1F2TA

Crystal structure of atp-free rad50 abc-atpase
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
149
structure length
145
Chain Sequence
MKLERVTVKNFRSHSDTVVEFKEGINLIIGQNGSGKSSLLDAILVGLYWPLRIKDIKKDEFTKVGARDTYIDLIFEKDGTKYRITRRFLKGEIHAMKRLVGNEWKHVTEPSSKAISAFMEKLIPYNIFLNAIYIRQGQIDAILES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Replication
molecule keywords RAD50 ABC-ATPASE
publication title Structural biology of Rad50 ATPase: ATP-driven conformational control in DNA double-strand break repair and the ABC-ATPase superfamily.
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 31
structure length 145
sequence length 149
ec nomenclature
pdb deposition date 2000-05-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1f2tA00
2GCOA 1WP9A 3PG5A 1EESA 2HV8A 4PO1A 2YWGA 3ASZA 3TVTA 3C7KA 4B76A 3CRQA 2PLFA 3Q9LA 1W0KA 2EFDB 4JVMA 1MABA 3MJRA 3IPXA 2O8DB 2RGBA 2FFBA 3I4LA 2RCNA 5DISB 2RH5A 2F1JA 4PHFA 1YZLA 3QXJA 4WAUA 2VHJA 4U02A 3QVUA 3W9YA 4LUCA 2RGNA 5EXXA 4WZ6A 2PJZA 4ZDIA 4L15A 2HXSA 2H5EA 2RGNC 2YV5A 5LPNA 4C2UA 1TQ6A 3Q85A 2ZUCA 4ZIRB 4MYTA 2Z43A 4E03A 2W6IA 1R6BX 3EPHA 2WJGA 1XRJA 3FKSA 3WY9A 1EFUA 3CKLA 1TAGA 2K5UA 5JWRA 1QZXA 4DSOA 1G7TA 2HT6A 5KSPA 1KHTA 1KI7A 1XCGB 2IK8A 4EPXA 2GNOA 4QFMA 4JSYA 1S1MA 3A1SA 2UVQA 5JECA 5CYPA 1MV5A 1VTKA 3DPUA 4BLPA 1OHHD 3SZRA 4UQOA 3M1IA 2G0NA 3MJHA 2Z6VA 3K70C 1P2TA 2GJAA 3OHMA 2C99A 421PA 3EASA 3NC1C 4MUAA 1VYVA 1DO0A 4HAZA 4KBFA 4WW0A 1DAHA 3FPAA 4LRWA 2IC5A 4KBGA 3MWKA 4LHYA 1IAQA 1TADA 2GCPA 3NC0C 3IPYA 1BO6A 2FV8A 721PA 3SBDA 2IYTA 4GFDA 5JRZA 2XNDA 3C15C 3IGFA 4W5WA 4C4PA 4G5OA 3DMDA 4M0LA 2PX0A 1R0XA 5DGXA 4EPWA 1T91A 4RZUA 2XX3A 3IBYA 2O0KA 3TQCA 1MKYA 2CE7A 1NMZA 1NSTA 5HKKA 2O8BB 5AK0A 4L5BA 1KO1A 1GRNA 4M9XA 1UBGA 4U5XA 4Q9HA 3FYHA 3QUSA 1G4AE 3W8NA 4AKEA 2JA1A 4TMXA 4DIEA 4AYWA 1S8FA 2ZSAA 3ADBA 2HT1A 1GILA 2B7CA 1E0AA 1VHTA 3ZH9B 2DHRA 2KBFA 3K0AB 2FEMA 4UJ3A 1XMJA 1DVRA 5A5GA 2JDIA 3QKRA 5EE3A 2ZETA 1Z63A 1N6LA 1N0WA 3HYRA 1HURA 1M2OB 1VYUA 3WNBA 4QM7A 2OSBA 2HDNB 3OAAA 1S4QA 3KJIA 4NCKA 1A2BA 2ODNA 4C3ZA 3K9HA 2BJWA 3U3OA 1FQJA 3HPRA 4XTRA 2QY9A 2ZI9A 4Q9KA 4TLBA 1E2KA 2RHMA 4TSFA 1EFRA 5C46F 2NGRA 4CDGA 3LNCA 5GVRA 5KDDA 1GNPA 4EJSA 3SS8A 1CBUA 1X8KA 1Z08A 2AD5A 4B6EA 2QL6A 1U9IC 3QG5A 5FTJA 5LD2C 4M1WA 1QF9A 1SKYE 3UMSA 1IY1A 5AUOB 5KYKA 3MWJA 5KHOC 4IRUB 4UKDA 3WHKA 4ZPXA 3CB4A 2FWRA 4FINA 4R2IA 4LJ5A 2DPXA 4B2IA 3QPUA 3AB3A 2D7DA 1XTJA 4IOKA 1KSHA 1GDDA 3WNDA 3K9NA 2PMDA 2CXXA 4GP6A 5H70A 1YZKA 3VKHA 1YKSA 1LS6A 3THYB 2ZRLA 3FHTA 2W2VA 1XD2B 4TQ9A 5JSZA 2KI5A 1K5GA 3OIWA 4RD3A 5K8UA 1TUEA 5EUMA 3A6PC 3U3KA 3WNCA 4C0AC 1W36C 4URZR 4URYR 1QVAA 4H9GA 2PBRA 4AYTA 1W0JA 5DH9A 1R7RA 2JJ1D 3MMPA 1RVDA 2I1VB 4BGDA 4CRWB 3TSOA 5FOWA 1P2VA 5LBIA 5DNYB 3A8TA 2F7SA 4TYPA 5L3VA 1W5SA 3AV0B 1HYQA 5CIWA 1I4TD 1OFUX 5FI0B 4V0NA 1L8QA 1T8TA 4L9SA 2WMNB 4YQFA 2P6UA 2OAP1 1HV8A 1UDWA 2IYSA 2ZRPA 4QBGB 2YKGA 4DIDA 1RIFA 2ZRKA 4XTCS 4FMCB 2ZJ5A 4P4SA 5E7MA 3HPQA 1SGWA 4TMVA 3KQUA 3TMKA 2B6HA 4P33A 1JAHA 4V0ME 2GJKA 2BV3A 1M7HA 2BMDA 2V8OA 4JLDA 3GEIA 3RABA 2GJ9A 1F2TA 3VHLB 4DC9A 4D0LB 5E4FA 3RS7A 4PZLA 2ZYWX 2CVHA 2QRNA 4NHOA 1XEXB 2GTPA 5B2ZA 2WWWA 4BFSA 2JCSA 3K0EA 1PZNA 4DWJA 4G5RA 4KYIB 2OO7A 2QAGC 3ICEA 3NKVA 1R0WA 3ICQB 1Q0UA 5K8LA 4JVNA 2C96A 1ELOA 3T15A 1Z0FA 2CL6X 5KTYA 1CRQA 4AIIA 1IBRA 3WYAA 4YMTA 2P2LA 4M22A 4MUBA 5CYOA 4DLWA 2FSIA 4DUGD 4A8JA 4C7OB 4IVRA 4POAA 2J3EA 3LWNA 3CNNA 5JCPA 3TGPA 4HI0E 4P4TA 4PQYA 2CLSA 2XB4A 1O87A 2Q21A 5FOXA 2ZJOA 3OESA 2BBSA 2JIZA 4TTQA 2QEQA 3C16C 3GJ0A 4TLEA 2QE7A 4V0MA 2VSXA 4OHWA 3W6NA 1DG3A 3HR8A 5BN3A 2QBYA 3NVAA 3U7EB 1NLYA 5G3ZA 5CDFE 5FBRB 1XXHA 3KKPA 3BH7A 2ZRAA 3FHOA 1DOAA 2ZSEA 1G6OA 1NL3A 2IXGA 2ZJZA 1YR6A 1JR3D 3NH9A 3EPLA 3AVTA 4LC1A 4S2EA 4DB4A 3GPLA 3R7WA 3I92A 3AVWA 4IKEA 1ZM2A 2P67A 1E9RA 1F2UB 3V9PA 1QRAA 2FMXA 5DN6A 1JXMA 2J0UB 3K0FB 1KDPA 2P6RA 4I4LA 1DAEA 2X19A 3L0SA 2ZAMA 4RZ3A 4M1YA 2BVNA 5CLLA 1T5IA 2XNSA 5CM8B 1N6KA 4AKGA 1L4UA 1G4UR 1BYIA 3I5YA 2NIPA 3QJYA 4LZZA 2NOAA 1X1RA 2REOA 4GI7A 1GWNA 4Q1EA 4CGZA 1FNMA 3ZZTA 4DLYA 1UDXA 1E98A 1ZM9A 1ZD9A 1J90A 1XP8A 4JBWA 1U8YA 4UXHA 2IYZA 2C9OA 5CDFA 3CNLA 2WBLC 1JJ7A 4PC7A 1TEVA 1GSIA 1F6BA 3QIAA 2Q9CA 3KTAB 4NCHA 2G77B 3BERA 3LW8A 4D0GA 4TTRA 1SVMA 2QPTA 4QNMA 1N6PA 2Z4RA 3ASYA 2KBEA 821PA 1H65A 4ZKEA 2ZRNA 3CX6A 5L3QA 1D5CA 1RYFA 3GLIE 2EFEB 2JLQA 3IUYA 2G6BA 1ZP6A 5G41A 3IKJA 4C0JA 2NO7A 1XMSA 1GL9B 4B74A 4MQBA 1AS2A 1QHXA 1RRCA 2A5DA 4D0NA 4DLUA 2O52A 1G7RA 3X1ZA 1JR6A 4RFSB 4A2PA 3R9IA 4D4LA 2D2EA 2ODBA 3ZIAD 1ZC4A 5AWFC 1G3QA 2EYUA 5F3WB 3U3JA 4DLRA 4A15A 3E5HA 1OH5A 1LFDB 3AVOA 4I99A 4EDHA 3ADKA 2ATXA 4D2IA 1P7CA 2O8CB 1S3SA 2ORWA 2EWWA 2ZANA 3O8DA 1HQCA 1OIWA 3UG6A 2REXB 4M4SA 3VKWA 3WP1B 1NKSA 3VX4A 1KJYA 5KNBA 3Q7QA 4D81A 3EX7C 4FCTA 5EJEA 3ZJYA 2IHBA 3WMGA 3FE2A 1T9HA 1EWRA 4MYUA 3HJNA 1XPOA 1CJKC 1CKEA 1HEIA 4JLOA 5EZ6B 2WOJA 1K8RA 1QHNA 2WJYA 4LV8B 1P60A 2CLCX 2FGJA 1NG9A 3GLIA 3GJ7A 5HTKA 2VQSA 1KY2A 2ZI7A 4FXPA 1FZQA 4XVQA 1ZNYA 4IXMA 2PLRA 4QHYA 4J0QA 3LLMA 1XF9A 3RANA 2IXFA 5AR1A 3N2IA 3VR4A 3GLHB 3BFVA 1XB2A 3RNLA 2ZU0C 2ZRJA 5CLQA 1CJVC 2JLXA 1Z0DA 4X8HA 3LBNA 1RE0A 1KDTA 5F9HA 4RD0A 2WVJA 3CRVA 1SXJC 3KDSE 1W1WA 2NZ8A 1VCIA 4RY2A 4AC9A 2RB4A 3TVDA 1DO2A 3AKDA 1OHHA 2GESA 4PZZA 1TNDA 4TT3D 1X6VA 5D3MB 5SZJA 1QHSA 4NYIR 3P32A 1E32A 4MKGA 5EP3A 3QEJA 2WIBA 4Z51A 1IOZA 4NPHA 5HR5A 5FOUA 1F60A 1N0VC 2PCJA 1G21E 1PLKA 2BMJA 3F8TA 2IHYA 2B8WA 1G5RA 1T8UA 3U61B 5FH9A 2O5VA 4TN1A 2OFOA 2FEOA 2V54A 5BYKA 4DLXA 4TWZA 1ZIOA 3UMRA 3BB4A 5HE9A 1YE8A 3CONA 4WA7A 1TQ4A 4RKFA 1D6JA 3BIFA 3PUWA 3PXGA 4P4UA 2Q3MA 4TYWA 2P65A 5CB8A 3CUEF 1FNNA 4LWZA 1MRSA 5FOVA 2QQ0A 1IJEA 2Z4SA 4GMXA 3SHWA 1T3LA 2IX3A 1DE0A 4M9ZA 2GJSA 2FSGA 1DADA 1N0UA 4UNNA 4Q7LA 2YWEA 4N3NA 3I1FA 1LB1B 2BBOA 2QTHA 5LB2A 3F3YA 3PFIA 3GLFE 4WIAA 3PR1A 1RRFA 2QN6A 5HZHA 3DL0A 4V0OA 3EZ6A 5B64A 3THXB 3ZS8A 3SOPA 1CRPA 4NBSA 2ZITA 5JI3E 2YOHA 4M1MA 1KTVA 2N42A 5G3YA 4PAQA 4G0NA 3K0CC 2IS4A 3ZQ6A 3FOZA 2CL0X 3B1WA 3BE4A 1VG9B 1Q21A 3U3RA 4BRUA 2BMEA 1KO7A 8OHMA 1Z0IA 4GOJA 3SYLA 1WB9A 4OI4A 2AFHE 4DLTA 3AF0A 2XTNA 3JZMA 3FVQA 4G5QA 1P9NA 4IOLA 5BQ5A 4DJTA 4JYBA 4LPSA 1SULA 1KI9A 3TH5A 1OJLA 4YDSA 5GVSA 5DHFA 1TF7A 2ZS9A 4LYFA 3AKYA 1GTVA 1ONBA 5FTKA 4A9AA 2VP0A 4V0KA 3MGCA 3U6BA 3EZFA 4TYNA 1S1CA 3P27A 5TY0A 2O8FB 2J41A 1YQTA 3SEAA 1N3BA 4A2WA 4BZQA 1CEEA 3FHCB 2CJWB 2WSMA 4I81A 3VQTA 5KNDA 2VHTA 3MFYA 1WQ1R 3GLFA 4RZXA 1E2HA 4HLCA 2WKQA 5JRJA 4QXAA 3LA6A 4JJKA 4NYMQ 4M2LA 5FBLB 4LSGA 3PEWA 1QG2A 1U94A 1G291 1XPRA 4FWTA 4QJ4A 1VMAA 4C0LA 4NCJA 1Z47A 4IDHA 2NQ2C 3ADDA 3MG9A 3VR5A 4TMZA 2IWRA 2O8DA 4FN5A 3X1WA 1Z22A 1E0SA 1VCMA 2JJ1A 4Q7MB 2KSQA 3W6OA 3FMIA 2MSDB 4TLCA 4XWAA 1G20E 3K09A 4MA4A 4D80A 4QGAA 1OXSC 2ZJYA 4JLVA 5J4HA 2EFCB 1ZBDA 4OQXA 4PX9A 2Q3FA 3KXIA 3TUJC 3UK6A 1KYIA 1II9A 2FE4A 1GG2A 5EP2A 4ZIRA 3AEZA 3GJ5A 4A92A 4LJ7A 4AI6A 1KSFX 2G1JA 3AKCA 3U3MA 1IN6A 3HWSA 3TSZA 4RFVA 4K46A 1UADA 1E9SA 4A2QA 3LVQE 4IOMA 1ODFA 3QPVA 2NO6A 4DLZA 4Q1BA 1ZCAA 1UJ2A 3G0HA 1Y63A 4LHWA 1XMVA 4O2LA 1JR3E 6Q21A 2G1KA 2EYQA 4V03A 3AP2A 1AS3A 2GK7A 3CO5A 3B9QA 4C30A 1MO6A 2PH1A 5B57C 3ZVNA 5FTLA 1PLJA 5DI3B 1ZVQA 4B33A 2J45A 1E1RA 1V5WA 3PIRA 2QGZA 2H92A 4Q47A 4TL6A 1L2TA 3AGPA 2J0QA 3ZQJA 4HLUC 2A2ZA 2QMEA 3SJAA 2KE5A 2DR3A 2V6JA 4GZLA 3B1VA 3T5GA 2YJTD 4EFLA 3QQ5A 3SQWA 2FPLA 4AY2A 1LF5A 1N5KA 2WWXA 2GETA 1ETUA 3AQ4A 2H7VA 3T1TA 1WBDA 2O8BA 1A4RA 3PVSA 4EQ6B 5AUNB 4BFWA 1ZYUA 5FR1A 1R8QA 4DT1A 5KDOA 2ZRFA 2DCUA 1XEWX 1Z07A 1G19A 2QM8A 2YC4C 4WOPA 3N2EA 4P3YA 1ZUNB 1QG4A 4ACAA 4HDOB 2BCJQ 1JR3A 3VFDA 1UBEA 1YU9A 2NO0A 1EFHA 1JQLB 3IHWA 2GXAA 3AF1A 1EXMA 1G9XA 4M21A 4C9BA 1W4AA 4A6XA 3EA5A 1Z06A 2KB0A 2XOKD 4OBEA 1JECA 1HY3A 4HAWA 4XIGS 4QGGA 5BN5A 4F92B 1NBME 1A1VA 1KKLA 1AZTA 3ZS9A 4O2RA 1KO4A 1E1QD 1VCNA 3GLGB 2IYUA 3PUXA 3VU9B 4OQLA 2IF0A 2C2HA 2WPDD 3QF7A 2ZSFA 1D2MA 1IY0A 1BH2A 1W4RA 2J59A 3ZZUA 1ZM4A 2OCPA 2Z83A 1F48A 4X8OA 4XH9B 1SQ5A 1FMLA 3DZDA 2SHKA 5GJCA 4Q48A 2OFWA 4AURA 4E22A 3QKUA 2DFNA 1W7AA 1CR1A 4IEIA 3CH5A 3HU2A 3UG7A 4UNSA 3LH5A 3TNFA 2DB3A 3T1VA 5DHAA 1XEWY 4CEHB 3A4LA 4JLAA 4OQFA 2HEIA 2ZJ2A 3D6TB 2FOLA 5FL7D 4JL8A 3UWOA 2ERXA 3CW2A 4M53A 4B75A 4CEIA 5DYGA 2VF7A 2C9YA 5ELXA 2A9KA 1OB2A 1BYUA 2V6IA 1XD2A 3VNVA 4ESHA 4TZ0A 2RGDA 5BXQC 5EP1A 4JLPA 2IBMA 2YVUA 1R8SA 5AJYA 5FOTA 3ZIAA 3R20A 2W00A 3BBPA 2ONJA 4QOSA 4PANA 3VR1A 1OFIA 4US0R 4XOIA 3QKSB 5M04A 3VX3A 2ZS8A 3QG1A 4EAQA 1FUKA 2WJJA 3LVRE 4BFVA 4YMUA 2QP9X 1H8HD 4KLZA 4R2HA 1BMFD 4FIDA 3RS3A 4MGIR 2IL1A 1D9XA 1Q1ZA 3BAFA 3T5DA 2QPOA 3UKDA 1Z29A 2HUPA 1YHNA 1WRBA 2FZLA 2L0XA 5JJIA 2V1XA 4LBVA 1CTQA 3KXLA 3LFUA 2OM2A 3R9XA 1KY3A 2QP4A 4JMPA 5TMPA 2RAPA 5LDDC 2OBNA 1G8HA 2HYDA 1MO4A 1G5PA 1NVWQ 2VP4A 4RKEA 4X8LA 4OI2A 1M74A 3B8HA 5TV2A 2E9SA 2XZOA 2W2TA 1T0HB 2JJ8A 3UXMA 4C0HA 2ERYA 1VECA 4L16A 1G8PA 4G01B 4UNRA 1XFAA 3OEED 2GJ8A 5FPHA 3U6KA 1KI6B 3P26A 1ZIPA 2IXEA 4OHZA 1XEXA 1VG1A 2DFKB 2IYWA 4M9QA 3IO5A 2VSOA 2Q9AA 1WXQA 2R9VA 1RC8A 3ZD7A 1H8ED 4EPYA 2Z5FA 1A2KC 4LHZA 2YNMA 5FPTA 4UJ5A 4M1OA 4XD7D 2WKRA 1M7GA 5EZ5A 4HLQB 5TDHA 2ZIAA 4LJ4A 2B92A 3UATA 3NBYC 1GKIA 1XJCA 2WAYA 3TR5A 4C7OA 3T06B 4Q1CA 4BASA 3EZ9A 1WCV1 2WWIA 4IDOA 3QXXA 1P5ZB 3FDIA 4DRZA 5C18A 2IS2A 1WBBA 1HA3A 2G9NA 3REGA 3S1AB 4AYXA 1N5JA 2DFLA 2RMKA 4HUQB 4LJYA 1G64A 1R5OA 1US8A 1LF0A 3U2QA 4PTLA 1LV7A 3H2YA 4GNKA 1G3RA 1CR0A 4TT3A 3QBVA 3TAUA 2ZQ5A 1CJTC 1ZNWA 4ZKDA 2ZE7A 2X2EA 1NVVQ 1Z83A 1I4DD 3SR0A 4HB3A 1U8ZA 2ZRIA 1NI3A 2QROA 3LO5A 1TPZA 5E95A 4FCVA 3RLFA 5CB6A 1OV4A 1NJGA 4S35A 1G3UA 4EJSC 4LOAA 1W47A 3VHXA 4K81B 4KO8A 1F2UA 1E2PA 1EWQA 4XVRA 1G18A 2HF9A 2J0UA 3GFOA 3ND9A 4QM6A 4WXPA 1CIPA 4CVNA 1NY6A 5KNCA 3B82A 3P1JA 4IFEA 1P62B 1OXTA 4G1UC 4B34A 1P2SA 2ZREA 3BWDD 2FSFA 3K9GA 1DG1G 1Q57A 4U00A 4PQRA 4NE2A 3OF5A 4JLBA 3TKLA 3LX8A 3LBHA 2IEZA 2JJ2D 1TQ2A 2IA5A 2QGNA 5CJ2A 4A6PA 2VTKA 4KLNA 3CF0A 1Y3AA 5DE3A 4TZ6A 4AWXA 1JQJC 3A37A 1HE1C 4D4KA 1QBKC 2HYIC 3Q8XB 3TE6A 1E6CA 4HB2A 4L9WA 1N6HA 2FX3A 4B2LA 2GXQA 1QHHA 4NU0A 3KTAA 5KDLA 2BBWA 1E9FA 5AUQA 1Q1QA 4BFZA 1AJEA 4GP7A 3DO6A 3NEYA 1O3YA 5JEDA 2OCAA 2IUSA 4Q03A 4MITA 2V7QD 5LB4A 4OI0A 2O8EB 2JLUA 3KXKA 2J5XA 2P6NA 2NG1A 5FPYA 3O47A 3TJZA 2H57A 4D4MA 5ANRB 3NHAA 3SJZA 5DLQC 5J4LA 3K8YA 1S0UA 4QG7A 5JJLA 2AXNA 2ZR7A 2VF8A 4M1TA 2UZ3A 3I72A 5BW8A 2AR7A 4RFSA 2MSCB 1P73A 2F3TA 4ASUD 4CYMA 5CITA 4C2TA 4URWR 5JI2E 3K70B 4NL4H 2RKOA 3DHWC 3KKOA 1GOTA 1Z3IX 3C14C 4NH0A 4BEBA 4LBWA 1TTTA 2GRJA 3J81k 2J0SA 2YINC 1KSJA 3GLHE 4Q01A 1LW7A 1HTWA 1G5TA 4HZUB 4WZBE 4QGHA 4JLJA 5HCNA 1E94E 2OFXA 2PT7A 1XZPA 1FX0B 4H1VA 5AJVB 4ESVA 2PEYA 4KXFB 1GUAA 5IDVA 2XAUA 3CR8A 4IVQA 1R0ZA 3EIHA 4D6PA 4HDCA 1RZ3A 1YZNA 1E4VA 1GFIA 2I4IA 3CF2A 4A82A 5DSZA 4TLDA 2W2XA 3G82C 3P20A 4A8JC 1Q1BA 1CJUC 4ON9A 3B13B 2GVZC 5KSYA 2ZYVX 2IS1A 1CXZA 2F43B 1UKVY 4G3XA 2A5FA 3SYNA 2IYYA 3KKNA 2ORIA 2NTYC 4H1UA 1SHKA 3EZ2A 3MCAA 2OV2A 4D4JA 5L3SB 3EARA 2CEAA 1ZINA 2A78A 2FH5B 5UKDA 1W48A 2HJVA 3NEJA 2ODEA 1UEJA 2NO1A 1UPTA 1ZUIA 3C4JA 1NG1A 3GLHA 2XGJA 1LNZA 1Z2AA 1AKEA 2CMKA 1E9BA 4O3MA 3BB1A 1N6OA 2PMKA 3RYTC 3U5ZB 2JLVA 4LY6A 4W5JA 3FTQA 1VIYA 1RPZA 4GL2A 4CW7A 2CNWD 2HLDD 1L4YA 3IO3A 2C9CA 3NIBA 4LBYA 2ZM5A 4Q66C 1C9KA 1GP2A 1EG7A 2OESA 3ZYCA 5D3MA 4OK5A 5LD2B 2YOGA 3KZ1E 2Q9BA 3LXRA 4PAMA 1KK3A 1JBKA 1G8GA 5HCIA 1GM5A 4O0MA 2JLWA 5D3QA 3PUYA 1NRJB 2OCYC 4HYYA 4E09A 3UANA 3RVBA 3U7HB 3SC3A 4A0HA 3FB4A 2O0HA 4KODA 1Z8FA 2YOFA 1G7CA 5EE0A 1W2HA 3TW4A 5IK2D 3U44B 2C95A 1OYYA 3CZQA 3O8RA 2ZRGA 4EPTA 4Q4LA 2J1LA 4JJZA 4B3XA 4AKIA 3KX2A 5C4GB 4LHVA 1W36B 4MYCA 2QA5A 3FMOB 1KI4A 5KSZA 2WSSD 5JJKA 3CRW1 4TMTA 4NYJR 4IXNA 1GNRA 5FPSA 4BUJA 2JAQA 1NBMD 4ZI2A 1ZW6A 3V4FA 1J8MF 3THXA 2XB2A 2LKDA 1OB5A 3H86A 3QNUA 4I1OA 1KMHB 1ZD8A 4KU4A 1RRGA 2QT1A 1KI1A 1GRRA 3X1XA 1YR7A 3PEUA 3B1YA 4B3CA 2XOKA 4JSTA 5KOYA 1A7JA 2IF2A 3KJEA 4OKSA 4QBFA 5TARA 4KYUA 2F6RA 3CX7A 2ZUDA 3E70C 1E1QA 4PO8A 2QTFA 3AP1A 4Z54A 4TMKA 1NF3A 3BH6A 4QNRA 4HDQB 5SZHB 3NHBA 1G3IA 2RGCA 2WPDA 4MKHA 3Q3JB 1U98A 1TQDA 3FGNA 1NN1A 2BEJA 1DPFA 1U90A 3OZXA 3NBFA 4PHGA 3A1WA 4N0DA 4LYHA 1TF5A 4OHYA 1JXOA 2QAGB 4P32A 4ZDJA 621PA 4KITB 2O8FA 3K70D 4LHXA 2CJWA 3QENA 1J99A 1ZNXA 2VBCA 1N6IA 3H84A 4CEJB 3L0PA 3LAWA 3AP3A 4IFBA 1XDBA 5FL7A 3QPWA 4WBSA 4ERNA 3MUFA 2IEYA 3SJBA 1Q22A 3WMEA 3G5UA 3H0KA 4OYHA 3A4MA 3T12A 1PLLA 3P4YA 4IDPA 4LJAA 1Z0JA 4ILEA 3IDQA 3A1VA 5DI9A 3X1YA 4Q4HB 3ZZ0A 5FBVB 4TL9A 2V4ZA 2GA8A 3KUDA 2BIFA 3RRNA 2JLZA 1E79D 3HP1A 3K0SA 2PZFA 1DAKA 4HB4A 2H8KA 3AF2A 5HE8A 2YZ2A 4JLMA 4NYMR 4UNPA 4BECA 3K9LA 1HT1E 3B6EA 4PZYA 1IN5A 3EPKA 3REFA 3W90A 1J2JA 4FCWA 1FL9A 1X3SA 3GCGA 1H8HA 1L7VC 3FKQA 1BMFA 3A36A 1XXHB 1FP6A 4P31A 2OXCA 1Z6YA 1J8YF 1FMJA 3B5JA 4ZDKA 3IEUA 3CF6R 4JBXA 2MMGA 4Q9JA 1ZAKA 2MMCA 5FR2A 3R8CA 4HZIA 3TRFA 2Q0HA 4Q18A 4OJKA 3BK7A 4F4CA 1D2NA 1IN7A 2NMVA 2EFHB 5FUYA 4JVSB 3OEEA 4IDQA 1P2UA 2CCGA 3NH6A 5JEEA 4X8MA 3SN6A 5CIQA 3ADCA 3X1DA 2GK6A 3VAAA 4JYCA 3KB2A 3UMFA 2JASA 4BFYA 4AG5A 1DEKA 1XCMA 3B2EA 2ANCA 1UF9A 1E9DA 3IQWA 4G5GA 1OT3A 2H18A 5FOSA 4EFNA 4GDFA 4B48A 2AFIE 2BJVA 1H8EA 1PJRA 2JGNA 2ODWA 3F0TA 3FFBA 3FWYA 3KKMA 2XJ4A 5AJXA 2ZRMA 4TTPA 5DI3A 3U7GA 4XD7A 3EPJA 2VHQA 1DAIA 3Q5EA 3LBIA 2AKAB 1QHGA 2CL7X 3WRYC 2ZRBA 1NLZA 2VHUA 1FFHA 1R0YA 4Q9IA 4JL5A 4O25A 2QI9C 3W5JA 2XITA 4JKYA 4Q02A 2JEOA 2ZS7A 5FUVA 1UM8A 2CK3D 3GLGE 2QENA 1RFLA 5GJVC 3MWLA 4OI1A 3HYTA 1U99A 2J9RA 3FMFA 3I61A 2I3BA 4QBHA 2OG2A 5H8WA 5DO9A 4DDWA 4EQ6A 3EG5A 2BMFA 4GBMA 4V02A 3CIOA 2WWFA 5FBWB 1W36D 1OLOA 4Q4AB 1J7KA 5EQTA 4Q00A 2GHIA 3K53A 1D2EA 3RS0A 2R6DA 4MRRA 1AK2A 2ZJ8A 3LX5A 5E7IA 2ZSBA 1RJ9B 3SE0A 1CF4A 4QHSA 3O8BA 3AGQA 1VYTA 1W4BA 4E5UA 2R6FA 1KK0A 1YZGA 1P3JA 2XEXA 4KAXA 1Q3HA 2LWIA 3GD7A 2RGGA 1N6RA 4IW3B 3RHFA 4IHQA 4OHXA 4XVUA 3MWYW 1QDEA 4DBLC 3LV8A 5FUXA 1YZUA 4W7SA 1DBSA 4PO9A 2ZE6A 1XTKA 3V4RA 1DAMA 1GL6A 3I3SR 5K8TA 2OXRA 3DOFA 2A30A 2EQBA 1M8PA 3LY5A 5H68A 3GQBA 3GLGA 4KSCA 4F91B 2ZYUX 2FN4A 4EFMA 3VU9A 1LS1A 1T5LA 2TMKA 1SVLA 3EIQA 3ZD6A 4Y0VA 3D31A 5C2JB 1MT0A 1RYHA 3BD9A 5DYIA 3N70A 1UEIA 2PCLA 5EP4A 4BLQA 3HU1A 4DLSA 3I8XA 5EXSA 3IIKA 1KI8A 3KQNA 2PJRA 3W34A 4URVR 4MDFA 2GZAA 5BWMA 2H1LA 4R7ZA 4DXAA 3W3ZB 2EW1A 1RW4A 1G7SA 1UFQA 3MRSA 3DM9B 4CEHA 1GNQA 3ZGXA 2F3RA 2IUTA 3K09C 3RSLA 1NP6A 2IYQA 3DKVA 1W4CA 4TL7A 1COWD 3C41J 5TB5A 1IM2A 3AVVA 4BFXA 3Q5DA 4MRNA 4DZZA 3KFVA 2FF7A 4OK3A 1SXJB 5CK4A 3ZDQA 1GVNB 2ZEJA 3GJXC 2G83A 5J4VA 1E9AA 1OFHA 4WVFA 1SVSA 1ZD1A 3GP8A 4BRWA 1FP7A 1OXVA 4IEEA 3RAPR 4BPBA 4ASUA 2VA8A 1DTSA 4LYJA 3KFXA 2PZGA 3QKSA 2WV9A 5GJWC 1D9ZA 4ITRC 1HH4A 4PC1A 2CHGA 2QU8A 1KDOA 2VRWA 2GF0A 4DCTA 4PSVA 1R2QA 4NP6A 2DWQA 3JZAA 5J47A 1BIFA 4LV6A 4Z8YA 3EWSA 1UKEA 3ZVRA 1J70A 3KL4A 3BFXA 2P3SA 1X86B 3B1XA 4DUGA 4DCSA 4ZI3A 4N1AA 3GFPA 2XXAB 1U0JA 4LK2A 1ZRHA 4Z8XA 4FMDB 2FDCA 1P75A 3NXSA 4JLKA 1G41A 1WA5A 1Z6TA 5SZIA 4RVCA 4RSGA 4M1KA 1VHLA 1E2LA 1TEXA 1KI6A 2W58A 2IYXA 4ARZB 2HCJB 1V43A 2CDNA 2WJHA 1LVGA 4YMWA 3DM5A 2HXYA 2X2FA 1XEFA 3TK1A 2OLJA 2QUZA 5F2EA 3RC3A 3QSYA 5A4JA 2V55B 1NN0A 1MH1A 3K0AA 5FI1B 3PUVA 3L8ZA 3OIUA 3VNUA 1KOFA 1KJZA 3BFKA 1CR4A 1FOEB 3LLUA 2A5GA 2ZJBA 2BWJA 3DMNA 3CRMA 3VKGA 2V1UA 3S1AA 2A3RA 2C03A 2CNWA 4HUQA 2HLDA 3TAHA 2IYLD 2VL7A 4LCBA 4CT5A 3PCRB 4DSUA 2WMOB 4F38A 3VR2A 2EFGA 2GF9A 4A4DA 2QMUA 1ANKA 3LQQA 4Q1FA 3KJHA 4CF7A 3QXSA 4GMDA 3EIEA 2QP3A 3EZ7A 3JVUA 1P9RA 4GT1A 1E0KA 1T4GA 4YONB 5KU1A 4Q1AA 3THWB 2DBYA 4TYQA 4CZ2A 5TXGA 4LJ9A 3CPEA 2GVDC 2BKUA 4A0GA 1NVVR 3VTKA 2QQEA 3IIJA 1M6NA 1AZSC 1BKDR 3QXHA 1FQKA 3RRMA 1MO3A 3RSOA 4KFTA 3AH8A 2B7BA 5FL3A 1U2RA 3LW7A 4HSEA 4PXAA 2ZU6A 3EW9A 5KUTA 1Q1EA 2J7PD 3DKPA 2WZQA 3A58B 1DS6A 2WSSA 1JI0A 1RKBA 2E87A 2R2AA 4Y0AA 3AVPA 2VSFA 4HB0A 2ZI3A 4UXJA 3WYGA 3FMPB 4QGFA 4IVPA 4D82A 3THYA 3GEEA 1KZ7B 3OE7D 1NBMA 4ZDWA 1VG8A 3NG1A 5HZKA 2GKSA 4W9MC 4UXIA 2D2FA 1JJVA 3CWZA 4JT4A 2R6AA 4P0TA 2OLKA 5F98A 1S9DA 2RGAA 4R71A 3CLVA 1XNJA 4BE7B 2F9MA 2IW3A 2WOOA 3IEVA 2AK3A 2VO1A 1ZJ6A 1N2CE 1Z2CA 2WJVA 3L2OB 121PA 3NBXX 3QVVA 2BOVA 2FFHA 2WM9B 3QOFA 1JAIA 1JNYA 4BFTA 1P61B 3AUYA 2O8EA 1QHIA 4LJ6A 4BLRA 1SXJD 3C8UA 4PC3A 4NDZA 1TX4B 2EWVA 2GWHA 1OXXK 4JBYA 3BGWA 4F93B 4KVAA 1F3OA 3GJ3A 1ZM3A 2B8TA 2QSYA 2QM7A 1YJ5A 2WICA 5G40A 4L8GA 1EX6A 1S2MA 5EUQB 3I8SA 2E1RA 3RC8A 2C78A 3OFND 3QF4B 4BZPA 2R65A 4Q4JB 2R44A 2A5YB 4HZUA 1C4OA 4GSYA 1BOFA 3NBZC 1OIXA 4RCYA 2IYRA 2BEKA 4KVGA 1FX0A 1R5BA 4BEJA 1G6HA 1ESNA 2C98A 4QBIA 4ZCMA 1XMIA 2RGEA 4PPFA 2N1BA 1OXUA 1ZU4A 1R5NA 1R10A 3CNOA 1E79A 4UNQA 2J46A 1KSGA 4QC2A 3WYFA 3VMFA 4W5HA 2XJ9A 2J87A 2HCBA 2OZEA 3MD0A 4BLTA 2BDTA 1YZQA 5IF9A 4MKFA 4GOKA 1Q44A 2GILA 2F43A 3BXZA 2OEPA 4DT1B 3ECCA 1G8YA 3W8RA 1OH6A 2R8RA 2O0JA 1AIPA 5L3SA 1YRAA 1FTSA 1UKZA 1G17A 4F7WA 1II8B 4JLNA 1JEEA 1DAFA 1XJQA 1CLUA 2WHXA 1XPUA 1BS1A 1NIJA 2AKYA 2NZJA 4ZV4A 1Z6XA 4B32A 2ASEA 1Q12A 5JS8A 4K8OA 2IUUA 5JHGB 2PT5A 1XTSA 3LD9A 3T1QA 3LXXA 4URUR 4GPTA 1G1MA 2F1RA 1I4LD 1KI3A 2D74A 1I2MA 4LGMA 1OH7A 2PL3A 3BB3A 3K0FA 5IRCD 4B3FX 4D26A 2AN9A 3U4QB 1RRPA 3MLEA 4FI3C 2IT1A 2GCOB 4ACBA 3BRWD 4MYHA 2D7CA 3I5XA 4PPQA 2V9PA 3R8FA 3B7GA 3I62A 1U9IA 2GXSA 1P6XA 2FU5C 3W6PA 1MABB 4B35A 3RDPA 4MRPA 5L8VA 1K5DA 2MSEB 1CR2A 1N5LA 2XSZD 3KQKA 2Q6TA 4Q21A 2PX3A 5KSOA 3GJ4A 3SFZA 1ZU5A 3DVLA 3T1OA 1EGAA 4CIDA 1SVOA 1ZMXA 2CHVA 1T3HA 1JB1A 2CK3A 3B9PA 3C5CA 2H16A 3HR7A 4US1R 4MKIA 1OFTA 4NMMA 2P5TB 3U44A 3RS5A 1E2FA 5JFGA 1DARA 1NNEA 1HQYE 2AWOA 4C0SA 4CEIB 2F1HA 5BYJA 4F4IA 2VIIA 4QHTA 4YDHB 1MRNA 2OCBA 1JPJA 1Z6AA 2C8VA 2F9LA 4OQMA 4BQSA 3DDCA 5EXPA 1DELA 3WBKA 5CK5A 4YMSA 2NPIA 4HAYA 5C4MA 1NIPA 3T61A 2ZRDA 4A36A 2P5SA 1E96A 4DEXA 2VPPA 1DAGA 4KSBA 1OF1A 2WWYA 1W2GA 2C77A 2REBA 1KMHA 1U0LA 1HUQA 2YWFA 5SZKB 2ZXUA 3QY0A 4II7A 1W44A 2ZYTX 4LYAA 4RD6A 2LKCA 2C5LA 2W0MA 5FTMA 5HPYB 3CX8A 4ZCLA 2KJQA 2FG5A 4FW9A 3SYKA 4YXWD 2YYZA 2O8CA 2B21A 2VYFA 1HT2E 3WXMA 1E2QA 1M1YE 1YR8A 3PV0A 2WJIA 1E2JA 2GBLA 3BC1A 4GRAA 2ZJAA 2VHCA 2XTZA 4A1FA 4DEYA 4JZKA 1KK2A 4EUNA 3VR6A 5IT5A 4XJXA 1JEDA 2X1VA 4M8NE 3PENA 1TL7C 3GFTA 2C04A 2GBLC 4DCVA 2HF8A 2OE2A 1XXHE 3H1TA 3OIYA 4KFRA 2QAGA 3RRZA 5FPKA 3KJGA 1XCPA 2G88A 3SQXA 3UWKA 2OT3B 4Q5IA 5FFMA 1XU4A 3TLXA 3M0EA 3F5FA 4C0BA 2LCFA 3A1UA 3CBQA 4C0KA 1Q20A 2WAXA 4CEJA 3ZVMA 4Q9LA 4L4UA 3EA0A 3I73A 1YRBA 4CT4B 1E1RD 4PFSA 3Q7PA 2QMHA 1COWA 5J4KA 1W49A 1T0JB 4B71A 1ESMA 4Q4HA 3QKRB 1CULC 3NWJA 1PUJA 2Y8EA 2XZPA 3LDAA 4PSKA 3AVYA 2GEVA 2ZRCA 4B3GA 2VP6A 2PZEA 2RHDA 3EAQA 2R6GA 4OHVA 1IXZA 1XX6A 2Q3HA 1US8B 4N0EA 1LTQA 3CRRA 3TR0A 1XTIA 2ZI5A 1TU4A 2GEUA 2W83A 1OYWA 4BFUA 2WWHA 2QSZA 1AGPA 2AL7A 4KFUA 4PAOA 3A1TA 4EJSB 5GADl 1C1YA 2FJUA 1NMXA 3PJRA 2F1IA 2J0VA 2QPAA 4DB2A 1E2NA 3NDBB 4PHHA 4V0LA 4RCZA 1PVOA 2GDJA 1EFCA 3U7FB 3IBGA 3L0IB 1FW6A 1P72A 3RWMB 4F4JA 4JIMA 3UIEA 5E7JA 1KGDA 1E2DA 1M34E 3SDZA 4DHEA 2D06A 1E0JA 5IHPA 3E1SA 3OEHD 1OKKD 2G0TA 4LDJA 3U60B 4HUTA 1I2DA 2ZE8A 3RWOA 4Z1MD 1VDZA 1WDTA 4HAXA 2CVFA 2GZHA 1E4YA 5JBQA 3BS4A 2QZ4A 4IOJA 1E3MA 2ECKA 1E2EA 3CR7A 4NCNA 4PPGA 1AQUA 1SVWA 1XD8A 2W6JD 3QBTA 4TQAA 5BN4A 4PPNA 1G8FA 5JSZB 1GIAA 4OL0A 4YC7A 4MRSA 3VR3A 4FD2A 3SNHA 1W0KD 1AQYA 2AD1A 2GCNA 3WMFA 1KIMA 4QKQA 1JALA 1E9CA 3AF3A 2VH5R 1AGRA 3C5HA 2HJGA 3BOSA 1QHYA 1XJ0A 4MGKR 1SZPA 4EPRA 1NY5A 1QHHB 4XSGA 4QJ3A 3TBKA 4LBZA 2ZUBA 3AVQA 1N5IA 5L3RA 2I1QA 1GRQA 1G16A 1KNXA 1NKTA 2QT0A 3WP0A 1FUUA 1SKYB 3GMTA 4DCNA 2OBMA 5B58C 2AXPA 1D8TA 3KKQA 2NO9A 3QE0A 4P4SB 5CJPA 2AWNA 4LJ8A 3ND8A 2W6ID 3PQCA 4RZ2A 3AM1A 4Q4AA 3FKSD 3N5CA 4BZXA 2DWOA 1R4AA 1B23P 3WHLA 2KWIA 1Z0AA 1SVKA 2ORVA 3EXAA 3FFAA 3OIVA 3IIMA 4WXRA 2IWHA 4B47A 1IJFA 4DKXA 1OSNA 2QG6A 3D3QA 3EC1A 1WF3A 4HEJA 2FFQA 1RJ9A 5JHHB 1IXRC 1F2TB 4KI0A 4R98A 1KK1A 1E99A 3LQRA 3O8CA 2OUKA 4AK9A 3SFVA 2QNRA 2NPFA 4YLGA 4IDNA 3L0OA 4HLDA 2P0EA 4I1UA 1SXJE 1IXSB 4B44A 3P4XA 1Z6GA 5EXTA 3D7MA 4Q19A 2OHFA 3T35A 2ZPTX 1UAAA 4ZO4A 2J7PA 1KO5A 3QEOA 4R9UC 4JVLA 3IQXA 3W3AA 4MRVA 4FMDF 4A8JB 4D25A 3SHFA 4B2PA 3DZ8A 4I1SA 4DCUA 3V00A 4AG6A 3ZLJA 3OE7A 1IN4A 2XNDD 2X77A 1FPMA 1E69A 2AX4A 1AA9A 1SVIA 3B60A 3T34A 5C1BA 2QMOA 2GEDA 1B0UA 5HKKD 5EE5B 5H1YA 1KZGB 3AUXA 2FZ4A 1Z0KA 2FPKA 4RD4A 2F55A 2QBYB 5FUWA 2WTUA 2YC2C 1AM4D 4BLOA 3CH4B 2JLSA 1W46A 2ZR0A 3DOEA 4B6FA 3MSXA 2VLIA 4LI0A 2H17A 2GAOA 1KAGA 221PA 4NTZA 2J7KA 1W5TA 2DFTA 5AJZA 1SXJA 5F9FA 4KJZA 3R7WB 2JDID 1KO8A 3PEYA 5CM9C 3AVUA 4Q7KA 1KNQA 2JLRA 2ATVA 2ZE5A 2WIAA 1Q3TA 4NZYA 4TQUS 3SJCA 3KB1A 4A0RA 2JATA 5AUPB 1HE8B 1PV4A 1ZM7A 1A5TA 1KDRA 1TMKA 2EU8A 4LX0A 3BORA 1VG0B 3BJIC 3OAAD 1PUIA 1P9WA 3OFNA 2RGXA 1S96A 4PC2A 2VP5A 5AJWA 1XD9A 4HATA 3QI2A 4EPVA 4TSFD 1EFRD 4RJLA 2V3CC 1AN0A 1N6NA 2X8AA 5JWOA 1WMSA 5E3HA 2ZI6A 1UBFA 4GZMA 4JKIA 4Q7JB 1Z28A 4ZCIA 3DEFA 2YHSA 3L82B 2BKEA 2YWHA 1TF2A 2XXAA 2UZIR 4OJQA 3RS4A 3RS2A 1XBTA 4QRHA 3SI7A 2JLYA 3K1JA 2OBLA 1NVUQ 1OE0A 4JT2A 4DSTA 4NYJQ 3ZVLA 1CP2A 3IHLA 1AKYA 3SU8A 4TYYA 4LV5B 1P4SA 2ZVQX 4LC0A 5L3QB 4M1SA 1EK0A 3HU3A 4ARZA 2CCJA 4NKRA 4AKHA 5JZVA 1U8AA 4FWIB 1SKQA 4RD1A 3TQFA 4EKDA 2W0SA 1E2IA 3B78A 1NJFA 2FPMA 2PEZA 4QL3A 4RD2A 3KQHA 5J4YA 2D4HA 1VPLA 1KI2A 2AK2A 3M6AA 4B73A 4TMWA 4DVGA 4A0FA 4E07A 1W0JD 1A82A 4XWOA 3K0CA 2AHOA 2FGKA 3WRXC 1KKMA 3TIFA 1GAJA 4I1VA 5JS7A 2QRZA 3Q72A 1NN5A 1GL7A 2CE2X 2R62A 1E9EA 3GJ6A 1YR9A 2FA9A 2VP9A 4XWKA 1U0HC 3NTUA 1LY1A 2ANBA 4TLAA 4DLVA 3SBEA 4NCIA 4KFSA 2ZR9A 2ZAOA 1QVRA 1VIAA 3HDTA 1OIVA 4PSAA 5JCZA 2BC9A 3GEHA 5K8IA 2FNAA 1VKJA 4NONA 5JLJA 4MGYR 1OW3B 1CU1A 3I32A 5J5CA 2XSZA 3THOA 2JJ2A 3TUIC 4ABYA 3GLIB 4GOXA 4LPKA 2N46A 3IILA 5J40A 3THWA 1E2MA 3TUZC 3EWAA 2WWGA 4PQFA 1NVXQ 4EIWA 1NLFA 1IQPA 5FBQB 3LRPA 2QORA 1XWIA 2BHRA 1GKUB 2V7QA 3R9WA 4Q1DA 3TSWA 4YMVA 2EVWX 4KV9A 1Z5ZA 1ZNZA 4KHZA 3E2IA 2GZDA 2R6CA 4JL6A 4NYIQ 1F5NA 5FTNA 1YVDA 1ZUHA 2DWPA 4B3BA 1MOZA 2ZTSA 1IHUA 5GJBA 1X8LA 2JIZD 5KPDA 1NSFA 4KCGA 4OK6A 2QE7D 4JS0A 3TW8B 1GZSA 3CPJB 2CHQA 3QXCA 2IS6A 2G3YA 4HAVA 1UKYA 4PHTA 1WE2A 4YXWA 1SHZA 3AVXA 1EFTA 1U81A 3PUZA 4URXR 2BBTA 4MDEA 1T6NA 4US2R 521PA 3PEVA 2ONKA 2ZVPX 1NN3A 3KUCA 3PITA 5KPJA 3EC2A 2BM0A 3ONWA 1G3MA 1OPXA 3A4NA 3AF4A 3W5IA 5JMTA 1OH8A 1T3SA 2OAQ1 4C0QC 2OILA 2Z0MA 1AS0A 1IY2A 1IN8A 1E2GA 4HAUA 5DN6D 2XZLA 4M9SA 2CLDX 3D8BA 4AD8A 3L8YA 2A5JA 2CCKA 3B1ZA 3AKEA 4IJMA 3QF4A 2XTMA 2D62A 3MAAC 1XTQA 4Q4JA 3CPHA 1GKYA 1VCOA 3JVVA 3ETLA 5TVKA 4DDVA 4B3DA 1EX7A 1FTNA 4OQNA 3UPUA 1ZC3A 4U7DA 4BWYA 1TU3A 1X1SA 4HLUA 4DDTA 2DYKA 4G5SA 4FMBB 2UKDA 1TUIA 1ZCBA 1XZQA 1KAOA 3H4MA 3X2SA 2QTVB 3NDPA 2DY1A 2D3WA 1JPNA 4PR0A 4WZAE 1K6MA 4TL8A 2GAAA 5DIFA 1M7BA 1N25A 1YZTA 1CS4C 4MH0R 2ZROA 2QAJA 5P21A 4B43A 1MR3F 2ZI4A 4QJ5A 1IONA 1S9HA 3CM0A 2BCGY 3KQLA 2IYVA 5B30A 5EE1A 4MGZR 1II8A 1KJWA 1XTRA 1GITA 1X8JA 2ZSDA 1S3GA 3CWQA 4DSNA 1KMQA 3B85A 1MO5A 5A0FA 2BM1A 2VEDA 2ZRHA 3CZPA 1UBCA 3GJ8A 4XSHA 3RRYA 4BLSA 2VP2A 2WKPA 2GXUA 3GLFB 3QKTA 2FSHA 1OKKA 3OEHA 5JWHA 1II0A 4FMCF 2CBZA 3M4YA 1NMYA 4PC6A 5IK2A 4Z1MA 1CJMA 5KO2A 2A7QA 4DDUA 3WBJA 5G53C 2FFAA 3L43A 3BH0A 3U4QA 5EE9A 2W6JA
chains in the Genus database with same CATH superfamily
1KR2A 1SK8A 2X22A 1GZ3A 1VI6A 4OMDA 2F3UA 3E9NA 1NYLA 3EVAA 4IGKA 4JAVC 5KCMA 3P9KA 5LLDA 5TGTA 1L5LA 4Q37A 4YT8A 1X7YA 1WOMA 1R66A 5LQJA 1X8XA 1TVMA 1N2EA 2F1JA 3INTA 3K0KA 1YZLA 3DBVO 5TJHA 3ZY3A 2C4NA 1M83A 4WAUA 3JYHA 2VHJA 1L7PA 3QVUA 1RXCA 3DO5A 4TS3A 5CVCA 4JJEA 4Y2SA 5CBPA 1SXQA 5HZMA 1POWA 2ZAIA 1MB0A 1CSEE 1U5AA 1I01A 3H05A 1PHRA 5LLTA 2EFYA 1NW6A 2XCSB 2NU7A 4XZ3A 2A0KA 4FT2A 4C43A 5LPNA 3CLRD 2VDNB 3W7BA 1KP3A 3H9EO 3H99A 4MYTA 3VOBA 4ZIRB 1Y6QA 3EPHA 3E9CA 1GYPA 2V45A 3KPVA 4RPCA 5GGXA 3JARB 3G2OA 4Q7EA 1EFUA 3WY9A 3ZXUB 3TS1A 3WISA 4UMFA 1PQ4A 4G86A 2BFDB 1J5PA 2K5UA 3IJPA 4OJYA 2W71A 1G7TA 3OM1A 3U9SA 4N9QA 1KHTA 4HUJA 4YP6A 4I9NA 2GNOA 3I1JA 3N8GA 4FYVA 1HMYA 4CM1A 1VGVA 4JSYA 3A1SA 3ZDXB 4OFXA 4AZ0B 5B1YA 4S1TA 4CL3A 1MV5A 2J3DA 3LUHA 4RZHA 3I76A 1QOPB 3B48A 4UTXA 4BLPA 3A3OA 5H0IA 4UQOA 3M1IA 2G0NA 2ZYHA 3QE9Y 1TKAA 1C4KA 1K8ZB 3MJHA 3PDUA 3SKVA 4AS2A 1P2TA 2GJAA 3EXEA 4BNFA 4RX1A 2VT7A 5DX0A 3NC1C 4F3RA 4RJTA 2DULA 1DXQA 4WW0A 2VP3A 3D1LA 4CKCB 3DE3X 1O03A 2AQHA 2Z56A 3EYWA 3NM4A 4FI3F 4LHYA 5K0GA 1TADA 3PSHA 2L42A 4Z3DA 4CF6A 1EK1A 2N9UA 5F2OA 2FV8A 4TWRA 3SBDA 1EFPA 4YRQA 3UUEA 3E4DA 4LKOA 1UMKA 1WHSA 3IGFA 4G5OA 4YRDA 2V7GA 4C5CA 1YDFA 2Q07A 4YRSA 3RWBA 4J16A 4QLBA 1IB0A 3I2GA 5KQLA 2J5KA 3BZBA 4EMSA 1AKVA 4UTNA 2WRZA 1GRNA 1UBGA 2C82A 2O2DA 1Z38A 3FYHA 3CUYA 1EM6A 4C4TA 1SY7A 1SBYA 3CLTD 3NANA 4QO8A 3UJ6A 3W8NA 4EHNA 3HHEA 4XFJA 3BZUA 5AKJA 3WL8A 2XADA 2WU1A 3DT9A 3JQ9C 1HFEL 2DHDA 3S81A 4AYWA 2PQ0A 1S8FA 2GBGA 3FSEA 1KPHA 1PZGA 2ZSAA 3EMDA 1GILA 3QVOA 4H35A 5IUKC 3ADBA 1RQ7A 2CXHA 2PRJA 5DK4A 4R7GA 2NM0A 3BD6A 3V46A 3UKOA 4E21A 1K08A 3QKRA 4MZDA 2YY7A 5I7UA 3FZGA 3UMGA 3R5FA 1YTUA 3QTTA 3HY4A 1QWOA 1PFQA 4C5BA 1HURA 4GLJA 3LECA 5ED0A 1FJGB 1L9KA 2OSBA 2HDNB 3I53A 4JJAA 3IPCA 1SN7A 4CQMA 1N8SA 4MEAA 5MF6A 1M1NA 1FU8A 3U3OA 1FVFA 4WESA 1ZS9A 4A7PA 4C4ZA 4XGRA 4J49A 4TLBA 3VZSA 4PBSA 5KDDA 5GVRA 3G85A 4H27A 3S0JA 3VI3B 4EJSA 1JG6A 4L28A 3A0RB 1H2WA 1X8KA 1Z08A 3KOWA 2IW1A 4LJRA 3QG5A 1G5QA 2FG6C 3GBSA 2GASA 3WLQA 2OHXA 5HMLA 1YS7A 3ZY6A 1N77A 4EHJA 1P1KA 1NURA 2HK7A 3TKYA 3H9JA 5LJLA 3OO1A 4BAGA 2X5KO 4CHGA 3Q11A 4BCDA 4UC0A 1OBCA 3ZK9A 2JB9A 1S7GA 4X91A 1N8NA 1FF9A 2PWPA 3QPUA 4JIGA 1N4AA 1QLWA 4XE5A 1A5SB 1FUYB 4HZGA 1T0BA 2JGFA 2WIGA 1CZUA 4P98A 3GARA 1GDDA 1E62A 2A1TS 4RCVA 3UJHA 1X1BA 1EBBA 2ACVA 2IP2A 3DHEA 2O05A 4OSEA 2VJKA 1K7YA 4UMEA 2RJOA 2PPLA 4LVUA 5ALUA 3ROZA 3EFEA 2NU8B 1FFYA 5LYYA 4R68A 3KO8A 3H7IA 3THYB 3N8HA 3GFQA 4ZCTA 2Q5FA 1KVSA 1C1DB 2P68A 5EUMA 3S40A 4ZP1A 4ECAA 4TRRA 1QVAA 1DOZA 2FSPA 5BT9A 2H3EA 5DFAA 3LY8A 3VVCA 1N9GB 1E5DA 1UIRA 2JJ1D 2P9EA 4FOLA 5KOHB 4MWZA 4BRZA 3TSOA 3G9UA 5M5BA 2CV2A 5U1PA 5DNYB 4OHBA 3LI2A 2JGAA 1PR4A 4UQLA 3C1TA 4LWPA 3UCXA 5I4IA 2ZSIA 3GIWA 1ZH8A 2OGTA 2XD4A 1JHQA 1OFUX 1NJ6A 3R0XA 4KWTA 1L8QA 5CIWA 3HCDA 1P3DA 1G98A 4JJIA 4MVJA 3WQSB 4MS1A 1UBJS 2OAP1 5ESRA 2FEXA 1UDWA 5T3YA 5F5LA 4NV0A 4DIDA 3I01M 4XTCS 1O58A 2VT3A 4FMCB 1EVKA 4M54A 3MT0A 4TKUA 1M9NA 1NR5A 1BU5A 2NX2A 4QDOA 1QHFA 3PUIA 1Z7YA 1R9NA 4IJVA 5C8DA 1M7HA 3GVIA 4NPAA 2FRVA 2XCQA 2Y1EA 1ODJA 3DWIA 4QTYA 1W19A 3HP7A 3BGIA 2X0IA 3KK0A 3RADC 3W04A 3PJGA 4M0CA 4TZKA 4EG5A 4NSNA 4IIEA 3AEQA 2GVNA 3D9QX 3WV4A 4NHOA 4UE2A 1P9LA 4JDUA 2JCSA 3BBLA 4KYIB 4CWAA 2QAGC 1K7XB 3AETB 2HF7A 3NKVA 2B6NA 3T15A 1WCIA 4QATA 1A8PA 1CRQA 4NJEA 1U31A 4P34A 3WYAA 4YMTA 4M22A 3UT0A 4U1RA 1CZRA 3DG9A 4DJDC 4DLWA 2FSIA 4CF4A 4A8JA 3GB9A 1H23A 5ECYA 1DIHA 1DO8A 1O9HA 3TR6A 4POAA 1KKUA 2DJIA 4B3MB 1RXSA 2Y1DA 4OYYA 1EDEA 4FYYA 2XB4A 3Q87B 2D8AA 1VBFA 2Q21A 4Y2YA 4XYLA 3ITNA 5COBA 5I5GA 4R81A 1UQTA 3D0RA 2HZBA 4K9NA 2BBSA 1LDEA 2JIZA 4KXUA 3D3WB 1TIPA 2Q49A 4TLEA 2QE7A 1Q0QA 3JQPA 1UXGA 4OHWA 3U7RA 2R48A 1DG3A 2GPYA 4BGUA 1GSOA 1U7TA 2EC5A 3O4HA 3P9PA 3U7EB 2JGKA 4LQDA 1P1BA 2WWRA 3MGAA 1WVIA 4L4YA 3DDOA 1CT9A 2Q5LA 4FDLA 5CDFE 3S99A 1SUDA 3S2YA 3O0DA 1RCUA 3KKPA 1KE2A 4FYXA 3X1JA 2FKAA 3FHOA 3FWPA 4FU0A 2ZSEA 1NL3A 3DPSA 2IXGA 1JIKA 3EULA 3NH9A 7GPBA 4PX5A 3G0CA 3AVTA 4HMPA 1YRQA 2JK0A 5FAKA 4DRXA 1MCZA 1D04A 2G25A 3DXXA 4DB4A 4GZ5A 1TM7E 1RDFA 1Z82A 3R7WA 1NYQA 3GPLA 3MLBA 3P45A 1MQ9A 3GVCA 2PXHA 3AVWA 1EBUA 1UMCB 1ZM2A 4MI6A 4DGSA 3V9PA 1QPZA 1EE2A 4LGYA 1MB3A 1ZVJA 2HNKA 3K0FB 2P6RA 1K3UB 2OV3A 4I4LA 4S2UA 5CVEA 3HB4X 1LTHR 1UJ5A 1Z88A 5DTMA 1PL7A 4B46A 2Y99A 3X0DA 4KR0A 4C7VA 4QRDA 4UM9D 1ZZEA 3IA2A 3C5VA 4L72A 5CM8B 3IPLA 2R97A 1L4UA 1OAOC 4CG3A 3AR9A 1S2NA 4LGVA 1V8PA 3GEDA 4LZZA 1YMVA 2XODA 3JYQA 4ILKA 4HDNA 2REOA 3M5WA 1GWNA 1HTBA 3EMKA 4GI7A 2XY4A 4QYIA 4JROA 4W82A 2VDQB 1N32B 2J6HA 3PNBA 4RVOA 2HLPA 4K0RA 1NBWB 1J90A 1KDYA 3PP8A 4UXHA 2IYZA 1UBRS 3PNMA 5CFZA 3PHIA 5EUCA 3KYIB 4JQSA 2HK9A 4G4GA 2Q9CA 3JR7A 1U1CA 3BERA 3KWLA 5BWCA 1E4OA 3L5OA 3LPAA 1ZRMA 1SVMA 2QPTA 1P7ZA 4QNMA 3W2TA 1N6PA 1NXSA 2Z4RA 3RJMA 3F46A 2YIVX 821PA 1M2NA 3RSZA 3EXIB 5HP4A 4KXWA 1D5CA 5FX2A 2HA4A 1XA3A 3Q5GA 2EFEB 4TYMA 2WQ7A 2JLQA 4G0ZA 4ND2A 2YL2A 4FR0A 4ML3A 4UUQA 2A9FA 1XMSA 5EJAA 3L8CA 1XLTC 1RJFA 2H9AA 3JRWA 3OC0A 3DBLB 2BGLA 5DSTA 3ZH9B 1S8OA 1U2ZA 2C4HA 2NUPA 4D0NA 2O52A 3DT8A 4BC1A 4RIEA 1KBZA 2ODBA 3HZZA 3ZIAD 4D4LA 3OJ0A 3QLUA 2FPGB 1G3QA 4KFCA 1O6GA 3U3JA 5B1SA 4M8SA 4DLRA 4IAOA 4A15A 3E5HA 2XGOA 4OXXA 3RFUA 3CN9A 3FPCA 4KO1S 4J0EA 3NONA 3RGWS 3QU7A 1LA2A 1NJ2A 3N58A 2PO7A 1CCWA 5EQFA 1P7CA 3AW8A 4MV0A 3ZNOA 2O8CB 1MJNA 2A33A 1NF8A 2QVCA 1J22A 3VH2A 4M4SA 1C3OA 4QGBA 3IQEA 1HLFA 3VX4A 4ER0A 4IUCS 1KJYA 3HCRA 4M9RA 2HDOA 3DYIA 1BVHA 3OZDA 4KB5A 4RENA 2W90A 4FCTA 4X95A 2LCIA 2CHUA 3ZHCA 3ZJYA 3WWZA 1ADFA 3OZAA 4K8RB 1RYBA 4MYUA 2O4CA 4YR9A 4GVLA 4XR9A 5FBHA 2JCGA 1EXVA 2C59A 4HT3B 1BNCA 5SYAA 2WOJA 1K8RA 3ZWQA 4UAGA 2CLCX 1NXXA 2VYQA 1ZXLA 1RPJA 2FDRA 4LY9A 4MVJH 3V7YA 4CV1A 2AC4A 4PVCA 4F4FA 1AQJA 2VQSA 3ILHA 2X6TA 4Z9AA 1NFRA 3I5AA 1SBCA 4E7PA 3K9FC 2B82A 2NXWA 1A71A 4HH0A 4WOBA 4FC7A 2GZRA 1CG6A 1WUHS 2O48X 3MTIA 4QX6A 4AS3A 1EUCB 1RADA 2ISSD 4V2UA 4EITA 3SHTA 3D2BA 4FKMA 4R1LA 3VR6H 4IXMA 5JC8A 2PLRA 1QH1B 3ZTTA 1DEAA 1K4MA 1XF9A 3STHA 3H4TA 3F8SA 1H6CA 4HGPA 3CZ5A 3GL9A 4FEAA 2YNMD 1OZFA 1SIWA 2EG5A 1P3Y1 2IPXA 3T7CA 3BFVA 4WZBB 5G4KB 3RNLA 1FA9A 4W7IA 3REOA 2JLXA 2B0CA 3P2KA 1AF7A 4LZWA 2GPSA 4OREX 1ZGJA 1QH9A 4Y2XA 1EGQA 2R7NA 4RD0A 3FX2A 3IE1A 1SXJC 2JIMA 2WVGA 3L8EA 1WCYA 3LT2A 2VRBA 4LZLA 3EGWA 1SPXA 2RB4A 3AHGA 3TVDA 1DO2A 4H18A 3AKDA 4DQXA 2GESA 1PZHA 4PZZA 3M3DA 1X6VA 4FHZA 5D3MB 2PSDA 5SZJA 1QHSA 3C0KA 1JQ5A 1UQRA 1GAEO 4EI9A 3ZU6A 2VCHA 5EP3A 3QEJA 4ENSA 2WIBA 1QAOA 1K3FA 4Y7DA 4NPHA 4ITVA 3AI2A 5FOUA 1F60A 2BTEA 2PCJA 2BMJA 4D0RA 2R86A 5KTOA 4UU0A 5T57A 1H0HA 1EFLA 1G5RA 1GQQA 1T8UA 1M2JA 2B8WA 2J33A 1GN8A 3VO8A 4WBNF 4TN1A 5FH9A 1CUDA 4NY1A 2CXNA 3O1LA 2OPHA 1QK4A 4EYSA 4XI9A 1NDUA 1E4EB 4TWZA 5ELLA 5CA0B 3T7EA 2FWAA 2YZKA 3UMRA 4DC0A 5JUWA 1YE8A 4O4HF 1OZGA 4WA7A 4CI0B 3RRFA 3BIFA 3EQ6A 5ADVA 5A5FA 3PXGA 3T4UA 3AX6A 2Q3MA 4MJ3A 3PRYA 1WTCA 2P65A 1RWQA 3W5SA 4DYHA 3CUEF 4TYWA 3BMQB 2FYTA 1MRSA 1D1QA 1LDBA 4I55F 5KYUA 2XUZA 5HMMA 4KUHA 2Z4SA 1D3AA 3E9QA 1C0KA 3V55A 3RRXA 1DE0A 1X14A 5CDUA 1GNTA 2YN2A 4N3NA 3I1FA 1LB1B 2QTHA 4ND6A 1AU9A 1JFRA 5LB2A 2FR8A 3BSSA 2IHVA 3OOHA 3COPA 2EX0A 2QN6A 1JUDA 4ZALA 2RHCA 4R1OA 1DKNA 4C2UA 1HR0B 3QI7A 2O2HA 1ZD5A 2FW7A 3UMJA 5FV4A 1YB4A 2ZITA 1K63A 3ONDA 4NDAA 4M1MA 1KTVA 3TPZA 5G3YA 3IT0A 1H2FA 5HJ2A 2LXNA 3EAGA 3OWHA 3K0CC 5J9FA 3HSYA 2YRXA 2TMGA 3LO8A 3R77A 3ZQ6A 1GG5A 3BE4A 5BR7A 2ZXFA 1VG9B 2ZDHA 4BRUA 4QOJA 2BMEA 3L93A 5FUBA 5ABPA 3M5CA 3MTBA 3O8OA 4JUCA 4ZO6A 3ZHYA 5CDHA 3UV3A 1WB9A 1SVUA 4K6FA 1QOZA 4J1TA 3FVQA 4DJTA 4JYBA 1WZEA 3NCHA 2P4HX 3OKPA 5KX5F 2ZM6B 5IAGA 1E5LA 3K9BA 1ZITA 3NM6B 1KI9A 2IZ6A 3H2GA 1WW2A 5DHFA 4DS3A 3K1AB 3TLZA 4OB6A 3WQBA 4CIBA 3AKYA 3BGSA 1ONBA 4V0KA 3S28A 4AZ3A 2GS9A 4PNHA 1RAHA 3AG5A 4NEQA 4X66B 1N3BA 1C7IA 1MC5A 2IEBA 3FHCB 3PWKA 4I81A 4MB0A 3K6RA 3CH6A 1YMUA 3JVDA 4DOMA 5CEFA 3QVGB 4QXAA 2GD2A 4JJKA 4K6GA 1WLSA 3CZ4A 1FFEA 3GDHA 4U2FA 3MJSA 1I2AA 2ZB8A 1ULHA 1DDIA 2C5EA 1XTPA 3DE4X 5E7QA 3L7OA 1FLAA 1QG2A 1U7HA 3UH0A 3PEWA 5BSWA 1G291 2DTXA 4KC0A 3S5JA 4OQDA 1G8MA 3KQSA 4NCJA 3VU1A 4IDHA 1YK1A 1HI9A 3MG9A 3ND7A 2O8DA 3N8IA 4I8IA 3EQ2A 1AHHA 4O4JF 4GYJA 5E6RA 3WSTA 4LHEA 1UXHA 3O95A 2JJ1A 2X9VA 1RZRD 4KE7A 2I66A 3LX6A 1F1BA 3THSA 1MC8A 2KSQA 4G07A 3W6OA 1TLLA 2FETA 3AV3A 1ICIA 1CF9A 4OXNA 3NHJA 4XWAA 1KJQA 1JE1A 1U2DA 1EX9A 1Y33E 5KAMA 4JLVA 1UC5B 2JGDB 4YHBA 5GV7A 1W9MA 3HCCA 1ZBDA 1SHTX 1SKBA 3KXIA 4DPMA 3RSSA 5B64A 4E6EA 1KYIA 1AMNA 4EFKA 4IGAA 1KWKA 3EODA 3C2QA 3ICCA 3AEZA 3GJ5A 5A6VA 3JWIA 1KSFX 2HQSA 5TPWB 1RAGA 1CZLA 1HFWA 2PPVA 1U0EA 2HCFA 3TSZA 3USZA 2O7SA 3DLTA 1EK2A 4MS3A 4HFNA 3EEYA 3PI7A 5CA1F 5CFNA 4NBTA 5T4FA 4A2QA 1I36A 1UDAA 2C1XA 4NMXB 3TZ6A 1OX4B 3V8MA 1XQVA 4R40A 1T25A 2NNLD 4R1NA 3IQDB 1W52X 1WBJB 4QEKA 4R2JA 3WYDA 1MUUA 1UOPA 4O2LA 2VDVE 1JR3E 2A6PA 6Q21A 4V03A 2GK7A 1XGKA 1OU4A 5TF0A 2WI8A 5BMOA 1MO6A 2PH1A 2PX6A 1QH8B 3BYZA 1K2WA 2GZSA 3IAUA 1HM5A 5DT2A 7YASA 5FTLA 3DOCA 1H1TA 2H7YA 5TGDA 1P8JA 4O63O 4DCPA 1U1GA 4K6KA 3IC5A 1E18A 4TL6A 4BNZA 2XA1A 3ZQJA 3SJAA 4UM8B 2DR3A 2MSKA 4IM7A 1X0VA 3B1VA 3RHZA 1EZZA 2FPLA 1N5KA 1VMDA 1WPQA 2R7LA 4I5EA 4B8WA 4KE8A 4CFSA 1IEQA 3T1TA 5KHAA 4KVZA 3K8QA 2OZLA 2EWMA 1RCFA 3MSCA 1L5GB 4DT1A 5C35A 3MWEB 2DG2A 4AMZA 1AZWA 1EA7A 2DM6A 2B37A 3GRKA 1GPYA 3IERA 3N2EA 4MCAA 3KT8A 4BGEA 2CB0A 1I9GA 2BCJQ 1LBQA 5G4LA 1FRVA 3EGDA 4HADA 1OREA 3NV9A 4BIIA 2C9DA 3ENWA 3IT3A 1QIKA 3UHAA 3P9YA 3FM9A 3AF1A 1UPUA 1QZUA 2WAMA 4LNUA 1KJIA 4FFLA 2WWVD 2R11A 1EXMA 2FK7A 4G4JA 4E32A 1W4AA 4RKRA 2NV2B 4WBNB 4AL4A 3BXHA 4XIGS 1M2OA 4QOFA 2YFQA 1A1VA 4WD3A 3U1VA 2VHEA 4TWAA 1JSLA 1YJQA 1AZTA 3OUTA 3Q88A 4O4HB 1V39A 3KVNA 3RS9A 4BX9A 2X7JA 3WI7A 1RLOA 3ANTA 4ZMRA 1NZFA 3VU9B 4G0UA 5LOVF 4OQLA 5A05A 3EEOA 1FIUA 2JPDA 3QF7A 3OQHA 1EFVB 1X92A 2VQ3A 2XB9A 4L4ZA 4I55B 3NFYA 4B3RB 1ZM4A 2AVDA 1IFXA 2OCPA 4K6CA 1N36B 4NATA 3JSXA 1UJNA 5GJCA 5CGZA 4O2AA 1QM5A 3TQQA 3ETCA 3GAMA 4DJEC 2AFHB 1CR1A 4PWYA 3A2NA 4UCFA 5JAPA 1KYZA 3CH5A 3PD1A 4UNSA 3MZ0A 4Z7NB 4UW9A 1PEKE 5DHAA 5KVVA 4ODIA 1VA4A 1XEWY 5BWNA 4HN9A 5AI5A 3PDWA 1JT9A 3ET4A 4O5OA 4L0CA 3CW2A 4BQRA 4FDUA 3UAWA 3KZNA 3U4HA 4B75A 4CM4B 3KZOA 2QDXA 4ZZ2A 5DYGA 3AY3A 5ELXA 2FF5A 3AUSA 3FMGA 4OHUA 2RHGB 4CTKA 1W87A 1XD2A 2V6IA 4MIYA 3VC1A 4D5EA 4TZ0A 3NFRA 1TVKB 1X7XB 2AF4C 3D0KA 1B6RA 4ZU6X 1Q7BA 1JFVA 1M73E 4N41A 2DP4E 4RLSA 4NCBA 5U4XA 5FOTA 3ZIAA 5IEBA 1Y3IA 3BBPA 1R0CA 5KX5B 5G0TA 3KAQA 4G0OA 4QZVA 2E37A 2M1XA 1OPRA 3QKSB 1G8SA 1JIXA 4X63A 5BPHA 2ZS8A 1UODA 1JJBA 3M4XA 2B99A 3QG1A 4HNAA 1FUKA 5I8ZA 1I3LA 4PONA 4FIDA 1P1IA 3Q3JB 2COKA 4OP3A 3OBIA 3RS3A 1BD3A 1D9XA 2C3UA 3I05A 4YCBA 3BAFA 5HGJA 3T5DA 2QPOA 2V7EA 1WTAA 4FFOA 5KYTA 1WRBA 2E4XA 1QLHA 1IHPA 3KXLA 2RK4A 1MX9A 2C58A 2XF8A 5FYQA 1DX4A 4HVCA 4H1WA 4JOQA 1ZSVA 5TMPA 4YUXA 5LDDC 1DEHA 1MO4A 3AW9A 3C8DA 4I50B 4PSUA 3B8HA 1IBLB 4TQGA 1T0HB 1VXRA 4RJJA 2Z2KA 1VECA 3A3KA 3MUOA 2BEUB 3E3LA 4L16A 5KVQA 4BATA 1X13A 3HLKA 5JASA 2H2GA 4NF2A 4NENB 2R4UA 3P26A 2IXEA 4O4JB 1SUBA 1TTQB 1XEXA 5HCUA 2J4DA 3V7FA 2H7XA 1R0BA 1XHEA 2FUNB 4J16C 4B09A 3QZUA 4HY3A 5IG2A 1LXCA 3IO5A 2R9VA 4K2AA 3F4KA 4EPYA 1A2KC 4LHZA 1M8KA 1FE8A 1CE8B 1TPYA 2YNMA 4X1KB 5GV8A 4EGFA 5A5DA 1PR9A 3GJZA 2CNDA 4HG2A 4XD7D 5I45A 5JSZB 2CVPA 2QRUA 5TDHA 4DCMA 1JSZA 1RTKA 4D0SA 5FWNA 2B92A 4JA2A 2WAYA 1XJCA 1WSWA 1U8CB 2XPCA 1CY4A 4Q1CA 1JU3A 2GFHA 2IIVA 1BFKA 4IDOA 3WLJA 1LSUA 1D7OA 4HVLA 3O4IA 3DKIA 4Z9BA 5C18A 2HUNA 1CIVA 3REGA 2OCGA 3PNPA 3RUFA 4G0XA 3O8QA 1BSVA 2X1LA 3DVRX 1JIVA 2DFLA 3ULKA 4AYXA 1XL1A 1P5HA 1BJKA 1G64A 4HJXA 4LJYA 3WBFA 3D54D 4KK3A 3DXZA 4RESA 1XAIA 4GNKA 3H2YA 3E5MA 4YECA 1GR0A 4TRNA 5CA1B 2HSZA 4JP1A 1CR0A 3F2IA 4C1BA 2ZQ5A 1ZNWA 1C7RA 2H5LA 3EQ9A 5K2MA 2X2EA 1SUSA 2A58A 5CG1A 1Q19A 2ENUA 4YFYA 4QGSA 3AHEA 2QROA 4EMUA 3W5HA 4FCVA 1YI0A 5CFPA 2BY4A 2IUFA 3DZJA 4M89A 5CB6A 1JAZA 5T4BA 2P9HA 4S35A 4EJSC 4INZA 5C3UA 2N75A 2PD4A 3ZKWA 3PX7A 2FPXA 1W47A 1ZI9A 4K81B 2HO5A 1EWQA 1NDHA 4XVRA 1XQ9A 2X9GA 1IZ7A 1P77A 2J0UA 3GFOA 3ND9A 3V48A 5D5HA 2WINI 1XZGA 2ZCVA 2WJPA 1P62B 1TYCA 2NNWB 2IYNA 1Q2XA 1P2SA 3BWDD 3IE2A 3LXUX 1AKTA 4XGQA 4B34A 4PXSA 2DT5A 2FSFA 2HFJA 3LQ2A 1DG1G 2D1RA 2AFVA 2WSLA 1U3WA 2FPPA 1X7YB 4PQRA 1ZBQA 3GAFA 2XHEA 4HX9A 3LBHA 3KXPA 3T3MB 2PSSA 1VBNA 4DMKA 1JKJA 1TQ2A 2JJ2D 1EHIA 1OQAA 4TZ6A 4YAEA 1Y3AA 4M83A 5LYJA 5JBIA 3GG2A 2FMTA 1HE1C 1P19A 4B0PA 3ZWMA 4HB2A 5HFJA 1N6HA 1T29A 3HB5X 3PT5A 4B2LA 4WUVA 3N05A 4NU0A 1E9FA 3LE8A 4NMWA 4BQPA 4BFZA 1XZLA 4EYEA 1TB4A 5LNK1 5TF4A 1AJEA 5AT1A 5EJ6A 1TMYA 5ES3A 4B3SB 1O3YA 2N1MA 2WT4A 3T95A 4IINA 2IUSA 4DJFC 3ACCA 1Y7LA 3T41A 3TM5A 4OI0A 2J5XA 1A3CA 1R4MA 1T6YA 2NG1A 1EZ1A 3O47A 3TJZA 4D4MA 5ANRB 2EJBA 4P6VF 3CY6A 5DEOA 5E4YA 3SJZA 4CTOA 2R87A 4P8RA 3V1KA 1S2OA 1CUZA 3I72A 1XXLA 3IAM1 3R0VA 3VZBA 1QRRA 2AOWA 3K9WA 4RFSA 2CYAA 2Q6LA 2W22A 5LOVB 2F3TA 4ASUD 2LNDA 4V24A 4URWR 2JVIA 2XGGA 1M33A 2J0SA 1TTTA 3IAAA 3D4OA 1IOWA 3TLCA 2HQRA 4YRIA 4Q01A 1DEOA 3GLHE 5JAQA 1J33A 2Z5LA 1QQ6A 4MW6A 3CLHA 2BGTA 4CG0A 5BWBA 4RORA 1V7PC 4HV4A 2AMYA 2X3UA 2OFXA 3IAHA 4JLJA 5LZ5A 4H1VA 2VS1A 4R16A 1JHYA 3L5KA 1UKCA 2PEYA 2OMKA 3PLRA 4CL0A 1VJRA 4BMVA 3CR8A 1R0ZA 2G0AA 2Z6AA 5JW6A 4RTRA 2BE9A 1M8JA 3M2PA 4JNCA 4JUIA 3JATA 1GFIA 2I4IA 3NOOA 4PINA 4YQZA 4BXOA 3AY0A 4I3GA 3WR5A 4BNYA 3P9NA 4P3KA 1UZNA 4TLDA 1O96A 3PNLA 3QBEA 3HCFA 3WL7A 1RZRA 4RPHA 4A8JC 1Q1BA 3DFMA 1KMMA 4Q9NA 4Y9SA 5AW8A 4A8PA 4LRSB 2AS0A 4NFYA 1CJCA 4F8YA 4KXXA 2PUEA 2A5FA 3SYNA 2NTNA 1JA1A 2ORIA 3H17A 3W1WA 2IELA 2JW5A 4H1UA 4Y2UA 1N2ZA 3LFTA 1Z16A 1TGYA 2OV2A 4YRZA 3AB8A 4D02A 2CEAA 5IANA 2A78A 3THRA 4Y2JA 3TXXA 1ZCFA 1WO8A 2P1ZA 3ELWA 3NEJA 1GXSA 1P80A 1XN1A 5L7WA 3U4CA 4R0MA 2BUBA 1MJGM 1S2GA 2WHPA 2YIJA 1RWWA 3C6KA 1Z2AA 3QELB 3PWSA 2CMKA 1WKCA 1Z13A 1P2DA 4UDXX 4EVQA 3EEFA 1LI4A 1MQAA 3OQOA 3BB1A 1N6OA 1QFXA 5DSXA 1JX6A 5CDTA 2FE1A 2YN0A 4IJ6A 1T36A 1U3DA 4WKCA 2Q4DA 4DLKA 5JYDA 1ONNA 1VIYA 3I9MA 3BIOA 1AMOA 4CW7A 5JZMA 2CNWD 4CQMB 1BX0A 2C9ZA 5HQ3B 1WQ3A 3TCNA 2C9CA 4FFNA 2EP8A 1DKRA 3QWAA 4WFKA 1NRXA 1L4KA 5MGNA 2BUAA 1W9HA 3BCRA 5LD2B 1MG5A 2XUKA 1YBMA 3CLKA 1KK3A 3PDHA 3QFCA 1TMOA 1G8GA 2J48A 3FAZA 3AUAA 5C8XA 1RLMA 2B98A 5D3QA 3PUYA 1KAHA 3PVCA 2OCYC 4HYYA 4PICA 3V8NA 4MMYB 5TR9A 5KYWB 3G59A 3NUGA 4ROTA 1CERA 3FOWA 4A6EA 2PUDA 2O0HA 4BLRA 1Y6GA 4FBLA 1WABA 1LQ2A 3GRYA 3S2GA 1I3KA 2UUPA 5IK2D 1XNHA 3WJ2A 2GHTA 4EJ0A 3AI1A 3IMFA 9MHTA 1MZPA 2C9BA 4E2FA 1HDEA 4B3XA 2BGRA 1SUCA 3BKWA 4IL5A 2XNKA 4NPCA 1QIIA 2J0EA 4IIDA 2MINA 4LHVA 1I5OA 2QA5A 1QGOA 2HMYB 3FMOB 3A04A 3G0BA 3NATA 1OLXB 4M1EA 2O06A 5A1TA 1CUFA 1BXGB 2Q1YA 3ZBTA 2WHRA 2HF2A 2P2SA 2VJLA 3UCFA 1M0WA 1UBUS 2X4LA 2XCIA 3BK2A 4NYJR 5JC1A 5FPSA 1GNRA 1ZG3A 3E0XA 1FMTA 3AFOA 2JAQA 3ROGA 1J8MF 1D1TA 1R37A 5G0VA 4EYKA 4KRGA 2GR9A 3UHPA 2B2XA 3AESB 1VB5A 3P94A 2QGFA 2QRKA 5EGNA 5HKAA 1XALA 3QNUA 4OYRA 1ZD8A 3MEQA 1RRGA 2QT1A 2DKNA 1CJSA 2GYUA 2RBGA 2HWKA 1VE7A 1YR7A 3CC8A 3EIWA 3OQIA 4FOTA 4GG1A 2ZIXA 3KJXA 4QAJA 3QLUC 4QM6A 2V3VA 1CJBA 2ID4A 4OKSA 1D2GA 2P4SA 3NT4A 5IC4A 3E70C 4FJ2A 4R3NA 3JQGA 2D2IA 2I99A 4TMKA 3MMNA 4ARVA 5DMHA 4QNRA 4HDQB 4HWKA 1DDOA 2XUDA 5SZHB 2RGCA 4MKHA 2JJQA 3P0HA 3IAFA 2JHPA 2I2FA 3AUKA 4BVGA 2BEJA 2DTDA 4LJSA 3MTEA 1ZW1A 1JHMA 4PHGA 3ER9A 1IBMB 3TBHA 2QR2A 1TUBB 3B89A 4E51A 1F4LA 2CUNA 2B4RO 4OMFG 5ITZB 4KQJA 4MTLA 4P32A 1DV2A 1HQKA 3AEQB 2VG8A 2GYWA 2G06A 3BWVA 3MYYA 4MIKA 4C88A 4C22A 621PA 2O8FA 3K70D 5T6MA 2AGVA 4LHXA 4IQ0A 4Z6KA 1WXXA 4O5AA 5BUZA 1JKXA 3H84A 3AIIA 3LAWA 1MVLA 2QUBA 3AP3A 4CEJB 2X9LA 3X43A 3W8FA 4DLBA 2IDZA 2BTOA 4YALA 3OX3A 4JH0A 3KKEA 3ET5A 4RWEA 1Q22A 4U3JA 3SJBA 4UUBA 4ZGBA 4MW9A 1DOHA 1Z68A 4IDPA 3JV7A 3N2GB 3OKFA 4DUYB 3E8XA 4JEIA 1E7YA 1EB9A 1KJJA 3CLRC 1TT5B 4XEUA 1A27A 5F4BA 4TL9A 4EHIA 2FMIA 3KUDA 4BWVA 2JGRA 2BIFA 5HBGA 4BVJA 5HRUA 3K0SA 1FNSA 3HP1A 3ROXA 2PZFA 1W76A 1UBMS 1DAKA 2OMEA 2ZPUA 4HB4A 2H8KA 4ZC8A 1LLUA 1WCWA 2XKBA 3ROMA 4FM9A 4H6XA 4BECA 2CKMA 4YPOA 5LZ2A 3K9LA 1HT1E 5CDGA 1GUBA 4X1IA 2XVXA 3NW9A 1MRZA 5EVCA 4DM4A 1E1CB 4JEMA 2ZUEA 3OX2A 1V1MA 4PQGA 3F73A 3ZE8A 2HIMA 2P9CA 1G2PA 2H0RA 3V1UA 4WL0A 2X8JB 4XKJA 4XFKA 1XKTA 3JW8A 4NESA 2Q6IA 2QW8A 5EVJA 4BO9A 4NAVA 2NVWA 4ZDKA 3IEUA 3CF6R 2FW0A 2G8LA 3FPKA 3LPMA 3RIGA 1ZAKA 4NNOA 3NHFA 1LSOA 4WHMA 4HZIA 3OPMA 4QDTA 4WOKA 3W5DA 4DQ0A 2P77A 1F5SA 2QY6A 4Q18A 1QYDA 2CJXA 1FRNA 1XHLA 3UA3A 2O23A 5JNSA 4MZXA 3BK7A 4BHTA 3DLCA 4XIFA 2NMVA 3E35A 4QYXA 1B16A 4RK4A 1T5HX 5E9JA 3R2JA 3OIFA 4JVSB 4D1YA 3MC1A 1JEAA 3ANMA 2PV0A 1P2UA 3ADCA 5IX8A 5CIQA 3DB2A 3X1DA 2GK6A 4YAGA 2FWJA 3E7DA 4DY6A 2H48A 1XCMA 4LVNA 3B2EA 3C3CA 1MNQA 2FOXA 2YV1A 3WQRA 4EFNA 5CB0A 1C8KA 4OAOA 2X6RA 4NAHA 3EDQA 2XQIA 1U1FA 4QPDA 2AG5A 2BI8A 4XD7A 4F5ZA 1NR7A 3EPJA 1BXRB 2VHQA 1TQ8A 3E84A 4PCAA 2WSIA 4QUJA 3ZE6A 4BDSA 2CL7X 4TKLA 4AJKA 4Q16A 1NLZA 1T2UA 3MUEA 3TL2A 2FR8C 3R3JA 4L3WA 1NUPA 5G0UA 3URMA 4Q02A 3GLGE 5FUVA 5IXYA 2QENA 3MWLA 5IABA 2ADOA 2D0OB 2PWAA 2QZZA 5JQGF 2VQDA 2PSHA 2VWPA 1F17A 4GYYA 3I61A 3E9DA 5HM8A 1OLUB 1ZVKA 4MWOA 5ES4B 5DPMA 4LXIA 1ZOPA 4JJ4A 4K03A 4I66A 3TB4A 4BKQA 3EG5A 4BP9A 4EQ6A 1W36D 2WWFA 3QPCA 4GPD1 4N5NA 4Q4AB 5KHLB 1J7KA 5F76A 2GO1A 4BFYA 2NUPB 2OBYA 3K53A 2JIDA 1ONSA 2QHXA 1FTWA 3RS0A 3NDJA 1NXPA 2J07A 2OVFA 2R6DA 3MNFA 2ZJ8A 5E7IA 3TCKA 2WF9A 3N8KA 5JPCA 5JD6A 3AM3A 4J1TC 5IFLA 3LUCA 4MI1A 4DR4B 2BKXA 2FMKA 2JH8A 2YV3A 3O26A 4DQDA 4F6CA 1YFZA 1W4BA 1U7PA 2QLJA 1RRMA 2XWSA 3GD7A 3D6JA 1AURA 1Q77A 1Y0BA 1H93A 1RI5A 2DPYA 3OKCA 1QX3A 3MWYW 4OHXA 4DR1B 1XRMA 3LV8A 4JB3A 1E1DA 5GOZA 1VIVA 2ZE6A 4U5QA 2NXNA 1GL6A 2W6QA 3I3SR 5HF8A 3V4RA 5K8TA 1NBIA 2H1OA 3Q7EA 1BJTA 3TOZA 3GQBA 3RD5A 3WGGA 3WGNA 3ADPA 3EIQA 3VZQA 4RZSA 2WKSA 1MT0A 2KMLA 4HWTA 3SF8A 1RYHA 3TGLA 3R6WA 5DYIA 4F2GA 4UTRA 3NIFB 1NT2A 2I03A 2FWNA