1F2TA

Crystal structure of atp-free rad50 abc-atpase
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
149
structure length
145
Chain Sequence
MKLERVTVKNFRSHSDTVVEFKEGINLIIGQNGSGKSSLLDAILVGLYWPLRIKDIKKDEFTKVGARDTYIDLIFEKDGTKYRITRRFLKGEIHAMKRLVGNEWKHVTEPSSKAISAFMEKLIPYNIFLNAIYIRQGQIDAILES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAD50 ABC-ATPASE
publication title Structural biology of Rad50 ATPase: ATP-driven conformational control in DNA double-strand break repair and the ABC-ATPase superfamily.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Replication
total genus 31
structure length 145
sequence length 149
ec nomenclature
pdb deposition date 2000-05-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1f2tA00
2ZS7A 4US0R 2Y8EA 5EE0A 1W36D 4AG6A 5JSZB 2OBLA 2DFLA 1GDDA 1S8FA 4Q01A 2WJGA 2WICA 3K70D 4B3GA 1E2GA 4Z8XA 4IVRA 1COWA 1CP2A 1NN3A 1MABB 2QUZA 4D25A 5FBLB 1W0KD 1VMAA 5FTJA 4DDUA 2FNAA 3ZZTA 3EIHA 2FOLA 3SQWA 3ZYCA 4NCJA 1W0JD 4HZUB 2ECKA 4NYJR 4QC2A 2ZI3A 3NVAA 3QEOA 4G1UC 1NKSA 2J5XA 1E2PA 2C8VA 3BK7A 4EPVA 4KYIB 4Z51A 3QKRA 3DPUA 2P3SA 4JLJA 2PT7A 4LJ8A 5F2EA 1L7VC 1P2SA 1XEFA 3O8BA 2OUKA 3CF6R 4Q1CA 2P67A 5KDLA 3FMPB 4M8NE 2FX3A 5IDVA 4PAOA 1GZSA 2RCNA 1KKMA 5G3ZA 2O8EA 3RRYA 1Q57A 4X8HA 2VP9A 1CR4A 3P20A 3UPUA 1CR1A 4C2TA 2HUPA 4C0HA 3UANA 2A5JA 3TBKA 4PTLA 4XH9B 2RGXA 5DI3A 4D0GA 4V0ME 1E2EA 1Z8FA 2NO1A 3QNUA 4ZCMA 4TMWA 3LVQE 4C30A 3I8XA 1E4YA 2NIPA 2ZJAA 1LNZA 1W4AA 4POAA 1DS6A 2B6HA 3VX4A 2V3CC 1RPZA 5AUOB 1KMHB 1IXSB 1U90A 2WKPA 4KFUA 4RVCA 5F98A 2QBYA 3KUDA 4DLRA 3CM0A 1OFUX 3LW7A 3KKNA 1XJQA 4YDSA 2NMVA 1CLUA 2VP5A 4E09A 1G20E 3KFXA 1DVRA 2ERYA 5DI3B 1N0WA 3EARA 4WOPA 2D2FA 1H8ED 1MKYA 1X1SA 1SHZA 2IYVA 1M74A 2NO6A 2LKCA 2QAGA 2CMKA 3AKEA 1E2NA 2ZJ8A 2P0EA 1VG0B 3AV0B 3PUWA 1VCMA 1G7TA 3Q9LA 4KI0A 2EWVA 1A5TA 2IA5A 1U81A 2GZDA 4LBZA 4C0JA 3LAWA 1NVVR 3KUCA 5D3MA 5DH9A 3T12A 3MWJA 1Q21A 3KQUA 1EFRD 2RGEA 4C9BA 1EFTA 4C0SA 1T91A 4KAXA 1FUUA 4QKQA 2IYWA 3EPLA 5FOUA 1CIPA 4V0OA 4BASA 2GBLA 2QBYB 5JS8A 4KLNA 1XDBA 3OE7A 1VHLA 2A7QA 2B92A 3PVSA 4GZLA 2PT5A 5CJ2A 3RRNA 5CB8A 1TTTA 1TAGA 4AKIA 1XZQA 2VIIA 2C96A 2F1JA 3CRW1 3KFVA 3SC3A 2ZPTX 1QVAA 1ZW6A 4P32A 2ZU0C 4QBHA 1ODFA 1KHTA 2QAGB 721PA 2DWPA 5HPYB 2LKDA 1SVSA 1UEIA 2G88A 4RKFA 1UKZA 5D3QA 5JI2E 1J8MF 1PZNA 2DFNA 1E2IA 2IS1A 1GFIA 1GNRA 4NTZA 1X1RA 4DDTA 1S2MA 4IOMA 4L9WA 1WBDA 2WWXA 4L5BA 4LV6A 4A0HA 1JQJC 1KI7A 1CRPA 2ZETA 4AG5A 2PH1A 3HR7A 4DEXA 2H8KA 4EPTA 4O25A 3QBTA 1OXTA 3H1TA 2WVJA 1U8AA 1NMYA 2J7PA 3C8UA 2JCSA 4IDHA 4I81A 2DWOA 2W2VA 4KVAA 4JLAA 1VG1A 1AQYA 3B78A 4KXFB 1KJZA 4JSYA 2O8CA 1DOAA 2EYUA 3AF0A 3ADCA 1Z3IX 1VCOA 1XMSA 4RD1A 4Z54A 4UNSA 2O8FB 1ZNYA 4F92B 3ZVMA 5LD2C 1RYHA 2MSEB 4NCKA 2ONKA 4DZZA 1E2JA 3CPEA 3LBHA 4WVFA 1NVUQ 5IK2A 1E2DA 1FNMA 1U2RA 4M9ZA 2AHOA 4FN5A 1G3RA 4PZZA 3U3OA 1MOZA 1UM8A 3I4LA 3IKJA 2AXNA 2Z83A 4OK3A 1B0UA 3X1DA 4ASUA 1N5KA 2KSQA 3KB1A 5LD2B 4BLQA 3GEIA 2WSSA 3LXXA 1E79D 1H8HA 2XTZA 1VDZA 1JALA 4HB0A 3P27A 4I4LA 4LJ6A 4IHQA 5E7IA 3U4QB 5KUTA 4V0LA 3GMTA 3NH6A 1ZD9A 5J4VA 1E1RA 2N1BA 4B74A 2VHTA 4I1VA 4MGIR 3K09A 1WP9A 1YZGA 2F3TA 3WYGA 2QSZA 3PCRB 4PANA 3SBDA 1LTQA 4N0EA 3RDPA 1C1YA 2FF7A 1OKKD 2ODNA 4HB4A 1V43A 4A1FA 3TQCA 4A15A 3ASYA 1D6JA 3I92A 4MGZR 3SJCA 5EUQB 4US1R 1R10A 1GL9B 3TUJC 3LQRA 1XEWX 4IKEA 1W4RA 1XTRA 1SVKA 2G83A 2O0JA 3RVBA 2GXSA 4BFUA 2R44A 3R7WA 4F93B 3TR5A 4QXAA 2D7CA 2OFWA 2REBA 1M7GA 3LNCA 5G53C 1GRQA 2O5VA 1G6OA 5JWRA 1ZRHA 5CIWA 1WRBA 4R98A 4P4SB 4GRAA 2B8TA 5KSZA 4DCUA 4LGMA 4OHZA 3A1VA 4RD6A 4TMTA 3W5IA 3KKQA 2C03A 2XZOA 4CZ2A 3GJ4A 5GJWC 1IJFA 2HLDD 3Q5EA 5JFGA 4OI2A 4IXMA 3AUYA 3B5JA 4MH0R 4RCZA 4HLCA 5FI1B 3VNUA 4IVPA 3AEZA 5F3WB 4NE2A 3ZZUA 4Q9IA 1KK1A 1IN5A 1CULC 2KI5A 2IW3A 2YC2C 2ZYWX 3TK1A 3X1WA 4AYTA 1FTSA 2CL6X 2FG5A 1R0XA 3BH6A 2Q0HA 3OE7D 3RS4A 4EQ6A 2VSOA 1FQKA 1E0AA 4B2LA 2QQ0A 1FFHA 5BYJA 3QKTA 5FR1A 3SE0A 3U6BA 2XB4A 4GDFA 1PJRA 2IEYA 2IS6A 4JVSB 1OF1A 2JASA 1DO2A 4IJMA 4RY2A 3RC8A 1OHHA 2OCPA 3THXA 5HR5A 4AWXA 2OBNA 2B21A 2BDTA 1XTIA 1JPNA 5CDFE 1JR3A 1F2TA 1XRJA 1Z5ZA 3U3JA 3ZZ0A 2GDJA 1UBCA 2RMKA 3FGNA 3VHLB 1SZPA 3W5JA 3WP0A 4BUJA 1CJUC 4OL0A 4BFXA 4CEIA 3BD9A 4UNPA 4IVQA 2OAQ1 2QT0A 3BGWA 5JWHA 2OHFA 4EQ6B 1XD2A 1SXJC 5IRCD 1G21E 2PJZA 2ZRMA 4HUQA 3UWKA 5FBRB 5JEDA 1LV7A 5DHFA 4D0LB 3IIJA 2GCOB 3GQBA 4AC9A 2IK8A 6Q21A 2ZRJA 4IOJA 4QJ5A 3QXJA 4OQFA 4XTCS 4GFDA 5KNBA 1Q20A 3THXB 2WPDA 1GM5A 2ZJ5A 1P60A 1SQ5A 1SXJB 1CKEA 5C1BA 3H84A 4UNQA 2ZEJA 3CIOA 1OE0A 4TMVA 2ZR7A 4PO9A 5AUNB 2VHUA 4U7DA 3GLGA 2FZLA 2GAOA 4CEIB 1MR3F 5EXTA 4OI1A 2I3BA 5DHAA 2BHRA 3IPXA 1T5IA 2XZPA 2ATVA 1S0UA 1LS6A 4WIAA 1OPXA 4XVRA 2E87A 5EE9A 1DAMA 1E9DA 1R7RA 3QUSA 1GAJA 2PZFA 2BV3A 4E5UA 2CCJA 4B47A 4M21A 1NL3A 1W2GA 2J9RA 1JAHA 1G8FA 3M0EA 2GCNA 3ZIAA 5JI3E 1D2EA 2YWHA 3TVTA 2JLXA 2Z4SA 3AF2A 3GLFB 2DCUA 5H1YA 1MRSA 4M22A 3U6KA 2ZSBA 1GNPA 5DN6D 4TLBA 4QNRA 1IM2A 2VLIA 3GLGB 3PV0A 3L0OA 4LYAA 3BC1A 1SVIA 4TT3A 3S1AA 4JT2A 1E9AA 1HURA 2Q6TA 4XJXA 3A8TA 1P9RA 3FHTA 3DO6A 2JJ2A 2XB2A 4XVUA 2FU5C 4UJ3A 4NPHA 4R9UC 3ZS9A 2HCBA 2FGJA 4G5GA 2MSDB 621PA 5E3HA 3CX6A 2F1IA 1CJVC 1ZIPA 3QVVA 4HLUC 2GRJA 4RZ2A 2NOAA 3TMKA 2IBMA 3CH4B 1GL7A 3B1WA 5L3SB 4Q7MB 3PITA 1II0A 2VH5R 3AGPA 4UXJA 4MGKR 1XBTA 4ZDWA 2W58A 1GNQA 4LHXA 4ZI3A 4HLDA 2QMEA 4RCYA 4YMUA 1F2UB 2GXAA 2IUTA 2JIZA 4XWAA 2V1UA 1E69A 2P6NA 3QKSB 4Q4HA 2EQBA 3K9GA 3S1AB 1JR3E 2VL7A 1LS1A 4JL8A 1XFAA 1U98A 3R9IA 3NC1C 4NYIQ 3B1ZA 4HYYA 4LOAA 4QJ3A 1I2MA 1KO7A 1Z47A 2CXXA 4Q1AA 4QJ4A 4EUNA 3KQLA 2RHDA 2RGNA 4BLRA 4EDHA 1BKDR 2XOKA 3OEHA 1FP7A 1T8TA 1XWIA 2PEZA 5KPJA 2ZRDA 3LA6A 4O3MA 3IDQA 4HUTA 1K5DA 1I4LD 4J0QA 1RYFA 4GNKA 4L16A 3RS5A 4IDQA 2V6IA 3ASZA 1ZM4A 1ZUHA 3EPKA 1WMSA 3MSXA 2FFAA 5AJYA 3UKDA 2CVHA 3EA0A 3G82C 1QHHA 1P62B 1WXQA 4AI6A 2G77B 4M1TA 2GK6A 2N46A 1E96A 1JECA 1JXOA 3SFVA 3TIFA 1JBKA 2I1QA 4TWZA 1HTWA 1SKYE 2OZEA 1UADA 4NL4H 2JLVA 1GVNB 1JR3D 1VECA 2CE2X 4CT4B 3RS3A 3DKPA 3NC0C 4Q1EA 3VTKA 4BFZA 4F4JA 2F1HA 2WHXA 2ZREA 5AJZA 2YOGA 3GLIE 3GFPA 3BB4A 4E22A 3Q7PA 1AZSC 4EJSA 5K8IA 3R20A 4NU0A 4LBVA 4W9MC 2FMXA 3GJ0A 3EZ6A 3GCGA 1TPZA 2C2HA 3OEED 2G0TA 5KDDA 2H1LA 4M9QA 4BFVA 1OIXA 4H9GA 1GG2A 1DADA 1Y63A 1Z83A 3IQWA 2ZRAA 3MG9A 3WNBA 3LXRA 1N6NA 3TSZA 4Q4AA 4DHEA 3BH7A 2VF8A 4Z8YA 2AK2A 3SQXA 4MRSA 1N6HA 1KDPA 2VHQA 2WJIA 4OI4A 5FTKA 3AF1A 1OW3B 2ZI5A 1H65A 3TLXA 3F5FA 2DWQA 4PO8A 3CLVA 1WE2A 5EP1A 4QG7A 5FUVA 3SBEA 3A6PC 2A2ZA 2P5SA 3OFND 2D2EA 4BEJA 3QF4A 3SJAA 3CPHA 4JLKA 4D4MA 2CEAA 3T1VA 2BMDA 2ZE8A 4W5JA 4KITB 3QSYA 4JYBA 2FH5B 4DCSA 3NH9A 5BW8A 1W7AA 2YOFA 4CEJB 1MO6A 3PUZA 3BORA 2WOOA 1GWNA 2KBEA 1ZAKA 4IXNA 3C41J 3BERA 1K6MA 4DB4A 2EFGA 1W36C 821PA 2J3EA 5CM8B 2IYQA 1NJFA 4Q4AB 1WF3A 4W5HA 3EIQA 3K70C 2BEJA 1W5SA 1N0UA 4NCHA 4PR0A 2OFOA 4QHYA 1TU3A 3RRZA 3P32A 2P6RA 1W44A 4DT1A 3IQXA 1NLFA 2XSZA 2BCGY 2V9PA 2AXPA 3MLEA 3MFYA 4PPFA 4A8JC 2ZS8A 4D4LA 5TY0A 1W36B 3T61A 3TKLA 3FMIA 3Q72A 2BJVA 2CE7A 3B13B 3K70B 3GJ5A 1KY2A 3TAHA 1YZKA 3HYTA 3GLHB 1G3UA 1DARA 4PC2A 3OAAD 1G41A 2JLZA 1E9SA 2GEUA 4AYWA 4PZYA 3TSOA 1WBBA 3DOEA 1NBME 1QHGA 3M4YA 4A8JB 4JVNA 3TR0A 4Q02A 5JRZA 4NH0A 4WA7A 4PC1A 4D81A 2ORWA 4C0LA 3EZ9A 4KFRA 3AVTA 1QG4A 4ZDKA 2RGCA 2GZHA 1VYTA 1ZJ6A 1E32A 1ZCAA 1S4QA 4QHSA 1E1QA 1TF5A 2ZYUX 4A9AA 4GOXA 4DIEA 1XP8A 3KTAA 4URUR 1E9RA 1BOFA 2AFIE 2ZYVX 1XPOA 2RHMA 3BAFA 5SZIA 1SVMA 4A4DA 1S96A 4OHYA 3EZ7A 1US8B 1MO5A 5FOXA 2J0UB 4OJQA 1XB2A 2WBLC 3R9WA 3SOPA 2H7VA 4DKXA 4LBYA 3SDZA 1YU9A 2JJ1A 4DUGD 4OHXA 1NBMD 2AX4A 2FPLA 2YNMA 4LWZA 2Z43A 1XTSA 5B30A 221PA 5JSZA 1KK3A 4D80A 2DB3A 1TEVA 1EG7A 3KTAB 1DAHA 1X6VA 3PR1A 2QE7D 1Q1BA 2CL0X 1FQJA 1MABA 2VP6A 1W49A 3M6AA 4LHYA 1CJMA 2JJ8A 2AWOA 1LY1A 4A2QA 1M34E 4BGDA 2IYSA 1HEIA 3SNHA 4DIDA 3K0CC 4AKEA 4GMXA 2P6UA 3IUYA 2DFTA 1AK2A 1SULA 1A82A 2WM9B 3REGA 1U8YA 3SFZA 2V8OA 2Z6VA 2J87A 4LI0A 3PUYA 3X1ZA 3ZGXA 4P4UA 4HDOB 5AJVB 5F9HA 3K0AA 2GNOA 1R5NA 3LVRE 3T1TA 4XSGA 2P2LA 2C04A 2IYZA 4Q9JA 3VKGA 1SVWA 2CCGA 1F5NA 5EUMA 4JLDA 1GUAA 2N42A 3KKPA 2IL1A 2EVWX 1VTKA 2H16A 4LY6A 4KU4A 2V54A 3BB1A 3RANA 4CYMA 1G7RA 4MYCA 5K8UA 3EIEA 2G9NA 3B9PA 1NVWQ 4TTPA 3NEYA 1Z6YA 3UWOA 1DELA 3EWSA 5FPTA 1UJ2A 4CGZA 4ON9A 1U99A 2F55A 2V4ZA 1VHTA 3B82A 4JJKA 4BPBA 1G3MA 1ZU4A 3K0AB 1RRCA 1XU4A 2RGBA 3LBIA 1MV5A 5JWOA 2FEOA 4Q7JB 2IYTA 5J40A 3ZD7A 1C4OA 1A1VA 1YE8A 3KJHA 1TL7C 3IEVA 5FPHA 1KMHA 3T15A 2ZRCA 4WW0A 2GF0A 4WBSA 2OAP1 4EFMA 3VKWA 3ICEA 2FSFA 1G4AE 4LC0A 3U44B 1ZD1A 1T8UA 2HF8A 4G5RA 3SEAA 1QRAA 1KK2A 3ZLJA 4RFVA 1EWRA 2GJSA 2ZJOA 4W7SA 3GJ3A 2BKUA 2JLYA 2GILA 3VR2A 5JJLA 1XCMA 3AVPA 1YZTA 2GEVA 1HE8B 3TAUA 3V4FA 3U7GA 2OT3B 2D74A 2Z4RA 3Q3JB 4Q1BA 2ODWA 3AF4A 3ICQB 3PFIA 2RGGA 3BIFA 3KJIA 1E98A 3SS8A 2E1RA 4XTRA 2D7DA 1ZP6A 2YVUA 1EFUA 3QPWA 1FMJA 1MT0A 2FFBA 1G18A 1CTQA 1DE0A 1F60A 2IYRA 1NN0A 2ASEA 2B8WA 3OF5A 3NTUA 1LF0A 3QPVA 4N0DA 3IBGA 4KFTA 5DLQC 4HAXA 4PC7A 1NI3A 3IIKA 3CWQA 3FFBA 3MJHA 5FTLA 5J4HA 1OH7A 3NHBA 4DC9A 4M1SA 2HV8A 1L8QA 1P5ZB 4LYFA 1RKBA 1S9HA 3L8YA 3UXMA 1NRJB 1NLYA 2EWWA 3CW2A 3CZQA 5HE8A 4ZKDA 5H8WA 2UKDA 3BFVA 2W6IA 3K9LA 4F4IA 1Y3AA 4Q03A 1WA5A 4Q1FA 2FPMA 3RC3A 3T5DA 3JVUA 4Q5IA 2W6JD 1RRFA 3IHLA 3FOZA 4GP7A 1AN0A 3EXAA 4H1VA 3ADBA 3I62A 4Y0AA 2WWFA 1OFTA 4P4TA 3GEEA 3RWMB 1ONBA 3N2IA 2IUUA 2ZE7A 2NQ2C 2IYLD 4II7A 3RS7A 2QMUA 4LYJA 2BM1A 5KO2A 3DEFA 2OV2A 1M8PA 1A2KC 3EG5A 4RD4A 3W3ZB 5HKKD 2O8FA 4TYQA 4ABYA 1G7CA 3MGCA 3A58B 1KI6B 4C0BA 4QBGB 2DHRA 1M7HA 4TLAA 2JDID 1XD9A 3K9NA 3TUIC 4UXIA 4KSBA 2BKEA 3HPQA 4RD3A 4DLWA 2GJ9A 3V00A 4C2UA 2EFDB 1E2HA 3A1UA 5KSOA 3EC2A 1IHUA 4MITA 2BMEA 1RJ9B 4B33A 1KI1A 2OXCA 2QORA 5DE3A 1COWD 1II9A 2J0VA 1XMIA 3GJ6A 5FUXA 3DZ8A 2XEXA 3U4QA 1YQTA 4PC3A 1E0JA 2DYKA 4MYHA 4B34A 3Q7QA 1FX0A 2IYXA 3ZD6A 1TF7A 1UKVY 2X2EA 4KCGA 5E7JA 1G8HA 1QHNA 4Q00A 3P26A 4NYMQ 1N3BA 1UBEA 4HLQB 3VU9A 1KAOA 5IF9A 1Z06A 4BE7B 5CLQA 2NO0A 5CYPA 4JYCA 4YQFA 1KGDA 2Q9BA 4JLOA 5FOSA 4AURA 1G17A 2NO7A 2Q3FA 4HAUA 4JZKA 2PCJA 4MRVA 2FWRA 1KJWA 2DPXA 3WNDA 3A4NA 3FKSA 1W48A 3FPAA 3K0EA 5LB2A 2CVFA 2F9LA 3EZ2A 2CJWB 5DGXA 1MRNA 2ANCA 4OQXA 521PA 4LV5B 1QZXA 1FX0B 4B6EA 4JJZA 1PUIA 2FGKA 3AP2A 3CNLA 3GJXC 5EZ6B 5B2ZA 2GJKA 1KDRA 5TDHA 2Z0MA 4P4SA 1IOZA 5GJBA 1ZBDA 1QHSA 1XEWY 2NZ8A 3BE4A 4MUAA 2ZAMA 3KJEA 1U0JA 3VU9B 4YONB 4FMBB 3UG7A 2F3RA 5AWFC 2AWNA 5CLLA 4OQMA 2WAYA 2YHSA 3WY9A 4OKSA 4B2IA 4ZO4A 1E9FA 4LC1A 2WMOB 3HU3A 3VR4A 1Q44A 3JVVA 5CM9C 4D4KA 2ZTSA 4FI3C 4PSKA 5FL7A 2WJVA 4KFSA 2DY1A 3TSWA 4BZXA 4Q9HA 4MYTA 1J2JA 1K5GA 3KL4A 3T34A 4ERNA 2FPKA 5C4GB 3PJRA 3ZVLA 2VBCA 1G1MA 4TN1A 2JLSA 2J46A 4BLTA 3BB3A 1KNXA 4YMSA 3RYTC 1YZQA 1FTNA 3A36A 1M1YE 1Z6GA 2ORVA 5HTKA 2GJAA 4NBSA 4TLEA 3O8CA 1AKYA 1P6XA 2ATXA 3GEHA 2OXRA 1JNYA 1N5LA 3WYFA 2GVDC 3A4LA 3PXGA 2ZR0A 4Q66C 4DDVA 3DL0A 4X8LA 5H68A 2ZJYA 4FMDB 4NKRA 3EW9A 4WXRA 4B3CA 3PUXA 2EFEB 2ZE6A 3DM5A 2H57A 1QG2A 4JSTA 1M6NA 4TTQA 3UG6A 5EQTA 5SZKB 2JAQA 4TZ6A 3NEJA 2GVZC 3I61A 4LRWA 3ETLA 2A5FA 2AFHE 3LV8A 1YVDA 3U2QA 2B7BA 2O0KA 4D26A 1Q3HA 1CU1A 5J5CA 2QSYA 2OG2A 4BLPA 4E07A 5EZ5A 3AP1A 3THWA 4PFSA 3IO3A 2MSCB 3B8HA 4LCBA 4B3BA 4Q9LA 2A30A 3FTQA 2BM0A 3N2EA 1AS2A 4DJTA 2GCOA 4U02A 4LPKA 2GETA 4PZLA 1EWQA 3RSLA 5AJXA 3FE2A 2H92A 2VSFA 2IWRA 1N5IA 2X8AA 4NYMR 2C99A 2BBTA 1E2MA 1JJ7A 1FP6A 2VA8A 1SXJA 3C4JA 4Q48A 2QMHA 4CDGA 3CNOA 4DSTA 1YR9A 2KB0A 1XJ0A 2GEDA 1Z22A 2FSIA 4IEEA 3LDAA 4YC7A 5B64A 1G8YA 4BFTA 1MO3A 2FV8A 2PZEA 1TQ4A 2VP2A 4FD2A 4KSCA 2DR3A 4LBWA 4C0QC 1Q1ZA 2HXYA 3THWB 2J7PD 5K8LA 1X8JA 3I72A 4PHFA 1I2DA 3HJNA 2IF0A 4CW7A 1M7BA 3CR8A 4ESVA 4YMVA 4DLYA 4JLPA 4PXAA 4HB2A 4JL5A 2QRZA 2F7SA 3FYHA 1GRRA 2REXB 1D9XA 3TE6A 5LBIA 4MKIA 4K81B 2CNWA 1D5CA 2QG6A 3GLFA 1E0KA 2O8BA 1G7SA 1ZUNB 2ANBA 1KKLA 5IK2D 3KQNA 2J0QA 2AK3A 4O2RA 2ZITA 4XD7A 2ZROA 1D8TA 2VP0A 3PEVA 2HT1A 1EFHA 2NPFA 5JHGB 1AS0A 1U0LA 1MH1A 5BYKA 1HE1C 2ZE5A 4KHZA 1ZNXA 4LJ9A 4HDCA 2XXAA 2C9YA 3BJIC 2D62A 3EC1A 2EU8A 1ZM3A 4ITRC 4KVGA 2RH5A 5C18A 5JLJA 3THYB 3FHOA 4ASUD 2X1VA 1Q0UA 3K53A 4QNMA 5BN4A 4DRZA 2WSSD 1BMFA 1Z6XA 2WWYA 4IW3B 1H8HD 4U5XA 1VG9B 2XZLA 5L8VA 4V0KA 4YXWA 3PEYA 5KTYA 4BECA 4DCTA 2EFHB 1NY6A 1E1RD 1OYWA 4MKHA 1BYIA 2FFHA 2VP4A 5L3SA 1XEXA 2ZRBA 2O8BB 3HP1A 1PUJA 3SZRA 1IN6A 4RD0A 1F2UA 1HY3A 3FWYA 1X3SA 2GXUA 2ZYTX 1Z07A 1G64A 3QKSA 3NDPA 2ZXUA 1E9EA 1TQ2A 4HLUA 1L4YA 2W00A 2A9KA 4UKDA 2F43B 3DVLA 4GZMA 3H4MA 3LH5A 4JT4A 4PAQA 2IYYA 1S1MA 1T4GA 2XXAB 5FR2A 3LRPA 3AVQA 3UMFA 3H2YA 3ECCA 3C7KA 2V6JA 4XWOA 1P9NA 5EP4A 1R5BA 2HEIA 2UZ3A 1VCIA 4ARZA 3BFXA 1Z28A 4TL7A 2QQEA 3SJBA 1NIJA 2HDNB 3VHXA 5DI9A 2R8RA 1NJGA 4BEBA 3RWOA 3CPJB 2CK3A 1UF9A 1SKYB 2TMKA 4PO1A 1XEXB 2GA8A 1N2CE 2HCJB 3W3AA 3AKDA 1FUKA 1KZGB 4KODA 3VAAA 1NMXA 1NN1A 3AKYA 4L8GA 4BWYA 3UK6A 1U94A 1G5RA 2X19A 3L43A 1WCV1 1N25A 1UEJA 2W0SA 4PC6A 2CHGA 4MDEA 1G4UR 1XCGB 3MAAC 4EPRA 2JLRA 1EGAA 2O52A 1E94E 2REOA 1XCPA 5JJKA 1RE0A 3SYNA 2W83A 1BO6A 1CJTC 5FPKA 4N3NA 2ZRHA 3E70C 4Q7KA 1E9BA 4ARZB 2ZUBA 4MA4A 3LQQA 5KNCA 1IJEA 4UJ5A 3VX3A 2JATA 5CYOA 1OT3A 1KSGA 1N6KA 2J45A 4IFEA 1A7JA 4MUBA 5CIQA 4Q4JA 1Z63A 3PIRA 4MRNA 3BWDD 3ND9A 3KQKA 1UKYA 5GADl 2GHIA 4S2EA 4TLCA 4Q21A 5JRJA 1ZM2A 2PCLA 3MJRA 1XXHB 2V7QA 2RGAA 5FUWA 3GLFE 2QTVB 3T1OA 4KBGA 2ZUCA 4D4JA 1LVGA 5EP2A 3AVYA 1OHHD 4BLSA 4ZCLA 1AZTA 3C16C 3EZFA 3F0TA 3IBYA 4LSGA 4ZV4A 5GJVC 1XF9A 4L15A 4US2R 3GLGE 1KO8A 1VIYA 2BMJA 2BIFA 1N0VC 3A1TA 4MQBA 5ELXA 1T6NA 2L0XA 1ZNZA 3NBYC 3B7GA 5JCZA 3U7HB 2V1XA 4DXAA 2JLQA 4P3YA 2VHCA 4TZ0A 4Q4JB 2CLSA 2KBFA 1YZUA 1W47A 4NCNA 5SZJA 4RZXA 1YR6A 4TL8A 5JMTA 2NPIA 4UXHA 4JBYA 2H5EA 3JZMA 4CEJA 1KZ7B 2XGJA 2GTPA 2XNDA 1VG8A 4DSNA 4ACAA 1J8YF 5AK0A 4M0LA 5FFMA 2WPDD 1G16A 1JXMA 4NP6A 5EE1A 5FBWB 2ONJA 3NG1A 4C0AC 1QHIA 2ZM5A 3IIMA 3SHWA 1JPJA 1JB1A 4TMKA 4F7WA 4DLZA 5KOYA 1N6RA 2NZJA 3MMPA 3NKVA 2IWHA 2PBRA 1UBFA 1O87A 3IGFA 4FMDF 4QRHA 4QBIA 4FXPA 4IEIA 4C7OB 3LW8A 2I4IA 3WHLA 2OEPA 3AVXA 1VCNA 2BBSA 3GLHA 1KO5A 1TF2A 1F6BA 4WZBE 5FL3A 2ZUDA 3T35A 2WZQA 1YR7A 2QENA 3JZAA 4PPNA 1X8LA 3KB2A 3ZIAD 1W0KA 4YXWD 1OB5A 2WJHA 3U7EB 3FMFA 4U00A 4A8JA 3O47A 1D2MA 4KO8A 3LY5A 3W8NA 1W0JA 1FPMA 2K5UA 4A0GA 3KZ1E 3GJ8A 1R6BX 2PLRA 4PX9A 3WXMA 1VYVA 3LLMA 1S9DA 1W4BA 2RGDA 1OIWA 4R7ZA 1G3QA 1G8GA 2PL3A 2VQSA 4TT3D 2RKOA 2YWEA 1WB9A 1TX4B 3CWZA 2YINC 1E3MA 2C95A 4HSEA 4URWR 1XTJA 3NBFA 4Q9KA 4URYR 4NYIR 3X1YA 2P5TB 3U5ZB 1II8A 3C5HA 1T3HA 3X1XA 2F9MA 2JJ2D 2EW1A 3T5GA 2QP4A 2VTKA 3CONA 1UBGA 3KXLA 3K0FB 3R8CA 3J81k 1US8A 4XWKA 1DAGA 2IS4A 2J0UA 1NMZA 4HATA 4ZDJA 2OLKA 5A5GA 1P4SA 3AKCA 4WZAE 4B43A 2OCAA 2WWGA 3EWAA 5AR1A 1N6IA 2FEMA 4MRPA 4PHTA 3C15C 1B23P 4LX0A 1QHYA 2JIZD 3A1WA 5IHPA 4NYJQ 4D0NA 3VR3A 1HH4A 2D06A 4URZR 2R6GA 4CT5A 1D9ZA 2ZJBA 5EE3A 3M1IA 5B58C 1II8B 4K8OA 1TUEA 1LW7A 4A92A 4OQLA 4PPGA 3I32A 2QL6A 2QT1A 3LFUA 2W0MA 3EASA 1NKTA 4M1WA 4URVR 3K8YA 4JS0A 2XOKD 3H0KA 1GL6A 2IXGA 2G1JA 3OEHD 3R8FA 2WTUA 3KX2A 1KSFX 1OIVA 1KI9A 3EPHA 3I5XA 2IF2A 1AQUA 1R0WA 2AKYA 3IILA 4AY2A 3UMSA 2BMFA 2X2FA 4GP6A 3HU2A 3I3SR 1XD8A 4DWJA 5C4MA 1JEEA 3CH5A 4DLXA 1X86B 4G3XA 4R2IA 4EPYA 2IXEA 3SU8A 2QTHA 3K0CA 1H8EA 2QN6A 4D6PA 2QEQA 1ZM7A 3CB4A 2DFKB 5EJEA 4RJLA 1NLZA 5E95A 3P4XA 2F6RA 3NBZC 2NG1A 3OIYA 4B75A 1EFRA 2XX3A 4QFMA 2BEKA 3B60A 3BH0A 3WMGA 2C9OA 1OLOA 3I5YA 5J47A 1N6OA 4XIGS 3E1SA 3CUEF 3U60B 2ZRKA 4TQ9A 1EX6A 4TYPA 3DKVA 4F91B 3GLHE 3QENA 4X8OA 3DHWC 4FIDA 5EE5B 3I8SA 4D2IA 1RVDA 1OB2A 2DBYA 3D31A 1KNQA 3B1YA 1ETUA 3AVOA 1DEKA 1PV4A 3D7MA 3EPJA 2GK7A 1OFIA 3DMNA 4DSOA 1G6HA 4GT1A 1IN7A 4LJ7A 3QXHA 1E2KA 4Q4LA 2XJ4A 3ADKA 4OHVA 3QG5A 3FHCB 4QBFA 5CB6A 5KSPA 2NO9A 3AB3A 5KNDA 4OQNA 3TUZC 3K9HA 2OESA 1CR2A 2PMDA 2HXSA 5B57C 3U44A 4RFSB 4P31A 3TW4A 1ELOA 4TLDA 2XITA 1P75A 1NF3A 3QPUA 1DO0A 4TYYA 2ZAOA 5FOVA 3RAPR 2WKRA 2IC5A 1KMQA 3LD9A 3K1JA 3A37A 4DLVA 1W1WA 3DMDA 1DAKA 2AD1A 3U61B 3CRMA 4NONA 4A2PA 1ZYUA 3VR6A 1Q3TA 1R0ZA 2ZIAA 5G41A 5L3QA 1OXUA 4OK6A 1AS3A 3OESA 2R6FA 4EFLA 1ANKA 2QP9X 1KI4A 4M53A 3THOA 2R9VA 1KO4A 2R2AA 5CK4A 2XSZD 4LHWA 3RS2A 1KI8A 2VEDA 4LUCA 1ZM9A 5G40A 1DAIA 2GXQA 1YRBA 3CO5A 3MWKA 2A78A 4JLMA 2KE5A 1Q22A 3ONWA 1YHNA 4FINA 3ZH9B 2VYFA 2Q9CA 1SKQA 1GKUB 2J1LA 3AUXA 4WAUA 4ACBA 4HAYA 1HV8A 3VR5A 1F48A 2XTNA 4N1AA 1HQCA 4DSUA 1U9IA 1FZQA 3B85A 1E79A 3OHMA 2BJWA 3P1JA 1M2OB 5J4KA 1T0JB 1SHKA 4GOKA 3W90A 4JVLA 2YYZA 5A4JA 3U3KA 1OH5A 4FCVA 5L3QB 1ZUIA 1TU4A 2QMOA 1G5TA 1FNNA 3SN6A 1ZC4A 4DVGA 1CS4C 2FSGA 1U9IC 4QHTA 4TYNA 2YZ2A 4RZ3A 1OKKA 4HB3A 1A4RA 1E1QD 5DSZA 1OXSC 4LJAA 2IT1A 3F3YA 2QU8A 3QKRB 5G3YA 3T1QA 1NN5A 3A1SA 4LV8B 2CBZA 1PLLA 2WAXA 5LDDC 2CLDX 4OHWA 4PHGA 4QGAA 1NY5A 1SVLA 3HR8A 3BXZA 3QI2A 2BCJQ 4OJKA 421PA 1KI3A 1QHXA 2R65A 2O8EB 3PENA 1KI6A 3LX5A 4GSYA 3QXSA 4BRWA 4CVNA 3QY0A 2JJ1D 3CX8A 2BC9A 1VIAA 1OYYA 2PLFA 1PLJA 5DO9A 3HWSA 1YJ5A 1KI2A 3V9PA 2A5DA 1U8ZA 3TRFA 3SR0A 1ZC3A 2D4HA 5AUPB 2AKAB 4PHHA 2H18A 2C5LA 2GESA 2ZI7A 3L0PA 4O0MA 2ZI6A 1CRQA 1RJ9A 4Q47A 5L3RA 2HLDA 3WYAA 1RIFA 1N5JA 4M4SA 2ZRIA 3DZDA 3NIBA 2PJRA 3FVQA 4IDPA 3L0SA 5HE9A 3U3MA 1DBSA 2A3RA 5EXPA 5L3VA 2YC4C 3QKUA 4JKYA 1IY1A 4H1UA 2QAGC 1ZCBA 4IDNA 1KK0A 4XOIA 2FA9A 4C4PA 5J4LA 1HUQA 1JQLB 3FKQA 3TH5A 1LB1B 3O8RA 2CLCX 4KYUA 4LYHA 4B3DA 4M9XA 2GZAA 5BWMA 2J7KA 1AGPA 121PA 1HQYE 1JEDA 2GBLC 2C78A 4L4UA 5CJPA 3HYRA 1NNEA 3RHFA 2WIBA 1W2HA 4AD8A 2NTYC 1NIPA 1R5OA 1EESA 2CJWA 2HYDA 4GOJA 5CK5A 1ZMXA 2AD5A 4TL9A 1BH2A 1E2FA 5D3MB 1UAAA 4K46A 4LPSA 1NSTA 5C2JB 1N6LA 2ERXA 3G5UA 1XJCA 2W2XA 3I1FA 4LJ5A 1UDXA 2WV9A 1P73A 5DIFA 4PQYA 3W9YA 2A5GA 4A0RA 5FBVB 1IY2A 4URXR 2OO7A 1RRGA 3QXCA 4MKGA 4HAZA 1P2TA 1A2BA 2Q21A 2R6DA 2G0NA 1JR6A 1AGRA 4MDFA 4ZIRA 5GVSA 4I1SA 4I1OA 1IQPA 4PPQA 2JEOA 1GSIA 3EA5A 3VMFA 4BFSA 1NSFA 3KKMA 3U3RA 4BFYA 4BZPA 1XPUA 1PVOA 1ESNA 3C5CA 2WIAA 2ZJ2A 4GMDA 2BBWA 1UDWA 2ZRGA 4Q1DA 1TQDA 1DAFA 2IX3A 4M2LA 3K0SA 1DG1G 3BOSA 2ZSAA 4TTRA 5CDFA 4ZPXA 2ZSDA 5KHOC 1P2VA 4P33A 2AN9A 1WDTA 4IRUB 4B48A 1Z0FA 5FOTA 3NDBB 1GKYA 2QROA 2IS2A 3ZVRA 4DCNA 3QE0A 4ZIRB 3B6EA 3AP3A 4WXPA 1QBKC 3ND8A 2JLWA 4TMXA 2HJGA 2ORIA 1GIAA 2ZVQX 2OSBA 4DLUA 5GVRA 1IONA 4EFNA 5TARA 2O8CB 1TQ6A 5TVKA 4CIDA 4QM7A 2B7CA 4YMTA 3MCAA 3TW8B 4A6XA 5JS7A 4Z1MA 1JJVA 1Z6TA 1KYIA 3X2SA 5H70A 4TL6A 2G6BA 2NGRA 5P21A 4BFWA 5DN6A 4LZZA 1LF5A 5LPNA 1K8RA 4EIWA 5HZHA 4JLNA 2EYQA 4EPWA 3Q5DA 3PG5A 2ZI4A 2WMNB 1E4VA 4MRRA 2FDCA 1YKSA 4O2LA 3VKHA 2ZRPA 5F9FA 3K09C 2C9CA 4OBEA 4EPXA 4ZDIA 3D3QA 3SYLA 1OJLA 4JBXA 2GWHA 2WOJA 1IBRA 5HZKA 4QGHA 1VYUA 1ESMA 3GFTA 3FB4A 1C9KA 4TSFA 3R9XA 4YLGA 2ZJZA 3IEUA 2W6ID 4PQRA 1T3LA 2YWFA 1UPTA 3QF7A 4P0TA 5DYGA 3GD7A 1X8KA 3GP8A 2ZI9A 4IDOA 5M04A 1ZNWA 4PAMA 4B73A 4KLZA 5DYIA 1Z29A 5HCIA 4KBFA 2XJ9A 1E0SA 5DISB 3Q8XB 3LBNA 3ZS8A 4NCIA 4GL2A 3NHAA 1Z2AA 2XAUA 3KDSE 4BRUA 3MUFA 1OSNA 1TMKA 3RNLA 1NG1A 2C98A 1E99A 3W6PA 1NVXQ 3IPYA 2QA5A 3R7WB 2JGNA 5CITA 5JEEA 1GITA 2WJYA 2V55B 2YKGA 3WRYC 1Q12A 4PSVA 4HZIA 1V5WA 1P2UA 3GJ7A 4FMCB 2AR7A 1PLKA 3D8BA 1FW6A 3KXIA 1P7CA 4FW9A 2AL7A 1XX6A 3CF2A 4NHOA 3WNCA 5EP3A 2JLUA 1EFCA 4A6PA 3ZVNA 1KTVA 4B3XA 2ZANA 2I1VB 3F8TA 4NMMA 2IYUA 4NZYA 3PUVA 3AVVA 3DDCA 4BLOA 3KKOA 4G5OA 1AM4D 4F38A 3THYA 3AVUA 1E2LA 4A2WA 4JIMA 2ZRNA 3CKLA 5BXQC 3L8ZA 3AQ4A 1YZNA 5AJWA 3B1XA 2ZQ5A 1E6CA 1XTKA 4OYHA 1CF4A 1G5PA 1OXVA 1ZVQA 2W2TA 4QOSA 4ZKEA 4GPTA 3TQFA 2HJVA 3U7FB 1CXZA 1BYUA 5TB5A 1HYQA 2SHKA 3NWJA 2PMKA 1JI0A 1FL9A 1P61B 4AYXA 1WQ1R 4XSHA 4S35A 1DAEA 2FN4A 2JA1A 2ZSEA 2Q9AA 1FMLA 5FTNA 3E2IA 3OEEA 2GJ8A 2F43A 2VPPA 1GOTA 1Z6AA 2PEYA 1KAGA 2Q3HA 3W6NA 2IUSA 4B76A 4B2PA 3UIEA 1N6PA 3QQ5A 3FKSD 1XZPA 3LX8A 4Q18A 4V0NA 2QI9C 4PQFA 3KXKA 4LHVA 4JL6A 3T06B 5FPSA 2ZS9A 4OK5A 1F2TB 1YRAA 5EXXA 3ZDQA 5TMPA 3WMEA 2GKSA 1RRPA 2D3WA 1ZU5A 2O8DA 1JAIA 2BBOA 2J59A 4LJYA 5K8TA 1G19A 5LB4A 1Z0JA 3CX7A 3PEUA 2HT6A 4KJZA 3OFNA 3GFOA 4M9SA 5FOWA 1XD2B 1L2TA 3SHFA 4MKFA 5FPYA 3GLIA 3MD0A 2G1KA 4HUQB 3E5HA 1L4UA 1AIPA 4F4CA 2XNSA 4Y0VA 3C14C 2VO1A 3FMOB 5FL7D 3AM1A 3BS4A 3V4RA 3CRRA 2OFXA 3RABA 4FWIB 4DBLC 3N70A 4RD2A 1OV4A 3EX7C 2A5YB 5JBQA 4NDZA 2FFQA 1IXZA 2XTMA 5EXSA 4Z1MD 2QGNA 4FCWA 1E2QA 1IXRC 3QIAA 2IHYA 1NP6A 1O3YA 2PX0A 2YWGA 2ZU6A 3KQHA 1YR8A 2OILA 3CNNA 2ZRFA 3QBVA 5FI0B 3RLFA 2FZ4A 2O8DB 2CDNA 3W34A 5KYKA 4DB2A 4Q7LA 2R62A 3NXSA 4ESHA 4DDWA 3LLUA 1ZIOA 5TXGA 4L9SA 4RSGA 1GP2A 2LWIA 2J0SA 4C0KA 1XXHA 1I4TD 2QY9A 3GLIB 4UNRA 2X77A 3RS0A 5KDOA 1SXJE 4HEJA 4HI0E 2WWWA 3CRQA 1GTVA 3QOFA 3WMFA 3ZQ6A 1D2NA 3OAAA 3OIVA 4TSFD 3UMRA 3SYKA 2VRWA 5KSYA 4W5WA 4HDQB 4JLBA 4Q19A 3W6OA 2BVNA 2ZRLA 3OIUA 2QZ4A 4A36A 2OM2A 2ODBA 2GCPA 4V02A 3RSOA 1U0HC 1DTSA 2R6CA 2WJJA 1J7KA 2QNRA 5E7MA 2HF9A 3SJZA 1IAQA 4M1OA 4DCVA 3EAQA 3TJZA 3UATA 1E9CA 3B2EA 4IFBA 4TQAA 5FBQB 2G3YA 4G01B 1P9WA 1TADA 3NBXX 4FWTA 3AF3A 5FUYA 1KJYA 3WP1B 4I99A 2OBMA 3B1VA 5FTMA 2J41A 3BRWD 1SXJD 2WWIA 4TQUS 2WKQA 2ODEA 2QPAA 4JBWA 3D6TB 3MRSA 3L2OB 3G0HA 2VHJA 2YJTD 3WHKA 3LO5A 2UVQA 3FFAA 1G8PA 1ZD8A 4DUGA 1KSJA 3TGPA 2UZIR 4JMPA 2QP3A 4E03A 1CEEA 1NBMA 1XMVA 2QRNA 2KJQA 4B3FX 2HYIC 5BN5A 1NG9A 1SVOA 2RGNC 4Q4HB 5ANRB 3QJYA 4AIIA 4C7OA 2CHVA 4CF7A 2IHBA 2P65A 1W5TA 2FSHA 1AJEA 1IY0A 2F1RA 2QE7A 1BIFA 1R4AA 4DEYA 1OXXK 4IOKA 1GILA 1RZ3A 1YZLA 1CJKC 1EXMA 2CNWD 1KY3A 2GF9A 3OZXA 2KWIA 4HAWA 4X8MA 4D82A 2QPTA 4JKIA 1HT2E 4BZQA 4OI0A 3VQTA 1OH8A 4XD7D 3WBJA 3W8RA 3VR1A 4AK9A 1Z08A 3A4MA 3ADDA 2WSMA 3HU1A 4FCTA 5JECA 5C46F 3PEWA 1KOFA 2OCYC 1XNJA 3Q85A 4QGGA 4BQSA 2O0HA 3VFDA 1QHHB 1RFLA 4B44A 1TUIA 4AKHA 3CF0A 3AH8A 1ZINA 4LHZA 4XVQA 4EJSC 4HAVA 1BMFD 3HPRA 3O8DA 4GBMA 3QEJA 3K0FA 4TYWA 1G3IA 4I1UA 1RW4A 2YOHA 4B6FA 3H86A 1OFHA 1J90A 2MMGA 2PZGA 1IN8A 4A82A 1RC8A 3P4YA 2RAPA 4UQOA 1XXHE 3DM9B 5FH9A 5IT5A 1IN4A 1QVRA 4M1MA 4EJSB 4R71A 3TNFA 3ZQJA 4LJ4A 4M1YA 4B32A 1Z0AA 2VF7A 3QG1A 3MWLA 1DPFA 2FJUA 2Z5FA 1KIMA 5JHHB 5JCPA 3L0IB 5J4YA 1CR0A 2QGZA 4ZI2A 5BN3A 2ZR9A 2WWHA 4QGFA 5JJIA 3IO5A 5JZVA 4CEHA 4FMCF 3AGQA 4IOLA 1QDEA 3CBQA 4QM6A 2QTFA 1P3JA 3QVUA 3QXXA 2CK3D 1OH6A 1S1CA 1Z2CA 1LFDB 4ZCIA 5GJCA 1Z0IA 1T9HA 8OHMA 3QF4B 4DLSA 3I73A 5KPDA 3BBPA 2OE2A 1G291 2Q3MA 1I4DD 3BFKA 1MO4A 1HA3A 1Q1QA 3B9QA 5E4FA 3VNVA 1KDOA 4G5QA 4CRWB 1KO1A 2QAJA 1W4CA 3WRXC 2PX3A 3ZJYA 4AKGA 2QM7A 4LK2A 2EFCB 1CBUA 1S3SA 2VSXA 4CEHB 1G9XA 1W46A 1VPLA 1XMJA 5KU1A 4RZUA 5SZHB 4LDJA 4G5SA 3HDTA 1XTQA 4M1KA 4ILEA 3GPLA 4WZ6A 4DT1B 2MMCA 1R2QA 3CRVA 1J70A 4QL3A 1VKJA 4YDHB 4RKEA 4KV9A 2V7QD 5A0FA 1AKEA 4UNNA 1P72A 1EX7A 2E9SA 2IEZA 1S3GA 3AVWA 4PSAA 2RB4A 1FOEB 1KSHA 4TMZA 4A0FA 2GAAA 1T0HB 1TNDA 3MWYW 4C3ZA 4V0MA 1AA9A 4DLTA 2OCBA 2H17A 4GI7A 4R2HA 2FE4A 1SGWA 4B71A 4EAQA 4MYUA 2ZSFA 2IXFA 3DOFA 1QF9A 1R8SA 2BOVA 1R0YA 4YMWA 5DNYB 4RFSA 5HCNA 4B35A 2W6JA 1F3OA 1Z0DA 5BQ5A 3L82B 1R8QA 1TEXA 3RRMA 3OIWA 2LCFA 4G0NA 3SI7A 2CCKA 1BS1A 3N5CA 2R6AA 1XPRA 3KJGA 1T3SA 1UKEA 2XNDD 2CL7X 1GKIA 1HT1E 4MGYR 2YV5A 3IHWA 4JLVA 1J99A 1T5LA 2BWJA 1EK0A 2C77A 3CZPA 4V03A 4HZUA 3TVDA 5UKDA 5HKKA 3FDIA 1DG3A 1Z0KA 1GRNA 1Q1EA 2ZVPX 3PQCA 3WBKA 3REFA 2QM8A 1UFQA 1KDTA 2OLJA 4JVMA 4EKDA 3CR7A 1NVVQ 2JDIA 5AUQA 5TV2A 2QPOA 3LWNA 2CHQA
chains in the Genus database with same CATH superfamily
4US0R 1TJPB 2FP4B 2AJDA 1KFEB 4AG6A 2FPGA 5ISMA 5JSZB 5I7SA 4FFNA 1FFGA 2OBLA 2DFLA 1E7MA 3I76A 4JB3A 2VH2A 4IMRA 3SF8A 1PWEA 3E6AA 2WJGA 4MS1B 2HQSA 5ALWA 4ZHQF 4B3GA 1E2GA 4HX5A 4J03A 2WAAA 4C04A 1GAQA 2QR5A 1COWA 1UBJS 2BE7A 3KJZA 5TQJA 1M2OA 1MPXA 3F7OA 1VMAA 5ALYA 4TV8A 2VDNB 1IIRA 3TTSA 1A8IA 1RZVA 3SQWA 1VGRA 4NARA 3UH1A 4N48A 1RKQA 1W0JD 2GM4A 4L50A 4BAGA 1FFCA 1NPYA 1FTYA 3SG0A 2ORYA 4QC2A 1RXCA 4EF4A 1BJTA 2IELA 3CLTC 3NVAA 1UJNA 3K9QO 4M55A 2BI4A 3QEOA 1B2LA 1CWUA 1JSCA 1NKSA 4KQEA 3TAXA 1WWKA 2RH9B 3STTA 4TSRA 4ATNA 4CKCA 4RY9A 3ZN2A 5HF8A 4EUEA 4Z51A 1YJCA 2I6SA 3VAYA 1NJ1A 3OA0A 1JDNA 3RSLA 1AKNA 4DF3A 2BEVA 3X44A 7GPBA 4N6GA 2PT7A 1E3DA 5F2EA 2H7XA 1L7VC 1P2SA 3MJFA 4DYDA 4HNUA 5KYYB 3CF6R 4OSOA 4YS6A 4Q1CA 5DHSA 5KDLA 3ROZA 3FMPB 3UXYA 4D8TA 1RYEA 2GZSA 4LXTA 5A4KA 3F73A 3R5SA 4PAOA 1EUDB 3JWHA 4E7PA 1HDZA 3PPXA 4BXOA 5CX1A 3CLRD 4ZTBA 1FDOA 3GI1A 1Q57A 4FZRA 4UDOA 4X8HA 5CBKA 2ZAGA 5K2OA 2YX1A 4YACA 4BU1A 1CR1A 2EHDA 1NW5A 4C4RA 5DNEA 4DGSA 5ERYA 1QK3A 3DV9A 3U4MA 3HZOA 4I4IA 5SY6A 2CF6A 4PTLA 3UUWA 2RGXA 3UCXA 4RIEA 5JDIA 3HM2A 4BC0A 2ZPAA 3WGJA 1E2EA 4YK7A 4JR0A 4YAJA 5DU2A 5CLJA 3QPDA 1Q2UA 2PPLA 1FUYB 1FDIA 7MHTA 3I8XA 1AMOA 4W5OA 2DOKA 3E3LA 3ZE9A 2HA0A 2NIPA 1XHEA 1W4AA 2XVXA 4QEZA 5AW7A 1WPXA 3EIXA 3O92A 5IULC 2K2WA 3FSEA 4ZC1A 2EXXA 3ABIA 4RGBA 1KMHB 3ZDXB 4NS4A 1B1CA 1Z17A 4N8DA 5BSEA 1VL0A 4EKEA 3ENKA 4LY3A 5F98A 1I4OA 3KUDA 4KJXA 4DLRA 1NQAO 4BNHA 5IC6A 1I6LA 1WCXA 3P5BA 1QIDA 1RWWA 1L7DA 1VLJA 2HA7A 2PT6A 3IBSA 5KJEA 2VP5A 1CFJA 3KFXA 3OCWA 3G9TA 1GAEO 2ERYA 4KXQA 3GV0A 5DI3B 2UXDB 4PGMA 1SBHA 2FSPA 3WA6A 4PG5A 4WOPA 1GA4A 1MAHA 1SA0A 2QUBA 4I9FA 3FF4A 1SHZA 2NO6A 2QAGA 2H07A 3AKEA 4R1TA 2W2OA 1ZEJA 3GU3A 3RVLA 1J9GA 2D8AA 1U81A 2GZDA 3HCWA 1V7ZA 3GVCA 3SR0A 1A9XA 2AQKA 1XJ5A 2D7JA 3T7AA 1Q21A 4FHFA 4Z4FA 2MT9A 5DNUA 3ETEA 5T5QA 3W5HA 4R31A 3K1AA 1EFTA 3GFVA 3ZUGA 3O4HA 4KAXA 5AK4A 5JYEA 4QYWA 4YAIA 4OVKA 1GARA 1ZIXA 3LYAA 1CIPA 5CLHA 2GBLA 5I3ZA 2QBYB 3MMSA 3LBAA 4KLNA 1VHLA 2B92A 3DHYA 1KEWA 3NAMA 5T57A 1YHYA 1BDJA 4JWTA 4RVDA 3C3CA 4EJ2A 3PWKA 3ZV3A 1ARZA 2FWIA 2PU5A 2VIIA 3L3BA 2F1JA 3SC3A 1F12A 1T2NA 2X8BA 3FCYA 5D5PA 2R1ZA 2ZU0C 4ZYVA 1ML3A 3ZY2A 1KHTA 1QHFA 721PA 5FFNA 2WW8A 4GM1A 2WB4A 4ZK6A 3GZTB 3WNZA 2J5QA 5LP1A 2VQFB 1MJGA 5BMVB 3VISA 3RUHA 3IDSA 4YRNA 5K6TA 5D3QA 5JI2E 3BWVA 3TCXB 4WT7A 3VJKA 2ZJ7A 1C1DB 5K20A 2GARA 4MYRA 1RCFA 1Z2PX 3F71A 3GRRA 3JD0A 4DDTA 3UJBA 4IOMA 4R5HA 3KPVA 2BGWA 1WBDA 2WWXA 3D4OA 1EPUA 3DDOA 4RMJA 4JHXA 2JRLA 2E55A 1KI7A 3KV1A 5KREA 1V6CA 2PPVA 1PAUA 2FMUA 2PH1A 5A02A 3VOTA 2IZOA 1KEEB 1OQAA 1U8AA 2JIRA 3SK0A 1NMYA 1TEHA 1TCUA 2JCSA 4IDHA 3UMVA 2XECA 4I81A 4TKUA 1AQNA 1CDDA 5I7WA 1AQYA 2LBPA 1U2EA 3B78A 4ZAYA 3BMQB 5TQVA 3ZHZA 5CEEA 6NULA 3N9IA 4JSYA 3SJ7A 2WT9A 2K4MA 3VR6D 2HRBA 4H7DA 1TCAA 1PZGA 1P7WA 4EG0A 4GPD1 2QD2A 4YO8A 4UNSA 4F3RA 2PRKA 3D8NA 3G0BA 1DPGA 1RYHA 2ONKA 3AYZB 3IR6A 3CPEA 3LBHA 2J6HA 3BKWA 4DWOA 3G9UA 1E2DA 1T9KA 3HCPA 4QJBA 4S0XA 1LK7A 3MRXA 1JDPA 4M9ZA 1G0NA 1V8OA 1UDCA 2AHOA 2MSNA 4DV1B 1R27A 3EXFA 3OZWA 1I7PA 4IIXA 4AS1A 3EIOA 1MOZA 5L7TA 3I4LA 2JI7A 3WV5A 2HN9A 2IIBA 3SY8A 1MB0A 2VEOA 4K9NA 3URKA 4FOLA 2DY0A 4NS1A 5EIEA 1WUIS 3B70A 1F06A 3P7MA 4ND8B 4YDQA 5LQUA 3O8QB 3AETB 1N5KA 4ASUA 4RULA 3DFFA 1M73E 5G0TA 2C31A 4Y30A 1G21A 2JGJA 3FZNA 1PV1A 1E4EB 2XTZA 4IHJB 5E7IA 1F0YA 3D3JA 3ZNNA 3QA3E 1UZUA 2FFJA 3AOGA 2YTZA 1JX6A 2IEIA 3NH6A 1TYEB 3OZUA 2YL2A 3O4IA 4I1VA 4O0LA 2H08A 1WP9A 4D9GA 5IZCC 2IYEA 1ZGAA 1C1YA 4LYYA 2HBYA 1AKQA 2RH8A 2VN8A 4CL0A 2PX2A 2IYPA 1YZYA 2ODNA 4IIJB 2I1LA 1RBMA 4HGYA 4A15A 2GNAA 4M0FA 2EIHA 3SJCA 1KXJA 5BR1A 7ADHA 1Q6ZA 1CFZA 1KYQA 3ZY3A 2NWQA 1B2RA 3TUJC 4BMDA 1NQUA 2OC9A 3TXYA 4RTPA 1Y7IA 4IKEA 3G0DA 3KEMA 3A2NA 3KBOA 2GQ0A 3R5TA 4BFUA 1T2EA 3X1KA 2LD4A 2TMYA 1M7GA 3LNCA 3A3YA 7REQA 2H63A 3OX1A 1Y5NA 3V8EA 2WD7A 3TEFA 1DOHA 4R98A 3WZMA 1SUAA 3GY0A 1H2AS 4GRAA 4JT9A 4NATA 4P4SB 4QPDA 4UAGA 4F9GA 5KC9A 4DCUA 4HWKA 4BKUA 1YS2X 5LZ2A 3CVOA 1OX4A 3Q3GE 1BEUB 1Q7EA 3CEAA 3V2UA 3R75A 3WB9A 3KUUA 1ACMA 3TSCA 4DQDA 4CZ2A 5A7FA 4M89A 5FPQA 1V7CA 1YQEA 2HLDD 5KAMA 3A9CA 4HDNA 1LPSA 1L5WA 3AUYA 3GT3A 1S5PA 4RCZA 1VKOA 2D0IA 3LZ6A 4QOJA 3NOOA 4IVPA 3L7YA 1GGFA 4D0RA 2G40A 3ES9A 4HGOA 2G9UA 3FNIA 3EFEA 4TQGA 4YRDA 4AICA 1ADBA 4DNFA 1IN5A 1HE2A 5LZ7A 5AVOA 1GGVA 4FYXA 3A04A 2YC2C 5FT9A 1RWQA 3TLKA 3UC5A 3WLEA 3X1WA 5GV7A 2IDKA 2XMPA 1G8KA 1SD2A 3BZBA 4OHUA 1JJFA 1R0XA 3OE7D 1AQ6A 4RLFA 5C3UA 3RS4A 5DTMA 2EF0A 4OIFA 1E0AA 2Z98A 4B1FA 1UCFA 1S7GA 1C3EA 4E4RA 1FFHA 3DYVA 4G4IA 4HAIA 4MVYA 2VZ8A 3SE0A 3QKTA 4BO8A 4BP1A 3U6BA 4GDFA 1IZYA 4K6KA 1IOWA 2JFWA 4K0RA 4J7CA 4O4HB 3PF8A 4FYIA 4IJMA 1MFPA 1NVGA 3RC8A 1QUFA 2B8NA 1USWA 1I0LA 1TI7A 3AINA 1VJ5A 5J3JA 2R87A 3C2QA 5KTOA 3VSAA 1JPNA 5CDFE 4NAVA 4KIFA 3W4IA 4CI0B 3FN4A 4S2UA 3FGNA 1CP3A 4YRAA 3KTOA 1PJTA 1TQ8A 4RTNA 5FWYB 3IUEA 4UNPA 1FFXA 2OAQ1 3RFFA 1CUVA 5LQAA 2HA5A 2OHFA 1WPRA 3SQMA 5M7EA 1SXJC 3FROA 3ITKA 3QNWA 3PFWO 5K4HA 13PKA 4HUQA 2G9VA 5DHFA 4FGUA 3DZCA 3MYRA 3IIJA 1WCWA 2HD4A 3GQBA 3QLJA 1I3KA 4MQ4A 3SAJA 5AVQA 2IK8A 4HOYA 2WA2A 4BN0A 6Q21A 2ZRJA 4GWGA 1SUIA 1XCJA 4QJ5A 2YVLA 1NFFA 2YJ4A 3CLKA 4FMPA 4XTCS 1GM5A 1JHOA 1YSCA 1SQ5A 3MERA 4BQPA 4LI3X 1JVSA 3G88A 2PUCA 3PQ3A 4TMVA 3QOXA 4PO9A 1Q92A 4BPRA 4U7DA 4FDTA 2AB0A 3JQAA 4W5NA 1MR3F 3A25A 1NOKA 3BM5A 4PLWA 3C5WP 3V7WA 4QOEA 4LWQA 2BHRA 1S8OA 3G5MA 3AB7A 1T5IA 1U11A 1YR2A 2ATVA 2XZPA 2ZK7A 5B3JA 3ZWWA 3Q6NA 1UK6A 3ODGA 5EE9A 1QE3A 2XMGA 5BR8B 2PZFA 2BV3A 4AQDA 4QFDA 3LG2A 4E5UA 3NBKA 2C4MA 4M21A 1W2GA 3L5KA 4EBFA 2ACVA 4RUKA 3U0VA 5JI3E 1D2EA 4KB5A 5JD3A 4UM9D 3TVTA 1ZRMA 2Z4SA 1SQ0A 3AF2A 4W1SA 2H1HA 3JQFA 1EM6A 1AXEA 3F3KA 4Q3DA 1DC8A 1M1NB 3AR2A 3B9BA 5DN6D 3SD7A 1M3SA 3RVQA 1K5HA 5CXQA 1J2YA 3GLGB 4LYAA 4RDHA 1DKQA 4U2GA 3C98A 5C7LO 1V37A 1R12A 1CR6A 2E0IA 2WZBA 3AIIA 1E9AA 1A8UA 1XXLA 4DC0A 5JIBA 1LSSA 1UMBA 4EHLA 2PRIA 3L7JA 2X58A 2DJ5A 1GPNA 1F8UA 2WHPA 3FG9A 5BMVF 1P9RA 5I7HA 1FMCA 4EO4A 4N0MA 1KGSA 1R66A 3EVFA 4NPHA 3ENWA 2HCBA 3LQYA 4PICA 3U7RA 4G5GA 1OU4A 4BQOA 621PA 3GOQA 2AOUB 3UT0A 1XOIA 1CJVC 1ZIPA 3DTVB 4GPEA 3R7BA 2NV0A 1I24A 2NOAA 3TMKA 2A0WA 5GZ1A 1PNRA 5FUBA 2F8MA 4L4XA 1CE8A 1T26A 3TL3A 2VH5R 4UXJA 1LX6A 1JTEA 2QTBA 2FW0A 4LTNA 4LHXA 4RDIA 4C87A 4ZA2A 1P80A 5EMJA 4Q6BA 4RK5A 2V1UA 4LMPA 1Y3BE 2IV7A 3W2IA 3EXHB 2J3QA 4JB0A 2X86A 4D99A 4YCMA 1JDZA 3K9GA 4HWTA 4PSCA 3DCYA 4QU5A 1C7FA 2DKFA 2B25A 2X9NA 1DL5A 3S1AB 4R5MA 1NASA 1UDAA 1GDHA 1JTFA 1LS1A 4DABA 4ZYTA 3ZY5A 4UZEA 5F7XA 1DJNA 2H54A 5KB3A 3PGVA 3B1ZA 3FWZA 4GQBA 4LOAA 5BSWA 3C7AA 1Z47A 4QUKA 2CXXA 1SK8A 3I6QA 3NCTA 1HK7A 3I0MA 4EDHA 4YAUA 1JFRA 3QVTA 2ZBDA 3OEHA 1HG1A 4ZVUA 4PRYA 3OZBA 1B74A 5KPJA 2PN1A 3PI7A 4FE7A 3H16A 4JGIA 2EBWA 1YCDA 1K7CA 1NE7A 3EPKA 2V6IA 3ASZA 3Q15C 1ZUHA 2OV1A 3GK3A 2V7TA 2JFUA 2I4RA 4FUQA 5F1YA 1WMSA 3V2IA 1O5OA 1IXYA 3UKDA 4TYMA 9ABPA 4G0YA 1XGKA 3TBFA 3EA0A 3RPEA 3I9MA 1WXQA 3J7AC 2G77B 2JCYA 4IHJF 1GPUA 3WGOA 1BZYA 4DQXA 3SVTA 1JECA 3N2GA 4LYGA 5DXFA 3QM1A 3ZXUB 2HA3A 3GRFA 1SUBA 4UEOA 3BVPA 1SKYE 2IU6A 3BSWA 1JIQA 3IMGA 4JXKA 2JLVA 1JR3D 1U8FO 1VECA 4CT4B 3Q6MA 3MQ2A 3FI9A 4RAQA 3JRXA 4B0PA 1A9SA 2Q5OA 2VCYA 2VTBB 2BTEA 2AUNA 4IIJF 1YB6A 3ZNOA 4KPUA 1R6VA 1O9HA 3BB4A 4E22A 4EJSA 1DIHA 4NU0A 3DD5A 4TV9A 1Y8CA 2R6ZA 3RKUA 1KZYC 4W9MC 3I62A 2NNLD 3HWX1 1J8FA 4V1CA 3CLHA 3GJZA 2H1LA 4CIVA 2F67A 1OIXA 5JY1A 2QD4A 5ER9A 1GG2A 1DADA 1PQ4A 1Z83A 2GPNA 2ZRAA 3MG9A 3WNBA 4DA0A 4R1UA 3V1TC 3E03A 3UPDA 3R7AA 3LXRA 3TSZA 5KNBD 4X64B 4DHEA 3BH7A 4G0QA 5EJGA 5B7PA 3QBJA 2JHPA 3PGLA 2AG8A 1D0IA 5M34A 5ALHA 5HQTA 5FTKA 3AF1A 3O1HB 4EHJA 3K9BA 3MLBA 3PTAA 4KH0A 5I3CA 4PO8A 2GD2A 2ZR8A 5EVJA 5AW9A 4YT5A 2IPNA 1WE2A 2QLLA 5FADA 5CA0A 1A9TA 1R9MA 5HKOA 2D2EA 3UJ6A 1NE2A 4C1BA 4AUMA 4E5KA 1EDDA 1SOWA 1BQ4A 1V6AA 3C48A 5J2UB 3RD5A 1OC4A 3T1VA 5JROA 5A3JA 1DHTA 1JKFA 4DCSA 3RUEA 1OT5A 1PFVA 4BE9A 2KBEA 1RMQA 2LIVA 1KBOA 2FUNB 4IXNA 3GBSA 4OTZA 4TWIA 3M3HA 2VNHA 1EJ6A 2Z08A 5LWHA 1NJFA 1SCUB 3ZBTA 4E2WA 3H2HA 4NZ9A 4LVUA 2FHSA 4C21A 3EIQA 2ZWMA 5JVDA 1SXGA 3NUZA 2XA2A 3I6MA 3O8OB 1CY2A 1VSUA 4QHYA 4L85A 1C7QA 1TU3A 5AVKA 1W44A 1O6GA 1JSRA 2QDKA 3CNQS 2AXPA 3OU2A 3L84A 3IMFA 3MFYA 3NAZA 4Y0NA 1PU2A 4PPFA 4E21A 5K51A 2FMKA 4O4HF 4M0CA 3MJDA 2RH4A 1XRPA 3JX9A 5CU7A 3RUAA 1L5SA 3TKLA 3PRKE 4BVEA 2I9KA 3K70B 2ET6A 2DP4E 3FDFA 4NBRA 4OSEA 3AJ9A 1NP3A 3BMOA 3MEQA 5DNDA 3HYTA 3WL6A 1M0EA 2HJRA 4D41A 1DARA 3Q10A 1G41A 1E9SA 4AYWA 1A2QA 1SHJA 3MOGA 4LRYA 3S1LA 3UV3A 4S05A 4YYZA 3AEKB 1WBBA 4CKXA 3HNRA 2LV8A 3M4YA 1XZHA 3WKBA 4A8JB 2I2DA 5KTRA 1W6UA 2OB2A 4R9RA 3STWA 1K0UA 4NH0A 4WA7A 1P7ZA 3SGLA 5BWLA 2ORWA 3KEQA 4C0LA 2WMYA 2BR4A 4Z0NA 2BUCA 3C1TA 1XP5A 5FUMA 3T3IA 5E1DA 1GADO 2ZCJA 2OZLA 1ZA1A 1ZJ6A 5ILGA 3SC2B 4L3WA 1IAVA 3S2SA 1H05A 3PNOA 5EAIA 4NEGA 3AHIA 1WTCA 3BAFA 3G9XA 2PX5A 4Y2GA 4YUAA 4HT3B 1H3EA 2BGTA 1DEOA 3I4FA 3FWPA 3I04A 2PJUA 3IP5A 4U2BA 4BQEA 2YXEA 2WP8J 3EZ7A 3SM3A 2IHZA 5KQPA 3SBXA 1XMOB 4M87A 2MIIA 4DNXA 1JL3A 2F4NA 5I6DA 2WG0A 1TXGA 4BUZA 4XD2A 3GGOA 3RUDA 4AN1A 3R6WA 2PL5A 4EMTA 1I14A 1YU9A 2FUG6 4DUGD 3A1CA 3PXEA 4F45A 3QWAA 1MEOA 2BISA 4OUKX 4R68A 1CEYA 1M2WA 5AKXA 4ZRNA 2DEUA 3D7KA 4QTYA 4CCWA 1XTSA 1Z25A 5L95A 2OTCA 1Z7GA 2ZSHA 3IP9A 4JFAA 4D3DA 3P9CA 1DDGA 4D5GA 3UK1A 3BGOS 3IOEA 2Q2NA 4N3GA 5TC4A 4MV4A 3TMYA 1GCGA 1DAHA 1H66A 2GA9A 1A3CA 1CNFA 2WI8A 4FX2A 2C3MA 2R47A 3KV3O 2QRHA 4FHGA 4BV3A 4DQLA 1WETA 1GYPA 3PIIA 4WOKA 4B8ZA 3FOAA 4OA8A 1DC5A 2QLBA 1KZ1A 1ZOLA 1YFKA 4HNVA 5KYXB 1JQAA 1JKJB 1GZ5A 2IYSA 1JEYA 3BXEA 3DCJA 3UJCA 3HJUA 3P2EA 4AS3A 4DIDA 3I0NA 4GMXA 1AH2A 3CEMA 2DFTA 4RADA 1SULA 1A82A 5EUBA 4RPKA 1T9CA 3LDGA 1ZDMA 4GPIB 4R84A 3SFZA 1UBUS 2J87A 3BK1A 3AHHA 3O90A 5THQA 3ZGXA 1GJRA 1OLXB 3USES 5AJVB 2E5LB 1U5BA 1B8OA 2Y66A 6REQB 4C78A 4BNFA 2GNOA 5T3UA 3F9CA 1T2AA 5LN1A 3T95A 3LVRE 2VRCA 4MHSA 2RI0A 1YA6A 4AY6A 2A1UB 1Z36A 4XSGA 4CM4B 5EWMB 4X85A 1Z13A 2A35A 1DWOA 4IDAA 4NFLA 5FBHA 5HRUA 5HDQA 1SVWA 4NABA 4BB9A 4FC7A 1XTTA 4EG1A 4YMLA 1R0KA 2H16A 2RC6A 3OFVA 3PA6A 4KU4A 2NYVA 3MGGA 4WY5A 4KR9A 3RANA 3W1WA 1Z39A 3Q2KA 3PGA1 3M5WA 3EFOB 3SNKA 4QDUA 4TTPA 4EY7A 2VDWA 5FPTA 3EWSA 5TJ9A 1K1EA 1UJ2A 3JAWA 4YTEA 4MRMB 2NUPB 2LIPA 4PU0A 4TUYA 2G5PA 3OM1A 4G0XA 4JJKA 3HU5A 1YR1A 2HFKA 1QGYA 2AT1A 1PW5A 3NHSA 4E88A 3K0AB 4DSZA 3HKDA 4G5FA 5DM70 1XVLA 2Z6UA 1PR4A 2FDRA 1C4XA 4CV1A 1MFZA 1R74A 1XI2A 4KX5A 3R8XA 3TG8A 3O4GA 5DXJA 3EDOA 1YE8A 3KJHA 3LF1A 1TL7C 2VK1A 2Q29A 2FMFA 2VZ0A 4PF1A 5HEKA 1O94C 3DONA 2ZBUA 3MUEA 1U4OA 2GF0A 4QVGA 1E63A 1GUBA 4NJEB 4D92A 1FC0A 1JDBC 1W29A 2O2JA 2ZDQA 3HUEA 1GNVA 1FJXA 2XF8A 3VKWA 3ICEA 2FSFA 1CY0A 2BGGA 2R8ZA 4E5VA 1MPTA 3P5SA 3KR2A 3HZHA 2HF8A 4G5RA 3U44B 1QRAA 3BTOA 5C35A 4QQFA 1Y4UA 2X7HA 4FNAA 4DV6B 1A8PA 3REQB 4RA6B 1RI2A 1QCYA 3P9ZA 1ZVJA 3RIMA 2GEVA 2VHYA 1FW8A 1NMQA 2H1WA 3V4FA 3Q3JB 4ZQGA 2PWZA 2D6FA 2JCVA 5C7YA 3PFIA 1N2JA 1CT9A 3HL0A 1M8KA 3NFRA 1J21A 1E98A 1LQTA 1SCKA 1UFKA 3JASA 4WSOA 5TJHA 3SS8A 2UYHA 3BF8A 1P2DA 3LKZA 4XTRA 1ZP6A 3HVHA 1EFUA 1ZWLA 5EKSA 4W6QA 5A04A 4INZA 1CTQA 4X92A 1ZMBA 3R7FA 1GGHA 1M6EX 3OKFA 4UTXA 1CQJB 4TTVA 2ASEA 5DB4A 1LF0A 2D5CA 1Y1SA 1U7UA 3IBGA 4FFWA 1R0BA 4KFTA 3HKCA 4OOEA 3ZX5A 4GW3A 4HAXA 3D7LA 1H2EA 1V4VA 5FXMA 1D09A 1TA4A 3MJHA 4IWYA 4UARA 5L3ZA 3LF2A 5J4HA 2HV8A 1VI2A 4QPNA 2ROQA 1M2FA 4PY2A 4IWXA 1RKBA 1K97A 1XQ1A 1X9IA 2AOXA 2AYZA 3P2MA 1Z4NA 3EK2A 3KZNA 4YRKA 1NRJB 4V39A 3TX6A 3ROFA 3KYIB 3P9SA 1E6EA 1DB3A 3OP4A 4XDZA 2ZDGA 5LBTA 3BFVA 1P44A 4IKOA 5AT1A 4JUFA 5I7UA 4Q1FA 3NTOA 5J2UF 1WHSA 4Q5IA 5J59A 2HMYB 1TYAE 2W6JD 3FAZA 3FOZA 4W5TA 1IMJA 2VATA 3IP6A 1PR3A 3ITNA 3M6FA 3CNHA 3T5BA 4DVJA 4IAOA 2WWFA 4L5IA 1OFTA 3PDUA 1UMDB 3ACCA 4XM0A 1SU7A 4P4TA 3V6LA 2WDPA 1JDTA 2WK1A 3GELA 3DAGA 1XYYA 4HDSA 3E7DA 3N2IA 4NC9A 2ZE7A 4II7A 3Q41A 4CDMA 1UM9B 2EZ4A 2MSKA 4WOBA 1UQUA 2PX8A 2QMUA 3GJSA 2BHTA 4EYQA 3CN7A 5BQ3A 1W9HA 1A2KC 4LXHA 4RPIA 5HIMA 3W3ZB 3K5IA 2WTAA 1G7CA 3MGCA 3VZRA 3HO6A 4IMPA 4NK4A 4UULA 5F78A 4OQYA 1TDJA 4OFXA 3TUIC 3UAYA 1XZMA 2Y99A 4G26A 1Q74A 4L2IA 5LQJA 1TLTA 3HPQA 5ENVA 4MR9B 4KIGA 4DLWA 2D5AA 4DZTA 3PDCA 4C2UA 3EC2A 4K87A 2GRUA 5KYUA 5DBHX 3WGTA 3O4FA 5AM5A 4N01A 4QPZA 3F6CA 3QPBA 5TX7A 2IJGX 2J0VA 3WSVA 3GJ6A 3EH1A 1BGWA 4JSRA 3SSMA 2SKDA 5FUXA 1SO8A 2IHNA 2PYIA 4GH5A 3FNGA 5HS4A 4HGQA 2P9QA 4MYHA 4CKYA 2O14A 3K6SA 1NDUA 1QLJA 3IOCA 1UKVY 2GBIA 3JCZA 4MUYA 3D2AA 4IZ6A 4LQLA 1QHNA 2X3FA 4M1ZA 2RHJA 4HTFB 4CL8A 3G68A 3BMCB 5IF9A 5JY6A 1N2IA 2NO0A 5A5DA 4JYCA 5LXTB 2Q9BA 3LYUA 2F62A 3GZNA 3K73O 4F2PA 5AFSA 4JZKA 4FC6A 1PG0A 2H1SA 4ARAA 2D5LA 3Q0TA 1ORIA 2YFYA 5CDTA 2PCJA 4MRVA 3G5LA 4AP9A 4CKWB 3O3MB 2V96A 3VO9A 4LKRA 4E7OA 2WV7A 2FZWA 3K0EA 7YASA 5IZCA 1DKRA 3ILXA 3ROKA 4W63A 3U5TA 4AQ7A 1Z4MA 1CUGA 1JU4A 4ZICA 3CW9A 4OQXA 4EVQA 3OETA 3WWDA 1NRIA 2XW6A 1IYZA 1FX0B 2A33A 3NS7A 3RBVA 4OAPA 2G63A 3GJXC 3ODPA 4MS4A 3WLKX 4RVSA 1MEEA 1I4WA 5GJBA 2UUAB 1GRCA 1XEWY 4ZMRA 1P4AA 2F3RA 3MTBA 1XMQB 2AWNA 4BGIA 4QTXA 1YRQA 3AHJA 4FB5A 4IZHA 1UBLS 1E9FA 4LC1A 4OEHA 1K3TA 1ZLYA 1Z3CA 3VR4A 2FPSA 4MV5A 4D4KA 5KTTA 3C1OA 2ZTSA 1SMKA 1T1GA 4PSKA 2NU9B 1M6YA 4FFBA 1DJLA 3HA5A 4AIRA 1E6UA 5K3FA 2V0NA 3GUUA 1EE1A 4MYTA 3KL4A 5TQ0A 3ESDA 1X1CA 4ERNA 2FPKA 5C4GB 5I8WA 3PJRA 4KPEC 1QYDA 1RM3A 4X6UA 3OOJA 4CQJA 3S8YA 4XRGA 4ERXA 2AMVA 3JQBC 4B3IA 4I6GA 3PRJA 3CJTA 4YMSA 4BLTA 1YZQA 1MOSA 3LXUX 3ROEA 3A36A 5K0JA 2R1TA 1M1YE 5CVJA 4ZVRA 1L1FA 5KTMA 2UU9B 2GJAA 1E2UA 1QG0A 1YUBA 3LT5A 4KDCA 2PVCA 4MUKA 4NBSA 3O8CA 5EJ8A 1NW6A 2EJWA 1IPEA 3ZLVA 4JI0B 1N5LA 3WYFA 4PG4A 2Q4DA 4LGVA 2GVDC 3RCBA 1JG2A 3PXGA 3EH2A 3FHLA 3KL2A 3DL0A 3K6KA 5T7BA 4DANA 3AHGA 4WXRA 4Q37A 3OJ0A 2ICAA 1EJ2A 3UG6A 3DM5A 2WF9A 3WIBA 2QJWA 1M6NA 1T8YA 5LLDA 4LHEA 3DLTA 1YKGA 4P54A 1P7PA 1S01A 2JAQA 1MO2A 3RJ5A 3IURA 5C1DA 3GPIA 4MVJF 3UJ7A 3QKWA 1YVDA 1HOXA 3ETGA 3A9RA 3U2QA 2WKWA 1Q3HA 2D5BA 1CU1A 3LUCA 4GWLA 2F1OA 3VTZA 4AJJA 4BLPA 1ONNA 2YW2A 5A0TA 3VI3B 4FM9A 4E07A 4G6ZA 4XR4A 3RAJA 1J1UA 3JQDA 3UHFA 2C94A 2WVAA 2G4CA 2HJSA 2IKQA 3FYDA 3IO3A 3UBMA 4C4AA 1C8BA 4DSAA 4B3BA 2E37A 3P9KA 1HDYA 4ZTUB 5KX5B 2I65A 2XA9A 4PZLA 1JEOA 1P5JA 4I5GA 5JG7A 3R76A 4B4UA 4OJTA 4PFKA 4H1WA 2W6NA 2C4UA 2IDZA 2IWRA 5INTA 5HBRA 2HK9A 1H2HA 1FP6A 1JJ7A 2BBTA 2DQKA 2WHYA 4LZNA 2O1SA 2Z2ZA 1SXJA 3PD0A 1G38A 5AVSA 3CNOA 4DRYA 3RJZA 2C7RA 5B36A 4OHCA 2E4YA 3VZPA 5B64A 4FFMA 4HPXB 4BFTA 3T4UA 1N7IA 5KVAA 2P5YA 5DOZA 3KB6A 1GXSB 4TLMB 5AXAA 2EL9A 2CV2A 4H2DA 4WKCA 3G17A 4C06A 4IFIA 3E5NA 3DHEA 4MV6A 1KE1A 1X8JA 5IVPA 5CCDA 1JYEA 5ARBA 1K3UB 1YS7A 2P27A 3H8JA 1Z15A 4FYHA 4CW7A 5K8VA 1M7BA 3I1YA 4HJRA 3CR8A 4B4WA 1DUSA 2FQYA 1BRTA 4EZIA 2YBDA 4YMVA 4QQRA 4IQGA 5E8JA 2WY2D 5DEIA 2ACKA 3IALA 1EVJA 4HB2A 4R0MA 5HFNA 1GRRA 3D1JA 2HU2A 1RCUA 3DOJA 1SC1A 1VSTA 2WTBA 4MKIA 3OC6A 4IICA 2QG6A 3RSFA 2WFLA 2Y9MB 4EGFA 1ZXLA 3EYAA 3GLFA 3QFHA 4C0XA 2ANBA 4F84A 1DXYA 2P90A 4ZVMA 2VJCA 5IK2D 3GAMA 3TLMA 1V1JA 1WUKS 2C9DA 5ALXA 1CUJA 2HT1A 1EFHA 2NPFA 5JHGB 1W34A 2GM9A 4YO7A 1U0LA 1MH1A 1HE1C 1H2XA 2XXAA 1ECFA 3BJIC 5K8JB 2D62A 3EC1A 4ITRC 4ME6A 2F48A 3GLQA 2FKNA 2QXUA 2RH5A 3NATA 4QXOA 1LBQA 1UODA 1IZ0A 2JD2A 1S8AA 3FHOA 2O50A 3MRVA 4YFYA 1UK7A 4RAOA 5HKLA 2VPZA 3GFRA 1OI7A 3QVWA 2OPHA 5BN4A 3LC2O 1Y6JA 1L4FA 3HRHA 4AL4A 3LT1A 4EHNA 1WOMA 2RONA 4D9JA 4GKKB 3PEYA 1YULA 4NF2A 2QUIA 4GKBA 3ANTA 1NBOA 2OAEA 5JMOA 1BYIA 2FFHA 3A27A 2O8BB 3MJSA 3WLIA 3SHTA 1HE3A 1PUJA 3ZPXA 1M33A 1ABFA 4UCWA 1YDGA 1IN6A 1HY3A 1C7ZA 2ZYTX 3I58A 3EEIA 4TN5A 4ZOLB 5H4HA 4I3FA 3ZHVA 3I9FA 4WVLA 3TLGB 2Q6LA 1ZD2P 4IY1A 4RMIA 5REQB 4Q24A 4LVNA 3KT0A 2IYYA 1T4GA 4FKBA 3AVQA 1XAJA 2BEUA 3UMFA 1JMVA 1ORRA 5F1KA 6PFKA 3DO8A 5BP7A 1VMEA 1R5BA 1JZTA 1VCIA 4ARZA 4MO9A 1BVHA 1QV7A 3UAZA 3QYFA 3INGA 4TL7A 3PS9A 4MB6A 1NIJA 3B1JA 3D6VA 2Y93A 4RNDB 5AJHA 1DSSG 5DYNA 3W4JA 4EELA 4P5DA 1SELA 3JQCA 1GA1A 1SKYB 1T4CB 2NV2B 2TMKA 2VQ6A 3FYUC 3GJYA 3MB5A 4G56A 4IIEA 3V42A 3AK4A 4RKYA 1XHLA 3RTDA 3W3AA 2BD0A 1XPJA 2GSDA 2I03A 2YJZA 1FUKA 5K3EA 3A6ZA 3BWCA 4KODA 4AJIA 2CMDA 3UK6A 1QNFA 4J4TA 4PC6A 5EIFA 2JH3A 1D6SA 2CHGA 1H1TA 1G4UR 3N6VA 3K96A 2FWMX 3TSAA 2VR1A 3GA7A 1EGAA 4EPRA 2VXCA 3AM5A 1DTWB 2V5VA 2REOA 1XCPA 2FVYA 4AMYA 1OFUA 3FCEA 5DCLA 1RE0A 4JLWA 4K9OA 1J0AA 4ETNA 3KZKA 1CJTC 4B2YA 3HFSA 2BCEA 4JI1B 4XE5A 5A7HA 3EVNA 1W8DA 3AL2A 3KHKA 3PXUA 4K2AA 1PQUA 3LQQA 1CY8A 4BX8A 3K5WA 1RR6A 2VS1A 3UZUA 3BCUA 2JATA 4IDFA 1Z4OA 3QRWA 5LXTF 3SXUA 2GBCA 2RARA 4IFEA 1R8YA 4OYRA 3W8FA 4ZVPA 3G7UA 1Z63A 2GYVA 4K3VA 1DZIA 1PGJA 2G25A 3PIRA 2WJWA 1U2DC 3L6OO 4TKMA 2IZ1A 3BRQA 3BWDD 2CVOA 4FHZA 2QL7A 4KR6A 1CUIA 1R3UA 2IEBA 3F2VA 4S2EA 1TJ4A 4LYFA 3GYBA 2PCLA 2DWUA 2H2HA 4YRRA 2RGAA 4KXLA 1MN6A 2I3ZA 2RFLA 3FWNA 5EP2A 3GBPA 1OHHD 5G02A 4BLSA 1AZTA 3EZFA 1B26A 2KX7A 4C88A 3CUUA 2PMEA 3QU9A 4G89A 5LQSA 3TN7A 4CMEC 2FSUA 1KO8A 2F4VB 4G1CA 1DT5A 1N0VC 2HGZA 3A1TA 1T6NA 5ELXA 3ZGZA 1ZNZA 2ZDHA 3H9QA 4UTZA 3EISA 3B7GA 3OZ7A 3U7HB 5J43A 4UZFA 2B9VA 4R9SA 2PUJA 2QE6A 2I3AA 2EGUA 2CLSA 1QJCA 1PYGA 2KBFA 3P8ZA 3IUNA 4Q4JB 4EEZA 4Y2RA 4NCNA 1T1IA 5K5EA 1IEXA 3TL6A 3JZMA 1XFDA 4DIFA 4EB3A 4QQKA 1JDJA 1R6TA 3P9XA 4M9CA 3RJMA 3UGKA 1V71A 3EMVA 1U1EA 5C3MA 2V59A 1T34A 2V97A 4C7JA 3NYIA 2BFBA 4N7BA 3Q6IA 2JB9A 1GZ3A 3GVXA 2WPDD 4B46A 4H7HA 1ISRA 2II6A 5AM4A 1G98A 3RTAA 5F12A 5FBWB 4FI3F 4YRGA 4KNYA 3IDFA 1QHIA 2FJ0A 3AJEA 1ESEA 3IIMA 1KY4A 1QP4A 1JPJA 3A6GA 2ZZMA 2YWRA 1JB1A 3IMCA 5SYNA 5ES3A 4BO7A 3DH0A 4ZN6A 1QO7A 1SCQA 4X61A 4OY3A 4REQB 1RPNA 5KIAA 1SY7A 3IGFA 3THRA 1RRKA 2AG6A 3HVIA 3I12A 4XB2A 5B7QA 2X42A 4FXPA 2A86A 4IEIA 4C7OB 1SK9A 3HFGA 1Y33E 1CQWA 2I3GA 2OEPA 4DGQA 3ZDDA 5ALPA 1UJMA 2IZ6A 4A16A 4HFRA 1F6BA 1LWOA 3IOBA 4B4OA 5AVYA 3UMYA 2AW5A 1O8CA 4O2AB 1QIEA 1X8LA 3IVXA 4I1YA 2XB8A 3RS8A 1RQRA 1D6MA 1IG3A 1XKXA 2BFNA