1F2TA

Crystal structure of atp-free rad50 abc-atpase
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
149
structure length
145
Chain Sequence
MKLERVTVKNFRSHSDTVVEFKEGINLIIGQNGSGKSSLLDAILVGLYWPLRIKDIKKDEFTKVGARDTYIDLIFEKDGTKYRITRRFLKGEIHAMKRLVGNEWKHVTEPSSKAISAFMEKLIPYNIFLNAIYIRQGQIDAILES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural biology of Rad50 ATPase: ATP-driven conformational control in DNA double-strand break repair and the ABC-ATPase superfamily.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Replication
molecule keywords RAD50 ABC-ATPASE
total genus 31
structure length 145
sequence length 149
ec nomenclature
pdb deposition date 2000-05-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1f2tA00
1VHLA 5CITA 4Q7JB 3KQLA 1AZTA 1OFHA 2O8CA 3QXJA 4HUQB 1SXJB 1T6NA 2C9YA 1ESMA 3W3AA 4ON9A 1L2TA 1FUKA 1MKYA 1FMJA 2K5UA 2R9VA 4L15A 2LKDA 2JLWA 4ASUA 2MMCA 1S3SA 3SC3A 1BOFA 4TTRA 2P5SA 5EZ6B 2DWQA 4PPGA 4Z1MD 5J4KA 3GJ6A 5AR1A 1KDOA 1S1MA 1XEWY 3QXSA 4BEBA 3I73A 2FH5B 1GG2A 1L4YA 2I1VB 4Q03A 2FOLA 4QBFA 4IHQA 4OL0A 1NBMD 3GQBA 4CF7A 4ESVA 2UZ3A 1E96A 3I32A 4S2EA 3RRMA 2GEVA 2OHFA 2QE7D 1YQTA 3DPUA 4PFSA 2WWYA 1EFRD 1ONBA 1OXVA 2ZE7A 4LBZA 4OHWA 2I3BA 5G3ZA 1RKBA 4HYYA 2A5YB 1P6XA 2ERYA 2CNWA 2ZRLA 4QNMA 1GRQA 2FGJA 2WJGA 4BFZA 1X3SA 4HAWA 4NYMR 4HAVA 3QUSA 4LC1A 2W00A 2IYRA 3QKTA 2IYZA 1XXHB 3L2OB 3VKWA 2PCLA 4F38A 4D6PA 3FPAA 2XZPA 1OHHD 3FHTA 3EPKA 5FR2A 1SGWA 4B2IA 1QHXA 1AM4D 1PUJA 1N5KA 1NY6A 1E2IA 2D2EA 4NU0A 2C9CA 2REBA 4UNPA 2L0XA 4RJLA 1JQLB 1NBME 3HPRA 4OHVA 4RFSA 4C0SA 2YWGA 3CX7A 4JLJA 1Z47A 4B3GA 1KYIA 2IBMA 3MMPA 2IX3A 3VHLB 4C0LA 2CHQA 3RSLA 1KY3A 2IYUA 2ZU6A 2PZEA 4UNQA 4HLQB 4LBWA 2ZM5A 1QHYA 4EIWA 8OHMA 4NCNA 2QTFA 3BB1A 2H17A 1R6BX 3OAAA 4N0EA 5DHAA 2XX3A 2R62A 1DTSA 1EX6A 1YU9A 1KAOA 4JSYA 4WZ6A 3GEIA 3AF2A 2CK3D 3IIKA 4NYJQ 5EE9A 4A1FA 4V02A 1HEIA 1IONA 4JSTA 4O2LA 2GXUA 2GBLC 1F60A 1KZGB 5FOWA 3BFKA 3LQRA 2ZEJA 4US2R 3QG1A 3EPLA 3K9GA 5AUPB 4W5WA 5C46F 3QE0A 5CLQA 1LF5A 3AQ4A 3QQ5A 3X1DA 5CK4A 121PA 2OXCA 4JLKA 4HDOB 3KXKA 4L9SA 4A2WA 3ADDA 1C9KA 1SKYB 2HJGA 2XOKA 1G3MA 2A5GA 5JECA 3GJ5A 3O8CA 4B34A 1EK0A 3ZLJA 4CEIA 1T0HB 3KB2A 3VR3A 3NEYA 4KLZA 3BB3A 3VQTA 3FMPB 1CP2A 2CEAA 3EASA 4AKGA 4EPVA 2AD5A 2OM2A 2NO9A 1OW3B 1E0JA 2OFOA 4XJXA 3QBTA 1CJMA 3CW2A 3THXA 2ZTSA 2Z6VA 3HWSA 4HB4A 3OFNA 2LWIA 1Z63A 4URYR 1C4OA 4YDSA 1JPNA 3A1WA 5CB8A 3MWKA 4LBVA 5FL7D 1D8TA 4YMVA 2WPDD 4N1AA 4OQMA 1TQ2A 1IJFA 1R10A 4KITB 1QG2A 2ZU0C 1TAGA 3RYTC 5DHFA 4EQ6B 2OT3B 3HYRA 2IT1A 4A2PA 5JZVA 2BEJA 1D2EA 2QAGB 2MMGA 3NKVA 1OV4A 5DLQC 3B1ZA 5E4FA 4EFLA 1QG4A 1NBMA 3BIFA 4KFSA 1T4GA 4A4DA 2NPFA 2GVDC 2GZHA 2OFXA 3IBGA 3T15A 4UKDA 4V0MA 1NLFA 1FNNA 3W6NA 1X1RA 4TQAA 3CIOA 1RJ9A 3CR8A 2W6IA 1N6OA 2O52A 4I81A 1LY1A 4DLTA 4MGYR 3EIHA 2GETA 2QZ4A 2QBYB 4WXRA 3TVTA 4AI6A 4Q9HA 1DVRA 2QGZA 2JJ1A 1E2MA 1GNPA 1GNQA 5HE9A 1YRAA 3A4NA 1E1RD 1W5SA 2W2XA 3MSXA 4QGFA 4C4PA 4E22A 3U4QB 3AVPA 2BHRA 3AVTA 1FP7A 3ZIAD 1G8PA 2GK6A 1UKYA 4UQOA 3DDCA 3LX8A 3IO3A 3Q9LA 5JHHB 3DZ8A 2C9OA 3W5IA 4LC0A 3C5HA 4BFUA 2BMEA 4JMPA 4QJ5A 1XCPA 4ZIRA 2WKQA 2WBLC 1MRSA 3IO5A 2P5TB 1KO1A 3I8SA 5KDOA 1NSTA 2ZQ5A 2CBZA 1KSHA 1G16A 4KI0A 4MYUA 3QPUA 3EG5A 2VBCA 2A2ZA 1VDZA 4NCJA 1XX6A 5AJZA 2ASEA 3KFXA 3RWMB 1ZMXA 5KHOC 4KSCA 4TTPA 1W0JA 3AF1A 1P4SA 4GBMA 2DCUA 2VP4A 3WXMA 1P61B 4G5RA 5HTKA 4WAUA 2XTNA 1QF9A 1KOFA 3Q5EA 4Q7MB 4DSTA 1MOZA 2Z4RA 3B9PA 2UVQA 1UBCA 2ZREA 1GL9B 3L82B 3CRQA 1L4UA 3KQNA 2YOGA 3BRWD 1N3BA 1U98A 4CIDA 2ZRCA 4IVPA 3SQXA 5EUMA 3AVYA 1QVAA 5JLJA 1NL3A 4QL3A 2O5VA 1H8ED 1NKSA 3LVRE 1RE0A 4TMKA 2AHOA 1X8JA 2BC9A 4TYPA 3RRZA 5JWRA 1I2DA 1OXUA 4H1VA 2BV3A 5JSZA 3K0FB 3Q7QA 1E2EA 2FFBA 3EWSA 1UEJA 4FMDF 1XEFA 2R6GA 2OCBA 2UKDA 3R8FA 2QU8A 2V1UA 2PMDA 3VKHA 5FTMA 4A8JA 2J59A 4J0QA 4EPXA 1RIFA 2BDTA 2NGRA 3R7WB 1YZQA 3PEYA 3ONWA 1VG1A 2IYWA 5FFMA 1NN1A 5UKDA 3GPLA 1KTVA 2X2EA 3FOZA 1DEKA 1U0JA 3VR6A 4L9WA 2C98A 1XFAA 2OSBA 4JYCA 3PIRA 3CKLA 4QM6A 4M22A 3RS4A 2PT7A 1HQCA 4FMCB 4TMTA 2H7VA 4PQFA 1R5OA 5EUQB 3U3RA 4ARZA 4DDUA 2Z43A 4KHZA 1N5IA 3FYHA 4IEIA 4MDEA 2PZFA 1E2KA 1E0KA 2O0JA 4D82A 2VLIA 2CJWB 3A1UA 4Q48A 4RCYA 1JB1A 2ONKA 1A82A 1ZC4A 3LLMA 4UJ5A 2ZI9A 5C1BA 1ZD8A 1WXQA 2NG1A 4MYCA 5A5GA 3B2EA 4HAYA 4C0QC 3K70C 2HXSA 2V6JA 1Q3HA 4BLRA 5TXGA 2FGKA 5FUVA 3CH4B 1KSGA 5KPJA 3FDIA 3UANA 4OQLA 2D06A 3X1ZA 4P31A 4Q1DA 4WA7A 2ZS7A 2OCAA 1AK2A 3OEEA 3AV0B 1T8TA 2WWHA 4QNRA 4XWOA 1GFIA 1Z2CA 2RHDA 5FI0B 1R8SA 3CNNA 2FG5A 1KO7A 1JECA 3N5CA 3W34A 4GP7A 2XSZA 1IXZA 3RAPR 2QNRA 2XEXA 3MWJA 4PO1A 5LBIA 2WPDA 2Q3FA 2H5EA 2HCBA 2AKYA 3RRYA 1CF4A 4JIMA 1R7RA 1AQUA 2TMKA 4PPQA 2A5DA 2FN4A 5L3SA 4KV9A 2E87A 2J0VA 2WV9A 3BGWA 3A8TA 1CTQA 2EYUA 3AF0A 1GZSA 3GLIA 4CDGA 4CEJB 1XTQA 2PLFA 2ZSAA 2X8AA 1G8FA 4LJ7A 2BJVA 1TUEA 1V43A 2ZPTX 5M04A 1X8KA 4OI0A 1GIAA 5L3VA 4TL7A 5SZJA 4QXAA 1KNXA 3IQWA 2AD1A 3HJNA 2GDJA 1SXJC 3ADCA 4BE7B 4U7DA 5LB2A 3LXRA 2B7BA 3E2IA 1N6HA 1DG3A 1M74A 3ND9A 1GL7A 1ZNYA 2W0SA 2HF8A 1HT2E 3IILA 5TDHA 5F98A 2RMKA 1J8MF 2ZXUA 2GXAA 1QHHB 3I4LA 1GWNA 4RD3A 4Q7LA 4UXIA 4W7SA 4DT1B 1DARA 1YR7A 3PUYA 3K9HA 4MH0R 2AFIE 1FTNA 4DLZA 3TUIC 3KKMA 3UKDA 3U7GA 2LKCA 4LPKA 1VMAA 1UFQA 2CLCX 2FNAA 2V4ZA 2V7QD 4DLUA 2ZRPA 1KKMA 3AKYA 5AK0A 5FPYA 1PLLA 4DSOA 1A2BA 1ZUIA 4JT4A 1XTKA 4JLVA 3P4XA 5C18A 3CLVA 2VF7A 1F2UB 1N6LA 5J4HA 3I5XA 1W4RA 2JGNA 3K0CC 3Q7PA 1F6BA 3QF4B 4M1MA 4FCWA 5E95A 1FX0A 3LRPA 5FH9A 2FA9A 2WTUA 1K6MA 3RRNA 1NMZA 3N2EA 4I1SA 2W6JD 2IK8A 5IT5A 1FL9A 4CGZA 4C7OB 1VG8A 3DKPA 1C1YA 4ACAA 3KUDA 4OHXA 4KO8A 3QG5A 2R2AA 2FSIA 1KZ7B 2WJYA 1V5WA 3NH6A 4U5XA 1Z3IX 3C4JA 1XD2A 2Z4SA 5KUTA 4KLNA 3RANA 2ZRDA 3CH5A 2ZAMA 3P20A 2GK7A 4POAA 6Q21A 3UIEA 2VQSA 5HZHA 1E9FA 2IXEA 2NTYC 1Q44A 2PEZA 4D4LA 1EFCA 1F2TA 2ZS9A 4RY2A 3IUYA 4Q66C 5JBQA 2G83A 2C2HA 4MRPA 2IEYA 2FWRA 1WDTA 2B92A 3GLHA 4FIDA 3CB4A 3EIQA 3VU9A 1NY5A 2W58A 4HDCA 3OEED 4OJQA 2P65A 3HP1A 3RVBA 1E0AA 2VHTA 2B8WA 4MGKR 4PSVA 1P2SA 2C8VA 3EWAA 5KTYA 3CX8A 1JEEA 5IRCD 3VFDA 4DLWA 5JCPA 2WJHA 5B2ZA 3KXLA 4URZR 2QY9A 3U7FB 2X77A 1DAFA 3QVUA 1G3QA 2H1LA 4S35A 2C96A 1GRNA 1ZAKA 2O8BA 1QHNA 2ZSFA 3DMDA 2C5LA 3GJ8A 4L16A 4DLRA 2BOVA 3I3SR 4DJTA 2D7CA 2HXYA 3I62A 2VF8A 1QHSA 4TMWA 2WSSA 2EFEB 2FZLA 3CF2A 3CZQA 1JI0A 1Z0IA 5HZKA 4B2PA 2QMOA 5DI3B 2KB0A 4Z54A 2PL3A 2CJWA 3PCRB 2F7SA 1EGAA 3AGPA 1G17A 2GZDA 3KKNA 3ADBA 2VP6A 3FFBA 1CEEA 1SXJA 4DVGA 1HUQA 1KI6A 1P9NA 3BE4A 4AYTA 4RD2A 3X1YA 2PX3A 2QORA 3WNCA 4DLVA 2ZRJA 4MRRA 2NO6A 1NVXQ 1Z28A 3SNHA 1KAGA 4GMXA 4XIGS 2H18A 4E03A 1JR6A 1GITA 4LJ8A 4BECA 5FPKA 2QT0A 1Z6XA 1PLJA 3H86A 4OQXA 2P0EA 4XTCS 3GJXC 1IM2A 3QNUA 2QN6A 3IDQA 3PR1A 3UK6A 2G0NA 3KJHA 2WJVA 5EXSA 3SI7A 3T1QA 1BIFA 3Q85A 2KE5A 3PQCA 4HAUA 1S3GA 2I4IA 3NH9A 3PFIA 1G3IA 1O3YA 1EFHA 2RHMA 4KFUA 5TV2A 3THOA 1UBGA 4TSFA 1U9IC 4IDOA 2IUTA 5BN4A 1VPLA 2O8EA 4BLTA 3TE6A 5DISB 1P72A 3FE2A 1RRFA 3KKOA 3R9WA 3KL4A 2X19A 1SQ5A 1HURA 1XD9A 3B82A 2F43B 4QKQA 2VP0A 4TMVA 2RAPA 4GOXA 5KSPA 4B6EA 2GJ9A 4QJ4A 5IF9A 3WRYC 2EQBA 2DY1A 4MRNA 4M2LA 5FOTA 3KDSE 2DWOA 2YC4C 4LJYA 4Q4AB 2ZYUX 3CR7A 2OCPA 3PV0A 2V9PA 4B3CA 4U02A 3SHWA 2D7DA 3KQUA 2EVWX 3NIBA 4HLUA 4URWR 4LYJA 1CJVC 2QAJA 3EZFA 3NBYC 5TVKA 3VR2A 3IKJA 4PO9A 3SDZA 5BW8A 2XZOA 4ACBA 3PEWA 2OV2A 2JIZD 3K8YA 4GDFA 4PHTA 4ZKEA 1QHHA 4DT1A 1IY1A 1Z06A 2FFAA 4MUAA 1MABB 2G0TA 4EDHA 1A1VA 4PTLA 1XWIA 2ZI3A 3LO5A 2WOOA 1YZTA 1W4AA 5HR5A 1KK0A 4YC7A 1L8QA 3BS4A 4DB4A 1S1CA 2GKSA 1RYHA 2ATXA 2ZYTX 3EA0A 2DFKB 4RFVA 1ZIOA 1KK2A 3DL0A 3A4LA 1II8A 1U8YA 4M1KA 1H8HD 2IS4A 1RVDA 2KBFA 4DCNA 2QSZA 4IVQA 3VX4A 2O8FB 1NI3A 2VPPA 3VHXA 1RZ3A 1Q1ZA 4ZI3A 3T1OA 1E9AA 1WCV1 5HKKD 2ZE6A 3GLIE 5A0FA 1U0HC 2DPXA 4PPNA 4QGGA 2YKGA 1NVUQ 4XSGA 4UJ3A 1E2DA 4CYMA 4DEXA 5EE0A 4GPTA 4C7OA 4IOKA 1Q12A 1UM8A 1TF5A 4B48A 2RGEA 1ZM4A 4W5JA 4C0KA 3THXB 3GJ0A 4G3XA 1NVWQ 4NKRA 2VHCA 3B6EA 4PAOA 2ZVPX 5BN3A 1E2GA 1KO8A 2FE4A 3K1JA 4HSEA 4MQBA 3WHKA 1VYUA 2CE7A 1KMHB 2IXFA 4IDQA 4Q19A 5JRJA 5K8TA 4JLOA 3CONA 3EXAA 3SR0A 4V0LA 2DFLA 3SE0A 521PA 1YRBA 2ZJ8A 4G5QA 2OBLA 2J3EA 2W6JA 3Q72A 1TQ4A 2OZEA 2CLSA 2NO0A 4NYMQ 1ZYUA 1VCMA 4ZKDA 2QAGA 4HB3A 5SZKB 2PX0A 4QM7A 2VA8A 1ZP6A 2IF0A 2WOJA 2QAGC 3KQKA 1VHTA 4LWZA 1CR2A 3SYKA 1SVMA 5KNDA 4URUR 3GFOA 5DGXA 2DWPA 1UBEA 4PC2A 1II9A 3IEUA 2WWXA 3MD0A 4OK5A 4G5GA 3WMGA 1KJWA 5C2JB 4QBHA 2AN9A 5ANRB 1HH4A 1G3RA 4MUBA 3QF7A 3UWKA 4JL6A 1NIPA 1CRQA 4LUCA 4BASA 4PPFA 1OE0A 2ANBA 4MRVA 2G77B 1OH8A 3K9LA 4V0NA 2H57A 5GJWC 4RKEA 5AWFC 4HB0A 2CL0X 1E2PA 1W46A 2IC5A 3WNDA 2O8BB 2FDCA 4MRSA 1XMIA 1E2QA 1M7BA 2QUZA 3LWNA 4RKFA 2ECKA 4Z8YA 4C3ZA 4K8OA 4K81B 3VKGA 1II0A 2RGBA 4AIIA 2R6DA 3GEHA 4EFNA 1K5GA 2F1IA 4FI3C 2J87A 3MFYA 4OHZA 2HDNB 2VSXA 4PHGA 1L7VC 2NO1A 4TMZA 3W6PA 4A92A 3QIAA 3AVOA 5KPDA 1P2VA 1B23P 2GF9A 1E9DA 4HUTA 2F9MA 2WWIA 4QJ3A 3JZAA 5FOUA 2W83A 5JS7A 1JEDA 2WAYA 3QVVA 5C4MA 3H2YA 1US8A 2HF9A 1OHHA 2V54A 3GLHE 3LFUA 4KSBA 4NYIQ 3V9PA 3UATA 2QP3A 4YQFA 2BVNA 3FHCB 2JDIA 1KK1A 4L5BA 4CZ2A 1Z6AA 2KI5A 3CF6R 3IEVA 1DPFA 1Z0AA 4OI4A 4HZUA 3C41J 1NN3A 2WHXA 3T35A 2QL6A 1OH5A 1I4TD 4CEJA 3DEFA 1W2HA 1DG1G 1TUIA 3U7HB 2RGGA 1VKJA 2Q21A 1U81A 2ODNA 1XXHA 2QE7A 4HEJA 4NDZA 4ILEA 1ZINA 3QXXA 3LD9A 1XD8A 3IPXA 1DAIA 2ZYWX 4BGDA 2FPMA 1TU4A 5EP4A 3G5UA 2OBMA 4KCGA 2YOHA 1HTWA 4ZV4A 3KKPA 1XBTA 2ZE5A 5CM8B 4ZDWA 2QM7A 2EYQA 2KBEA 1N2CE 2YYZA 4BFVA 4B35A 1XB2A 4FN5A 1KK3A 2F43A 1I4LD 2IL1A 1SVSA 2OEPA 2Z0MA 1ETUA 2GA8A 1U94A 1UKEA 2ODWA 2FX3A 3B1XA 1UAAA 4FW9A 5G41A 5LD2B 3SBDA 4LJAA 4V0OA 3QPWA 3THWA 1IN7A 3ZS8A 4OHYA 3GLGA 2OE2A 3W9YA 4D26A 1MO6A 1OPXA 5EXTA 4M1TA 1KKLA 1T91A 5J4YA 2QTHA 4A82A 4BEJA 5FUXA 1LF0A 5DO9A 1M7HA 3VTKA 3U6KA 1Q3TA 4B44A 3H4MA 1IBRA 4F7WA 2C78A 4O2RA 4X8OA 1OSNA 4N3NA 4TTQA 5F9HA 3C8UA 1DBSA 2ORWA 4WBSA 4E09A 1Z2AA 2PCJA 3RC3A 2AWNA 3Q5DA 4LJ9A 3D6TB 2FEMA 2RKOA 5GJVC 1KMQA 2FSFA 1M8PA 2BWJA 2ZIAA 3PUXA 5FOXA 4TL9A 4QHSA 1KDPA 5GJBA 3U5ZB 5E7IA 2Q6TA 4XD7D 5BN5A 1X86B 1G8GA 1R2QA 3GLFE 3BBPA 4HLUC 4DUGD 5KSOA 3B1YA 3I61A 1XD2B 4DZZA 4DCSA 5L8VA 2NMVA 2B8TA 1D2NA 1KGDA 2J1LA 4A6PA 2ZR0A 2GXSA 3DKVA 3BH6A 4RFSB 4LJ5A 5JJKA 4N0DA 1XMSA 3O8DA 1ZJ6A 2G1JA 2QQ0A 2QP9X 1GSIA 2GAOA 3AVQA 4EFMA 3A1SA 4QG7A 4R9UC 4CT4B 3GJ7A 1RPZA 5D3MA 4CEHB 1CR1A 1W0JD 4GL2A 2YINC 3IPYA 4D0NA 1OKKA 3AP2A 4TWZA 1EFTA 3R8CA 3K0AB 3QKRB 421PA 2J0UA 4P0TA 4D4JA 1W36D 4AD8A 5LPNA 1ELOA 4M1OA 4BRWA 2JLUA 2PH1A 3K0SA 3M4YA 3OAAD 3OIYA 4IEEA 2KJQA 2GJKA 3ZVRA 5LD2C 2XAUA 2ZJ2A 2IWRA 4IOMA 3B85A 4B74A 3B8HA 1NP6A 4LV6A 4C0BA 4NCKA 4NBSA 3RDPA 3QXHA 2JLZA 1BKDR 3LVQE 4LCBA 3C16C 1TTTA 2XB4A 1OH7A 3G0HA 5EE5B 4YONB 5AJVB 3T1VA 1BYUA 4EJSA 4ZCLA 4PQYA 1G6HA 4RD6A 1N6RA 2RGNA 3IHLA 3L8ZA 3T5DA 4F92B 4GOKA 1TEXA 1A7JA 1ZUNB 2Q9CA 2WVJA 3KZ1E 1T3SA 3FKSA 4WZAE 4NZYA 1E1RA 3REFA 1Z5ZA 2VHUA 2ZJAA 2BKUA 4B75A 2V3CC 3S1AB 2NIPA 1W5TA 1N5JA 4TZ6A 4IOLA 2FFQA 2QM8A 1W36B 2JLQA 4OI1A 4D80A 4Q47A 4F4CA 3KFVA 3DVLA 2FZ4A 1CIPA 3OIVA 1G1MA 1TF7A 2ZRAA 3R9IA 1E1QD 5F9FA 2W6ID 3ZZTA 4PO8A 2DR3A 2ZAOA 4HAXA 4QHYA 2XGJA 1AKYA 3TR5A 2HLDD 5J4VA 2GF0A 4M8NE 2ZETA 3WHLA 3GMTA 3C5CA 2ZROA 3IQXA 1VCIA 1ZU4A 3JZMA 1SZPA 5HCIA 1P9WA 2KSQA 1KY2A 4XOIA 3QEOA 4EQ6A 4OKSA 1M2OB 4IOJA 1R0WA 1DS6A 1D2MA 3SJAA 2ANCA 3GLFB 3AH8A 3A1VA 3REGA 4Q18A 3OE7D 4O0MA 1GAJA 2H16A 2J0SA 4TQ9A 2IEZA 2BKEA 2NO7A 2HJVA 4D2IA 4P4UA 4GNKA 2ZYVX 4Q4JB 4EPRA 3U7EB 4OJKA 3SYLA 4L8GA 5FTJA 2A9KA 2RCNA 4FWTA 1AGRA 1F5NA 5FL7A 4TLBA 3EW9A 1GUAA 1MR3F 2BIFA 4KODA 5TY0A 5BWMA 3FKSD 3UG6A 2EW1A 3EZ2A 4EAQA 3RSOA 3ZQ6A 4BFYA 3WYGA 4PQRA 2EU8A 3K0FA 4A36A 4QFMA 3JVUA 3NHAA 2WICA 2DBYA 4LK2A 3BOSA 4OK3A 5CYOA 1KIMA 1TX4B 1F2TB 2ZRHA 2JLSA 3NEJA 1P60A 1A2KC 5DE3A 2JJ2D 2BCGY 3KTAB 4DRZA 1YZNA 3LBNA 1N6KA 3ICEA 3KJEA 4EPTA 4II7A 5KDLA 1OKKD 4OQNA 1P5ZB 4TT3A 3RC8A 3TH5A 1Z83A 1W48A 1GRRA 4A0RA 5JWHA 2IW3A 1IQPA 2WWGA 3LQQA 5AUNB 3TRFA 4DWJA 1G8HA 1T0JB 1ZM9A 2JLRA 5FBVB 3HYTA 4QGHA 4CEIB 2OAQ1 1W4CA 4ZO4A 1EWRA 4RD1A 3R9XA 1G291 3GLGB 4Q1FA 4XWAA 3KUCA 5F2EA 1FQKA 2I1QA 2PZGA 1YHNA 1G7TA 2A30A 3TQFA 5CB6A 3PITA 1Q1QA 3M0EA 3AP3A 4Q1CA 1H65A 3K70D 3P26A 1XTRA 4IFBA 4Q4HB 1GDDA 4JJZA 2HCJB 4KFTA 2XXAA 4AG5A 2VP5A 2AX4A 4MYTA 4B32A 4YMUA 4PAMA 4I1OA 1NF3A 3TK1A 4DLSA 2N1BA 2BEKA 1MO5A 2QTVB 2X2FA 4YMWA 1RW4A 4TLCA 3B78A 1EX7A 2XNDA 5TB5A 1ZC3A 2OILA 2VHJA 1NN0A 3CNOA 3FFAA 1DAGA 1P7CA 1ZVQA 5JSZB 3KQHA 2CNWD 4LY6A 2JATA 4NL4H 1GP2A 1XEWX 4LX0A 1JJ7A 3PXGA 4PX9A 5IHPA 3TAUA 4B73A 1P73A 5CJPA 1Z0DA 1NLYA 4NHOA 1COWD 3E1SA 2R6CA 2FMXA 2VSFA 5FR1A 1FFHA 2A78A 2F6RA 2ODBA 4P4SB 4JKYA 4B47A 4BLPA 5JCZA 5DNYB 4B3XA 2IS2A 3FMOB 1VCNA 2GNOA 3NBZC 5L3RA 1E32A 1UDWA 1JNYA 2ATVA 1JJVA 2CCGA 2ONJA 1DAMA 1FMLA 2C03A 3GFTA 3L8YA 5E7JA 1SKQA 3U3KA 5GADl 2OESA 2W2VA 2N42A 2ZANA 4Q4LA 3THYA 3ETLA 4IXMA 3OEHD 3X2SA 2CL7X 3OZXA 2BMDA 1WE2A 1E4VA 1NKTA 4KVAA 1EG7A 2VEDA 2Q3HA 1MO4A 3PUZA 2JAQA 2PMKA 5EXXA 3NTUA 1JAHA 3OF5A 1YVDA 5G53C 1QBKC 1B0UA 2GCNA 2FFHA 3GCGA 1TNDA 2QG6A 2V1XA 1T3LA 4BZPA 4FD2A 3SZRA 1W4BA 4JYBA 5H1YA 4LJ6A 3PEUA 3OEHA 1NSFA 4PANA 4BZXA 2PEYA 2W0MA 1U90A 4LBYA 4WW0A 1BYIA 4ZIRB 4NONA 4UXJA 2VO1A 3I8XA 4OBEA 1KI8A 4LYAA 4GI7A 4LYFA 1MH1A 3U61B 1YE8A 3IHWA 3SS8A 3T61A 2JDID 3PENA 3CRVA 3P4YA 3BJIC 4IXNA 5KNBA 5GVRA 1DAEA 2HUPA 2V8OA 1S9HA 2FSGA 2FSHA 2GCOB 3DMNA 1F2UA 2ZI5A 2GILA 3QPVA 1IJEA 1Z6GA 2AFHE 4GZLA 3MJHA 3SBEA 1ZNZA 3DOEA 2ZRGA 3BC1A 3T5GA 4BWYA 2O8DB 3K0EA 1TEVA 3B9QA 2WJJA 4TYYA 5EZ5A 1NMYA 3VR5A 4GT1A 4DIEA 1SVLA 3ZQJA 1FZQA 2ZJOA 4EJSC 5K8UA 4W9MC 1UEIA 4IVRA 2PLRA 1SHZA 3TKLA 3V4RA 2MSCB 4URXR 4L4UA 3KX2A 2GHIA 1J90A 2P6RA 2R44A 1XEXB 5H68A 2NOAA 1WBDA 1X6VA 5J40A 1OFUX 4D25A 3NG1A 1E79A 4DBLC 1JALA 4XVQA 1RC8A 3GLFA 2JA1A 2FPKA 1WB9A 2BMFA 1EXMA 1S9DA 4HLCA 4TLEA 2WIAA 3N70A 2IYLD 2BCJQ 3KKQA 3UMSA 1ZU5A 2IYXA 5FPHA 5G3YA 4A9AA 1XNJA 3AF3A 3MJRA 2QEQA 1KNQA 1T8UA 1XCGB 1N0WA 1P75A 1XP8A 3GD7A 4Q9IA 4PZLA 4ZDJA 1N6NA 2V7QA 2P67A 4JT2A 4DEYA 4EPYA 1IN6A 1XJQA 3B60A 1G19A 3SN6A 3CRMA 4AKHA 2IUSA 4A0HA 4MGZR 1F48A 4BFTA 1ANKA 5LB4A 2OLJA 1IXRC 3AEZA 3TGPA 1OYYA 5FOVA 1ZW6A 1LNZA 4LPSA 2BBTA 4Q00A 1GKYA 2QRZA 3CWZA 2W2TA 4QC2A 4TT3D 1DO0A 3AB3A 3ZZ0A 3RS0A 4F4IA 4M9SA 1XF9A 2OBNA 4Q1AA 4P3YA 3AF4A 3SYNA 5BYKA 2O0KA 3ZYCA 2C95A 1OXXK 4HLDA 4BPBA 1LW7A 1G18A 4KYUA 4C9BA 3IIJA 4V0ME 3O8BA 3AVUA 4XH9B 4IRUB 2C04A 2GTPA 2E1RA 3CF0A 1HYQA 3UXMA 1MV5A 2ZSBA 2QP4A 2BBWA 1UKZA 4KXFB 2RGDA 3GFPA 5P21A 3SJCA 5DI9A 3V00A 5L3QB 1CJKC 5KU1A 1ZCAA 5EP3A 4PC6A 1TMKA 5EP2A 1WMSA 3ADKA 1ZIPA 3ZVLA 2BBOA 4GSYA 5HKKA 4XTRA 3ZH9B 4F4JA 5ELXA 1ZNWA 5JI2E 2GEUA 3ASYA 4Q1BA 4XWKA 1Z08A 2D74A 3E5HA 3TNFA 1H8HA 3BWDD 1KI6B 2Q9AA 4US1R 3LH5A 3BD9A 3K9NA 4MGIR 1XJCA 1BS1A 1KSJA 3DO6A 2F3TA 3EAQA 4HB2A 3EX7C 1FNMA 2R6FA 3A58B 1G3UA 1ZD1A 2QQEA 3EC2A 5B64A 2E9SA 1G7SA 1GOTA 3TQCA 3PVSA 2B7CA 2B6HA 1XZPA 1Q22A 1LTQA 2UZIR 3UMRA 1OT3A 2DB3A 2JIZA 1R0ZA 1BO6A 2IYYA 4M1WA 1ODFA 1E9BA 2JASA 2ORVA 1AGPA 4PHFA 3CZPA 2J9RA 2IF2A 4TQUS 3MG9A 5JS8A 4FMBB 1KI4A 2XTMA 1X1SA 3X1WA 3K09A 4HAZA 1TQDA 1OIXA 4AYXA 1E2LA 2OXRA 1G4AE 2YWHA 1CLUA 4P33A 4Q21A 5HCNA 1AN0A 5J5CA 2G88A 3U4QA 1OJLA 5FOSA 5C4GB 4DDVA 1CULC 3QKUA 5JJIA 4B6FA 2ZE8A 4JBYA 3G82C 4TYQA 4HUQA 1GL6A 4Q5IA 2VL7A 2EWWA 4LHVA 5AJWA 3THYB 5CIWA 1OB2A 5DN6A 1CU1A 1T5IA 1N0VC 2CCKA 3QJYA 1SXJE 1Q20A 1R8QA 4TSFD 1G7RA 2HT6A 1G4UR 5DI3A 5JFGA 2ZVQX 221PA 3TAHA 1R5NA 2CVFA 2H92A 3RLFA 2XITA 5JMTA 3UG7A 1DOAA 2QI9C 1DAKA 1W44A 3SFZA 1AA9A 4U00A 3VAAA 4M1SA 1RRGA 5EP1A 1FQJA 4PC3A 1AIPA 2ZITA 3QF4A 1JXOA 3OIUA 1WA5A 1JQJC 1JBKA 3CNLA 1D5CA 2CHGA 2G1KA 1G5PA 2QMUA 4KYIB 2J41A 3NXSA 3CRRA 4JZKA 1Y63A 4NTZA 3SJBA 3TR0A 4YXWA 1VYVA 2HEIA 3KJGA 2GCOA 4HATA 2CVHA 4M4SA 2NPIA 4OK6A 4WVFA 4AKEA 1SXJD 1E94E 3AKCA 1YZUA 2WKRA 4QHTA 3SQWA 4Q1EA 4Q01A 4DUGA 4BRUA 2EFDB 1MRNA 3TJZA 4BZQA 3AP1A 4KFRA 1HY3A 3ZD7A 1U99A 1WP9A 3KXIA 1RFLA 2Z5FA 2QPAA 1U8AA 2WSSD 4OQFA 4Z8XA 4M1YA 1ZM7A 1P62B 5E3HA 2IS1A 3F3YA 1G64A 4LV5B 4NCIA 3SU8A 2ZR9A 3K70B 3QEJA 5JEEA 1Z6TA 1XEXA 1S96A 2F3RA 2JLXA 4BLQA 2J7PD 2XSZD 1J70A 3VU9B 4QGAA 1QHGA 2SHKA 3LLUA 4TLDA 1KO5A 3LW8A 1E6CA 5JJLA 3A4MA 3AVVA 1BMFD 1ZNXA 3EARA 4M0LA 2GWHA 3DZDA 5KOYA 5HPYB 3CO5A 4Q4AA 2AK2A 1Q0UA 4E07A 5KO2A 4X8HA 1XPUA 721PA 4URVR 2X1VA 1M6NA 3HU2A 1CJTC 4CEHA 2Z83A 1S4QA 1NVVR 4TN1A 1OB5A 1J7KA 1GTVA 4ARZB 1G41A 2VHQA 2WSMA 1Q1BA 1VG0B 2O0HA 2QT1A 5AJYA 3HR7A 3CPHA 4DSNA 2ZI6A 3NVAA 1TF2A 3L0SA 4FMDB 4JVNA 4BFXA 5EXPA 4LHXA 1CR0A 1TQ6A 4JLNA 4DKXA 3VNUA 2IYTA 3DOFA 4W5HA 1P3JA 3U44B 3U60B 4RD4A 1J2JA 5DH9A 1N6PA 1RYFA 1R0XA 3U3JA 4PZZA 3VR1A 5LDDC 3N2IA 1NJGA 3NC0C 3W8RA 1P2TA 3U6BA 1E2FA 2P3SA 2XJ9A 3T06B 5AUOB 1BMFA 1NRJB 1FW6A 4Q4HA 1OXSC 1G5TA 2ZR7A 1UDXA 3RS7A 2RGAA 3ZGXA 1JR3E 3QSYA 1YR8A 4C2UA 1QHIA 1NJFA 3AVXA 3HU3A 1NMXA 2RGXA 3FMIA 3ECCA 1RRPA 4TLAA 3D7MA 2VYFA 2PJZA 2XNDD 1YZLA 2REOA 1XTIA 4C30A 2YWFA 1TADA 4NMMA 3WMFA 1AS2A 1G6OA 1UPTA 1UJ2A 4H9GA 4HZIA 4OI2A 3FGNA 1OLOA 1CKEA 3R20A 4YDHB 1XJ0A 1YZKA 3WBJA 1US8B 1RJ9B 4PR0A 2FV8A 4FINA 4Q9JA 3F5FA 4AYWA 1XTJA 1U0LA 4DB2A 4B2LA 2ZJYA 4JS0A 4R71A 3GEEA 4TYWA 4P32A 3QKSB 3QBVA 1M7GA 4HZUB 4RCZA 1E69A 1WBBA 2V6IA 1W36C 2XOKD 4A2QA 3ICQB 1KJYA 2J46A 3RS5A 1KDTA 4G1UC 1LFDB 5FBWB 1W47A 1Q1EA 4NYJR 4QBIA 4A8JB 1AJEA 3NBFA 2GJAA 2OAP1 5FTNA 3CPJB 1K5DA 3T34A 2FJUA 1JPJA 2ZI4A 2GRJA 3ZS9A 4B3BA 4A15A 4BQSA 1WQ1R 4LHZA 1I4DD 4G01B 3RWOA 1ZRHA 1T3HA 3LDAA 1RRCA 5G40A 4BLSA 1FP6A 4DC9A 3M6AA 3QI2A 2ZUBA 3K09C 1CS4C 4MKGA 2XTZA 2CE2X 2OFWA 4M53A 1ZBDA 3C15C 3BK7A 2J5XA 3OHMA 1IY2A 3FHOA 3LXXA 1GILA 1Z8FA 3SFVA 3I5YA 3RS3A 2F1RA 1MABA 4C2TA 1LV7A 4YMSA 4A8JC 1EWQA 3MRSA 3THWB 3ZIAA 3WY9A 3A36A 1S2MA 3EPJA 4XSHA 1OFIA 3TIFA 1CBUA 5TARA 1OYWA 2ODEA 1HE8B 2QA5A 2HYDA 2AXPA 3ZZUA 4WOPA 2JJ1D 3WYFA 4DIDA 4AY2A 2F55A 2PJRA 2ZJBA 4PSAA 1SHKA 1DADA 1UF9A 1II8B 2YVUA 621PA 4DDWA 2A5JA 1GVNB 1U2RA 3EZ9A 1NN5A 4MKFA 1JAIA 2VH5R 3L0OA 4GZMA 1BH2A 1NLZA 2AR7A 2BJWA 1EFRA 4PHHA 3AKEA 4EPWA 3TW8B 1ZM2A 5FI1B 4KBGA 4LRWA 1J99A 1AS3A 3W90A 1W7AA 4LHYA 4JJKA 3TSWA 3K0CA 5FL3A 1AQYA 1N6IA 2VSOA 4JKIA 2YJTD 5CDFA 5CIQA 4DCTA 2XXAB 1CRPA 2HLDA 3LAWA 3TUZC 4TYNA 4M9ZA 1Z0KA 3W6OA 1U9IA 4ZCMA 1F3OA 1Z0FA 1E1QA 4D81A 3R7WA 4CVNA 5DIFA 3V4FA 4QOSA 3I72A 2HV8A 4JBXA 4IDHA 5F3WB 1E3MA 2VIIA 1TPZA 4V0KA 1S0UA 2Q0HA 2DFNA 3QOFA 2F1JA 5CK5A 4MA4A 4LV8B 1KI2A 4AWXA 1GKIA 2HT1A 3ZDQA 2DYKA 3U3MA 5FPTA 1LS6A 4TZ0A 2P2LA 2ZSDA 5FBRB 3A6PC 1X8LA 3OFND 1A5TA 2D2FA 2CCJA 5B58C 3I1FA 1Z07A 1R5BA 2ORIA 1SVWA 4FXPA 2O8EB 2N46A 3QKRA 3H84A 2ZS8A 4DLXA 4DXAA 2FF7A 2OCYC 4R2HA 2AK3A 1VIAA 2WZQA 1PVOA 1GKUB 4Z51A 4RZXA 3P32A 2GAAA 3AKDA 3ZD6A 3CBQA 4NP6A 3B7GA 3FMFA 2MSEB 3CWQA 4R98A 2O8CB 5EE3A 4DCVA 2ZRNA 2AKAB 3A1TA 2DHRA 2REXB 2IYVA 4C0AC 1T9HA 1OXTA 5GJCA 3H0KA 1NIJA 2YNMA 1QRAA 4R2IA 2FEOA 1XMJA 2OUKA 2C77A 3IGFA 3QXCA 4XVUA 2JJ8A 5EJEA 1KJZA 1FPMA 2CK3A 4US0R 2IYQA 1NG1A 4ERNA 3FB4A 3T12A 4EUNA 4KU4A 3NBXX 1N25A 2YHSA 4M9QA 1KI1A 3TSOA 1FX0B 3KJIA 1HV8A 2JLVA 1MO3A 3IIMA 3PG5A 2QGNA 1SVIA 4TMXA 3WP1B 1KMHA 4B33A 4BUJA 3EA5A 5L3SB 821PA 1KHTA 3IBYA 1PZNA 4R7ZA 3ASZA 1KO4A 2CLDX 3E70C 3GLIB 4B76A 2QPOA 1VECA 4TL6A 2CMKA 2ZI7A 4UNNA 2WAXA 1TU3A 1ZD9A 2QMHA 2GEDA 3BB4A 3FTQA 5BXQC 2RGNC 4JVSB 3GJ4A 3W3ZB 3VMFA 4K46A 1HE1C 1W1WA 1E2JA 5DN6D 4Q4JA 2OG2A 5JRZA 2BMJA 1ZM3A 3O47A 4BFWA 2J0UB 3MWYW 2ZRIA 3LX5A 4FCTA 4WIAA 4LSGA 5FBLB 3BFVA 3LW7A 2GCPA 5GVSA 1AS0A 2VRWA 4YMTA 4EKDA 4LDJA 2WWFA 3AUXA 4YLGA 3Q8XB 3TUJC 4G0NA 3B1VA 4PSKA 4IDNA 3U2QA 1D9ZA 4LHWA 1YJ5A 3D31A 4Q7KA 1G9XA 3MWLA 1Q21A 4CRWB 3P27A 2A7QA 1HT1E 2LCFA 5K8LA 3L43A 1VG9B 2AWOA 1ESNA 4NPHA 4EJSB 3WYAA 3P1JA 3C14C 4Z1MA 2GJ8A 1XTSA 4ZDKA 1W0KD 5TMPA 2F9LA 3Q3JB 2HYIC 2IUUA 1QDEA 1G8YA 4PXAA 1IAQA 4Q9LA 4G5OA 2G6BA 1T5LA 3CRW1 3RABA 3KB1A 4JVMA 4AURA 3KTAA 4GRAA 3EC1A 3LA6A 1A4RA 1LVGA 3AM1A 3SEAA 3DHWC 3GP8A 2YC2C 2IHBA 2Y8EA 2D4HA 1TL7C 4A0FA 4NE2A 1UBFA 3ZVNA 4IFEA 1NVVQ 4MYHA 2KWIA 4CT5A 3WMEA 3EIEA 4IJMA 4Q9KA 1YR9A 3BFXA 5EQTA 1CXZA 2R65A 3LNCA 1Z22A 2CXXA 2WIBA 4GP6A 4RVCA 5E7MA 4B71A 4IKEA 2J7PA 3LY5A 3I92A 4UNRA 5K8IA 2O8FA 1G5RA 3UWOA 4NCHA 4MDFA 1WF3A 2Q3MA 1Z0JA 1XRJA 4ZCIA 4LGMA 2MSDB 5H70A 5FUYA 4B3FX 5JWOA 1IXSB 3D8BA 1R4AA 4JBWA 1GNRA 2G3YA 1COWA 2RGCA 4LYHA 3B13B 3CX6A 4D0GA 5KYKA 1D9XA 2Q9BA 3GLHB 3QENA 2ZRMA 1XMVA 5J47A 5CDFE 2GVZC 1R0YA 5FBQB 3HR8A 2J0QA 2IS6A 3WBKA 4YXWD 3EPHA 2VP9A 1XDBA 2F1HA 1IN4A 1OH6A 3BH0A 1E9RA 2RB4A 3NDPA 1ZUHA 2CHVA 2EFHB 2ZRFA 4KBFA 3EZ7A 2PT5A 1GM5A 3PUWA 5DYIA 2WM9B 1FOEB 1ZCBA 2NQ2C 3L0IB 4P4SA 1XU4A 4LOAA 1U8ZA 4FWIB 1O87A 4RD0A 1N5LA 2P6UA 4IW3B 3BXZA 3EZ6A 1KI3A 4DLYA 2NZ8A 1OFTA 3VX3A 1W2GA 1PV4A 1M1YE 4OYHA 1SULA 1I2MA 4AG6A 3T1TA 1Q57A 3SJZA 2P6NA 1PJRA 1DAHA 1Z29A 2YWEA 5BYJA 3MCAA 4I99A 5AJXA 5SZIA 2WWWA 5FTLA 1YKSA 1QZXA 4Y0VA 1PUIA 3FWYA 4AC9A 4WXPA 4A0GA 1E99A 5FTKA 1LB1B 2OO7A 4E5UA 4ESHA 1SVKA 1XPRA 1VIYA 4JLBA 5A4JA 1XPOA 4XVRA 1E79D 4I1UA 3PJRA 4JVLA 1PLKA 1E9CA 5CLLA 5JHGB 2DFTA 4BFSA 5CM9C 1W49A 5FPSA 2VP2A 3U44A 2QPTA 4NYIR 2ZUDA 2WJIA 3FKQA 4HDQB 2IYSA 1DO2A 4C0HA 4KVGA 4PZYA 2XJ4A 4PC1A 4AK9A 3AGQA 2AXNA 4A6XA 5KDDA 3WP0A 2QRNA 2D3WA 2YOFA 4JL8A 2ZJ5A 4M9XA 2WMNB 1AKEA 3OESA 1XZQA 2GJSA 3M1IA 5HE8A 3TBKA 5DSZA 1K8RA 4CW7A 1NNEA 4GOJA 3WNBA 1P9RA 4V03A 1IN8A 5BQ5A 1XCMA 2NZJA 1Z6YA 4O3MA 5D3QA 3RNLA 1XXHE 3VR4A 2ZRKA 3ZVMA 3RS2A 3X1XA 1HQYE 5DYGA 4LI0A 4BLOA 1Y3AA 4DCUA 2FPLA 3NHBA 2O8DA 1FTSA 2CL6X 2GXQA 3TVDA 2J7KA 2IXGA 3BORA 1VCOA 1YZGA 3MGCA 1WRBA 2H8KA 4ASUD 4KJZA 1OF1A 3H1TA 3OE7A 4NH0A 4I4LA 2EWVA 2GZAA 1G21E 4G5SA 4ABYA 3NC1C 2R8RA 1CJUC 1OIVA 1SKYE 3FVQA 4DDTA 2B21A 4RZ3A 5KNCA 3DM9B 3B5JA 1SVOA 2ZUCA 3GLGE 1D6JA 1YR6A 2CDNA 1JR3A 4JLMA 4I1VA 3RHFA 3AVWA 1E9SA 3K53A 1NG9A 4FCVA 1E2NA 2XNSA 4UNSA 2C99A 1W0KA 2IWHA 1IOZA 1MT0A 3TSZA 5JI3E 2GESA 2IHYA 4X8LA 3VNVA 1E9EA 5D3MB 4MKIA 3F8TA 1LS1A 3LBHA 1KDRA 1S8FA 5SZHB 1P2UA 1VYTA 4IDPA 5B30A 2FU5C 3TMKA 5FUWA 3DM5A 4GFDA 1J8YF 2VTKA 4FMCF 1VTKA 1E98A 3C7KA 3WRXC 3QY0A 3W5JA 4Y0AA 3HDTA 4JL5A 3NWJA 5CJ2A 2JLYA 2XZLA 4HI0E 3PEVA 3UPUA 4JLPA 4ZDIA 1E4YA 1KI7A 2A3RA 2JCSA 3BERA 3J81k 2QSYA 3F0TA 1DE0A 3LV8A 2YZ2A 3SHFA 4B3DA 3UMFA 5IK2D 3D3QA 5JEDA 4O25A 1M34E 2WKPA 3A37A 2ZRBA 2PBRA 4JLAA 3SOPA 3TLXA 2EFGA 1AZSC 2IA5A 4MITA 5L3QA 2ZSEA 3S1AA 3L0PA 1KSFX 2D62A 3MLEA 5CYPA 2J45A 2QROA 4ITRC 3LBIA 4PAQA 5AUQA 5KSZA 1H8EA 3B1WA 4KAXA 4H1UA 4WZBE 5KSYA 4LZZA 1IHUA 2BBSA 2YV5A 4PC7A 4C0JA 2BM0A 2GBLA 1N0UA 3TW4A 4ZI2A 4AKIA 4ZPXA 5IK2A 3MUFA 4TL8A 1E0SA 2QENA 4D0LB 2R6AA 4Q02A 5H8WA 1G7CA 4F91B 4RZ2A 3U3OA 4DSUA 1DELA 1JXMA 1G20E 2JEOA 3W8NA 4JLDA 2G9NA 3CUEF 4MKHA 3ZJYA 1OIWA 2RH5A 4XD7A 2QBYA 4RSGA 4P4TA 1HA3A 5B57C 5IDVA 2OLKA 3GJ3A 2A5FA 2ERXA 4QRHA 4LJ4A 1UKVY 3AUYA 2V55B 3CM0A 3K0AA 4GMDA 1KI9A 2XB2A 5EE1A 4DHEA 2AL7A 3ND8A 4F93B 2JJ2A 3CPEA 3HU1A 3MAAC 4B43A 2BM1A 1IN5A 1EESA 3HPQA 4X8MA 3BAFA 3OIWA 4D4MA 3QKSA 2ZJZA 1QVRA 4D4KA 1EFUA 3PUVA 3O8RA 4UXHA 4M21A 1UADA 1IY0A 2EFCB 2QMEA 5J4LA 1E2HA 3BH7A 1CR4A 2WMOB 1JR3D 3NDBB 4QBGB 1FUUA 4RZUA 3JVVA
chains in the Genus database with same CATH superfamily
2BMVA 1OYVA 1C7FA 3FCSB 3HXLA 3WMWA 1OFHA 3KQLA 4G8BA 4I5FA 3VZQA 1IE3A 3NAMA 3PYXA 4HQKA 1M6VB 3W3AA 4ON9A 3O0DA 4L78A 4B2YA 1CUCA 2OP1A 3JAMA 1KRWA 3IEIA 2AFRA 2VUUA 3G8AA 2OD7A 1VKOA 5TF4A 4ASUA 1O0BA 3UK7A 3SC3A 1S3SA 3MIIA 4WJLA 1BOFA 5JUWA 2P5SA 1AKQA 5EZ6B 4DIUA 1LBIA 3ZI7A 4Q39A 3V2UA 5CXQA 5I9NA 5HCUA 3I73A 4Z1OA 2FH5B 1NLMA 3HN6A 3A1CA 4Q7QA 2OMEA 2OY0A 4QBFA 1O97C 1LJLA 3GQBA 4GEKA 4YRIA 4FW8A 4S2EA 1ZOOA 3TECE 4K0RA 3D43A 4PFSA 3SYRA 1K6XA 1KYYA 1GPLA 1QB8A 1U0OC 1ONBA 1OXVA 1E6UA 3SHTA 5BN4B 1GGEA 4KAFA 1U0BB 4D42A 2BFDB 1SZCA 3IC5A 1QWSA 3DMYA 3DNMA 4WKCA 4YV1A 5B6IA 5G2OA 2FQYA 3PL5A 4NYMR 5IDWA 3QUSA 1ORDA 5E8JA 2W00A 3CU5A 3BMOB 2IHVA 3QKTA 4KQXA 1WCXA 4CFYA 1U7XA 3L2OB 4XPZA 4HFNA 1UZUA 2RHGB 3VKWA 4D6PA 2XZPA 1U6JA 2GS9A 1J20A 1PZHA 4YACA 3EPKA 2PTHA 1FU8A 1DZIA 1Z2PX 2JFQA 2F8TA 1PUJA 3OA2A 1K68A 1NY6A 2C9CA 3QVWA 2N0SA 4RJLA 5CNMA 3W5DA 4OHVA 2H4WA 4PU0A 1OU0A 3DW3X 2YWGA 4HN9A 4MVJM 2IBMA 4RZSA 2ZUVA 3WR5A 1D1PA 4C0LA 2H54A 4RUKA 2W5UA 5ITVA 5D5PA 3RAFC 2PZEA 1U2QA 1MA0A 4HLQB 1RZRD 5JZBA 1GAEO 3AEKB 1X92A 2ZM5A 2ZGVA 3LPLA 2RHCA 4NCNA 3WJ2A 4EIWA 3PGA1 4N0EA 1A7KA 3KNZA 1UZMA 1C30A 3QTBA 4CMCA 4JSYA 4WZ6A 1U02A 3FVVA 3GEIA 1C81A 3IIKA 2ISSD 5H4HA 1E5VA 2G5CA 4HEA1 4A1FA 3G8DA 4X1IB 4O2LA 2GXUA 2PRYA 2O4UX 4DGQA 4V1CB 2GBLC 3KEQA 4AP9A 1F60A 3LQRA 4HMOA 3EPLA 1IOVA 1DJQA 3KJNA 3O95A 4RQAA 2D2XA 1AHPA 5GIOE 5CLQA 4D80A 1LF5A 1GTSA 3FF4A 4HDOB 2ECFA 2VDKB 3JD4A 4ZT5A 4IIFA 3MTQA 3ADDA 2HJGA 2XOKA 5JECA 3QUBA 4FX2A 3EUFA 2BHNA 4B34A 5IDXA 3LFTA 2QTZA 3OHPA 2OVFA 5GAJA 4H16A 2YQZA 2IJGX 3AZOA 3DD1A 3UTDA 1HK7A 2XBUA 1GA6A 5DTEA 4UULA 2H2AA 2HNKA 1EBUA 2OM2A 5IZCA 4FFNA 2BZGA 4XJXA 2QZPA 1CJMA 2YFYA 4O1MA 2QK4A 1K0UA 3H1EA 1K8QA 3HWSA 2LWIA 5EPOA 2NU8A 5HUQA 1Z63A 3HI4A 5DK6A 5H83A 3ER6A 3U7RA 3NWOA 2QTWB 1E61A 2GD1O 3OZSA 1PDWA 4N1AA 1G21A 2VJQA 3KM0A 1TQ2A 4OQMA 3N39C 1R9MA 4PIMA 5TPZD 2FXVA 2R1VB 3S68A 3QFHA 3T41A 1Z26A 4KITB 1T8WA 3IB3A 4KMMA 1K92A 1NW5A 2GPSA 3H9CA 4MJ3A 3SIXA 1CZKA 5DHFA 4E70A 4EQ6B 1BMDA 2B0JA 3H8VA 4X24A 4PS0A 3IQFA 3P2IA 5FADA 4CMKA 5LOVF 4CR8A 3E9NA 4E21A 5IS2A 1D2EA 2MMGA 1OV4A 1QONA 5DLQC 4FNOA 3IDAA 3BEOA 3TTYA 1KFKB 2JIMA 3C24A 3G17A 5BV7A 1T4GA 3L1HA 1DBRA 3K1AB 1Y34E 2OFXA 3H8JA 1P4RA 3ZN2A 1MEEA 2C2XA 3GFSA 4TLMB 3VVCA 3LGAA 3W6NA 4BC0A 2OR3A 2G76A 3TQHA 2G9UA 3CIOA 5TEWA 1DX6A 3M7IA 1RJ9A 2QZJA 3SVZA 3JQ6A 3C3WA 4L5AA 4F2PA 2W6IA 1N6OA 4NMHA 1GU1A 3AW9A 5JVDF 2QRJA 1LY1A 4XDHA 3MOIA 5DVZA 4R0MA 2HHJA 2VK4A 1T2VA 2GETA 2QBYB 2FPGA 1SCQA 1YOVB 3TVTA 4O08A 2WWRA 3B1KA 2GPBA 3GJTA 2BELA 2YZMA 5CP8A 4AI6A 3O9ZA 2PV0A 1SCIA 1USWA 1V2HE 4M86A 5GM2A 1JLSA 1E2MA 4F21A 3VHQA 4ZTBA 4GXNA 2W2XA 5CFOA 4HDMA 4FDMA 2GTHA 4ZZ1A 1U3WA 2AGVA 5AMXA 1FP7A 1JEQB 1WL8A 2DWCA 2YQ4A 2YIVX 2DGDA 2ZWMA 3JWJA 3SEFA 4X1YB 5CFNA 2CHFA 2GN8A 3U3DA 3LX8A 3IO3A 3O7WA 1JTFA 1KERA 3JQ9A 3Q9NA 1E18A 4MS1A 1G20B 5JBIA 3C5HA 3O2QB 3JX9A 4OB8A 3IR7A 3LSYA 2BMEA 2ENUA 1C1HA 4EJMA 4CM6A 1YHYA 1MX9A 3I8SA 2QDXA 4YCAA 3SQLA 4B83A 1ZRSA 1ZMOA 1SU4A 2CDBA 4JJ4A 4K3VA 4YPFA 2QRMA 1HL3A 4IWYA 4ZK2A 4C4YA 1KBQA 2UU9B 4GE3A 3EEOA 1Z82A 1ZQ1A 3E0QA 1GCGA 4AJ4A 2QVZX 4OEHA 3SKVA 5JDIC 3EX7C 4MVJD 5FNVA 4Z7QB 1CJCA 1W1UA 3UFBA 5CT6A 1MAVA 4KSCA 4TTPA 4AU1A 1RHKA 3M5WA 5C8VA 1P4SA 4TVKA 5BXYA 1C3XA 3ZHZA 1GA4A 2PBLA 1Z25A 1F0KA 3CVJA 2WJ3A 4G5RA 3WXMA 1PNRA 5HTKA 4FE7A 1J2YA 5A06A 2GN2A 1OT5A 4WAUA 3ZK9A 5AKLA 1U7OA 3WQSB 3OEWA 1H9CA 3F2VA 3R23A 1MOZA 2ID8A 5DTQA 1RQGA 3U40A 3S8YA 5FI3A 2Z3WA 5ERYA 4ZCPA 3D4IA 1UBCA 3EH1A 1GL9B 3L82B 4YAWA 1B0PA 4MKZA 5F7XA 3KQNA 4A0QA 3FRHA 5DWVA 5TQVA 1ZVKA 3IKTA 2HHAA 3DGFC 3CKKA 2VDVE 3I52A 2H1IA 1NL3A 3ORYA 2O5VA 3LVRE 3OI7A 3FD8A 3M2TA 1X8JA 5JWRA 1SU7A 3FYSA 4EG4A 1RFGE 1IPEA 1YR3A 3P2MA 1OXUA 3BD7A 3FN4A 5EI5A 2PD3A 4Z9YA 3WIUA 2PMBA 1E2EA 2GM3A 2YVKA 4R1MA 5GV8A 4B45A 1KJ9A 4E5MA 4Q15A 1U1DA 3D4LA 2R6GA 4ZOAA 2MYTA 1A9ZA 2O8CA 2VRCD 1L3CA 2LR0A 3GA0A 1ZKMA 1NP7A 3VKHA 2WA2A 4J0QA 2VYND 2R751 3NHJA 4O4HF 3H4TA 4YJHB 2ZIVB 5TPWB 4EA8A 5E6RA 3ROGA 1T5SA 2BDTA 3V1UA 4TKMA 3WLNA 1YZQA 2AN4A 1BSVA 2QX7A 3PDWA 1VG1A 4UTPA 4Z2AA 5CGQB 2IYWA 3COVA 1NN1A 1B0AA 4ZVKA 1YD7A 3ZCVA 1KTVA 2X2EA 1N7GA 3E03A 3HB4X 4ZJZA 5K45A 3IJPA 1N8TA 1KQ3A 1Q0LA 2ZYIA 1P5JA 3NOOA 4L0MA 5ENDA 3WK9A 5KQMA 3RSFA 1IHXA 4JYCA 4QM6A 1ZI6A 3CKLA 1U5BB 4ZAXA 3R7DA 4AO8A 2K7FA 4PZ0A 3HB5X 4YP0A 4KTVE 5JADA 3L02A 3ZV5A 1UBHS 1W94A 1Z4MA 4ZU6X 3DZBA 4PLCA 3RSHA 3B1JA 1SD5A 4OLHA 4S0ZA 3WJ1A 2LV8A 2PZFA 1Q0PA 3ESZA 1RKUA 4RK7A 1UQUA 2C2KA 3HXPA 1DT5A 2JFZA 1O96A 4UC0A 2HWKA 4XPIA 1ICEA 2CJWB 4XRRA 1ZICA 3A1UA 4Q48A 4RCYA 1JB1A 4YNBA 4H6PA 3VVMA 3LLMA 3O9MA 4WECA 1O6ZA 1G8AA 1WXQA 5CDTA 3RHZA 4MYCA 1B2RA 3TOCA 1DBPA 1QANA 4ONEA 4Y6RA 3KZVA 4ZD6A 2C84A 3DDSA 4H60A 3TBFA 1Q3HA 1JZTA 2PL9A 3K0KA 1B8NA 3NVMB 1M2VA 2NX2A 3KEFA 2WF5A 2FGKA 5FUVA 3GI1A 4WLUA 1KSGA 1J7JA 3DFUA 3FDIA 3P9KA 4KIWA 5DM1A 3LXUX 2ZQYA 4P5PA 5ALWA 1QKKA 3UANA 4B31A 3D8UA 5ALDA 4OX9Y 3SC2B 2ZS7A 4RVSA 4R0NA 4K6FA 1AGYA 1T8TA 2JD1A 4QNRA 4EA7A 3RYHA 8ADHA 1PT6A 4GDMA 4NULA 2CXPA 4WOJA 4DDMA 1V1JA 3W4IA 5P8WA 4X7BA 3STHA 3SZ3A 3NDRA 3X1KA 4I6GA 5IULC 1GPNA 3PVZA 2XT0A 2O3RA 5FAXA 3MWJA 3GRUA 5LBIA 1X7ZA 4AXXA 3FOWA 3L1VA 4FDUA 5KTSA 1AZWA 4DV2B 2HCBA 2UUBB 1DEOA 5KREA 2A33A 1NNUA 1HRDA 4JIMA 4CCAA 5LJIA 2TMKA 1RR6A 5LZ4A 4B80A 2XQKA 4KV9A 4F4CA 3SF8A 3A8TA 1CTQA 1MTOA 1G98A 2H9IA 3KHUA 3OTWA 5FPQA 2J6BA 1GZSA 1GQRA 1QO0D 2QLJA 1D2AA 1XDSA 3DVAB 2VATA 2NT3A 3HJCA 3AI2A 4HWRA 1HFEL 4X3OA 1GFWA 1G8FA 2PA0A 1BGWA 1DEHA 3VOTA 2BRUA 4ND2A 4AQ7A 2JKVA 1SQFA 4OI0A 3TRDA 3WKBA 1GIAA 2YJZA 2FETA 3FYTA 1JZSA 1YDEA 5I8ZA 1MTZA 1R6DA 2EERA 4IHAA 2WM2A 3IQWA 5B1HA 5AIBA 4IMRA 1F12A 5I7UA 1R6XA 3E3OA 1XTUA 1SXJC 1Y82A 3AJ9A 4FBMA 1YQGA 2V3VA 4YCJA 4BE7B 3FBTA 4F1KA 5LB2A 3LXRA 4OG2A 5L51A 3OO1A 1JYEA 2F4NA 3ND9A 5HIAA 5F51A 2W0SA 5DNAA 1HT2E 5JCXA 2RHTA 2P9GA 5FIUA 6YASA 1K2WA 2J3KA 3LQ1A 4CKBB 1XZMA 3P9IA 1D2GA 2MYPA 1Y9DA 1OGJA 1QHHB 4D3XA 4GM1A 4Q7LA 4W7SA 1U9CA 4DLNA 3IEMA 1DARA 1L5ZA 5B58T 2C5GA 1FTNA 3OCCA 3L3BA 4HF7A 3NI2A 3OY2A 1VMAA 2P2DA 2FNAA 1IQUA 2J3QA 4LE1A 4Q3DA 3WL5A 2O59A 2YRXA 4GEGA 2CC2A 2RI1A 3GPBA 4G8JA 2A7XA 3IL2A 1QRRA 4E51A 1R1DA 3AFHA 1PLLA 3PD0A 3QVGB 2KHZA 3I5UA 1XTKA 1SG6A 2A1TS 3A70A 1SKUA 3UMGA 4DR2B 4YJGA 1V6SA 1KBOA 3ILSA 1UFVA 3L01A 1F2UB 5F3DA 4G6ZA 3WO1A 1R4NB 3I5XA 1UPBA 3Q7PA 2Z30A 3EQ7A 3BQNB 3KR0A 4FSXA 1KR5A 4WBNB 5ADHA 1Z5VA 1TEHA 3WGKA 3PP8A 1ZGHA 2REQB 1VRWA 2WNHA 1K6MA 3VI4B 4D9CA 4GKKB 4OQ4A 3KQTA 1V3UA 3KQMA 5JH7B 5CEEA 1N2OA 2IK8A 5IT5A 5LXTB 4CGZA 1JQAA 2W4MA 4EYGA 1AKNA 1C1YA 1H1LA 4GAEA 4OHXA 5A0VA 2I4LA 3H1AA 3QG5A 4K9RA 1LDNA 2WJYA 4X85A 5C8XA 3ZX4A 1RJFA 3WC4A 1JKJB 1T4CB 4AJLA 5DMXA 2NXWA 4U7WA 3FH0A 3QHQA 2Z4SA 3ES9A 1M2FA 5G4KB 4ZALA 2EGUA 1S89A 4ZT4A 3RANA 2CKMA 2GK7A 1UC8A 4YJ3B 1KJJA 1XWFA 1PWZA 4FXOA 1T2DA 2GO1A 4MQEA 2R66A 2IXEA 2I34A 2WUEA 3PDJA 4YCSA 2BSXA 2ZKLA 7GPBA 3EGIA 4DYVA 1EFCA 1QGZA 4UEOA 3ORFA 1F2TA 1DL5A 2CXOA 3A32A 4HUJA 4Q66C 2BZSA 3CS3A 4Q3BA 4WFJA 2JAOA 1UMKA 1KEEB 1W52X 1WDTA 5DJ5A 4FIDA 5EL0A 3EIQA 3QVJA 1NY5A 2WQ6A 2W58A 4HDCA 1QNFA 3EOZA 1DXQA 2V4UA 2VXOA 4UZFA 5MFPA 1EX1A 3RVBA 4ZPJA 2BDUA 4WACA 2VHTA 3M6MD 1VL8A 3LT4A 4I55B 2PR2A 2LTAA 2RHRA 2V6GA 1JE0A 2BP7B 1J6UA 1GXSA 1P2SA 1MG0A 2D0DA 2VSQA 2ZR8A 3MBOA 3QA9A 4QQFA 4WPGA 3KE9A 3VSCA 5IRCD 4GS5A 1VE3A 1E6KA 1HLPA 1OA0A 4I9NA 2ZBEA 4FFOA 2Q4TA 2NYVA 3BSWA 4GXRA 1ISRA 3I45A 3KXLA 3PUIA 4M0CA 4URZR 5T3UA 1VJRA 5HRCA 2VVTA 3U7FB 4KFCA 2EL9A 4MTCA 1G3QA 1N2HA 2B3DA 2H1LA 4QUIA 4IJ6A 2O3JA 4B87A 1UC9A 3VKVA 1Y5RA 4I3HA 1GRNA 1PZEA 3GAZA 5HM8A 1D07A 1ZAKA 5LQNA 2HSDA 1J8QA 1OFGA 4JFRA 2ZSFA 4YK7A 2C5LA 3BULA 3L6DA 3GJ8A 4KR9A 4DLRA 2BOVA 4OTZA 2D7CA 3K73O 3O38A 4GD3Q 1CLEA 5DU2A 4BV3A 3AJAA 4JX9A 5A5FA 4TMWA 2WSSA 3IAEA 2FF5A 2FZLA 3CZQA 2AX3A 4KIGA 5M29A 3V8PA 1UC4B 5FI5A 3IAS6 5AHWA 4Z54A 1W59A 2B34A 3LT5A 4H18A 5KIAA 3K92A 1ZKDA 3HCRA 3TKYA 4BCDA 4CLOA 3E7XA 3FFBA 3TXXA 3G85A 1QIEA 4IH9A 1M6VA 3JSXA 4MHTA 5K0NA 4AYTA 1NYTA 1WSAA 1RWXA 2O7SA 5GMOA 4EHJA 3AHJA 1RMQA 2GX6A 4MA5A 2W93A 3UGQA 2JS7A 1XRMA 2X4IA 1Z28A 1EK6A 5IABA 4GMXA 1W8DA 3JAWB 2GDZA 2P4UA 3PK0A 3OZIA 1VMIA 2GUGA 1YOBA 2YJGA 5KHAA 3Q8MA 4DCGA 1GITA 4LJ8A 1Q1GA 2PKQO 2QT0A 2WZDA 2AJCA 5TQ2A 1Z6XA 2OHVA 4PX5A 1PLJA 1SKAA 4RA9A 5EKSA 4JC0A 4XTCS 1HZJA 2FCRA 4LSZA 3GJXC 4N03A 1XN4A 1EK2A 3R7SA 1MF7A 3IDQA 3BT7A 1FTQA 3KJHA 2PBFA 1BIFA 4HAUA 4C06A 5TLSA 1PT5A 2I4IA 2TRSB 4RKQA 4V0SA 3RVMA 5KS2A 1O3YA 1D6SA 2RHMA 4R1TA 5C9ZA 3D3JA 1UBGA 3LUJA 2C7QA 4EA6A 5JO9A 4FVTA 1N2GA 2Q07A 4R81A 5BN4A 2O8EA 1P17A 5HQ3A 3INRA 4MMZB 1FDVA 3VHRA 4DQVA 3DA8A 1QP8A 4FYXA 1JU9A 2X19A 2P77A 3I9V1 2PUGA 2B1RA 5FBZA 1G60A 4B6EA 4OJTA 4IG9A 1XZKA 3WRYC 2GM4A 3P5SA 4NG4A 1TA9A 1D04A 2WU8A 3DOJA 4XRGA 4M2LA 3PSHA 4BNDA 4MR8B 4J1NA 4E08A 1ZGBA 2DT5A 5BUSA 2ZT8A 5IWAB 4PZ9A 2BFEA 3TTUA 2ZYUX 3B9RA 5A7FA 2JANA 3PV0A 4LMBA 4LZLA 3OX4A 3C3JA 3SHWA 1Y8RA 1UBOS 3KQUA 1V37A 3X2FA 4ZVVA 1AKUA 4URWR 4ERXA 2QAJA 3W1VA 3JRWA 2PXXA 4XUGB 3IKJA 3SDZA 3B3AA 5LZ8A 2XZOA 4ICIA 3H05A 1TT5A 4DILA 3PEWA 2JIZD 1BE6A 3AEQB 3COSA 3NKLA 3CSUA 4ZKEA 1VZ3A 2A92A 2IPOA 1Z06A 5AO9A 5LWHA 2PJUA 3ENWA 4XR4A 1BEUB 2G0TA 4CR7A 5HRUA 5HTOA 2HREA 4RIGA 4PTLA 3BQMB 3ETEA 4Z2YA 3A3YA 1P1BA 1FFCA 3ENNA 4NV0A 3LPDA 3PNPA 1FQOA 4N6GA 4P2BA 4FFSA 5D5HA 4UTOA 3DE4X 5AK3A 2HSZA 4EY3A 5IUNC 1S1CA 3PIDA 1VGRA 2HF2A 3DL0A 1KK2A 3OMXA 4M1KA 2B3TA 4NU6A 1MAUA 1GPUA 2GKGA 3T4PA 3LTNC 2QSZA 1FMCA 5I7RA 1L1EA 4ZOEA 1B8OA 4KWEA 2VPPA 2V0CA 3VHXA 3GVCA 4QYMA 2H3EA 3E18A 4C4ZA 3WS7A 1B8PA 1E9AA 3MBIA 1K4MA 2ESRA 3GFGA 3EVNA 1U0HC 3WZ2A 3BN3A 4QGGA 1R4MB 1DIAA 4TUYB 3I0MA 3AR3A 5BSRA 2EW8A 4DFDA 3LQ2A 4J1SA 4NBTA 4TRJA 4UDXX 3U4MA 1Q12A 1GNLA 1TF5A 1ZM4A 2QYSA 4WN9A 5F7OA 4Z0HO 3L7KA 1GZ5A 3OJFA 2AJ8A 4CDNA 3H9JA 1ZOLA 1KO8A 4HSEA 3WAKA 1R0CA 3VNBA 3KQQA 1BN6A 1FY2A 4Q19A 1KMHB 1S7GA 4R9VA 1FMTA 1YUMA 5EZYF 4UD2A 2DFLA 4YRKA 3UM9A 4FTWA 5G0VA 1TQ4A 2N1MA 2NTEA 4UQLA 1I01A 3SJUA 2CLSA 4RA6B 4D45A 2X9GA 4YRQA 3JQAA 5IAKA 4RW0A 4DANA 1M2EA 1VCMA 3WLHA 1EUCA 3KZNA 4TRMA 1FX1A 3Q7IA 2PX0A 2D59A 4PTYA 5ARBA 1C50A 2WHEA 2WJ6A 4QM7A 2FDXA 2JCYA 4MQ4A 1TTHA 4LWZA 3ZCUA 3RRBA 2OQ2A 2P35A 1VJGA 4URUR 2HU7A 1TK2A 5DGXA 1KMMA 1NXSA 1QLHA 2DWPA 4IDDA 2YCLA 1N3YA 4BVHA 1II9A 1YS1X 5GTDA 3MD0A 4OK5A 4G5GA 5K4GA 1W1IA 1GNTA 5C2JB 3ENQA 1QPBA 2P7HA 5CT5A 3ZJVA 1G3RA 1OLUB 3QF7A 3HFRA 2Q41A 1VBNA 1I3MA 1QNLA 1DIGA 1Z39A 3G8BA 4LUCA 3TFQA 1NI5A 3W79A 5LJLA 1JN0A 1DKRA 1YH3A 1DEXA 1OE0A 5EJAA 2PRJA 3U37A 3UV3A 1N8SA 3IDOA 3NTLA 3DE5X 1H5UA 3EUAA 4RKEA 1A7UA 3HGTA 2VWHA 2J8ZA 1YQQA 3K5HA 2CL0X 3KV3O 1E2PA 4HB0A 4OXXA 3CURA 4CM8A 4ZJUA 4JYPA 1QXSA 4L8LA 2EX4A 5FUQA 1ISMA 1M7BA 1SOMA 2QUZA 5KTPA 4CMEC 1WXHA 3QWAA 4RKFA 1T0PA 2WAAA 3ANTA 2ECKA 4Z8YA 3FTEA 3A26A 4D6XA 1HI9A 2I54A 3CE6A 4H1HA 4QG3A 4AIIA 2R6DA 2PX5A 2HTFA 3GEHA 4GZ5A 3EWNA 5JC1A 2AG0A 2F1IA 3Q11A 4OQEA 1ECPA 3MFYA 2BM9A 5EXEA 4XD2A 4PHGA 3FOFC 3PR2B 3EFEA 4BTVA 1PD1A 2I6QA 3L1UA 4FNAA 3NOQA 3UC5A 3F74A 3VMMA 4G56A 5I3ZA 2GF9A 1E9DA 3NTXA 4B1FA 4HUTA 2VT2A 5ITZA 1NW4A 1QIDA 1TZKA 3JZAA 4M0EA 3Q2IA 3BWMA 4Y1RB 4CMHA 2XF2A 4ARCA 2YVLA 3QVVA 4G85A 1N2SA 3HSKA 2NN3C 2V54A 2VHYA 1U8UA 2YWRA 3HCCA 3QMPA 4Q0MA 2ENWA 5IEJA 5JATA 4COOA 4NYIQ 4ALIA 2QP3A 5DNDA 3SSAA 4RJTA 4X20B 1K66A 3WBFA 2C3PA 1N9ZA 3P5BA 2C4NA 2OZVA 3EXHA 4CM5A 4OI4A 4HZUA 1Y3HA 4LJKA 1RD4A 3CPSA 3TOXA 1FB5A 1TIKA 1CZRA 1ZOSA 2IXTA 3IJEB 5B3JA 3DEFA 1TDJA 2B99A 1DG1G 2JB9A 4B6RA 3H99A 3U7HB 1CQPA 4P98A 2BMWA 2XUIA 3QLVC 3LD9A 4OHFA 1BXKA 1JI3A 1SWWA 4IVNA 1X7GA 1WZNA 2ZYWX 2GBPA 2QM3A 1H3NA 2Q9UA 3QEMA 1NFRA 4RV9A 5EP4A 5EWMA 4CU5A 2OBMA 3K5IA 4R5MA 1SVUA 1WR8A 2FSSA 3HJRA 2RBEA 1ZJZA 1AKMA 2ZE5A 1NNLA 5U1PA 3R3ZA 2RH9B 3QEAZ 1G5HA 2YYAA 2NXNA 5J9FA 2X0JA 1ISFA 3N0VA 4LMRA 3O91A 3PLRA 4Y2YA 3UK2A 1E64A 2Y71A 3PI7A 1ENPA 4FEEA 4KPFC 5J2TA 2F67A 4H7HA 4HEA6 4PRZA 4TN5A 4YJHA 2ICAA 2IDMA 2OEPA 1ETUA 1JQBA 2GA8A 3MS4A 1XT6A 1JJAA 4K9DA 4BYGA 5G41A 1EHYA 2HK6A 3SBDA 5JY6A 1KYQA 5IJ9A 2PPLA 2Q5LA 3JALA 5C31A 4BNKA 1IN7A 1EZ1A 3U9TA 4OHYA 3NB0A 3GLGA 2Z6AA 1DCMA 1P6UA 1M5TA 2G25A 1UK7A 3A27A 5EXTA 5BPHA 1R64A 2JGLA 4CIWA 3U56A 1CY2A 2YCBA 2QTHA 4A82A 4QXRA 3VU3A 2CUZA 2BW0A 4BEJA 4F9EA 3DDZX 1LF0A 1CY7A 2ZBGA 4ZI5A 3VTKA 3KPJA 4EUKA 3ANNA 3DT9A 2PGJA 4B44A 3NQ41 5COBA 2C78A 4O2RA 4X8OA 1OSNA 5F9HA 4RHXA 3PC7A 4P6VF 2I7XA 5CM2Z 2C4KA 2XOXA 3RIMA 2JGDA 1Y0BA 1Z2AA 1MB4A 2I7VA 3PPWA 5AW6A 1J8FA 4G1MB 3V42A 4D4HA 3QU4A 4ZVSA 5BQFA 2GEBA 4WLNA 3D3EA 4M8LA 2HMUA 4ND3A 2FSFA 1M8PA 2M6SA 5T6BA 4BMDA 3V80A 3VTAA 1IRIA 1KZ9A 3ROXA 5GJBA 1DGQA 3U5ZB 5E7IA 1XV5A 2YIDA 1B42A 4YV0A 4O1HA 4FYVA 3UB3A 3AUAA 3UPDA 2DUUA 1G8GA 4UHFA 5BSWA 2P1DA 1KARA 2V9ZA 1EWTA 1JHMA 3DJYA 3L1KA 1KTIA 5TMEA 2GCEA 1PQUA 2DUMA 1WBJB 3U4AA 1VC2A 5JNWA 5C81A 1D2NA 4DMMA 1EXVA 1KGDA 1AE1A 2QN3A 5HF5A 2ZR0A 4LJ5A 3ZHUA 4KN5A 1XMSA 1ZJ6A 2G1JA 5CH3A 2QP9X 4FR0A 3DAYA 4JWKA 1BU8A 4GX0A 4CT4B 5D3MA 3WMRA 2A9RA 2FR8C 5CA0A 2W71A 3WB9A 1W0JD 1CD5A 3QU7A 3IPYA 4X91A 4MB6A 3MCWA 4CM9D 4TWZA 3K0AB 3QKRB 4P0TA 3WZLA 1DC5A 4AD8A 1YK1A 2JLUA 1ESDA 5DXFA 2VUIB 3E1GA 3IQDB 3OIYA 2PQMA 3GUHA 4PGMA 4G37A 2BP7A 5A04A 5IF3A 5K8VA 2ZJ2A 1Q19A 4B0PA 1ETHA 4DADA 3G2JA 3B85A 4XWTA 3B8HA 4GP9A 4LV6A 2AG1A 3AO0B 4NV1A 4NCKA 2EDCA 2B4RO 3L8HA 4Y2PA 2PAFA 1BKDR 4I1YA 4MV8A 1TTTA 1T9GS 4BO6A 4RV5A 1KPGA 2VSNA 5EE5B 4YONB 3KHKA 1BYUA 4EJSA 1ULUA 3T5DA 3IHLA 3H0CA 3L8ZA 3UGKA 5DHTA 5DRTA 1ZUNB 3OECA 4FBGA 1U3VA 4C03A 3REFA 4B75A 1Z5ZA 2ZJAA 4FGZA 3WMXA 1FS6A 2NZWA 4BJ3A 1R6UA 1U7PA 3I6MA 2XCOA 3PLNA 2XUAA 4ZA2A 3VJKA 4YAKA 4UMEA 1LLUA 3PRYA 5JDCC 2QM8A 3KSUA 3AHFA 4UD6A 3OQIA 4NXNB 3SX4A 5FYDA 2O2IA 2C58A 3AHDA 3G0CA 4HBZA 4TKZA 3DMGA 3SSMA 5D00A 3EQZA 3SG0A 3CTMA 4AJ2A 4CUZA 4GHWA 3OIVA 5JNTA 1TF7A 2X7JA 2ZRAA 4RY8A 3URMA 4DRXB 4X54A 2I66A 1WWKA 4ALJA 5AVRA 3JWIA 5F9FA 5I7WA 3MRTA 3OZ7A 4CLOB 4HFJA 4PO8A 4YIKA 5THKA 5F1OA 5L4SA 1H0SA 2YN4A 1RAIA 3ZHOA 1EUDA 3F8SA 3V97A 2YJ6A 4QVIA 3B8EA 2GNPA 4C6SA 3G9QA 2QN8A 3IQXA 5E9WA 3HG7A 1BHO1 3VTFA 1E89A 1SZPA 4KX3A 5HEKA 2QN2A 1TK9A 4MZDA 2QLNA 4XOIA 4YAFA 1NWHA 5K01A 1D2MA 2PN1A 1RRKA 2H65A 3SJAA 1K27A 1NQWA 3REGA 1SD2A 3ILVA 1JDTA 1G2PA 3IOMA 3RT7A 3QHPA 3LO8A 4BJ1A 1NXOA 4OFZA 2C07A 1FF9A 1L5QA 3DXXA 2HR1A 1R74A 4EPRA 3G0GA 3V55A 3RFVA 3SYLA 4L8GA 4YP5A 2RCNA 1Q7GA 1L6IA 1AGRA 1F5NA 1SK8A 1JSCA 3FPHA 3FPBA 4BV9A 5IYZB 2IQIA 1LTKA 4JVOA 4OB6A 4OFXA 4P82A 4R2JA 4KODA 1RZUA 1YZ3A 2X8WA 5HDQA 5JS2A 4BFYA 1BXZA 4PQRA 3LWZA 3K8ZA 3VDRA 4A36A 4UAGA 2FSVA 4I50B 5IAJA 3NHAA 4ISCA 1WF6A 5F3RA 1NVDA 2WNSA 3OZAA 5ALJA 1GCAA 2WZCA 4YMHA 4RTPA 2FP3A 2VH2A 3ANXA 3FDJA 1TX4B 4QTYA 2D5BA 3QBEA 4XXHA 2GBIA 1NWCA 1MUUA 1P60A 2Y67A 3FUCA 3UGTA 4EABA 4EWLA 1A2KC 1GHTA 4FJ1A 4M1EA 4QTXA 2BCGY 3GAAA 1KEEA 2C2ZA 3KTAB 4G0QA 4KO3S 4KWCA 3GP3A 2PO7A 2H0AA 2BFEB 2XWJI 5EUCA 3RI3A 3AL2A 3DTVB 4NX2A 4NBNA 3WGHA 3J7TA 3ZKAA 3S81A 4ND7A 2ZP1A 4K7JA 4ZZ0A 3TH5A 4CQLA 3CR3C 1GRRA 1LRLA 1Z7YA 3QZUA 3S2GA 1IQPA 1MQSA 2ZB8A 3PFGA 3QVOA 4FIZA 2A5LA 2QTBA 4E33A 1SBZA 5FF9A 5DGIA 3R0VA 1VLVA 1ZM9A 2WIFA 5FBVB 3HYTA 1U1FA 4KQGA 4RDCA 3HDQA 4ZO4A 5DCWA 4PG7A 3QPDA 3C45A 4DBVO 4C7XA 3R9XA 2XKBA 4Q1FA 4DVJA 2CLLB 5F2EA 2I1QA 3TTTA 4HPJB 1EDEA 3UJ7A 1Q1QA 2ALJA 3M0EA 4Q1CA 4YUWA 5MGNA 4JUDX 3EXIB 4EW1A 1DBVO 1SC3A 2FXIA 3E3AA 4IEFB 1DFIA 4N6NA 2NUTA 3SEQA 3CEHA 4J2OA 3DKRA 2XXAA 2HF7A 3A6DA 4L7VA 2I3AA 2RBGA 3L4KA 2PGIA 1QG6A 1T0UA 1Z4PX 1Z75A 3UBMA 2BEKA 1MO5A 4EHBA 1OXKB 3B78A 2XQVA 1K7EB 2PUEA 1T8RA 3HLKA 3O5AA 2PYIA 3A3NA 2C4VA 1TI7A 3KLBA 2OD2A 1K2VN 2PT6A 4XM0A 3V9AA 3VYVA 1YL7A 3RVRA 3V2GA 2JATA 4NL4H 5BWOA 4LX0A 4L5JA 3BDIA 4MV7A 2V4MA 1J25A 1TCBA 4MI1A 4S3MA 4TTSA 2E5FA 2X5JO 3NONA 4HDAA 5IHPA 1QFYA 4PINA 2V45A 4RADA 5A0TA 1N4DA 1PW5A 1Z0DA 4RJJA 3TZLA 2V7VA 3ZLUA 2VSFA 5FR1A 1O97D 3PX7A 1FFHA 4EHKA 3SQWA 1U8TA 4REOA 5DNYB 1FK8A 3URKA 2QUHA 4B3XA 3MJSA 4ZRDA 3VBCA 3WDMA 3NBZC 5KTKA 3AMVA 3K9QO 4LVOA 5L3RA 2J3LA 3TDNA 3ONDA 2GI4A 4E5VA 5I8PA 4Z4GA 5CX4A 2O1SA 2CCGA 3C3BA 2Y6UA 4IDGA 4JKOA 4I2VA 3OJEA 4GWGA 3ZV7A 3L8YA 5IXYA 2LUOA 3HWWA 4Y6PA 3VO9A 1X80A 5GADl 3Q3HA 4MAAA 1H69A 1Z7WA 2FSPA 2ZANA 4F5YA 2HA4A 2H5IA 2VFAA 2WI8A 2Y1OA 4EX6A 4XQ9A 3EVAA 5AM0A 1E7SA 3OZXA 1TO6A 2O2GA 2J85A 2Q3HA 3ONEA 3PUZA 2JAQA 2PMKA 4H35A 3DWIA 3KUKA 2ZT6A 4FR5A 3OF5A 4I5EA 4XUEA 1YVDA 1SHTX 2VJLA 4TWRA 3OCVA 2FOIA 4CQMB 2PYDA 4QOGA 4TV9F 3GCGA 1TNDA 1O6FA 4JNKA 5DPMA 4HO1X 5T4BA 3UUFA 3DBIA 2XUQA 1MAWA 1Z2NX 1EVQA 2JGFA 3PEUA 1RACA 4M37A 5D01A 1O95A 1F9EA 3H5WA 3OEHA 3GRRA 4PANA 1ISSA 1Z35A 2NU6A 1GQOA 2XADA 4LBYA 1U90A 1XKQA 4BRSA 1NW7A 3H9EO 4NJEB 3FCCA 4WADA 1P9OA 4ZIRB 4DC1A 2YY5A 2CUKA 2O2CA 4OHOA 1IEWA 3RBAA 3U61B 1VZ2A 1BFKA 1QMPA 1W29A 3EQ8A 3HHPA 1Y8RB 4QEKA 3UMVA 1XLVA 2O5RA 3D7NA 4ZQHA 5SYAA 4HEQA 1QAMA 2NTJA 3PC6A 4DA7A 4MP3A 1DAEA 4LOJA 2HUPA 4MQMA 2F2TA 2FSGA 2QWXA 1F0PA 3MINB 4R2KA 3DUFB 3LBFA 4TKVB 3ZWBA 1JWAB 3H17A 4UBNA 4DLLA 4D1YA 4ETWA 1T15A 5CA0F 2NVUA 3DO8A 1QZ3A 3QPVA 4DAOA 3DR5A 4CHTA 4ZMBA 1Z12A 1MNAA 1QRSA 3EG9A 2IE0A 4KOEC 3DEHA 3DOEA 2ZRGA 3BC1A 4BWYA 6ABPA 1O2DA 2PX6A 1TEVA 5J5VA 3KIPA 2FRDC 1XDGA 1LTHR 2WFLB 3VR5A 3RRJA 4GPBA 1IMOA 3H16A 4OFWA 4ITVA 4GT1A 3V8EA 1SVLA 4EJSC 5K0BA 4DV0B 4IVRA 3R0JA 1CVRA 2VXBA 3SHVA 3TKLA 2MSCB 4URXR 1TZCA 2YS6A 3LDFA 4GPIB 2RGWA 1BVYF 5H68A 2DSTA 3FHLA 1WBDA 4OQPA 3O31A 3ZY5A 4GGPA 1E79A 1T2NA 1XPJA 4NPAA 1LX7A 4BV8A 2B4QA 3GLFA 4ZICA 1DKLA 2JA1A 3EPRA 3IUMA 1R6AA 2AR0A 1RWOA 3HFSA 2X1MA 2YIJA 1EXMA 1S9DA 2HADA 2JF0A 2O2DA 2YQ5A 3HLYA 3N8NA 4HLCA 4TLEA 4B3TB 3KKQA 5A7GA 3L06A 4A9AA 3A2MA 1Y1SA 2A4KA 3AF3A 1CC1S 3DD5A 3I42A 3MJRA 5ALGA 3RLIA 4B4OA 4DBZA 1AOXA 2J6HA 3P2EA 4ZDJA 5LQCA 1KA9H 1UIMA 4UBLA 2V7QA 2ZB4A 2VZ9A 3C4QA