1UZLA

Maba from mycobacterium tuberculosis
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
239
structure length
231
Chain Sequence
AKPPFVSRSVLVTGGNRGIGLAIAQRLAADGHKVAVTHRGSGAPKGLFGVECDVTDSDAVDRAFTAVEEHQGPVEVLVSNAGLSADMTEEKFEKVINANLTGAFRVAQRASRSMQRNKFGRMIFIGSVSGSWGQANYAASKAGVIGMARSIARELSKANVTANVVAPGYIDTDMTRALDERIQQGALQFIPAKRVGTPAEVAGVVSFLASEDASYISGAVIPVDGGMGMGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
publication title Crystal Structure of Maba from Mycobacterium Tuberculosis, a Reductase Involved in Long-Chain Fatty Acid Biosynthesis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 78
structure length 231
sequence length 239
chains with identical sequence B
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2004-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1uzlA00
2HK7A 2W90A 1E3JA 4FSHA 4C4OA 2P9EA 2QZ9A 1N7HA 1J49A 3F4LA 1B8VA 4D0SA 1DJNA 1R0KA 1PZEA 1OZAA 3FRJA 1QRRA 3GUCA 1RM3A 1L7DA 1YOVB 5DZSA 3T4XA 2GYYA 3RBXA 1PEDA 3B1JA 4CM9A 1PL7A 4NBUA 1DXYA 4RDHA 2DKNA 5KCZA 4R4JA 1DRUA 2Y1OA 2WYUA 1P33A 3GZNB 3JD1A 4XQCA 2G1UA 3HWRA 4RVHA 4JGBA 5L45A 3GN1A 1BXGA 1UZNA 4GLOA 2C5AA 1JA9A 1XDWA 1FDVA 1HZJA 1WDMA 1Z74A 2I3AA 2H1SA 4PVDA 4FC6A 2E48A 1EMDA 5CDSA 1M75A 1O5IA 3WMXA 2HMSA 4GVXA 3WXBA 5U4QA 4PLTA 1QXSA 1DC6A 5GZ3A 4Z3DA 1X13A 3V2HA 1NX6A 5A5EA 4A10A 3V2GA 4R1TA 4PLPA 1WLYA 4RPJA 3ZW9A 3FNFA 4DL9A 1YQGA 2AEMA 3ANNA 2PD6A 2FWMX 3PI7A 3ADPA 5ER6A 1MC5A 1M66A 4J9VA 1H94A 2YV3A 3KO8A 4RQUA 1ZK3A 4YT4A 1D7OA 1FDUA 4B4WA 3QVXA 2G5CA 1ZEJA 1KC3A 1X0XA 4XYEA 2VYVD 4I5FA 2AHRA 1E7RA 1XEAA 3H65A 1DAOA 4BKPA 1RM4A 3LT0A 3U3XA 3C85A 2OZPA 3I6QA 4NG5A 1R6DA 4OJNA 5A3VA 4AJEA 4X54A 4MVJF 3FNHA 4ZN6A 4MP3A 4XR4A 4E31A 4QO7A 1RKXA 1IYZA 2O3JA 5GZ6A 5JY6A 3EZLA 1VJ0A 3PXXA 3ZN2A 2AQHA 5CEJA 2EF1A 1PGQA 3OJFA 2J5KA 4R3NA 1UXJA 4DLLA 2IZ1A 1HWYA 3H2SA 1EBFA 1NQ5A 1U8XX 2CY0A 5CHEA 2Y0DA 3DL2A 1H6AA 4J49A 4CV0A 5JMPA 3ROQA 2SCUA 1B16A 4A27A 3DFUA 4MP8A 4WECA 4IDFA 2VUUA 3WQRA 3UAGA 4WE3A 1A72A 3JQEA 5JCJA 4K9DA 3QA9A 3SC4A 1VKOA 3LF1A 2QQ5A 5U1PA 4ALJA 4ND2A 4GBJA 4JX8A 1LRLA 4PRLA 2IDZA 1PS8A 3U4CA 1RPNA 4MVJI 1O0SA 1LDEA 4GX0A 1AE1A 4NBVA 1K6XA 3E9NA 4ALKA 3P7MA 3RKRA 1ADGA 3H5AA 1DPGA 5ILOA 3V1TC 1BVRA 3GRPA 4PG4A 3I23A 4JBGA 4Z6KA 4PLVA 2CDCA 4J91A 1VSUA 2D8AA 3SLGA 2A94A 1ZNQO 1Z45A 4FFOA 4MP6A 4MIEA 5CDUA 1DC4A 2Y67A 2BFAA 1JDJA 4YJHA 3B6ZA 3HB5X 3NTRA 4HX5A 3DO5A 2ILTA 1A4UA 1H2BA 1NFFA 5DT9A 1AGNA 4XGNA 1UZLA 4AJLA 1KVSA 4D42A 4ESOA 4OKIA 4L74A 4L75A 2BMAA 3GPDG 2VZ8A 5F21A 5JO9A 4CMJA 5T5QA 4HWKA 3BHIA 3FTPA 1PL8A 1T1RA 5DOVA 1ENYA 2RHCA 3L6DA 4CMCA 2I9PA 2OXIA 8LDHA 4QEDA 4IJUA 2DBRA 3BHJA 4XJSA 1R12A 4YA6A 4EUFA 1WNTA 3F9IA 3QV1A 3N74A 4E13A 1ZJYA 3QVOA 4J9UE 5A3JA 1MFPA 2PZJA 1Y5MA 2ZB7A 3U4IA 1YRLA 5HA5A 2IXBA 4J7UA 5I8ZA 2Q1TA 2EXXA 2POQX 4GSKA 3BTVA 3GMDA 4IMPA 4CM4A 4NZ9A 4LMRA 2CDBA 2FZWA 1IULA 2W2LA 4D3SA 3B1FA 3DEYX 5IG2A 1KY4A 1SO8A 1V35A 3OFSA 3PIDA 3VH3A 1ISFA 5C37A 2HMUA 2EIHA 3AM3A 1HL3A 4FDAA 5DCYA 3T4EA 4JJGA 1HYGA 2ZB3A 3RCBA 2C2XA 5JAQA 1UXHA 3ICCA 5I7FA 5B4VA 1X7GA 5G0SA 1PSDA 4PZDA 1R4MB 4ZHSA 5L3ZA 3O4RA 5A03A 2ET6A 1BGVA 1N9GA 3PJFA 4CMEC 1X1EA 3PHLA 3LT1A 3PEFA 4HFRA 3GNSA 3GLQA 1DC3A 4M89A 4NU6A 3RC2A 2NM0A 1T2AA 1NPDA 1FDSA 2Y1CA 3PWSA 5HS4A 2P4QA 3IS3A 1K5HA 3TOZA 1ISHA 3H3FA 2GGSA 4KQWA 4RZIA 3I4CA 5BQFA 5CFZA 1E3WB 4E2XA 1R0LA 1EK5A 3FWNA 3WJAA 3KYDB 2IEDA 1Q0QA 1LDNA 3RUEA 4RGBA 3RVDA 3OSUA 2RIRA 3FF4A 1J6UA 4CM9D 2AQIA 2FR0A 4I5DA 2J3HA 4W4TA 2FY8A 3PJDA 4E5NA 3D4PA 4HKTA 4GH5A 4OXKA 5KWEA 4OL9A 2ZJ0A 1DOHA 1O89A 4XQGA 3NV9A 2BHLA 4GKVA 3INGA 4ZRMA 1E6UA 1SBYA 2X58A 1KC1A 1PZFA 1NTOA 4CMEA 2VYND 3RWBA 3Q3CA 3BMQB 2Q50A 1HE5A 3BMNB 3ITKA 4RCVA 2QW8A 4FBGA 5COQA 4WJZA 3JQ7A 1XSEA 4EUHA 2OUIA 1U5AA 4B3JA 1H2HA 5JO0A 5AXBA 2X5OA 4IDDA 2HAEA 5ADHA 2ZB8A 3OF2A 3W4IA 2X0JA 1ISMA 2PKQO 1DSSG 1E3IA 1P1RA 3IKTA 2DQ4A 4ZU3A 3AJRA 3FNGA 4XQ9A 2D5CA 2PA3A 5EN4A 1YL7A 4NH4A 3STHA 4BNNA 1OAAA 3OHSX 2IZZA 2X6TA 4IBOA 1VJTA 1V3VA 5A02A 3IUPA 1PJSA 3NYWA 4KWHA 1BW9B 3OH8A 3AUSA 4BNZA 2B5WA 2IRWA 4OYRA 3G79A 4E5PA 1XG5A 1K2WA 4XYMA 5LDHA 2GZ2A 3D5TA 3I9MA 2OBNA 4F3YA 3GMSA 4N5NA 4NU5A 1A9YA 2EJVA 2PR2A 5JCXA 3FWZA 3KM0A 3ONEA 3PVZA 2EERA 4DRYA 5KKAA 3DBRB 1SZJG 1VKNA 1JVSA 3NUGA 3O26A 2EGGA 4NK5A 4XKJA 2X9GA 1JTVA 3L6OO 4Z9XA 2OMEA 4AJJA 3OEWA 2W98A 3ENNA 3WYEA 4W7HA 1I0ZA 1E7YA 1UDAA 3JQBA 4CLRB 2JHFA 1U28A 1G0NA 4GKBA 3RFTA 1NYTA 4CQLB 2JFGA 4FJ0A 1KVTA 4AJNA 5G4KA 1C0PA 1I3NA 2JHGA 4I08A 1DFIA 4TZKA 2FRDA 3W8DA 4M49A 2R6JA 5KJ6A 5L4NA 4IGEA 4LW8A 1VM6A 5KJEA 4UEOA 3RFVA 3DZHA 4O1MA 3WGOA 3SXPA 3DAGA 1PJLA 2VHVA 5HRUA 1VPDA 3IMFA 4OM8A 3RUIA 1EBUA 4BHTA 4YACA 4XYBA 3DFZA 1P74A 3UN1A 4CM8A 4BO2A 2EKPA 3GG9A 1F8FA 2V65A 1PWXA 1FF9A 3QW2A 4A2CA 2GLXA 2JFFA 2J3JA 3FR8A 1VSVA 3LVFO 8ADHA 2IYPA 3IL2A 4L9RA 1A7AA 3INRA 2JCYA 3ZWMA 3ROMA 4YYZA 1T2DA 5IDXA 3C7AA 3D0OA 3DAPA 3FI9A 4BNUA 1ONOA 3LC2O 1X7DA 1A4IA 3ROPA 1GV1A 1LSJA 1R4NB 2OO5A 1TT5B 3NDJA 4KOAA 5I9MA 2PGLA 2EV9A 1YVEI 4U6QA 3JQCA 4RVSA 4BGEA 1PS9A 3UXYA 1MG0A 1PR9A 3VPGA 3TWOA 3ZH2A 4Q3NA 4BKUA 1HEUA 5FWNA 3ZV5A 4R69A 1TXGA 3RUAA 2R00C 2BFMA 1EUCA 3FSRA 3F46A 1WZIA 3LLVA 4FJ2A 3GEGA 1DIBA 1RJWA 3FPCA 4G65A 3OJOA 1ZSVA 3TF5A 4GSLA 1V9LA 2GR9A 4FS3A 4PLFA 4ND5A 1UAGA 1HDGO 4M54A 2D1YA 5A9SB 1AXGA 1JLLA 3GN2A 2X7HA 3AM4A 5BSGA 5ITVA 5KJCA 3M2PA 4KUGA 2W2LD 5CP8A 3GF4A 3I4FA 3NDIA 4HV4A 1GCUA 1TLTA 2ZQYA 3JQ8A 3SEFA 3ZWXA 1GADO 3D1LA 1C1DA 3RBVA 1YJQA 1YS4A 4AJPA 5KIAA 5IDQA 1F17A 2LDXA 4J1QA 1P0CA 2FPIA 4Y9DA 4XRRA 1EK6A 4Q3AA 4AFNA 4YRAA 1XWFA 1F0YA 1HDOA 2NNLD 5KKCA 3DZIA 1LTHR 3GR6A 5L40A 3WGZA 4CMIA 3ZV4A 3C7CB 1V8BA 2R00A 3LQFA 3HDYA 5T57A 3BTUA 3EY4A 4CMBA 4N7RA 4XR9A 4PZEA 4QO8A 5EQFA 1ULSA 1IZ0A 4L4RA 2DPHA 4CODB 1PZGA 5A4DA 1I01A 1LXCA 2X9NA 4CL8A 4AVYA 2PK3A 4UEKA 2PWZA 1KOLA 5L95A 2E6UX 2BF7A 2YFQA 4BNLA 4DREA 1DIGA 2WSBA 1VL0A 1GEEA 4EITA 2XF8A 2CVQA 1HLDA 4OIMA 4II2A 2DU8A 3DBHB 3E8XA 5T64A 1O9BA 4M1QA 1ARZA 1GUYA 3WOHA 1D3AA 5JSFA 2I3GA 1HDCA 1PGPA 3E48A 2WD7A 2GUGA 2J5QA 2VNSA 1EFLA 1DBVO 4KQXA 4KUHA 4ITUA 3JYOA 3EDMA 3D4NA 1RYDA 1VE9A 3MCVA 5JAZA 2X5KO 3Q9NA 2YV1A 3WTBA 3PIIA 4CR6A 1I24A 3CUKA 5L7YA 2D4AA 1RYEA 3HFGA 3NJ4A 4U0KA 3K6JA 2PZMA 3A28A 4IM7A 3TFQA 3KTDA 3RIHA 2VYVA 2CMDA 2AA3A 4O63O 3WQSB 5A5FA 5BR7A 2PH3A 1QR6A 1NR1A 5JLAA 4XIYA 1O95A 5GZ1A 4D41A 3GT0A 3ZCXA 1D4FA 4O59O 3VZPA 5H82A 3RASA 3WGHA 4YAEA 2B69A 1ORRA 1H93A 4CLDA 4NQZA 4E2ZA 4JROA 2YV2A 1OC2A 4H3VA 4ID9A 3RBZA 1YB1A 4UVEA 1NASA 4QUKA 4IDGA 3UGKA 4AJ1A 4XDYA 1SCUA 1SOVA 5IF3A 4ZRNA 2HJSA 3CE6A 4IDAA 4CJXA 2G17A 3DHNA 2EJWA 1VJ1A 2NTJA 2VQ3A 5EIOA 1J0XO 1Y1PA 3HB4X 1DC5A 4XD2A 5KVVA 3GVPA 4P8RA 1GPDG 2CNBA 1HE2A 4UUPA 1CQIA 2BI7A 1Y8RA 3TZQA 2X23A 3AI1A 4YVFA 3VAZA 1C1XB 4E6PA 4R5MA 4F45A 1HTBA 1QV7A 4OKNA 5T8KA 4OOFA 3W6ZA 4R9RA 5IJZA 1BHSA 1H9BA 3P2OA 4RZHA 4W9NA 1K6JA 1KEWA 4DYVA 4XGKA 3E9MA 1LDGA 1IPFA 2YQ5A 4GWKA 4TRJA 3MJVA 1U4SA 4XGIA 5K0ZA 5DCUA 2LDBA 2GN6A 3PQEA 5IZCA 1T26A 1LSOA 2A92A 1IOLA 1G0OA 1U7HA 3WLEA 4AJ2A 3JQGB 2Q2VA 1Q1NA 2AE2A 1CEQA 5AYVA 3O8QA 1ZUD1 1AUPA 2FHSA 2VUTA 2UYYA 3DTYA 3PDJA 5ICMA 4M55A 1YGYA 3MOGA 2HU2A 4RORA 3RU9A 2VT3A 4B7XA 4BNWA 3JV7A 1WZEA 2GF2A 1Y8QB 1KVQA 2VTDA 3PWKA 4Z0TA 2VOJA 2GCGA 1ZSYA 2H63A 1OC4A 2EEZA 4URFA 1QP8A 1LA2A 2QRKA 2Q49A 4LRSB 2YHIB 3EMKA 4CLOB 3EYWA 3HADA 1X15A 1NNUA 1E1LA 1I10A 1Y7TA 5F5NA 4M86A 1U8FO 4J0FA 5I7EA 2X1HA 2C5EA 1MUUA 2D3TA 4H16A 3RUHA 5G2OA 2EW2A 4RPKA 3PYLA 3F3SA 4P38A 1WMAA 3RU7A 2WYVA 3LK7A 1V3UA 2V6GA 2YJZA 3JQAD 1LI4A 4D45A 3H4VA 1CJCA 1MA0A 4YR9A 1U7TA 4IJVA 5CDTA 4E3ZA 1D1TA 1SC6A 4DLAA 1LBEA 4D43A 4PLWA 3L6EA 4CV2A 2GASA 3R6DA 3O38A 1Z6ZA 2ZTVA 3IC5A 3KRTA 3ONDA 1LQTA 3EC7A 4EDFA 1PWZA 4Z3KA 3BTSA 3WBBA 1PJ3A 4TVOA 4WGGA 4O5OA 1E0DA 1NHGA 4FFLA 1UDCA 2C82A 1P9LA 2HSDA 4RVFA 3LLSA 4W99A 1U1IA 4UREA 1PX0A 1MXHA 3PHJA 4MIOA 1TA4A 3RUCA 1N1GA 4Y67A 4IMRA 1SB8A 2YFHA 4TROA 1JKJA 1R15A 3TZCA 3WYBA 5I8WA 1XQ6A 4YXFA 5IXYA 2GO1A 2VUSA 4RL6A 1ZBQA 3ICPA 3W4JA 2NQTA 1H6DA 3CZMA 4ONEA 1YB4A 2IYOA 3LZ6A 4CUZA 3WWYA 4INAA 4YAIA 4CR7A 3QIVA 3KETA 3Q2KA 2ZYAA 3CZRA 2VHXA 2B35A 4TRRA 2JKVA 2FSVA 5DBGA 1H5QA 3ZWCA 3ZDFA 2OBYA 4DIBA 1PGNA 3H5NA 3OQ6A 4GGPA 4J1TA 3VDRA 3ZHYA 2DLDA 1Z7BA 3NAQA 1I3KA 5FEUA 2C20A 2PFGA 3EAGA 1KS9A 1ZIDA 1U2DA 2VYNA 5DDIP 4OSOA 1ZEMA 3AW9A 5BT9A 5TIIA 1B14A 2A35A 4XWYA 1JKIA 5AXCA 1PQPA 4J2OA 4AICA 5L4SA 4CM7A 4WLFA 5EPOA 3TZHA 3DQPA 4YEDA 3AUTA 3TFOA 4WCFA 1ADFA 2Q1SA 3ZV3A 1ZVMA 2I5PO 5L9AA 4BKOA 1U3WA 4EEXA 1IE3A 2AXQA 2JAPA 2Q3EA 2O50A 1U5CA 3KYBA 3IP1A 5C7IO 3EHEA 1N8KA 3VDQA 1DLIA 4CM8B 1ID1A 1ISGA 4MVJM 1L1FA 3PDUA 4IDEA 4BNMA 3C1AA 3P2YA 1B8PA 4R51A 1ZK1A 2DVMA 2V6FA 4Q3DA 4RDIA 4ZQEA 3VOSA 4Y98A 4MVJA 4JK3A 4PG5A 2NUAA 2VN8A 4FFRA 4I5GA 3ZW8A 2VWQA 4Y8VA 3JD2A 1QYWA 4HFMA 4J16A 5C5IA 3V5NA 1KETA 4GMGA 3R3SA 4KMSA 1HKUA 4P4LA 5L51A 1TT7A 1VI2A 4BMVA 1UP6A 3JQ9A 2CD9A 4Z9FA 2CUKA 1YL5A 2DM6A 3NRCA 3HZZA 2PZKA 4IZHA 4XDZA 4EUEA 2FZEA 4BV9A 5TLSA 1QYXA 3ETGA 1E6EA 5IAAA 4WLVA 4WEOA 3WX0A 1F06A 1EVYA 4XYGA 3U4HA 4PLZA 5ILGA 2QYSA 3HNPA 5GY7A 3MJCA 2VWHA 2GNAA 3BMOB 3KLMX 2C2YA 1VL8A 4QTZA 1ZKMA 1ONPA 3IP3A 1WVGA 2BELA 3DMYA 5B4TA 2PNFA 3D3WB 2C0CA 4QXMA 2HCTA 2PH5A 2BGLA 2X0IA 3KHUA 5DBIA 5B1YA 1LLQA 3DOJA 1H6CA 4YJFA 2YY7A 3ULKA 4CQMB 3DZFA 3NJ8A 3ZU4A 3FN4A 3H8VA 3LF2A 3MZ0A 3FBTA 1YDWA 2YHUA 5L53A 2E37A 5IDYA 3OQ1A 3WYCA 3DHYA 2FN7A 4DTIA 1NBOA 2AQKA 5ICSA 3D7LA 1YBAA 3JQFA 2YDYA 5A9RA 2J3IA 1F14A 5TT1A 3HHPA 3WNVA 1ZCJA 5JFOA 3HDQA 5KJ1A 3DZKA 1XHLA 2CSUA 3WMWA 3MOIA 3ZV6A 4NFYA 4IGFA 4BO7A 1U4OA 3OJ0A 2VHZA 3DMTA 2Y1FA 4CMGA 1P45A 5EERA 4E32A 3FPLA 4FQ8A 4CMIB 2IODA 4RPLA 1PJQA 1PIWA 4NFSA 2VT2A 3S2EA 4MIYA 3KLPX 3U49A 1P1JA 4J0EA 1ZXBA 1W8DA 3QHAA 5A1TA 3VZRA 4ALNA 1V6AA 4CLHA 4TVBA 4NI5A 3KXDA 4EGFA 1NVGA 4OXNA 1H6BA 1XKQA 2ZATA 2P9CA 4CM3A 1GV0A 3IIEA 5ER9A 1CYDA 4O0LA 4ZA2A 3SC6A 2Z1NA 3PFFA 5KJFA 1B8UA 4A03A 5TS3A 1MLDA 3ZWVA 1IL0A 2HK9A 1HE3A 1LC0A 2WD7B 1KIFA 4E5MA 2YUTA 3RQSA 1PS0A 2C7GA 3UF0A 4UUNA 5DP2A 2BFPA 3MWEB 1DAPA 4TWRA 1BDMA 5DBFA 1S6YA 2JJYA 2XXBA 3U0BA 4DC0A 4IIVA 4MO2A 1BTOA 3PLRA 3DZGA 2J6IA 4MDHA 4EI2A 5MDHA 4DYDA 3I5MA 1TVEA 1BXZA 4GVLA 4TMFA 4NDNE 1PJTA 4UUMA 2FR8A 3PWZA 1HETA 3TJRA 4IS2A 4AJIA 3RC9A 3ZWPA 2BKAA 4U7WA 2O4CA 5JAMA 2NU8A 3VH4A 4BQPA 5KOIA 4BGVA 2TMGA 5CPBA 6LDHA 5ENDA 4JLWA 3ZGYA 3GGOA 3AU9A 1HXHA 1N1EA 3QSGA 3PLNA 1QORA 4DIOA 3WDSA 5AOVA 3TNLA 1TB4A 2X9VA 2C59A 1JW9B 4RJTA 5TC4A 4HBGA 3L4BA 1EVIA 4HY3A 3ROKA 3PQDA 2QRLA 4RF2A 4B4UA 3UCFA 1X0VA 1QLJA 9LDBA 2C29D 5I9LA 2D2IA 3X2EA 4TSKA 3RJ9A 1EDZA 1R0SA 4RPHA 1HT0A 1LSSA 3P19A 4ZQBA 1SAYA 3KB6A 4D46A 3EVNA 4Z0PA 1GY8A 3PZBA 4NK4A 4DVJA 2W2KB 2GN9A 3ITDA 1AHHA 3M1LA 4R1UA 1E5LA 1Q7CA 3WSVA 5HWSA 3RJ5A 4BMNA 2Q45A 2NVWA 4PLGA 1QMGA 2D5AA 4J6FA 1XR3A 4TRMA 4WPGA 3UFXA 1Y9EA 5DN9A 1E92A 3GC6A 1KEUA 2ZIZA 2G82A 3GOHA 1GZ3A 4HFNA 1HSOA 2VRCD 5JS6A 3WTCA 1C0IA 3U62A 1IZ9A 3JQBC 4NNJA 1V0JA 2NTVA 1P1KA 4CLEA 4IY1A 4CUKA 4Y6PA 3O8QB 1G1AA 4Q9NA 4JP2A 3KV3O 4B79A 3E1KA 2PY6A 3O9ZA 2WM3A 3TOXA 3QQPA 2PLAA 4CL3A 4NJMA 3WWZA 3GNTA 3HN2A 4YQZA 3QWHA 1HZZA 4R54A 4MVJD 2UV8A 2RHRA 3ON5A 2B37A 5AXAA 3WLFA 1Y6JA 5ES3A 4E5KA 3K31A 4J7XA 4BMSA 3JYQA 1I2BA 2GN8A 3SJ7A 1OMOA 3AK4A 3ONFA 4LK3A 1K3TA 2DBZA 4H7PA 4ZICA 4D7AA 4KZPA 1Q7GA 4YAKA 2V6MA 3DONA 3I83A 3WB9A 1E7QA 1EFKA 1XU7A 3TSCA 4BB6A 1I36A 2Y66A 4WUVA 1YOVA 3KOUA 3EW7A 1UUFA 3C8MA 2J3KA 4J1NA 4B8WA 3JTMA 3BMCA 2Q4EA 4TKMA 2Y0CA 1Q2XA 4WEQA 3WGQA 4EZBA 2QHXA 4EYEA 2I76A 2Q2QA 3GZNA 3ETDA 3WGIA 5G4LA 3UW3A 3G1TA 1QLHA 4G81A 3QVTA 4CMKA 1OBFO 4XA8A 4OGWA 3DBLB 3AY7A 1CIVA 4DXHA 4II3A 3CIFA 1WMBA 4NBWA 4ND1A 1XA0A 3AUAA 1J4AA 5HTOA 4ND4A 4CLXA 2NVUB 3H6KA 3L77A 3OP4A 3RC7A 4IQGA 4R16A 2C7VA 1ISJA 2GZ1A 4BO9A 1C14A 1YQDA 3GZ4A 1SMKA 1I3LA 4J7CA 1GQ2A 1I2CA 1Q0HA 1I8TA 2PKQP 4IJWA 4UEJA 2AE1A 4GMFA 4NBTA 3U9LA 1WDKA 3VTZA 1JVBA 4I9NA 3IUSA 2NU6A 2B83A 2PV7A 3ZWOA 1D1SA 4Q3CA 4BS9A 4BKRA 2DT5A 4AJHA 5BNTA 1BXGB 3E03A 3GEMA 3JQAA 1JAXA 4FGWA 1RM5A 3PHIA 4GX2A 4YT2A 4WNCA 2YYYA 1T4BA 4B4VA 5JYEA 3DHEA 3ZU2A 2ZKLA 2VCYA 3HFSA 3C24A 5KVSA 2OP0A 4L4SA 3H9QA 3HN7A 5CAEA 2JCVA 2PD3A 4LSMA 3I9KA 5G0WA 4E4YA 4M87A 1XU9A 3BXXA 3GVXA 4BO6A 2BLLA 3WGGA 4F6LA 3CINA 4OOEA 2GD1O 3AFMA 3UVEA 5DULA 1HSZA 4C7JA 3E5MA 3TQHA 3WBFA 1IHXA 2GERA 4U6SA 3BTOA 1HLPA 2VZ9A 4N54A 4BO1A 1YDEA 4DPMA 5JY1A 1MB4A 1PQUA 4WASA 3GY0A 4DC1A 2O4UX 1NP3A 1ZMOA 1F12A 1O6ZA 4JN6B 3IDSA 2DPGA 2BFOA 3ZI0A 5CEEA 2HJRA 2HMWA 4LVCA 4UVGA 4B3IA 3IJPA 4BIIA 3U09A 3QY9A 2YDXA 3AWDA 1DB3A 1DIRA 1EVJA 5BSHA 4TZTA 1XYGA 3V8BA 1NPTO 4AJOA 3CMMA 4B3HA 4WOJA 3IJRA 2WTBA 5IDWA 3RUDA 4QT0A 5JW6A 1MXFA 4MKRA 3JD0A 4QX6A 1N2SA 2E4AA 5EINA 2PZLA 4LVUA 4Q3EA 2AW5A 3GGPA 3WFIA 4D0RA 1AHIA 4JNKA 2EG9A 2O3TA 4L76A 3G49A 1FMCA 2X86A 3S2GA 3NEPX 3SJUA 1YBVA 1YL6A 4U8GA 4YWJA 1GR0A 5AXDA 1SNYA 1LUAA 2ZJ1A 5IFLA 3OQBA 2OGUA 1QV6A 2ZYDA 3AI2A 3HG7A 4UVIA 3S55A 2GZ3A 4MINA 3PGJA 4BNTA 2AEFA 3UCXA 2OP1A 3ZNNA 4F46A 4PG8A 1P1HA 3O03A 4ZQGA 3F5SA 3VH2A 4PLHA 2DUWA 5JAIA 4YB8A 1GEGA 4DPLA 1B3BA 2D0IA 4WKGA 3K92A 1T25A 4K1LA 4RV9A 1EE2A 4JIGA 1R66A 1M2WA 3GEDA 5K6AC 3E18A 2DAPA 1P1FA 5KVQA 3NKLA 5JDCA 4YJHB 5JXWA 2F00A 2X0NA 1LEHA 3NX4A 1N5DA 2WEKA 4IXTA 5HBRA 3EVTA 1NVMB 5T8KC 7ADHA 3I52A 5G0TA 3KEQA 2I65A 1HDZA 3C1TA 4W9NC 4MVJH 2PTGA 1WW8A 3TZKA 3I9NA 3KYCA 3OIFA 3OBBA 5T67A 5IZCC 3LU1A 5F1OA 5BNIA 1R4MA 3RUFA 1ONNA 3JYLA 5JNLA 5FI3A 3U4DA 2X8LA 2ZCUA 1Q0LA 4BVAA 4CR8A 1EQ2A 1UDBA 3AY6A 3R3JA 4OO3A 1BSVA 2QX7A 3QP9A 5A04A 1IY8A 1IHYA 2VWPA 4WOKA 4JBHA 1NM5A 1ADBA 5K6AA 3OIDA 3RSHA 1M76A 1PJBA 1E3WA 1P0FA 3KYDA 5TNXA 2E82A 1UXIA 4N18A 5B37A 3WR5A 5I9NA 1V3TA 4FN4A 2WJPA 4MOWA 4CM4B 2H6EA 1E7MA 1E3LA 3GGGA 1OI7A 4NIMA 4YT5A 1YO6A 4NBRA 1M6WA 4I5EA 2XAAA 3S2IA 3UUWA 2RBEA 3VVBA 5KTKA 5JYDA 2JD1A 5K9ZA 4MVJP 1QSGA 4BQRA 3AOEA 4UAGA 2NU9A 1YJ8A 1AXEA 4E2YA 1ZMTA 1KEPA 4K6CA 3NTOA 2O48X 5CG2A 2UDPA 4DBVO 4BGUA 3ZNOA 2A4KA 4BO0A 4AJ4A 1ZO8A 4CUJA 2JD0A 5ITWA 3K73O 3BMQA 3GAFA 4YCAA 1DLJA 1B3RA 2FR1A 2OOSA 3PYXA 2OL4A 1W4ZA 1MP0A 4XCVA 3MJTA 1N9GB 6ADHA 2PD4A 5J23A 2JD2A 3EK2A 1BMDA 3K8ZA 4J1SA 4NJOA 1LLUA 3WSWA 4B7UA 1I3MA 1XLTA 1KYQA 1SEPA 4LGVA 1PJCA 4HP8A 4FCCA 3JQ6A 4AL4A 2IZ0A 5C3MA 1HDRA 4WLOA 5EMHA 1NXQA 5TGDA 2O3QA 3U5TA 2OHXA 3W8EA 4IDCA 5G0VA 3WNQA 4CV1A 1LU9A 2QYTA 2Y1EA 4J43A 5EQDA 4UULA 1UR5A 4E5YA 1YBMA 3HQ4O 4FR5A 2HK8A 1PU2A 3BHMA 2OFPA 3LT2A 3GHHA 1E6WA 5JE8A 3W8FA 4YPOA 5IZ4A 3PP8A 4GAEA 3DBRA 4BGIA 3GVIA 2UVDA 1L7EA 2RAFA 4IQ8A 4YJGA 2WMDA 2WD8A 5TSDA 3TL3A 2B36A 5THQA 3JQ7B 4BUCA 2X0RA 3L07A 3FHLA 3HDHA 5AQ1A 5CG1A 3FCOA 2EHDA 4YRBA 4CLRA 3OEYA 4QFCA 2IE0A 4CQLA 2H9IA 2AQ8A 3HSKA 3DB2A 4QQRA 3UHAA 1JWAB 4RF3A 1PQWA 5EESA 4DMLA 4YBZA 1BRMA 1I2ZA 2E49A 2JFHA 1NR7A 2D59A 4WCFC 4ALIA 4FD3A 1YONA 5LC1A 2CZCA 4E33A 1LNQA 1K89A 4NJMB 4CQMD 3RD5A 2EKLA 2FPPA 1P3DA 1P44A 4ZD6A 4TKLA 3ZZNA 1U3TA 4KWIA 3WG9A 1PL6A 1ZSNA 4PIVA 2J5RA 5TRTA 3OA2A 1GDHA 3PQFA 1CERA 4BB5A 1OOEA 4BNHA 2P91A 1WXDA 4FFMA 3KBOA 4W82A 3I9JA 1R16A 4YAGA 1EDOA 2QRJA 4RO0A 2Q99A 1YWGO 5B4UA 2NLOA 3GAZA 2ZCVA 1QG6A 3H9JA 1R4NA 1FXSA 1TT5A 1P31A 1S7CA 3BMCB 5ENVA 3F5QA 3G0OA 4U0JA 3LSYA 4RVDA 4ZVVA 1O94A 2EP7A 5G4KB 1A27A 2VZ0A 2P5YA 3JQ9C 3L9XA 2DBVO 3E5RA 2X5JO 4FPXA 3QWIA 3AU8A 3WFJA 1IB6A 1UP7A 4IINA 3L4SO 5FYDA 2VRCA 3VPXA 4MVJE 4JBIA 3DDNA 4BNFA 1ZH8A 3WQQA 2NVBA 4UVDA 1I33A 1VLLA 3UKOA 3KSDO 4Q3BA 4GPD1 4HFJA 4WK6A 2O3RA 1IPEA 1LRKA 4EJ6A 2HQ1A 3KVOA 1XQ1A 5EL0A 2FMUA 3V1YA 4KUEA 4DQXA 3ABIA 1NQTA 4GGOA 2PKRA 1R37A 4HNHA 2ZTUA 3OJEA 5A9SA 4OQZA 4XIJA 1ENPA 1XIVA 1I30A 4K26A 1HYHA 4PZCA 4E12A 4IXWA 1NWCA 1LLDA 3TZ6A 4FFPA 1LLCA 1EQUA 3NT2A 1GUZA 1DIHA 4P22A 2HKIA 1I5RA 3PZRA 1YE3A 2NSDA 3JQFC 4IS3A 4DGSA 2HRBA 1GYRA 4E0BA 1N92A 3M1AA 1EEHA 3T7CA 4QFDA 1HDYA 1ZJZA 3OECA 5HM8A 3JQAB 2O2YA 3DMTC 3PTZA 1FK8A 4IUYA 4W6ZA 2GDZA 3PFWO 5F1KA 2ZYGA 5TQVA 3B1KA 4JJIA 4XQEA 2F1KA 3UH1A 3GUYA 1YXMA 3QE3A 4JQCA 3MJ4A 1QYVA 2NQ8A 1BG6A 1YB5A 2VRBA 3ETEA 3SLKA 5C7LO 1RM0A 4DMMA 1NAIA 4LCEA 3VPSA 4E30A 2I67A 3DBHA 3BIOA 4S3MA 2QZZA 2GN4A 4P4NA 1YKFA 1UXKA 2EKQA 1XELA 2X22A 3ANLA 3IAHA 4MJLA 3WIDA 5DP1A 4HXYA 1C3VA 4GI2A 3JQ8B 4OSPA 2HO5A 3EGOA 3FD8A 1C1DB 3QWBA 1DJQA 4N5LA 4BNIA 5CDYA 5JPIA 1ENZA 1VRWA 3L9WA 3ZWWA 2EWMA 3D3EA 4KP7A 3PYMA 2AG8A 2VNAA 1ZK0A 2Q4BA 1E1MA 5CDGA 3B20A 1DDOA 2NTNA 1GYQA 4PG7A 3VTFA 1OFGA 1T1SA 3LYLA 4XB2A 3TRIA 3WJ7A 2Y99A 3N58A 4J4BA 2AMFA 1CRWG 2P4HX 3QRWA 3PGXA 2CFCA 4UVHA 3ZU3A 4MVJG 4DPKA 1YQXA 2OORA 3NT5A 2P2SA 2BGMA 2VTEA 3CH6A 4CMHA 3G1UA 3ORFA 4E21A 3PHHA 3S8MA 4FOSA 4MPDA 2RH8A 1A71A 1Z75A 1LDMA 1ULUA 4GQAA 5TX7A 1W6UA 4NMHA 3L4BC 2ZK7A 4MKZA 3ANMA 4R5HA 4GWGA 3C3XA 5CEFA 1M6HA 3JQDA 1SEVA 1DEHA 2NACA 1LJ8A 1FDWA 2QG4A 3GPIA 4LN1A 4DBZA 2Y68A 4JJFA 1MFZA 3F6YA 3FR7A 3OM9A 3PK0A 3Q2IA 4FC7A 4R3WA 3X2FA 1GUFA 3AI3A 3PHGA 1W73A 3D64A 3JD3A 1F8GA 2GRAA 1DIAA 2NV6A 3B70A 1C1XA 2G76A 1DHRA 3DTTA 4ROSA 3K30A 1WAMA 2ZTLA 4OHUA 3VZSA 3ZWAA 2DC1A 3GVCA 1E1KA 5T6BA 4N5MA 1QKIA 2JL1A 3GA0A 2QIOA 1P1IA 4A73A 2O3SA 2DTEA 3V2UA 3KUXA 3UICA 3FNEA 2W4QA 4MKXA 3JQGA 3KYCB 4CM1A 1KEVA 1QYCA 4EBFA 3WS7A 3S1LA 4YDRA 4FW8A 4U5QA 3OA0A 5A05A 3JYNA 4K28A 5I7VA 3H9GA 4FOOA 1PGOA 3AY3A 5DF1A 3D5QA 3IOYA 3HE3A 4W7IA 1E77A 1NAHA 3I9OA 2TMDA 2I66A 3A9WA 4FB5A 1Y8QA 1B26A 3TDKA 2ZQZA 2CVOA 1Y8RB 2JAHA 3Q11A 3TL2A 4CPDA 2GPTA 4BNXA 1CDOA 4CM5A 1ADCA 1UAYA 2B4TO 2YHIA 2WYWA 4Y6SA 4F6CA 4CLOA 1WPQA 3GFBA 4B7CA 1A5ZA 2Y1DA 3W6UA 4ILKA 1GTMA 5G0UA 1VC2A 4BO4A 4LCJA 4EW6A 4TRNA 4BNGA 4GL4A 1C0KA 2O3UA 1E7WA 1VL6A 4AJKA 9LDTA 1EUDA 2NWQA 3AUUA 4WNIA 3UOGA 1PJ4A 4WLUA 4BL5A 4K6FA 2C54A 3E6AA 5LCXA 2C07A 1EUZA 2ZB4A 3KZVA 4DWVA 4H15A 3V1UA 3PRJA 3AOGA 1JN0A 3W4KA 3GRKA 1UP4A 4A5OA 4L4XA 2P5UA 1CQJA 1PR3A 4RPGA 3SBOA 4BO3A 2VHYA 4I8XA 2UUOA 5FFFA 2HLPA 3NDRA 2NADA 2DFVA 1MX3A 5H81A 5JDIC 5U9CA 1U3VA 1QYDA 3FTNA 3FBGA 3CXRA 1E1NA 2P9GA 1KBZA 1KY5A 1GL3A 1GFSA 4YTEA 1FDTA 4A7PA 2I99A 3HDJA 1UXGA 1X14A 2PGDA 4PGFA 3SVTA 1LDYA 3G17A 3AFNA 4RVUA 2Y05A 4TQGA 1CF2O 3COSA 3CSDA 1ISIA 1XCBA 4PRKA 4RVGA 1NPYA 3ZWYA 1SPXA 3RKUA 2X4GA 2O7SA 2VOEA 3F1LA 3MEQA 4P4GA 2UAGA 5TJ9A 1BXKA 4Z9YA 3S2FA 4J90A 5TF4A 2XXJA 2WE8A 3JSAA 1J5PA 5JDIA 3F4BA 3Q1LA 4YJGB 3DXFA 4BNVA 1E3EA 4ZJUA 2Q46A 4DUPA 4CM6A 1DRVA 2NU7A 3H9EO 2VWGA 2B4RO 4BO8A 1GPJA 4DA9A 3QVWA 3BA1A 3GNQA 1GZ4A 4JP3A 3VKUA 2BGKA 4RLHA 1ZK2A 5LDGA 4FFNA 1UH5A 4QSMA 3VVCA 1Y5RA 3DAFA 1GQQA 5HS6A 4XYLA 1LRJA 1RWBA 4PCVA 3MJSA 4KDFA 2XOXA 5JCJD 3CKYA 3QLJA 3LDHA 1T2FA 2HRZA 1KVRA 1NHWA 2BH9A 3CEAA 5TJHA 3RROA 4WCDA 2AG5A 3VPHA 4OH1A 1FJHA 3RC1A 4GX1A 5JMWA 4NFHA 3L0DA 2O7QA 3VZQA 3ZHXA 2B5VA 1BWSA 1PGJA 1T2CA 1NQOA 2FSSA 3MTJA 3D4OA 3H2ZA 2VHWA 4ZQHA 2DFDA 3I1JA 4KTTE 2WWRA 3Q6IA 4ZGWA 1JU9A 3JYPA 3VH1A 2JCXA 1WDLA 3I6IA 1CETA 1E7SA 4IQ0A 4CV3A 4BNYA 2DUUA 3DOCA 3GDOA 3ENKA 3P5SA 4JCOA 5MGBA 4WCFB 4BOYA 1D8AA 4YT8A 3DOOA 4NHEA 4G5HA 4L8VA 4R1NA 4LMPA 3I9LA 3BMOA 3ASUA 5TT0A 2RCYA 3QWFA 4JXKA 1CWUA 3W1VA 2EGHA 3K5PA 1Z82A 7MDHA 1JKFA 5A9TA 4OAQA 3D3WA 4IDBA 2FPGA 2G0TA 2YZ7A 5IN5A 4NR0A 4J4TA 3IKVA 5BNFA 4CQMA 1ML3A 3TN7A 5COBA 1M67A 4A26A 2Z5LA 2WE7A 3M2TA 1BDBA 2CF5A 1DFGA 2YQ4A 4L73A 1JAYA 1E5QA 1LC3A 1GU7A 1T2EA 4I9HA 4PN3A 3N7UA 3DR3A 3PJGA 5I7SA 3AM5A 3MJEA 5FI5A 5DOZA 4A0SA 1T4DA 1HYEA 1LX6A 1U3UA 5COAA 4Z0HO 4AG3A 4B8ZA 1GYPA 2J8ZA 4EEZA 4B4OA 4YQYA 2P68A 1GD1O 1I32A 1GCOA 3LC1O 2XPCA 2DBQA 3H3JA 2YW9A 1AN9A 3G3EA 3A1NA 3ZHZA 3ASVA 3ZHBA 3OICA 2V7PA 1UZMA 1X7HA 3NGXA 4I9UA 5JDCC 3VPFA 1PJ2A 1PTJA 2FOIA 1G6KA 3OJLA 3LT4A 3VKVA 1HDXA 3R0IA 1NFRA 2CVZA 4LISA 3A14A 4R01A 2GSDA 3GH3A 4S1VA 5F1PA 3ZNQA 1C0LA 2B0JA 2BRUA 5L7TA 3WGYA 3NT4A 3QWAA 4D44A 1X1TA 2HMVA 2V6BA 4OQYA 4YJFB 1ZZEA 3BZUA 4XEHA 2FP4A 1LQUA 2ZTMA 4WLEA 3DZBA 1BVUA 4KDEA 1NQAO 1U9JA 4GLLA 5CPFA 2WDZA 4E2WA 3CTMA 3QJ5A 2UUPA 1ZK4A 3GFGA 2H5LA 3WGTA 1U2GA 3E82A 1LDBA 4NPCA 1HE4A 1TI7A 3BAZA 3R1IA 1NFQA 5JC1A 3TPCA 3INTA 4FGSA 5L7WA 3F1KA 3HJAA 1B7GO 2W8ZA 3H9UA 4D3DA 3WICA 4XRGA 1T24A 4XJTA 4RLSA 1XGKA 4RQTA 5DCWA 2CDAA 1DHTA 1H9AA 3AOEC 3OMLA 1MG5A 4J2HA 5F5LA 5H83A 3H7AA 1ZW1A 4ZQFA 2HMTA 4HADA 4ALMA 2Y1GA 4Y6RA 1TEHA 4G2NA 5A06A 3RFXA 2A9FA 2EW8A 1GQYA 4OMUA 3VHRA 5JBIA 3LC7O 4OXYA 3GDGA 3ZU5A 3MTGA 3A06A 4KTVE 5BSFA 1PZHA 3JD4A 5B12A 2AEJA 5KNLA 3GHYA 3ZNPA 1MV8A 1N7GA 1ENOA 2RH4A 3GVHA 5C7OO 1P77A 3DC2A 3JCZA 2EP5A 1SOWA 1W0CA 1KERA 1K6IA 1UJMA 2HDHA 4LRTB 4YRDA 3RAJA 4RF5A 4ALLA 4BKQA 3GDFA 5IN4A 3QVSA 2Y93A 1A9ZA 3DBVO 4PLYA 3GK3A 3Q9UA 1JWBB 3I3OA 2B4QA 3T7EA 2W2KA 3C1OA 3KSZO 4I1IA 3NGLA 4IZIA 4XB1A 1LSUA 4D79A 1ZXLA 2Q1WA 3K9QO 3ZWBA 3A4VA 4LSWA 1B15A 5FF9A 1E3SA 3CMCO 3BMNA 2Z1MA 3H5RA 4QECA 4BO5A 1DRWA 4R68A 2R2GA 1O8CA 5KVCA 4HUJA 3ST7A 4EJ0A 1MC4A 3ZWNA 2I6TA 4C7KA 3VC7A 4IIUA 1YH3A 3C7DB 4YJDA 3DZJA 4O6VA 4WLNA 1WWKA 4RF4A 3K2EA 4BNKA 1A7KA 2Y0EA 5EJ2A 1GAEO 2DTXA 1NWHA 4ND3A 3SX2A 3KEOA 4PVCA 2Z95A 1KVUA 2PGJA 2Q1UA 4EJMA 1IUKA 2O2SA 4YAJA 4DIFA 2HUNA 2IXAA 3HUDA 3K96A 1BW9A 4HNGA 1DO8A 4FJ1A 1HF3A 4Q39A 4R41A 5DNAA 4BV8A 1JQBA 2DTDA 5F3RA 4PLCA 5AVOA 4J3FA 3DWFA 3EUWA 1EVZA 3PJEA 4L0QA 4DQUA 3RI3A 1SB9A 1ZFNA 1B0AA 1HRDA 3NTQA 3F47A 4DLBA 3GG2A 4IPTA 5IXSA 4GX5A 4IJKA 1B2LA 4CMAA 3Q0EA 4J4HA 1Q7BA 4XX0A 5BSEA 4PFJA 4PG6A 1H0KA 4D3FA 1NVTA 2CF6A 1Z73A 3KSUA 4R9SA 3OETA 1EE9A 5L4LA 1GZ6A 1DFHA 1Y9AA 3K2BA 4FIZA 4BNJA 5JC8A 1MGOA 3M6IA 3ADOA 1Y81A 1EZ4A 3BYZA 2BI8A 3OIGA 3CPSA 3WIEA 3E9QA 2O23A 2Q2WA 1WP4A 4XZ3A 1K0UA 1Z7EA 5THKA 3DBLA 3MWDB 3UCEA 2IEBA 3PPIA 3EZYA 4UUOA 4DQVA 5GMOA 4R1SA 3GQVA 3IQDB 2NVUA 4M8SA 2BD0A
chains in the Genus database with same CATH superfamily
2O8DA 2I7VA 2JRCA 2E87A 1E3JA 4FSHA 3QXJA 3FIUA 3HGQA 3K0KA 5TPZD 2ADFA 2R84A 4FR0A 1J49A 2VIIA 3RADC 3LBNA 4FHZA 1B8VA 2CL6X 4L6IA 4RZ3A 4UOEA 2FPMA 5K2MA 1E62A 2A5JA 1OZAA 3GUCA 1KDVA 2IXTA 4AUMA 1ULZA 4F4FA 4G5GA 3B1JA 4KN9S 1Q7EA 3ECCA 4RETA 3VR4D 3BIXA 3FZQA 2DKNA 4NCXA 4K3UA 2QNRA 2B8NA 2VDQB 4O8CA 4D9MA 1HTTA 1Z5PA 3AEUB 1Q84A 1S9HA 3DT6A 3Q5EA 4JUBA 4M9UA 3PXGA 5TARA 1SHZA 1UZNA 4GLOA 1N2GA 1CSEE 4D8TA 3SP1A 4EK9A 2ZKIA 1JA9A 2CCJA 1FDVA 2OENG 1FUUA 4BE9A 2N42A 1GRCA 1XD2B 3IERA 1EFVA 4PVDA 1L5VA 4FC6A 5DU2A 2E48A 1GQOA 3GI1A 3B9QA 2PZ8A 3S5JA 3PEUA 2EOAA 1X19A 3C8DA 5FADA 2WTMA 4G56A 2XNDD 5KSWB 4RKRA 3MIZA 1TCBA 1YJ5A 3PDIA 1PFVA 3QTLA 1EXMA 3VBCA 1QXSA 4WXMA 4R6WA 2YWDA 4X91A 5DHUA 5GZ3A 2VJQA 4QU5A 3VR2A 2SICE 3O3MB 1JQLB 1L7VC 5SY4A 1GGHA 4MTCA 3Q3IA 4R1TA 3UG7A 1MCZA 1WV1A 1CJMA 1WLYA 2E4VA 4E51A 1IBMB 4KYIB 3M3HA 2FWMX 3K72B 3KJQA 3GJSA 4BVLA 2Q2NA 4YT4A 1ZWKA 3KXKA 4Y18A 4AW9A 1JTEA 4YCBA 3SQMA 3WNCA 3FCAA 3E9EA 1X0XA 4M98A 4XCQA 1T4GA 1BHO1 2VYVD 3K1TA 3NONA 3X44A 4ADSG 1E7RA 3R41A 4HT3B 3TK1A 2EL9A 4M9RA 4CWAA 4BKPA 1BYUA 1ETHA 4ZOQI 4EYOA 1FC0A 2QVYX 1KR2A 1BGXT 3U3XA 3I6QA 4U2KA 4NG5A 4QE3A 4RHYA 2QMOA 1NL3A 4XR4A 5I7HA 2PS9A 2YS7A 2QZPA 1U3CA 2ODPA 2Y1WA 4EB0A 1RKXA 1SN7A 2O3JA 3GJYA 5GZ6A 1PK8A 4QL3A 3O9VA 3ZY6A 1VJ0A 3ADBA 3TNDA 3R09A 3R7NA 5FL3A 5LL6P 1PEAA 2YJNA 2PBRA 3P2KA 1YK1A 1Z4KA 1GL6A 4OB6A 1BE6A 3OJFA 4R3NA 3E9YA 4DLLA 3KPUA 6GPBA 1G8PA 3PJRA 1K3FA 3IBCA 5IAJA 3H2SA 4PC2A 3MVEA 4OV6B 4TLLB 3T7RA 2D3WA 3CZ5A 2WSYB 5CHEA 4YJ2A 4PC6A 2ZYHA 1GTL1 1GNLA 4J49A 2O2IA 1UC9A 3MCWA 2R7KA 1FA9A 3DFUA 1JMKC 4GZ5A 1A72A 1FTYA 1V1RB 1JHVA 2LZ0A 3JQEA 4EVQA 3D3NA 1TEZA 1VKOA 1X1SA 2PUTA 5U1PA 4Q1AA 4BP9A 5LLDA 1H8HA 3MMNA 3U4CA 3ZKAA 1NLMA 3DAYA 5F23A 4WH0A 2NP7A 1P72A 3L7KA 3E9NA 3IOMA 2NPFA 1Q1QA 2IX3A 2FZLA 1MEJA 3WJ2A 2XMRA 3V1TC 4FYXA 3EQ7A 3ADKA 2XLCA 4PLVA 2G0NA 1NMQA 4DJEC 2CDCA 1ZM2A 2BMEA 2XOKA 1RI2A 4J91A 4ZI2A 4DJDC 2HHCA 2OV4A 1Z45A 5FO1A 1PAUA 4OREX 1XO1A 4YJHA 1FFGA 3B6ZA 1WEKA 5AWFC 3G85A 4CW7A 5FNVB 3NHUA 3G23A 1ZP6A 4YUYA 2SECE 3DO5A 2ILTA 1NFFA 4KAXA 5GP1A 3LWNA 4OQ4A 4CU5A 4KBGA 4ZT3A 4D42A 1F0NA 4KI7A 1UJ5A 4J94A 3A25A 2LR0A 3C6YA 2VZ8A 3QMWA 4UE2A 3OE7A 5C9ZA 3OZEA 3I9V6 1T1RA 1YQQA 4WXYB 3L6DA 1HYBA 2GM3A 5AO9A 4ZVKA 4P3KA 1GPKA 4CMCA 4EHBA 8LDHA 5JSZB 1CUZA 2DBRA 3C6BA 3ZIUA 1ZZGA 1F2UB 1FTSA 2B8JA 4FDLA 1DO0A 3F9IA 3SJCA 4EUFA 3DCJA 1ZJYA 3IXLA 3QVOA 3K6RA 1FLAA 1PO7A 4J9UE 4KFTA 5A3JA 2IITA 4K8OA 4IOMA 3BXFA 4HR7A 1YRQA 4QUJA 5LZ7A 1Y5MA 3CEPB 3LPLA 5B2EA 3U3OA 2BP7A 4YRSA 5SYNA 2IL1A 3MUEA 3QBVA 5HA5A 5EHXA 3QV2A 1GZHB 2VK4A 4I4TB 3MJHA 4EPRA 2DERA 2POQX 2ERCA 4L5IA 2ZS7A 3DW3X 2A5YB 1EH5A 3MCZA 3AEQA 2FZ4A 4KIGA 3IO5A 1EX1A 3BD8A 4KO8A 1IULA 1P2GA 2DR3A 2PL3A 2GDJA 4MQFA 3B1FA 4EHHA 4LJSA 4EY6A 5HJ5A 3GLSA 5IG2A 1NIPA 1XCJA 3PIDA 2FN4A 2P9BA 2Q3LA 2GPAA 3VH3A 1ISFA 5DE3A 4NOLA 4Y1RB 4G0WA 2P2YA 2HBYA 2NXWA 4JJGA 3TINA 3AL0C 1HYGA 5GWXA 2ZB3A 3OX4A 1OWPA 2BFEA 3O3CA 1UK7A 1UXHA 4JMPA 4YP1A 1ZUIA 4FCVA 3GWGA 1R4MB 1CP3A 2VHQA 3L18A 1HNZB 2WUGA 3I05A 5A03A 4PZYA 2ET6A 3KKKA 3ETCA 2L0XA 3MB5A 4MA0A 4R81A 1FDRA 4MB6A 4QRHA 3OTOB 4S1NA 4Z3OA 1DC3A 4M89A 3HCEA 4QFBA 2NM0A 4RSRA 4TV9F 1UPTA 2JJ8A 3W2EA 4BCDA 2JIPA 3DV9A 2VF2A 2VSQA 3UV3A 3EGWA 1G5HA 2WKRA 2C4WA 1F4LA 2UYGA 3IS3A 2CJPA 2GGSA 1QCZA 4RZQA 3I4CA 4E2XA 4QGGA 4IG4A 2AJCA 4GDFA 2OZVA 4X44A 3L1HA 1TYCA 3WJAA 2IEDA 1Q0QA 5K3BA 2AYYA 1D2NA 4EB3A 1T8WA 3IDZA 5JASA 1FMJA 2ALJA 1KH1A 2GEKA 2NYAA 4NMWA 4G84A 2OVBA 1G5QA 2J3HA 3EODA 3H2YA 1A04A 4A8HA 3Q1KA 3B2EA 3C14C 3FFWA 5IU6A 3B2QA 3DEKA 3FYTA 4GH5A 4OXKA 3D02A 3HUFA 3RRNA 3V7WA 4C29A 5KNDA 4XQGA 4ZRMA 3URMA 3R77A 2OD9A 2NU9B 3AHHA 4CI9A 2Y71A 4X3OA 5C1PA 1U6KA 4LKOA 2ARKA 3AL2A 4BGDA 2HNAA 4LYEA 1PZFA 1OTXA 1SHUX 1Z0UA 2G63A 1P3JA 2GWRA 5FRDA 3R0VA 3HBJA 1SZPA 3Q10A 2PWBA 3BMQB 5BYJA 2Q50A 3BMNB 2QW8A 4AU1A 4WJZA 3JQ7A 2QN6A 5GJVC 2WMOB 5ALIA 5C34B 4BFZA 4CDRA 3CW8X 2O20A 2TRSB 5BWOA 1DAIA 4IGIA 4QICA 4BLVA 1UBHS 1ISMA 1JL3A 1YU6A 2C96A 1NXOA 3S6JA 3VDNB 2XTAA 1E3IA 1KQOA 1Z6YA 2EZUA 2X42A 3IKTA 2DQ4A 3VHQA 4UDYX 3K1AA 4Z2YA 4XQ9A 5EN4A 3V8NA 2PA3A 3VMFA 1JHXA 1U1EA 1Q16A 2AZMA 2YMQA 2C1XA 3PC6A 4HTAA 1X9HA 4NH4A 2DHRA 4TWAA 3PR1A 2JIMA 2X6TA 1MNAA 1ZCBA 3DOFA 4NE9A 5FA8A 3DL4A 3H3XA 3KEMA 5BN5B 2Q7OE 2YWBA 4Z4GA 3FPHA 3X1WA 3AUSA 1GLNA 4F60A 2FEWB 1CYEA 1ZUNB 1JS1X 2ETVA 2XYPA 5B7NA 1GUDA 1XG5A 2KM1A 4CG2A 1ODIA 4NSNA 1DMSA 5CX1A 2GZ2A 2W93A 4ZHQA 5AVRA 1RQXA 1TQ8A 2P4SA 4F3YA 1KU0A 4XM0A 3MLEA 4NU5A 1A9YA 3HR4A 3FWZA 3KM0A 3O1LA 3IPCA 3ONEA 4DCGA 3U16A 4C7OB 2EERA 3ZK7A 1Q0PA 4DDUA 5KOJB 3FW1A 3D7SA 1SZJG 1VKNA 4QAQA 3TM4A 2ZT6A 1KGDA 1TF2A 3F7MA 1KJ9A 2QR2A 1G59A 1NW6A 2BM0A 3R5KA 3WP1B 1GKKA 2HGSA 4JI1B 1EWQA 1N78A 4W7HA 2W6JA 1E7YA 1MHPA 1UDAA 2CUZA 3JARB 3IAS6 1U28A 1G0NA 4Q0MA 4FEYA 4RZXA 3M3DA 3IJ5A 4PGMA 1XX6A 3ENVA 3RFTA 2JFGA 3FMGA 5G4KA 1X8XA 2QAJA 1C0PA 4I08A 2FWNA 3CW9A 3WNBA 3K6SB 3W8DA 4NDAA 2V98A 1FX0A 2ZUTA 1GTG1 5JSYA 2JHCA 5KJEA 4UEOA 3DZHA 1EVKA 3BVPA 3EIEA 4KIWA 4J2TA 5BMOA 5L8VA 1YQWA 4OAOA 1MAHA 3EWNA 3GJQA 5HRUA 3Q9LA 3RQIA 1VPDA 2MSWA 2A14A 2QRNA 4PC1A 4YACA 4BHTA 2ZDHA 2I4RA 1VL5A 4CM8A 2AXEA 3OTGA 1Y1QA 3TVYA 2GTIA 2Z4SA 2EKPA 1YR6A 1FF9A 1M2VA 1G5PA 3JZDA 3W06A 2PCLA 5TV2A 1GQRA 3IUQA 5FUVA 3KOOA 3P4UA 2C9DA 2IYPA 2XOKD 4JBNA 4L9RA 1YZ3A 4ZT2A 1NBHA 1W5EA 4KSBA 1CLUA 3DF7A 3VV3A 3Q6NA 1MOPA 5HQ3B 1T2DA 4EPWA 2QW1A 3C7AA 3PT5A 3WGMA 1A9XA 3DAPA 1N2OA 1W52X 3K0AA 5J5AA 5IBCA 1ONOA 2R48A 1XRJA 4A92A 5FKJA 4C0WA 1R4NB 1YMVA 3MBKA 1TT5B 1ZONA 1DEKA 3NDJA 4KOAA 1WD7A 3IESA 1YVEI 1GARA 1QPBA 1EESA 3B1VA 4YBRA 3JW8A 2PSFA 1BKDR 1UDXA 2WPNA 4ID3A 4EDHA 3NNNA 5GAJA 1G291 4NBLA 1XAHA 3C1UA 1ORDA 5GV8A 4QDKA 5DXAA 4BKUA 4R1MA 3ZV5A 2FTKE 3CCFA 4LG1A 4R69A 4Y7DA 3RUAA 2VP2A 1QS0B 2BFMA 2R6R1 1EUCA 4GYJA 3FETA 4AZ0B 5BUSA 3DSRA 1WZIA 2YN0A 1YAHA 3G5UA 4C0SA 1FFXB 1KEZA 4LECA 4GT1A 3T1NA 3GEGA 3GLIB 2WTAA 3FDZA 1T8UA 4NZZA 2IYUA 4UQPA 3KV1A 4G65A 1W76A 4Q02A 2GR9A 1U0FA 3PKIA 1GPUA 2BRUC 4FS3A 4ND5A 5DK4A 5FUXA 2CDNA 1HDGO 3WDMA 4ASUA 4F56A 5KYNA 4DY6A 1WF6A 5A7GA 5FI0B 4EY5A 1JLLA 4EPVA 2X7HA 1AHPA 5DM0A 5EC8A 5EKTA 2HNKA 1WXGA 4M1MA 3T3HA 3MSCA 4Q9KA 2D5LA 5C81A 3R0JA 1GCUA 1TLTA 4NP6A 2ZQYA 3SEFA 4OQLA 3HKCA 1YS4A 2ZLBA 4F71A 4YHBA 5D3KA 4GQBA 1PSZA 2XMDA 2P9FA 1CS0A 2QLFA 5B3KA 1U2GC 4N01A 4Y9DA 2WZBA 4AFNA 3T3MB 4OQEA 2H11A 4QD3A 2XCLA 3ILYA 3UKDA 4C7BA 1XWFA 2BMWA 4YRAA 1F0YA 2NNLD 4F7WA 3R6TA 5FULA 3GR6A 4EMUA 3WGZA 4QTXA 4D4IA 2ACVA 3ZV4A 1V8BA 1LBSA 2BAGA 2V03A 2VPWA 3LQFA 3HDYA 3OHMA 4LI3X 5AKXA 9GPBA 1DWOA 4QPZA 4N7RA 3PDCA 2IOYA 4L4RA 1VMEA 2DPHA 4LQDA 4AXXA 3W6PA 1HFKA 1JXMA 2IYXA 4TUYB 2W00A 1I01A 1LXCA 4X90A 4BBZA 4HEA6 5A4DA 3BL8A 3OIUA 1O08A 4Y2TA 4YMSA 3ZE7A 4XWKA 4GPBA 2Q3CA 2PWZA 2YFQA 1UEJA 2NW6A 1VCIA 4WL0A 3VOBA 3IT0A 1Y6FA 1U63A 1DIGA 2XUIA 3ZHRA 4RDXA 5J2TA 2WSBA 2VXYA 2FW1A 2I03A 1UEIA 4B47A 4C30A 1AKWA 4II2A 5LNK6 2O8CB 3E8XA 4WZBB 1XJQA 2ZOSA 4M1QA 3GLRA 3EPLA 4U2EA 5LWHA 5FNVF 4TMVA 1K8QA 1D3AA 1PGPA 3AETA 5EWJB 3V46A 2WD7A 1J25A 3WQHA 5JD6A 3RM3A 5KOHA 2GUGA 1ZD8A 2Z2ZA 1LPMA 1P5ZB 1T36B 5IJAA 2SCUB 1MO4A 4I50F 1KZ6A 2I33A 4C78A 4KUHA 4ITUA 3X1YA 5IMBA 2VDWB 2Y8EA 2JLAA 4EFKA 3D4NA 5C5DA 4CGZA 3MCVA 2X5KO 3VNVA 1N34B 4MYRA 1KXZA 3TX2A 4HGNA 4KQEA 3PIIA 3UPUA 1UBOS 4N7JA 4ZAGA 1U5BA 2GAJA 1I24A 4QRIA 1RBQA 3TO5A 3TTSA 3IDQA 1XZMA 4HNVA 6YASA 1HLFA 3HFGA 2JK0A 4KRYA 3VSBA 1CUGA 2IQIA 4U0KA 4G5QA 2PZMA 3TFQA 3LWDA 1SKBA 3PXDA 3CZ9A 1IJKA 4O63O 2R85A 4BZPA 2PH3A 3PNVA 4HGPA 5CB0A 1GT91 1WXEA 3B51X 1PFWA 1NR1A 5G02A 3C3AA 5JLAA 5H4GA 3VO8A 2YYZA 5GZ1A 5JBNA 2IOHA 3H0KA 1Q21A 4I4TF 1N0IA 1U1DA 4QLAA 4E3WA 3DUWA 3EFEA 3C43A 2H2WA 2JEZA 2OB1A 2GVNA 2LV8A 1DCMA 1ORRA 2CHVA 2CLHB 3KWMA 1THTA 3AY0A 2DHQA 3QBDA 3F49S 1RRVA 4DAOA 4MDFA 2JKYA 3N2EA 2YV2A 3DTNA 3F74A 1SXHA 4ID9A 2V6IA 2FSGA 5FNZA 3S28A 3USCS 4QUKA 4K6MA 4IDGA 4WCVA 4LVOA 4CZ2A 1LF0A 3RVRA 2PX4A 2J87A 2BJVA 1BFUA 2HJSA 4IDAA 1CJVC 3Q87B 1VHJA 3DHNA 3LWBA 2HXGA 1WL8A 3V34A 4YCDA 3LMKA 4BN0A 3NM5A 2SHKA 4OGGA 3QVJA 4GG1A 3IPRA 5CDHA 1GPDG 1HE2A 3R3WA 1UANA 1E2IA 4XLTA 4MRMA 2C95A 4KAFA 1UCFA 1V39A 3TZQA 3CKLA 3BXEA 1Z5OA 4RUKA 4YVFA 1V1JA 4BE4A 1JHUA 2H4YA 3G8YA 4HC4A 4QDXA 1ZC4A 3VAZA 1C1XB 2HA3A 2AFHE 3OLZA 3E3OA 1II8A 1T5IA 5J58A 1O77A 5F73A 4LAFA 4E6PA 1CXZA 1M1YE 2G3YA 3RNLA 2I29A 2J0EA 4Q01A 2VJNA 1QV7A 4LYGA 1XZDA 3GLGA 5I4CA 3WWPA 3ZGOA 4US2R 1BHSA 1H9BA 4RZHA 1YQTA 2YXEA 5D6OA 1XMPA 1KEWA 3KR1A 1W48A 1Z9BA 1EDDA 1LDGA 2YQ5A 4KE8A 4TRJA 5K0ZA 2RGNA 5LOVB 5DCUA 4KLCA 3KUCA 1IM8A 5IZCA 4LHSA 1PR2A 1RAGA 4LJ5A 3NW9A 4UZEA 4AI6A 2IYFA 3UJDA 1JEQB 4MI3A 1TNDA 2PX2A 4OA5A 1SC4A 1A88A 2Q2VA 4YY3B 4QM6A 2I2CA 1Q1NA 2AE2A 3QLTA 2CYBA 5KB3A 1MT3A 2BF4A 1RE0A 1FDIA 2VUTA 4B45A 2ZRGA 5C4GB 4TZ6A 3ER9A 1OFVA 3KJFA 3HWSA 3OUUA 1QH8B 1YGYA 2VBCA 3Q9SA 4M55A 5C8YA 3RU9A 4CCYB 1U7XA 2VT3A 3LX4A 3VC1A 3NHRA 4YRKA 1AF7A 4DADA 2BFCA 3EVBA 2B8TA 1VIMA 2VTDA 3AFGA 5EUMA 4W5HA 1HFJA 2I87A 2WV9A 3ENQA 1QP8A 4OHVA 1EK2A 1ULAA 4CLOB 1Y8AA 4M9XA 5J63A 5I8PA 3GP8A 1RKQA 5IC4A 2P30A 2VP5A 4JC8A 4M86A 5CRIA 1KHHA 3RRJA 3D4LA 2UXDB 1IM2A 2D3TA 3RUHA 3GUVA 3K09A 2EYUA 4UHDA 1L8XA 2F4NA 3HLKA 1WMAA 1XF1A 4UNIA 5DYYA 3WRXA 4QUAA 2I2BA 4COKA 1QFYA 3H4VA 3MTDA 5BUQA 5M3BA 4YR9A 1QTRA 2B25A 4JKOA 5KTNA 1VE1A 3L0IB 1D1TA 3G2KA 4DLAA 2CV0A 3N2IA 1TVMA 2AF4C 4D43A 4GKJB 2O2EA 2X9QA 5MF6A 5JPCA 1QO0A 1GN9A 2NSHA 3R6DA 3CR7A 4K9PA 3ZDQA 1CE8B 1W85B 4EA7A 3HBLA 4EDFA 3FZYA 4G09A 2D06A 1OYOA 2EBWA 1VI6A 2HRCA 4XAQA 1PX0A 5ELLA 3TLGA 1QFJA 4FUTA 4OP1A 5FL7D 5TE9A 2RI1A 3RRYA 4BVKA 3PTAA 3HM9A 1F2TA 1ICEA 1SB8A 5IT9A 4PTYA 4EFNA 2RB4A 4L1KA 3GGSA 4DLZA 5JWRA 2HL6A 3VAYA 2GCOB 5I8WA 3RV4A 5FUMA 5JNWA 3O93A 3FDFA 2IS1A 3F6RA 4YXFA 2GO1A 4BFTA 1ZBQA 2XCTB 4M46A 1GGFA 1G8FA 3M0EA 3WADA 5LQNA 3TI9A 3KETA 3C48A 1JBQA 1RPJA 3CZRA 4L3VA 2B35A 4X85A 4TRRA 1NLFA 521PA 2FSVA 3RC3A 2KBEA 2FPUA 2OAP1 3C6KA 5JMOA 1G20A 4RQBA 3Q7QA 4EAQA 3DJYA 3OQ6A 2JBAB 4C01A 2FF7A 4X1IA 3LWZA 3QYJA 4RMHA 4WW0A 1I3KA 3GO4A 1KQGA 2PFGA 3EIOA 3HCNA 4Q6BA 3DOHA 1CLEA 3FPKA 1GAJA 4PSUA 3JASA 2NU7B 2VYNA 5HP4A 1ZEMA 4DV6B 3NHYA 2E4XA 2A35A 3H8WA 4AICA 3NBAA 4GZLA 1YS2X 4YEDA 3WIVA 5EXPA 2ZWIA 6CHYA 3TSAA 1Z4IA 3KBBA 1PX2A 2H7VA 5K09A 2ERXA 3WWOA 1WU7A 4JS0A 3PFNA 4Q24A 4P7KA 4RY9A 4EEXA 3CVWA 2QRZA 4BU0A 4N8EA 3AP2A 4MGEA 1Z0SA 2M2IA 5IYZF 2BFBB 2MTBA 5E6RA 3Q40A 3EHEA 2D5BA 2Z8ZA 1V5FA 4IVNA 4G1UC 3NLLA 4CEJB 3VDQA 3A4YA 1DLIA 5E1OA 4Q12A 2R7LA 2BFWA 1FU4A 1ISGA 2HSWA 4MVJM 1L1FA 2PBZA 3D3QA 3CUTA 3EG9B 3PDUA 5KWIA 3BKWA 4F8EA 1DBSA 2C58A 3C1AA 3P2YA 1ORHA 2P62A 3V4LA 4OLHA 1ZK1A 4Q3DA 2V6FA 3LUDA 1OXKB 2BZ0A 4ZQEA 3VOSA 1QFZA 4M7RA 4JK3A 4MVJA 4BP1A 1SC9A 3ZW8A 1FBTA 1O4WA 1ODKA 1QYWA 3PXUA 3DFFA 2PLFA 5DEIA 1XK7A 4BQIA 4ZI7A 2GCNA 5AKKA 3U56A 1YR8A 2V7QD 3GCGA 1KETA 3V5NA 1G8SA 1UBKS 3HV2A 2WM9B 3R3SA 3ET5A 4BVJA 1PLLA 3EC2A 1CVRA 3HVRA 1CR4A 4P4LA 3N5CA 3F5MA 5KMGB 2ODQA 1VI2A 1M2JA 4ZVLA 1UP6A 1LK0A 1V7CA 5T4EA 3ZU4A 3NRCA 1JXAA 1JSCA 3QHPA 4HQRA 2PZKA 4JP8A 3FUCA 4L9AA 4LZZA 4X1YB 4ZDIA 3FSJX 1YASA 4BPBA 1Z2OX 4KO2S 3ETGA 4FSXA 1VCNA 1ZUWA 2Q7DA 1EKXA 3AFOA 1X7YA 2XNCA 4Q82A 2ZM6B 2JZNA 4WEOA 5DYNA 4CTOA 1S2IA 1XQVA 4GXNA 2COUA 2APJA 3DLTA 5CM8B 3SSAA 4U2BA 3U4HA 2QYSA 2Y9PB 1RKBA 1NXXA 2BM9A 1Z4PX 1OKKA 1P2BA 3KQYA 1O97C 3IR5A 4JL5A 4I5IA 4QTZA 4U7PB 5IF9A 5C5CA 1R9JA 4FYWA 1J2YA 1WMFA 3DMYA 3RK1A 1SQ6A 1VXOA 3DV0B 4QXMA 3QKRA 2HCTA 4P3XA 4ZDJA 2BGLA 1YS6A 3HRIA 1LLQA 1RR6A 1OAKA 4LOAA 4YJFA 2YY7A 1UMKA 5CB4A 1OFUX 1ZMXA 1QB7A 3R5JA 3DZFA 3NJ8A 2FDRA 3LF2A 5TQ2B 3FBTA 3STUA 4LRYA 1YDWA 4G5FA 5L53A 2QL5A 3S8YA 2GK3A 3ZJUA 5IDYA 3OQ1A 1AH2A 3JALB 1SUSA 2AX3A 3BSYA 1DDGA 1EQAA 2AQKA 5AW8A 3D7LA 7YASA 5ICSA 2A33A 1E4EB 1ODJA 1SK8A 2J3IA 2RAPA 1ZCJA 3IVCA 4TWBA 1DXQA 5DFAA 3ZLTA 2XWQA 1R0RE 2WTNA 5BN4A 3MOIA 1O5TA 7AT1A 4IGFA 1DUIA 3OJ0A 1JDSA 5H4HA 1SXJA 2Y1FA 4CMGA 3C45A 3LDGA 5FOSA 5HF5A 4E32A 3FPLA 2V59A 4CMIB 5AVVA 4C5AA 3K15A 2B30A 2XUOA 3MHTA 2K7ZA 4RPLA 1PJQA 3G9QA 3IEVA 3S2EA 1YFKA 3QBEA 1KYZA 4R98A 4MIYA 3U49A 4EYGA 3PUWA 4INJA 1K7EB 1L4YA 1P1JA 4JC5A 1ZXBA 3H0CA 1SKYE 2O2ZA 3TQFA 5GADl 4LXQA 5A1TA 1UFVA 4TSFA 1ZOPA 3EVFA 4F5YA 1OYYA 2IU0A 4NI5A 2B20A 3KXDA 1ZY2A 1NVGA 4UUQA 4LHYA 3LY7A 4LY3A 4IJ6A 1J56A 5JVDB 4O0LA 1KKLA 1TKCA 3PRHA 2BGJA 4LC1A 2XE4A 4OI1A 2CV2A 2H2HA 4PYKA 2NT3A 2ZIWB 2P9YA 3RR2A 4B35A 3A1CA 3AESA 4DLKA 1Y7HA 5BT8A 3NM4A 3AQ4A 1T2VA 1CDEA 3H13A 2QI9F 2OXTA 1DT5A 3STWA 3WHPA 2BEUA 4DLTA 5UKDA 1XA4A 2ZULA 2VQSA 5LBTA 2WNHA 3IKMB 3ABZA 3AKCA 3OKFA 4IWYA 1W34A 2JS7A 3F3KA 3R3HA 1GAWA 3LBHA 3QEMA 4F92B 1XTVA 2ILVA 1P1CA 3AR8A 4AUNA 2QPAA 4IF6A 4I4CA 1X94A 3PLRA 1PHPA 2G9VA 2ADOA 1KSFX 4AZ3A 4IGKA 2Z3WA 3MJDA 1U0HC 3I5MA 1S3IA 1BXZA 3W04A 4CG3A 4TMFA 2OCKA 4X63A 4RA6B 1PJTA 1QH1B 2PJDA 3OEED 1Z4MA 2D74A 4WK2B 5E0OA 2ZYIA 4A6EA 3A9RA 2XMQA 3ZWPA 2BKAA 2HY7A 2W0MA 2F43B 3LYUA 3QFFA 4WN9A 2NU8A 4IJQA 3UV6A 5BO5A 3K1JA 1NN1A 4IHQA 1GL9B 5CPBA 1S2GA 1VIAA 5ALEA 5BQPA 3RT1A 5G41A 3SZOA 3T5TA 4D6XA 2V45A 1HXHA 2BZSA 1AKVA 3QSGA 4GLJA 3PLNA 4HMPA 5AVWA 1XD8A 4PPYA 4DIOA 1L5MA 3TNLA 1TB4A 1Q0SA 3G2LA 5BPHA 3EEQA 1HM5A 1L4FA 4Q7LA 3UHOA 2POCA 2IBSA 2C59A 4U9IS 3GJ3A 5ALRA 1IJBA 3F7OA 4B6RA 2JLVA 2PGXA 3W5VA 2AG0A 2C3UA 5J3JA 3FCSB 2ZM5A 2FEPA 4W5WA 1NW8A 3RBAA 4RF2A 4YROA 4B4UA 3WMRA 5DPMA 1JZTA 3EJWA 4NARA 4PICA 4A0QA 4K86A 2QOEA 5CD9A 9LDBA 5K45A 3X2EA 3JAMA 4RPIA 2C2KA 4YQZA 1IWPB 5BN1A 1F6BA 2BGGA 4RPHA 1HT0A 4D1YA 1M2FA 2PTHA 3RIMA 4LWOA 1L1QA 3C3KA 3U9SA 1QZ3A 2X41A 4D46A 3KB6A 4RJ2A 2Z09A 4GM1A 4UARA 3GU3A 3VVMA 1GY8A 4KREA 3V1LA 4DVJA 2PQ6A 2DUMA 2GN9A 3ITDA 3LOQA 1HZZC 4Y3UA 4R1UA 2HRQA 4D80A 4F3KA 3MNFA 4W8HA 1GPAA 3DLHA 2HIAA 1ICIA 5EZYF 4EZIA 2C5GA 4ZZ3A 1L7RA 1OVGA 2Q6LA 3CEHA 1ULBA 3FF1A 2D5AA 3U7RA 3WK7A 5KWJA 4LK2A 3OZTA 5JT1A 3GBPA 5DN9A 4OI2A 3ZHUA 4WV3A 4KI0A 2QYOA 2IHJA 1NVVQ 3E15A 1E92A 3GC6A 1KEUA 4NAUA 1FVXA 2G82A 3A9TA 4M1OA 4NNPA 1HSOA 5B3LA 1IUPA 3KQQA 4E5DA 1X2BA 2WG2A 5LB4A 3BWXA 3RK4A 4GOKA 2AFHB 1VIDA 1X9IA 3DLPX 3QKIA 4QGHA 2NTVA 4NKRA 5I01A 2H2FA 2AN5A 1P1KA 1SUWA 4JYPA 4CUKA 4Q4JA 2ZUFA 4BC1A 5IJ9A 3O8QB 3U7QB 3CF6R 1UMCA 3KV3O 1QWSA 2CVHA 1C8LA 2PY6A 5BQOA 2HA4A 1I6WA 2KW5A 3KT8A 4Q1DA 3TCNA 2QORA 1CUYA 3LUAA 2Z57A 4GF5A 1BX3A 4AAYA 5LD2C 4MVJD 1PCXA 2GZRA 3HY3A 3C4QA 3K31A 1TLLA 2QUJA 5I9IA 3CQ9A 2P6MA 1H2RS 2QTNA 4P7FA 3JYQA 3ZDEA 3STYA 3L7OA 1F2VA 1OMOA 4O33A 1YKSA 3SJ7A 2DBZA 4YJ3F 3R5SA 4TQ9A 4D7AA 2XCUA 2FX5A 1VL2A 3AUJB 4XX0B 1DQNA 4YAKA 1RHRA 1XZFA 4GLFA 4OUKX 1EFKA 3VPBA 3QIAA 3FYUB 4EENA 4R2MA 4JEHA 3SPXA 3CX8A 2D0PB 4YRQA 3BCUA 1WHSB 4ZCPA 1JBKA 4IXMA 5KWSA 5E4TA 1YOVA 1RXSA 3KOUA 3EW7A 3WYDA 1UUFA 4EB6B 2UZ3A 4OLBA 4IV8A 3JTMA 4IR7A 1T13A 3AB3A 2OBMA 3BMCA 4MWGA 5JRJA 3LUKA 3GJ5A 3THWA 2Q4EA 4TKMA 3ZCTA 2O8BB 1UPCA 2PKWA 3A6DA 4TWIA 3RVOA 3EQ2A 2I76A 4GXQA 4HRXA 2OO5C 2Q2QA 3PGKA 3N3BC 5EVCA 5FQOA 4FEEA 4EG8A 3A0UA 3CNQS 1YULA 1O87A 2HLDA 4HNSA 2IPNA 3TSOA 1GCGA 1NGSA 2QRUA 3NHSA 2G67A 3O8BA 3WGIA 3UW3A 1MB2A 1QLHA 1Z8HA 3ED1A 5SZIA 2WFLB 4QBHA 3RYTC 4GOMD 1HR0B 4FGKA 4CMKA 2PDAA 2OHJA 4M7OA 2WWFA 5ETJA 1FUEA 1COWA 4HDQB 1SOUA 2IYVA 4Y2XA 1ZVQA 3KQMA 1YI1A 2IXFA 4GYKA 4OP2A 4S05A 4V0KA 2PS0A 5BW4A 1IY1A 3AUAA 4JI6B 5CVTA 1FFHA 2AI1A 5I9BA 3LX6A 2NVUB 4B0PA 1U99A 2IA5A 4IQGA 2C7VA 1ISJA 3VJLA 3LCUA 2QEQA 1W1WA 2QRQA 1YQDA 3H1BA 4MMYB 2I8LA 4INOA 5BOSB 2WICA 5CLJA 3PIRA 4E5UA 4Q4DA 2QTFA 3OZCA 1H2ZA 1OVMA 1BJRE 1DAEA 2D54A 4IZOA 1OSNA 2GPYA 4FEGA 2WF5A 3FPFA 5FV7A 2B3DA 1ECFA 4EI8A 3RB8A 4GMFA 5AW4A 3WV5A 4F84A 2Q3DA 2D2VA 2YXPX 5DXFA 5JCZA 5IBPA 4HEJA 4WA8A 3V4SA 1RS0A 4K05A 2O2GA 1V37A 3L7IA 3PSHA 3O7MA 5EJMA 1QQAA 2ODNA 4ZOEA 1J2RA 1HGXA 1ZM3A 2NU6A 3ZWOA 4L85A 2JJMA 1P80A 3OE4A 4RK4A 1J21A 3DD5A 1S4MA 4C1BA 3KAPA 1I1QB 1WCWA 3DUFA 1FP4A 4TSFD 3GEMA 5DHPA 1TYEB 1KDYA 2QV0A 1RM5A 5E2AA 3TIGA 3CE9A 3DM5A 4D92A 1T4BA 1EFVB 3I37X 1CP2A 4C43A 1P4AA 3CLRC 3SZLA 3FSEA 3HFSA 2OCPA 4GS5A 3UJBA 5KVSA 2NN3C 4WT7A 5D85A 4UTPA 1L2TA 3DMDA 4MLCA 2BMDA 3DEFA 1KI8A 3NPAA 1OIWA 3A2NA 3ACCA 4XPIA 5H80A 4CGYA 1EAMA 5G0WA 3DE1X 4DLSA 1CZLA 1NJGA 2Q9UA 1XC7A 3F8SA 3OBIA 3OZVA 2IOFK 4LDZA 4BO6A 2WA1A 4N0MA 4F6LA 2FWRA 1H8EA 3LGAA 1DO2A 3B9RA 1JQEA 5KQRA 5T3YA 3LCCA 3UVEA 3V8RA 2FQYA 4X7BA 1KQNA 4C08A 1HSZA 1RE1A 4OBWA 1I3OA 3WBFA 4C7JA 3QE9Y 2GPWA 4F3TA 1UBSB 1FL9A 2G5PA 3HBAA 2QXUA 2VNJA 4ZJPA 3GBVA 5KC9A 3K2QA 3ZGVA 4WASA 2QXTA 1KO8A 3GY0A 2C5HA 1RRGA 2NV0A 1GNQA 1NP3A 3TRDA 1SQGA 4A6XA 3NEJA 1MV5A 3PFCA 4F96A 3HJUA 1PG2A 1XCLA 1DC8A 5KQPA 4RTKA 2NUAB 3LPAA 4LVCA 2QVBA 5AOBA 3IJPA 3P26A 4C0HA 2R0QC 3GFOA 5BR8B 1RYBA 2Z58A 4AS3A 3EGVA 4HB4A 1KFBB 2G1JA 4TZTA 3WDKA 2NSYA 1W8IA 4B3HA 1UQRA 3AYXB 4QATA 3TVDA 3ASZA 3EEFA 4RS4A 3WXMA 1NYLA 5HXAA 5IDWA 4QWMA 2HHHB 3JRNA 3I04M 3PD0A 4D8WA 1SIBE 2F1OA 4I3FA 2VEDA 1N2SA 2R25B 1O95C 1ZGCA 1Q1ZA 1M54A 2VF5X 2XDQA 3OF5A 4LVUA 5K3EA 4NZNA 1S8FA 3PR3A 3W7VA 2FDXA 2EG9A 3DNFA 1WCXA 3BE5A 3H1AA 3Q3GE 4URXR 2VRNA 3I8XA 1P4RA 1S8OA 3NEPX 1E1CA 4PGAA 2A7QA 3S2GA 5M2QA 1EGHA 4UTRA 4ZTBA 4COOA 4YJ2B 3ZCQA 3R9XA 2ODTX 1RRFA 5D00A 1LUAA 5BQ3A 4DB2A 4JBXA 4ZYVA 2DEUA 1X1BA 3VGJA 4BLRA 3K0HA 4J76A 2GZ3A 1P6QA 1M34E 3UCXA 2OP1A 3NZEA 3IR6A 3T3DA 2XJ4A 4JU8A 1T9HA 4PG8A 5JVDF 5LQRA 2WPDA 1SVOA 5B7QA 3K70D 3VH2A 4TLMB 2R6GA 2HLNA 3ZOZA 5JAIA 2ZPTX 4YB8A 1GEGA 4FW9A 3ZV7A 1B3BA 2K87A 2MMCA 3DVRX 4UQLA 3CV3A 2HU8A 1EWKA 3GYGA 5FPHA 3SY8A 2PJRA 2LCQA 1XNQB 1R66A 1M2WA 3GEDA 3ND6A 4Q9HA 5K6AC 1ORWA 3G9UA 4L57A 1P1FA 1T0BA 4PM4A 4Q05A 3OCWA 3P9QA 3S70A 2H29A 4FHEA 4I9FA 4YJHB 3RANA 5HJEA 4OHYA 4O4JF 1FYXA 1LEHA 1Y9DA 3PC7A 3P94A 1N5DA 2WEKA 4CU2A 2CXXA 3GQBA 4QOSA 3GRZA 1IH8A 5CNMA 5T8KC 2I65A 2BJWA 4QPJC 2FXIA 3C1TA 4W9NC 2Z0MA 1WW8A 3TZKA 3OE1A 4Y2YA 4LYDA 1JHPA 2J32A 2CVFA 1II9A 2NZVG 3OIFA 3QEJA 4O25A 5T67A 5KJCA 1TIBA 3DYIA 3JAKA 2C2MA 3K5WA 3LU1A 5EE9A 4CT4B 5JUWA 1A82A 2ZAGA 2G83A 2VR1A 2JBHA 2G4VA 2X8LA 3R75A 1YJBA 1AY0A 3VYTB 3AL3A 1E69A 4QOHA 1TZBA 4K03A 5BNWA 3EEIA 3GLGE 3BGOS 5E0KB 3U7EB 2AXNA 2M6SA 3NIWA 1NW4A 1QFMA 1SKYB 4CKWA 2BP7B 2E21A 1E3WA 3BIWA 2J85A 2H65A 2I1LA 2C8LA 2E82A 3E4CA 4N18A 5B37A 3ZCSA 1B1AA 1NJ2A 2H6EA 4WVLA 1NN5A 1XHFA 1N1DA 1OI7A 1ABBA 1G8JA 3LXUX 3W5JA 5LU8A 4QU9A 1NVFA 3KB2A 3T5AA 1H2YA 2ZUEA 4LI0A 3KQUA 4CEIB 2I6SA 3L8DA 5ALLA 1N6OA 4P0TA 2JD1A 2QNIA 4Q19A 3CJQA 4MVJP 3RNOA 5K9ZA 2HLDD 1MJGM 2VVTA 1Z15A 2XEXA 3N8GA 1KZHA 3KQKA 5IKEA 3SNKA 4K6CA 1NE2A 3GGCA 5ALOA 1DELA 1MJGA 2UDPA 3UQYS 4D3XA 4LZWA 3CVUA 1U2EA 4BO0A 4B3RB 1NSTA 1XAIA 2EATA 1P2VA 5I47A 5ITWA 1FNMA 1DLJA 4RZUA 2FR1A 4YCAA 2GD0A 4R71A 2OL4A 3JS5A 1MP0A 4XCVA 2QQFA 4EG7A 5AVYA 1CJTC 1QQ5A 1ZCAA 3B3AA 3EZ9A 4KW7A 3WO1A 6ADHA 1JF8A 2PD4A 3HXTA 3R2JA 2C61A 3HA7A 4H17A 4ZAXA 3CO5A 1NF9A 2J4CA 2OY0A 3P0RA 4KLZA 4BAZA 3K8ZA 3BILA 1DKQA 3EGDB 1GUAA 1RP7A 3J80A 4POAA 1OH7A 2QTAA 1FFAA 1XLTA 3GJXC 1ZL0A 4MV0A 1ESDA 5FPQA 4K8RB 1OZGA 1KYQA 1NZDA 1T8YA 2VP3A 3GEEA 3MMSA 1PJCA 2XQIA 4LGVA 3V7UA 4QOGA 4FCCA 4CBVA 3DEJA 5C3MA 4ZREA 4WLOA 1NW5A 2AZ4A 1NXQA 1P2DA 2ZRBA 5E8RA 4L5BA 3M34A 4IDCA 1SU7A 2QAGA 2R7AA 4K9KA 5G0VA 4CNQA 2OFOA 2Y1EA 1JSZA 1PKXA 4UULA 1KQPA