1F2TA

Crystal structure of atp-free rad50 abc-atpase
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
149
structure length
145
Chain Sequence
MKLERVTVKNFRSHSDTVVEFKEGINLIIGQNGSGKSSLLDAILVGLYWPLRIKDIKKDEFTKVGARDTYIDLIFEKDGTKYRITRRFLKGEIHAMKRLVGNEWKHVTEPSSKAISAFMEKLIPYNIFLNAIYIRQGQIDAILES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural biology of Rad50 ATPase: ATP-driven conformational control in DNA double-strand break repair and the ABC-ATPase superfamily.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Replication
molecule keywords RAD50 ABC-ATPASE
total genus 31
structure length 145
sequence length 149
ec nomenclature
pdb deposition date 2000-05-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1f2tA00
1I4TD 1VPLA 4LJ7A 4PANA 2ZI7A 2QY9A 3PJRA 2G83A 1CJUC 1M34E 4LHWA 2HYIC 2F1RA 2O8DA 4O2RA 1S0UA 1N2CE 2AK2A 5AJZA 5JWOA 1PUIA 3K9LA 3GFTA 1ZD1A 5DLQC 2RCNA 3DL0A 1NSTA 2A7QA 2HDNB 3GCGA 3ZZUA 4GOXA 5FPYA 1P2UA 4D0LB 5A4JA 2JJ8A 3AV0B 4MGZR 4NE2A 1G4AE 3KTAA 5FTJA 3CR8A 1TADA 3IUYA 2VF7A 5CIQA 3OE7D 3SS8A 1GM5A 1K5DA 2P3SA 4NL4H 3W5JA 1T5IA 1GITA 1E1QD 3LNCA 1NVVQ 3PCRB 1HE8B 3KQLA 2EFEB 4QC2A 3QPUA 2QPOA 4KI0A 1TTTA 4QBGB 3EZ6A 5JBQA 1GG2A 3W6NA 3KJHA 4KLZA 2JIZD 3PEYA 3UMFA 1GTVA 4DDTA 3LW8A 4A2WA 4NP6A 1TNDA 3BB1A 2C9YA 3ICEA 2BMDA 3MWLA 3EIEA 3QF7A 2NMVA 3IIMA 2XZOA 1CR4A 3BK7A 5LPNA 1NVWQ 4R2IA 1TF7A 3KXIA 5IHPA 3I8SA 4DIDA 4F92B 3JZAA 1P2SA 4TL8A 4EFNA 1U0JA 5KNDA 1EX6A 2W00A 1MO4A 1NBME 2VP4A 3B1ZA 4G0NA 5IK2A 3KQNA 2P6RA 1AIPA 1X86B 3BFKA 3CX7A 3SQXA 1XD2A 2ODWA 1GNQA 1LW7A 3GJ6A 3LV8A 3RS7A 3TVTA 1OIWA 3KQKA 2GK6A 4Q03A 3HDTA 4B71A 2DFKB 2FH5B 3QNUA 3GLGA 1AS0A 2IS4A 2VRWA 4HB0A 2FU5C 2OFXA 2J7PA 4CF7A 3GLIB 2CJWA 4TLBA 1IQPA 4QBFA 5J5CA 1S1CA 1R8QA 1XP8A 2ORIA 4LYAA 1F5NA 4TQ9A 4DC9A 2ZTSA 2BVNA 3AF2A 4WZBE 4LHXA 4B74A 1KI4A 3CWQA 2HUPA 3KKPA 2ZR0A 1ZBDA 1Z83A 2XTMA 4PQYA 3THOA 4PHGA 4ZIRB 1BMFA 2QMUA 1ZD8A 3Q8XB 2BC9A 2IK8A 5P21A 1RRFA 3BBPA 4OHZA 2KWIA 4IRUB 4F93B 3UG6A 3THYA 4TLCA 3QEOA 4HAWA 3NH9A 1QBKC 1YU9A 4PSVA 1JR3D 3EXAA 4OQMA 4IKEA 4C4PA 2ANBA 3WBJA 1N6IA 2DYKA 2IF0A 4DLYA 4ZDWA 4RZ3A 4P4UA 3RRYA 4ZDKA 1CR1A 4IDNA 2VIIA 1ESMA 1G6HA 3HR7A 3K0FA 2FGKA 5H1YA 5EE1A 4B44A 4OHVA 1XMSA 1NKTA 3A6PC 1GIAA 5FI1B 3L0OA 3W8NA 1D6JA 4M1OA 2W58A 1AA9A 3VQTA 2XNSA 3W6OA 3VU9A 1E32A 1XJCA 1G5TA 1M8PA 2FFHA 5G40A 2CXXA 4JJKA 1LV7A 2ZRFA 1TF5A 1W0KA 2C9CA 2ODEA 4G3XA 5BW8A 3CRRA 4URUR 4IDQA 3C8UA 2CNWA 4JL5A 3U44B 2AD5A 2JCSA 3P1JA 4OJQA 4XVRA 3QE0A 3CF0A 1KTVA 4RD3A 1AJEA 2P5SA 1N6KA 1II0A 4JKIA 2WJIA 3M1IA 3LVRE 3QI2A 3U44A 5FOWA 2Z5FA 3SFVA 2A2ZA 2QQ0A 3W6PA 4Q4AB 1SVWA 4G01B 4Q9IA 1UBFA 4HAUA 2IUUA 4B34A 2PJZA 3F5FA 4MRRA 3CPEA 2IYQA 2I4IA 4WIAA 1NSFA 1KSGA 1ZCAA 2BEJA 1R0XA 4PC6A 2VBCA 3N5CA 2Z43A 3O47A 4M1SA 4B2LA 4EFMA 4TYWA 4HEJA 2AFHE 4DKXA 3L2OB 2G9NA 1VHTA 4RZUA 1DAHA 1KZ7B 3SYLA 2OT3B 1MRNA 1VTKA 2F55A 4LV6A 3ETLA 1KI1A 3UATA 4BZXA 3WP1B 1WE2A 3NG1A 2HYDA 2PCJA 5JRJA 1SKYB 1HEIA 5FBWB 2ZXUA 1GWNA 1ZVQA 4Q4AA 5AJXA 4LHZA 3CO5A 4MYTA 2VHTA 1JR3A 4BLRA 4ON9A 1SKYE 3X2SA 1IY2A 3LX8A 2GVDC 1E96A 5FH9A 2C77A 2O8CB 4JLJA 3WYFA 1Q1ZA 1G5RA 3GFPA 4ZCIA 1XXHA 4M22A 4RVCA 3EW9A 2X1VA 1JAHA 1TUIA 1RIFA 1GUAA 4YXWA 4A2PA 3DOFA 4PAMA 2FSHA 2UZ3A 1N6LA 3P27A 3ICQB 2EFDB 4J0QA 4O25A 1EG7A 4HZUB 4M4SA 4HLUA 3TK1A 3F0TA 2VO1A 2RGXA 2EVWX 2WMNB 1KK2A 3U4QB 2IWHA 2VYFA 4BZQA 3GJ7A 3GFOA 3PUWA 5DHAA 2BOVA 1Z22A 5FOTA 1ELOA 4ARZB 2GXUA 2C95A 2C99A 4ITRC 1U99A 2TMKA 2YWGA 1W1WA 1KKLA 4IVQA 5KTYA 2BBSA 4B32A 1E9FA 2G88A 1G6OA 3R20A 3Q9LA 1UDXA 1BMFD 3B5JA 4FCTA 4YMTA 5LB2A 4YMVA 4CEIB 2CE2X 5DIFA 2OCAA 4QG7A 4RCYA 4ASUD 1N5LA 1P5ZB 1P9NA 4LY6A 4CYMA 3KQHA 3V4RA 1Q57A 2HV8A 2ZUBA 3NBYC 2AX4A 2C2HA 1DOAA 4E07A 5JJKA 4Q01A 1OYYA 1ZD9A 4FMDF 4D4LA 5B64A 1JBKA 3AF1A 5DYGA 3BIFA 1KAGA 5B57C 1T3HA 1YR9A 2ZRMA 2ZYUX 5LDDC 4Q5IA 3FFBA 3UPUA 2IXGA 1E99A 4YC7A 1N6NA 2ZJAA 5IF9A 1W0JA 4PTLA 4Q7LA 2PL3A 4ABYA 1AS2A 1Z6YA 4W7SA 2O0KA 5C2JB 1EXMA 1NIJA 4AG6A 2XNDA 2ZRGA 2C98A 4HB3A 4M9SA 4RY2A 5FTLA 3PUVA 1IAQA 1OFHA 3L8ZA 3AVYA 4M1TA 3A4LA 1ODFA 1GNRA 4LC0A 2IYXA 4O3MA 4OQLA 1YR8A 1IN5A 1MH1A 3LO5A 3U7EB 4LYHA 4NYIQ 3R8CA 2DCUA 2MMCA 4RD4A 2FF7A 2WWHA 1XEXB 3C5HA 2FG5A 2ZQ5A 5KDOA 3IO3A 2HXYA 3X1WA 5G3YA 4Q7MB 5KSOA 2WWFA 5FL3A 2RGBA 2QQEA 4MKIA 3TR5A 3U7GA 1ZJ6A 1KI9A 4C2TA 5ANRB 1VYVA 3PENA 3CX8A 3SYKA 1Z3IX 1N0UA 4EJSA 3I5XA 1G21E 4EPYA 1GRQA 4B6FA 1QHNA 4TSFD 4OQXA 1G3MA 4AIIA 1FQKA 3CIOA 4F91B 3WMGA 2QP4A 3NC1C 4V0NA 4EDHA 2ZRPA 521PA 5HKKD 4TT3A 1ZP6A 2CJWB 3CNLA 2W6ID 4JLDA 4ACBA 1EESA 4R7ZA 5FPSA 3FTQA 2CHVA 4ASUA 5JI3E 5BYJA 1LFDB 4IFEA 3NXSA 4C7OA 1G8HA 2A5JA 3V9PA 2ZI9A 3BC1A 1YKSA 2ZJBA 5FOSA 4DEYA 3TLXA 4BGDA 1UADA 1RZ3A 2J9RA 2OHFA 3BS4A 4Q1BA 2IYVA 4JVSB 5EXPA 2MSEB 3QPWA 2ZYWX 3K9GA 3LD9A 4URXR 4JBYA 2MSCB 2QAGB 1J99A 4U7DA 2P5TB 2YYZA 4NYMQ 2XJ9A 1MKYA 2QTFA 2GJ8A 2WWXA 4HUQB 3KXLA 2IC5A 1LS6A 4D82A 4MDFA 2JGNA 1P9RA 4KODA 4GP6A 5EE3A 1IN8A 1E0SA 1SXJD 1PZNA 4DVGA 4ZCLA 3IBGA 5C18A 2VSXA 3FWYA 4LHYA 2QPAA 1DAFA 1E9BA 2IYZA 4Q1CA 4CW7A 3AF0A 3KJGA 1TQ6A 1Z6AA 3BORA 4RD6A 3ZDQA 3S1AB 1R8SA 2WAXA 1UPTA 4KYIB 2IEZA 1XCMA 2P65A 2XJ4A 5FPHA 4LJ5A 3RWOA 4B73A 4Q9JA 1Q1QA 2D4HA 3AVPA 5L3QB 1QVRA 4B3DA 1E9RA 1JALA 2BWJA 4DLTA 1GDDA 5FPKA 4LDJA 2HT1A 2PZGA 3NC0C 2OBNA 3OFNA 4B3FX 2BMFA 4PC3A 2B7CA 3DDCA 1QVAA 1GP2A 1O3YA 1KHTA 2ZJOA 3O8BA 4A92A 1N0WA 5J4VA 3U3KA 4IOJA 4LC1A 2BBOA 1ZU4A 2GZAA 1W4RA 2O0JA 3HP1A 4BLTA 2ZJ5A 3BH6A 2O8DB 2GA8A 1II9A 3JVVA 1RE0A 3NHAA 1XTKA 3T15A 1R6BX 1JB1A 3QF4A 1MV5A 4L9SA 3P26A 5J4HA 4WOPA 1E9AA 2H17A 2VLIA 2YWFA 2JAQA 4YONB 5TXGA 3GLHB 4EIWA 1E0AA 3FMPB 3R7WA 4DZZA 2VP0A 4KU4A 1SVOA 1XBTA 3RS5A 3TIFA 1GL6A 4C0KA 2Q3MA 5IT5A 2DWPA 2VHCA 1TPZA 2YVUA 2ATXA 1RKBA 4XD7A 4HI0E 2YOFA 1T6NA 3W3AA 2V8OA 1Z8FA 3U7FB 2NQ2C 3K09C 3UIEA 3VTKA 1M1YE 2FJUA 4YXWD 4JLOA 5JSZA 3TVDA 3OIUA 1JI0A 3CF2A 5D3MB 1XTIA 3TUJC 1G9XA 1QHGA 4BFYA 4P4TA 5D3QA 4Q19A 3T1OA 821PA 3GLFE 5JZVA 2ERYA 3GLFA 621PA 4MYUA 3IO5A 5TB5A 2KE5A 1NKSA 5EP3A 4BFSA 1E2KA 2AHOA 3D31A 1T5LA 1M2OB 4MUBA 3ADDA 2RGNC 3ND8A 2PZEA 4B43A 2PZFA 4DHEA 3K0SA 5AK0A 3TUIC 1G1MA 3X1XA 4BFXA 1HT2E 1S9DA 5FTMA 2GJKA 4HAVA 2AWNA 4CEHB 4PFSA 4DT1B 4B33A 5FTNA 4KFRA 3UWOA 5L8VA 5KUTA 1VHLA 4LJ4A 1FP7A 1P2VA 1R4AA 2V1UA 4TZ0A 1OE0A 1VIYA 4DLXA 2VHJA 2EFCB 3KKNA 3UANA 2VL7A 4MITA 3WHKA 3ZIAA 1XMIA 5BQ5A 1XCGB 1GSIA 1G7RA 1KMHB 3CRMA 2BDTA 5CJ2A 1YZTA 3QF4B 2WWYA 4Q18A 5L3RA 2NO1A 4NH0A 1ZM4A 1UKEA 4RKEA 1Z0JA 2OV2A 4M1WA 4R71A 4IVPA 4OI2A 2CLCX 1XPRA 2JATA 3K70D 1JXMA 4P31A 4UKDA 4DCTA 4HUQA 1KO8A 2ZRCA 4L8GA 1IY0A 3SJZA 1A2BA 4Q66C 1NN1A 4WZAE 1QHXA 1Z06A 3C7KA 3KJIA 3CKLA 4N0DA 1YR6A 3EPHA 3IILA 3IEUA 4JLPA 1U8ZA 5KU1A 1OV4A 3OIWA 3K0EA 1F48A 1H8ED 1UFQA 3N2EA 4PPFA 2DR3A 4TSFA 4X8MA 3EIQA 3CPHA 4FWIB 4ZPXA 4JBXA 1B23P 2FZLA 3C15C 4QRHA 3AEZA 3CH4B 3PFIA 1DVRA 2ZAOA 1HA3A 3CLVA 4QGAA 3KXKA 1L4UA 1MABA 5EXSA 2P67A 4D25A 1OSNA 2B92A 2P6NA 3B1WA 3NDBB 2PH1A 2G1JA 1DO0A 1US8A 221PA 4W5WA 4G5OA 3CF6R 1OHHD 2X19A 4XWKA 5HZHA 2XOKA 2Q9BA 3AGQA 5DI9A 1Z5ZA 2VTKA 4JL6A 4D26A 1P75A 2JASA 2GBLA 1Q44A 5C46F 3T5GA 2YHSA 4TMZA 1E4YA 4P0TA 4JYCA 3WNCA 2X8AA 3WYAA 4DLVA 3FDIA 1KSHA 2HCBA 3NKVA 4FN5A 1AGPA 3BWDD 3RS0A 3KJEA 4TYNA 3ZS8A 1YZNA 3VR3A 1XCPA 1YRAA 5GJCA 4GBMA 1FPMA 4ZO4A 4BLQA 1KK3A 4EQ6B 2F9MA 1YHNA 3L8YA 1XB2A 1HY3A 3GJXC 2NG1A 3FOZA 3KFVA 3PEUA 4P4SA 4O0MA 4CT4B 3H84A 3TRFA 2ODNA 3KQUA 4A8JB 2GZHA 4GT1A 3VR6A 1VCMA 3IPXA 1NL3A 2V4ZA 1Z07A 4RD2A 1GKUB 2BCGY 1ETUA 1KI8A 1E2FA 3I4LA 4JSTA 5JMTA 2WVJA 4QOSA 1CIPA 4LOAA 3NBZC 4A0GA 1R5BA 3FMFA 2OESA 3IQXA 1E2PA 4AK9A 4MA4A 2DWQA 3OESA 1JAIA 1ZINA 1G3RA 4FW9A 1TX4B 3MJRA 1SHZA 4Q02A 3FMOB 1YVDA 2ERXA 3B1YA 3THWB 1XEXA 3LQQA 4QGGA 1NMXA 4I1UA 1NBMD 1ZNYA 1E98A 4KJZA 2EU8A 3PEVA 4B3GA 1U90A 2FFQA 1F2UB 3KTAB 5EE9A 2GBLC 1N25A 1CXZA 1E1QA 2Z0MA 3OEED 4NTZA 1F2UA 2ZS8A 2HF8A 4EPTA 1DEKA 3DZ8A 5TY0A 1QHYA 1CRQA 1G7TA 1R5OA 1W47A 2FFBA 5E7JA 3IDQA 2FMXA 2PT5A 4EAQA 1OPXA 3NBXX 1L2TA 3W90A 1N6RA 1TU4A 1SVSA 3DMNA 3T34A 3R8FA 1SGWA 3N2IA 1Z08A 1D8TA 1R10A 2BM0A 2E87A 5FUYA 3KZ1E 2FDCA 4CEJA 4LCBA 3X1DA 5B30A 2GEUA 3L43A 1AGRA 1KI3A 3HPRA 2IHYA 1IJEA 1U94A 3AB3A 1II8B 1G3UA 4KLNA 1NNEA 4BFTA 1KI6A 1XFAA 4JBWA 1W0KD 3ZIAD 2JLQA 2ZRLA 5JHHB 1CULC 2A5FA 3T1QA 1ANKA 1QRAA 3LX5A 4JLKA 4JVNA 2J1LA 1SKQA 4H9GA 2B8WA 4EQ6A 1ZMXA 2A5YB 4TMVA 3FKSA 1YZUA 1G8FA 1W2GA 4RFVA 3B8HA 4LBZA 1YZGA 3I61A 1XX6A 1E9DA 2V6IA 5AR1A 4DXAA 1G4UR 1NI3A 2ORWA 3EARA 4PPQA 3TQFA 1OKKA 1P3JA 3AVTA 1Q0UA 3TJZA 3UK6A 4PSKA 3UMSA 3VMFA 4DCSA 2OCPA 4L15A 3SEAA 2PX0A 1NY6A 2QRZA 1IM2A 1QF9A 1KY2A 1NG9A 1G3QA 1IXRC 2XSZA 1KNXA 3U6KA 4B2IA 1BYIA 3NHBA 1CEEA 4PC1A 2IS1A 2GXQA 2FWRA 1XD8A 1UEJA 1A7JA 4OHYA 1HTWA 2BEKA 3RRZA 4PHHA 4RKFA 1JJ7A 2XEXA 4OKSA 3K9NA 2J0SA 2RGNA 1TF2A 1DAEA 2ZEJA 1A2KC 2ZSFA 3B60A 4X8HA 3VX3A 3NVAA 3K0FB 1NVXQ 4FD2A 2JLWA 1OFUX 4QNMA 5JS7A 3LQRA 1GVNB 1XEWX 4AKGA 1XTRA 2ATVA 5J40A 2VH5R 1W4AA 2NZ8A 2LWIA 1A4RA 1X1SA 2GTPA 2ZYTX 4JJZA 2IUSA 3QKRA 4HUTA 2QMOA 2JJ2D 5BWMA 1EWQA 1BH2A 3WHLA 1Z0DA 1G5PA 2RGEA 2B8TA 1IOZA 1FNMA 2A78A 4NCJA 2JA1A 2QEQA 3DOEA 4DLZA 2IS6A 4UNPA 2KJQA 1I4LD 4XSHA 2GWHA 3SFZA 4Z51A 1P6XA 4WXRA 4AG5A 3AM1A 4P33A 1YR7A 2RH5A 2YKGA 4WA7A 4Q4JA 1SHKA 1COWA 3KB2A 3REFA 5JEEA 1SVKA 3GLIA 1E9SA 2BV3A 4QM7A 2DB3A 1N6PA 2UZIR 1YZLA 3RC8A 1MT0A 1EWRA 4K8OA 1T0HB 4P32A 4WAUA 1OXUA 1Z2CA 5FPTA 4C0JA 5GJBA 1E79A 4A6PA 3PQCA 1W5SA 3L0PA 3EWAA 4HAYA 3THYB 4E5UA 5CYOA 2QU8A 2Z6VA 5FFMA 2IYUA 3BB4A 4KO8A 1HE1C 2VSFA 3HU1A 2FA9A 2BKUA 2XNDD 4JYBA 4G5GA 2RGDA 4UNNA 5EQTA 2ZVQX 1E79D 5FOXA 5SZIA 2HCJB 1T8TA 4Z8XA 2H7VA 2PMDA 2QRNA 5JFGA 5KSYA 3HU3A 3UKDA 3T1TA 3TMKA 1E2JA 1UJ2A 5E95A 4XJXA 2CVHA 3BRWD 1GOTA 3RRNA 5E3HA 4Z54A 2K5UA 1G8GA 2WPDD 1J8YF 1R0ZA 4LPKA 2HEIA 3VR1A 1NN3A 1QDEA 3K9HA 4NCNA 4OI4A 2CVFA 3GEIA 1G3IA 1ONBA 4RSGA 1GAJA 3FE2A 1FTNA 5F2EA 5J4YA 3C5CA 2C03A 4KSBA 3L0SA 4WXPA 3GLGB 1E4VA 3T35A 2WHXA 3BFVA 4MGYR 4TL7A 2D2FA 4D4JA 2NO9A 1VDZA 3AVOA 4B3XA 5TDHA 1Q21A 1UBCA 4MRNA 4Q9LA 4OQFA 3ZLJA 3Q7PA 1II8A 2LKCA 4TQAA 3C14C 4GZMA 1QHHB 3P32A 3W9YA 1W46A 4HDCA 1M7BA 2QE7D 3B82A 4GFDA 2N1BA 1OJLA 4CEJB 1P72A 3OEHD 3SOPA 4OL0A 2GJAA 1OH5A 3JZMA 4MYHA 1RJ9B 3OEEA 1N5JA 2I1VB 2B7BA 5DI3B 4D81A 1KY3A 4CIDA 4NONA 1O87A 4W5HA 4F7WA 1ZM9A 2E1RA 5BXQC 4URYR 4M9XA 2F43B 5AUQA 4RCZA 3EC1A 3HU2A 4BLSA 1OXTA 1AK2A 3EZFA 5F3WB 2IYLD 1XMVA 1IJFA 4U02A 4N1AA 2GK7A 1JNYA 3KFXA 1BYUA 3LFUA 1T3LA 2XZPA 5FBVB 5AJVB 3ZD7A 1RYHA 2WSSD 3HPQA 1QG2A 4IVRA 1EFCA 2R62A 5K8UA 2Q3HA 4PZZA 2IYYA 2XB4A 3DKVA 3SR0A 2NIPA 3WMFA 3QVUA 4NYJQ 2FN4A 2DWOA 4UJ5A 4YMWA 3M4YA 2H8KA 4LJ6A 5HE8A 5AJYA 2QI9C 2X2FA 3GPLA 4G5QA 1Y3AA 5HZKA 3A36A 2R6DA 2CHGA 3TR0A 1E2NA 1KGDA 3SZRA 3PIRA 4C9BA 4XOIA 3IHWA 4M1KA 2OM2A 1W2HA 3FYHA 4OK6A 1P2TA 2ZPTX 3EA5A 1M7HA 3E70C 4DT1A 3EZ7A 1KDOA 4P4SB 2YC4C 2PLFA 2QP3A 2D3WA 3IIJA 1HT1E 3PV0A 4LYJA 4B6EA 3CX6A 2ZIAA 1S9HA 1X8LA 3G0HA 1FX0B 1ZC3A 5FL7D 1U8YA 3DPUA 4F38A 5BN4A 2J0UA 1KAOA 3BERA 3CNNA 4XTRA 4FCWA 4BWYA 3OZXA 3NTUA 5DI3A 4LBVA 1GL9B 3NEYA 3RS4A 3GLFB 1EFRD 1ZCBA 2BHRA 3FGNA 4Q47A 3PEWA 2D2EA 1EFRA 1EX7A 5EJEA 4LK2A 1OXVA 2O8CA 5DN6A 4L4UA 2FSFA 3Q72A 4L9WA 4M9QA 1KK1A 4TMTA 2XSZD 4ESHA 3KKQA 5AUPB 4QHYA 3WMEA 1KIMA 2VP5A 1S8FA 5FBLB 3HWSA 4ILEA 1T0JB 2VHQA 4GPTA 121PA 1KJWA 1VG1A 1ZUNB 2GRJA 3B2EA 4IEEA 5TVKA 4A36A 1Z2AA 3AF3A 2NTYC 5CLLA 4R98A 4BE7B 1P73A 5E4FA 3NDPA 2WSSA 2VP9A 4PSAA 3WNDA 3G5UA 5DGXA 1DO2A 4K46A 5GVRA 1DADA 1K8RA 1OT3A 4NYJR 2WKQA 4B76A 4LUCA 2L0XA 4JLVA 5LD2C 1OFTA 2WJGA 4B48A 4UNSA 4A0FA 1ZUHA 1NY5A 1IXZA 1E2DA 4D6PA 1XJQA 2OXRA 5C4MA 1PVOA 3O8DA 3QEJA 5G3ZA 1WA5A 3MFYA 5FUWA 5A0FA 2VF8A 1AKEA 1P7CA 1CP2A 1WDTA 3R9XA 3SC3A 1HQYE 1Q20A 4FCVA 2P2LA 1DTSA 4I1VA 4MDEA 4URWR 1X3SA 1E94E 2ZS7A 3FKQA 1XTSA 3CRQA 1VIAA 3WBKA 3QKRB 3GEEA 2ZSAA 4HDQB 1J7KA 3AH8A 4ZKEA 1Z47A 1T8UA 4HSEA 3RANA 1Q22A 4LSGA 4KFTA 5IRCD 2BJVA 1J70A 2FFAA 4A9AA 4QJ4A 2RMKA 2ODBA 1S3GA 3MGCA 1NN5A 2OFOA 4AKHA 1D2EA 3MAAC 1FZQA 2XOKD 3LVQE 2R2AA 2ZRIA 1KJYA 4DCNA 1YJ5A 3K09A 4TT3D 4Q9HA 2NO0A 3SE0A 4QHTA 4TYPA 4PQRA 5EP2A 3VR2A 5JHGB 3A1VA 1E6CA 2GCNA 2Z83A 3ZD6A 3NWJA 3KUCA 2YWHA 3ZVRA 2OBMA 4KAXA 5B2ZA 4CEHA 3BFXA 3ASYA 2XITA 5CLQA 2XB2A 3MMPA 2J46A 2OZEA 1E0KA 3AUYA 2R6AA 2GF9A 3CBQA 4HZUA 2NO7A 1ESNA 2WIBA 4YMSA 1LF5A 3KL4A 2DFLA 2F1HA 4TLDA 3TNFA 1ZM3A 3OF5A 4IOKA 1FUKA 1P60A 5TV2A 4A15A 3AKDA 1KK0A 3QXJA 3T61A 1H8EA 1RFLA 1G8YA 2FSIA 5FR2A 1OH6A 1SZPA 4B3CA 5D3MA 1JPNA 2FE4A 4C7OB 2ZUDA 3LBHA 1BO6A 5JSZB 4DLSA 1UAAA 1UKZA 1N0VC 1NP6A 1W7AA 3MCAA 1F6BA 2Q0HA 1RYFA 2V54A 2GEDA 2ZAMA 4IEIA 4OHWA 1W44A 4MH0R 5BN5A 3SBDA 5KPJA 4NPHA 4YLGA 3SJAA 2XXAA 1P9WA 2UVQA 4DUGA 1KSFX 2F7SA 1E2EA 4OBEA 3TQCA 4TTPA 1FX0A 5EZ6B 1JJVA 2OCYC 5H68A 4C0HA 2GVZC 3K70B 4JT2A 4US0R 3UXMA 2EWWA 4DCUA 2QN6A 5GJVC 4DDVA 1GRRA 4JLNA 3EASA 3GJ8A 3C4JA 2IF2A 4B3BA 3HYTA 2SHKA 2EFHB 2QPTA 1UKVY 1S2MA 2ZETA 3OAAD 3A1WA 3VKWA 1ZM7A 2B21A 5TARA 4A1FA 3ZH9B 2QNRA 2G0NA 4BUJA 5L3SA 1VG8A 1WF3A 2NO6A 3QKTA 1TQ2A 3EIHA 3SN6A 3TSWA 3QJYA 1MO3A 2ZREA 4K81B 5DO9A 5CM9C 2QT1A 4U00A 1LY1A 3RSLA 1KSJA 3B13B 2G77B 4NCHA 1RRPA 2GAAA 3A37A 1X8JA 4TMKA 1CRPA 3GLGE 1XTQA 1UKYA 3AVQA 4ZDJA 2XTZA 2HT6A 3IQWA 1SXJA 1PV4A 3VX4A 4L16A 4GOKA 4I81A 1OXSC 2WJVA 4ZDIA 1G20E 1VCOA 4AYXA 1OFIA 1OH7A 3TSOA 5IDVA 3U3MA 1ZRHA 2R6FA 5KOYA 2XZLA 1P61B 1W4CA 3SJBA 3DEFA 1ZAKA 2ZJZA 5HPYB 3J81k 4WZ6A 2ZI3A 1FUUA 1Z0AA 4FMCF 3TSZA 3SBEA 4E09A 4HYYA 1Z63A 1RC8A 1XDBA 4OK5A 4RD0A 4HAXA 4IJMA 1L7VC 1E0JA 1CJKC 3R9IA 1SXJB 2IYSA 5JCPA 3EA0A 4Z8YA 3QUSA 2GXAA 3E2IA 1NG1A 3RC3A 2BKEA 1ZU5A 1NLFA 5TMPA 1W5TA 1XZQA 3KB1A 4AYWA 3PG5A 2JLSA 3EAQA 1WB9A 1DELA 3ADBA 4DDWA 2JLUA 1RVDA 4QJ3A 4D0GA 1Z0IA 4M21A 5CB8A 4IXMA 5A5GA 1W36C 5BYKA 2VEDA 5DISB 5B58C 5CJPA 1T91A 1U0LA 2DPXA 2CMKA 2WJJA 3BH7A 2AFIE 1LVGA 1MOZA 2ZI6A 4TLAA 3CRVA 4UNQA 5SZJA 1OKKD 4C0LA 2GAOA 3AP1A 3MWKA 1JPJA 2GILA 1AQYA 1UEIA 3QY0A 3THXB 1XXHE 4RZXA 5DH9A 2RB4A 1H8HA 2P0EA 1I4DD 4M0LA 3K53A 1AZTA 3PXGA 4ZI3A 2GJSA 3QSYA 2GNOA 2GESA 2ASEA 4MUAA 1RRCA 1E2MA 3O8CA 4YQFA 3QENA 4CDGA 1BOFA 3GMTA 3IPYA 4BRWA 3FPAA 2ZUCA 3W3ZB 5C1BA 3ONWA 2YC2C 2YNMA 4EPXA 3P20A 4EPVA 1ZW6A 6Q21A 1YQTA 3ZVMA 4TMWA 4V0ME 1ZNZA 3MRSA 5CYPA 3W34A 1NVVR 4Q21A 4RZ2A 2QL6A 2YINC 4XTCS 4B35A 2MSDB 4PPGA 1D9ZA 3IKJA 1WBDA 2OO7A 5SZHB 5KO2A 1GRNA 4W9MC 1AZSC 1GZSA 1DAIA 1COWD 4PZLA 4XH9B 3L82B 1YRBA 3KUDA 4PC2A 3BOSA 3LBIA 2QE7A 2W2XA 3NH6A 1E2HA 4CZ2A 5FOUA 2WIAA 1XWIA 2OEPA 4LX0A 2ZRJA 2QAGC 2ZS9A 3WXMA 4D0NA 5IK2D 2N46A 1CKEA 5C4GB 1UDWA 1OB5A 1TUEA 4AYTA 4HAZA 3QXCA 2OFWA 3K0CC 1Y63A 2CBZA 2EWVA 2ZE7A 4QNRA 4XIGS 2PLRA 4BEJA 3CW2A 1US8B 1M6NA 3ND9A 3B85A 4QGHA 3Q85A 2J5XA 4A0HA 3WNBA 2CE7A 2DHRA 3SQWA 3TAHA 4KYUA 3SI7A 4MGKR 1MABB 4NMMA 1IHUA 1SVIA 3TKLA 4W5JA 2W2TA 2OSBA 2XX3A 3AUXA 3RABA 3MLEA 3MWYW 3ZVLA 3MSXA 1KO5A 1Q12A 2ZU0C 4QHSA 2IW3A 3RWMB 3U60B 4LBYA 3VR5A 1EFTA 1XRJA 3UWKA 4GSYA 4Q4HB 1FMLA 1U9IC 5HE9A 2QSYA 2FNAA 4O2LA 2AWOA 2ONKA 3EWSA 3QBVA 1TQDA 3CB4A 4PC7A 2XXAB 4IOMA 1E3MA 3F8TA 1G7SA 2XAUA 1WBBA 1JXOA 2ANCA 2W0MA 4GMXA 2WZQA 3SHFA 1KDTA 4ZKDA 1N5IA 1OH8A 2A5DA 5ELXA 3K8YA 4PPNA 3BGWA 2RHDA 2J0QA 2NPIA 1XZPA 5LD2B 1T3SA 1XF9A 1IY1A 4UXIA 4V0KA 4U5XA 5FTKA 4QL3A 3AGPA 4Z1MA 2OCBA 4KXFB 3Q5EA 3GJ3A 2E9SA 4MYCA 2YJTD 2VHUA 2XTNA 5K8LA 1HYQA 2J7PD 1EGAA 1WCV1 2DFNA 1WQ1R 3CPJB 3D7MA 4D2IA 3TBKA 5KSPA 4KFUA 4OQNA 3A58B 5JI2E 3TUZC 1NRJB 4DB4A 1KMHA 2NOAA 3DHWC 5HTKA 2WKRA 1OXXK 2D62A 3CZQA 3HYRA 2IL1A 2QENA 2ONJA 2BCJQ 2GKSA 2CK3A 1E9EA 2VP6A 3U2QA 4LZZA 1FNNA 3VFDA 4FMCB 2REXB 4CT5A 3T12A 4TWZA 1G19A 2Z4SA 1P4SA 4TLEA 1NLYA 3GEHA 5DNYB 2JLZA 3VNUA 2RKOA 1N3BA 4BEBA 4I4LA 4ZCMA 3U5ZB 1HUQA 3EX7C 2O8BB 1D2MA 2GF0A 1U8AA 2GXSA 2WSMA 4DBLC 1TU3A 2WPDA 4NBSA 2H92A 3GLHE 4KVGA 3I62A 4G5SA 4Q7KA 3R9WA 1ZNWA 1U9IA 2AD1A 5FI0B 2OBLA 4GZLA 1G17A 4X8LA 2G1KA 2ZRHA 1KMQA 4BLOA 4GRAA 2ZSEA 1XNJA 2YOHA 4D80A 1V43A 1VYUA 2BBWA 2QGNA 5CB6A 3U3RA 2H16A 3GJ5A 4NCKA 3FMIA 3LDAA 1U98A 4B47A 4MRVA 3EZ9A 3ZQ6A 5J4LA 2ZROA 3LXRA 4TL6A 4C3ZA 3AP2A 3B1VA 2O8FB 3D6TB 2J0UB 3LA6A 1E2IA 4JMPA 1FQJA 2JDIA 4BFZA 3R7WB 1R0WA 4IHQA 3ZYCA 1NBMA 1QHSA 4M53A 2WOJA 3SHWA 5L3QA 2JLVA 5HR5A 4F4JA 3I8XA 4LV8B 1CS4C 1CLUA 4L5BA 3E5HA 1W36B 1OF1A 3H86A 4OK3A 3K70C 4RFSA 1LTQA 2WBLC 4OHXA 4WBSA 4IXNA 4GMDA 3HJNA 3PVSA 1CR2A 4DLWA 5FBRB 4QM6A 2REBA 2CL0X 3CNOA 3QG1A 2DY1A 4KFSA 2AK3A 2D06A 4N0EA 3PITA 2W83A 2HLDA 1PLJA 4UNRA 2OG2A 2J41A 1WXQA 1AQUA 5DN6D 1IN7A 1DARA 1B0UA 5CIWA 1EFUA 2CCJA 3W8RA 5G53C 2CL6X 2PCLA 2R65A 4S35A 4TTQA 1E69A 1P62B 3QQ5A 3P4YA 1FW6A 1KNQA 3I3SR 3CONA 2J59A 2J87A 2HLDD 1C1YA 2RGGA 5DSZA 1XD9A 1SULA 1AS3A 4UQOA 4NU0A 1A82A 4E03A 2WJHA 2FV8A 3LH5A 1I2MA 2QUZA 4LJ9A 2Q9AA 2R44A 3WRYC 3I5YA 4JT4A 3S1AA 3RDPA 3AVWA 1OW3B 4POAA 3UMRA 4YDHB 4D4MA 1M7GA 3LY5A 4NKRA 5AUOB 2CLDX 2O52A 2NPFA 1XD2B 4RD1A 5FR1A 3TGPA 1GKYA 4WW0A 3C16C 1NVUQ 3E1SA 5KNBA 1G64A 1JQJC 1W48A 1YZKA 1ZC4A 1FP6A 1PJRA 2AN9A 1R7RA 3EZ2A 4XD7D 1U81A 2FPMA 2WKPA 1FOEB 4IW3B 1X6VA 5JLJA 5EE0A 4EPRA 3GD7A 3D3QA 3QBTA 2P6UA 1HV8A 3THXA 4LYFA 4XVUA 5FL7A 4AY2A 5KHOC 3K0AA 4TTRA 3H0KA 4H1UA 4EUNA 3WRXC 1J90A 3M6AA 3FVQA 3LRPA 1DE0A 2ZI5A 4JKYA 4TMXA 2IYWA 4RFSB 3SNHA 1S3SA 2ZRNA 4LV5B 3RAPR 3GJ0A 3BAFA 5CDFE 5J4KA 4AI6A 3FHTA 3OE7A 5K8TA 1BIFA 2AR7A 4Z1MD 2N42A 3LLUA 1K6MA 3GLIE 1SXJC 1RPZA 5H70A 3ZZ0A 3EPKA 2Q9CA 1BKDR 1L8QA 4PQFA 4C0QC 2FEMA 2CHQA 2ZVPX 4A8JC 4LJAA 1U0HC 2ZU6A 3RNLA 5EUMA 1MR3F 3L0IB 4F4IA 3DKPA 1XU4A 3OEHA 1VG0B 3OIYA 3GP8A 1NMZA 1V5WA 2H18A 4Q1FA 3SJCA 3PR1A 1ZM2A 2WOOA 4FMDB 4PAOA 3I32A 2BBTA 2G0TA 3DM9B 4QJ5A 4ARZA 4DEXA 2PX3A 4BFUA 1PLLA 4C0SA 4BECA 2A3RA 1Z6GA 2F3TA 3IIKA 4QFMA 1PLKA 2JEOA 1NF3A 3BE4A 4GNKA 8OHMA 3QKSB 2JDID 4JZKA 1FFHA 1XJ0A 1KZGB 2O8BA 5AUNB 3LAWA 4DJTA 4KHZA 4LPSA 4UXJA 2RAPA 3RRMA 2W2VA 2OLJA 3B1XA 3NBFA 1F2TB 1FL9A 2BMJA 2HJVA 2V55B 4OJKA 4PR0A 1IBRA 2WV9A 2JJ2A 4MKHA 3TW8B 5G41A 3IEVA 4AKIA 4F4CA 2WM9B 4DCVA 4PHTA 4HLDA 2QBYA 3SDZA 4PXAA 1X1RA 2QTHA 2ZI4A 2I1QA 2C04A 1A5TA 2V9PA 4A82A 3QXHA 2G3YA 4LI0A 4Q1EA 5LBIA 1SQ5A 4LRWA 4AD8A 3C41J 5JJLA 1YZQA 2AXPA 2F43A 1UM8A 2O8FA 1DG1G 1XMJA 3TAUA 3BB3A 1CJTC 1BS1A 1JQLB 1RJ9A 2QORA 4KBGA 4A2QA 4BPBA 4CEIA 4G5RA 3NEJA 1E9CA 3AF4A 5CK4A 3MD0A 3VHXA 1F3OA 1G16A 1JR3E 1CR0A 3OAAA 5FUXA 4AKEA 721PA 2IX3A 2QAJA 5HKKA 4IDHA 4UXHA 4HLCA 2BJWA 4LJ8A 1N5KA 5FOVA 1VG9B 1QHHA 4AURA 1GNPA 5HCIA 2DBYA 3RSOA 3BH0A 3VR4A 3CWZA 1Z0FA 1ZIPA 2Z4RA 2CL7X 4D4KA 2J45A 1X8KA 1ZYUA 3BXZA 2OILA 4JLMA 4Y0VA 1TQ4A 2KBFA 3KX2A 3LW7A 3MJHA 3W5IA 3CR7A 1DPFA 5KDLA 4NZYA 4TL9A 5EXXA 3VNVA 2J3EA 3CUEF 1NJFA 2HF9A 1TAGA 3ZQJA 3ECCA 4NDZA 4YDSA 2QMHA 5E7MA 1VCIA 4IOLA 2FX3A 1E2LA 4QXAA 1DBSA 4LGMA 3VAAA 3U3JA 2YV5A 2GETA 2IXEA 4NYMR 1QG4A 2ZM5A 2RGCA 2ZR7A 3OFND 5JWHA 5J47A 1LB1B 3FFAA 1S4QA 2VA8A 3EC2A 2JLXA 3VU9B 3RS3A 1C4OA 1N6HA 5DYIA 2Q6TA 5EP4A 1K5GA 4JSYA 2MMGA 4DSTA 3WP0A 2WWGA 3DVLA 4EFLA 1G7CA 1A1VA 1CJVC 2C8VA 1TEXA 4XWOA 1KO1A 2QP9X 1KYIA 4Q4HA 4ERNA 1F2TA 3FHCB 3THWA 2XGJA 1KOFA 2CNWD 2EYUA 2V1XA 2GJ9A 1Q3TA 3Q5DA 3ZGXA 4JVLA 5H8WA 2O8EA 4V02A 1NN0A 2NGRA 3IBYA 4M1MA 4KSCA 1TL7C 3B7GA 5JECA 2LCFA 1JR6A 2O8EB 2JJ1A 1D9XA 4Q1DA 3TE6A 1XEFA 3OHMA 4DSUA 4UJ3A 4LHVA 4DSNA 2B6HA 3T1VA 5K8IA 2D7DA 3CH5A 4HDOB 4MKFA 2ZRBA 4Q4JB 1W4BA 2Q3FA 2QT0A 3TH5A 4PHFA 3ZS9A 3AVUA 2X2EA 5JRZA 3FB4A 2C9OA 4I99A 2FSGA 1E2GA 3T5DA 4BZPA 2AXNA 2ZRDA 3QKUA 2EFGA 4DWJA 1Z28A 1WRBA 5EXTA 3UG7A 1XPUA 2ZSDA 2NZJA 4A0RA 4GI7A 4S2EA 4XWAA 3B9PA 2GEVA 3BJIC 2F9LA 3CRW1 2CCGA 4PO1A 3MG9A 4P3YA 1YE8A 4QKQA 4TYYA 3A1UA 4LWZA 3U61B 2F6RA 2ZJYA 2CK3D 4PX9A 4QBHA 5LB4A 1OIXA 5JCZA 1T9HA 5EP1A 2FOLA 3V4FA 4C0BA 3H4MA 4CGZA 2WICA 4FXPA 1DAMA 2IWRA 1EFHA 4HB4A 2FEOA 4WVFA 4PO8A 5FUVA 3ZZTA 2ZYVX 2AKAB 3A1TA 3AKEA 3RS2A 4URVR 2JLYA 2WMOB 4V0MA 3BD9A 3A8TA 2QTVB 5HCNA 3EPLA 1GKIA 2YOGA 1KKMA 1KJZA 2PBRA 5CITA 3ADCA 4LJYA 1IN6A 2G6BA 3EG5A 4KVAA 2ZJ8A 3DMDA 4Q48A 3DZDA 2CCKA 3ASZA 1OYWA 4A8JA 3VHLB 5L3VA 2IA5A 2WAYA 3PUXA 1D5CA 5DE3A 4JL8A 1CU1A 3AQ4A 2W6JA 4TZ6A 3B9QA 2J0VA 1Q1EA 1R2QA 2O5VA 2UKDA 2W0SA 4V0OA 5GVSA 4EJSC 1RW4A 2A30A 4FIDA 2OUKA 4DSOA 3ADKA 1OIVA 2BMEA 3A1SA 3X1YA 4LBWA 3AVVA 1MO5A 5F9FA 2ZE5A 2OLKA 1G41A 1AN0A 1UF9A 1J8MF 2F1IA 1AKYA 4EKDA 4BRUA 2GHIA 4G1UC 5CDFA 1NLZA 1QHIA 4IDPA 5L3SB 2BIFA 2KBEA 1WMSA 5EE5B 2ZJ2A 4GOJA 4DRZA 1U2RA 5KPDA 4RJLA 4QBIA 5E7IA 1XPOA 1DAGA 4KV9A 5AJWA 4US1R 4I1OA 2ZRAA 5BN3A 1OHHA 4MRSA 2OE2A 4JIMA 2QG6A 1ZIOA 1F60A 1LNZA 3QVVA 1G18A 2KB0A 2WJYA 2A9KA 4Q00A 1ZNXA 4Q7JB 3QOFA 2REOA 4OYHA 3GQBA 2EYQA 2ZANA 1N6OA 2JLRA 2QZ4A 2D74A 3AKCA 3QXSA 4KCGA 2IEYA 3WY9A 5CM8B 4AWXA 3M0EA 4ACAA 3U4QA 4YMUA 3TW4A 4B75A 1E1RD 1VCNA 4OI1A 1CJMA 5FBQB 2C96A 2KSQA 2IYRA 3SU8A 4E22A 2F1JA 2VP2A 3JVUA 3VKHA 3K1JA 4TN1A 3KKMA 3LXXA 4HZIA 2OAQ1 4GP7A 4B2PA 4BFVA 4C0AC 1MRSA 1G8PA 2I3BA 5F98A 1XXHB 5JS8A 1H8HD 2IUTA 1OLOA 2ZITA 3K0AB 4NYIR 2JIZA 3H2YA 3Q3JB 3QIAA 5SZKB 4PZYA 1D2NA 4KBFA 2PEZA 3VKGA 3D8BA 1W0JD 4C30A 4IDOA 4HB2A 4JLAA 3DO6A 5KDDA 5UKDA 4ZI2A 1GFIA 2VPPA 4HLUC 4MRPA 1E2QA 3A4NA 2QSZA 4FINA 2R9VA 3CM0A 2O0HA 3RHFA 4TYQA 2WWIA 2ZRKA 5JWRA 4ESVA 4XSGA 1R0YA 2QMEA 3F3YA 3I73A 4GDFA 1DS6A 5AWFC 1W36D 1IXSB 3N70A 2PEYA 1HQCA 3AKYA 4IFBA 4MQBA 1WP9A 3RLFA 1UBGA 1KDPA 4DDUA 2R6GA 4V0LA 3U3OA 3U6BA 1Z0KA 1S96A 4M8NE 1NMYA 5M04A 1Z6TA 3AP3A 1SVLA 1TEVA 2D7CA 4MKGA 4M1YA 1DAKA 4AC9A 3I72A 1C9KA 5KYKA 1TMKA 4QGFA 1JEEA 2GDJA 1T4GA 4BFWA 2JJ1D 1NJGA 2AL7A 4M2LA 3RVBA 3FHOA 4NCIA 2H57A 2C5LA 3NIBA 5KSZA 2W6JD 2AKYA 4XVQA 5EZ5A 1W49A 5KNCA 4BLPA 4BASA 2IXFA 2HXSA 3LWNA 1DG3A 1M74A 4X8OA 3GLHA 1HURA 4NHOA 1KO7A 1E1RA 1OB2A 4DLRA 3B6EA 4US2R 4JS0A 1XEWY 3QKSA 1KDRA 2CDNA 1VYTA 3B78A 3I92A 3OIVA 2R6CA 1PUJA 2IBMA 2QA5A 1SVMA 2ZE6A 4HLQB 1LS1A 3I1FA 3V00A 4EPWA 1EK0A 1RRGA 2GCOB 2GCPA 4H1VA 4Q1AA 3QG5A 2ZSBA 4OI0A 3ZJYA 3EPJA 2PJRA 2ORVA 5JEDA 2GZDA 2RHMA 3IHLA 4DLUA 4JLBA 2V7QD 3MWJA 1QZXA 3WYGA 2OAP1 2IHBA 3DM5A 4Y0AA 5CK5A 2R8RA 1VECA 2PT7A 2A5GA 3KDSE 4Q9KA 1JECA 421PA 4ZIRA 4KITB 4A4DA 2LKDA 3CZPA 2GCOA 3QPVA 2QM8A 3X1ZA 2J7KA 2Q21A 5JJIA 2DFTA 3T06B 1IONA 2VQSA 1KI2A 3RYTC 4V03A 2FPKA 4DUGD 4URZR 2FZ4A 3KKOA 1CF4A 2EQBA 2EW1A 1AM4D 2C78A 2QROA 1S1MA 2IT1A 3P4XA 4N3NA 4A6XA 4EJSB 1JEDA 3GJ4A 4DB2A 1MO6A 3Q7QA 2X77A 1Q3HA 1XTJA 2PMKA 3PUYA 4GL2A 4DIEA 4ZV4A 1Q1BA 2V3CC 1VKJA 1L4YA 2OXCA 1LF0A 2W6IA 3LBNA 1CTQA 2KI5A 1GILA 2V6JA 5GJWC 3AVXA 2ECKA 1R5NA 2YWEA 3K0CA 4BQSA 4CRWB 3U7HB 2IYTA 3O8RA 1ZUIA 4Q4LA 1FMJA 1Z29A 2F3RA 2QM7A 1IN4A 4HATA 2IS2A 3G82C 5GADl 2Y8EA 1J2JA 1Z6XA 2QAGA 1SXJE 4PAQA 4TQUS 4CVNA 2CEAA 1KI7A 1KO4A 2H1LA 3H1TA 2WWWA 3IGFA 5F9HA 1GL7A 3A4MA 4R9UC 2FGJA 2ZR9A 4MGIR 1H65A 3MUFA 4R2HA 2ZE8A 3REGA 4FI3C 5DHFA 1HH4A 5EUQB 1CBUA 4PO9A 2QBYB 2HJGA 2RGAA 3FKSD 1I2DA 1KI6B 2H5EA 3ZVNA 3HR8A 4FMBB 2VSOA 4II7A 4JVMA 2V7QA 4M9ZA 1VMAA 3PUZA 3QXXA 3LLMA 1UBEA 1G291 4I1SA 2FPLA 2QGZA 2WTUA 4C2UA 2BM1A 3SYNA 2CLSA 4FWTA 2YZ2A 1FTSA 1NIPA
chains in the Genus database with same CATH superfamily
2A1TS 1I4TD 1VPLA 2RONA 4H1TA 4NATA 1I10A 1QGYA 2ZI7A 1UXGA 4L5JA 2G83A 4QDTA 1EFKA 3FYCA 2QZ9A 3BWMA 2HYIC 1S0UA 2AK2A 2JFUA 3IUQA 4X3OA 5DNWA 3LDFA 5FADA 4CR7A 1B2RA 1E5DA 1ZD1A 1M34B 2PKWA 1QZ3A 2A7QA 3D59A 3T3IA 4U8GA 3ZZUA 2AOVA 4AMGA 1GAEO 1PEDA 1UKBA 4G4SO 1VJGA 3VVLA 4DMFA 4MGZR 1G4AE 1HZZA 5FTJA 1IL0A 3HB7A 3SZLA 3IUYA 3ZU5A 2VF7A 4IDFA 1DAPA 3OE7D 2QJWA 4UM8B 4R8LA 3E15A 3IESA 5CIQA 3CLRC 1X92A 2P3SA 1OD6A 3W5JA 3IULA 4FZ3A 4ND5A 5B7PA 4TVSA 3URKA 1DCFA 3PCRB 1L7PA 3KSUA 3JQCA 3TL6A 3HUFA 1DT3A 4KWHA 1HE8B 1IEQA 5GGXA 3GR6A 4MWCA 5I7RA 1R0LA 1AKVA 2OGWA 5DHTA 4QBGB 4RF2A 3UAZA 1TTTA 3TZQA 2I9KA 4KQEA 3W6NA 1A8HA 1C3JA 1UC4B 3EZNA 4BTVA 3USES 3LW8A 1M5RA 2QUIA 3UPTA 2CHUA 5EOVA 3ICEA 2EFJA 4HGOA 5JW6A 4PYJA 4KDRA 4OJNA 2IOFK 5HG0A 3QF7A 2NMVA 1PQ4A 3IIMA 3A3YA 5AW7A 1W4ZA 1FDWA 4PICA 4RTSA 3EVBA 1V96A 3GJSA 3MYRA 1I94B 1M2EA 1NVWQ 3UUEA 1X38A 4D4HA 5J59A 2NU6A 2CWWA 1RXWA 1I30A 3I8SA 2K2QB 4L0CA 4JITA 1Y8RB 4A2QA 3ILVA 4HG2A 1P1CA 2YHIB 3GUCA 4XVHA 3SD7A 5KNDA 3CJRA 1GGHA 5IK2A 4L1KA 3KQNA 1NE7A 3BFKA 3HADA 1XD2A 1LW7A 3BRSA 2GAFA 2VHVA 2F9FA 2AUMA 3SXPA 1EQAA 3V6LA 1O2DA 3LY9A 4AB1A 4D97A 1EP3B 1HTTA 3OTQA 4LXIA 3ZU2A 1U63A 3HNRA 4GQBA 4GGMX 5BUQA 2QB5A 3HDVA 2OFXA 4GYYA 1PI3A 1Q0SA 2K87A 5K0FA 4TLBA 4F3RA 1KWKA 3F8WA 3GLTA 1XP8A 5IJ0B 1PJAA 4JEUA 5A62A 2FEWB 4TQ9A 3AEUB 3ONNA 4I6EA 3O9VA 1XNRB 1BHSA 2QG9A 4LHXA 1KI4A 4OHCA 1VJCA 3CWQA 4QVGA 2ETVA 3MMNA 4HVCA 4F56A 2ORYA 3IKTA 4J0DA 4LY0A 3PWKA 4ZIRB 2QMUA 4NAUA 3NYIA 2QG4A 4GR5A 4LECA 5P21A 1XLVA 1RRFA 3OMWA 4AU1A 4D9FA 3BBPA 2KWIA 4IRUB 3H9UA 3UG6A 1W88B 2WF6A 3QEOA 3CUSA 4TLCA 3NH9A 1ADJA 1YU9A 2XGOA 4PSVA 1JR3D 4CKBA 3CPSA 4NE9A 1R74A 4OQMA 3PWSA 3TB6A 1Z4KA 3WBJA 1EH5A 3GPDG 1RR6A 2DYKA 2IF0A 2JJMA 3GA7A 1HQKA 1H2YA 4ZDKA 1Q7TA 5LQCA 1NFQA 1UAYA 2VIIA 3HR7A 4IDNA 1PV2A 4K9RA 4DCGA 4JBIA 2IPOA 3OICA 1ZK3A 4OU5A 2VNSA 4R1NA 1R8YA 3BCHA 1IBCA 4OXYA 4S0XA 1BEEA 5B1DA 3L4KA 3KZXA 3URMA 3L0OA 3OUUA 3EF0A 5ELLA 4MVJF 5DSXA 1CEYA 3MHPA 1W85A 1E5QA 4IH1A 2GMWA 5G40A 5IBPA 3RARA 2FFHA 3VU9A 5NLLA 2LD4A 3N53A 1LV7A 3WYNA 4ZV7A 3NU1A 4G3XA 4LVUA 2X1HA 3NVKI 3KNZA 1CCWA 1G63A 5DGDA 3E1GA 2A35A 3OVMA 3U44B 5LZ7A 2AD5A 3JSXA 2JCSA 4OJQA 4DNQA 1BZYA 3N8IA 4ZQBA 3STUA 5TIIA 2J07A 1EGVB 4JT9A 1XLWA 4B6RA 4DTIA 1II0A 3JQFC 3RSCA 1TVEA 1ECGA 2A9JA 3LECA 3LVRE 3QI2A 2IDJA 4F86A 3U44A 1YD7A 1U7WA 2QV7A 3E22B 4HFMA 4QTXA 5BYAA 7AT1A 1JAYA 3W6PA 5L7YA 1A0OA 5FWXA 1JA1A 1RMQA 2FEPA 3VYRB 3F5FA 3ONDA 4V0QA 1V9CA 3OOEA 5E6SA 3PQ4A 3CPEA 3U4AA 4WK0B 3RR2A 3UC5A 2COKA 3HQ4O 1KSGA 1HMPA 1ZCAA 3RUIA 2Y66A 4RGBA 3MWEA 4EGCB 2QIOA 4C5CA 1PS9A 4I6JA 1O5TA 1VHTA 4HXFB 4D9NA 1KRWA 4WKBA 3VH3A 3FZGA 2Z1DA 3PNLA 2X0EA 2DKNA 1EWYA 1KI1A 1XHLA 1RYNA 4LV6A 4PIMA 4LVCA 5AOBA 3D54D 3W7VA 3GUYA 2DH6A 3ZHSA 1HEIA 1M1UA 4L27A 5FBWB 3EGOA 1ZVQA 2X4GA 1PWYE 1ISJA 1Y1PA 2VBIA 3IBSA 4LHZA 4KRFA 4DG9A 3OWOA 2C31A 3X2SA 1XTUA 4IFTA 4N3CA 2HNKA 4CDNA 4EEZA 1IY2A 1Q6ZA 4JJGA 3LX8A 4GSLA 2O8CB 3NHSA 4NAVA 2RD2A 1Q1ZA 2C58A 2POCA 2XYQA 4F1KA 1G5RA 4L8YA 4AICA 1KMCA 1A9XB 1AZWA 2VWPA 3D0KA 3UKOA 2VS1A 3RFCA 1TKAA 1Y9DA 4D9IA 1GA1A 1YQDA 1WW3A 2VAVA 4ZD6A 4ZYYA 7GPBA 3T95A 1HF3A 2FSHA 3T3DA 4EAAA 1O9BA 2FEAA 4TUYA 4G89A 3GELA 1EG7A 1WDLA 4CLXA 4BATA 4C22A 4IF4A 1HYGA 4MEAA 3H8SA 2RGXA 3HS3A 1NWHA 2WMNB 3CH6A 1FDTA 4OQEA 4B31A 4BZQA 1TMYA 3GJ7A 3WIOA 4HWSA 1KXZA 1T8PA 4NENB 3DKRA 4ZOBA 3UTCA 3D2AA 1ELOA 1E3QA 3HO8A 1YQGA 2YWDA 4KO1S 1IH8A 3NHRA 1R3DA 4I4TA 3ISTA 5KTYA 1H9BA 3FSRA 4B32A 1E9FA 2J6BA 1QWOA 3UZUA 1X1QA 3ZW8A 5K0TA 1SC9A 3NGMA 5G0UA 3RU3A 3ICWA 4A8TA 1KQOA 2F8TA 2W6NA 2P9JA 4BLVA 1HR0B 1MQAA 4J75A 3EDCA 5DIFA 3PCTA 5DBFA 5LB2A 1QVWA 2OCAA 3ABRB 4QG7A 1N5LA 5FWDA 3OQPA 4HNGA 3NBYC 1R15A 2AX4A 4M9RA 5LQJA 4QDOA 2VBGA 3FBTA 4XGNA 5LQRA 2FPUA 1MN6A 5ITVA 3KYIB 1L7NA 3ZYZA 1VYHA 3LI2A 3BIFA 3OT1B 3MTJA 4RADA 2QMYA 2Q5FA 3AMVA 2GN6A 1MU0A 2WK1A 4M6WA 4DQXA 4HGRA 4Q5IA 3ZV3A 5JNSA 1C2YA 2HD4A 3UPUA 4YC7A 5EQFA 3AEQB 3AK4A 3C8MA 4K9LA 4ZJZA 1F7VA 3C3PA 4TM7A 5IF9A 4Q7LA 2JFGA 1JVSA 4JI3B 3AUAA 3T6KA 1K7SN 1NXWA 4B8ZA 4KXQA 4BPRA 4W7SA 5HOEA 1BGVA 3GAMA 4CUJA 4TXMA 4MXDA 3CJTA 3E3AA 4YB8A 2RJOA 2H2HA 4M9SA 3IB6A 4RY2A 1QIGA 4KL8S 2Q0QA 4L0QA 3OM1A 4MV1A 5AICA 3CZRA 5DK6A 1OFHA 5M3BA 2B5VA 3L8ZA 3AVYA 2GVNA 4LC0A 2J9FA 1TAUA 4EUEA 2VBFA 2C92A 4L85A 4ERXA 2FF7A 1XEXB 1NW4A 1TCVA 2IIVA 2FG5A 5KDOA 2NUPA 1O0SA 1S2LA 2HXYA 3FF1A 5C1DA 5JSFA 5F7OA 4ZT2A 2QQEA 2V7VA 3AJRA 1N2CB 4I14A 3MT8A 3TR5A 3OE4A 5I9IA 1H1TA 5CVEA 2OY0A 4C2TA 4PU0A 2GGSA 3C48A 3FBWA 3T7RA 1V25A 2JFHA 5KU7A 3TECE 2B2XA 3SYKA 1N0UA 5DNDA 4Q39A 4H4DA 1G21E 3CEJA 4GM1A 5FEMA 4EPYA 5K8JB 4B6FA 4CM3A 4LYEA 4KQKA 1NVMB 2PD6A 3N0TA 3UT6A 1G3MA 3S8YA 3CIOA 3WGIA 3W5BA 1O94C 4F91B 3AJAA 1ML4A 5FT9A 2QP4A 1MNAA 1T15A 3ZGVA 5EJ9A 2ACKA 3CO0S 1Q0TA 3IKVA 1M73E 4AMVA 5HKKD 2GPJA 1QMGA 3A9RA 4JNCA 3WK9A 4LE1A 5LP6B 2CHVA 3BGVA 3AOGA 5JNLA 5DV9A 3ZW9A 4YJKA 4IAOA 4GKBA 1E1CA 5FNVA 3BC1A 5CYFA 2ZJBA 4H16A 4KQFA 3ZNQA 4BGDA 2LV8A 1FXUA 1L7OA 4G37A 2IYVA 3DP7A 2FQXA 4URXR 1P2BA 3O4IA 4JBYA 1EHCA 2E3JA 2ZZKA 4L22A 1L5VA 3MT9A 4IYJA 3UCEA 3QNWA 4U7DA 1T9ZA 3A2KA 1WXGA 2XJ9A 3HY6A 2XRFA 2WWXA 4M9CA 5ER6A 3KXLA 2HDOA 4FZJA 4NZZA 4A5SA 2ONCA 4B5LA 2FJPA 3OKFA 4GP6A 4IG9A 1E0SA 2JCGA 2BFFB 2WD7B 1JZTA 2JD1A 2AFHB 3CSUA 3F6RA 4X63A 1ODIA 3E9EA 5WRFA 2H2WA 3RAJA 4JEMA 3VVCA 1Z5VA 4C07A 5CCEA 4NK4A 5AKYA 1T4MA 4EZBA 1QTRA 4UM9B 1O58A 2IYZA 1E9BA 2RH8A 5KOHA 1IXYA 1XVVA 3AF0A 3IAM6 1TQ6A 3KJGA 3K5IA 4MR7B 4RD6A 5IJ9A 1LNSA 1GU1A 3JQEA 4XUDA 3VSEA 1X0XA 3DWEX 2O8NA 2BTOA 1PYDA 1MG5A 3LLCA 1LGYA 4RU1A 1H23A 3EFEA 1IHXA 2JVIA 1G2QA 4LNUB 3CHYA 1YK1A 3PWTA 1QVRA 5HDQA 3R75A 4JXZA 3FGOA 2IE8A 3DFMA 5FIUA 2BWJA 4DLTA 1FLAA 4H3SA 2VTBB 5LBUA 4DMGA 2HT1A 3AQIA 1MC1A 1T1GA 2PZGA 3H11B 3HWRA 4G97A 4BXOA 1IOVA 2GD2A 1FSGA 1Y7LA 1D07A 2H48A 3DDWA 5E3JA 2B7CA 1LDGA 2JCBA 1EGHA 5E2AA 3MBKA 3RUFA 4ZICA 3AOEA 1GP2A 3PD7A 4BMNA 1CT9A 1H5NA 1EM8B 4EECA 9LDTA 5J4VA 4IOJA 3ZXXA 4E15A 3E8MA 1X7WB 1T5DX 2BBOA 2GZAA 1W4RA 2O0JA 2OC4A 2P3LA 2O8DB 1OTHA 1II9A 3BRCA 2ID4A 3O4FA 5HK9A 5KTMA 1OAKA 4DSAA 1Q2UA 4EKIA 3ENZA 2VHYA 5DWVA 5M5BA 5ALFA 3OPNA 1RDFA 5C8VA 4E2XA 1L5MA 2H17A 4QT0A 2YWFA 4FE4A 5J5AA 4AZWA 1EBUA 4CM5A 3FMPB 3U5TA 3S68A 2EZ4A 3H19A 1H22A 3WIDA 1D03A 2VJBA 3WJ1A 4TTAA 3TIFA 1GL6A 3COVA 4KR6A 1DOHA 2Q6LA 2EP8A 3FUTA 4HOYA 3T94A 3Q8KA 4YBRA 5LKRA 2YOFA 3QBEA 5LQDA 3FETA 2A0UA 1H2BA 3FWPA 3DMHA 3TCKA 1V16A 1QP8A 4QECA 3K09C 3OOHA 3VTKA 1M1YE 1ZHFA 2G36A 4EHHA 3DS8A 1EB9A 1GTSA 8AT1A 3KAJA 1JI0A 1YV9A 2CY0A 3CF2A 1Q95A 1OYVA 2BUAA 2GYUA 3OIUA 1XIVA 2PM8A 1G9XA 1QHGA 4D96A 4BFYA 1U3GA 5LQAA 5D3QA 3C6ZA 3I1YA 2NTJA 5JZVA 2IPMA 5FWAA 3G8DA 4LZAA 4UUPA 4AF8A 3IO5A 4IHJB 2P6OA 3NIDB 1PWEA 2DBVO 3IPRA 1K88A 4Y2XA 5DM4A 5F9MA 5TR9A 5A3VA 1GL3A 2FK7A 2C3PA 4EQZA 5EKXA 3ADDA 3ZE2B 1CY1A 1SY7A 3TUIC 5A5FA 5JDIC 5IYZB 5DTRA 3NGLA 1AK9A 4MWEA 4Z3OA 3OT4A 5FTMA 3HMQA 3I5MA 4BNUA 4DAOA 4RTMA 1NZJA 1WY5A 2BMVA 2AWNA 3IUEA 4Z2YA 3JPYA 4RX1A 3JZIA 4DT1B 1ST2A 5LOVB 4ESHA 4ZP1A 3JARA 4TV8B 1IOLA 5KUTA 1P2VA 4ZAYA 2QM0A 3QMPA 4CKCB 5K4AA 1KDZA 1U7PA 4ZAWA 3S1SA 2VL7A 1QOPB 2X7HA 2C2OA 3H65A 1KMHB 5BQ5A 5FAKA 1RBYA 1TMOA 3L46A 3FYUC 2E5WA 1CZHA 1N9ZA 2WWYA 1EP2B 3EVFA 4PVDA 1AQJA 3IPAA 4F2DA 1Z0JA 1NBAA 1SK8A 4FQ7A 2YS7A 4D0RA 2CLCX 5IH3A 2JATA 3NTLA 1JXMA 4KPFC 4DCTA 5EG5A 2QRMA 2VWHA 3H9QA 1A2BA 4UU8A 1J4AA 2QMZA 2YWJA 2FSUA 1NLMA 1TYEB 4JU9A 5ALSA 2IOYA 2WDPA 1BNCA 2O2ZA 3F74A 1UBJS 1W85B 4UHKA 5IKEA 4ZXFA 5IH7A 1AB5A 1P19A 1R0BA 3VKUA 3IEKA 3HVRA 4KPUA 4XM2A 4U2GA 4B7XA 4IIUA 5BUCA 1OV4A 5KU1A 4U3JA 2ZIXB 5ALOA 5SYMA 5FO0A 4FIZA 3S2ZA 3P8ZA 2A86A 2DR3A 3PVZA 4TSFA 3IE2A 3LYLA 3VHQA 4G4SP 4JBXA 3N7UA 1F2DA 2FZLA 2WYUA 3CH4B 4WKCA 5TS3A 3ZV5A 1DVRA 1FP4A 3A1CA 3KZNA 3PX3A 4OG2A 4QGAA 4YN3A 3UAGA 5U4QA 5ARBA 2P4UA 2BGMA 1JKJB 4ZVTA 3J7AC 1MABA 5EXSA 5BOSB 5T64A 4D25A 1X74A 1Z17A 3GVHA 2B92A 3NDBB 3FHJA 2PH1A 3TBFA 4N49A 3IDOA 3QEAZ 1KVRA 2O7SA 3NJ4A 1DO0A 4MO2A 3HTXA 3K9FC 1H2RS 1SEPA 3CF6R 2WM8A 2D0DA 2X19A 3HKCB 4G5OA 4W8HA 5C9ZA 2RHWA 4XYBA 3V1NA 2QTZA 4AXXA 5I7EA 2H52A 2SKDA 3I9V1 4FEAA 3AGQA 4HWTA 2AC4A 1QIMA 4XJSA 1WXDA 4EF4A 3MTGA 2DFVA 3BFJA 1P0IA 1QQ6A 3T5GA 5BQ3A 2W8BA 1E60A 4U2DA 1E4YA 3AY0A 4BKPA 5HIJA 5IAEA 4UHFA 2X8AA 3WYAA 4DLVA 4ER3A 5CYGA 4FN5A 1S7CA 2PZLA 3HDHA 3BWDD 3KVOA 3MOGA 3WLQA 1QWSA 3ZI4A 4EATA 3N2KB 3ZS8A 4P5PA 1YZNA 2VJMA 5JZSA 3K1AA 3M7IA 1XCPA 1YRAA 3VR3A 4UDOA 5GJCA 5E1BA 3WGLA 4D45A 4MV3A 1JW9B 1PD1A 1FPMA 2OCKA 3BTSA 4QG3A 1B3BA 2F9MA 13PKA 1CW2B 2FDXA 1A4IA 1D0SA 1Y3FE 3FPKA 4RSHA 1XB2A 3SP1A 1GQSA 1RAFA 1FTYA 3N2GB 2Z1MA 3PEUA 1GR0A 5CEJA 3KQUA 1C0LA 3AWDA 2WILA 1FSPA 2JH8A 1PKEA 4GT1A 4A8JB 4YXFA 3K6KA 4H7HA 2O3TA 4JVOA 1IN1A 4UUQA 1NL3A 2V4ZA 3V8MA 4W5TA 1DJMA 5D7NA 3GGGA 3KSDO 2YS6A 4G84A 2CZQA 4MV7A 2B83A 1ETUA 2X7JA 4RTOA 1MXHA 2ZWVA 1XJWA 4JSTA 3ROXA 4PGHA 1RM0A 1AMNA 2JKZA 3A28A 1TRHA 3FMFA 2OESA 3IQXA 3UV3A 1MFPA 2DWQA 2PUGA 3OESA 1JAIA 3LUPA 3BUSA 4RVUA 5D84A 4CMKA 3DGFC 3W7AA 1TX4B 3MJRA 3ZHYA 4Q02A 2DZDA 4MW5A 3RKUA 4RE6A 2OCGA 1UXHA 2HZBA 4QGGA 1XK7A 3K30A 2BFCA 1N2ZA 4UARA 1DBRA 1NBMD 1ZNYA 4I7EA 2K4MA 4ZQGA 3SPXA 2AV6A 2QWXA 2YMPA 4B83A 3I12A 3KTAB 4ZT4A 4PHCA 2PS0A 1N25A 2OSVA 2BZ0A 1E4EB 1CXZA 2H9AA 3OEED 1DX9A 2GPWA 4GR4A 1KJJA 4I4CA 5LCXA 5REQA 3WLTA 2CYBA 4K0KB 3QWAA 1LQUA 1JWLA 2W2QA 4BZZA 1CRQA 4KXVA 2P40A 1PQYA 4CM4B 3GZNA 4MQEA 3IDQA 2F4NA 2VYND 1QTIA 1UWCA 2H11A 4U8HA 4YNBA 4A8PA 4POOA 2D5BA 5HKBA 1EG2A 1NVTA 3DMNA 4WNYA 2I4LA 3L6CA 3LUFA 3R8FA 1SGWA 3LX4A 5FUYA 1QE0A 2FDCA 3E4DA 4CEJA 1EWKA 3KZ1E 5F2KA 5B30A 1VKHA 3DEAA 1V5IA 1T9AA 3ABZA 4QIHA 4G1FA 1AGRA 3OU7A 5CT9A 5BYBA 3HPRA 1TAQA 1ZXXA 3P9PA 3QUCA 4O02B 1U94A 1O96A 2UYOA 3BF8A 2JGRA 3GCZA 3L7BA 3LWZA 5GAJA 3T1YB 1G3UA 1V95A 2P35A 1VXOA 2VUTA 5COBA 3CW8X 4PE5B 1SZCA 4N5HX 4BFTA 4B84A 1DKRA 3LC7O 1A97A 4PRYA 4DV6B 2ATEA 3IBCA 3ZIAD 2JLQA 1FNCA 2DT8A 1QIJA 2NN3C 3T1QA 3FPEA 3ACBA 4JLKA 3AR6A 4JVNA 4YRSA 1JUDA 2ZQYA 1LBQA 3O9ZA 1XAJA 1ONOA 4IJVA 4N5IX 1RLJA 3HWWA 3TEJA 4EQ6A 2WHRA 2H3EA 3FD8A 4ONEA 2HJSA 3H13A 4W9NA 4QTZA 5A0TA 2D5IA 1EXNA 1PS8A 4L95C 4TXJA 5D6NA 4D0SA 1N78A 3OFSA 4UZSA 1WMFA 3MWDA 1W2GA 3N2LA 1B7GO 4RFVA 5DTEA 3SIPA 1LJUA 3D8TA 1K4MA 1YZGA 3EUFA 3L40A 4CIVA 4OBBA 1VLVA 3J81k 2VCYA 4CQMD 2XGSA 1Y8QA 4MPPA 1Z5UA 4KR2A 2TS1A 2PUHA 3CTPA 3G3EA 5E2IA 5E6UA 4PPQA 3TQFA 3S0JA 3DE4X 3ESZA 1Q0UA 4LQ4A 3TJZA 4NAHA 3UMSA 3L8EA 5CDHA 2OCPA 3AJDA 1QUFA 1AVTA 3O2NA 4H7DA 3SEAA 4FHFA 5HNKA 3GP3A 1IM2A 2ZSIA 1AGNA 3JQGA 4BU1A 3EEYA 3RH0A 5CFZA 3RVNA 4DUPA 2QZZA 5A02A 5EA2A 2V4UA 3GBSA 4YV1A 2DFPA 5KTRA 4RFLA 1UEJA 1A7JA 4XB1A 1LA2A 1WZIA 1BW9B 4OQDA 4RJJA 3OTHA 2BEKA 4CTJA 2WIGA 3EVZA 2RE8A 4LRUA 1DEXA 2IPAB 3EG9A 4OKSA 3K9NA 1TYDE 4TKUB 4UTZA 4O4HB 3TJRA 3D8RA 4F97A 3CVXA 2WTAA 2RGNA 3I0MA 3SFTA 1A2KC 3OPQA 2J33A 3OTIA 3NVAA 4LMAA 5AP9A 1CV2A 5DW3A 1Y1RA 1QB7A 4RNCA 1GTZA 4EYKA 2ATVA 2JFBA 4EJMA 1LBHA 2VH5R 4LC9A 1U2PA 2FP4A 4CIWA 1JH9A 3PT9A 2I4TA 3KETA 1KVSA 2IELA 3L7NA 4HUTA 3JAMA 2JKVA 4L3OA 4YQZA 5K1ZA 3VDMA 1QDUA 3M4XA 4WHMA 2PL9A 4DW8A 1S5PA 2IP2A 1WZCA 3AESA 3IQEA 1N8KA 2OBFA 2P77A 1G5PA 4WCFC 3B3GA 1IOZA 5JJLA 1D1SA 1GTMA 4DLZA 2JGMA 4PVCA 4BMYA 3Q3CA 1BA3A 2KJQA 4CCSA 2YXBA 3UJCA 3KC2A 3KQPA 2X5OA 4X1YB 3TPCA 4D74A 5C5EA 2NZVG 2AG0A 3SFZA 4ZI7B 1KBQA 1XRQA 3C6YA 4D9HA 3H6GA 4WXRA 1KEZA 1H9AA 5C51B 3LF2A 5EWJB 1RHKA 2RH5A 4MS3B 5AM1A 1GZ3A 4JELA 4DM7A 3MERA 5KJ6A 3GLIA 2QLTA 3VJLA 4IINA 1D1QA 1UBRS 1TZMA 1EWRA 3DTYA 3ASUA 1EINA 1QOQB 1T0HB 2Z9CA 3LE8A 4Y2QA 4WAUA 1OXUA 1Z2CA 1YACA 1I7LA 4W9NC 3GQVA 2DBZA 2RHBA 1XTZA 5L51A 1RVV1 3DAYA 2G63A 1E79A 2PH3A 4FNAA 3PQCA 3QFSA 1W5SA 3E2PA 4WXEA 5KKCA 3AR3A 1IBKB 5CYOA 1ABEA 1CDOA 3BE6A 1ECCA 1GFZA 3KYDB 4NQZA 4NZNA 2Z6VA 2ZUFA 3Q88A 3V4SA 5JAIA 4KO8A 2BN4A 1HE1C 2XGMA 3WWDA 3HB9A 1EUYA 3HU1A 3GNLA 4OP3A 2FA9A 5EIWA 2BKUA 2BY4A 2XNDD 1IFXA 4G5GA 2R7AA 3H6KA 4JT8A 1JKFA 2IU3A 2ZVQX 1E79D 4G65A 4LQLA 5EQTA 2WZCA 1O57A 1PG0A 5D7BA 3SLGA 4BJ5A 4Z8XA 1QPBA 4H18A 2VQ6A 3FGPA 3FI0A 1LI4A 3W2TA 5E6RA 4CTOA 4RTPA 1U3UA 1BXGA 1M1YA 1XQXA 4IGEA 4IRMA 1YO6A 2QD3A 4N6NA 4XJXA 1LPNA 3KLMX 3MCTA 4I50B 5F7ZA 3RRNA 2Y0PA 3HBFA 1N5OX 3BXEA 5IMBA 4B9AA 1WM1A 5E3HA 5FHRA 5CLIA 1T6ZA 1G8GA 3DE5X 4YVFA 5LU9A 2GAIA 2HWYA 2HEIA 3G6WA 1RWOA 3I9NA 1QDEA 3IRVA 3WYEA 2W4MA 3Q6MA 2CVFA 3GEIA 1ONBA 2BD0A 4RSGA 4ZTBA 1JG7A 3EVNA 3O38A 1QJ4A 1H6DA 2PXHA 2ZBGA 3LPNA 4W1RA 4BV8A 2DKFA 5AI8A 1XNQB 5PNTA 4BFCA 5A9SA 3AIIA 2ADMA 3HN6A 2CB0A 1VXRA 2HIAA 4NFLA 2VDMB 4YJ3B 3WNVA 3Q7PA 2LKCA 1JG2A 4BIMA 4N48A 3E8XA 3I0ZA 5CPFA 1QHHB 1YGYA 3W9YA 3PNMA 4D8WA 3OMLA 4PF1A 4XYMA 3UMGA 1C3LA 1OJLA 5F1PA 2AE1A 3R3HA 1DG9A 5BV0A 1P72A 3OEHD 4Y2YA 4N6OA 4WLFA 4CEJB 1F0NA 4CTKA 2UVDA 4YR9A 4RSMA 2NNLD 1XRMA 1GUYA 3R77A 4MYHA 4HKTA 2I1VB 5EMNA 3IPCA 5DI3B 5IKOA 3RU9A 5H3HA 4D81A 1HFKA 1A04A 3LYHA 4FR2A 1Z12A 3B3QA 4MVJA 1EVZA 5H83A 1N7JA 1QC5B 1ZM9A 2E1RA 3KJQA 5BXQC 5I7FA 5JNVA 2F43B 2N0SA 4BC0A 1XVLA 3LPMA 3EC1A 1RCFA 3JQ7A 1OXTA 1U9ZA 1WXIA 3B8EA 1P74A 3QLVA 4DMCA 5HZGA 4N40A 1FYWA 1Y7TA 1QNLA 1VRVA 1W25A 1FNDA 1QH1B 4B5KA 1BYUA 3GDWA 5CCBA 2ZJ1A 1QO0A 1YS1X 2XZPA 3V8QA 3WGQA 1PZXA 3E35A 3WS7A 1C9JA 1QG2A 4IVRA 3S3TA 4DS3A 2PGNA 4PGAA 3CNBA 2Q3HA 3KZCA 2XB4A 1MIHA 2GI4A 4NYJQ 1Y5LA 3O83A 2HGZA 5EKTA 3KPVA 2IUEA 1C9DB 2WAOA 1WO8A 3GJRA 4RYDA 3DAPA 4D3YA 1L4KA 3HE3A 3ESQA 4U9HS 2W2PA 1SC3A 1YBAA 1H93A 4QDKA 1GPUA 3EN0A 4LJ6A 4XLTA 1ZL0A 2YMMA 4IIJB 3UENA 5K6AC 1CVRA 1E7QA 1UPCA 3IOCA 4G5QA 3T7KA 5KWIA 3B20A 1MC5A 1DV2A 1OZ0A 2R6DA 3A36A 1JAZA 1Q19A 3ZWQA 5HZKA 2G4VA 1LDNA 3ONVA 5CBKA 1QX4A 3SZRA 4YP5A 3PIRA 2IQIA 3G2JA 2PIDA 5IFLA 1M1NB 1NASA 3FYHA 2FK8A 1P2TA 2ILVA 4DT1A 1KDOA 4FKMA 2YC4C 4CL0A 1IRIA 1RWPA 2QP3A 4GICA 3PV0A 1HT1E 1QNFA 3PXCX 4HMQA 1DQZA 4JR0A 1X8LA 4R3NA 1YL6A 1YTUA 1QYWA 3UA4A 2COEA 3ILSA 1B73A 1UT6A 1TTQB 4F38A 2V0CA 2GEKA 5ICCA 2TMDA 3BERA 5KYNA 1JU4A 3DD1A 4IQGA 3RQIA 1LSSA 1PAUA 3NTUA 5DI3A 5DNEA 3EOAI 2VYVD 4UM5A 3O90A 1KH1A 2JI7A 3NEYA 2CVPA 4IZ6A 2J09A 3IELA 2ECQA 4YRPA 1EFRD 1SUBA 2XODA 3FGNA 3D4LA 4FJ0A 2JAHA 4Q47A 1EFRA 1ODTC 1QR6A 3QLUC 3EWNA 5GP1A 3S2EA 1V47A 2WUWE 3LRTA 1KK1A 4TMTA 3WKBA 3NASA 3H2BA 1KAQA 2X8BA 4FUTA 4OMCA 4QHYA 5EJ8A 1KIMA 2VP5A 4BRSA 1O6CA 4TUYF 1J06A 1I4OA 1VG1A 3RUHA 3A4IA 1T4CA 5TVKA 2C2GA 2PLAA 3ED1A 3CF4A 1E3WA 3FRJA 4RVOA 1POWA 2CMFA 3DAHA 1ZHOA 2XYGA 4PSAA 3OX1A 4OMUA 1FPQA 5BOSA 3QYPA 5I3CA 5KMGB 4NYJR 2WKQA 3QU7A 3RSFA 1FP2A 1UMCA 1H5QA 3M89A 3PR3A 4GXTA 2HV9A 3HCWA 1GNVA 4JLVA 3HFJA 3VH1A 1Z0ZA 3FI9A 4A0FA 1ZD5A 1QOZA 2CFCA 4MW6A 4NBUA 4FDTA 4RPGA 1XJQA 3E9DA 1INLA 2XWJI 2WZBA 1DIRA 1UCFA 1BDMA 3AJEA 1QORA 3WIBA 5F76A 3WL5A 2PWYA 3P9SA 1GGEA 1WA5A 4O08A 4DE5A 1L1RA 1QH0A 4ZEXA 2RGYA 3AY7A 5T3UA 3JD1A 3TFOA 4L78A 1EE9A 4V2IA 4W82A 5DTJA 3RT1A 4D98A 4AAYA 3OURA 3TL3A 4LIPD 2CLIB 1JX6A 1DTSA 2WUVA 1EPUA 4EHBA 4YRMA 1Y3HA 5ADVA 4E5VA 5AVVA 3E3MA 4JI7B 4FZ5A 1LSJA 4HL6A 1PUXA 1W5EA 5K0ZA 2VSYA 3GEEA 3RAEC 5KWSA 2WSIA 1AKTA 2ZRQA 2DERA 1N8SA 1W52X 3Q9NA 1T8UA 3CX4A 1QO0D 4HSEA 3RANA 5ICGA 2P75A 3G2LA 2Q27A 3LCRA 2BJVA 5DX1A 5JC8A 3ZWDA 3K1ZA 4WKPA 1OX5A 4JXJA 1JH8A 4KXLA 4A9AA 5ICMA 2B8JA 1S3GA 3W3AH 3SSNA 2X15A 3MAAC 1AMUA 2ATIA 3ZZMA 2R2AA 3CEMA 3H1AA 2R5WA 5JYBA 1YJ5A 2XDWA 4D9KA 3K09A 1U3VA 2AGVA 3FIUA 2UZAA 4MVJD 1YMVA 2H1VA 4WSOA 1C9EA 3T3PB 1VFPA 4CGYA 3HYSA 5JYEA 1LLQA 4QHTA 5D3ZA 1P2DA 4CKCA 2MYTA 4KK4A 3HJCA 4S1OA 5E1MA 3K9CA 4HQLA 2VRCA 4BQOA 4D42A 2P3QA 2YWHA 2ID7A 4D99A 1U0NA 3GUZA 4MJXA 1VE7A 4CEHA 4MS3A 3ASYA 2VQDA 3GGJA 1NFRA 2QHXA 5CLQA 3S2IA 4IJKA 4CE6A 4F04A 5CA1A 5AVWA 2J46A 3PLAE 2P1RA 4EGQA 3AUYA 3CKMA 1A77A 2GF9A 2JFYA 3JQFA 1T43A 3CLSD 3N8KA 3GOQA 4I3HA 4BNNA 2PS9A 4WOKA 4LHEA 4ZFNA 3OA2A 1ISMA 1UWVA 2I4RA 1KP3A 4D8YA 4AFNA 1RC0A 4MPDA 2DFLA 1RHMA 5LM3A 1H3FA 3OF5A 4BV9A 3HYLA 3F6PA 2Z5VA 3T4EA 1P60A 1PVVA 2WHYA 4HNVA 3UGKA 3QXJA 4UUMA 3T61A 3ZCRA 4GGOA 1T9BA 2I6FA 3HA7A 4ND2A 4Z4GA 1P1FA 1ZG3A 4UZFA 2FE4A 3LBHA 2EQ5A 2HI0A 4YT5A 4DLSA 3A1NA 1NA5A 4BMZA 1N0VC 1X13A 2P27A 1M0EA 3TOXA 3LOUA 3MCAA 1REQA 5TT0A 1T3TA 3DLCA 1AQ6A 4R6XA 2ZAMA 5U4XA 1JFFA 4MH0R 5AW5A 1XZDA 4NPHA 3U31A 3CLSC 4YLGA 2WLSA 4K28A 4DUGA 2SKEA 4ALLA 5ALLA 3O94A 2DJIA 2FRDA 1KSFX 1C1DB 1VL1A 3LG2A 4L3VA 4RK4A 3OG9A 1GCAA 1FX0A 5AI5A 3KVRA 2P9FA 4JEIA 1L5HA 1ND6A 5ALVA 4ND8A 2GVZC 3LP5A 3K70B 4QPPA 3A7EA 3HYNA 1JR4A 5T7BA 2QN6A 2TECE 2CLOB 4DDVA 1IOWA 3ETGA 3NKFA 5FORA 4Q6BA 5GZ6A 1IVNA 3HV2A 1Y37A 4OGFA 1KS2A 3EASA 3GJ8A 3C4JA 2IF2A 2KLBA 4B3BA 4CV2A 4XFJA 4ZC8A 1G2PA 2OGZA 2QX4A 3DTTA 3L4BA 4HNHA 1C7IA 1UKVY 1S2MA 4HNQA 4PG7A 4UAGA 1IVSA 4BO4A 3B7PA 2OO3A 1MW9X 2E2WA 3RVQA 4RWZA 2HMWA 4QWWA 1GCGA 3K3PA 4EKGA 3WAKA 3IVXA 1JHZA 3QVXA 4BUJA 3DT6A 3OLWA 3SN6A 4U7PB 4PTYA 3GFGA 4MVWA 5FDFA 1Z6ZA 3RS8A 4K81B 1N2XA 2QT1A 3MBOA 2AI3A 4QXMA 4U00A 5CVDA 2HQ1A 1R6TA 3WGMA 4W5RA 1WCWA 1XZCA 3IH5A 1B8PA 4JYPA 4Q3BA 2QNBA 5DNUA 1FU4A 4R0MA 5KAPA 4P3KA 2EKBA 1XA0A 2HPVA 3L8MA 4H08A 4HNSA 4J90A 5KWEA 1RRPA 3ANXA 1NVBA 3GOHA 3PX7A 2J3HA 3WWZA 2LCIA 3A37A 1UDAA 1IPHA 3Q2OA 1X2EA 4ID9A 1T8WA 3LHFA 1GHTA 1N2GA 4LQCA 1MD9A 1UODA 2JRCA 3ZV4A 3VX4A 3WJ2A 1JDBC 3S7TA 1PV4A 4GOKA 3OECA 4I81A 2G6TA 4Z7NB 1GTL1 1G20E 1I7NA 1RPAA 1VCOA 2FPIA 2WD8A 4H7FA 4UEOA 4DLLA 5IDVA 3U3MA 3LHDA 3KIPA 1EFAA 4M89A 2XZLA 4PY2A 3SJBA 1IZYA 3HRKA 3IMEA 1X7DA 1ZAKA 1U7XA 2PUTA 4GKVA 4LA4A 4NE7A 4NEGA 5AM0A 3TIVA 2YN2A 1Q1GA 3UM9A 1C9YA 2EJBA 1E5VA 2WP0A 1XDBA 4GX2A 1RC8A 3UHOA 3KKKA 4G1BA 3G8CA 3N6XA 1XZAA 4C87A 2IYSA 2VF4X 5KX5F 1I2CA 4DJAA 4ENRA 3RC3A 2BKEA 4IUBS 2E4VA 3GCWA 2R00C 2VAXA 3MILA 4Q3NA 3IX7A 1CDDA 3SX0A 1WB9A 1JLSA 5I48A 3ADBA 5A5DA 1NMQA 2GR9A 3A6KA 3DJFA 1JHMA 3PQDA 4PQGA 2WIDA 3I4FA 4Q3OA 4ENSA 4M21A 4IXMA 4OUDA 2PQ6A