2GA8A

Crystal structure of yfh7 from saccharomyces cerevisiae: a putative p-loop containing kinase with a circular permutation.
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
353
structure length
326
Chain Sequence
VDTHKLADDVLQLLDNRIEDNYRVCVILVGSPGSGKSTIAEELQIINEKYHTFLSEHPNVIEVNDRLKPMVNLVDSLKTLQPNKVAEMIENQGLFKDHVEDVNFQPVKYSAEETAVVARGGTANAIRIAADSINIAQIVPMDGFHLSRRCLDLFKDPQTAHKRRGSPSTFDSNNFLQLCKILAKTSLKVSTSSVFEKLSKTFSQTIPDIFVPGFNHALKDPTPDQYCISKFTRIVILEGLYLLYDQENWKKIYKTLADTGALLVYKIDIDYEATEERVAKRHLQSGLVTTIAEGREKFRSNDLLNGRDIDNHLIKVDNIVHIRNDH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Hypothetical 39.9 kDa protein
publication title Crystal structure and functional analysis identify the P-loop containing protein YFH7 of Saccharomyces cerevisiae as an ATP-dependent kinase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 109
structure length 326
sequence length 353
ec nomenclature
pdb deposition date 2006-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07728 AAA_5 AAA domain (dynein-related subfamily)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ga8A00
2FFQA 1L2TA 3PQCA 4RD1A 3U44A 3TAUA 1ZNYA 3LNCA 2GF9A 4JMPA 1M8PA 3I5XA 4GP6A 3ADCA 1RRGA 3OESA 5A4JA 2VSXA 2V6IA 3FMIA 1YE8A 4AYTA 2D3WA 4RJLA 5KTYA 4H9GA 1OHHA 5ELXA 1JR3D 2GZDA 3EPKA 1KK0A 2B8TA 4LYJA 1OIVA 1XDBA 1SXJB 2IXFA 1ZCAA 3B78A 4NCIA 1ONBA 4M8NE 4JYCA 4LI0A 3SFVA 5GJWC 4GOKA 3K0CA 5G3ZA 5BYJA 4BLOA 4MKFA 3CWZA 2C95A 1PUJA 2RCNA 1KO7A 2VO1A 5TARA 1Q0UA 3W6PA 2DHRA 3ZLJA 1NIPA 2PEYA 2VHCA 5HTKA 2PT5A 1Z6AA 3GLHB 1OYWA 4URVR 4CIDA 1DARA 1E6CA 1QHYA 4MGZR 1XBTA 1DAIA 4V0ME 2XXAB 1LF5A 1KY3A 1QG2A 2QGZA 3MWLA 2GZAA 2R6CA 2V4ZA 1IN6A 2QRZA 1M1YE 4IHQA 2NO7A 2QSZA 4M1OA 1Z28A 3VU9B 1SKYB 1G3IA 4B48A 1DVRA 1QHIA 2BMFA 3AVQA 2J0VA 1XPRA 5CK5A 2XX3A 1CJMA 1UM8A 2VP4A 4P33A 2QZ4A 3P20A 2AD1A 2KI5A 3TQFA 1Q1QA 1GNRA 2IS1A 1OXVA 5FOSA 4P31A 2B21A 1W1WA 1NJGA 5FR2A 4LJYA 4AURA 4LHYA 4Y0AA 4B3DA 3OEED 3A36A 2YC2C 3VNVA 3FGNA 1QHGA 3KB2A 3REFA 5JJLA 3Q5EA 3WMFA 1D9XA 1E1QA 1VG0B 1G3UA 4HLUA 1OPXA 3ADDA 1P2UA 1Q12A 2WKRA 2ODNA 5E4FA 1E9DA 1GDDA 3SQXA 2HT6A 1G4UR 2DBYA 2FPKA 5JJKA 1Z3IX 4B2PA 3AKCA 1MO6A 2QPTA 1RJ9A 2ZI6A 4DSNA 3R20A 4JVNA 4DLTA 3EX7C 4QJ5A 4TYWA 2P6NA 3WHKA 5FI0B 5E7IA 2OXCA 3H86A 4IKEA 3MJRA 4CVNA 3RDPA 2GAOA 1KZGB 3LRPA 2NG1A 4QG7A 3RVBA 4F4IA 5JZVA 4UJ3A 3O8BA 3B1WA 4IXNA 2FZ4A 4PTLA 3VR3A 4B6FA 2P0EA 2WWYA 4LOAA 3TMKA 3CNLA 2GA8A 4AG6A 1T3SA 1GNQA 4B6EA 2WWFA 4YMUA 4KVAA 5JRJA 2OUKA 1CF4A 4WXRA 1VHTA 2BM0A 3TW4A 3TW8B 5FI1B 1XTQA 4DXAA 2PCJA 1N6NA 1ETUA 2JJ1D 2ONKA 1G3RA 2AHOA 3LFUA 3FTQA 3PUYA 4MRRA 1A7JA 3BC1A 4B73A 1ESMA 2HCJB 3HU3A 3MWJA 1N5LA 2A5FA 4DEXA 4M1SA 3RANA 4XJXA 1XCGB 2JJ2A 3A4LA 2WWXA 4EFNA 4EDHA 5AJVB 3B1VA 3MUFA 1DEKA 1UF9A 1W48A 2FPMA 4HLDA 2AFHE 3K09A 3WNCA 4JLBA 4PZLA 5GADl 4HB2A 1JXMA 4NTZA 5DE3A 4LY6A 2AK2A 3X1WA 4WZBE 1E2FA 1Z47A 1XZQA 2ZYVX 3A1VA 4WBSA 2KE5A 5EUQB 3X2SA 3AV0B 4BZXA 2XNDA 3EZ6A 4PC1A 1JR3E 3KXLA 2PZEA 4XVRA 2IX3A 1GVNB 1E2EA 1TX4B 2ZE6A 4DLVA 1M7BA 4AKIA 3ASZA 4OHYA 1ZM2A 1F6BA 2VSOA 5FBVB 2B92A 2ZE7A 2P6RA 1N5IA 2CL7X 3ZD6A 2G0NA 1KO5A 5SZKB 4JIMA 4M1WA 3QF4A 1XEFA 2VBCA 5HCIA 1LFDB 1S8FA 3K1JA 4A0FA 2V7QD 4YLGA 1RYHA 3BH0A 1P6XA 2ZYUX 1AIPA 4RFSA 3PUZA 5B30A 1W5TA 1KO1A 1TL7C 3L82B 3AQ4A 1KK2A 1DOAA 2G0TA 1G17A 4M1KA 821PA 1XX6A 4M9SA 2V3CC 4WVFA 3LW8A 2ZRAA 2OLKA 1Z5ZA 2BMDA 1OKKD 4NMMA 1KDTA 2YZ2A 4Q1AA 3KXKA 4OQMA 3CH5A 3FMFA 3H1TA 3IKJA 3Q9LA 3CR7A 5EXXA 4E09A 1IHUA 3NDPA 2GDJA 2NO9A 4B71A 4ARZB 1E2LA 5TVKA 4BFZA 5IDVA 3HYRA 3RS3A 3TUZC 1XFAA 2YINC 4UKDA 4D4MA 4JSTA 3AM1A 4LC0A 2WJIA 1F2UB 1PLLA 4KYUA 5TY0A 1NJFA 1CTQA 2N46A 1F2TA 4A0RA 5EE5B 3D31A 2ZU0C 1I4DD 2ZR9A 2XEXA 3O47A 3LLMA 4Q21A 4A15A 2W0MA 2EWWA 1OIXA 2ZANA 3FMPB 5FPTA 3Q7QA 1CU1A 3P27A 1DBSA 2RGNA 4BZPA 1PUIA 4GT1A 5L3QA 4A6PA 4EIWA 2O8CA 1D5CA 3GJ3A 3E1SA 4LBZA 2IUUA 5AUQA 2IT1A 3RRMA 4C0KA 2IS4A 1ZBDA 2ZQ5A 5J4HA 2JDID 4MKGA 2R6DA 3TGPA 4QBHA 3QVUA 4CEIB 1IN5A 4G5OA 1RYFA 2ZROA 2B6HA 2VTKA 4Q4AB 3SJBA 3AF3A 3A4NA 1ZU5A 4DLRA 2FN4A 3EIQA 2NOAA 2ODWA 3B60A 2IWHA 4CGZA 1W0JA 2G6BA 1M74A 2WWIA 1WB9A 1DO2A 1KSGA 3JZMA 1UKZA 1A2KC 4U00A 2EQBA 4B3BA 3B85A 3M6AA 4XTRA 2CHGA 2UZ3A 3EWAA 1NN1A 4FCVA 5FOVA 1S3SA 4EPVA 3OFND 1VCIA 3KZ1E 4YDSA 3EPHA 1XJ0A 4R2IA 4KSCA 3QEOA 2QRNA 2IYUA 2ZI3A 1P60A 1ZAKA 1B0UA 1VYUA 2MSCB 3UK6A 1P72A 1NL3A 1R0WA 4Z8YA 5KNBA 1A1VA 2WSSA 3R8FA 2OESA 2BBSA 2R62A 4I1SA 4MDEA 1XTRA 2YWGA 1P2VA 4G0NA 5G53C 1WP9A 4YMTA 5JBQA 2ATXA 1YHNA 1CP2A 3P4XA 1QF9A 4MGKR 5L8VA 1GITA 4Q4JB 1T6NA 1RRFA 2FGJA 2QSYA 4DVGA 5JI2E 3WRXC 5BYKA 1UBFA 1E2GA 1KKLA 1T3LA 1PLKA 2W2TA 3SU8A 2BJWA 2ERYA 3LWNA 1FNMA 3QBTA 3Q85A 4FMDB 3UMSA 2GAAA 1EXMA 4HAUA 1IM2A 2ODBA 4C4PA 2F1RA 1W4CA 3K9NA 4RFVA 1EWRA 1OFTA 4LV6A 1UBGA 4TZ0A 5M04A 1SXJA 1OLOA 3LBHA 4TT3A 4AKGA 5HE9A 2OE2A 4L9WA 5C46F 1G8HA 2IF0A 1FUUA 3SBDA 4HLQB 1GL7A 1YVDA 4PC7A 5FUVA 1I2MA 1GL9B 3X1XA 1KI7A 2IS2A 4I1OA 3JZAA 1C1YA 3CRQA 2VL7A 4Q7JB 4MQBA 1QHHB 1Z0IA 4DLSA 4EJSC 1OXSC 1FMLA 1WDTA 2ZUDA 1FNNA 4JLDA 3NH6A 1XJCA 1HURA 2ZUBA 1SVSA 4JL5A 3U3OA 2RB4A 1OJLA 3LXRA 2ERXA 3W90A 4B75A 2XXAA 4GBMA 1E4YA 4P4SB 1YJ5A 1G64A 5DH9A 2FZLA 2IL1A 4D0LB 1R5BA 4DEYA 4B33A 2BCJQ 4Q1DA 3VU9A 3DMDA 1GSIA 2BJVA 4BLTA 2ORVA 2RAPA 4QNMA 1AJEA 2H5EA 3QXCA 1H8HA 4UNRA 4F93B 2QL6A 3SJCA 5K8TA 1EWQA 3WY9A 1CRPA 4IVQA 2N1BA 1F60A 3QKSB 4FXPA 2YC4C 4DKXA 4Q48A 5AK0A 2D4HA 4Z51A 2JCSA 3CZQA 1R2QA 1KI4A 1IXSB 3KKOA 5J4KA 5CB6A 2QG6A 2PL3A 2GESA 5CB8A 4MITA 2QE7D 3U60B 4BFWA 1JJ7A 2X1VA 1KI1A 4URWR 1NI3A 4UXJA 1L8QA 2DFKB 3EIEA 4QBIA 4B34A 3KL4A 3IO5A 4U02A 5EQTA 2HJVA 2A5DA 4RD6A 1OF1A 1A4RA 2XOKD 3SC3A 3T15A 5EZ6B 2G1JA 3DPUA 4OHWA 5H1YA 1ZJ6A 2OCPA 3SBEA 1II8B 3U6BA 1E9EA 1K6MA 2WV9A 3LQQA 1X8LA 4C30A 1Z2CA 2J7PA 4BECA 3K0FA 3RS4A 1SZPA 3DKVA 3NTUA 2XTMA 2OEPA 2QT0A 3DZDA 5DISB 1LTQA 4UNSA 4CW7A 2OBMA 2WJJA 3BK7A 1J8YF 4KFUA 2CCGA 2ONJA 1IJFA 1S9DA 1N5JA 4HAZA 5FUXA 1GAJA 1T8TA 3MWKA 5FPKA 4ZKEA 2ZVQX 2V55B 2P5TB 3BORA 4JLNA 3Q5DA 4O2LA 1E0AA 4AKHA 2HLDA 3M0EA 4D2IA 3DM5A 1Q1BA 2W83A 1PZNA 3W8RA 1SHZA 2GKSA 2N42A 1R10A 1Z0FA 2V54A 5P21A 3SNHA 1P3JA 5L3VA 1E9FA 2CEAA 2ZTSA 3PUVA 4MKHA 4PAMA 4UNNA 2ZSAA 1E79D 1IY1A 4FIDA 4HUQB 1H8EA 1W2HA 1AQUA 1M7HA 5HR5A 2PCLA 2VPPA 3EASA 4LJ7A 3B82A 3VR4A 4YXWD 1W2GA 1JEDA 4QBFA 3RC3A 4XVUA 2GEUA 1QBKC 2CJWA 2RGBA 4IXMA 4XH9B 4DDWA 2ZJBA 5LDDC 1JNYA 2VSFA 2YV5A 1IOZA 4TMWA 2OAQ1 4A1FA 2CLCX 3TQCA 1G5PA 4ACBA 1LNZA 4OI4A 4IEIA 3T61A 3NEYA 2HV8A 3MSXA 3NXSA 2HUPA 2D2FA 5CIQA 3SYNA 3QG5A 1FOEB 2V1XA 4IOMA 4KFRA 4A9AA 4LJAA 3BIFA 2C77A 3SHWA 2FSHA 4D4LA 4DRZA 2VHTA 1OH6A 1JPJA 4XD7D 5KYKA 3FE2A 2ZRFA 2XITA 2IF2A 2GK7A 5HKKD 1TTTA 2ZYTX 4N3NA 5FTKA 2GXSA 2BC9A 5EXPA 2QMOA 1LS1A 3CF2A 2O8FA 2QMHA 4CEHB 3AVOA 1DPFA 2ZRDA 4BFXA 5FH9A 1FX0B 2MMCA 1P2SA 1VG1A 4BRWA 1NVUQ 3AKYA 3AF0A 5JHGB 4NYJQ 1OHHD 1G18A 3ZJYA 2BBTA 2CHVA 3P32A 4KU4A 5CDFE 1T91A 3R9XA 3PEWA 2ZRKA 1KJYA 1OT3A 5DIFA 1VCNA 4ARZA 8OHMA 2OV2A 2NPFA 1Q44A 4B47A 4Q5IA 1NSTA 2VF7A 4X8HA 4BFUA 1KK1A 2J9RA 3QVVA 4Q03A 4ZDKA 1IONA 3HWSA 2C5LA 2ZS8A 1X1SA 4H1VA 1E2PA 3BOSA 5DYIA 4JLOA 5CJPA 2DCUA 1T4GA 2IYVA 1T0JB 1XNJA 4HI0E 3SDZA 1QZXA 2PEZA 2VP6A 4PQYA 3PXGA 3ASYA 1FP6A 5DI3A 1CS4C 4LPSA 2O5VA 1M7GA 1KYIA 1OSNA 1NNEA 4FCTA 4BUJA 3BBPA 2RKOA 4GMXA 2A7QA 2C2HA 2FEMA 3LBIA 1OFIA 2BMJA 2IXGA 3PEVA 3WMEA 1XF9A 4LGMA 121PA 3RRYA 4HAXA 2NO0A 3BE4A 1JXOA 4MUBA 2VYFA 3KXIA 3IHWA 4MA4A 4A8JB 4NYIQ 3TR5A 1GIAA 4RKEA 4CF7A 4TMKA 3R7WB 2VP0A 4MYCA 3SJAA 3AVPA 4A4DA 4B3XA 1BYIA 1II0A 1DAGA 4FD2A 4HZUB 1ZP6A 5KO2A 2HDNB 1RC8A 4PSAA 2BMEA 4OHXA 5EUMA 3I73A 4DSOA 3U4QB 5LPNA 2GF0A 4YDHB 3ZZTA 2G3YA 2PJRA 2D2EA 4M9QA 1AQYA 4Q9JA 1ZYUA 3ADKA 4XVQA 4DLYA 1E1QD 3ICEA 2FDCA 4G01B 5H8WA 2QQEA 2AK3A 4C0AC 5KDLA 5DGXA 3QKUA 2ZAOA 1P9RA 2ANCA 3GLFA 1OFUX 2GZHA 3PFIA 2CNWA 1R8QA 1G7RA 2AXNA 5BN3A 1ZM9A 1IY0A 1EFTA 2WMOB 4URUR 5BQ5A 2CXXA 1J90A 3D8BA 3QIAA 4DSTA 1E1RD 3T1OA 1MT0A 3UG6A 5KDDA 4A36A 1Z83A 3HU2A 4Q4JA 1N0WA 2BBWA 1Z0JA 2IYZA 2BWJA 4L5BA 2PZFA 1JAHA 2ZJYA 1TADA 3GQBA 2E87A 3L0PA 3OHMA 1XXHB 2ZJ2A 3SJZA 4KVGA 5FPSA 3THYB 1FPMA 4PHGA 3TVTA 2F1JA 3CPEA 4XTCS 2FEOA 2VLIA 4P3YA 4E22A 5FBRB 4P32A 5TDHA 4NYJR 3TKLA 3CNOA 1GKYA 3TRFA 4DZZA 5IHPA 4M1TA 1CXZA 3MGCA 4AG5A 4W5WA 2BDTA 4Q9HA 1GTVA 2RGGA 1KIMA 2CDNA 3EPJA 3EWSA 3QXXA 1DE0A 5SZJA 1QHHA 1XMIA 1YR7A 4TQ9A 3Q7PA 1A2BA 5E7JA 1R7RA 5H68A 2WBLC 2JJ2D 3TIFA 3KUDA 4R7ZA 4C0QC 4IDHA 3PCRB 3L0OA 4G1UC 1R4AA 3IIMA 1XEXB 3LD9A 2FU5C 4MUAA 5EP1A 1S3GA 1JJVA 2HF8A 1YZUA 4TMTA 3ZVNA 1GOTA 2XNDD 4P4SA 2VRWA 3CBQA 3CX7A 1IN4A 2GJKA 2H8KA 3KX2A 4FINA 3W34A 3B8HA 4JLAA 3THXA 1S2MA 4M9XA 1E99A 3TSWA 1QVAA 1L7VC 3EZ9A 3SEAA 3LXXA 1WF3A 4V0KA 3I92A 4L15A 4NYIR 2GBLC 1E98A 4M1MA 1KK3A 4JVSB 4PPGA 4PPFA 5J47A 3OEHD 1G6OA 3QKSA 1P9WA 3IO3A 4DUGA 2QP4A 2HYIC 1E32A 2QUZA 4M9ZA 3WBKA 1TNDA 3N2IA 2VP2A 2AN9A 3HPRA 2QBYB 2REOA 2ZRGA 3IEUA 3NHAA 4KSBA 2H16A 1Q22A 5H70A 2P67A 3BFXA 2GJ9A 1Q3HA 2ZRPA 3CIOA 2CCKA 4NDZA 4F4CA 1P61B 3FHCB 1W4BA 3K70D 2W2VA 3H4MA 1NKTA 5KPJA 4C0BA 1TMKA 1VG9B 1NRJB 4FCWA 5JFGA 1G8GA 2XSZA 2AXPA 5FL3A 3G0HA 2WICA 2NO1A 1I4LD 2IBMA 1GRQA 1VCMA 4MGIR 1T5LA 3A8TA 1MABB 4Y0VA 3AH8A 4NKRA 3X1YA 2KBFA 3H2YA 5D3MB 3KKPA 5EXTA 4Q1FA 4KITB 4QFMA 3Q3JB 4V0LA 4A0HA 3SI7A 1MO5A 1YRAA 2CLDX 5KOYA 1ZNWA 4Q7KA 5HPYB 2FFHA 5FUWA 5TV2A 4ILEA 1X3SA 3IGFA 2GTPA 1HYQA 2WSMA 4MRPA 3T1TA 4C0HA 4MYHA 4DJTA 1LY1A 3ONWA 3UIEA 5G3YA 3GJ4A 2J41A 3ND8A 4LUCA 4BPBA 4XWAA 5FTNA 1CR4A 3SE0A 4NPHA 4KHZA 4ZI2A 3L8ZA 3MFYA 3ZD7A 1CEEA 3KJGA 4FN5A 2ZJZA 3EG5A 4XSHA 3W5JA 1RRPA 1GILA 3MJHA 4BFVA 3SN6A 3AKEA 4DT1B 3SQWA 3U7FB 3I3SR 1FFHA 4JJKA 4CEJB 1W0JD 4HUQA 3TNFA 1QG4A 4Q4LA 5JS8A 4PC6A 3RYTC 3C4JA 3I1FA 1XWIA 4JBYA 1HTWA 4RD0A 4KXFB 3AVTA 1VIAA 1U8ZA 2GEDA 4TMVA 4Q01A 2WMNB 1ZUNB 4DLZA 1MKYA 2FPLA 1S9HA 2EFEB 3FYHA 5GVSA 3CWQA 2QMEA 1BYUA 2ECKA 3OAAA 1SVIA 4QGFA 4B43A 3I61A 1E9CA 3EARA 1H65A 2G88A 3AVVA 3K0AA 4GOXA 1DELA 1DAHA 3W8NA 2ZEJA 2Z0MA 3A1TA 2WSSD 1AS2A 1C4OA 1S96A 1XD9A 2DWQA 4LX0A 4AC9A 4NZYA 4ZCMA 1HA3A 1VPLA 3I5YA 1W46A 2KJQA 1U98A 5CM9C 3VR1A 3B1YA 1TUEA 2GK6A 2P65A 3PENA 1P73A 2FV8A 5J5CA 4QM6A 4EQ6A 4CEHA 4WA7A 4URYR 2OXRA 3PITA 3WYAA 5F9FA 4UJ5A 2H57A 5B58C 1P9NA 2C78A 2F43B 4BLRA 5CYPA 1R0YA 3OIYA 3RSLA 1QHXA 3GMTA 1YQTA 2FNAA 4GMDA 5JRZA 1RKBA 2CVHA 1ZVQA 4TT3D 5DHFA 1AZSC 3QNUA 4A2PA 3W9YA 3OIVA 2YJTD 1V5WA 2MSDB 1MH1A 1N6LA 1XRJA 4JT2A 1GP2A 3T34A 1P4SA 3EIHA 4XWKA 4QM7A 3CF6R 4ASUA 3B2EA 2QMUA 3IIKA 2WJHA 2ZXUA 3QI2A 1AGRA 2OFWA 1TQ6A 4FMDF 5IT5A 2ZR0A 2JJ8A 4X8OA 2I1QA 2YWHA 2FF7A 4CT4B 1G21E 3GFPA 4B2IA 4JBXA 2FOLA 5TXGA 5J4VA 1CKEA 4MKIA 1KJZA 1OFHA 5FBQB 4D0GA 1A5TA 1N6OA 1R6BX 5ANRB 1VHLA 4DCNA 2FA9A 2RHMA 2ZRLA 3IIJA 1JR3A 1RE0A 1E9SA 2GCNA 5JWRA 3QKRA 3AGQA 4JYBA 3A1SA 3UWOA 1ANKA 2FFBA 5FOXA 1X86B 4EJSA 1VYTA 4PQRA 1H8HD 3A6PC 1Z0DA 1E3MA 2GCOB 1OXXK 4LBWA 3WHLA 1EESA 4TL9A 2FH5B 1CRQA 2F9MA 5KHOC 4JLKA 2Z5FA 5IK2A 1DAFA 3NC1C 3GEHA 4HZUA 4KCGA 3K0EA 4H1UA 5DLQC 3VMFA 2JLYA 1PV4A 1JB1A 4MYTA 3RS5A 1XD2B 4UNPA 2DWPA 2J0UB 4PFSA 3F3YA 4RZUA 3U4QA 3LX8A 3GEEA 3E5HA 3PIRA 5KSPA 4YMVA 4JSYA 3IPYA 3GLIA 5AJZA 1KI8A 3WRYC 5FL7A 4XWOA 1F3OA 2IYQA 4PHHA 3NHBA 1E2JA 1RIFA 1Q21A 221PA 4QJ3A 3SS8A 4DHEA 5KUTA 1MR3F 2Q6TA 4BEJA 2AR7A 1DG3A 1T9HA 4M53A 4AWXA 4BZQA 1Q1ZA 4X8MA 4DSUA 3LDAA 4GNKA 2JLXA 4E03A 3QENA 4KODA 4EAQA 2HEIA 1D2MA 2CMKA 2W6IA 1TU4A 1UKVY 2J7PD 4Q1EA 5KU1A 4YC7A 3AP2A 1G4AE 4V0OA 1UJ2A 2QM7A 4PPQA 2W2XA 3P26A 3KFVA 3CZPA 2W0SA 4B35A 2IW3A 1ZIPA 4UNQA 4NONA 2H7VA 2C8VA 4IFEA 4LHWA 2IWRA 3ZH9B 2D7CA 3AP1A 3GJ0A 2ZS9A 4Q19A 2QU8A 1XXHA 1XMSA 2WWWA 3THYA 2EW1A 2QTFA 3FDIA 2J87A 4DLWA 5JSZB 2R6GA 4K46A 5SZIA 4TSFD 3IEVA 1CJTC 2MMGA 1D6JA 4JBWA 4NCJA 4OK3A 5FPHA 3QJYA 5EE3A 1TF2A 2IYXA 4HSEA 4NU0A 3GD7A 4RZXA 2ORWA 3MRSA 3RS7A 1WCV1 3B6EA 2O8BB 1SVWA 1H8ED 1UFQA 1EX7A 5G41A 1CR0A 1U9IA 1MOZA 2UZIR 1OV4A 4LZZA 5KSZA 1GRNA 2SHKA 5TMPA 3THWB 1XEXA 4IJMA 4Q00A 2IA5A 4BLQA 4Q9KA 2ZE8A 4F38A 1OH8A 3NBFA 1DADA 3TBKA 4JVLA 2D06A 4ZI3A 1G7SA 2Q9BA 3WP0A 4PC2A 1W36D 3DOEA 2FFAA 3GFTA 3D6TB 5J40A 1ZW6A 2IYRA 2Z6VA 3B13B 2BOVA 4I1VA 2OG2A 4HAYA 4JL8A 5JECA 4M2LA 1E0JA 2F6RA 3E2IA 3QPUA 4DDTA 2GVZC 3UKDA 1G19A 4FMCB 2NZ8A 3I32A 5K8IA 4PAQA 4TL7A 4A8JC 3K0SA 1BH2A 3F5FA 4PPNA 3AF1A 1WBDA 1CJVC 2FSGA 3DZ8A 4U5XA 5BN4A 2DWOA 3U7HB 2YOGA 3R9WA 3L8YA 4IDNA 4OI0A 3WYGA 1CJKC 4OQNA 5CLLA 4JT4A 4KYIB 1ZM4A 1ZC3A 2RH5A 1TEVA 4QGGA 4OQLA 2FGKA 3O8CA 4D0NA 3GEIA 4ABYA 3DMNA 3GLHA 3NWJA 3PJRA 3IUYA 1N0VC 2CBZA 2WPDA 4HLCA 2FSFA 1AN0A 3HDTA 4TYPA 5KSOA 5KPDA 4DLXA 4QC2A 2WOJA 1UKYA 1BMFD 1FP7A 1NP6A 2QORA 4PSKA 4ZIRB 5JS7A 1U0LA 2GEVA 2GETA 2GNOA 3ADBA 4ACAA 2R65A 3B1XA 4OQFA 3LVQE 2EU8A 1OB5A 3S1AB 2O0HA 3CPJB 4DB4A 2A3RA 1W7AA 1MABA 1T5IA 4TTRA 5F3WB 5D3MA 1T0HB 3ICQB 1U8AA 3BB4A 5KSYA 2OCYC 3UATA 1JPNA 1Z0KA 2V8OA 4O3MA 4C7OB 2YYZA 4XIGS 2KSQA 1ZC4A 2BKUA 5B57C 5DNYB 3K8YA 1Z6TA 2V6JA 1N6HA 2J5XA 3DHWC 5IRCD 4URXR 1X8KA 2XB2A 5JHHB 4Q4HB 2XJ9A 5DYGA 3QXHA 3C7KA 3WP1B 2ZYWX 2Q0HA 2WJVA 1SQ5A 2DFLA 5K8UA 4LV5B 1D8TA 4KFTA 1G8YA 1E94E 1UBCA 3FHOA 5GJBA 2ZREA 4OJKA 4BEBA 2WTUA 4B32A 3QBVA 2QAGC 5E95A 3TR0A 4A2WA 1P7CA 4JL6A 2MSEB 1DAEA 4NCNA 3VR2A 2EVWX 4GOJA 3V9PA 4DT1A 1OH5A 4LJ4A 4CEJA 1GZSA 2PLFA 1MO4A 2XZLA 4M22A 3VAAA 3MCAA 3GJXC 4BRUA 4QGHA 4D26A 1EFRA 4FWIB 3QPWA 2C9OA 4CRWB 1XTJA 3C15C 1G20E 4DIDA 2YNMA 1U9IC 1W49A 1FUKA 1PLJA 1HY3A 4TL8A 1FMJA 3BRWD 4B76A 3BWDD 4RD4A 2IYSA 2O0KA 4POAA 2CNWD 2XZPA 1IXRC 4HAVA 2WAXA 4MRNA 3W6NA 2ZIAA 3AEZA 4ZO4A 4G5QA 4TLAA 4YONB 5EJEA 1J99A 2JDIA 4KO8A 2AX4A 1N2CE 4V0NA 4KFSA 5LD2B 1G1MA 5DN6A 2F9LA 4IOJA 2JLRA 3H84A 3GLGE 2G83A 1YRBA 1NY5A 621PA 1W0KD 3CLVA 2GJ8A 2L0XA 5AJWA 1CJUC 2AKAB 1G8FA 2F7SA 1OH7A 1QVRA 4Q9IA 3ZVRA 2CCJA 1P62B 2F43A 3RAPR 4YMWA 2XGJA 4AIIA 1O3YA 3OE7D 4IDPA 5EXSA 5LB4A 2O8EB 1HT1E 2IYWA 2VHQA 1G5TA 1SVMA 4HUTA 4Q1CA 4Q7LA 2W00A 2D62A 1VECA 2I4IA 4ZDIA 1KMQA 4ZKDA 1Z63A 5CLQA 1ELOA 1TQDA 1OE0A 3IBYA 3M1IA 4LHXA 1SVOA 1HT2E 3Q72A 5B64A 4TYNA 3PR1A 2LKCA 2Z83A 3AVUA 3D7MA 4D81A 2VQSA 3CRW1 3EZFA 1HEIA 4QBGB 4EPTA 5BWMA 1V43A 3CB4A 2WIBA 1U94A 5KNDA 3ZVMA 2JEOA 4TLEA 4DB2A 4RY2A 1E2MA 4V02A 2WVJA 4FI3C 3TH5A 4D4KA 4EKDA 5F9HA 1JR6A 3F0TA 4QHSA 1KY2A 1N0UA 3MLEA 4KLZA 1TF7A 3FFAA 3JVUA 4W5HA 1M6NA 3T5GA 2H1LA 5FTMA 1NG1A 1JECA 3M4YA 4CZ2A 1E2HA 4IEEA 2DFTA 1T8UA 3TUJC 3LQRA 3B1ZA 4DUGD 4GP7A 2FMXA 1DG1G 5E7MA 1EFUA 3LAWA 4DCVA 1TEXA 2XTNA 3VR5A 1ZU4A 4GL2A 1KI6B 1AZTA 3SFZA 1F2UA 2VP5A 3ZVLA 5JCPA 2ZAMA 2REXB 1YZNA 1OXTA 2OCAA 2QNRA 3B9QA 2ZRIA 1COWA 2ANBA 4PHTA 1P2TA 2A78A 4PX9A 1Z6GA 1CR2A 4D6PA 1IY2A 4US1R 4PZZA 1ZM7A 2C9CA 1OW3B 3A37A 1IN8A 2P5SA 1XZPA 5CIWA 1G3QA 2GBLA 4L16A 1WBBA 4LHVA 4DC9A 1DAKA 4Q02A 2JLZA 1PVOA 4Z1MA 2RGEA 3HU1A 1NBMA 2K5UA 3OIWA 3VQTA 1UDXA 2W6JA 3HR7A 1XJQA 2XB4A 4CEIA 2GVDC 2HF9A 1ODFA 2IUTA 2AFIE 4Q4AA 4RKFA 1SGWA 4W7SA 4RFSB 3BD9A 2IEYA 1KJWA 3GPLA 4IOKA 2X2EA 2XNSA 2C9YA 4LJ9A 2E9SA 5G40A 4PO1A 2O8DB 1W5SA 4PXAA 1R8SA 3NC0C 3GCGA 3VKWA 1L4YA 2ZETA 4DIEA 2G77B 1YR6A 3IBGA 4DCUA 3K70B 3GLFE 1AKEA 4WOPA 1GFIA 1U99A 3G5UA 2JIZA 5KNCA 3ZDQA 1KI2A 2WWHA 2XOKA 2GXUA 5FOWA 3UXMA 3BB3A 3SOPA 2GCPA 2WHXA 3IQXA 1Y63A 4Q7MB 4LJ8A 1Z6XA 2I3BA 5EP2A 2JATA 4BASA 1TU3A 4C2TA 1OYYA 2ZRCA 4BLSA 1R0ZA 1G7TA 4NBSA 4TTQA 1FZQA 4OL0A 4QHTA 3THWA 3U3KA 1YZTA 3PG5A 1MV5A 2CE2X 1NN3A 4DLUA 2EFCB 4LV8B 3I8SA 2ZRBA 2IS6A 2O52A 4KLNA 5L3QB 2O8CB 1G6HA 3OAAD 3B7GA 4C3ZA 2DB3A 1B23P 2WAYA 1Q1EA 2QAGB 4TZ6A 3RNLA 3V00A 1NN5A 3THOA 4QJ4A 1CIPA 2ZSBA 2X2FA 2JLSA 1QHSA 4TYYA 2WIAA 1J8MF 4WZ6A 3BH7A 1KSFX 5E3HA 1XP8A 3FHTA 1NLFA 1QDEA 1KDOA 2QP9X 4LBYA 4IVRA 2QP3A 3OF5A 5EE0A 2CVFA 5SZHB 2ZRNA 1WE2A 3MD0A 1IQPA 2JGNA 3LBNA 3HR8A 3P1JA 4YXWA 1G3MA 1OB2A 3KB1A 4G5RA 3WMGA 3EZ7A 1IN7A 2DFNA 2OM2A 3G82C 1KI9A 2LKDA 5BW8A 1XPOA 4HDCA 4MRSA 1NSFA 4ZIRA 3MMPA 1DO0A 2WWGA 1G41A 1GM5A 2OT3B 3DEFA 1CR1A 2BVNA 3NG1A 3CF0A 2LCFA 4II7A 2NQ2C 3L2OB 5JMTA 2FG5A 4XD7A 4ERNA 5CM8B 4IDQA 2OAP1 5HKKA 4R2HA 1ZUHA 3SZRA 1U90A 1TAGA 2AD5A 3I4LA 4C0JA 3RABA 3BB1A 4C7OA 1F48A 2ZRHA 1UEIA 1ESNA 3HP1A 4F92B 1P5ZB 1LV7A 4P4TA 3I72A 2YOFA 4MH0R 1N25A 4Q4HA 4K81B 1ZIOA 2IYLD 1RPZA 4K8OA 1VIYA 1J2JA 1NF3A 5AJXA 4LBVA 3TAHA 1NG9A 4BLPA 4G5SA 2NMVA 2EFHB 3NBXX 1G9XA 4D80A 3QOFA 1W4RA 2VA8A 4B3GA 1TQ4A 2CLSA 1NVVR 2QGNA 4BGDA 5IK2D 4DWJA 3UPUA 1KNXA 3NH9A 4WW0A 2CK3A 2KBEA 4BFSA 2BEJA 1II8A 2ZU6A 2A5YB 5J4LA 1E9AA 4NH0A 3AVXA 1JI0A 4Q47A 3UWKA 3BXZA 4L4UA 1YZGA 1UPTA 1S0UA 3LY5A 5FL7D 2A5JA 3GJ5A 3LVRE 1I2DA 3AUXA 2DY1A 2J0QA 4R71A 2OHFA 5FFMA 4LPKA 3GJ6A 4KAXA 1EGAA 1K8RA 4V0MA 2NPIA 4XOIA 4XSGA 3AF2A 3ZZ0A 3SR0A 2OLJA 2ZSEA 1K5GA 1M34E 1Q3TA 1ZMXA 1G7CA 4NE2A 4ZCIA 1RVDA 2HT1A 4KV9A 2J46A 2R2AA 2W6ID 1KHTA 1WA5A 1YZLA 2FE4A 1MRNA 5EE1A 3W6OA 4JLJA 4FWTA 1S1MA 3CKLA 2AWOA 3VR6A 3EPLA 1IJEA 1BIFA 4QRHA 4TLDA 3EW9A 1GRRA 3QXSA 1KO8A 3CH4B 4IDOA 4HEJA 1HV8A 1Z29A 2A5GA 2PH1A 3DOFA 1UADA 3D3QA 4TYQA 5EE9A 1Z22A 1HH4A 5JCZA 1ZM3A 2IYYA 4GI7A 2ZR7A 1KMHB 2J7KA 3VKHA 2VHJA 3KQHA 4AKEA 2GXAA 2O8EA 3NDBB 2J59A 1KO4A 2F1IA 2IYTA 2QQ0A 4I81A 5HE8A 3ZIAA 4N0DA 4TLBA 1IBRA 2CL6X 3VKGA 3K9HA 1GG2A 2YOHA 2ZI5A 4PZYA 3MWYW 1AS3A 5CJ2A 2OFOA 3C14C 3FKSA 5AUPB 3PEUA 4JLVA 2J0SA 4PAOA 4V03A 1II9A 1E69A 1E1RA 4LSGA 2QT1A 3K0FB 4UXHA 3WBJA 4ZDJA 3T1QA 3WYFA 3LO5A 5F98A 3AGPA 3EC2A 1L4UA 2ORIA 2ZSDA 3CO5A 3RS2A 1YR8A 3B9PA 4C9BA 4URZR 3KKNA 5TB5A 2WOOA 3BAFA 1AGPA 2IHYA 3VHLB 2C04A 1FX0A 4EPYA 3CR8A 1HQYE 1E2KA 1JEEA 1E4VA 2QA5A 2QTVB 3ETLA 2FWRA 4F4JA 1E2DA 4Z54A 1DAMA 4GDFA 3J81k 1MO3A 4ON9A 4N0EA 3REGA 4OKSA 5IF9A 4DCSA 4EPXA 2JLVA 1SXJD 1AK2A 5J4YA 4GZLA 4RCZA 3FWYA 1OIWA 4EUNA 1W47A 5UKDA 2C98A 4LC1A 3T35A 3AUYA 3ZQJA 4CT5A 5FR1A 4X8LA 1KI6A 4HB4A 1YR9A 2VIIA 3RRNA 3KQNA 3GLGB 4HATA 5AJYA 4TL6A 4L9SA 4LYAA 3BFVA 3R9IA 3K0CC 1XEWY 2H17A 1FL9A 3EAQA 1WXQA 5LB2A 5JEDA 2CJWB 3U7EB 4QXAA 2G1KA 4N1AA 2VHUA 1XCMA 3OIUA 4A82A 2VF8A 2NIPA 2WPDD 2BIFA 4FMCF 1Q57A 4JLPA 4LK2A 3ZQ6A 4ZDWA 1W36B 4EPRA 1TUIA 2BV3A 2C03A 2J3EA 2XAUA 3BH6A 4RSGA 4BWYA 2Q21A 2GWHA 3FMOB 1FQJA 2XZOA 1KZ7B 1XEWX 3HPQA 4A8JA 4UQOA 1D2NA 3CRMA 4M4SA 1A82A 4HDQB 1RRCA 1JBKA 1TPZA 4JVMA 1IXZA 2Z4SA 3OEHA 5DI9A 4NP6A 3R7WA 2RGXA 3CPHA 4OQXA 2D7DA 4HDOB 2CL0X 421PA 5GJVC 2BBOA 4TLCA 2DR3A 3QF7A 4O2RA 3W5IA 3BGWA 5GVRA 2YVUA 2O8FB 1HE8B 521PA 3BS4A 3GLIE 5LD2C 2O8DA 4M0LA 4TMXA 4PSVA 1NLZA 3KTAB 3N5CA 3OZXA 3TSOA 3QEJA 4KBFA 4QNRA 4TQUS 2GJSA 4WIAA 2ZITA 1YU9A 4LHZA 5HCNA 3U7GA 1S4QA 2PMKA 3AP3A 3L0IB 4MDFA 3TSZA 4JZKA 1BOFA 4C0SA 3GJ8A 1P75A 2IC5A 4HLUC 3A58B 5JJIA 5FOUA 2RGDA 1VTKA 721PA 3PEYA 3EA0A 2WJYA 1NKSA 4OJQA 3H0KA 2PZGA 5DI3B 1ZNZA 3ZS8A 1HE1C 2PBRA 4G5GA 3C41J 4AYXA 4AI6A 1N6IA 4A92A 1EFRD 4EFLA 4I4LA 1LVGA 4QL3A 1XXHE 4NYMQ 2F1HA 4M1YA 2QROA 2EWVA 1LB1B 4QGAA 1XTSA 3O8RA 1SULA 3OEEA 2TMKA 3RRZA 2QAGA 1N6PA 4PANA 3ECCA 2HLDD 1SVLA 2GJAA 1US8B 2F3TA 3AKDA 4NHOA 2ZS7A 3A1WA 3T06B 3I62A 2ZI7A 3U6KA 1E96A 5FBWB 3DVLA 2B7BA 2C96A 1NMXA 3LV8A 1GKIA 3N70A 5DN6D 2E1RA 4FMBB 1ZD1A 2JASA 2IXEA 3JVVA 4Z8XA 3L43A 1SVKA 4QOSA 3X1ZA 5FOTA 1KAGA 4IOLA 3RC8A 1U8YA 1W44A 1X6VA 3QPVA 3DM9B 3KKQA 3HYTA 4NL4H 4HYYA 2RGCA 1XTIA 2BKEA 5GJCA 5LBIA 4HAWA 2GRJA 4DBLC 1NMYA 4JS0A 2HJGA 3FKQA 3T12A 1LF0A 3KUCA 1KAOA 1ZUIA 1EX6A 2HCBA 1KI3A 1N5KA 1J7KA 2X19A 3K09C 4D82A 4EPWA 1RZ3A 1O87A 3W3ZB 2IUSA 3X1DA 5L3SB 3UMFA 3GLFB 1F5NA 1KGDA 5FTLA 1SXJE 1QRAA 4RD2A 2YHSA 1G291 1C9KA 2B8WA 3FVQA 2JJ1A 2C99A 4QHYA 3DDCA 4ZCLA 3DL0A 4WXPA 1R5OA 1KDRA 3FPAA 4LJ6A 4BQSA 3CX6A 3QSYA 2QBYA 4OBEA 1NVWQ 3QKTA 4IRUB 3CRVA 3GLHE 4G3XA 3TE6A 1R5NA 1XTKA 2EYUA 2BCGY 2P6UA 4PO9A 3B5JA 4RZ2A 1S1CA 4R9UC 4RZ3A 5A5GA 1E2NA 4JKYA 5HZHA 4I99A 5CK4A 1U0JA 2OBLA 1Z0AA 4O0MA 2BM1A 2X8AA 2F55A 1ZINA 2PMDA 1SKYE 2ZM5A 4B44A 1X1RA 2XTZA 1WRBA 5AWFC 4TQAA 1XMVA 3K9GA 3E70C 4TTPA 2BEKA 5FUYA 2WZQA 3K70C 1AS0A 1KKMA 1KNQA 5FPYA 4QKQA 1T3HA 3EC1A 4RCYA 1J70A 2REBA 2EFDB 2QY9A 3O8DA 3IDQA 1N6RA 1OXUA 1COWD 2PX0A 1JALA 4TN1A 2V1UA 2V7QA 2P3SA 3LX5A 4KI0A 3QF4B 4WAUA 3LH5A 3U44B 2GILA 4AD8A 1NIJA 1WMSA 3NKVA 4KJZA 4NYMR 4RD3A 3DKPA 4HZIA 1GUAA 3THXB 1OKKA 5BN5A 4Q9LA 3VFDA 3FB4A 2Q9AA 3A4MA 4Z1MD 1LS6A 3L0SA 3RSOA 1NBMD 2UVQA 1LW7A 4F91B 2RGNC 1G16A 2ATVA 3V4RA 3GP8A 2W6JD 5FBLB 3T1VA 5C18A 4GPTA 2B7CA 5JWHA 4C2UA 2ZJ5A 2OSBA 2FJUA 2A30A 5B2ZA 5F2EA 4MRVA 3RWOA 2P2LA 1XB2A 1VMAA 2O0JA 1DS6A 3CNNA 5JEEA 1EFCA 4P4UA 3GJ7A 3VX4A 4AYWA 2G9NA 2YWEA 1KMHA 1XMJA 5D3QA 3A1UA 3K53A 1Z08A 3ZGXA 3F8TA 1BO6A 1Z6YA 2ZVPX 2Q3HA 4LYHA 3ZYCA 4A6XA 1G8PA 2LWIA 1K5DA 3BJIC 1DTSA 1N3BA 2JIZD 2CE7A 2D74A 1ZD8A 2OCBA 4OYHA 2QENA 2R8RA 3NBZC 1JAIA 4PR0A 2RMKA 3MAAC 4LWZA 2AWNA 3MG9A 4AK9A 1QHNA 1YKSA 4NCHA 2J1LA 1I4TD 3KQUA 3RHFA 4IW3B 1D2EA 4Q1BA 5JLJA 4LCBA 1BKDR 3TK1A 3N2EA 1FTNA 4A0GA 3ZS9A 2YKGA 4OK5A 2F3RA 4MYUA 2OBNA 3SHFA 4E07A 1FW6A 1KDPA 2ZJ8A 2GXQA 4B74A 3OFNA 1Z8FA 4RVCA 2JLWA 2PT7A 2OILA 3AB3A 4TSFA 3C5HA 5DHAA 2OZEA 4LYFA 2VEDA 2R6AA 3QQ5A 2IEZA 1NLYA 5KDOA 2HXSA 1UDWA 1RJ9B 1SXJC 1CULC 1FTSA 5BXQC 2HYDA 2WKQA 4GZMA 2YWFA 3GLGA 4IFBA 1SHKA 2QPOA 3UMRA 4US2R 4ESVA 3WXMA 3KJEA 4PHFA 4GFDA 2WKPA 4GSYA 4DDVA 1E2QA 2ZE5A 4OI1A 3RLFA 3T5DA 4A2QA 4GRAA 3R8CA 5A0FA 4L8GA 4C0LA 2R9VA 2GHIA 2FSIA 2QI9C 1NY6A 5C1BA 2WJGA 1ZNXA 4WZAE 3IPXA 1AM4D 2EYQA 4CDGA 5L3RA 4TWZA 1VDZA 5C2JB 1E0KA 2RHDA 2VH5R 3K0AB 4FW9A 1TQ2A 1YZQA 4BFYA 1NVXQ 1E2IA 4JJZA 3EXAA 2GCOA 1VCOA 3VTKA 3KDSE 1E9BA 3TJZA 3TUIC 4OI2A 4OHVA 4B3CA 4EQ6B 2JLQA 4LDJA 3WNDA 2JLUA 3C5CA 1XD2A 4M21A 3Q8XB 2Z4RA 5CITA 3NVAA 2J0UA 2OFXA 3KTAA 3PUXA 4BE7B 3W3AA 4US0R 1E0SA 4W9MC 1RW4A 2ZJOA 1PJRA 2QTHA 4EFMA 2IK8A 3I8XA 3QG1A 1U0HC 4ZPXA 4DDUA 2WM9B 2PX3A 2QN6A 3LA6A 3SYKA 2I1VB 2EFGA 1BS1A 3KQLA 1BMFA 1X8JA 3UANA 3ZZUA 2V9PA 4BFTA 5CDFA 1ZD9A 3KQKA 1NBME 4Q18A 1KOFA 1NMZA 1M2OB 1XPUA 2JA1A 2VP9A 2XSZD 3CX8A 2CK3D 2FX3A 3QY0A 6Q21A 4NCKA 4PQFA 3BFKA 4AY2A 3KFXA 1VYVA 3NIBA 5HZKA 1W4AA 1TF5A 4IVPA 3U61B 2UKDA 2ZJAA 1XD8A 3HJNA 2AKYA 1E9RA 2QM8A 2XJ4A 3LW7A 2NTYC 3AF4A 4R98A 4HB0A 3RS0A 2H18A 5JI3E 1SKQA 1UBEA 3EZ2A 1NN0A 5C4MA 5EP3A 1R0XA 1AA9A 1KTVA 1CBUA 2ZRMA 1Z07A 1ZCBA 2QE7A 3QKRB 5AR1A 4OHZA 4P0TA 2A2ZA 1XU4A 1US8A 2ODEA 5JSZA 2X77A 5EZ5A 1UAAA 1WQ1R 2ZRJA 4PC3A 1UEJA 4TMZA 4EJSB 1NVVQ 1UKEA 3TLXA 2NGRA 3V4FA 1D9ZA 4YQFA 4CYMA 1ZRHA 1JQJC 4ESHA 2Q3MA 1CLUA 3U3JA 2KB0A 4S2EA 2ZI9A 1Z2AA 4D25A 1XCPA 2O8BA 2ZUCA 2RGAA 3UG7A 3VX3A 2Z43A 1F2TB 2ASEA 5AUOB 5DO9A 2A9KA 3PVSA 3GLIB 3U2QA 2R6FA 2R44A 3CRRA 3CUEF 3IILA 3SYLA 4LJ5A 3U3RA 3C16C 2KWIA 3C8UA 2QPAA 1EK0A 1IAQA 2Y8EA 3LLUA 1Q20A 3ZIAD 1GNPA 4E5UA 2OO7A 3CONA 4W5JA 3WNBA 2DPXA 5L3SA 5C4GB 3IQWA 4ITRC 3TVDA 2QAJA 2JAQA 3PUWA 1HUQA 4OK6A 2AL7A 3FKSD 5EP4A 5JWOA 3CM0A 4YMSA 3QE0A 3VHXA 3DO6A 3U5ZB 1W36C 2HXYA 2W58A 3AVWA 5DSZA 2CHQA 5AUNB 4O25A 2PLRA 4JKIA 2Q3FA 3QUSA 1YZKA 3KKMA 1GL6A 1RFLA 4MGYR 1AKYA 1VKJA 1W0KA 4D4JA 1E79A 3ND9A 1Z06A 3NBYC 4J0QA 4B3FX 1GWNA 4DCTA 1HQCA 3FOZA 2NO6A 4F7WA 4U7DA 4Q66C 1G5RA 1Y3AA 3VNUA 1GKUB 2ZSFA 4KBGA 3FFBA 3KJHA 5CYOA 4HB3A 2PJZA 3NEJA 3RWMB 3OE7A 2ZPTX 2Q9CA 3BERA 5FTJA 5K8LA 2DYKA 3AVYA 2H92A 3IHLA 2IHBA 1KSJA 1FQKA 1N6KA 1U2RA 3EA5A 3QXJA 2NZJA 4I1UA 3GFOA 3CW2A 2J45A 4PO8A 4S35A 3P4YA 4LRWA 1KSHA 4JLMA 4ASUD 2BHRA 3PV0A 3U3MA 3S1AA 3KJIA 4UXIA 1MRSA 1U81A 2QEQA 1VG8A 1EG7A 1JQLB 3K9LA 4B2LA 2ZI4A 4ZV4A 1EFHA
chains in the Genus database with same CATH superfamily
1XGKA 3EJ6A 2QZPA 5HOEA 4DV1B 1XELA 2GF9A 1L5SA 3M70A 1M8PA 2VUIB 4ES6A 3ADCA 2AN5A 2PKEA 3GBVA 4W8GA 5A4JA 3TMYA 1YE8A 1IU9A 2D3WA 4OBXA 4AYTA 1XTUA 2DVMA 3UH0A 1JR3D 2Q3BA 4L95C 2H31A 3IBSA 1U2GA 1DIRA 5A04A 4D42A 4Y0NA 1OIVA 3JQAA 3MJTA 1SXJB 2V3WA 4U2FA 4BQQA 3PQ5A 5AJUA 1ONBA 3T7AA 1IZ0A 1XZCA 4JYCA 1RXEA 2H7YA 2NU6A 3WLKX 4GOKA 2O2JA 3IUQA 5G2OA 3S99A 1SY7A 4EZBA 4F2DA 5G3ZA 1TIBA 1JLKA 3O75A 3AUJB 2X4DA 5DTRA 1TJ5A 1X7WB 2BKXA 1YL6A 1Y9DA 1MXFA 2VO1A 2PWBA 1PR1A 3ZLJA 1NIPA 1LK0A 4B84A 2YY5A 1OYWA 3HJAA 3IEMA 1V26A 3COPA 3MBIA 1E6CA 4TWJA 5IFKA 1I7QB 3FCOA 1A2QA 4J3FA 3JASB 5E7QA 4M8KA 3AUSA 1DFGA 1XI2A 3DE4X 4G5HA 4AJHA 5CVTA 2BDEA 1L4BA 1IN6A 3KU4A 1T4CB 2QRZA 3L6CA 4MUFA 4Z4EA 1M1YE 4IHQA 3UT5A 3D6MA 3DTYA 1QCDA 2G36A 2AQIA 5TJHA 1IVYA 1SKYB 1NMSA 4CKXA 2J0VA 3JQ7B 4RKYA 4CG2A 4DVJA 1EXWA 5FWXB 1RQNA 1K6IA 1I7LA 4J6FA 2VP4A 1UJNA 2BGRA 5DM0A 5EZYB 1DL5A 2KI5A 4BQIA 1ZWLA 2W6OA 2PA0A 3DWGA 1Z0ZA 1GNRA 3T7KA 1OXVA 1T29A 1Z36A 1P4AA 2FUEA 5FOSA 4CL2A 4PSCA 5ES3A 4RVDA 1OWMA 3ED1A 2P9TA 4IIGA 1W1WA 4RVFA 1F20A 1VJGA 1ZL0A 3H5VA 5FR2A 4F5DA 4R0NA 3TLKA 4YUZA 2HTFA 2R1VB 3FGNA 2OGZA 4KVFA 4ZRMA 1QHGA 3KB2A 1JVBA 3K20A 5AI0A 4ZAWA 4PHCA 2WZCA 1N9ZA 1SFRA 1G3UA 3D5EA 1V6CA 1D2RA 3CEAA 4AZ0A 1Q0QA 4RWEA 3ZE2B 2P4SA 2VK1A 2WVGA 4L07A 1G4UR 2DBYA 4EYEA 2JANA 3BZUA 3FROA 2XQKA 1Z3IX 3I1JA 4B2PA 4DF3A 2VZ9A 1S89A 2X3YA 3AY3A 4QQ8A 4X61A 1MO6A 2OAEA 4HQNA 4QYIB 3NJ8A 4EHBA 4IQ4A 4JQYA 2LE0A 4Y2QA 4D56A 4BMCA 5J1SB 2VRBA 4QJ5A 5A1TA 4XLTA 4BV8A 3H86A 2GAOA 3VDNB 3LRPA 4QTTB 3ZU6A 3ZQ4A 4GM0A 1JU9A 4AY4A 2WG1A 1PR6A 4UJ3A 4CKBA 4F4IA 3VR3A 1MPXA 4B6FA 1YQXA 2P0EA 3ETHA 4WOJA 4KRYA 2Q7OE 4KEAA 5ALRA 1V8OA 2I4RA 2JFPA 1ZIXA 3WSTA 2GA8A 3KBBA 5EMJA 4BQEA 1M2VB 3IKLA 1T3SA 1GNQA 2IHKA 2J3MA 1FQOA 2EFYA 4H7EA 4IIHA 4KVAA 5EJ4A 3RBAA 2FW7A 1VHTA 3R23A 4WXRA 1W73A 2C5GA 4LNUA 1NBHA 2R7KA 2QN8A 3F5DA 4TUYB 4UVGA 5ESDA 4BVKA 3HO1A 2AHOA 3LKDA 1M6VB 2WD9A 3EQ6A 1U28A 3FOWA 2A0XA 3HVUA 2IOFA 2XOXA 5DX0A 2HCJB 5ALTA 3T7IA 2YRXA 4JFRA 1DBPA 3TM4A 3UAXA 1DRJA 1MJGM 3TOXA 4IPTA 4BVBA 3RANA 3DMTA 3I2GA 3F3KA 2JVIA 3ET4A 4Q37A 4AUEA 5IJXA 5AJVB 1BS2A 5EAIA 4G0OA 2C61A 3IODA 1G0OA 2FPMA 1QPGA 4TTJA 1SOUA 3NHLA 4ZVMA 1B42A 5T3YA 5TMBA 1PEDA 1K08A 3R6DA 4HB2A 4PZLA 3U7GA 1EDOA 1CZUA 4LY6A 3RR2A 1Z47A 2P4EA 3H5AA 3LT2A 1XZQA 2ZYVX 1BDIA 1WAMA 4MV5A 3AV0B 3R7FA 3ICPA 1P17A 2HWUA 4DPKA 2ZTVA 1JR3E 1B2LA 3KQMA 2ZUEA 1ZD5A 3PXDA 1FSGA 1LC3A 3DDUA 2PZEA 4YJHB 1Y89A 5JV5A 2FCRA 3ASZA 2PN1A 3D4OA 3OF3A 2OXTA 4P86A 4U7FA 1F6BA 4LQCA 3DV2A 2B92A 2ZE7A 2HRRA 1N5IA 1NONA 1ESDA 4FCCA 4DQXA 3DEYX 4JIMA 4IQFA 3A4TA 4A0FA 1WXIA 3D5QA 3K1JA 2V7QD 1T26A 2VUHB 4YLGA 1RYHA 1L5GB 2I8CA 1AIPA 3D81A 3H1PA 4G0ZA 1D3AA 2FWJA 3R0XA 4NZPA 5B30A 2VWGA 4H3VA 1U2DC 2WYIA 2ZWVA 1G21A 1GZUA 1KK2A 1DOAA 2G0TA 1G17A 1AHNA 2R60A 3AQ4A 1XX6A 4M1KA 2V3CC 2H2FA 2ZIFA 3LW8A 3OQJA 3KZMA 2GPNA 1SBTA 4DM7A 3KXKA 1M72A 1EDZA 2B1JA 3H1TA 4S12A 3V8RA 4JITA 5ALZA 3ZWMA 2NO9A 4ARZB 5TVKA 1NTOA 1SG9A 3TX6A 4BFZA 1G8JA 3HYRA 3RS3A 2WQ6A 4DQKA 2NNLD 3BTSA 3GLTA 2PUWA 1XFAA 2MSKA 1V1RB 2YWJA 3IVGA 4HPJB 2IITA 3W3AH 4EYKA 1FSPA 2NLOA 5KTSA 4D4MA 2B1GA 3A06A 4ZGGA 3K8ZA 5BWNA 3WGVA 1RXVA 1FYFA 1JILA 4J49A 1DWUA 3KHSA 1O57A 1PLLA 5TY0A 1CTQA 4YGYA 3HJRA 1JVSA 3LYHA 1F2TA 4O4IB 5MN5A 4D9NA 1RRVA 1UXHA 5EE5B 3JQ9A 3PFFA 5COAA 2FUKA 3TPCA 3MTBA 3O47A 3OFKA 4FJ0A 2BTQA 2R96A 2W0MA 3DVAB 5ER9A 5J3JA 2C2XA 3ORRA 5L3ZA 3Q7QA 4U2GA 2VHWA 4LYGA 4I8DA 3T5MA 3BRCA 3GXBA 5L3QA 4TV8A 2EKDA 3VJRA 1D5CA 2C54A 3GJ3A 2IUUA 5AOAA 1M1NB 4JCCA 1J20A 4Y6LA 1LKZA 3C70A 1JKMA 3KJFA 4YHHB 3ZX5A 1O0CA 2IS4A 3TSOA 3ADOA 2H2DA 1AF4A 1TMYA 2QS9A 2XA1A 2R6DA 5D6OA 3VV3A 2XWQA 1A9YA 3G85A 2VTKA 4EGJA 2QVCA 1Y5LA 1S2LA 2EX4A 3U7IA 4CFZA 2PGIA 2Z6UA 1OTYA 2VPZA 3WJ1A 1CZNA 3NAZA 5KQLA 2OENG 1DO2A 1KR5A 1YHZA 1UKZA 2FW9A 4P7GA 1SVUA 4UBOA 1VI2A 3QYAA 4Y6QA 3N7UA 3ROZA 3D0QA 3WGGA 4YPVA 3UOGA 1UR5A 2CHGA 2UZ3A 3W4KA 4AZ3A 3H18A 3HVIA 2JGLA 4KH0A 4FCVA 4KOAA 2LIVA 3A9TA 3H5IA 2JFBA 3I0ZA 5FOVA 4JP8A 5AJTA 1FBNA 3ZY5A 1YFLA 1QU3A 5BMVF 1XJ0A 4R2IA 1X7XA 4Y2PA 4ZEWA 2NYRA 1Y6FA 1QYWA 3U5TA 1M75A 1BRMA 4IGAA 3UZUA 2ZIGA 4BS9A 5K0TA 1B0UA 4R2LA 1VYUA 4EGAA 4HMOA 1AHHA 2EL7A 1NL3A 5DGIA 4C78A 1O4WA 4COKA 5KNBA 2WSSA 4UFNA 3N1UA 2OESA 4YQZA 4KE6A 5FQNA 1O0BA 1P2VA 4G0NA 3IULA 2ATXA 2CBXA 3P4XA 1X7DA 1QF9A 3UCFA 5ALNA 1BX0A 1JIVA 2AG0A 1I3OA 2QVGA 3OT4A 1IL0A 1VGVA 4Q4JB 5L8VA 4XASA 1JA9A 1V96A 1UP7A 1O6GA 2VNKA 2WVHA 4GZ6A 3S2SA 4BLUA 3WRXC 1UBFA 4XQCA 2ZYGA 2O8NA 1T3LA 2XLCA 4KIJA 4RF2A 3RH0A 5I48A 1U8EA 2BJWA 3LUDA 1FNMA 2G5TA 2X5XA 3LWNA 3QBTA 4FMDB 4KBYA 2QG4A 4HAUA 2RGUA 3SPXA 3UMSA 2ODBA 4C4PA 2F1RA 4NNJA 1A5AB 1P80A 1VZ2A 4IIJB 5ARCA 4TZ0A 1JUDA 4EGCB 1SXJA 3UA3A 4AKGA 4MHOA 1XMQB 4H16A 4AP5A 1HSZA 1A04A 4YRQA 1YVDA 2F8MA 3ESBA 4PC7A 3OLQA 4IMRA 2C9MA 5FUVA 4BNMA 5K45A 1C0KA 1PZXA 2D1YA 2IZ7A 3JZAA 3JQQA 2IS2A 1QHHB 4Y2YA 1WD5A 1FLVA 2FPXA 2I6TA 3TLYA 5FWYB 4LF7B 4ALKA 1KQOA 5EC8A 5AKXA 1XDSA 4TX1A 4NK4A 4UNIA 4WCDA 1XJCA 2IXDA 1HURA 3G8CA 1XL1A 2AZMA 3L6BA 1GGMA 3ML1A 4I8IA 5GY7A 1Z5GA 2B9EA 5KCMA 1DGQA 1NE2A 3MVEA 1SBYA 1OJLA 2RB4A 3LXRA 3UWSA 3K5HA 1A8UA 1IOVA 1DBRA 3QYFA 3BSFA 4GVPA 3W90A 5JAHA 3JASA 5CCXA 4KO1S 1CIVA 5HBRA 5IHXA 4DV5B 3L4BA 3H2ZA 1EEXB 2X6RA 3BD7A 1GFWA 2C3OA 4ETIA 3W05A 1PJLA 3AJEA 3TF5A 4I8XA 4O2AB 4X91A 1GSIA 4FFVA 5H16A 1OZAA 4BLTA 2W4MA 5FWXA 3QXCA 1H1LA 1CZOA 5GM2A 4BYMA 4UNRA 4UC0A 3SJCA 3PGVA 2P2SA 4CL8A 3SM3A 1KRXA 3WY9A 2CBGA 1DQZA 4FE3A 2I2BA 4FXPA 3I9JA 2SKCA 2YC4C 5I8PA 2IYAA 4DKXA 1RU3A 4AUNA 1NI4B 2JCSA 3WLOA 1AD2A 2ODAA 5I7SA 2DFVA 4HKTA 2GPBA 3FNEA 4IFIA 3W2TA 4UEWA 4J75A 4IMPA 1F5SA 3KKOA 1YDGA 2PL3A 3N6XA 2R1VA 1V6SA 2AGVA 4LDNA 1U3WA 1YA4A 4H0CA 3I39X 1NDQA 1LX6A 1L8QA 1TKCA 4QBIA 5CNJA 1XG5A 4GC9A 3EYWA 3JQ8B 3I1IA 5EQTA 1PG0A 1QGOA 2HJVA 2X0KA 2VZEA 4RD6A 5L53A 3DP9A 2FN9A 1OF1A 4EW1A 2HLHA 2XOKD 3PT5A 3T15A 3WHPA 5EZ6B 3DPUA 4QYIA 3HJBA 1MAAA 5IU6A 4XA8A 3BF7A 2PUAA 3TEJA 5JU6A 1II8B 4ML3A 3MBKA 3EEQA 1E9EA 1K6MA 4UZFA 3HYSA 3PC8A 1Z2CA 2J7PA 2X76A 1SC1A 3K0FA 1SZPA 4QPJC 1YS6A 3RS4A 1BVHA 2YCLA 3FZQA 2Y0PA 3NTUA 2R7MA 3VVCA 1F0YA 3WGJA 1RRMA 2OEPA 1S8OA 2QT0A 3DZDA 3EN0A 4UNSA 4W7IA 2BCEA 4CW7A 3U1VA 2WJJA 5DGCA 3L41A 2R1ZA 5HSGA 4RIEA 2ONJA 4AG3A 1OLUB 3I6MA 5DWVA 1GTG1 5FUXA 1GAJA 1T8TA 4XE5A 2B98A 3L8CA 5MGNA 1RQRA 2PKRA 1AMOA 1WL8A 2GZ3A 2HFKA 2Q4RA 1Z56C 3B2NA 2QW8A 3GA0A 1UZNA 2I65A 1PJ4A 3EUEA 4RYLA 1PBTA 4K6CA 1P7ZA 3QVXA 2QTVA 5T6MA 1N7HA 3WGYA 1VPWA 2IE8A 1E0AA 3AO0B 3BDVA 1WV0A 5E2AA 3FY4A 3N59A 2JARA 1LQ2A 1M1YB 3IP8A 1Q1BA 4HJRA 2R6R1 2ZUWA 3FHLA 3CCCA 4TUYA 4WFQA 1SHZA 2N42A 3L3BA 4KMMA 2VQ3A 1M6VA 1R10A 3KBOA 1YMUA 4R1SA 3GMDA 5EQFA 4G0VA 5P21A 5I47A 2C88A 1E9FA 5D3ZA 3PUVA 4PAMA 2DE0X 5LZ4A 1X13A 4FMPA 1K6EA 2J3JA 1VPVA 4HLNA 4TKLA 1J00A 2VRCA 5F52A 1JEQA 1IY1A 1ONNA 1D1PA 1RLTA 3I09A 4KAJA 3ZV3A 3D2AA 4H27A 5TPZA 1L9XA 1AQUA 4GPZA 5BURA 5JATA 1TCBA 2VPPA 1AB6A 3JS5A 1WY7A 3B82A 3GFBA 4LJ7A 4TRJA 2GD6A 1JEDA 3RC3A 4XVUA 3MMNA 4XH9B 1QBKC 2CJWA 1M0EA 2IVFA 2ZJBA 3NTRA 4JUIA 4LFBB 5KYNA 5LDDC 2VSFA 2IEGA 1WPXA 1ZZGA 3HY3A 3WGZA 4A1FA 3V55A 3TQCA 2QXYA 4LMAA 4OQ4A 4IEIA 4Q3EA 4BMZA 1QYCA 3NXSA 1E6WA 1TAQA 2HUPA 3DBHB 1XN4A 2B4TO 3B1KA 3H9EO 3B6ZA 3JX9A 4RGQA 1RNLA 4ARSA 1FOEB 3P5BA 4LJAA 2WF5A 3HV0A 4F6RB 2AG1A 1IUPA 2QF7A 4RZIA 1C3LA 3EVNA 4C3OB 2I4OA 5F3RA 3WLSA 1PYDA 4D4LA 2POQX 2VHTA 1UM9A 1RCTE 4G1VA 3ZKWB 2ZRFA 2VBGA 2XEDA 1RKVA 3VDQA 4RIGA 5FTKA 1FDVA 2W98A 1JXQA 2WF6A 3BJEA 3FFXA 4FFPA 4DDMA 1FTGA 1RXCA 4XDGA 1UBRS 3QWFA 3TB6A 4AKSA 5CB4F 1TZMA 4NEGA 5AVJA 3DLPX 2GSWA 5JMWA 1B6SA 4FDTA 4BRWA 5J23A 4RKQA 4NYJQ 1OHHD 1H0RA 1CUEA 2WVAA 5KYVA 4AY6A 3PIDA 3ZJYA 2BBTA 3G2PA 4IS3A 4OX9B 5CDFE 1T91A 2ET6A 3DE2X 3LSTA 3PEWA 1Q0ZA 2VF5X 1F0KA 4RV9A 4OXIA 3RHTA 4ARZA 4DGSA 2PX8A 2BFOA 3L0BA 4Q5IA 1CJBA 2BF4A 3ENQA 1V1RA 4GLLA 3TRHA 3IMEA 4EHAA 5KVCA 5TLSA 3AI2A 1VMEA 2C5LA 4PW0A 4BU0A 2Q50A 3BOSA 4PAGA 3LP6A 4B8YA 2DCUA 1T4GA 1W9MA 3MTEA 3WXBA 5ETJA 5AQ1A 2HHAA 4M87A 1PZFA 3SDZA 4BDTA 1EVZA 4O4IA 5DI3A 3HCAA 3PEFA 3JTMA 3N2KB 3D8RA 3PDUA 4KXQA 4TKVB 1LI7A 2N3ZA 1M7GA 4EKGA 1KYIA 4U39A 4FCTA 3DJFA 1PJQA 4R2JA 1WZCA 3DVAA 2K7FA 3DSRA 4EB3A 5H3HA 1MXHA 2A7QA 2DBVO 2VZLA 4YP7A 4AJEA 4CM8A 2BMJA 1G9TA 2IXGA 1IWBB 1XF9A 3FSEA 3WMEA 5EIEA 3RRYA 3GK3A 3AMVA 2BGIA 3RC9A 5BSFA 1JXOA 4OXRA 1CUHA 1V39A 4MUBA 3CMMA 2VYFA 3KXIA 4MQEB 4MLDA 3VC3A 1M1NA 4L4SA 3SSOA 2YJ6A 3GRUA 1VKZA 1TO2E 3I2YX 5K0EA 1Z2DA 2C92A 1C8LA 1JQKA 3MTJA 3HGMA 5I4KA 2EV9A 4D9MA 3RTGA 4CF7A 1J49A 3RFVA 3R7WB 4MVJP 2DKOA 3K94A 2JIBA 4D74A 1T4DA 2WIGA 3CXRA 1II0A 1T9GR 4MHSA 4B3XA 2I03A 3P19A 1ZP6A 1P1JA 4HZUB 4BRSA 2O59A 5KJEA 4G0MA 5IN5A 9ATCA 1T5OA 4COOA 3FSGD 4EMBA 4DUYB 3E8SA 3I73A 4DSOA 2GF0A 3C7AA 2PSHA 4YDHB 1IVSA 3NAMA 4F2WA 2HSJA 1OQAA 4M9QA 1YB2A 4PF1A 3WA6A 5KOHB 2WYVA 4DLYA 1EG2A 2HMYB 2FDCA 4G01B 2QTAA 5DTIA 4GXTA 2QQEA 2RHHA 4OYRA 4PZUA 3TINA 3U62A 1E0DA 2X5NA 3PLAE 3EGWA 1CQZA 3LSYA 2JLCA 1NU6A 4QICA 4GIBA 2R8ZA 3EVBA 1QK3A 5KDLA 3UHFA 2E4VA 1PDWA 1E3JA 2ANCA 3GLFA 4FYWA 4XAQA 4BMDA 2JRLA 4XGKA 5EKSA 2J9XB 4QARA 2AXNA 1K89A 3H87A 1BEEA 3TTXA 3ETDA 1J90A 4FLEA 3WGQA 1HTBA 2G1UA 3NGLA 3D6UA 2FZKA 3LTNC 3UC9A 3UG6A 1MT0A 2PRZA 3GIDA 1ODLA 3N58A 1DBVO 2IV3A 1ZLYA 5JANA 3G7UA 1ISIA 2XQVA 4Q4JA 1L3CA 3ELYA 3TJRA 2QYTA 1N0WA 4BP3A 2Y1FA 3ZJ4A 3P9QA 5B4TA 1Z0JA 5AW4A 1RPAA 2A0UA 2PXXA 2QLLA 3KQPA 4Q05A 4WNCA 4A5OA 4L5BA 2ZDHA 1JAHA 1TADA 2X5OA 2PTHA 1OD6A 3OHMA 4Z5XA 5IMBA 1M6YA 1DC4A 3TVTA 1W34A 3AIMA 4E22A 2QX7A 1P4GA 3JD3A 5FBHA 4G8BA 4NYJR 1VE3A 4MJ3A 5FYQA 5J2TB 1IPFA 2P6PA 2XMQA 2ZOSA 3MGCA 4AG5A 5CYGA 1MBZA 4OQQA 5AK4A 1X7GA 1AHPA 1EQUA 1GTVA 1H1TA 3LT5A 5E9WA 1R1DA 1WXXA 1AX9A 3EWSA 5ELLA 3F6RA 1HF3A 1QHHA 2X41A 2DSTA 4F6CA 1A2BA 5H68A 1R7RA 2WBLC 3TIFA 5FWYA 1BA2A 3AHFA 3HDYA 5EJFA 1ESZA 5BV8A 4C7KA 2WFMA 3URKA 4DCMA 1L5LA 4C0QC 1ZCZA 1EDDA 2XODA 4YV7A 2WLTA 1R4AA 2OK7A 3ILSA 3LD9A 4EUKA 1JJVA 1YZUA 4TMTA 1ENOA 1C1XB 1FPQA 2YV4A 2AB0A 4QNNA 4YV2A 2KLHA 3HNOA 4YJFB 1E3QA 1SA0A 3TECE 3UTDA 4WI1A 4M99A 2HMVA 4RTKA 2H8KA 4FINA 2A9VA 3W77A 2FMFA 4TRMA 4JLAA 3FH0A 3HCOA 1A4UA 1PV1A 4NFLA 3GGJA 1S2MA 3FCSB 3Q9NA 2C2GA 1QVAA 1L7VC 1VHWA 1ZJZA 1ZMBA 4KRGA 2YHBA 1RXSA 2P8JA 4UUOA 4DV6B 3HGQA 2XRFA 2GBLC 4W5OA 1E98A 4M1MA 3SDBA 3GDHA 4JVSB 4NIMA 1KEKA 3N76A 1M10A 3AWDA 1YJCA 4B6JA 1WHTB 2HYIC 1E32A 4FGKA 3HEAA 3PGA1 2NYVA 3EODA 1T8WA 1TNDA 1E8DA 1HZZC 4UEOA 4D8XA 2I1WA 2ZUUA 3AYZB 3HJCA 2DBRA 1MW9X 5H70A 4Y3UA 2P67A 1IUKA 1A8QA 1SHLA 3PICA 4Z9BA 1SCDA 3RC2A 1Q3HA 1PG2A 2ZRPA 4HADA 1BFKA 3D6FA 3V80A 2FQ1A 5D5HA 3FHCB 4F4CA 1W4BA 3X0DA 1KAEA 2GRUA 4MA0A 5FA8A 1KP2A 1P7PA 2W2VA 4D97A 4AU1A 3JQ8A 1I0LA 5F1YA 4C0BA 2JGEA 2G80A 4ONEA 1R9NA 1TMKA 3NWBA 3DCYA 1ZICA 4OPMA 3ACDA 5KHAA 2JD2A 2QRQA 5JFGA 2XSZA 2W7TA 2ZIZA 3LUCA 3G0HA 4FE7A 1VLZA 3LPAA 1T0PA 2WTAA 3L0DA 4J8PA 4MGIR 4RIHA 1NASA 1MHPA 3C0KA 4HNHA 5K0NA 1Z37A 1Y8AA 2B36A 3AH8A 4NKRA 3X1YA 3ZWAA 2QVXX 4MVJI 1U2DA 3FWHA 3KKPA 5D3MB 1JG6A 4BP8A 2OM6A 4LXUA 4Q1FA 5EXTA 5C5DA 3ZWBA 4YNBA 1YRAA 4PZCA 5HUHA 1OLUA 1Z88A 1ZNWA 5HPYB 4KNWA 5FUWA 1OYVA 1X3SA 1L7OA 1XQ9A 2D2IA 4WSOA 4CMBA 2P9BA 1HYQA 1CZHA 3RV4A 3WR5A 4MYHA 3VO8A 1JP7A 5G3YA 4LDAA 4FYVA 4RTPA 3JAKB 3COSA 1MIOB 1U7PA 1Y7IA 5H80A 1KVQA 3M9WA 3SE0A 3MQFA 3KE9A 5EWJA 4DA9A 5E9QA 2P0AA 4YPFA 4E14A 1YULA 2IDMA 3D9QX 2CNLA 5BSRA 4P9NA 2JCBA 3EG5A 1RRPA 3MJHA 2FWPA 4BFVA 3GCDA 4DT1B 4EG7A 1D4FA 1E1NA 1G6Q1 2AMLA 2H29A 4GU5A 1L9KA 1E62A 4KQ2A 4QOEA 5CMLA 4ESEA 4F3CA 1KS2A 3EPRA 4FQ7A 1S8NA 2NSDA 2I4LA 2ENWA 4JT8A 1JTFA 4PC6A 5AD1A 4YCLA 4EB8A 5IC4A 2BLLA 3L8EA 1KJ9A 3SOZA 2W22A 1DQRA 2HSZA 5KWJA 3NZEA 1L3IA 3IHKA 4Q01A 4WKBA 4UTPA 4GAEA 1VSQA 3S8MA 1OC4A 1R6AA 2BR4A 3G9UA 4DLZA 2WMDA 4QVIA 2RAUA 4P53A 3QX9A 2DU8A 4MV3A 2X0DA 1GXSB 3CWQA 4RHYA 2ECFA 4QGFA 3EARA 1H65A 1V2HE 2GN2A 1SCKA 1U7TA 3QMWA 2XV1A 1DKNA 4GOXA 1DAHA 4F6RA 2ACVA 2ZEJA 5FTJA 3A1TA 1C4OA 1S96A 1XD9A 1I7PA 1Q14A 2DWQA 1F0PA 1GZ5A 5HXAA 3ZKWA 3TOZA 4HVAA 1P4HA 4KTTE 3AUAA 3FNFA 4S3MA 1M8FA 5L7YA 3JSAA 5TS2A 1T8PA 3JZFA 3NHRA 3INGA 1ABBA 1LPOA 5LFAA 4RF3A 2FV8A 2QM0A 4OEHA 4Y2TA 4HWPA 2QW0X 2EQAA 2MYTA 3PUKA 5ICFA 1ZK3A 3SFTA 4E5NA 4Z2AA 4UOZA 3AEQB 1EM6A 2CXOA 5B58C 4FKZA 1USWA 4JOSA 2WE7A 1GGEA 4L50A 4KIWA 4FJ1A 4HNVA 3IB3A 1R6TA 3RSLA 1QHXA 3GMTA 1YQTA 2FNAA 4RZQA 3BTUA 4DWWA 4EG4A 1RKBA 3UF0A 5AQEA 2J5RA 1BCSB 4Z4HA 4A2PA 2QNIA 4I46A 5HF6A 5DBHX 1SU7A 2Q5LA 5HP4A 1Q91A 1XZJA 3BMCB 1RKXA 4RA6A 1V5WA 4O3FA 4Y9UA 1EFDN 1XRJA 3NRBA 1F4LA 4JT2A 3UCXA 4J03A 1ZXBA 5LSAA 3VR4H 4RTMA 4JKOA 3B2EA 5LM3A 2QMUA 3HCWA 4G4GA 4KXXA 1XP5A 3RSQA 2F1OA 3S40A 3O0TA 4DQUA 4ENTA 2J5QA 3FMVA 4LXQA 4JEUA 2I1QA 4EY4A 2XKJE 3C3PA 4TM7A 2FWIA 3RTAA 3BQ9A 3GFPA 1XDWA 4B2IA 5JS8A 2NUAB 2FOLA 4WV3A 3FI0A 4AWAA 4AUMA 1E77A 1CWUA 1KJZA 1OFHA 2H3HA 2LD4A 4J7CA 5LBUA 5FX2A 2C7RA 3EH2A 1VHLA 2XCIA 1QC5B 1FRZA 2RHMA 3IVAA 2H63A 2OWEA 3IIJA 3N39C 4DR5B 1JR3A 4MQEA 1EBFA 2OV1A 3FAZA 4JYBA 3JD1A 3RU7A 2UUBB 4LS3A 4FNGA 3GWZA 4MSUA 4QXOA 1M83A 4PQRA 1H8HD 1TVCA 3VU1A 4D9EA 4YT4A 1E3MA 1PJAA 3DUWA 3V8QA 5FPQA 4A6DA 3HCPA 1EESA 3KZCA 3WO1A 2FH5B 1XAIA 4JLKA 1PYGA 4JOCA 3OY7A 1XRPA 3GEHA 4HZUA 1SCAA 1NVDA 1ZXLA 3EJWA 3VMFA 2I1LA 2JLYA 2RSLA 4MYTA 3OURA 3BCHA 4UNPA 3RS5A 5EHZA 2B3DA 5LYJB 2YS6A 2J0UB 4HN4B 4PFSA 2HH9A 5IVIA 5J59A 2X8LA 3BF8A 3GEEA 2GBPA 3LX8A 3MD9A 5LZ5A 4YMVA 1QZZA 1KEUA 1XE3A 1XVIA 3AB7A 4RVNA 3EXEB 3LWDA 3TDNA 3DAGA 3GLIA 1U3TA 1Y5IA 5KOHA 1QDLB 3RHZA 3S3TA 4B3MB 2PUEA 1F3OA 2GWRA 2H07A 2WHQA 3C1TA 4MB0A 4Q34A 4EYSA 5B7PA 3KT8A 2VK8A 3KUUA 3TNLA 1Q21A 4WNYA 1KPGA 4FGJA 3RUDA 5EJ6A 1DCMA 1J2UA 1GPWB 1KGSA 2QD4A 3FGOA 3HYNA 3N7TA 3NTQA 3SS8A 5KUTA 1MR3F 4V24A 3FYUB 1DX9A 4M53A 4BZQA 4CM5A 3LDAA 1KMCA 4GNKA 3GF4A 2PNJA 5EJMA 4E03A 5A4AA 5IBCA 1AXRA 4EAQA 3QX3A 2OLEA 2HEIA 2W6IA 1JHXA 4ODIA 3EXFB 2VZ8A 5KTMA 1N2XA 3WZLA 4CIBA 1XRSB 2GLUA 3O73A 2SECE 4NV1A 1YNSA 4PLHA 5TQVA 4HFJA 4C21A 2W2XA 1ZD4A 3PDHA 2W0SA 1VL2A 3KL2A 1XHLA 3OQHA 4WACA 5AOBA 1ZIPA 1TD9A 1VPEA 1T2CA 2BHTA 3I6ZA 3IR7A 4LHWA 1ZSYA 3LCRA 4KVZA 4AMBA 1EXNA 2BM8A 4RESA 4W5NA 3ZBPA 1GSHA 4OJYA 2AW3A 4S0ZA 1IIRA 3I4CA 5L4NA 1N92A 2B35A 2Z6AA 1SUDA 1QYIA 3LF2A 2J87A 1Q0HA 3RJ9A 2J6BA 5A7FA 5I4IA 5JSZB 2R6GA 4CTNA 1IZYA 1ORIA 5EKUA 4DV0B 1R37A 1HORA 4NICA 1U5AA 1CJTC 3OP4A 1D6JA 2I5PO 1R4NA 5FPHA 3TNYA 3QJYA 5EE3A 2G0AA 1C0IA 1VHJA 2IY8A 3Q98A 3GD7A 3DGFC 5IDYA 3TWOA 4DQVA 3RS7A 5CG1A 1WCV1 3RIHA 3O4RA 3U1TA 2V7XA 1SVWA 1H8ED 3NHKA 1K7SN 3TSCA 3GRZA 1CR0A 1OV4A 1XNQB 4RPGA 5D7NA 3V4PB 2R7NA 3GNSA 4KACA 3B1FA 1TKBA 5BUQA 2Y1LA 4JI5B 5TMPA 3KPVA 3PXAA 5FFFA 1CETA 1VGQA 4YRSA 2ZE8A 3EZNA 4JJFA 1OH8A 1WLYA 2IEDA 4IDAA 3TLMA 3JQCA 4JVLA 4JDUA 1ZJJA 1A72A 5JSKA 2WY2D 2Q9BA 2CJXA 3I6QA 3SS9X 1MOSA 1XAHA 1S8AA 3DOEA 5E3JA 1W36D 1M66A 1BVRA 2RHTA 5J40A 2IYRA 2Z6VA 2YDXA 1XYYA 4F56A 2DKNA 1RBQA 4N54A 4O02B 3V4ZA 4UUAA 1X9GA 1E0JA 1C9DB 3DE0X 4DFDA 3ZWCA 5KS2A 3RBVA 3KYCB 4KLRA 1PTJC 3ILVA 3KJZA 4ZU3A 4WBXC 4NZNA 3I32A 4TGLA 3T4EA 3BFPA 4H77A 1WHTA 3CE6A 3OCYA 3AINA 4FHCA 4PPNA 4YBZA 1B6GA 1QGYA 2FSGA 3DZ8A 2CLFB 4JUCA 4U5XA 5I7VA 3E84A 3R5SA 1D6SA 2XCQA 3E3AA 3L8YA 3R9WA 3I1YA 4OI0A 3LKBA 4DIBA 1OROA 4Z99A 2QTNA 1B1AA 4JT4A 5KWSA 3ET5A 3FR8A 1ZM4A 1OAKA 3ZHSA 2RH5A 3EGXA 4MRMB 1IHDA 1Z18A 4C7JA 3W5BA 4OGFA 2J9FA 1J07A 2J09A 3GEIA 3MW8A 4FQ5A 3VPCA 2VUTA 3KKEA 4CM1A 4X3CA 2AE1A 1XLUA 3CBGA 3R5XA 2DETA 3I28A 1N0VC 3PJRA 1XZKA 2WPDA 1AN0A 4E15A 2WSBA 2KYRA 1U8TA 1ZI6A 3DP7A 1H2ZA 4PO3X 2VXOA 3L04A 1UKYA 1VYHA 1N3YA 2J4DA 3LCCA 4FBGA 4PSKA 4U6NA 5I5GA 2P75A 3U7QB 1IDOA 2GEVA 3RAEC 1ZAYA 2FDRA 5H7XA 3OZRA 4HD8A 3ADBA 1GA1A 5KKNB 4OQFA 2C07A 4CIWA 2ACKA 4IWXA 1QM5A 4RQUA 2PGOA 1CUBA 2VAWA 4GLBA 4TTRA 5D3MA 2L42A 5JD5A 4H60A 5AKLA 1IPHA 1WPRA 3EZLA 5TT1A 1BU8A 5TIIA 4C7OB 2YYZA 2O4UX 4U8HA 4XIGS 4RVSA 3VKFA 1FTYA 4IRMA 4LJLA 1Z2OX 2E5FA 1N6HA 2BHNA 2J5XA 1V3TA 3DHWC 1EKXA 4URXR 4IDDA 5IRCD 4Q4HB 4X6UA 1FU4A 3R24A 4NJOA 1L1RA 3T9AA 4F3NA 2ZSUA 1Y9AA 4PN3A 5A2GA 5JS6A 2WJVA 3UMCA 2Z8ZA 3DAPA 5K8UA 5M2QA 2X1MA 4BQRA 2BGNA 1G8YA 3DYVA 1MIOA 3GP5A 3GW8A 5DPMA 1E94E 2OPHA 5BP7A 1J1UA 4IWYA 4NCXA 2ZREA 4BEBA 3R4CA 3OX3A 4AMYA 4RTNA 1QFYA 2AFVA 1C3EA 5HF8A 3TR0A 4DIOA 2HI0A 5KNLA 4JL6A 2C2BA 2MSEB 3ZXYA 4FZVA 4PYLA 2CV1A 1DAEA 1Z34A 3VR2A 4B4VA 4DT1A 2FPGB 5F51A 1OLXA 3IQZA 1F8YA 3DZGA 1MO4A 4EHFA 5HVNA 3S8EA 4PZAA 2CVOA 4G1EB 4RM2A 4ZVVA 5H82A 3W7AA 1ACMA 1SXGA 2WV7A 3KQWA 4YROA 3RD5A 2VRNA 4WKPA 1BWSA 4LHSA 3CS3A 5AVTA 4WZZA 3FPLA 4R6WA 5HWSA 3RF6A 1DHRA 2JJQA 1V25A 3E9QA 3KHUA 4DIDA 4BRZA 2PXCA 2HSWA 1NXTA 2Q6KA 1XLVA 3TLBA 2Z4TA 5BNTA 3OTIA 1GR1A 2HWKA 1DJPA 1Y80A 2IYSA 3G2IA 3NGMA 5FEUA 4R1MA 4XLLA 2CNWD 1GZHB 4HAVA 4KSYA 3RV3A 4AFNA 4QPCA 3RI3A 4A2CA 4U6SA 1BOOA 3LFHA 1J99A 2YDYA 4KO8A 1N2CE 2ZIWB 4EJMA 2XZDA 1CY8A 5B36A 4CL3A 1K2VN 4ZOLF 1G1MA 1JSZA 3L40A 4GZ5A 2G83A 1NY5A 3HWX1 2GJ8A 2L0XA 3RIYA 1EA7A 3CC8A 3WLRA 1ISJA 1UQTA 3ANTA 4HY3A 4JUDX 4MI9A 1BX1A 1E66A 3NASA 4P93A 3HG7A 1QVRA 4Q9IA 3ZVRA 1PZEA 1P62B 3D6NB 4X3PA 4Q6WA 1D04A 1A9XB 4BCBA 1UPFA 4PYNA 3VBCA 4KQEA 3LTEA 2WUFA 4LRYA 5A62A 2AKEA 3S28A 4PINA 4UU8A 5LB4A 4BN5A 1KE2A 1BCSA 1GPH1 2IYWA 1SVMA 4EF4A 3BMCA 2C2OA 3HJHA 3KLOA 2LZ0A 3IV9A 2JIOA 2G06A 1PGPA 5CLQA 3H4TA 2G8LA 3BXHA 4YCJA 2QL5A 3M1IA 3QU5A 4XRRA 4DDKA 3FJYA 3N2NA 2VR1A 3STHA 1HZJA 3PR1A 1ABEA 3IC5A 1RBZA 2VXYA 4PCUA 2LKCA 5AVZA 2H4XA 4BMPB 2VNJA 1Y1PA 1XWFA 2NUAA 4Y1FA 4D81A 2QMQA 2M6LA 3WKCA 3V8EA 2R3SA 3I9KA 2QN7A 2NP7A 4RY2A 3HBFA 5CD9A 1QP4A 1QC5A 2IZ1A 2XWSA 1KBZA 3LOQA 5BSTA 1JR6A 2IIBA 1NRXA 3GGDA 3OE1A 1N0UA 3MLEA 4KLZA 3HRHA 1TF7A 1GNSA 4KUHA 4RIIA 5HJ2A 4P80A 2HBQA 4C4XA 1R15A 5HKAA 4REMA 1T6BY 1NG1A 2B37A