 2G9UA 3TLXA 3QUTA 2LXNA 1BE0A 4PS0A 3BXPA 1L5SA 4HY3A 1VKRA 5EMJA 5H02A 1BJTA 4A0QA 4B5LA 5JNVA 3GNSA 4DMUB 1V0JA 5DNCA 3MNFA 3GJQA 3C97A 1S3IA 5IF3A 1UP7A 5HFJA 3QFSA 3CZPA 2A30A 3DLBA 2ZI3A 2WMNB 3OOYA 3IRUA 4K6KA 4PGFA 3AHEA 3N2GA 4OCZA 3N6VA 1GG2A 4LY9A 2XMGA 4F3YA 4N5HX 3TLGA 1YCFA 1HKHA 5K3CA 4B7AA 4RZIA 5LP1A 1MJFA 1B3BA 1JLHA 4CDNA 2NTYC 3KQVA 2Q8QA 1FS6A 1ZJYA 1NLUA 2Y66A 5F12A 3HYNA 1JS1X 1BU8A 3STXA 4AZ0B 1ZJ6A 3PPVA 5KDLA 821PA 1EFLA 3O38A 3JQ6A 2OAQ1 4FW8A 4XEHA 2W2VA 3CIOA 1W47A 4W5QA 3A1EA 1WEKA 3HYCA 3D6HA 3HMKA 5FT9A 1J8MF 1W4BA 1ELOA 2Y0BA 3FRHA 4LZWA 1DOAA 1C0KA 4R16A 5JOQA 3O4RA 4MWDA 4MYHA 3DPSA 2XTAA 3PGJA 5JNUA 2HHJA 1CVRA 2A58A 4RVDA 1NP3A 2CYBA 3AEKA 3PHCA 1MOQA 4P8RA 2QP3A 4CU5A 4EPTA 4JP3A 2H2DA 4UHKA 3Q98A 4ZYUA 1WU8A 1OMOA 1X7WA 1WVIA 2WSBA 1IY2A 5EUCA 3ZW8A 1W87A 1J06A 1GGVA 2FEWB 2Q2WA 2ZTHA 1KVUA 2VKQA 4CF3A 1H8EA 5F3RA 3H13A 1E7YA 2C8VA 1NN0A 4XUGB 2R87A 1NU8A 2NSYA 3D7KA 1PNQA 1H69A 2D7JA 2R7NA 2YNMA 4P98A 1BJRE 3VHLB 1SUBA 1ZR2A 5JNLA 1M1YE 3NBUA 1PGOA 2NXCA 3KTFA 4E94A 4PLVA 2DULA 3NOQA 1CV2A 3TTTA 5J4HA 5A02A 3ORRA 4XGRA 2O4UX 2OV3A 2M6SA 3A6LA 1ZJJA 2WPDD 3EZ7A 1T9BA 3P20A 3LLCA 3QLVA 2R2AA 3GH3A 5LB2A 3T7KA 5IM4A 1X9IA 4D9MA 2I67A 3ISJA 3QVVA 4ENTA 4BNLA 5KOHA 4KL8S 4BNHA 4R1SA 1PG0A 4HH3C 2G83A 1XD9A 4YR9A 3GBPA 3BZBA 1NFQA 3BD6A 3BDIA 1T5HX 3R5JA 5JFGA 1ID8A 1ZKMA 4EB3A 3F7OA 2IYXA 3KUDA 1LQUA 2TECE 3ILHA 3NHJA 5BSMA 1FP2A 3GF4A 4IV0A 3IHKA 3DBOB 4Y8VA 3AI3A 3I8OA 3MLBA 1RXWA 4AFNA 4UM8B 2G72A 5TDHA 3ABRB 2O8FA 4ND8A 2UYCA 2X40A 4CIDA 1BMQA 3NOOA 2W2LD 3O9ZA 5K2MA 5B30A 1JG1A 3QW2A 3KCNA 1QVZA 1XR3A 1V7QA 1KYYA 1PZEA 2P91A 3L8FA 4HFJA 4O29A 5EJ2A 3UWPA 4KWHA 1YJ8A 3LWNA 3TSOA 3HY3A 3TJRA 2GEDA 4KQFA 3P0IA 3NKLA 2I4MA 2OO3A 2UVQA 3PWKA 4OQDA 4YNBA 4CEJB 2BEWA 2AR9A 2WWTA 3HCFA 1LK5A 4O4LB 2AFHA 1MABA 4IIJB 3GAFA 1QHHA 1T8TA 4AYWA 1A71A 3QE2A 1DXYA 4P80A 2CFCA 3QEMA 4C4ZA 1HNZB 1WEHA 4DS3A 5AM3A 1G38A 1U8ZA 3P7MA 1O97D 4EG1A 2JLZA 3I83A 4KRFA 4GD3Q 3BIWA 1R6VA 2O2EA 2I1QA 3OEYA 4C7JA 2W22A 3E35A 3KQMA 4D1YA 5I4CA 5JLAA 1H0SA 1BQ3A 3ANTA 5KSWB 2AMYA 2G1AA 3V4RA 1XKQA 3AR9A 3IRVA 5CLHA 5DTEA 4E12A 1QVAA 2X8WA 2VLBA 1RMYA 1NW8A 2CNKA 2HRBA 4GVPA 5E8JA 5LBIA 4CR8A 2FMTA 2J9YB 3MD9A 5FA8A 5C37A 2DERA 4KIJA 4Y30A 1MH9A 1SKMA 2AUTA 2BBOA 4N47A 4K6CA 3ZE7A 4KXXA 1MHPA 1MJNA 3M4ZA 3NYQA 4BB6A 2YW2A 1RPJA 2ZYDA 4PEVA 1ZD4A 5CAEA 4UJ5A 2H7YA 4ZPJA 2QTMA 2OHXA 2VATA 2D54A 3ESBA 5P21A 3PFHA 4RMHA 2NV2B 4L5IA 3GGPA 5K3FB 4CLRA 4IEIA 3EA5A 5EJ9A 4UJ3A 3I0NA 3ZVNA 2GBLC 4U7TB 1N7HA 4FZRA 3BJMA 4QG7A 4XVUA 2J3EA 1GQSA 4L2IB 4DYVA 2QUIA 4U7HA 4M37A 5H9WA 3B5JA 4ZQHA 1VRWA 4BRUA 5BQPA 4IVPA 4BBAA 2GFHA 4KBYA 4PQGA 3HJTA 1T9ZA 1JJVA 3H86A 4AKTA 2XDQA 3CUVA 1YBAA 3LPNA 3NLLA 5DSZA 2DP4E 3V9AA 4JVNA 2VH2A 1PZHA 3O47A 4LRYA 5BVGB 1EBUA 5DXFA 3ZDFA 1G18A 5CT8A 1LY1A 1ZD2P 4GPBA 5DHPA 4D43A 4OBEA 2A1TR 2O2GA 2HQBA 1D4FA 2QTAA 1I4LD 4WOKA 3D8HA 3RTGA 3M49A 2JJ2A 4ITRC 4PZCA 1G3MA 1CZLA 4RKWA 4US2R 1KI8A 1PZMA 3BH7A 3ESYA 2SBTA 3K9HA 2GRUA 3PTAA 3D3WB 4XRGA 1SCIA 5AK3A 4D4IA 2N3ZA 1TZMA 1OA0A 1ZY2A 1U3TA 3TQOA 1MW9X 1L7XA 3VNAA 3QVSA 5C52B 5A6SA 2ZWAA 1NQUA 3WBBA 1YDHA 3RRZA 1WW3A 1F3LA 3MUOA 5EE1A 5FL7D 3V00A 2AD5A 1H5UA 2WMYA 2IE8A 1L5GB 1KOFA 2DQ4A 3ETGA 2PA3A 5E7MA 4CXMA 4DB2A 1GLGA 5CM8B 1M0TA 4MQMA 1RT9A 5AW8A 3UMMA 2XMBA 1SVKA 3WRXC 5F78A 4I1YA 2P9TA 5EP1A 2ZRHA 4PFSA 4BKUA 2ZJ8A 3LX4A 5CB4F 3K1AA 3MUFA 2C2YA 1SGWA 3FWNA 1GFIA 2JD1A 4INOA 4RQBA 1A1VA 2C0PA 3DTVA 4GLOA 3VSEA 2GBLA 1JG2A 3EOBI 1ZMTA 3G2PA 3W6ZA 3WB9A 5HQTA 1Y8ZA 5EERA 1EIZA 4XJVA 1UUFA 2E37A 3S8MA 4PCUA 2ZUBA 4CYMA 3FOEC 3L1KA 1SG9A 3PNKA 1YFKA 4XTRA 3B1JA 2WKWA 3FHOA 5KS2A 4MYCA 3H9JA 3TMAA 4B4DA 3AI1A 4DHEA 1JGTA 2WJJA 2PUWA 2FJ0A 5ER9A 3AHGA 4BMDA 4P54A 2YDYA 5DYYA 3OKCA 4ZU6X 1J6UA 5C46F 3G59A 5ARCA 3A0UA 2QE6A 3FCAA 3ITNA 1DG3A 5BURA 5JPDA 4Z86A 1QUFA 1S01A 2J4FA 1TK3A 3QUCA 4PHHA 5C2JB 2I4IA 1YZFA 5MHTA 1ZH2A 3TD9A 2EHDA 2DBRA 1QLJA 3FB1A 3IP7A 4QPNA 4AULA 4BJ1A 5ICEA 1GCUA 1UBTS 1FX0A 4MV6A 4RFLA 3BGIA 3N8KA 2HW8A 1FDSA 4HLCA 1UDCA 3ZNOA 1Z6PA 1NVGA 1F0PA 3HJNA 5ADUS 4XJSA 4TZ0A 1V6SA 2FPRA 3FBGA 3TX6A 3MRSA 3FPBA 3L4JA 1HX7A 2JRLA 3TDKA 5C3UA 4E5SA 1P4AA 2YMMA 3UH0A 1Q1EA 1TRKA 5HGXA 4RD0A 5JH7F 4OQMA 1HLFA 2MSLA 4D0GA 3HJGA 1KOGA 4DUPA 3AR7A 3LPMA 2COEA 1EWTA 1NNLA 2X41A 2XX3A 4JBIA 5EQFA 4BQQA 3B6ZA 1V47A 4ZQEA 2QD2A 2WA1A 5DYGA 2QA5A 4URZR 1INLA 1PR5A 4TQAA 4C30A 3KSRA 2WUDA 3BXXA 4EGSA 1NP7A 1VYTA 3I28A 1WCYA 3EDRA 2MYPA 4MUMA 4R8SA 3GFFA 4IIUA 4D0LB 1H3EA 3C1TA 1FLAA 2JKZA 2Z5FA 4O6VA 2CNBA 1WXFA 3SMVA 1L8XA 2HK7A