1UZLA

Maba from mycobacterium tuberculosis
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
239
structure length
231
Chain Sequence
AKPPFVSRSVLVTGGNRGIGLAIAQRLAADGHKVAVTHRGSGAPKGLFGVECDVTDSDAVDRAFTAVEEHQGPVEVLVSNAGLSADMTEEKFEKVINANLTGAFRVAQRASRSMQRNKFGRMIFIGSVSGSWGQANYAASKAGVIGMARSIARELSKANVTANVVAPGYIDTDMTRALDERIQQGALQFIPAKRVGTPAEVAGVVSFLASEDASYISGAVIPVDGGMGMGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Maba from Mycobacterium Tuberculosis, a Reductase Involved in Long-Chain Fatty Acid Biosynthesis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Oxidoreductase
molecule keywords 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
total genus 78
structure length 231
sequence length 239
chains with identical sequence B
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2004-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1uzlA00
4R3NA 2Q4EA 2P9GA 3WTCA 1S6YA 1VE9A 5CHEA 4B3IA 1B15A 3D1LA 2WSBA 7ADHA 3BMOB 3HN7A 1PQUA 1DC3A 4BS9A 4L75A 1PR3A 2X4GA 5JPIA 4CM1A 1YBVA 1DC5A 4CQLA 1NX6A 4EGFA 3UXYA 1E3JA 4F45A 3I5MA 2D5CA 1HDRA 3DMTA 3EK2A 1SAYA 1P77A 2DVMA 1HLDA 4J43A 3C85A 3H2SA 3W4IA 2AQKA 4CMJA 1VL8A 4XX0A 4TVOA 5B1YA 3RI3A 3RUAA 2E48A 4M49A 1LSJA 4XZ3A 3GDGA 3S1LA 4WCFB 3WNQA 2BFMA 2X9NA 4OXNA 4CLHA 3DTTA 3L4BA 1T1RA 4WLEA 1B2LA 1NVGA 3UHAA 2XF8A 3NT2A 2NADA 5AYVA 2NQTA 3I52A 2WEKA 2WE7A 1N9GA 1LDNA 3ZU3A 3WBBA 4CM9A 2HK7A 4Z0HO 1LDMA 4CQMD 3GH3A 3U4IA 3JV7A 2AE1A 2JHGA 3QWAA 2Y1GA 4MVJM 1XU9A 2VRCD 3ENKA 3DBHB 3DZFA 4M89A 1PJTA 2NSDA 2O3QA 4YXFA 2AEFA 3CE6A 1ZZEA 4BO8A 1PL6A 3V5NA 4TQGA 2DPGA 1NP3A 4N5NA 2QX7A 1VLLA 4YJHB 4BO5A 5AQ1A 4CQMA 1FF9A 1E7QA 2I76A 2ZQZA 4JP3A 3GZNA 2VZ8A 5I8WA 3ZNOA 4ND4A 4L4RA 1NFRA 1LSSA 4EEXA 1M6HA 3ASVA 4PZCA 1DHRA 4XB1A 4CQLB 1LXCA 4HFMA 3GEDA 4ZVVA 2Q1UA 3HE3A 1YVEI 2C54A 3V2GA 4HADA 3IQDB 3W4KA 1ZK0A 4IDDA 4Q3AA 3BTSA 4DXHA 6ADHA 4D0SA 1HE2A 4MKZA 1F8GA 3EZYA 4OL9A 1DBVO 4ZGWA 2FZWA 3ABIA 3DAPA 2NU7A 1SCUA 2AMFA 4CL8A 5TRTA 2GD1O 2VHWA 1YBAA 4B4UA 4GX1A 4NK4A 1EBUA 2VUSA 1DRUA 4HX5A 1VRWA 4MJLA 2AA3A 3OQBA 3RU9A 4MKXA 3O03A 1YS4A 3GFGA 3NRCA 1JA9A 1GYRA 3JD1A 2VHXA 1R16A 3JQ8A 1DO8A 3IS3A 4Z9YA 1QYVA 4GWGA 3ONFA 3ETDA 4LCJA 3H9GA 5THQA 4L9RA 1WZIA 2O7SA 4CM7A 3PGXA 3FNEA 4J4BA 5I7SA 3KSDO 1LQUA 2J5KA 1P44A 2VRBA 2JCVA 3PZBA 4GLLA 4MPDA 4OHUA 4ZRMA 1KERA 1E7RA 1RPNA 4J1SA 3WSWA 1BG6A 1FMCA 2VT3A 3SJUA 2C7GA 2ILTA 1EUZA 1F0YA 1TI7A 4W7IA 3HDHA 4MIEA 3EVTA 4BGEA 1HYEA 1H0KA 1K6IA 2WYVA 3LQFA 4D3DA 4UUMA 4IQ0A 4N5LA 5IZCC 4E5NA 4OKIA 2P68A 5U9CA 1I2ZA 1LA2A 3MJTA 2EKLA 3LK7A 1QV7A 4DUPA 1OFGA 4YAJA 3B1KA 3EHEA 2ZTLA 1ZSVA 4U6QA 4QFCA 4WJZA 5LDHA 4U8GA 3VHRA 2PK3A 4FJ2A 5FYDA 2C0CA 2VNAA 1I2BA 4GVLA 4B4OA 2OL4A 5JCJD 1WP4A 4S3MA 4II3A 4NDNE 4Z9XA 3P2YA 1KEWA 1P1KA 2NV6A 1OC2A 4R69A 4WEQA 5L4SA 3E6AA 5L7TA 4M55A 2VYND 3K2EA 2EJVA 3NDJA 1WLYA 1RM5A 2ZK7A 1GYQA 5K6AA 1UDCA 1HYHA 1R66A 2Z5LA 2PLAA 1PTJA 2VOJA 4E5YA 3OJFA 3D5QA 4GBJA 2PGJA 3E48A 4U5QA 3RUFA 1BVUA 1DRWA 1X7DA 3AFNA 4YWJA 1VC2A 3BAZA 4KZPA 1HYGA 4U0KA 4D45A 2W90A 3RJ9A 1I36A 4OM8A 1I2CA 1RYEA 5I7VA 3WWZA 1KETA 4J7XA 2CVZA 3NX4A 2UYYA 2B4QA 3ZWNA 1P33A 3LVFO 3BHMA 4WLUA 4CL3A 1BSVA 4RVSA 1YE3A 3DOCA 3G3EA 3FPCA 4I9HA 1NNUA 4E2WA 1P0CA 3V2UA 3ZWVA 2DUUA 2CDBA 4IXWA 8LDHA 1BDMA 1TXGA 3PJGA 4FD3A 3WMWA 1E7WA 1JVBA 2YW9A 3NV9A 2Y1FA 5KVQA 4BGIA 4KUEA 3ROMA 1O6ZA 3DFUA 4J0EA 1YWGO 4D3FA 4AG3A 3F5SA 1NAHA 2F00A 2W2KB 5GZ3A 3LT4A 2XOXA 3TN7A 1AE1A 3TFQA 5JNLA 3JD3A 2HKIA 4H15A 2AE2A 2PR2A 3T4EA 5CDUA 1MB4A 1ZO8A 3C24A 1JKIA 3BZUA 5L7WA 2X0RA 3WOHA 4ZU3A 4DYVA 4M86A 1L1FA 4WLVA 2A4KA 4ID9A 2PKRA 3K96A 1DIRA 3ZCXA 3GG2A 3PEFA 1U7HA 4FSHA 2V6GA 1ZXLA 1JQBA 3G1UA 4BVAA 1EUCA 1LRLA 4GGOA 4GX5A 1DC4A 3E5MA 4I8XA 1NYTA 4PGFA 3AI3A 3TZQA 4GMGA 1NQ5A 2QRLA 8ADHA 1EQ2A 3HADA 4EJ0A 4EI2A 1NASA 1GPJA 4R16A 2RCYA 3GAFA 4PFJA 1O5IA 2OP1A 1U3UA 2QYTA 5LCXA 4IZIA 1DC6A 4PLPA 2HJRA 1B8UA 4E30A 1JAYA 3RFTA 4OXKA 5GY7A 4FFOA 1V3VA 3RU7A 4R1NA 3WFJA 3KYDB 1E5LA 5CFZA 2AEMA 4YJFA 2CNBA 2OZPA 3ZU5A 3L4BC 4ITUA 1PJQA 1QORA 3ITKA 4KOAA 5COQA 4CLOA 3AUSA 3QLJA 4J9VA 1U9JA 1T25A 2I6TA 4A2CA 4DPMA 2QZZA 5A06A 4Z9FA 1W4ZA 1V9LA 1NPYA 1K6XA 3Q9UA 2JAHA 4UUNA 2QQ5A 2B69A 1T2FA 3QVXA 4CMEC 5U4QA 1I8TA 3A9WA 3L9XA 3AOEA 4HNGA 1SOWA 4BNJA 5KJ6A 1HZJA 1SEVA 2HLPA 4GKVA 4NIMA 1IPFA 2X0IA 1PZGA 4L4SA 3OH8A 4FFMA 5BR7A 1GD1O 2ET6A 1MFPA 3OMLA 1EBFA 3DFZA 3ANLA 4PLGA 2XAAA 4G2NA 3JYNA 2H5LA 4KUHA 1A4IA 2GSDA 3HB4X 5L53A 3ICPA 4KMSA 3FNGA 1JWBB 2VHYA 2X7HA 3PYMA 1XEAA 4J4TA 4K9DA 3OA2A 5EMHA 5JAQA 2RAFA 3WYCA 4HKTA 2GASA 2X1HA 1GCOA 2NLOA 3HDQA 3WWYA 3E9QA 4XR4A 2GDZA 3PI7A 4BO7A 1ZK2A 3VZPA 3H7AA 4UVHA 2JHFA 5IDXA 2PWZA 2TMDA 1H9AA 3HNPA 2CY0A 1HZZA 1UXGA 2DFDA 2BMAA 3FBTA 4PRLA 2P2SA 1LDBA 1NWCA 3VZQA 3TFOA 5G4KA 4R5MA 4YAGA 3BTVA 4FN4A 4WLFA 1ZIDA 2OFPA 4AJOA 1Z6ZA 1PZFA 2NU8A 4A10A 4RVHA 3DMYA 3K5PA 4LVUA 2YHIB 4FOOA 4LSMA 3PWSA 5JCJA 4BNGA 3GPIA 5KJCA 2JL1A 3DXFA 4JK3A 4FFLA 1XYGA 3ZWWA 5ICSA 4JIGA 5JYEA 2PY6A 3IL2A 1IPEA 2X23A 2J3HA 2VYNA 5A9RA 2DFVA 4IPTA 5DCWA 4Z0TA 1F8FA 4BMVA 2OHXA 4O59O 4YRDA 3DBLA 2EERA 3F3SA 3D3WA 4WCFC 4AJPA 3ANNA 3O38A 1QYXA 4BO6A 2PKQO 4ND2A 3OEYA 1U2DA 2C7VA 1QLJA 3ETEA 3DR3A 4XWYA 4IDEA 3OIDA 1B7GO 4B7UA 4BNNA 5ILOA 1YQDA 3PIIA 2XXBA 5I9MA 2YQ4A 2G0TA 3U09A 2FP4A 4TROA 4R3WA 5ADHA 3VH2A 1BHSA 1FDWA 2DBRA 1QXSA 1JDJA 4CR6A 3UOGA 4FC6A 2CF6A 1TB4A 5BSHA 1E92A 3TZKA 3DBHA 3PLNA 3ZU4A 3HHPA 5G4LA 3JTMA 3EY4A 2WWRA 3C7CB 1ENOA 4Y9DA 2NTVA 4I5FA 1EDOA 4W6ZA 1WVGA 4WLNA 4PLCA 1LRKA 2CMDA 5A3JA 1LUAA 3CZRA 5AXBA 3ROPA 2OO5A 4P38A 4CQMB 3FRJA 4I5GA 1Z45A 2FN7A 3UVEA 1UR5A 1KBZA 3WNVA 1XLTA 1QYCA 3JYPA 1HL3A 4WLOA 4YR9A 3QA9A 3WG9A 2BF7A 5C7OO 3DZIA 3D4PA 1B3BA 1BWSA 1ID1A 3RD5A 3UUWA 1BGVA 3I6QA 1MX3A 5BSGA 4XR9A 4XRRA 1FDUA 1DLJA 1U3VA 1Y8RB 3KOUA 3A4VA 4J49A 3WS7A 4BNTA 3CKYA 2EGGA 1L7DA 4MIOA 3Q3CA 1JKFA 1H6DA 3DZBA 3GEGA 3EVNA 1ZSYA 2Y66A 1MFZA 3JQBA 3L0DA 2CD9A 1LNQA 5F1PA 4PCVA 1PJ4A 1Z7BA 2AQIA 3WIDA 4AJ2A 1H9BA 1JAXA 3WYBA 3IUPA 4KUGA 2HRBA 1R0SA 1XR3A 3GFBA 4NQZA 5A9SA 1E0DA 1UXJA 2JCXA 3MOIA 3DBVO 4RVDA 1QLHA 5TF4A 3EDMA 3OIFA 3PJFA 1OMOA 3TWOA 3BMCA 1X0VA 1E77A 1NPDA 1VJ0A 2FPIA 2X9GA 3BHJA 1N5DA 3HQ4O 5CPBA 2CSUA 1Y8RA 4J2HA 1MG0A 1K89A 4HFNA 4PLWA 3WLFA 2BHLA 3E5RA 4ZHSA 5IDQA 1LDYA 4IJVA 3DHNA 5EQFA 4BKQA 1F06A 2GPTA 3PHGA 2YFHA 1PJBA 4XQ9A 5JMWA 1PJLA 2C2YA 3OF2A 3LZ6A 4YT5A 2PZKA 1EDZA 4UREA 5DN9A 4NG5A 4ALNA 4F46A 3GNTA 3UCEA 3A06A 4IDGA 4MP3A 3X2FA 2BFPA 5T8KC 5DOVA 3H5RA 3QVTA 3H6KA 2OORA 2JAPA 1GPDG 5HRUA 2GLXA 3S2FA 1EE9A 1KVQA 4RDHA 5IZ4A 1D1SA 4D79A 5T6BA 4MO2A 3ULKA 4WPGA 4CJXA 3GVPA 5KWEA 1X1TA 2O2YA 1R0KA 2UDPA 4XKJA 1O8CA 2NVBA 1T1SA 3DL2A 3GHYA 3DBRA 4Q3NA 4FS3A 3U49A 1V3UA 2B5VA 4PZEA 1GFSA 4IMRA 2R00A 1E7YA 4WCDA 3ZU2A 7MDHA 4CLXA 5JAZA 4O0LA 1N8KA 3JSAA 1IB6A 1C3VA 2Y1CA 1VSUA 1WDKA 3IOYA 2GRAA 1X15A 3IKVA 3SX2A 3WQRA 2J8ZA 5KKAA 1C1XB 3ADPA 4Q3CA 3LT2A 1DIHA 1JKJA 3WDSA 2C2XA 4Y6SA 1B3RA 4WKGA 1U4SA 1P9LA 3NJ4A 1BTOA 3ZI0A 4XJTA 3I83A 3PJDA 3WGTA 2SCUA 2FR0A 3TNLA 1M6WA 4WASA 4EBFA 3UN1A 5G4KB 3VDRA 3R1IA 1YXMA 3QIVA 3ZWCA 4XCVA 4WK6A 1YJ8A 4MINA 2VZ9A 3PQDA 1SMKA 3GVXA 4EJ6A 1EUDA 4PN3A 1QRRA 1O89A 1OBFO 2DM6A 1CQJA 1PJ3A 2P9CA 3JYOA 1X7HA 2H9IA 1BW9B 4QECA 3UFXA 3FCOA 1IZ0A 3AFMA 4FJ1A 1R15A 2W4QA 4MP6A 1R12A 1AXEA 4NH4A 4P8RA 3ZDFA 1DEHA 1HDOA 1VJ1A 2IE0A 2IEDA 2YV3A 3BMQB 2HK9A 3LF1A 3GK3A 3MWDB 1N92A 3K9QO 2W2LA 4P4GA 1G6KA 4A5OA 1PJSA 1PS8A 4UVEA 5A03A 1GQYA 1E3EA 3KLPX 2VOEA 4XA8A 4IJWA 1IYZA 2OMEA 3GT0A 3ZWPA 5THKA 3PHHA 1IZ9A 3OJ0A 4M8SA 2DT5A 3K8ZA 2JD1A 1SB9A 2HRZA 4E6PA 1IOLA 1T4DA 1YONA 2H63A 2PD3A 3O8QA 3PHIA 4PZDA 5ER6A 4QX6A 4CUKA 5BNFA 4JBGA 3AU8A 4CLOB 2VWGA 5G0WA 3RUEA 4W9NC 5C7IO 4DMMA 2P9EA 1QG6A 1Q0QA 2O48X 1E6EA 3N7UA 3JQ9A 1O0SA 4UVGA 5IDWA 2JKVA 3K6JA 4GPD1 4CM4B 4FB5A 4CM9D 2Q1SA 5AVOA 1D7OA 4AJ1A 3ZV4A 4YT8A 1WNTA 4PRKA 3AM3A 2XPCA 3V1YA 1E3IA 4LN1A 5KJEA 3RJ5A 1FXSA 4BO2A 5DBFA 1R4MB 5TIIA 1J5PA 4GH5A 2Y1OA 4AJKA 4PG4A 1UAGA 1ZEJA 2ZTMA 3EZLA 1EFKA 4FR5A 1DIAA 4RORA 5A5FA 2Z1MA 3W6ZA 1CDOA 4HNHA 5IF3A 5JCXA 2ZB4A 3CMCO 1D3AA 5JBIA 3U0BA 2AG5A 5TNXA 2PGDA 5CDYA 5AXAA 3SBOA 4BUCA 2I67A 1ULUA 3K92A 4CMGA 3DTYA 2G76A 1VM6A 4Z3KA 1M75A 5IAAA 1B8PA 4EYEA 3VVBA 1CEQA 1VL6A 1ISGA 4TKMA 3B70A 3EAGA 1PWZA 2RBEA 3WBFA 1HTBA 4J7CA 4R1SA 2BLLA 1ZH8A 2VWPA 2G82A 3CH6A 3HFGA 1NBOA 3QV1A 3S2GA 4IJUA 5BSEA 4YYZA 2DU8A 1GYPA 4XGNA 1XGKA 1FDTA 2ZB8A 3E82A 1HSOA 3L9WA 4NFSA 1GEEA 4WCFA 3TOZA 4KDEA 3GAZA 5LDGA 1MA0A 2UVDA 1YGYA 2HUNA 3W8EA 4OOEA 4CM3A 2PGLA 3NTOA 4BKPA 3AM4A 4LMRA 4CODB 2D8AA 3PIDA 4MOWA 2NM0A 1PEDA 3PQEA 5DF1A 1I3KA 4C7JA 3FWNA 2YZ7A 1ZVMA 5F1KA 3W8DA 3ZWAA 1EK6A 3KYCB 1LX6A 3F47A 2Q50A 1GZ3A 5DULA 3DWFA 3GNSA 2C59A 3VKVA 4Q9NA 4XEHA 5A1TA 2DAPA 5I7FA 4E4YA 4DGSA 1M67A 1X1EA 2UV8A 3GGGA 3O26A 5JDIA 2VCYA 3FD8A 3N74A 3ORFA 3ZWBA 1I0ZA 1ZCJA 1ISHA 1ZEMA 4E21A 3PGJA 4Y8VA 1I33A 3AM5A 2Y1EA 2VYVD 2OBYA 1RM4A 3R0IA 4II2A 4PIVA 4RPLA 4L8VA 4F3YA 4K28A 4WNCA 4QEDA 4RPJA 3L6EA 1DDOA 3RQSA 2PD6A 1NFQA 1QV6A 1NM5A 1DAPA 4BHTA 4GSLA 1E1MA 4B3HA 2Y99A 3GNQA 3LC2O 1P1FA 2Q49A 2GCGA 1YRLA 4D41A 1T2DA 4YAKA 3IP3A 4PLVA 5COAA 4FW8A 1T26A 3TDKA 4ALMA 1FJHA 5BT9A 3BHIA 4XYEA 4ZICA 4ZA2A 4WOKA 5ER9A 5T67A 1I5RA 1MP0A 3Q11A 2POQX 1QR6A 1Y1PA 2WMDA 4NK5A 2BH9A 1I3MA 1PWXA 2IEBA 4KQXA 1Y8QB 1HSZA 4GX2A 3KZVA 3VPHA 4TZTA 3Q2KA 2TMGA 1MGOA 3R6DA 2O3JA 3T7CA 3AOGA 1XQ1A 3DZKA 1P3DA 3IC5A 1IHXA 2CVQA 1GADO 4BNLA 3OQ1A 1ENYA 4E3ZA 3C1OA 4E0BA 1SO8A 1Y5RA 3GGPA 2PKQP 3HUDA 1HDCA 4J4HA 3D0OA 2W8ZA 3RBZA 5KVSA 2YHUA 4G65A 1L7EA 2VN8A 2EIHA 1PL7A 5ILGA 2NVUB 3VH3A 4B7XA 2X5JO 1ZMOA 1P31A 4GWKA 1KY4A 2NWQA 2Q2WA 3FWZA 1DRVA 1PGNA 4NBVA 4OQYA 4AJEA 4ZJUA 2YDYA 5MGBA 3KYCA 1LRJA 2D3TA 4UULA 4P22A 2EP5A 3ROKA 3O9ZA 3A28A 3OJLA 3MWEB 4TRNA 2Z1NA 3IJRA 2DKNA 2AW5A 2JJYA 4WNIA 2ZQYA 4DPLA 1XG5A 3RVDA 2A9FA 3TJRA 1KEUA 1P1JA 4LW8A 3NJ8A 2X0JA 2VT2A 4M1QA 5FI3A 1SEPA 1BRMA 3M1AA 4D42A 4LVCA 4YQZA 1E1LA 3V8BA 5AXDA 5TLSA 3DMTC 3VH1A 1HKUA 2CDCA 5A02A 5KKCA 4R68A 2X86A 1KC3A 1TA4A 2HMTA 4CUJA 1E7MA 1X14A 5HS4A 3GUCA 3I23A 5CDSA 1C0LA 1FDVA 1WDLA 1U8FO 2O2SA 2I5PO 2PV7A 5TS3A 4BOYA 3SLKA 3U4DA 1Y8QA 3VPSA 3JQAB 3AJRA 3QHAA 3EC7A 1YB1A 1KS9A 4Q3BA 5IJZA 2BGKA 3ZGYA 3JQFA 4YEDA 3WGOA 2PTGA 5JC8A 4UEOA 1G1AA 3K2BA 1CETA 2NTJA 5TGDA 3GGOA 1U1IA 3WGYA 1EZ4A 5ICMA 4D0RA 3WGIA 4IUYA 4XQEA 4PG5A 4AJHA 4RZHA 3D7LA 2X58A 5L7YA 4IDFA 3NT4A 5DZSA 3F1LA 1CRWG 3MJVA 2NVUA 1NPTO 3PTZA 1GAEO 1XSEA 2W2KA 3LC7O 9LDTA 4HUJA 4RPKA 1MLDA 5TJHA 1ML3A 3NDIA 4CLRA 3RC1A 3VTZA 2C29D 1ZNQO 5F1OA 3G17A 3JQ9C 1HWYA 3I1JA 5L3ZA 3UGKA 2YFQA 4YJHA 4EZBA 5H81A 1GCUA 2A92A 3IIEA 3R3JA 2A35A 1NAIA 1E3WB 2CFCA 4WOJA 3HJAA 4RZIA 3GLQA 4AICA 1P74A 2BI8A 5CEFA 2BKAA 1GY8A 1PGOA 4J7UA 5A3VA 4RDIA 2AQHA 1AXGA 4JBHA 4R1UA 2FR1A 1Z82A 5HTOA 4G5HA 2QZ9A 2DC1A 3FI9A 2O23A 3BTOA 4BNIA 1C1DA 4DC0A 4ZQBA 1YDWA 3JD4A 2H1SA 3I4CA 4EUEA 2X9VA 4N54A 3TPCA 3RFXA 1DFIA 1E3LA 2ZIZA 3RSHA 1GDHA 4AJLA 5B4VA 5G0UA 2DLDA 4NU6A 5AXCA 5TX7A 2BGMA 2EW2A 1NFFA 2Q99A 3QY9A 4JBIA 5JDCA 1UZLA 4E32A 1T24A 3H9JA 3F6YA 2WE8A 1DIGA 1U5AA 1UZMA 3OM9A 1ZK1A 3E9NA 2NACA 3GQVA 4R51A 3WTBA 1H2BA 4BKRA 4G81A 4ESOA 4YAEA 5HA5A 5JDIC 5I8ZA 3H8VA 2DBQA 3RIHA 3SXPA 5GZ1A 4GKBA 3ZNPA 4CMIB 1LLCA 2C5AA 4NBWA 1RM0A 2F1KA 2O3UA 4BO9A 1A9ZA 1F17A 4CMKA 3OFSA 4CUZA 4BGUA 2H6EA 2NU9A 3GDFA 3RBXA 1PGPA 1IE3A 1OC4A 1ENZA 4FOSA 2YV1A 4R54A 3D4NA 1V3TA 1LLQA 1S7CA 1ZUD1 3HN2A 3PJEA 4GLOA 4H3VA 2FMUA 1XA0A 3BMNA 5JFOA 3LSYA 1NHGA 4IQ8A 1NQTA 5FWNA 3FPLA 4MVJF 1CF2O 1XQ6A 4CLRB 1VKOA 4TRJA 3KYDA 3OEWA 3OQ6A 3BA1A 4Q39A 3GN1A 2B4TO 1KVTA 4IIVA 4DYDA 3MTGA 1HF3A 4DIFA 1MXFA 4I5EA 3H9EO 4KWIA 4ROSA 3W6UA 4B7CA 2FOIA 3MJSA 3B6ZA 4RPGA 4MKRA 3H2ZA 3AI2A 1DB3A 4BNHA 4DA9A 4NR0A 3DONA 5B4TA 1P0FA 1DLIA 1ARZA 1I32A 4CLDA 4R41A 5B12A 3QWHA 5IN4A 2GNAA 3WIEA 3GVIA 5KOIA 4CM6A 5DP1A 3C7DB 4R1TA 2WM3A 4OQZA 2VUTA 3CXRA 4RF4A 2EEZA 2HDHA 2UAGA 1XCBA 2AHRA 1KIFA 5A9TA 2FR8A 4JCOA 4KQWA 4IGFA 4R5HA 1JVSA 3JD2A 2OP0A 3F5QA 4BQRA 1C1DB 4A73A 4NJMA 4BGVA 1G0OA 2AG8A 1GL3A 1VKNA 4URFA 3PVZA 3M1LA 5DCYA 2GGSA 2I3AA 1Q2XA 5MDHA 2WYWA 3RC2A 1YH3A 4QTZA 3ENNA 3RUDA 4Y6RA 3D3EA 4UVDA 3ZWYA 4BNUA 2WDZA 2R6JA 1PZEA 3L6DA 1UH5A 3VZRA 1LLUA 4GAEA 4X54A 1EVYA 2DTDA 3HZZA 4XDZA 3TSCA 3VPGA 3WX0A 1ZJYA 4JLWA 4INAA 4PLYA 4ZQHA 5JLAA 3PFFA 2W98A 1I24A 3E03A 1A72A 3F9IA 3OJEA 4HY3A 3ZV6A 2BFOA 2CUKA 1GUYA 1VPDA 2G1UA 2IYOA 2X0NA 3NTRA 4RO0A 5JE8A 4I08A 3QW2A 3CSDA 2GZ3A 4PG6A 2EP7A 2NTNA 2E4AA 1WMAA 1GQ2A 3ZN2A 3OHSX 4XJSA 1R4MA 5U1PA 3L77A 4DIOA 5EPOA 3H4VA 4IJKA 4IGEA 4E2ZA 3PDJA 2PA3A 2EKQA 3NAQA 1R37A 1AHHA 3TQHA 1Y5MA 2JD0A 3STHA 1UP7A 5CG1A 1KVSA 3JQDA 3PFWO 2VHZA 1EVZA 2YHIA 1V6AA 1LTHR 4TKLA 3KLMX 3P2OA 3M6IA 3ZHZA 5EL0A 3IJPA 2V6BA 4ZQGA 1HDXA 3LC1O 5EIOA 3OIGA 5JY6A 4XGKA 4LMPA 4AVYA 2PD4A 4CM5A 3BMOA 1B14A 3LT0A 5FEUA 3DBLB 1BDBA 1C0IA 5EESA 3HG7A 1DSSG 3L07A 2AXQA 4QT0A 1K3TA 1Y9AA 2D5AA 3PWKA 4RF5A 5A05A 2JFGA 4BV8A 2I99A 1Y81A 4FIZA 1Y9EA 4FDAA 4RVFA 4K26A 3TZ6A 4YVFA 2OGUA 3DB2A 5BNIA 1KVRA 2PNFA 3VDQA 5HWSA 2GO1A 1QYDA 4DLAA 1KC1A 1NVTA 1U3WA 2OUIA 2V7PA 4J1TA 1B0AA 5IDYA 1CWUA 1NHWA 1Q7GA 4TWRA 4HWKA 4LSWA 1I3NA 3ASUA 4E5PA 4GSKA 5EINA 3OSUA 1AHIA 1FK8A 3QSGA 3FNFA 4YT4A 4JP2A 3F4BA 2HQ1A 4D7AA 3GMSA 3H65A 5FFFA 5A5EA 5JO9A 3KTDA 4R01A 4BO1A 3ADOA 3JQ6A 3BMCB 2LDBA 5DP2A 5GZ6A 4Z3DA 3ZNNA 1KEPA 3NUGA 3LT1A 3Q1LA 3AI1A 5JY1A 4U0JA 3GR6A 1YL5A 4J6FA 1U28A 1PQPA 2QRJA 1H6AA 1DJQA 1YOVB 3ONEA 4J9UE 4OO3A 6LDHA 2DUWA 4CMAA 3UW3A 2Y0DA 3CZMA 4BMNA 1C14A 3U3XA 4ZQEA 1UDBA 2P91A 1I30A 4PVCA 4B79A 2EW8A 5JC1A 1T4BA 2QHXA 2VYVA 3VH4A 2IXBA 2Q3EA 3W8FA 2B37A 2Q4BA 2NU6A 5IN5A 4Q3EA 2GERA 1LDGA 3WMXA 4YRBA 3F4LA 3QVWA 1ZKMA 1GV0A 1ZSNA 3CMMA 2O3RA 2FHSA 1YQXA 4AL4A 1ZFNA 2RH8A 1ISFA 3MZ0A 4DMLA 1A4UA 3DOOA 3I9JA 1XIVA 2FY8A 4IMPA 3EW7A 4OSPA 1BXZA 2B36A 3KHUA 1WW8A 2E82A 3MJEA 4BKUA 5I9NA 5JMPA 1P45A 4DREA 3KSZO 1VI2A 1FDSA 3SEFA 1E6WA 2Q46A 3FTNA 1JLLA 1N9GB 1SOVA 1R6DA 1WMBA 2AEJA 1BVRA 3RROA 2VRCA 5ITWA 2B83A 3U4CA 4YDRA 3RKUA 3UAGA 4LRSB 5CEEA 2HCTA 4LK3A 3RFVA 1EEHA 1E1NA 4U6SA 4P4LA 5IZCA 3MJ4A 1CJCA 3AY3A 3GZNB 2C5EA 3KEQA 4XGIA 3KETA 2J5RA 1HEUA 1B8VA 4CMEA 1LC3A 1LU9A 2RHRA 4OKNA 4BQPA 3EYWA 3PHJA 3MTJA 1UZNA 4YRAA 1Z75A 3CUKA 3P5SA 2WD7A 2ZB7A 4HBGA 3WSVA 3KUXA 5F5NA 3ZHXA 3FBGA 5FI5A 4NFYA 4OSOA 2YY7A 3OA0A 5IXSA 4MVJA 4ILKA 1DHTA 4W99A 1EFLA 1LI4A 3JYLA 4DBZA 2FZEA 3ST7A 5CPFA 1P1RA 4MIYA 3QVSA 4A7PA 2EKPA 4EJMA 3KVOA 2ZJ0A 5HBRA 1UAYA 2PH3A 1KY5A 4GL4A 4JJFA 4GGPA 1KOLA 1TVEA 1PQWA 4K1LA 3QP9A 1CERA 3M2TA 2GR9A 3KM0A 4J90A 4YA6A 4YCAA 5GMOA 1PZHA 4NI5A 4FFPA 3ICCA 4W9NA 4EEZA 2X5KO 4JGBA 4ALJA 1TEHA 2B0JA 3MCVA 4M87A 1OI7A 2HSDA 5JDCC 4EITA 4YBZA 2Q2VA 1Q0HA 3FR7A 1RJWA 5JXWA 2O3SA 3PK0A 4RVUA 1X0XA 4E33A 3LYLA 2Y93A 3WR5A 4FC7A 3CINA 2Y0EA 2NUAA 2GN9A 3HWRA 3RUHA 1HDZA 2I9PA 2VZ0A 3D4OA 3MOGA 2ZB3A 2X5OA 3UF0A 2JD2A 2JFHA 3JQCA 1CIVA 4AJNA 2VNSA 3VTFA 4WECA 3ZHBA 4LGVA 4CV2A 5LC1A 4O1MA 1NWHA 5DOZA 5TC4A 3QWFA 4OGWA 3V1TC 4ND5A 3PXXA 4Z6KA 1G0NA 5DNAA 3AWDA 3RBVA 2HMSA 1PX0A 3UKOA 3ONDA 1UP4A 1ZMTA 3D5TA 3NGLA 4TVBA 5B37A 2P5UA 3CTMA 4IINA 4BNMA 4CV1A 1HDYA 1LEHA 3UCFA 1UUFA 3ZWXA 2GUGA 5JAMA 4N7RA 4IDAA 2Y0CA 5KIAA 4OOFA 2Y1DA 1T2CA 5C37A 3ZW9A 3A1NA 1XDWA 4ZRNA 4FGSA 1YKFA 3GDOA 4L76A 3VPFA 3IDSA 5EN4A 4L0QA 5CG2A 3PP8A 2O4CA 4XIYA 4BNYA 5K6AC 5L4LA 3LLSA 4MVJG 4DLBA 1BXKA 1N7HA 4IS3A 3DBRB 3PQFA 1DFGA 2DQ4A 3FNHA 3QJ5A 1SPXA 4BB6A 1OOEA 1B16A 3B1JA 1VL0A 4OJNA 4R9SA 4ALLA 3GVCA 4DWVA 1U8XX 2BELA 2E37A 2X22A 3OECA 4A27A 3I9LA 1T2AA 2D1YA 3E18A 4HFJA 3JQ8B 2PZJA 3JQGB 4BL5A 3DQPA 3DO5A 4TMFA 1O9BA 1ZJZA 3GRKA 3IKTA 1HETA 4UAGA 3CIFA 1N1GA 3E9MA 4RQUA 3KO8A 4J1NA 4QO8A 3SC6A 3ZV3A 3P7MA 3E8XA 2WYUA 3JD0A 4IY1A 5T57A 3M2PA 1W8DA 5FF9A 2HU2A 3AOEC 5TT1A 5L4NA 5L95A 4RPHA 3U9LA 5HM8A 4Q3DA 1H2HA 4CR8A 2JFFA 3NDRA 3FTPA 4J1QA 5DDIP 4E2XA 2VHVA 1JWAB 2E6UX 5C3MA 5L40A 4WEOA 1KVUA 3KEOA 2ZCUA 3HFSA 4YJFB 5CAEA 2P4HX 5KNLA 1BXGA 4C7KA 3JQAA 3R3SA 2DTEA 4YJDA 3ON5A 5CDTA 1LSOA 1LBEA 1R0LA 2PZLA 3INTA 4WGGA 3DZHA 3H3JA 1NXQA 3WGZA 1IY8A 1I10A 2ZJ1A 1ISJA 3AUUA 1MC5A 3GPDG 3I6IA 4FFRA 4MVJH 2HO5A 1GUFA 1SZJG 5DT9A 1WWKA 2UUOA 3JQFC 4PLZA 4O63O 3CEAA 1PS9A 3O8QB 3PZRA 4XYGA 4JNKA 1J49A 5C5IA 1RYDA 4BIIA 4CMCA 1QMGA 1E1KA 3UCXA 4BV9A 3FN4A 2IXAA 1UXKA 3C1TA 3INRA 1PJ2A 4NJMB 2B4RO 1MUUA 4CV0A 4M54A 4HXYA 2G17A 4GVXA 4R9RA 3C7AA 3JQ7A 4HV4A 3JCZA 4L4XA 1A71A 5KJFA 4BNWA 1IHYA 3PYXA 1EK5A 1MG5A 4HP8A 3B1FA 3SC4A 1H6BA 4BMSA 3EGOA 4F6CA 5A4DA 1E5QA 3BMQA 4L73A 4JJIA 3PYLA 1B26A 3QWIA 3WICA 4YPOA 5KVCA 2FPPA 3NKLA 3ZV5A 1V8BA 1MV8A 4D44A 4KTTE 3U62A 1HT0A 2D0IA 3ZW8A 4KTVE 3FF4A 2V6MA 1YO6A 5KCZA 4RGBA 3WXBA 4OMUA 3WGHA 1R4NA 3VC7A 3VKUA 2NVWA 2DPHA 3I9KA 4AJ4A 3OICA 4PG7A 1GZ6A 5JO0A 4LISA 3LDHA 3LLVA 1BXGB 4XQCA 5HS6A 2VWQA 3EMKA 2A94A 4MVJI 2Z95A 3VPXA 3WGGA 4C4OA 1Q1NA 4N5MA 4ONEA 3ANMA 2EJWA 2X8LA 3DOJA 4JJGA 2G5CA 3ZNQA 2BFAA 3PWZA 3I9NA 3IP1A 1D4FA 4FPXA 4D43A 1JW9B 4IDBA 2EHDA 5I7EA 4NNJA 1ISMA 1GTMA 4NU5A 4CMHA 1ISIA 4CPDA 2GYYA 3B20A 2OOSA 5K0ZA 4XB2A 4PG8A 3GEMA 3GG9A 1IUKA 4J3FA 4RLSA 1IULA 4CMIA 1C1XA 3KSUA 2NNLD 4IBOA 1N1EA 1YL6A 3GC6A 4I1IA 4E5MA 4B4WA 4GI2A 4YACA 4FFNA 9LDBA 4OH1A 1WPQA 1GV1A 4DVJA 5G2OA 3H3FA 4EDFA 4BNVA 3U4HA 3LU1A 2PFGA 4PLFA 1HE3A 2DBZA 1DOHA 4J0FA 5JW6A 3H9QA 4DL9A 2BI7A 1YOVA 4PVDA 4NPCA 4CV3A 3GMDA 3RUCA 1M66A 2EF1A 3EUWA 4N18A 3V2HA 2YJZA 4YJGB 3VOSA 1EQUA 1U4OA 4CM8A 5C7LO 3RC7A 4QUKA 3ITDA 4FJ0A 3TOXA 1DIBA 5J23A 2Y68A 4DQVA 1O94A 4NJOA 5BSFA 1SBYA 4BNFA 2VUUA 2GN8A 3K73O 3G0OA 1GEGA 1WAMA 2YUTA 1K0UA 1DAOA 5CP8A 1DPGA 3K31A 5IFLA 1LLDA 1JN0A 1LSUA 4EW6A 4LRTB 3C3XA 1E6UA 4PLTA 1CQIA 3S55A 4BO0A 5KVVA 4DQUA 3U5TA 1A7KA 2VQ3A 5EJ2A 2B35A 1ONPA 4IXTA 4CMBA 3HDJA 4WUVA 3A14A 1J0XO 1X7GA 1XKQA 1X13A 4RF2A 4BB5A 2FPGA 2ZKLA 2J6IA 1GR0A 2QG4A 2J3KA 3DHYA 2VTDA 4YB8A 4I9NA 4NBTA 2FRDA 2GN4A 3DAFA 4H16A 3H5NA 1QKIA 3JQAD 2I3GA 4O5OA 2IZ1A 5L9AA 2ZTVA 3FSRA 4AJIA 2AQ8A 2D4AA 3HSKA 1PGQA 1VJTA 2P5YA 5IG2A 4B4VA 3GHHA 4DRYA 3AUAA 2WD8A 2OBNA 1Z73A 4Y6PA 4JXKA 3AU9A 3NT5A 1H93A 3Q9NA 1PJCA 4ALIA 1UJMA 3BIOA 4JROA 3ZH2A 3BYZA 1MXHA 3T4XA 1ORRA 1ADFA 2QIOA 3L6OO 1NQOA 3C1AA 3GVHA 2Q1TA 3KV3O 4BNKA 3RAJA 3WLEA 2WD7B 3NYWA 3AW9A 4XYBA 1E3SA 1K2WA 3GF4A 1I3LA 4XD2A 1SC6A 2C07A 3WQSB 3GN2A 3I9MA 1F12A 4RL6A 5T8KA 5L51A 2O3TA 1LJ8A 4E5KA 1P1IA 4OYRA 4DTIA 2ZTUA 4MVJE 4KDFA 4MP8A 3AK4A 3WJ7A 4TRMA 3I4FA 3G49A 1WXDA 1BMDA 4IS2A 5G0TA 2DBVO 3KRTA 1HDGO 2HK8A 3RCBA 1EMDA 4HFRA 1XU7A 2B5WA 3DAGA 2HMWA 1RWBA 2QRKA 1H6CA 1W0CA 3OJOA 4YTEA 3RUIA 3TZHA 5BQFA 2O50A 4JX8A 1F14A 1P1HA 3ETGA 1KYQA 1ZW1A 1M76A 1ONOA 4P4NA 1H94A 3MJCA 4ND3A 3JQBC 1SNYA 1YDEA 4XQGA 1WDMA 4UUOA 2P4QA 4PLHA 3GY0A 4YT2A 3BMNB 2ZCVA 5I9LA 1U3TA 4AJJA 2D2IA 4U7WA 3WQQA 5ES3A 4YAIA 2HMUA 4RCVA 5F5LA 1C0PA 1HRDA 4B8ZA 3WGQA 2Q1WA 3HDYA 4FCCA 3D64A 3I9OA 2IDZA 3DZJA 4I9UA 2X6TA 4GQAA 4Y98A 3DHEA 4J91A 1V35A 5TJ9A 1Y7TA 4UVIA 4F6LA 3GRPA 4E31A 5T64A 1DJNA 1BW9A 3DZGA 3F46A 3T7EA 2J3JA 3QRWA 3SLGA 4RJTA 3P19A 1UXIA 1QP8A 4RV9A 1K5HA 3K30A 4E12A 2PH5A 2UUPA 1HE4A 1AN9A 5DBIA 5KJ1A 4AFNA 3JQGA 4E13A 3W4JA 1EVIA 1E3WA 1I01A 4CR7A 4NFHA 3TRIA 1YBMA 3ZHYA 1DFHA 2EXXA 3TZCA 1ZBQA 2O7QA 3VAZA 4DC1A 1Z74A 3BXXA 5ENDA 1ONNA 3ROQA 3JYQA 2DTXA 2EGHA 4NBUA 1ADBA 3S2EA 1LQTA 1ADGA 2Q2QA 2YV2A 3NTQA 5A04A 3PRJA 2BD0A 4QO7A 2ZYAA 2VTEA 1W73A 3RASA 4RF3A 2RIRA 4YQYA 1PL8A 1PU2A 4QXMA 4KWHA 1AGNA 1M2WA 3GZ4A 1XELA 2C82A 2D59A 3SJ7A 4EUFA 1E7SA 1O95A 5G0VA 4FQ8A 1D8AA 3UICA 4B8WA 1NR7A 3H5AA 1Q7CA 1A5ZA 1Q0LA 1ZK4A 1ENPA 1UP6A 3GOHA 4FBGA 3KYBA 2YQ5A 4QQRA 3RC9A 5A9SB 1HLPA 1D1TA 2IRWA 2OXIA 3ZWMA 1XWFA 1GUZA 2WJPA 3GA0A 4NZ9A 4OIMA 3G1TA 5T5QA 4IZHA 4TZKA 2GN6A 4XYMA 2NQ8A 1OAAA 2FSSA 2R2GA 2ZYDA 3C8MA 3CPSA 2QYSA 3KB6A 3UH1A 1GU7A 4NHEA 3QE3A 4XYLA 3FHLA 1ZK3A 1DXYA 5H83A 1PR9A 5JS6A 4UEJA 2I65A 1ADCA 1C0KA 1N2SA 1A7AA 4W4TA 4DIBA 2FSVA 4J2OA 4D46A 4JQCA 3W1VA 2JCYA 1TT7A 3TF5A 1AUPA 3Q2IA 4UEKA 1QYWA 4UUPA 4Y67A 2RH4A 3KBOA 4DBVO 2YDXA 3QVOA 5K9ZA 3RKRA 1TT5A 2IYPA 3F1KA 5H82A 3PLRA 3PDUA 4FGWA 5COBA 3O4RA 1XHLA 3OP4A 2Y67A 3JQ7B 4DLLA 5KTKA 4TRRA 2GZ1A 1PGJA 2J3IA 1MC4A 3S2IA 4A0SA 1YJQA 3Q0EA 1EE2A 1R4NB 4A26A 4ALKA 5ENVA 2C20A 3N58A 4R4JA 3PPIA 5CEJA 5F3RA 3AY6A 1A27A 3ZZNA 2WTBA 1N7GA 2FWMX 1CYDA 2V65A 3OBBA 4MVJD 4MDHA 3ZWOA 2GZ2A 1NQAO 1WZEA 1A9YA 2EG9A 1SB8A 1U5CA 2E49A 1GZ4A 1PIWA 4D3SA 4IIUA 2HAEA 2ZATA 5B4UA 4RLHA 3QWBA 4E2YA 2ZYGA 3IMFA 5DBGA 4W7HA 1YB4A 3WB9A 1K6JA 2CVOA 3SVTA 5CDGA 4BO3A 3G79A 5JSFA 4S1VA 4I5DA 3S8MA 1RKXA 3NGXA 1LDEA 1NTOA 1PS0A 4XRGA 3E1KA 1HE5A 2GF2A 1RM3A 2Q45A 3VZSA 3L4SO 3KXDA 5EQDA 1KEVA 1W6UA 4B3JA 4ZN6A 5ITVA 2IZZA 1TT5B 1LC0A 1ULSA 4CLEA 1YL7A 5TSDA 3X2EA 1JU9A 1V0JA 2EV9A 4H7PA 1TLTA 3DDNA 2CF5A 1J6UA 4YJGA 4CM8B 1QSGA 5DCUA 2QW8A 4BNZA 1UXHA 4BO4A 4CM4A 3BTUA 3DC2A 4ND1A 3MEQA 5IXYA 2RHCA 4NBRA 3WYEA 1OZAA 4K6CA 2YYYA 3GUYA 1U7TA 4A03A 1Z7EA 2VWHA 2PZMA 1Q7BA 4Z0PA 4LCEA 4QFDA 2CDAA 4J16A 3PHLA 1NVMB 1YB5A 4RQTA 3V1UA 1IL0A 3WJAA 1GQQA 3TL2A 1ZXBA 4QSMA 2HMVA 1HXHA 3FR8A 1JTVA 4KP7A 4BNXA 2R00C 4K6FA 1T2EA 3AUTA 5TT0A 2BRUA 4ZQFA 1UDAA 4XIJA 1NR1A 5L45A 1J4AA 3H9UA 4IQGA 4TSKA 5JAIA 2O4UX 3IUSA 4GX0A 5TQVA 4JN6B 2EWMA 1H5QA 3LF2A 4WE3A 5EERA 4GMFA 5AOVA 1U2GA 4DPKA 4IDCA 3Q6IA 2I66A 2W2LD 4OAQA 2CZCA 5BNTA 4OXYA 4NMHA 2Y05A 5G0SA 5JYDA 2LDXA 4EUHA 3OETA 3VVCA 2HJSA 3WFIA 2IODA 3DEYX 1YQGA 2BGLA 2IZ0A 4XDYA 4ZD6A 4L74A 3IAHA 4W82A 2J5QA 5F21A 3RWBA 3NEPX 3I3OA 3INGA 4DQXA 2V6FA 3D3WB 2XXJA 1EVJA 3AY7A 4O6VA 3TL3A 4MVJP 4RVGA 1VSVA 4BKOA 3QQPA 3JQEA 4IM7A 1PSDA 3HB5X 1Y6JA 3COSA
chains in the Genus database with same CATH superfamily
4LXHA 4OL0A 2Q4EA 2P9GA 4GC5A 4R3NA 3LV8A 1COZA 1E9SA 2OZEA 2YMPA 2HPHA 1HH4A 3FFWA 2ECPA 5CHEA 5EPEA 3WNZA 2B34A 5BV0A 4ECEA 2WSBA 1MH9A 2VUHB 2D2EA 1PQUA 2INGX 1JHVA 4B31A 3U44A 3DFMA 1EFVA 2XUGA 3F0TA 3EFEA 4FCTA 4QJ4A 1YJAA 1U31A 2BZGA 3OD5A 5B7GA 4QG3A 3F4KA 3KZNA 4J76A 3WC4A 2H4XA 3OU7A 5DN6D 4F4DA 4F21A 2QV7A 4UTPA 4U63A 5LN1A 2R8XA 4HWTA 4PZLA 5FDFA 3U81A 4RKRA 5DB4A 2O6HA 1EX1A 3B6JA 2B7CA 2D5CA 3IO3A 2NUTA 1GAXA 3KQQA 3FSJX 5EXSA 5FNVF 4K9QA 4J43A 5CU7A 4RY2A 1NUQA 2AQKA 5B1YA 1VL8A 1OH8A 4MSUA 4TVOA 3RI3A 3KPJA 2E48A 4M49A 1LSJA 2EC5A 3EGVA 2G8NA 1Y3BE 2G88A 3GDGA 3KOYA 4S1OA 3S1LA 1DKOA 3OBIA 3SU8A 2R0QC 1WABA 1WSBA 2CC2A 2F4NA 2IIPA 3BL8A 2NADA 1WRBA 3NT2A 4KFRA 5AYVA 1PFWA 2B61A 2NQTA 3MM4A 3TRKA 3U0VA 3UOWA 3WB0A 1TCCA 1VLMA 1JDVA 4KNVA 1T1JA 3ZX4A 4F5ZA 3QTLA 1XALA 1XZFA 4UAJA 2QE7D 2HIHA 2ZU6A 4UUQA 1G42A 3BSWA 4M1MA 4CQMD 2CV2A 3GH3A 3NKFA 3U4IA 3RYHB 5CX1B 1NUPA 3WLNA 4QYSA 1YK0A 2HRQA 2PUHA 3FCAA 4KSCA 1MVNA 5ALQA 4M89A 2J0EA 4MV4A 3DZFA 4OHKA 2QNRA 3QMMA 2W2MA 4M6WB 1N6OA 3OU6A 4YJ3F 1QHYA 4UOQA 1N5LA 1KQNA 4NEHB 4QAJA 2AEFA 1VJCA 2FH5B 2ZXFA 3B8HA 1BX0A 3AHEA 3QELA 1ZZEA 4ZPXA 5A6SB 5M5BA 1A9XB 1D7AA 4MRVA 4TQGA 5JSYA 1Z6GA 2ZDGA 3V8PA 4G85A 2V9CA 5HEKA 4N5NA 4J75A 5ERYA 4PSKA 5LZ7A 3RSFA 1TC2A 4J0HA 1I4OA 4RFVA 1A7UA 4CQMA 5HCUA 2XUZA 3CYFA 3NBUA 3Q3IA 5FBKA 2VZ8A 3OZFA 3W06A 1F2UA 3UT0A 3MERA 5CVEA 2ZIFA 5BUCA 1ZDMA 2FEXA 5DLEA 3S2YA 4XWGA 4XB1A 1F0PA 3EA5A 3R7BA 4HFMA 2XE6A 1C9JA 3BK1A 3HE3A 1PAUA 5AW8A 2VXYA 3EMDA 2H2AA 3W4KA 3NWEA 5IVPA 3L0ZA 3JZMA 4D0SA 1ISPA 1JSXA 1BWRA 2I0FA 4ZGWA 1A2QA 3DAPA 1I9CA 2ZRGA 4KDRA 4RELA 4X0EA 5FTLA 3BT7A 3AQIA 3SYKA 2JATA 1D6JA 2FWPA 3OC0A 3S44A 5TRTA 2GD1O 2M1ZA 4NKRA 4J94A 3ZDBA 3IJ5A 4Z4IA 3I45A 4V0SA 4FDTA 1F3OA 1B00A 3KT0A 4NK4A 1H0RA 1V1JA 4C78A 1T5DX 2A9PA 3VTKA 2VUSA 1MEEA 4OH7A 3K0SA 1N6NA 3ZG6A 4U7GA 4HCJA 4HTFB 1YS4A 3NRCA 3T12A 4HDRA 1GYRA 2WJYA 3EA4A 2VHXA 5TE9A 2XCRB 3DPIA 1R16A 4GYYA 1AQIA 1DEOA 1QYVA 1CF4A 3ONFA 1TKCA 3K8QA 1KYVA 3BDIA 4JLNA 1IDN1 4KQ2A 5ITSA 5BVGB 2VAVA 5H9VA 2Q7OE 5I7SA 3DZDA 1EG7A 2H06A 3KSDO 3DAOA 3JRNA 3R44A 5CNIA 1P44A 1HK7A 3PZBA 2R3SA 3PUYA 3SHQA 4J1SA 1RPNA 3IT2A 1BG6A 1FMCA 3GA7A 1YF3A 2YX1A 4HNAB 3WSTA 2DXIA 1XRSB 1UCFA 2C7GA 3K9BA 3QPDA 3AVVA 1ILEA 1F0YA 3HDHA 3DV2A 3DMRA 5BUQA 2AZ4A 2QZ4A 3E3AA 2W93A 3LS2A 3NP9A 3PSHA 4H1VA 1HYEA 4TTQA 4AU1A 1V96A 4W5NA 1LF0A 2MOKA 5HF6A 3L6RA 5IZCC 1MX9A 4E5NA 3LYHA 5J2UB 3P2MA 2EGUA 3ZZ0A 3MTQA 2NXEA 1KO7A 1MAVA 1RZRD 4KWCA 1A97A 3F6RA 2H31A 2P9ZA 3ZE9A 1DCKA 2PGIA 3N3AC 2CUZA 3H16A 3IEPA 5BQ5A 1JQDA 5LDHA 1WV1A 2YJ6A 3WHPA 2ACEA 3JVIA 1OU0A 2VNAA 4EG4A 1I2BA 2O57A 1QQBA 5IT5A 3AR9A 4B4OA 3K0CC 3E5NA 3O73A 1VMIA 1OC2A 4IO0A 4JI0B 3E6AA 3EEIA 5D1NA 4M55A 2QGNA 2L18A 4U6NA 3TXXA 5J4LA 2HCBA 2XXAB 3FDZB 4DMCA 1UDCA 2OV1A 3MMZA 2PLAA 2VOJA 2I1LA 2I6QA 4URWR 3FYTA 4U5QA 1DDIA 1FP7A 1X7DA 1LY1A 1ZM9A 4GR5A 4Q9HA 4B2IA 4LWOA 4DNQA 1PHRA 4YWJA 5SZKB 5IULC 3RADC 1HYGA 1MF7A 4D45A 2Q5EA 3EPPA 2W90A 2CK3D 4WACA 3OZGA 5L3RA 4YUZA 3RYCA 1RYEA 3LKVA 3WWZA 3ZKAA 2FN3A 1KARA 1GKUB 5EXDA 3ZQ6A 3QLUA 4BZWA 3QUCA 3LVFO 2XDYA 1SVNA 3PF8A 1BSVA 4RVSA 1C81A 5BR1A 4O2BB 1QF7A 2WAMA 2YZ2A 3DOCA 1XZAA 4I9HA 3NG1A 4NYMQ 2WU1A 4ZCTA 1NNUA 1KI2A 2OV3A 3UAVA 1T2UA 3UENA 2JH8A 2FGKA 3V2UA 3ZWVA 2ADOA 2Q5QA 4ESEA 1KU0A 1TXGA 5DHRA 2O52A 3PJGA 4HHEA 2YW9A 2FPPB 1UADA 4WGFA 1CYEA 5C8XA 1YWGO 1WXHA 1Y3AA 3CW8X 4YP0A 3DJYA 1Y4AE 4AG3A 3Q98A 5A4AA 1NAHA 1DOAA 1QQAA 2PZFA 4C08A 3HXMA 1E5XA 1ZJJA 1KZGB 2B4KA 3FFXA 3OWHA 3X1WA 5EXPA 1FDIA 1LBHA 4K6KA 4AO8A 3B3FA 4ER3A 2AOWA 2JRCA 2GSWA 3NCHA 5LKRA 3FKSD 4KXQA 5CDUA 2QUKA 2JLWA 3C24A 1ZO8A 1IM8A 1RBQA 4BP3A 2W2PA 4G41A 2WSYB 4ZU3A 3VKWA 2NMVA 1YTLA 4WLVA 4WW0A 3A6LA 3MT7A 4X8MA 1G60A 2PKRA 4YO7A 4RM2A 1IN4A 3IMEA 1UPAA 2FFQA 2QN2A 3GG2A 2JI9A 2OAQ1 1SUWA 3V4OA 2XZDA 5HXAA 1FUIA 1LW6E 2VATA 1LRLA 1ZG3A 2RAVA 3IXLA 5DWDA 3MCTA 3F98A 3TOCA 3CF4G 3NC1C 2VJYA 4PGFA 5KNCA 3V7FA 4D9CA 2ASEA 2DBYA 1P7WA 2AB0A 1NQ5A 4GMGA 4J0CA 4QDUA 1UBKS 4QXPA 2BONA 4BAUA 4BXOB 2IYZA 2QTLA 1YR2A 3ESRA 1EQ2A 4NS4A 3TSZA 3BK7A 3GP5A 4X6LA 5JNRA 3IVMA 5TQ0A 4PFJA 3CRNA 1C9EA 2YXDA 4FWIB 4EW3A 1Y0BA 2QYTA 1B93A 2DWQA 2HWYA 3WK6A 4PLPA 4LWZA 3V8NA 2J9GA 3GFPA 4B3GA 3IDFA 2Z4RA 3I1IA 3D6FA 4OP1A 4IW3B 1SXHA 5FBZA 4IV8A 4KVAA 5ECGC 4JVLA 4TYWA 3W2FA 3WGKA 2ID9A 4QDKA 1M2VA 5CFZA 2VT7A 5CAEB 2OZPA 1QM5A 2AUTA 2IPOA 3PB3A 3ZU5A 1PJQA 3DV9A 3HCBA 4H1HA 1JMKC 3CLUC 4KMRA 4KOAA 4CLOA 1E63A 5EIEA 1BKSB 3HEMA 4TXLA 4YRFA 4WBNA 5LP1A 1EHCA 8MHTA 3UJNA 4DPMA 4Z9FA 4KPGA 3HS3A 3KJQA 3OTWA 5BSHA 4DIKA 1R00A 2YS7A 1Q12A 1XEWY 1YQUA 4UUNA 3SHFA 1T2FA 1Z2DA 1TO6A 5U4QA 1UMDA 3A9WA 1R5BA 1RNLA 3AOEA 5KJ6A 4X65B 1Y6RA 5JZOA 1TU4A 2X7XA 4AG6A 4HMQA 1QE5A 4V03A 4NIMA 1YI1A 1CDEA 2VTVA 5IBRA 3OH8A 3AL3A 1PCXA 4FFMA 1FTGA 1XZIA 4U9HS 4US2R 3OMLA 1Q84A 1AS0A 5F12A 3WHIA 2VA8A 2B8JA 2JS7A 4IYRA 1J24A 1V48A 3ZXYA 2LWIA 4L50A 2HDWA 3PEUA 3M33A 3O4HA 3CZ9A 3O74A 5AVWA 1SVLA 4JBWA 4MZXA 3A2LA 3ZD6A 2BAGA 1Z4IA 4Y1RA 3PDIA 4IIJF 5FUXA 3N2NA 2WIFA 1EXMA 2ZWAA 3RR2A 2X7HA 3C8DA 4BFLA 3OLWA 4J4TA 5EMHA 3CR7A 3EVDA 4PFSA 5LVAA 1N77A 4FNOA 1GCOA 1W93A 3OQIA 5KSWB 4L5YA 3BF8A 4FYKA 4R7ZA 4CHGA 2XWJI 4IR7A 1ZK2A 1BXRB 3VZPA 4C14A 4K9KA 4UVHA 3W9UA 2Q6VA 1QRTA 1EUDB 5B1IA 5TQ2B 1WSAA 1JIKA 4Q34A 4W5OA 2R8ZA 2WVHA 1E1YA 3FBTA 3VPAA 4PRLA 2A6PA 3MWYW 4U2KA 3KR2A 3V4RA 4XUEA 4QXQA 4DMUB 1Z15A 1QO0A 2G9UA 3PFCA 1D0SA 2BFBB 4R5MA 3HABA 3BTVA 1L7VC 1JQJC 1KE2A 2BISA 4HQOA 2GETA 1Q77A 4JP8A 1GSIA 1ORDA 4TLAA 3ONWA 4LVUA 1MOQA 4CEJB 1P0PA 2YHIB 1H4SA 3ASYA 4MA0A 2XRYA 3TLGA 2KBEA 3RYFA 3GPIA 1EX9A 1GCAA 1DWPA 5L6MB 3ZWWA 4MUEA 2A30A 4PHGA 1KNQA 1PR0A 1XJ5A 2PY6A 3IL2A 3R6TA 2J4DA 2ZPUA 1GKIA 2J3HA 4W5QA 3Q10A 1N3LA 4CTMA 2DFVA 3ZCVA 2GYVA 2JAQA 1JFSA 4BX9A 5BWLA 1RYBA 4RGVA 4YRDA 5DNEA 5DM1A 3F3SA 4CIAA 1MRSA 1G5IA 2NGRA 3KYJB 2LCFA 4URXR 1QUEA 2MU1A 1OILA 3L8MA 3L0PA 2YQZA 5HKKA 5IT9A 1TMKA 5E1OA 2C7VA 4L85A 3GFSA 3RGGA 3DR3A 2BDTA 3MMXA 4GC9A 4IDEA 4POOA 1P80A 2QJTA 4B7UA 3HJGA 2KPOA 5F9MA 4MWCA 2I34A 1P5ZB 1TUGA 4MYRA 1CTQA 2XXBA 4BX0A 2V54A 3RM3A 2G0TA 5FTWA 3U09A 1W87A 3FDFA 2IHKA 4KQ6A 4FS8A 1TQHA 5J43A 4XM2A 2DBRA 1MAUA 3MWKA 2W6PA 3O0DA 1JHXA 5ALGA 4Q01A 1JDJA 1RW4A 3UOGA 1SCBA 3VNUA 1J06A 1CUEA 3CLUD 4MKGA 3TZKA 1ZIXA 3DBHA 3ZU4A 3HHPA 3CRVA 4Y0NA 4ZOBA 4LC0A 5FLXA 2WWRA 1BCSB 1ENOA 2XH8A 1C9DB 3UWOA 5IXJA 2H1CA 1E1RA 2NTVA 4I5FA 4W6ZA 1ULHA 2NZWA 1VCMA 4PLCA 1LRKA 1MO3A 1NVVR 3CZRA 5H3HA 1QGDA 3RVMA 5KAPA 4IQFA 1KKMA 2OO5A 2H4FA 5AW5A 1S4QA 3AERB 2CMKA 2UYHA 4KH1A 3G0CA 4P0PB 4M60A 2BFDB 4X24A 3ZHSA 3ICEA 1RYFA 1QYCA 5BURA 1O97D 2W6JD 3X44A 2BF7A 2PAFA 2G71A 3NP7A 1B3BA 1S4MA 3RD5A 4J0DA 1I6MA 1IBCA 1SQSA 3NBMA 5DHUA 2ZRPA 3I6QA 3CWCA 4R71A 1GTVA 2ST1A 4XRRA 1R8JA 2KX7A 3KKOA 1FDUA 3NEYA 4WOBA 1NMQA 4LJ7A 1NV8A 4PF1A 1PN3A 1VMKA 1ULZA 4J49A 3LIPA 2PVSA 3CKYA 3ZTTA 4B2YA 3WIUA 2A9JA 3W6PA 3OZVA 4X71A 1ZD8A 1ZD4A 3BG5A 3GEGA 4G5FA 3EVNA 3O82A 4DHEA 4ZI7F 5BXYA 4ZAFA 3L0DA 4UBKA 1J97A 4DV1B 1TVCA 1KJIA 1PR5A 3GZTB 2CD9A 2DE0X 3K09C 3O4IA 2QMQA 3TLMA 3WQHA 4AJ2A 5C1DA 2AQIA 5JWHA 3ZCSA 1H9BA 3SR0A 5IWCA 1D03A 3IA7A 3WYBA 4KUGA 1Z0IA 1R0SA 5IJAA 2ZKIA 1XBTA 4TSRA 1J0AA 3MOIA 5TXGA 3DBVO 1KO4A 4PN7A 4GEGA 4OK6A 1U0EA 3GCZA 2QTRA 5TF4A 4BWFB 3IUJA 2CFSA 3TIFA 1AV6A 3Q7IA 5AI5A 1STOA 3C4JA 2CT8A 3PJFA 3VHXA 4ZPJA 1OVMA 1X0VA 3GRFA 3C48A 5LM3A 1C1HA 2W22A 3HQ4O 2ZRAA 3KKNA 3RDPA 4ED9A 4FILA 1VLJA 3JY6A 4I46A 3HTXA 2BVNA 2BHLA 3WLFA 5TARA 4ENRA 4ZHSA 5IDQA 2O8FA 1U0RA 2FSIA 3ZY3A 4C21A 2GPTA 1JKXA 3PHGA 4OEHA 1PJBA 4XQ9A 1PJLA 2C2YA 3OF2A 2F17A 4F46A 2VQSA 1EDZA 5DN9A 3FCUB 6REQB 2XBLA 4O4LF 4ALNA 3GNTA 1I6WA 3UCEA 1HOXA 3A06A 3AJEA 4ZXFA 2XKKA 3M8KA 3ZY4A 3H5RA 1Z22A 3KTOA 3LQQA 4O4IB 2JAPA 2JI6A 1L6RA 5D6OA 3V8MA 4EJSA 5HRUA 1TM7E 1E0SA 1EE9A 4W5TA 1KF0A 4X91A 3P9ZA 1GZVA 3WZLA 1D1SA 2FUNB 4KQ9A 2FV8A 4D79A 1YRWA 4YQEA 5CYGA 3ADDA 4PIPA 4WPGA 4LI3X 2QTVB 1JI3A 2B99A 5B7NA 1ES9A 1TTQB 5KWEA 3D43A 1R0KA 1N2IA 4C0WA 3FLEA 3ZWQA 3KE8A 1R9GA 3O1HB 5D6NA 3U48A 1O8CA 2WJAA 3AJ8A 3BJZA 4XIGS 5FLYA 3ZXXA 2WOOA 1NJSA 5K8LA 4B3MB 5FOWA 1JJVA 1YGPA 2OG2A 1ZOOA 2Z2KA 5HKBA 2BMEA 3MCUA 4XDGA 2PLWA 5F4BA 3P9IA 1Z5UA 4HNSA 5K3SA 4PZEA 3GRAA 3NASA 3U44B 3GXOA 2R00A 1GXSA 3N5KA 2L42A 4CLXA 2R4TA 4L16A 4O0LA 4LJSA 3L4JA 3ETNA 1X15A 1S02A 1C1XB 2Z5GA 3ADPA 2YN4A 4GRIA 5KKAA 3AKZA 1DIHA 2XZPA 3D7RA 4L0DA 2UU9B 1SCAA 3CVYA 4KG7A 1F60A 1M2EA 4WKGA 4JEUA 3MUFA 5A3SA 5CR9A 4LE0A 3LWZA 2ZJ8A 3NJ4A 3H05A 2DQYA 1OTXA 4NZMA 4X20B 2P79A 3HBLA 5DK4A 4XJTA 3HY3A 4PX3A 5AMXA 5EA2A 1LTKA 2PKCA 2BBWA 3C3MA 2FR0A 4EJ2A 1C1YA 3F78A 4FNAA 1M6WA 2VEOA 1UDXA 3IB3A 3NORA 4PQEA 3X1DA 2Q1XA 2XV1A 2DGDA 2QPTA 3QIVA 5KS2A 3RF6A 1THTA 2QT0A 4ARAA 3K53A 1B6RA 5ALXA 1NBMD 4BUJA 1X7XA 2M6RA 1UBEA 2XUDA 2C04A 3NIWA 4RKEA 3E9RA 4M9UA 2XA1A 4PN3A 4DA0A 1XJ0A 2V96A 2E1RA 5ARDA 5IWAB 2H9IA 1D2RA 3FKQA 2ZSHA 1RDFA 3UMSA 1TA0A 3PXDA 2W71A 3UJHA 4ZI3A 4ZV4A 3INNA 4TLEA 4FJ1A 1BCRA 1GQSA 2I6UA 1R12A 4P8RA 4RSRA 4PC7A 1DEHA 1A4XA 1VMAA 3PGKA 1OBHA 4JU8A 1QCCA 5E1BA 3ZQKA 5BPHA 3CNEA 3GK3A 3LF1A 1N92A 1I4DD 1JBKA 4P4GA 2HMAA 4UVEA 4YRSA 1H23A 1T43A 4BE4A 5A03A 1GQYA 4H9GA 2F3QA 3I61A 1PG2A 2XYQA 3T5CA 2ODAA 4XA8A 3B13B 4XUGB 3AIKA 5LWQA 3V97A 3R5HA 3PHHA 4HPXB 1F5SA 1XK6A 1M1YA 1BEEA 4I5IA 3NOVA 2GRJA 3PD1A 3QI2A 4I1SA 2XT9A 4BNDB 1NJ2A 1BD3A 1II8B 1T36A 1J8FA 1AGRA 4IMJB 3G2NA 3NEJA 3TX6A 1L2TA 3O8QA 2H63A 2PD3A 1H69A 4DLWA 3SEZA 3DKVA 4PHCA 4QX6A 4C43A 2NYRA 2AL7A 5G0WA 1QFXA 5I5GA 4W9NC 5C7IO 4TMZA 2QR2A 4CKCB 2P9EA 4FGUA 2QM0A 3K1ZA 1NYLA 2BZ0A 2JJQA 1L5VA 4UNRA 3HYLA 3JQ9A 3QXCA 3NYIA 4ENWA 5IDWA 4EMUA 1TZKA 3NO4A 3D4LA 7MHTA 5AVOA 2H4WA 2CL5A 4PRKA 1WZCA 3AM3A 2XPCA 3V1YA 3T5PA 4UUBA 3EOBI 3RJ5A 4FX2A 3PCXA 2DG2A 5LYJB 2G6TA 2G80A 2HO4A 2IEGA 2ZI9A 4G37A 4C0JA 1CUWA 3HWX1 2BKUA 4QOIA 2JAOA 4FLMA 4LTMA 4CEIB 3OCYA 2FVXA 1EFKA 1JNYA 3UJ6A 2JLXA 1ESZA 2R1ZA 4HNHA 2IBMA 2EFCB 4CBVA 4V39A 3HRIA 3T5TA 2FW9A 4HDSB 5CDYA 2GCPA 3LSTA 3D1JA 2GBLC 1SKAA 2KHZA 2WFLA 1WXWA 3MG9A 2Q4RA 2FFHA 2G76A 3UFXB 1U81A 3GIDA 2X5NA 1M75A 3OTGA 2Q5FA 5DLPA 4CKYA 3C8UA 4JXJA 4MW4A 2A2ZA 2REXB 4KIWA 3LNCA 4V0ME 3DDHA 1UKEA 3TCXB 4LNHA 3GJ8A 2H11A 1M2VB 3K09A 1Y4ZA 1E2GA 1N2GA 4B6QA 1ZH8A 1M8GA 2FLKA 3M6FA 4I19A 3HL0A 3F67A 1QP0A 2YZGA 1F8YA 4HDNA 1FUKA 1MZVA 4KRYA 4HAVA 5EJIA 2DU8A 1GYPA 1FDTA 4A8HA 4BVLA 1YA8A 2HU5A 4PX9A 5JQGF 2O5RA 1F3LA 4NFSA 2ZYVX 4WZBB 4QUAA 1Z2EA 2G1KA 1NT2A 1MA0A 4LQCA 2HUNA 4PXYA 4GOOD 4X1YB 5DLYA 4G1UC 4OOEA 3W7BA 1N2HA 2PGLA 4CM3A 5H4HA 3BXFA 3K72B 2JLZA 3CUVA 3KDSE 3BDAA 3QHQA 5AOBA 4P7BA 2VZEA 4CODB 2O8DA 2AFRA 4MOWA 4EYSA 1GRRA 1Y4SA 3OP1A 2C9ZA 2HHLA 1PEDA 2FSVC 4R98A 1BVYF 5DF1A 4C7JA 2HW8A 1MIOA 3L46A 1OV6A 1RQNA 1EK6A 2C83A 1E18A 2PN1A 2VQ6A 4ZTBA 1V6SA 1XF1A 1BAPA 3S0JA 1NW8A 1W4CA 3STYA 4JUCA 4F2DA 5HP4A 2XMSA 3GNSA 2HNAA 2BFFA 5K3FA 4JJAA 4EPWA 1KMIY 3OZEA 2A5JA 4E4YA 2CVFA 1PSWA 3T0FA 1M67A 221PA 3GGGA 1RHMA 2FUG6 2QF7A 1TF2A 2VK1A 5HSGA 3N74A 3ORFA 1E0KA 4KAAA 4YAFA 1Z06A 5AJTA 3IMCA 1GFWA 4HAIA 4FNMA 1SVOA 4ZKEA 2GD0A 4I1YA 1ZEMA 5G02A 3T3DA 2PZ8A 4Y8VA 4J8PA 4YGXB 3EXHC 2QTMA 5BV1A 2CMGA 4DARA 2BKXA 4MR7A 4QBGB 1DQYA 1Z4PX 3AEYA 2W6QA 4YRRA 3K0CA 3UWDA 2Y1EA 4QYMA 4YNBA 5EMNA 2OBYA 1QJCA 2P35A 1RM4A 1RR6A 3ELUA 1IOZA 3IUQA 4L8VA 4F3YA 2WLTA 4QEDA 2QRUA 2PSDA 4P7KA 4DE5A 2PD6A 1RWWA 3WKDA 1YD7A 2XQKA 3OPQA 4LF6B 5FNVA 4LZJA 4AF7A 1NI4B 3MSCA 4GSLA 4Q4AA 3T3OA 3GNQA 2BRUC 1IHDA 1YRBA 2JEYA 3GQBB 4G97A 4K9SA 2IU0A 3TQSA 3UT5B 3IP3A 1QFZA 4C9BA 4F38A 2V0NA 3IP7A 3EQ9A 2B1QA 4DILA 4EL5A 1G64A 3P2JA 3TDKA 4Z4HA 2E1PA 4S05A 1MJHA 2Y77A 1GLNA 1C4WA 1JP7A 4ZA2A 1JPNA 1T4CA 3C0KA 1X7ZB 5ER9A 1GGJA 1O6CA 1SIUA 1FP1D 5BO5A 4EG5A 1MTOA 1RJDA 2IEZA 4FZ5A 1P7ZA 1G7SA 1I3MA 1QG2A 2BH9A 2ZIGA 3IESA 3L01A 2B8WA 5AKLA 2IEBA 1KQGA 4YV7A 1XDGA 2CK3A 1U3CA 2OHVA 2BEVB 3VPHA 4WCVA 1PNTA 4AMYA 5EJ6A 2TMGA 2V7EA 3R6DA 2O3JA 3DZKA 1DX6A 3QYAA 3NAZA 2D1SA 4JI6B 4R2WA 1IHXA 2FJUA 1A77A 1GADO 2OKGA 3FBWA 3DL7A 3OQ1A 4LBZA 3ZEAA 5INTA 2R1TB 1HX7A 3UK0A 1SO8A 3GGPA 3KOZA 3VPCA 3CN7A 5KSOA 2GFHA 2C4KA 2ZAMA 4PTYA 3V7WA 4E5VA 2C5SA 1RAIA 5BYKA 2EIHA 3AGQA 3GZJA 5ILGA 3VH3A 3IE0A 2ZVPX 1DZIA 4OY3A 4TTAA 1P31A 1I0IA 5FA6A 2BFFB 4ACAA 2NWQA 2Q2WA 2QE7A 3OPYA 1ESNA 1RYZA 3E58A 4OREX 4ZJUA 1GGMA 1QHSA 3PQ6A 5MGBA 1LRJA 6CHYA 4AUKA 1OFTA 4K9PA 2RJ3A 2HZBA 2XB9A 3MWEB 3OJLA 5IM4A 3SNKA 4WNIA 4I1PA 3HCEA 3WDMA 3M1IA 4DPLA 5KOHB 3G2MA 3RVDA 2WTUA 4EVQA 3PNLA 3OEHA 2RONA 3AFOA 5KYYA 3H1BA 3M1AA 5D7BA 1M73E 3BE4A 4X6UA 3ZHCA 4D42A 3HRKA 3V8BA 1G6HA 1Z6PA 5AK0A 3TB4A 3KALA 1GG9A 2AD1A 1KC3A 4NC9A 1MQSA 4GGMX 4CUJA 2UUAB 1E7MA 2DEUA 1Q3KA 3JAKB 4QBKA 1O96A 2EP8A 3I32A 3R8CA 2V8BA 1TRHA 1C0LA 1EFDN 3S1SA 5C18A 4LSZA 1SXJE 2HA0A 5IP5A 2O2SA 2HU7A 1GPH1 1KZ9A 1Y8QA 2PL1A 2C9OA 1IVNA 1YZYA 3Q5GA 2TRSB 1OXMA 1YB1A 3OX1A 2CXSA 3KQWA 4B17A 3NC4A 3TIGA 5IJZA 4GXTA 4F93B 1UWKA 4JDPA 2PTGA 2Y1KA 5B2FA 1SXJC 1QGZA 1G1AA 1HG1A 2OGSA 2QT9A 3K2BA 3OCZA 4LJ9A 4ZODA 3VR2A 1ZR4A 4LXUA 5AM0A 1AS3A 1CUVA 1YS2X 4YH1A 4ARBA 3AWIA 3M5WA 4KACA 5AM1A 4DLPA 5F23A 3IV6A 3SP1A 1W2GA 3WGIA 4B3TB 4XQEA 3ANXA 3QE9Y 4X93A 3ZDRA 3QZUA 4QYIA 2X58A 2LPMA 4IDFA 3FF1A 4L8FA 4LI0A 1F6BA 3B82A 3IQIX 2PU7A 4RTJA 5DZSA 2J9YB 4FHCA 2QTCA 1I7SB 3PTZA 9LDTA 3LC7O 3L1KA 1TM4E 3SSMA 1IQPA 1A2BA 1QGAA 5DYGA 4HVTA 1R88A 5TJHA 1KMQA 2FW6A 3A6HA 1FSFA 1XCJA 5KO2A 4EHBA 5A62A 1VMEA 3RC1A 1X7YB 2O2EA 4A6EA 3BXEA 1E6LA 1ZNQO 4GOND 3R9IA 3HUTA 3G17A 3JQ9C 4NP6A 3UGKA 1AQNA 3OT1A 4G4SO 4IDNA 1VLQA 1Y33E 2QENA 1VRCA 3IIEA 4CT5A 4N3AA 5IUJC 1YR3A 1NC1A 4IWYA 4P31A 5EZYB 3GD7A 3FUTA 4LHYA 1BWPA 2CFCA 1E2LA 1UQUA 3ZD9A 3PEYA 4RZIA 3GLQA 5NULA 3CX8A 3G2LA 4AICA 2BI8A 3LUFA 5EQTA 5J59A 1KJJA 1O4WA 1PGOA 2OM6A 4Q3LA 4UHKA 2G5PA 2OB2A 2VJNA 3OZBA 5JU6A 5F9HA 5E6RB 3IAXA 2Q8QA 1AXGA 4PNZA 3P52A 1M1XB 1LBSA 1Z82A 4M8LA 4XYBA 4N76A 3Q3EA 4CKBB 4EA6A 2AOTB 2QZ9A 1P6QA 1L5SA 2DC1A 3FOWA 3WVNA 5JXGA 2R68A 5AKEA 1RRVA 2JI7A 4BNIA 1D1PA 2PLNA 3I1YA 1RLUA 4TUYA 1ISRA 4DC0A 1Y6GA 3OKAA 1GNSA 2AVDA 2CXNA 1XVAA 2P9BA 3P0JA 4ZCSA 2DCMA 1Y34E 2B25A 2CEKA 4MLCA 4XVUA 3RFXA 3IV9A 4ARZB 3C4QA 3GJTA 4COKA 3OUZA 3IIKA 2FSPA 3N07A 4TYMA 5LQAA 3U5ZB 4AIRA 2QI9C 1ZRSA 2Q99A 2B5OA 5J9FA 5B64A 1XCOA 4TMTA 2K5UA 2IIVA 2ZYRA 4EAQA 5AUNB 1YZKA 4RD3A 3LA8A 3OM9A 2YZNA 2PMEA 2WA2A 4PTLA 1BCRB 2AJTA 1JHYA 4YDSA 2GNPA 2VP0A 4R51A 3RODA 1XZHA 3M34A 4HC4A 3GEIA 1DBIA 4HB4A 4PS0A 3MXOA 3A6KA 1EJ0A 3H8VA 1IFXA 4L28A 5I8ZA 1V37A 3GDWA 3FZNA 4CKEB 2DQKA 3ZLTA 3GLSA 3KOMA 1KEEA 1T9GR 5CRIA 4JGGA 1DAFA 1Q57A 3QX8A 3UPUA 1TK2A 4U8HA 2V8OA 3C7KA 4CUZA 3L06A 3GDFA 5JOQA 5EZYA 4N0DA 1IE3A 1X1QA 2PX4A 4QOHA 2R85A 1UOOA 3RBXA 1F9AA 1YB2A 1B0PA 1SA0B 4FOSA 2DFLA 3IBTA 2V58A 4MMYB 4R54A 4YMGA 1OA1A 2GTPA 3NETA 4EGSA 5HPYB 1LLQA 3VXKA 4BN5A 2V6JA 4CMIB 5K5EA 2OD7A 2QW1A 2FMUA 5JFOA 5JAOA 3LSYA 1TF7A 4IQ8A 1XJCA 2BTOA 2Y4OA 5EZQA 3FPLA 5CXUA 4GI3A 4OHRA 1RMQA 3OQ6A 1L4FA 1TEXA 2LZ0A 2WR8A 1SVSA 3AVOA 3BA1A 1SHZA 3EQZA 3GN1A 3BGIA 4JJKA 5D8DA 4KN6A 1KR2A 3AF6A 1HF3A 4H0NA 5DYTA 3G9QA 4DIFA 4DA4A 1XEWX 3H9EO 4BVJA 4DDTA 3U19A 2CLCX 2IDMA 1TO1E 3HKDB 4B7CA 2FOIA 2CXPA 1A5AB 5JS2A 3MJSA 1SRRA 3B6ZA 4MUFA 2QL6A 4RPGA 2ZI3A 5AP9A 3VBEA 3WL7A 4Q9IA 4DCPA 1P5HA 2A7XA 4OM7A 2ZRFA 1JEQA 1CY7A 4F04A 1FMFA 3DHVA 5CLFA 1P0FA 3EXFB 1SCIA 1X87A 2JIRA 4HDSA 1I32A 4YMVA 3H11B 3QHPA 5E8RA 5B12A 3RTCA 4GYJA 5IN4A 3UMVA 2OWEA 3IHWA 4M4SA 1AF4A 5AW2A 4R1TA 1XLWA 1Z4LA 1QH0A 5I47A 3M4NA 1WKCA 2VUTA 4LZWA 2QQEA 2EEZA 1XZPA 3O3NB 1MC1A 1KIFA 2OCAA 3CNLA 4KQ1A 4JCOA 1WW2A 2CL7X 1JVSA 4QTYA 2XCTB 1NT4A 2HI0A 3ZQJA 3TYXA 2BMJA 1PDOA 4UEQA 2BWJA 1IN6A 1C1DB 2WDPA 3CURA 1Q1AA 1G4UR 3T7KA 4BGVA 2AC2A 3K1TA 4UMDA 4BIMA 1US8B 1I2MA 2QG9A 2GF0A 3OHPA 4KVZA 2GGSA 2CFTA 5CJ2A 1GDDA 4G67A 4EGQA 5C80A 1U2PA 4ZOLF 4CKCA 3GI1A 4ZDWA 5JARA 1NRJB 4KIGA 2QVXX 1J7JA 3ENNA 1OV4A 3ZQUA 3ZWYA 4GR4A 2WWYA 5FJIA 2R6JA 1PZEA 1XPOA 1QF6A 1LLUA 4JBXA 2ZE5A 4GAEA 4TKVB 1U28C 3MWEA 3HZZA 3WX0A 5LPNA 3R9XB 4TXMA 2ONJA 4PLYA 1R7RA 2ONZA 4C6TB 2H2IA 1C7JA 3CE9A 4FM9A 4FMBB 4ISBA 2FPXA 3V32A 3CSDA 4UU8A 4LNUA 3L6BA 5TQ0B 2GZ3A 1SKMA 5KX5B 1WMAA 1TYBE 1R4MA 3GA5A 1P75A 2CXHA 3RAFC 2O1WA 4IJKA 1UC4B 4XH9B 1WTAA 3TEMA 2QUJA 2ZG6A 3MJHA 3PDJA 5JJ5A 2EKQA 2FUCA 3ETHA 2OYRA 3BQMB 2BCGY 3JTEA 1ZHOA 4UPVA 5AK3A 4LYAA 4TTSA 1TAUA 1KY2A 3LQ2A 3NHRA 1YI0A 3LDGA 3TQHA 3H9BA 3P45A 3W04A 2X1VA 5CG1A 5FWDA 3JQDA 2PSFA 2TSYB 4E5YA 4E5SA 1LTHR 1WTCA 4G8DA 4ROTA 4B6FA 3D6UA 3P2OA 4KYUA 1EXWA 1T1IA 3H6GA 1XTPA 4ZAGA 3TRFA 1S2DA 5DLQC 3U80A 3WGLA 2O8BA 4EHAA 2QSYA 2F7SA 3P2IA 4FBLA 4MR9A 1TAQA 4XGKA 5JY6A 3C16C 4D98A 2EX4A 2R1VA 3GBPA 4CM5A 3QYJA 1B14A 4F72A 3EIEA 5EESA 1HE8B 1F2TA 3WYFA 1VA5A 1BZYA 3HG7A 2OHIA 1B4DA 2D06A 2XWSA 3PCTA 1DPFA 5I9IA 7AT1A 3WKEA 5CT9A 5E4TA 3U3DA 2NXWA 5A05A 4F56A 3J81A 2ISQA 4NMLA 1ZRHA 4BQOA 2X9QA 5FI0B 2VBGA 7GPBA 3RG8A 3FPEA 1SU8A 2HBRA 3QSYA 3RO7A 3LX5A 4FDAA 4C0KA 3K9LA 4GSYA 4YVFA 2OGUA 1U9YA 5BNIA 2AUMA 2X77A 1KSGA 1EESA 2RAUA 1XA4A 2GO1A 3IAUA 2FP3A 4WZBE 4DIDA 1NNEA 1P1BA 4DLAA 2J31A 3UJ9A 4BBZA 2QX9A 1C3EA 2V7PA 3ECCA 4JKYA 1B0AA 4EA7A 1CDZA 3OF5A 1NHWA 4GRAA 4NULA 2WNHA 3JWEA 3UJAA 2F8SA 2P1ZA 2R1VB 4DDVA 5LMZA 4P86A 3GAAA 5HMLA 2J7PA 4GSKA 4NCXA 3QOYA 5EINA 3OSUA 4J16C 5JYBA 2OO3A 4MPPA 4KQKA 4WFIA 4YT4A 3HR8A 3A25A 2AFHA 3PC3A 5E0KB 1YAJA 3GMSA 3H65A 4D7AA 2J0VA 4BO1A 1QP4A 1AGXA 2FPOA 3BMCB 1JFRA 4K1XA 1RI1A 1QG4A 4WFKA 5GZ6A 3RSSA 3P1JA 2QRGA 3OE5A 2W9XA 4ACBA 1I80A 1N2BA 3P2EA 4B6EA 2QVGA 2XF2A 2X9LA 4HEHA 4DSNA 2EIXA 3H0CA 2X0DA 1PQPA 2ZBRA 1XZBA 2EDCA 3D8RA 2ARKA 4GPEA 3MS2A 1I4WA 4MQUA 1DJQA 2YNMD 3D6AA 4H7DA 4TT3D 5JTUA 1RXCA 2XGJA 3UJ7A 4CMAA 1P19A 3UMBA 4BFSA 4ZEMA 2WWVD 2GESA 3BRQA 4ZQEA 3SAJA 1Q3TA 1HZZC 4MVXA 2F3SA 5JSHA 4KGVA 4OFZA 5JC1A 5EZ5A 2BSQA 3VH4A 2ODPA 4Q4JA 4LXYA 1SBHA 3PEVA 4D99A 3N2GA 2QS9A 1JWLA 1IH8A 3ROXA 1NYRA 2FX3A 3CMMA 4O4IF 4WZAB 5EP2A 3T06B 1JHAA 3TNYA 3P9NA 1CF9A 3C6QA 2PX6A 4OSPA 1BXZA 2FZGA 5M3BA 3KZMA 4ZVSA 3BORA 5I7OA 1VLHA 1WW8A 2IYYA 3I5XA 3MJEA 1Y9ZA 4BVGA 1MVLA 3CGGA 3KSZO 3KR9A 4DJEC 2A0YA 4X1YA 1E6WA 1Z4NA 2Q4TA 4EHHA 1JLLA 1FMJA 1N9GB 3L18A 4N9QA 3ZWDA 3L2OB 1C7EA 3RROA 1BVRA 3HEBA 1ODTC 3GJ5A 1MX5A 1ZUHA 1NQUA 4OQPA 1N2CE 4YDRA 2X2PA 3ESQA 4LRSB 4ZVRA 3K9WA 5CEEA 3GLRA 3MJ4A 3TPZA 4PO8A 4FNGA 2ZBQA 3R6WA 3L0CA 1PT5A 2JHAA 2BMWA 1N0UA 5T4EA 2B7BA 2HCFA 2GN2A 1IN5A 4G0YA 2ORVA 4GW3A 4HDRB 5K0NA 5AUOB 2W6ID 2Z2ZA 4A36A 3BCSA 3CUKA 2CL0X 2GEFA 3NHZA 4HBGA 1MAWA 3UIEA 4UHBA 1IQUA 4DXDA 4LEIA 4F91B 5F5NA 2GZDA 2XUKA 3FBGA 4KQGA 1XDUA 2IPLA 3CUWA 1JIJA 4CDNA 3NWBA 1XMSA 1AF7A 2XMQA 4RTPA 4D9IA 1HORA 3EODA 3K35A 3RIMA 4XPIA 1MO2A 1Z6XA 1NXXA 5CPFA 1DUIA 3H5IA 1JSCA 3QVSA 4BLWA 1L1EA 1P8AA 3NKVA 1S01A 4L8WB 4X1OA 3SHVA 4Y6GB 3HDTA 2GXSA 4MTCA 2MCFA 3M3DA 2CEAA 2R84A 2C00A 1TVEA 1KOLA 3CO0S 2CYCA 1O96B 2IE8A 3KM0A 5K3BA 4M1YA 3ZCTA 4C05A 3N6RA 3GEBA 3FYDA 3EYAA 1TECE 4TL6A 1UZAA 3TNJA 5ICEA 1QH1A 2PZGA 1R9JA 1ZN9A 3JWJA 3ONNA 4X61A 1B76A 1M7BA 3EFOB 3MCVA 3E70C 2HSDA 3NIDB 3QMPA 4M87A 4WJLA 3MWGA 5BNZA 1FBTA 3GIWA 3FMIA 3ZYZA 4N47A 3L8CA 3IELA 1VKZA 1BDHA 4Z8YA 3R23A 3PK0A 4JWTA 1X0XA