1F2TA

Crystal structure of atp-free rad50 abc-atpase
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
149
structure length
145
Chain Sequence
MKLERVTVKNFRSHSDTVVEFKEGINLIIGQNGSGKSSLLDAILVGLYWPLRIKDIKKDEFTKVGARDTYIDLIFEKDGTKYRITRRFLKGEIHAMKRLVGNEWKHVTEPSSKAISAFMEKLIPYNIFLNAIYIRQGQIDAILES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAD50 ABC-ATPASE
publication title Structural biology of Rad50 ATPase: ATP-driven conformational control in DNA double-strand break repair and the ABC-ATPase superfamily.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Replication
total genus 31
structure length 145
sequence length 149
ec nomenclature
pdb deposition date 2000-05-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1f2tA00
1KNXA 5GVSA 1E1RA 2FZ4A 1CULC 1E2NA 4RZ2A 3T5GA 4CW7A 4GFDA 4N1AA 4YC7A 1DE0A 3GEHA 3VHXA 3UXMA 2A78A 1W49A 4G5QA 5CYOA 4DCVA 5L3SA 1CP2A 2J0UA 4B48A 1PUIA 3IIKA 4D4JA 1OH6A 5GVRA 5GJBA 2QAJA 3QXCA 5DE3A 1TF5A 2ZSFA 4Z1MD 2H18A 1IJEA 3OIUA 2REBA 3Q3JB 4I1UA 5FTMA 1K6MA 5JRZA 4G1UC 4LSGA 4ZDIA 1SXJA 1MO4A 4G5GA 1P9NA 2ZRKA 3TE6A 4BZXA 1U99A 4ZCLA 3KX2A 1AS3A 1RW4A 2AFIE 3PEWA 3AVVA 4AD8A 1KIMA 4JJKA 1YJ5A 3EAQA 3HR8A 2ZYUX 3KZ1E 1UDXA 5SZIA 5HZHA 2IYYA 4HYYA 3GJ5A 5HE9A 1QF9A 2Q6TA 2VA8A 3KKPA 1TX4B 1XPRA 3D3QA 3QY0A 2ZR7A 4A9AA 4WVFA 4CEHB 5C18A 1N6KA 1G8GA 2J59A 3DOFA 4KFSA 2ERXA 4DCUA 3K0AA 3O8BA 1U81A 1BKDR 3R9XA 2VEDA 2G0TA 4HZUB 1NG1A 4EIWA 1LW7A 1EWQA 2XGJA 3FGNA 4V0NA 3GJ4A 3QEJA 2F43B 3PXGA 2RHMA 5TARA 3U2QA 3WNDA 4LC0A 2EWVA 1NSFA 1R0XA 4B71A 4DSUA 4N0DA 2QSZA 4AKGA 1QHYA 3SZRA 2PLRA 4IJMA 1KSFX 4NDZA 4CEJB 5JJKA 1XB2A 2FU5C 3B60A 3TSWA 1G20E 3RS3A 2MMGA 1NVXQ 221PA 4E07A 4DZZA 5DISB 3BORA 1BMFA 2AL7A 2VSFA 1VG0B 3I92A 3L8ZA 3QNUA 4Z8XA 3KQUA 2WJIA 4A0HA 2WJJA 5AR1A 1NY5A 3WHKA 2WBLC 5FUVA 4EPYA 5J4VA 5LB4A 3THWA 2IF0A 2CHQA 2PJRA 2R65A 1KK3A 3GLGB 1WXQA 1YZLA 3B8HA 3K53A 4OK5A 1OB2A 2DHRA 2VP6A 5FOWA 3H4MA 1J8MF 4KYUA 4BZPA 2IHYA 5FPSA 5HPYB 5J40A 1KMHB 1IXRC 1E1QD 1TQ6A 2R6FA 4GP7A 4IFBA 4BRUA 4BUJA 4CZ2A 4G3XA 2FGKA 4XWKA 4GRAA 5EE9A 4BLRA 2AKAB 1E98A 2I1VB 4MRRA 4XTRA 4A2PA 5B64A 3KXLA 1V5WA 5G41A 5JSZA 2FEOA 2VHTA 1RYHA 4RFSB 1E2JA 1J90A 1CU1A 5E95A 3KXKA 3FMPB 3FB4A 2GK6A 4QBGB 2I1QA 2HV8A 3PVSA 3Q7QA 5CIQA 5F2EA 2VBCA 4BLSA 4R2HA 4X8LA 4KVAA 4LDJA 1AKYA 1U94A 2YKGA 2WHXA 3P4YA 3K09C 4IFEA 3RAPR 1OYWA 2HJGA 3WNCA 3CW2A 3LA6A 5IRCD 4GNKA 4D4LA 1QHXA 1X3SA 4GSYA 5DYGA 3TQCA 3REFA 4FWIB 5JS8A 3CF0A 1IY1A 2J45A 2OLKA 2YINC 2PZGA 2XJ9A 3EA5A 2ZRDA 4QJ5A 4O0MA 1EFRA 1P2UA 4W5WA 1YRBA 2XNDA 3CX8A 4PR0A 1CKEA 3RS4A 5HKKD 4RKFA 5KDDA 5TMPA 2ASEA 2GETA 2FFBA 2QM8A 2VRWA 2ZE5A 4QBHA 4C0SA 2QU8A 3W3ZB 1ZUHA 3OEHA 2FN4A 1DAFA 1DAMA 1W4AA 2F1RA 2WWFA 3T1QA 2H16A 3AF4A 1DAGA 3I73A 1W48A 4PZYA 3C4JA 5EE1A 5CB8A 3IEUA 4OI4A 2BMDA 4WZ6A 3X1XA 4C0AC 1RRCA 2JDID 1VPLA 1VIAA 2PH1A 2Q3FA 3NC1C 4W5JA 2FPKA 2ZU0C 4URWR 2WIAA 2JLZA 3A4NA 4OHZA 1ZUNB 1VYTA 3KKQA 3SE0A 1OLOA 1XTSA 3DZ8A 3VR6A 5JLJA 2BMJA 2C8VA 2WPDD 5DN6D 1B0UA 4Q4JB 3DVLA 4TMWA 1Z83A 2QGZA 4PQFA 3C16C 5AJWA 4N0EA 4ZI2A 3R20A 4OYHA 2XTMA 3KDSE 4TL8A 4DC9A 3UIEA 1NSTA 1IN8A 1JPJA 2QAGC 4OHYA 2OILA 1FMLA 2PLFA 4EJSB 2ZYWX 3MUFA 2ZRFA 4B34A 1MO5A 3GEIA 3I61A 4US0R 1IAQA 3WYFA 5K8TA 1X8LA 2YNMA 2JCSA 5D3QA 2E9SA 2V54A 1N5KA 3C8UA 1D9ZA 4ARZA 1EFRD 2LWIA 4B6FA 2WSSD 2G1KA 2ZVQX 2GTPA 3T12A 1KK1A 2QE7A 2W2TA 1K8RA 2ONKA 3QG5A 1A5TA 2O0JA 4IOLA 4QL3A 5DYIA 1ZM3A 4DCNA 2WWWA 3K9HA 3GMTA 4A0FA 3UPUA 121PA 5FTJA 1YR9A 5KPDA 1XJCA 1D5CA 1W0KA 4TL6A 1OIWA 2DCUA 2XEXA 1SVWA 3KJHA 5G40A 4NCHA 4HAWA 2P65A 3WRYC 1GRQA 2FGJA 3MRSA 4EJSC 5IT5A 3RRYA 1XEXA 2Q9BA 3QXXA 3BOSA 1JXOA 1XWIA 2NIPA 2CL7X 4Y0VA 1BO6A 2NO0A 1ESMA 2O8BB 1IQPA 2QQEA 1NVVR 3AF1A 4TMZA 2CMKA 2ZYVX 3GFTA 4M21A 3QI2A 5EE0A 4XH9B 3AEZA 4LCBA 1F48A 3A4MA 1G8PA 2GF9A 3SQXA 2ZAMA 4CYMA 2FSHA 4B3CA 1E9DA 1KKLA 2VHUA 3NBFA 2Q3HA 4C9BA 1FNMA 1KSHA 3TSOA 5G53C 1F2TA 2I3BA 4I1OA 1WQ1R 3LO5A 4FMCB 2DPXA 2NZJA 3CB4A 5JS7A 1JXMA 4V0ME 3OIWA 4MQBA 3DMDA 2WV9A 2FSGA 4UXJA 4WA7A 1L4YA 2QG6A 3VMFA 2BM1A 2Z6VA 4IVPA 3FOZA 2A5DA 2J0VA 4I1VA 2QM7A 3SS8A 1II9A 3K09A 1O3YA 1RVDA 2YV5A 1AS0A 4FI3C 2V55B 1E9CA 2H92A 3NH9A 2JLSA 1E79D 1XMJA 5FUXA 1AGPA 2J0QA 1HY3A 3ZLJA 2HCJB 1W0KD 4P4SB 5TV2A 3ZGXA 2VIIA 2D2FA 5H8WA 5DSZA 2YWFA 1E0SA 2YOHA 4P31A 3H1TA 1T9HA 1TPZA 3BJIC 5FFMA 2FPMA 2ZS8A 2ZIAA 1S3SA 4WBSA 3AVWA 1Z47A 4X8MA 2ZJ5A 2O8CA 1NMZA 1YHNA 1ZM9A 3NH6A 4A92A 5JI3E 5FL7A 3BBPA 1KK2A 1QDEA 1G8YA 1H8ED 1P72A 1QZXA 1Z5ZA 3BFVA 2NTYC 2DB3A 3H84A 4PPNA 2WAYA 2VF8A 4MDEA 2YVUA 3U4QB 1US8A 1SXJE 4L9SA 4XJXA 2ZJOA 2KBEA 3X2SA 4Q1FA 1NRJB 3NXSA 4ZPXA 2PBRA 1W47A 2RGDA 5CJPA 3VX3A 2OESA 2W6ID 3X1ZA 3G5UA 4A8JC 5SZKB 4RJLA 3TAHA 1WRBA 4FINA 5CIWA 4AKEA 2QAGA 2WICA 3VU9B 2OHFA 1DS6A 5IF9A 4OHXA 1R8QA 3P4XA 3BB4A 1AJEA 3GJ3A 3TR5A 2PEZA 3N2IA 3LBNA 4BFTA 3AKYA 1PVOA 1I2MA 4M1KA 3IBGA 1CIPA 1CRQA 2ZU6A 2QROA 1X86B 2WMOB 1NL3A 3GLFA 2RKOA 2FH5B 4GT1A 2NGRA 2PZFA 4XOIA 5FBLB 1F2UA 3HDTA 1QHGA 4PHFA 5AJYA 1YZTA 1KY2A 5CB6A 1KNQA 4QG7A 4ZIRB 1FX0A 3AGPA 4TZ6A 3IIJA 1GFIA 1TEVA 2ZEJA 3B2EA 4RD1A 1QHSA 3AM1A 4LJ8A 4B76A 1JBKA 2ZI4A 3NBXX 4Q9HA 2OLJA 1JJVA 2IEZA 2ZITA 5DI3A 4KAXA 5FOXA 4C30A 4CDGA 4M1WA 4F93B 3R9IA 2OG2A 1LNZA 4PZZA 2J7KA 4QGHA 2P2LA 3B1WA 4RVCA 4UXHA 1ODFA 2CVHA 2BOVA 2L0XA 1NMXA 3I8XA 1QG4A 2CBZA 2F1IA 3IHWA 2KE5A 3NWJA 4HB0A 3ONWA 3VAAA 2YC2C 1ZCBA 3LW8A 5BN5A 5CYPA 2IBMA 2BCJQ 4C0BA 5KO2A 2V3CC 2QGNA 3IO5A 2A5YB 3EARA 3B85A 4BFYA 3SJAA 1MKYA 4KSCA 1VCIA 4POAA 2VSXA 4YXWA 5JMTA 2VP2A 2LKDA 1KYIA 4FCTA 1W36D 1R5BA 2HLDD 5KSZA 1P6XA 4ESVA 2GJKA 5M04A 2HT6A 2VP5A 5ELXA 1L4UA 1YR8A 4PC3A 4Q4HB 4PAMA 3BRWD 2J5XA 4MKGA 5H68A 2IF2A 4NYMQ 2O8FA 2QTHA 1ZD8A 1P2SA 1D9XA 1H8HD 1E9EA 5KSYA 2AR7A 3AF0A 3GLIA 2A30A 1TU3A 4FMCF 3VR3A 2F55A 2ZUDA 4D82A 4QOSA 3OE7A 1G291 1KO8A 4D0NA 2RB4A 4M4SA 3BIFA 2O8DA 3OFND 3K1JA 3CNNA 5CDFE 3P27A 2QNRA 3CLVA 4I81A 4F4CA 2IXEA 4LWZA 1T5IA 4MDFA 1KI1A 4HAVA 1AIPA 4I1SA 1YZGA 4WW0A 1T0HB 4TT3D 1OFIA 3TW4A 5HE8A 4EUNA 1YR7A 5FBWB 2ZPTX 4YMUA 2GZAA 3LD9A 4PQYA 4MKFA 2GAOA 4E09A 3L0PA 4Q66C 5GJVC 1NIJA 5JHGB 4FMDB 2QBYA 1Q3TA 1P60A 2AK3A 2C9CA 1G9XA 3ETLA 3T5DA 2CCKA 2V7QA 3MMPA 621PA 4D25A 3GCGA 2XXAB 4XTCS 3QXJA 3C5HA 1TL7C 4KBFA 5FTNA 1FOEB 1RYFA 4KVGA 1P62B 2QN6A 4NYIR 4URVR 1Z6AA 3NC0C 2NOAA 5CITA 2BHRA 2ZSBA 2OXCA 1JI0A 1YZQA 3U3JA 1OH8A 1XRJA 3DHWC 2DWOA 2ZRJA 4KU4A 2IUSA 1Z2AA 1YQTA 1NN0A 2DBYA 1GNQA 1G7CA 2FEMA 5EZ6B 4A8JA 4DJTA 2YWHA 2GESA 2C2HA 4B73A 1E2DA 4HUQA 4ASUD 1BOFA 4URZR 1OIVA 2ATXA 4NCNA 4AG6A 1Y63A 1Z3IX 2NMVA 4L8GA 1LF5A 4R2IA 3K9LA 1HA3A 3PQCA 3RS0A 1GM5A 3HYTA 1DPFA 3EX7C 3LNCA 4OQMA 3EIEA 3SNHA 2E87A 1G3QA 3C14C 3O8DA 3ZD7A 3LFUA 3GJ8A 4IXNA 2CVFA 2GHIA 3ZZTA 3ZQ6A 4TYPA 2W2VA 5FR1A 1AZSC 1ZRHA 3ZQJA 3DZDA 1EFCA 4JJZA 1BYIA 2D2EA 2F3TA 2V6JA 2ZRNA 2PCJA 4LPSA 4LYAA 1YRAA 3F8TA 1BH2A 2OFXA 1XCGB 2D4HA 1M6NA 1DO0A 3A8TA 1QG2A 3ZVLA 1T8UA 2XITA 4IOJA 4NCJA 2JJ2D 4NHOA 2D06A 3GJ7A 1FP6A 3RC8A 2G9NA 4JVLA 2WIBA 2YZ2A 5D3MA 3DPUA 3AVPA 1G18A 521PA 4XWOA 4DKXA 3MGCA 1Q20A 2GJ8A 3R7WA 2NO6A 3CBQA 5FI0B 4EDHA 4JYCA 1MOZA 5DO9A 1KTVA 2C04A 2VSOA 3EXAA 4M1MA 5J4HA 1SKYE 4JLJA 4M9QA 3FHOA 3JVUA 3VNVA 1F5NA 3TKLA 5K8IA 4A36A 3GLHB 3AP3A 1P2TA 2FJUA 5KDLA 1GSIA 3IDQA 4EPRA 1Z63A 1C9KA 5FR2A 4PO1A 5C2JB 1N5LA 1LFDB 2R44A 2V4ZA 2CCGA 3OZXA 1VHLA 1NLZA 4H9GA 1JNYA 1XCPA 3MJRA 3LX8A 2ZAOA 3NIBA 1M1YE 2CJWA 2XB2A 3IO3A 4TN1A 2BKUA 1RIFA 3B9QA 2WJYA 4PANA 3ZS9A 4ZO4A 2PMDA 4Q1BA 3ZVRA 4OI1A 4X8HA 4MGKR 1P9WA 1W0JD 4MRSA 1E3MA 3UKDA 1W7AA 5ANRB 4NONA 2XJ4A 3LVRE 1T5LA 1XBTA 1NLFA 2BJWA 3RLFA 4AC9A 1I4LD 1P7CA 3V00A 1M7BA 4LY6A 4PHTA 1WE2A 1KJZA 2F3RA 1G8HA 2ANBA 3JZAA 4Q7LA 5JJIA 3LLUA 2V6IA 4LHXA 1BIFA 3QENA 4A82A 4BFXA 3D7MA 4DIEA 2ZXUA 2QA5A 1J2JA 3MWJA 3ADBA 4M9XA 1AM4D 3AB3A 4Q48A 3EC2A 4GZMA 1G7SA 2GXAA 4FMBB 1D6JA 1LF0A 3CPJB 3SEAA 3LX5A 4RCYA 1GRRA 4UNSA 3I3SR 2VH5R 2DR3A 2JJ1D 3BERA 2XSZD 2EU8A 2ZUBA 1NLYA 2IK8A 4TLDA 4BFWA 1ZW6A 3CNOA 3WHLA 5AK0A 4OK6A 4B3FX 4BLQA 3FWYA 3TIFA 2NZ8A 2G77B 4M22A 4C7OA 4EAQA 3BXZA 2ZSEA 4II7A 2FPLA 2OCBA 5FBVB 3ICQB 2ZSDA 2JLXA 1Z0FA 5C4MA 2Q0HA 1II8A 1KY3A 3BB1A 2TMKA 1J99A 2C77A 5JRJA 1NN1A 4JYBA 3CR8A 2FFQA 3FFAA 4PZLA 2ZI9A 3THXA 2ZE6A 4X8OA 2HF8A 2XOKD 2ZRIA 2ZQ5A 2A2ZA 3W5IA 1GKUB 3K0FB 4HDCA 4JLAA 1HT2E 4D6PA 4KV9A 4LK2A 4WOPA 3W6NA 2C78A 5G3ZA 3CRVA 3B13B 1TNDA 3K70D 2GXUA 3H86A 2WJGA 4B44A 2UVQA 4JLPA 1ZIOA 4JL6A 4DLUA 2Z5FA 2FFAA 4EQ6A 2WWHA 2P6NA 2XAUA 3VX4A 3HPRA 1G5PA 3B78A 1XMSA 5FH9A 3PENA 4Q7KA 1XTRA 4OL0A 4DUGD 2RAPA 2OM2A 5EUMA 1XD9A 3KTAB 5JCPA 1EG7A 5SZHB 3IQWA 2OCAA 2PJZA 3ECCA 4B2IA 2JAQA 3B1YA 3KB2A 1E1RD 4PC2A 1E96A 3RABA 2ODEA 5AUNB 2QQ0A 1G7TA 1R8SA 3GLFE 1DVRA 2MSCB 2ZS9A 2B92A 3NVAA 3F5FA 3EG5A 4H1UA 4AI6A 1ESNA 2R6DA 4HDOB 3LDAA 2QTFA 5CJ2A 1XXHB 4TMKA 3I1FA 1XD2B 3CZQA 5BYKA 5BW8A 4E5UA 2N1BA 3PV0A 3A1VA 3DKVA 1R5OA 3W5JA 2JLYA 4WAUA 3QF4A 3OIYA 4URXR 2PL3A 3GP8A 4IKEA 2CLCX 4QJ4A 1RJ9B 1SXJD 4KXFB 4Q7MB 3ZH9B 4LBZA 1JECA 5K8LA 4UJ3A 1BS1A 2QENA 3B9PA 4IVRA 3R8CA 2RGAA 1ETUA 3EPJA 3KKNA 4TMTA 2EVWX 3HWSA 3VQTA 4RD4A 3D8BA 4DWJA 2QPAA 4EFMA 1NVWQ 4TYNA 3NEYA 1IXSB 3UWKA 3LW7A 2OFWA 5L3QA 3OEEA 1OXXK 3P26A 1R0YA 3TJZA 3I5XA 2IYXA 3EPKA 4TWZA 5IK2A 2REXB 3H2YA 2F9LA 3N2EA 4Q4AB 5SZJA 2HT1A 1VG9B 3B82A 1F2TB 2AD5A 4ZI3A 1XU4A 2YOFA 3V4RA 2FSFA 1XTIA 5CDFA 1AQYA 2P5TB 5BN4A 1OE0A 3GLIE 4RZUA 2WOJA 4IW3B 1QHHB 3FKQA 3RC3A 2CNWA 4EFNA 1XX6A 1PZNA 4U02A 3U60B 2O8EA 4JLKA 4XSGA 4AK9A 2JLWA 2ZRHA 2OV2A 1OHHA 3KFXA 2GEVA 4TSFA 2KBFA 5JZVA 1HQYE 3BH7A 1R0ZA 1RE0A 4Z51A 4DBLC 1BMFD 4DDWA 3PUZA 3VKWA 4NBSA 3QJYA 3CWZA 1WF3A 4Q00A 4RD3A 1L7VC 4HSEA 4LPKA 3QEOA 2IUTA 1A4RA 1OFTA 3R8FA 1N6LA 4W5HA 5CK4A 3OESA 2R6GA 3AKCA 1WBDA 2HDNB 3GJXC 5GADl 1MABB 1XEWY 2J87A 1ONBA 2O8CB 4AKIA 2QP3A 1Z0IA 1VYVA 2PT5A 1U0HC 2IYLD 1JB1A 3BB3A 2ODNA 3SOPA 1Z06A 1U2RA 4B75A 4GPTA 3B1XA 2CDNA 3W3AA 5BWMA 2ORIA 2JIZA 1CJMA 2QPOA 4KYIB 1G6HA 3U7FB 2QP9X 1R4AA 3RRZA 3AVOA 4PHGA 1FPMA 3QKTA 4F91B 1CBUA 3K0CC 2GNOA 4PC7A 4AIIA 4LJ7A 1EXMA 1LV7A 3SC3A 4D80A 2VL7A 1SHZA 2IYTA 3C15C 1RRPA 4GMDA 2WWIA 2ZROA 3B1ZA 2QZ4A 5EP4A 1E2PA 4BRWA 4LJ6A 1W36B 1Z8FA 2VF7A 5AUPB 1DOAA 1R10A 4UJ5A 1OKKA 1SULA 2VYFA 2QEQA 1QBKC 2HJVA 2GRJA 1PLLA 4QM7A 1E32A 1EX7A 1N6HA 3RSLA 2IT1A 2RGBA 4UNPA 1Z6XA 1CXZA 1GRNA 3X1WA 4BLTA 4MRNA 4GI7A 2OE2A 3EC1A 1E0KA 4P4UA 5DHFA 1Q22A 4JMPA 4OK3A 4V0OA 1LS6A 4OJKA 1F2UB 4AWXA 3THYB 1AZTA 4RKEA 2P6RA 1E2QA 1XTQA 2BBTA 4Q1AA 1CTQA 3RRNA 2VO1A 4IVQA 3AP1A 3BE4A 1K5GA 1DAEA 4JSYA 2XNDD 3AF2A 2ORWA 1KK0A 3QVUA 4B43A 4CEHA 1XPOA 2WJHA 4TMVA 3GEEA 4TLAA 2OFOA 4JL5A 4QGAA 3V4FA 4CEIB 3OEHD 4ERNA 1JR3A 4IDNA 4NZYA 4AG5A 5FUWA 1U8ZA 3PEUA 4BQSA 4DLVA 4E03A 5JWRA 3T06B 2IWRA 4HZUA 3PIRA 1ZAKA 2J7PA 4MYTA 2F43A 4IDHA 3MJHA 4P0TA 5GJWC 4E22A 5JI2E 4DLSA 4G5RA 4M8NE 1P2VA 1U90A 1FW6A 1NP6A 3KQHA 2RGNC 4Q5IA 3ADDA 1II0A 2DY1A 2OEPA 2ZJ2A 4MGIR 2VHQA 3OIVA 3AKDA 4CEJA 4C0HA 5AJZA 5JWOA 3A6PC 1P75A 2CL0X 2WKQA 4DLTA 1G4AE 2DFNA 3UK6A 2C98A 3UWOA 3TNFA 3PITA 1NVUQ 2JEOA 4JL8A 4NH0A 3IGFA 1NBMA 5FL3A 4QC2A 4KLZA 1OIXA 3CRW1 3KKOA 2ZM5A 5E7IA 3S1AB 3K0EA 1CR2A 2CHGA 1EESA 4JIMA 1YR6A 1EGAA 1GG2A 1KI3A 2R6CA 2OZEA 1IN4A 1F3OA 4TL7A 2GEUA 3GLGA 5B57C 4KFRA 1X1RA 4C0KA 4S2EA 2QE7D 3U3KA 3X1YA 4JLBA 2GEDA 4D0GA 2ZUCA 1KMHA 4HB4A 2BMFA 3TH5A 4WIAA 3CONA 5EP2A 4ABYA 1DBSA 1HE1C 3Q9LA 3UG6A 2CLSA 5F9HA 5IDVA 4OQNA 1FNNA 4Q4LA 5AUQA 4BASA 2AWNA 1I4DD 4D81A 2J7PD 2C03A 4OI2A 4RFSA 4D4KA 1UBCA 1GITA 1ZNXA 5EE3A 2G3YA 3MWYW 2OBLA 4DLRA 2NO7A 4URYR 4PSAA 2JLRA 1NIPA 4OJQA 2AD1A 2JJ8A 5BQ5A 2WVJA 3TW8B 5LD2B 4R9UC 2Z83A 3A58B 2CCJA 1GZSA 5EP1A 3TQFA 3BFKA 3DM9B 1OJLA 2G0NA 5DIFA 2QL6A 4RZ3A 4LHWA 1G21E 1XEWX 4RD2A 5JEEA 3K0CA 1E4YA 3OF5A 3G0HA 4Q03A 1EWRA 3TMKA 2ERYA 4Z8YA 4Y0AA 5GJCA 1KGDA 3RS2A 3HU1A 5LDDC 4O3MA 4ZKDA 3MCAA 1W4CA 1Z08A 3KUCA 1X8JA 4BLPA 1SQ5A 1IONA 1L2TA 2AHOA 1KO4A 1VYUA 3OHMA 8OHMA 1Q1QA 2WWXA 4EKDA 2F1HA 4A15A 2GZHA 2V8OA 1ANKA 1TUIA 3LQRA 2OUKA 5FBRB 4MA4A 4OHWA 3NKVA 5LD2C 2H5EA 2OCPA 2VQSA 1OH7A 4PXAA 4NYJQ 1NKSA 2ZYTX 2R9VA 4IHQA 4HLUC 3BH6A 3FYHA 1LVGA 2GCOA 2ORVA 3TVDA 4CVNA 4DSTA 1QVRA 4UXIA 1UEJA 2UZ3A 4U7DA 1TADA 1Z2CA 2C95A 4PPQA 2ZJ8A 4DLYA 1WCV1 3LAWA 2XB4A 1XDBA 4Q4JA 1HH4A 4LV8B 4B74A 1P61B 1FQJA 1W4BA 3OAAA 2FA9A 2R62A 3U44B 2FMXA 1VCOA 1XZPA 2R2AA 2WKRA 3L2OB 5FL7D 2IYQA 2MSDB 2ZI5A 4EJSA 3IPYA 4NYMR 1LY1A 3CF2A 2NO1A 5DLQC 4M9ZA 1JQJC 1ZINA 2RGNA 1P73A 4LYHA 3Q5DA 3O8RA 1NKTA 4HB3A 4Q19A 3PEYA 1K5DA 1XEFA 4QNMA 2A9KA 4KODA 1KI6B 2O52A 4AURA 5KNCA 1OXUA 1FQKA 5DHAA 5J4LA 1W5SA 3PR1A 4JBWA 5JHHB 2QTVB 3KJIA 2GXSA 1JR6A 1VECA 4LRWA 5IHPA 4OQLA 3W34A 1XJQA 1N6RA 4AYWA 3TGPA 4PSVA 3TUJC 1OFHA 4P3YA 5FOTA 2Z0MA 4DT1A 4RD6A 3U3MA 1GWNA 3IPXA 4NMMA 1XF9A 4DB4A 4L15A 1A2KC 1SVOA 4XWAA 2OO7A 3A1WA 3FKSA 2IS1A 1FMJA 4M1TA 4BWYA 2REOA 1R5NA 1IY0A 1KHTA 2F7SA 2GBLC 5FOUA 3KQNA 3QF7A 3K70B 1ZYUA 4NL4H 3RYTC 3EIHA 2RGGA 1UKEA 4HAYA 4JKIA 5KSOA 5C1BA 2OSBA 5LPNA 3E5HA 2GCNA 3EZ2A 4XSHA 2QMOA 4L4UA 2IYVA 2W6JA 5FPYA 4QM6A 1M8PA 4B2PA 1HEIA 6Q21A 2ZRCA 2ZVPX 1S8FA 4F7WA 1COWA 1Z0DA 1SHKA 4JLMA 1DELA 5L8VA 1MRSA 4C2UA 2ZR9A 5E7JA 2W00A 3UMFA 3TLXA 1VG8A 4LUCA 4MITA 4MKHA 4YDSA 5A4JA 4URUR 2QMHA 5TDHA 5J4KA 2ZRBA 1FUUA 4MRVA 1T6NA 3REGA 1ZM7A 1L8QA 1GOTA 3TBKA 3V9PA 4B33A 5DH9A 4HLDA 4JLNA 3T35A 1KAOA 2IX3A 1T3HA 2CK3A 3VNUA 4F4IA 1KKMA 2QORA 2J0UB 5L3SB 4LBVA 1XMIA 1E2MA 1E9RA 1JEDA 4ZCIA 4YXWD 1Q12A 4ZDKA 1A2BA 1S1MA 1VG1A 2R6AA 5JCZA 1KI9A 1J7KA 2F9MA 1F6BA 3B1VA 4HLCA 5FPHA 2GVZC 4MGZR 1SXJB 3C5CA 1ZP6A 4IOMA 3WY9A 4P4SA 721PA 3T15A 3WYAA 3NDPA 1U0JA 2AXPA 1PJRA 2GCPA 1R6BX 5FOSA 3QPVA 4PC6A 2IS6A 4Q9IA 3VHLB 1WMSA 1KZ7B 2HUPA 3CX7A 2EYUA 2YYZA 3OE7D 1DO2A 2WKPA 5FPTA 4CGZA 4QFMA 1MV5A 5KDOA 4DB2A 2IYRA 4XD7A 5H1YA 1X1SA 3P32A 4PX9A 1EFTA 2DWQA 2EWWA 2J9RA 2W6JD 1E94E 2GJAA 2J1LA 1CR4A 1CJTC 1ZIPA 2BMEA 2CLDX 2IYSA 4I99A 4DIDA 1UEIA 4QXAA 2ZANA 1Z07A 3U61B 3K0AB 2QMUA 3DDCA 3RANA 4RZXA 3ZS8A 4C0JA 5BXQC 1YKSA 2F1JA 3SBDA 2BVNA 3U4QA 4LHYA 4PAOA 3MAAC 4Q7JB 3FVQA 2ZREA 3GPLA 3WRXC 1JJ7A 2C5LA 2C9OA 2V7QD 3AVTA 4P32A 1TQ4A 1U8YA 2DFTA 3I5YA 2B7BA 4HAZA 1TTTA 4TYWA 3L0IB 4PO8A 4NYIQ 1W2GA 4BFZA 1IN6A 1ZD1A 4O2LA 1DAKA 2EFDB 3K9GA 3VU9A 1E9BA 1N6PA 2W2XA 4RY2A 3CUEF 4BGDA 4DLWA 3P1JA 4V0LA 4WZAE 1HV8A 3KJEA 2FWRA 4PC1A 2G6BA 3QKSA 4GL2A 3EWAA 1GDDA 3TVTA 1KAGA 4LV5B 4YMTA 1JR3E 3QOFA 3FHCB 3THWB 1S9DA 1MRNA 3FFBA 4Q9KA 4CT5A 4ZIRA 2A5FA 3ZIAA 2GZDA 2VHJA 1S4QA 3MWLA 4B2LA 1LS1A 2QI9C 3A1UA 1XD8A 4TMXA 2EW1A 1W4RA 2BM0A 2ZRLA 1XTKA 2B21A 1UF9A 4JBXA 4MUBA 4JZKA 1G1MA 4GOJA 1IN7A 2H57A 3O47A 4DEYA 1VIYA 4CRWB 1UPTA 3ZZ0A 3U5ZB 2GBLA 5BN3A 2G88A 3SJCA 5KHOC 5EJEA 1E2EA 4XIGS 1RRFA 4A1FA 1IHUA 1YZUA 2FZLA 5CLQA 1SKQA 1VHTA 3T34A 3U6BA 4HI0E 3CZPA 3VTKA 5JSZB 1D2EA 5FI1B 2F6RA 5KYKA 1JEEA 1NBME 2W58A 2BJVA 2Q3MA 1NF3A 3KFVA 2IWHA 3GFPA 4F38A 4M0LA 1GKYA 2PCLA 1Q57A 1NI3A 3TUIC 1U0LA 3RHFA 4BE7B 1NG9A 4HAUA 4A0GA 3FDIA 4TQUS 3AP2A 3NDBB 2FF7A 3ADKA 1WB9A 3GLGE 4LYJA 4PQRA 4Z1MA 2PEYA 4Q4HA 5FUYA 1G5RA 4C3ZA 5B2ZA 4D0LB 4QGGA 1KSJA 2BBOA 2Y8EA 4TLBA 2D7DA 3QXSA 1O87A 1U9IC 3Q72A 3ZDQA 1Q1BA 2VP9A 2J3EA 2QUZA 4M53A 4MGYR 4AYTA 4MYCA 4A6PA 2VP0A 3UATA 3FMIA 5F9FA 2RHDA 2EFGA 4JT4A 2P67A 1IJFA 4HB2A 4IRUB 1MO6A 1TU4A 4MYHA 4NP6A 3Q5EA 1IBRA 2IYZA 1G4UR 3IKJA 2PMKA 1CEEA 5HCIA 3BFXA 4OQXA 3IIMA 1R0WA 1RRGA 1S96A 3P20A 1AA9A 2EYQA 1SGWA 1GVNB 2CXXA 1KDTA 3SYNA 4CT4B 4D2IA 1U8AA 4EPVA 2NG1A 5TY0A 2WM9B 2GKSA 4G5SA 3D6TB 3IQXA 5CK5A 3MWKA 1Z22A 3AUYA 3RDPA 2XXAA 1Z6YA 2WWYA 1OB5A 3PUWA 2WWGA 4IEIA 3QKUA 3RS5A 1NNEA 1G8FA 1KJWA 3KB1A 4LZZA 5LB2A 5FPKA 4UNNA 1H65A 4PHHA 1PUJA 1TQ2A 5K8UA 1Q21A 3B7GA 4KSBA 3TR0A 1Z29A 1UBGA 3SFZA 3U7GA 2V1UA 1E6CA 3HPQA 1PV4A 4L9WA 3AV0B 3A37A 1E69A 4N3NA 2ZRAA 3EZFA 1DEKA 5P21A 4HAXA 3BD9A 4ON9A 4KFUA 4AY2A 3T1VA 3GJ0A 3IILA 2H1LA 4LHZA 1G64A 1CJKC 4US2R 3ND8A 4Q01A 4ARZB 1KI7A 2Z4SA 1S0UA 5E7MA 3WBKA 2P3SA 4IDOA 1E9AA 1CR1A 2JLUA 3R9WA 2AN9A 4CIDA 1E1QA 4IDQA 4LI0A 2W0SA 1N0VC 3EZ7A 1GNPA 1Q1ZA 1FP7A 1SKYB 3F0TA 1MT0A 1D2MA 4GOKA 4FWTA 1RPZA 4V02A 1FTNA 1JQLB 1G7RA 3SN6A 4IXMA 3QKRA 3PUXA 1A1VA 3F3YA 4DEXA 1MH1A 3FMOB 5C4GB 4R71A 2YWEA 3CRRA 4GMXA 1G3MA 2BKEA 3L0OA 4Q21A 2O0HA 1YVDA 3T1OA 2RCNA 2KWIA 1I4TD 3BAFA 1XEXB 4A2QA 3ZVMA 2AK2A 1LTQA 2Z43A 5EUQB 3HR7A 1ZNWA 1GL6A 4QHSA 2GILA 2Q21A 4KITB 3CF6R 1HT1E 1ZU5A 4S35A 4LGMA 4HUTA 2ZJZA 3HU2A 1UBFA 1YU9A 4GDFA 5HR5A 1WP9A 1P5ZB 5TB5A 3LV8A 2QSYA 3L82B 4BZQA 1WA5A 1ZC4A 4B47A 3GLHA 3EWSA 2GJ9A 3QSYA 2BBWA 1KOFA 1VCNA 3CRQA 4QBFA 4A0RA 2DYKA 2KB0A 3E1SA 5HKKA 1E0JA 2WZQA 1CF4A 2OCYC 5L3RA 4OHVA 2PX3A 5KUTA 1CR0A 1SVMA 1YZNA 2AKYA 4H1VA 421PA 1KJYA 1CRPA 2G83A 2DWPA 1U9IA 1ZUIA 2B8TA 1GAJA 2ZE7A 1I2DA 1T3LA 2QMEA 2ZETA 3ZJYA 1PLKA 4RD0A 2JDIA 3M4YA 4MUAA 2ONJA 3BK7A 2W83A 4K81B 2QRZA 2A5JA 1VMAA 4U5XA 2VPPA 1E2LA 2G1JA 5J4YA 1WBBA 3AVXA 1G3RA 1X6VA 5KNBA 3CH5A 3QVVA 4PSKA 2H17A 1E2KA 1F60A 2FG5A 4HATA 1EX6A 1QRAA 1ZU4A 2WPDA 5DN6A 4DSNA 3DOEA 1E2GA 3EZ9A 4KO8A 5JEDA 3A36A 1N5JA 3W9YA 3EW9A 1KDOA 3NEJA 4JVMA 3N70A 3VKGA 1ZBDA 1ZNZA 4K8OA 5KPJA 1E0AA 3OEED 1RC8A 3TSZA 2ZRPA 3VFDA 5IK2D 1ZM4A 2EFCB 4KCGA 2D7CA 3HU3A 2N46A 3FMFA 1SVSA 3GJ6A 2GVDC 1US8B 3W6OA 1VTKA 1Q44A 1Z0JA 4PPGA 4D26A 2WSSA 1N5IA 4L16A 1AN0A 1NN5A 2B6HA 4LJ9A 4BFUA 3MD0A 4G0NA 2CNWD 3NHAA 3AF3A 4MYUA 5CM8B 2QAGB 4AYXA 3ZD6A 3AKEA 1MR3F 2ODWA 1N0WA 2FE4A 4QGFA 4WZBE 5JBQA 1S3GA 4A6XA 1OHHD 1VDZA 4TSFD 1G3IA 2IYWA 4LJ4A 2QY9A 3Q85A 1OXTA 3DEFA 3K0FA 4DHEA 1Z28A 2GCOB 3GLFB 1Q1EA 4JLVA 5LBIA 4YONB 4IEEA 3PG5A 4DDTA 1FX0B 4Q9JA 4LYFA 1ZCAA 3X1DA 3VR2A 2KSQA 2WMNB 1J70A 1ELOA 3CO5A 1M74A 1DAIA 1XCMA 2W0MA 3E2IA 3K8YA 1XPUA 2AFHE 4L5BA 5FBQB 5UKDA 3WXMA 1HE8B 2E1RA 5A5GA 1KZGB 3K9NA 3MLEA 2MSEB 5J47A 2Q9CA 3A1SA 2RGXA 1R2QA 2JATA 2RMKA 1W36C 3SHWA 3DKPA 1EK0A 2YHSA 2PT7A 4US1R 3L43A 3KTAA 5DI9A 5DI3B 2FDCA 3THOA 1U98A 4JLOA 4DCSA 3M0EA 1TEXA 2JIZD 1W1WA 5B30A 2HXSA 2O0KA 4IOKA 4K46A 4Q47A 4DCTA 3NG1A 3CIOA 3UANA 1R7RA 3GQBA 2R8RA 2J0SA 5L3VA 2JGNA 2VP4A 4TQ9A 1GNRA 4JKYA 4NU0A 1XXHA 5CLLA 3QXHA 4J0QA 5F98A 2GA8A 2QP4A 3B5JA 3KKMA 4TTPA 1XD2A 2ZI6A 3AVYA 4M1SA 4XVRA 1GIAA 4M1YA 2KI5A 1DG1G 4B3BA 3HYRA 2K5UA 1E79A 2YC4C 4R7ZA 4DT1B 1KDRA 1OKKD 3QBVA 3I8SA 3W6PA 1TAGA 3LY5A 2BBSA 2GAAA 3EA0A 5J5CA 2EQBA 1RJ9A 3KXIA 2O8FB 2IA5A 3LXRA 3SYKA 2WOOA 4BEBA 4TYYA 3GLIB 1QHNA 3RWMB 4BLOA 1E2IA 2Q9AA 2BWJA 4LV6A 2HEIA 5KU1A 3IHLA 5EP3A 4YLGA 3CH4B 1T3SA 1CLUA 1AKEA 4EPXA 3Q7PA 2BCGY 3LXXA 3IEVA 1SVKA 1FZQA 3U7HB 2IS4A 2O8DB 1NJFA 2DFLA 1EFHA 4B3GA 3D31A 3SU8A 4NKRA 3M1IA 4LBYA 4YMSA 1H8EA 2X77A 3CPHA 2ANCA 2BV3A 4QKQA 4MH0R 1OV4A 3DMNA 4QJ3A 4Q4AA 1JR3D 1OXSC 1Z6GA 2I4IA 1GUAA 2IL1A 2OT3B 2PZEA 3ASZA 3MFYA 1T0JB 1N3BA 3KL4A 3U3OA 3VR1A 3HJNA 3G82C 1FL9A 1AQUA 3QQ5A 1JAIA 4PTLA 2QBYB 3WMGA 4C0LA 1A7JA 3VR5A 2YWGA 4QRHA 2W6IA 2J41A 3SFVA 4UNQA 5JFGA 4EFLA 1OSNA 2NQ2C 1QHHA 1NMYA 1E99A 5EXTA 3PFIA 2GXQA 2A3RA 1P3JA 2CHVA 3RS7A 3U7EB 1Q3HA 3QBTA 3WP0A 4Z54A 1IM2A 4C2TA 1NVVQ 2QPTA 4DLZA 2JLQA 4DSOA 1B23P 2HXYA 1KSGA 2ZSAA 2XZPA 3FE2A 3SYLA 1UDWA 4FD2A 1BYUA 3JZMA 3SQWA 4Q1EA 1TMKA 4DDVA 3RRMA 1XFAA 3WYGA 1XP8A 4ZCMA 3I32A 4LBWA 1XNJA 3WMEA 4NYJR 3U6KA 2ZR0A 3QIAA 1NBMD 2ZE8A 1A82A 4A8JB 2H7VA 2ATVA 3AVQA 3T61A 4HUQB 1KI2A 4B3XA 4C4PA 1GTVA 1NY6A 2IYUA 1E9FA 3EASA 4FXPA 1OYYA 5F3WB 3WP1B 2VTKA 1IOZA 4D4MA 1MABA 2QT1A 4FCVA 4FN5A 2FSIA 3ND9A 3BS4A 2GF0A 3AVUA 5E4FA 2A5GA 4NPHA 5HCNA 2C9YA 1EFUA 2XZLA 1DAHA 4IDPA 1IN5A 2CE7A 4TYQA 3GFOA 4JT2A 2D62A 1E2FA 3HP1A 3VR4A 3H0KA 2X2EA 1XTJA 2CE2X 3Q8XB 4ILEA 2B7CA 4M2LA 4Q9LA 3AUXA 4XVQA 4ZKEA 2A7QA 4FW9A 4Q1DA 1XMVA 3FHTA 4F4JA 4C0QC 1P4SA 2V1XA 4W9MC 3ZYCA 2CEAA 2JA1A 4BECA 3W8RA 3UG7A 3QE0A 1KMQA 3TAUA 1WDTA 3RSOA 2WTUA 2N42A 4YDHB 2ZRGA 3IUYA 1AK2A 1T4GA 1UKYA 4UQOA 4EPWA 1UFQA 4PO9A 2HLDA 3AH8A 2BDTA 2GJSA 5D3MB 1SVLA 2XNSA 1N0UA 3B6EA 4YMWA 2ZJYA 2J46A 4Q1CA 5E3HA 2SHKA 4LJ5A 3R7WB 1HTWA 3JVVA 2NPFA 3I62A 2DFKB 3QKSB 2ODBA 1S9HA 1H8HA 1JPNA 4LX0A 2P6UA 2X1VA 3TUZC 2BEJA 4ACBA 1PLJA 3CR7A 3THYA 2OBMA 3NBYC 4KFTA 2ZJBA 1Z0AA 2LCFA 4RFVA 3T1TA 5KTYA 4G5OA 3CX6A 1UBEA 1RFLA 2HYDA 3OFNA 4CF7A 5JECA 4KBGA 1RKBA 2WAXA 5TVKA 2NO9A 3LBHA 4DXAA 1GILA 1T8TA 3A1TA 5DGXA 3EIQA 2PX0A 4TT3A 2CJWB 1G6OA 2D3WA 5TXGA 3ZZUA 4TL9A 2FNAA 2ZJAA 2C99A 4CEIA 2X19A 1G19A 2MMCA 2P0EA 2YOGA 2AXNA 1SVIA 2O5VA 1MO3A 1QVAA 1M2OB 2QRNA 4G01B 4WXPA 5FTLA 3WMFA 4OQFA 1JALA 3L0SA 2ECKA 2FX3A 4GZLA 3KQLA 3PJRA 2EFHB 2ZI7A 1E9SA 4ZDWA 4WXRA 5EQTA 1VCMA 1W46A 3GLHE 3SBEA 4HEJA 3RWOA 5EZ5A 3CKLA 2O8BA 3J81k 2FFHA 3BH0A 3EPLA 1ZD9A 2Z4RA 3LBIA 4JSTA 3E70C 3FTQA 1YZKA 2FV8A 1G5TA 4AKHA 1DARA 3FPAA 3OAAD 4ACAA 5AUOB 1N6NA 5JWHA 4TQAA 1OW3B 3TK1A 1OFUX 2P5SA 4NCKA 4KLNA 1G16A 1AS2A 1S2MA 3M6AA 5AJXA 3LWNA 4JVSB 3S1AA 4TZ0A 1CJUC 1Q0UA 2XTZA 4ASUA 1J8YF 3DL0A 2IS2A 1TUEA 3ADCA 4EPTA 3KQKA 1M34E 5DNYB 4O25A 4C7OB 4BFVA 4NE2A 1ZM2A 1OT3A 5HZKA 1GL7A 2IEYA 4F92B 3K70C 3BWDD 1Z0KA 4DVGA 4R98A 3PEVA 2C96A 5EXXA 4ESHA 1II8B 3MG9A 5A0FA 3L8YA 1GKIA 1QHIA 4GBMA 3LRPA 1FFHA 1TF7A 3U3RA 3THXB 2BEKA 5KSPA 1D8TA 1E2HA 2UKDA 5CM9C 4P33A 1N6IA 3FKSD 2X2FA 2B8WA 1SZPA 1ZC3A 2JJ2A 1FUKA 2JASA 1HURA 1KO1A 1X8KA 2H8KA 3QG1A 3KJGA 4TLEA 5KOYA 2IHBA 3UMSA 2RGCA 1V43A 4GP6A 1NJGA 5AWFC 2AWOA 4OBEA 3O8CA 2JLVA 2WSMA 5EXPA 4A2WA 1G41A 2HCBA 1N25A 4M9SA 1LB1B 4UNRA 2RGEA 3PCRB 5AJVB 3LH5A 1TQDA 4I4LA 4EQ6B 3C41J 4GOXA 4JVNA 1COWD 3ICEA 1OPXA 4FCWA 4HLUA 5BYJA 3ZVNA 2YJTD 4B35A 2EFEB 2ZI3A 3QPWA 4RCZA 4BPBA 4A4DA 2HYIC 2ZRMA 2RH5A 3SJZA 4ZV4A 4LOAA 2OBNA 3AQ4A 3IBYA 1SXJC 2IW3A 1S1CA 1NN3A 3PUVA 2KJQA 4LHVA 4YQFA 3NTUA 2CK3D 4V0KA 4P4TA 1OF1A 2UZIR 1ZMXA 2ZTSA 1DADA 1CS4C 4QNRA 1UAAA 1CJVC 4QHYA 2IXFA 2XX3A 3DO6A 4Q02A 3SHFA 4OI0A 4OKSA 3SJBA 1GL9B 3NBZC 2OAP1 1W0JA 4TTQA 1UJ2A 3QUSA 1M7GA 3N5CA 4LJAA 3WNBA 2V9PA 1W44A 1P9RA 4KHZA 3QF4B 1G17A 3QKRB 3W90A 2AX4A 4DLXA 3VKHA 2ZS7A 3ASYA 2NPIA 5G3YA 2CL6X 4RSGA 5B58C 1YE8A 2IUUA 2XZOA 4M1OA 4B6EA 3CM0A 1DTSA 3BGWA 1C1YA 4B32A 1W5TA 3PUYA 3I72A 4MKIA 4V03A 4XD7D 4B3DA 4YMVA 1KI8A 3SDZA 1OXVA 4O2RA 4DRZA 3U44A 3LVQE 1KI4A 1XXHE 2JJ1A 4QHTA 5C46F 2XSZA 3RNLA 5L3QB 1T91A 1IXZA 1UKVY 1VKJA 3RVBA 1DG3A 3KUDA 4QBIA 4KI0A 3GD7A 4KJZA 2WJVA 4TLCA 4JBYA 1M7HA 4HDQB 1OH5A 4PPFA 2BC9A 4PAQA 1HQCA 1KI6A 1UADA 4JLDA 4JS0A 3CPEA 5JJLA 1TF2A 3AGQA 2BIFA 3LLMA 4ITRC 5EXSA 2GDJA 3TRFA 4LC1A 4DDUA 1HUQA 2OAQ1 1FTSA 2O8EB 2X8AA 1ZJ6A 4HZIA 4BEJA 2IC5A 3QPUA 1HYQA 4BFSA 1W2HA 1XJ0A 1GP2A 1ZNYA 2D74A 4MRPA 2VHCA 2IXGA 3CWQA 2XTNA 3BC1A 4W7SA 2XOKA 1N6OA 4PFSA 2HF9A 2FOLA 1KO5A 1Z6TA 3CRMA 1KDPA 4V0MA 5FTKA 4UKDA 1IY2A 3UMRA 3W8NA 1RZ3A 2QT0A 3I4LA 5EE5B 3LQQA 1G3UA 4NCIA 1C4OA 4XVUA 3SI7A 3EZ6A 5HTKA 2GK7A 2GWHA 3ZIAD 1UKZA 5H70A 4ZDJA 5KNDA 2OXRA 821PA 4LJYA 3CNLA 2LKCA 1ZVQA 3EPHA 3C7KA 1AGRA 4FIDA 4HLQB 2VLIA 1N2CE 4Q18A 3DM5A 3K0SA 3NHBA 1XZQA 1JAHA 5FOVA 3A4LA 1Y3AA 4DUGA 3MSXA 4NTZA 1KO7A 4FMDF 1D2NA 3SR0A 4TTRA 3WBJA 1UM8A 4U00A 1E4VA
chains in the Genus database with same CATH superfamily
1KNXA 1RAHA 1LVUA 1X9IA 2RCYA 1JHAA 2FZ4A 3VPGA 4BMNA 2QVXX 1CULC 1PR5A 1YS7A 1Y1KE 3ETDA 4KQEA 1MA0A 4N1AA 4Q4DA 4YMIA 3E15A 3DHEA 3HFRA 5FF9A 1KDVA 1KYTA 3CN9A 3H5RA 5FI5A 2X0EA 3P2YA 3UXMA 3I37X 3ZV7A 4CM3A 3W5AA 4CNBA 5F76A 5CYOA 4YRMA 2R68A 3WJ1A 1GFWA 1PJSA 1CP2A 3IVAA 1F5SA 4QIHA 2FEXA 4NJMB 1FSGA 3CUKA 1T1JA 1OAKA 2WHRA 3QV1A 4BXOA 2ZJ4A 2CXTA 4FYIA 4IQ8A 4UAVA 3QXCA 2P9JA 2W2KA 5DE3A 1TF5A 3CLSC 3M83A 1CZUA 2EGUA 3B3JA 4I1UA 4LSGA 3VNSA 4JR2A 1RKXA 1MO4A 1U0BB 2JFYA 2ZRKA 3TE6A 1CUIA 1P45A 1RW4A 3PEWA 5D86A 2PUVA 2CT8A 1KIMA 13PKA 3SLGA 2CL5A 3KZ1E 1XTVA 2P2GA 3WAJA 4TRMA 4HYYA 4YAWA 2EIHA 5G1NA 1H2AS 1J22A 1KJQA 3AL2A 2O2XA 4JLUA 3WKEA 3KKPA 1XPRA 3EEIA 4EY8A 3QY0A 3T9EA 2ZR7A 4WZAB 3V2GA 3WYCA 4A9AA 2EWMA 2BGRA 1YB4A 1JL3A 4NENB 4ZCPA 2J59A 1OASA 3ZCTA 3GMIA 2ACWA 5CD9A 2OZPA 3JZIA 4DCUA 4YIHA 1U81A 3UCFA 1M2FA 4NVRA 4RJIA 2R8ZA 2G0TA 2WK1A 3L8HA 1QTQA 2CLKB 1LW7A 1J7JA 3RCBA 3JZDA 2XGJA 3FGNA 3JVEA 3UC5A 4M89A 4V0NA 1Y42X 5BT9A 3QEJA 2PWAA 3QE4A 2RHMA 1FP1D 1P2FA 3PXGA 4LC0A 3WNDA 1R0XA 5B4UA 5I3CA 1BWSA 1LWOA 3QLJA 4DSUA 1DU4A 3RVOA 1X1DA 2LR0A 4ENRA 1L4NA 4MA5A 2OENG 2WFAA 2Z8XA 5CNMA 1I7LA 3LCUA 4R6WA 2C7BA 2WTBA 4F0JA 1C3JA 5FV7A 3SZRA 4B85A 2BKAA 4IJMA 1RHMA 3MUOA 4JSRA 1XNGA 2EKZA 1E18A 2BR3A 2SECE 2A86A 2WUGA 2MMGA 2XGOA 2PU5A 3FI9A 3R3ZA 3V4ZA 1L5VA 1FLVA 2C5GA 3STHA 4E07A 4PYMA 1ZMTA 2FMUA 4UBOA 1ZRSA 3HV2A 1BMFA 3HNRA 4ZI5A 3UGQA 4ZGWA 3OQNA 4LYGA 4DR2B 3RIMA 2B8EA 1FU7A 1ORVA 2XA1A 3FGPA 3N2YA 4AY4A 2AHRA 4UOZA 3AHDA 4MLPA 5FUVA 1KH3A 5AVZA 5J4VA 3UKJA 4ZHQB 2VJLA 1K1EA 5CFNA 2IF0A 3GW8A 1XWWA 1ECBA 3RGWS 1F6WA 1O97D 5KS2A 2PJRA 1W0CA 2WSIA 3CS3A 4MHTA 3FSGA 1WU8A 3GLGB 1WXQA 2QE6A 4INOA 4BL5A 2P1ZA 3I6IA 4OK5A 1UH5A 1KYVA 2J3MA 3OJOA 4IHKA 2OAGA 3MAGA 4W6QA 4BX0A 1OB2A 4YRTA 1EIZA 4YRZA 3IR6A 4X60A 3MTIA 1J8MF 3CC8A 5J5VA 4O3FA 1L5YA 4Q4CA 1MXFA 3RTGA 3KHSA 3WKBA 5FPSA 5HPYB 1KMHB 4Y2JA 4GP7A 3NTRA 4N7MA 3VH4A 1Z17A 2WAAA 3ZLUA 2NUPB 4BRUA 2O2ZA 2O2DA 2WHYA 4O2BB 3OY7A 1E98A 2UXCB 1LNQA 2ZYIA 4A2PA 8MHTA 4LZLA 4H3VA 1JEAA 2Z9DA 4FBMA 5JCJA 4ER0A 3S81A 5AM1A 1YMVA 2AW5A 4MQ4A 4AKTA 3VJRA 4Y67A 1OBHA 4YACA 1ZLXA 4R83A 4RFSB 5CCBA 3BL8A 2JA2A 4NMHA 1E2JA 1E3SA 1J90A 1RI1A 5CG2A 4O4JA 2BHLA 3PNBA 4P3XA 1IHYA 3KXKA 4RK1A 1YU6A 4RPCA 5HGXA 2GSDA 2VAPA 4PW0A 4QBGB 1Q91A 3IDOA 2ZJ7A 2J9GA 2P5UA 1W9HA 3PI7A 1YXMA 3ZEIA 4NX2A 3H4IA 5CIQA 5F2EA 1ZRMA 2VBCA 4BVJA 4J91A 4LWQA 1AKYA 4OLJA 2X0DA 3VH1A 3D8TA 2J9YB 3K09C 3SQMA 3H83A 4P35A 2NUAB 3CW2A 2PXXA 4Y2QA 2TMYA 2BH2A 4TQGA 1MB9A 1X3SA 4GSYA 3ILSA 1YA6A 2VDUE 1SG9A 3N1UA 3OOJA 3OJEA 4JJEA 1PJBA 3NOQA 3ZDXB 1BDIA 4ALKA 1ZXBA 2OLKA 1A72A 2XJ9A 2YINC 1LDBA 3FPEA 4QJ5A 4RVFA 4V0RA 1EFRA 2IKSA 3OE4A 1YUBA 3SM3A 4BBZA 1ULUA 2CHUA 3N87A 1D0IA 4PR0A 2V98A 1U0RA 1V16B 1Z2EA 2Q8QA 3QX7A 4BRZA 3KWLA 3QFRA 4C0SA 4ENTA 3ZDEA 4ZFNA 5KDDA 1E3DA 2QU8A 2O3TA 5EVCA 2XUDA 3OPVA 1E1NA 1E1KA 4HNRA 4ONEA 5CR9A 2FN4A 5FBKA 1CSEE 2F1RA 1GAWA 2ZYRA 2F1OA 2H16A 3SMVA 3AF4A 4FZ5A 3I73A 1W48A 3I2GA 1MZVA 3C4JA 3RT1A 3LP5A 2G8NA 3IEUA 2QZJA 4G0MA 3ZN2A 1XUOA 4CT0A 3OIFA 4WZ6A 3GAFA 4UD6A 4FGJA 1DFHA 1JH9A 1QQ6A 2VUSA 3BIWA 2Z5VA 2AR9A 4BKOA 5CVUA 3OPNA 4AF8A 4EJ2A 3A4NA 4PGGA 3JAMA 3CVWA 2AG6A 3WLTA 1JEYB 1OLOA 4GICA 3EFEA 5KNBD 2XMGA 5TEWA 5JLJA 1PDOA 5F5XA 4X20B 1QS0A 3VAYA 5CFMA 4M3NA 1GCGA 2YQ4A 1CY8A 3EYAA 5HRAA 5AJWA 4N0EA 5I3ZA 4OYHA 1K6IA 2VWPA 2POQX 2C57A 1JUDA 4DC9A 2VDKB 5K45A 3EE6A 1I4WA 2BF7A 4PSDA 3IQIX 4YO8A 2NVUB 4OHYA 1IJBA 1Y7PA 4RTSA 4MPJA 4EJSB 2ZYWX 1JI3A 2C0PA 3L4BA 4H1HA 1Z62A 1C7RA 3PXBA 4JJ8A 3IB3A 5HKLA 1VIVA 1HDOA 4HS4A 3U56A 3KTOA 1IAQA 4PNEA 2YNMA 5LUBA 1YAHA 2JCSA 4JVOA 3I0MA 3RAGA 4B7CA 1Q6YA 3C8UA 4G0PA 1HKHA 2ZVQX 3O38A 2GTPA 1QKKA 3T12A 4LZNA 1E6LA 4NATA 2PGAA 3AM5A 4ZJUA 2QN1A 3PC8C 5FFFA 5H7XA 1E8MA 4MS1B 1RWNA 4QL3A 2WG1A 1AXEA 5CCEA 4B3MB 2NSDA 1L4GA 2JBHA 4IV5A 1XLTA 2Q4TA 2G25A 5FRDA 5A06A 2ZW9A 4WCVA 2WWWA 3K9HA 1Y98A 5K3FB 121PA 1J2YA 1NWHA 1XJCA 1YGYA 3LYUA 3Q40A 1CW2B 1YT5A 3BL5A 4TL6A 1X3LA 1AU9A 3KT0A 2XEXA 2NU7B 5F78A 3IUPA 5DHUA 4HAWA 2P65A 4DCCA 3DTVA 3AFGA 3LZDA 2H0AA 3PR2B 4A3SA 5FUBA 2N0SA 1J0BA 3CV3A 3RRYA 3JQ9C 5KQPA 1IXKA 4QODA 3BOSA 1RCTE 2UYQA 1HC7A 1NQAO 3E9NA 4CDNA 4PU0A 1E3JA 3C1AA 4JQCA 1I8TA 1WLSA 5EE0A 3QI2A 1F2DA 4XH9B 1QZTA 4JP1A 5J63A 1L1QA 2C2OA 2XYQA 3IPCA 1WEHA 3JTEA 3A4MA 3OU6A 3SQXA 3A4TA 2A3NA 1OBFO 1GCUA 3HMKA 4LHEA 1TAQA 3NBFA 2IUFA 5C5IA 1SBHA 3NIDB 1XK6A 2I3BA 3OIDA 3RKSA 5D3KA 1Q7CA 5I8WA 2OFFA 1WB5A 3ESZA 1EX1A 3EGDB 1JRLA 3LS2A 4IIXA 4AZSA 4RTRA 5JS7A 2I54A 3R5JA 3BX1A 3OIWA 4MQBA 2ZVDA 5D5QA 4G26A 2WV9A 4G8JA 3G7UA 4WA7A 4EECA 3AW9A 1ZGCA 2X76A 2PUWA 2R00C 3G49A 3T3OA 2A5DA 2H4FA 4GVLA 2QM7A 3SS8A 2XVMA 5DHRA 2YV5A 1EI9A 3O1JC 5CAEB 4HG2A 4FI3C 2H1HA 4N54A 1V1MB 1E9CA 2R5WA 3AW8A 2JLSA 3NANA 3OIGA 2VWHA 1XMJA 4I8IA 5FUXA 1HBJA 5HF9A 2J0QA 3J7TA 2RBKA 1THMA 3HN7A 5C8YA 5CJJA 3WYBA 1W0KD 3BKXA 3FPSA 3GHYA 3IAAA 2CNKA 5TV2A 3QVJA 3P5SA 2BI8A 4J0EA 5H8WA 5KYWB 1IEXA 4ND2A 6NULA 1UBTS 3LLSA 2EHDA 3H1TA 4JENA 3ICCA 2HK7A 4P86A 1TPZA 3KJNA 1VFPA 1ZJ4A 4KYTA 1RI3A 3L3BA 1HXHA 5EIOA 3R7DA 1HYBA 1BE0A 4C4RA 1UIMA 3G7SA 2BKXA 3EQ6A 1S3SA 2ZIEA 4PBTA 5EJ2A 3AVWA 4L0CA 2DERA 4M7WA 3ORYA 2AE1A 3GLVA 5LQDA 3NMUF 4WZBB 4D9JA 4MI1A 1MJNA 3DVQX 3GX1A 5FL7A 2JD2A 5JI3E 4ZOEA 3LPAA 4MWTA 4BATA 1Z5ZA 2VTVA 1HM5A 1UXIA 1X0XA 2IP4A 2XWPA 3H84A 4GC9A 3BHJA 2WAYA 4MDEA 3QEKA 3NDIA 4BO6A 1R0BA 1CE8B 1SXJE 4MHOA 3AG5A 4JBHA 6PFKA 2H4JA 1RAFA 1NRJB 3NXSA 3CUWA 1MB2A 1F0YA 2HLNA 5DLDA 3VX3A 2OESA 2W6ID 4I4NA 4DQXA 3O8QB 4HQ0A 3JQEA 4G8CA 3CSSA 4JCCA 3GAAA 2HWKA 3L7DA 2XV1A 3TAHA 5CIWA 3AY7A 4AKEA 3VU9B 1H2EA 2IHJA 4IH4A 3SF8A 3R4VA 2XCRB 1MV8A 1XDSA 3UK0A 3TNLA 4IDGA 3NT4A 4XEHA 2Q99A 3A7DA 4PAWA 2HZBA 4P2BA 4BFTA 1QLWA 1GQ2A 4DPLA 4G5XA 1CIPA 1Q7RA 1LJUA 3O73A 2ZU6A 4M8SA 3WIDA 1IULA 1JSRA 1CDZA 4YQYA 2DEUA 2RKOA 4JAVC 4IIGA 4GT1A 3RS9A 1QKJA 4JC5A 4XOIA 1KY2A 5FA8A 4ETNA 4FSHA 1MX3A 3N59A 3LUJA 2GTHA 5DMXA 3OC0A 4LGYA 2ZEJA 2XF8A 3GBVA 3EUFA 3PDIB 5HVNA 3N8NA 5CW2A 5A9SA 4LXYA 3C6XA 1MLDA 4B0PA 3Q2IA 2ZI4A 4Q9HA 2IEZA 2RKWA 5IANA 2H1FA 3AHFA 4NMLA 5GM2A 2ZITA 1QK3A 1ZD2P 3VZCA 1H6AA 3VR4D 2B4RO 4CM4A 4DWOA 1LNZA 5KHAA 5ITZB 2QTBA 1E7QA 3B1WA 2EJBA 3KQUA 3C6KA 4HWKA 1HRDA 1QOPB 2UYGA 5DGDA 1UPAA 1PYGA 4LDPA 1QG4A 3DZCA 2CBZA 2PRIA 3NHZA 3NBUA 3SBXA 5A04A 2G5TA 3SNKA 3MILA 4DLKA 1Z8HA 5DZSA 3WDMA 4B7AA 3CF4G 1ZN8A 2JEZA 5CYPA 5C0OE 1FU8A 3NUQA 2XUGA 1GAEO 2ZBPA 2A5YB 1YKFA 2Z3VA 3EARA 3IO5A 5JMTA 1VCIA 5LA6B 1ZBQA 4BHTA 2LKDA 2VT2A 3BD7A 3IP8A 2BISA 3DGEC 4H0FA 5DNWA 5AXBA 6REQA 1WCIB 2HRCA 2EZ8A 5DN9A 2Q6IA 5KQMA 5M04A 3IXLA 3VISA 5ALGA 4E32A 5FPQA 3EZNA 2J5XA 4ED9A 1GZ5A 1DIBA 1HNZB 2IF2A 4R1MA 2QTHA 2FKAA 1SBIA 1BQ3A 3UOWA 1P2SA 1D9XA 4E5VA 2MIIA 2PV0A 3AF0A 1W59A 1GG9A 2IXAA 1IM8A 1R1DA 2QVYX 3N7TA 4Y9UA 3V8VA 1Y7TA 3NBMA 4O4LF 1QFXA 1W75A 2PAAA 3PL5A 1OLXB 3Q9NA 1EXVA 3TM4A 3UUWA 4RLSA 3PVCA 3F67A 3IPAA 5H0IA 3VGPA 1VMEA 4M4SA 3AESB 3WOHA 3SVTA 1PFYA 2XWJI 1TCCA 2H54A 3CNNA 3K1JA 1D8AA 2FQXA 2QNRA 4KX3A 5DDIP 3Q8KA 4OLFA 1FNBA 1KI1A 4RVGA 1YZGA 3A6JA 3BWYA 3QMVA 3GRKA 2NTNA 3C8ZA 4M0PA 4Q12A 3ZVKA 4L75A 2ZPTX 3EGCA 2VYVA 1H4TA 4PQYA 2D4AA 2JLAA 3RQIA 1X7DA 2GAOA 2VJMB 3B53X 3NHWA 2BDUA 5AKGA 5HM8A 1NIJA 4HDRB 2G8LA 4FMDB 3VHQA 1U3TA 4YDRA 1YFZA 1TMOA 3L8MA 3R5HA 1QDLB 621PA 1LLDA 2ZJ1A 2WKWA 4IUYA 4N18A 4D25A 3GCGA 3U5TA 5B6JA 1T2UA 2HPHA 2PKEA 2ORED 3C5HA 1CUWA 1N1GA 5JSUA 2ACEA 4ENSA 5L4SA 1FOEB 1RYFA 3PUIA 1TA4A 4KVGA 5IAJA 1IIRA 1Z2PX 1HO3A 1UJ5A 2Q45A 3L4EA 5G4KB 1Z6AA 1V41E 4BKUA 4Q24A 3VTZA 2BHRA 4YPVA 3G2IA 1BD4A 4DYHA 2ZSBA 5C32A 1SOMA 5BP7A 4CKWA 4IM7A 2ASVA 3U3JA 5TQ2A 1XRJA 1C1XA 5I48A 4X24A 3AR9A 2ZRJA 2IUSA 3EOBI 2ZBFA 4V2UA 2Y1CA 4D79A 5JADA 5M7EA 4HNQA 4UUQA 4EJFA 3TLJA 4A8JA 1NJ5A 3WXMA 1K6XA 1UK7A 5CU7A 2C2HA 4FFBA 1E2DA 2PSSA 3ILHA 4HS9A 4G4JA 4ASUD 4BIMA 1ISJA 4D9GA 4KQXA 3SICE 2XNJA 4MQFB 2QSJA 4K9RA 4HQKA 4MV0A 3H05A 4MVCA 4ERXA 2NMVA 1RXWA 1LF5A 1NBWB 4PRKA 3K9LA 4E7OA 3V33A 4JLWA 1GM5A 4JGIA 3L49A 1U5AA 3X44A 2PBZA 2GBIA 2PVCA 1G2IA 2WQZA 3EIEA 3N74A 4N9QA 3ZD7A 1DXQA 3LFUA 3R5TA 3L40A 5DNDA 2A5LA 4JT8A 3HKEA 2F8SA 2GHIA 1ZJWA 2IPOA 3IDFA 4TYPA 3M6IA 2H85A 1AB5A 2BP7B 3HN2A 1AZSC 4J0GA 2HO5A 4HX5A 1ND5A 2ZBVA 2YV1A 3F8WA 1UXHA 3SR3A 2AZXA 3F8TA 3E0QA 5CH8A 1XCGB 2D4HA 2YMMA 2V7TA 3HO6A 4ZI7B 3ZVLA 1FLAA 1NE7A 4UAJA 1K63A 4U2GA 4GYJA 3S28A 4NCJA 3WHPA 3R24A 3GU3A 2IXBA 4X6UA 4DMHA 1NXOA 2VHVA 2UYYA 3L1UA 3AT1A 1A8UA 1I6WA 4O6VA 2AOUA 3G8DA 4DQDA 2YZ2A 1NW4A 3O4IA 1RYDA 1O9GA 3NJ8A 1G18A 3CLUD 4KXUA 4Y6RA 3FCOA 3KE8A 3U40A 5AKZA 1TDJA 3Q1KA 1DKRA 2VNJA 3ER9A 3MPUA 3R7WA 4B9EA 4EDHA 5BSFA 1YRYE 5CB8A 1E89A 2FZVA 2X8BA 3DDOA 1KTVA 5HGJA 1P6QA 5LZ2A 1SKYE 1YCHA 1X7YA 3IOEA 5IJ9B 3DL4A 4RF3A 3JVUA 4MGHA 2PFGA 3S6JA 4E3ZA 3TKLA 3PI6A 1XDZA 4Z7NB 2FJUA 3EVAA 4EPRA 4IX9A 3O95A 4L5JA 3RVDA 2H1SA 3TZKA 1MC4A 3R5SA 1N5LA 1VSQA 4F85A 3ZBUA 3D4LA 2DPLA 1VHLA 5BR1A 3EPHA 5BVGB 1M1YE 5LA6F 4I8XA 4L8YA 2AJCA 1UBRS 3DBVO 4M83A 3V4VB 2V9CA 3NHSA 4Q1BA 5HIIA 3WJAA 4LQDA 3ZVRA 4AG3A 3FNQA 4HXGA 4X8HA 5I7SA 2I2WA 3EMVA 3GRAA 3KXPA 4GBED 1W0JD 4MRSA 3SX2A 4BGVA 1EP9A 1M2OA 4X7PA 1QC5A 4I9HA 2I55A 3PD1A 2ZJ6A 4I55F 1SUEA 1NLFA 4AC9A 1N92A 5G0WA 1MQSA 1VZ3A 3T4EA 1M7BA 1M34B 3VHRA 1J8QA 2HQBA 1KJZA 4P83A 4DTCA 1G8HA 4HGNA 4R9RA 5JJIA 1A97A 3LLUA 2X5OA 3ZCVA 1CP3A 1HE3A 3KPUA 4O4JB 3SZGA 2P5YA 2QD5A 5CB4B 3IKVA 4CR6A 3H6GA 1KBOA 3EC2A 1GFZA 3DFUA 2FN9A 2V58A 2RG1A 2HIMA 4F3YA 2P4SA 2HSWA 3CPJB 3P2OA 4RA6A 5DOZA 3SEAA 2DG2A 3ZQ4A 4XDZA 2LGJA 1GRRA 3H5VA 4LVOA 1ACMA 1E8NA 4HQLA 3JALA 2BGTA 2XSZD 1HK7A 3DT8A 1WXXA 1ML4A 2EU8A 2XUQA 2ZUBA 4BN0A 3EWNA 1SXQA 4OHOA 3WHLA 1W94A 1ZZEA 3GV0A 3NNSA 4TMFA 1D04A 2H08A 3KOUA 1E7RA 2G77B 1A4UA 2HC9A 5HCUA 1DP4A 2LV8A 2OXEA 1GRCA 4IIUA 1YMQA 5ALLA 2G6TA 1NAIA 3EUEA 1ZN9A 4II7A 5AYVA 1JEJA 4HMOA 1F8FA 3KO8A 1PWYE 1GCIA 2JLXA 4R69A 1NJ8A 1ZH2A 1NLUA 2J6HA 4OY3A 1YBVA 1KY3A 5I6DA 4C5BA 5JYCA 3TOVA 1NN1A 5IAAA 5J2TA 4KUHA 3G88A 3LA8A 3O4FA 3MWDA 3THXA 2ZATA 1KR5A 1VRWA 2FOXA 1ODJA 2ZRIA 3TRIA 1GKUB 1UXKA 5EFZA 4IMIB 3DC7A 5FJIA 4D8XA 4R1QA 2AX3A 2H6EA 4KV9A 5KTRA 5AHRA 5G3ZA 1L6IA 3WNVA 1DX6A 3B13B 1TNDA 4J3FA 2XXJA 3K0HA 1N2HA 2JG3A 4IICA 3IULA 3FNFA 2WJGA 4O1HA 4BO1A 5JD6A 1KXZA 1IN1A 5BR4A 4HWGA 4QOHA 1CQZA 4PQEA 3QK7A 4DLUA 4O8ZA 3STVA 3PLRA 4MV7A 2FFAA 2OV3A 5DGTA 1XAJA 2WWHA 2P6NA 5A5EA 3QVMA 4D8UA 1I5OA 2QVZX 2BFBB 3B78A 1Y9DA 1T5DX 2AQHA 3JPYA 2HA5A 4Q7KA 5JS6A 1YK1A 3F5MA 2W48A 4X71A 5K2OA 5CCXA 3WADA 3LWBA 2OM2A 1XD9A 2CHFA 4RGYA 3BIXA 1OLSB 1KPHA 4Y6PA 1QRTA 4K9MA 3ECCA 2JIPA 1RXIA 1UWLA 4CKEA 1SCUB 1MJHA 1WUIS 3D4OA 4ZAXA 4Z0PA 3RFCA 4TZKA 4YRCA 2ODEA 4HDKA 5DF1A 1T2CA 3RABA 5CEJA 2QQ0A 3DA8A 3RV3A 5EIAA 1R8SA 3O3CA 1DVRA 3ZWAA 2ZS9A 4TS1A 2NNLD 2V6MA 3BYZA 3F5FA 3NVAA 3LZ6A 1K98A 1L7EA 3BZBA 3PSAA 4NAVA 2QTFA 3LU1A 2Q6VA 4W8HA 1XXHB 1GXSB 1Y6GA 1XQWA 3A05A 4D1YA 4KREA 4JQYA 4L3WA 3E81A 1XD2B 4LDNA 5BYKA 1S8NA 1CUZA 2N1BA 1XT6A 3FA2A 1C7EA 1IEQA 5AW8A 3MINB 1RKUA 2VH1A 1SIWA 3STXA 1JAXA 1Y4ZA 1NHWA 2CLCX 3DOUA 3FETA 3VZRA 4X7MA 4FDUA 4CLHA 5AKYA 4QAJA 1JECA 3BGOS 2A0UA 3VKUA 3B9PA 3IBCA 3QFFA 2VG8A 3MCWA 3R75A 6YASA 3BE5A 4JKOA 3HDVA 4KO1S 3AXTA 4UFNA 3EBLA 5FPPA 1TZMA 3RSCA 3M5DA 3WB1A 1GTZA 1R4MB 2B3DA 4DWJA 1EBBA 1TYDE 2JGLA 1ONNA 4JHLA 3UWKA 5DXAA 4IWNA 3KLOA 3P2KA 4WDRA 3P26A 1TRKA 1SQFA 7REQB 1R0YA 4Y1RA 3TJZA 2IYXA 3SSAA 1XP5A 2ISQA 5H9WA 5L3ZA 3H2YA 1ADCA 4X62B 2F9LA 4WBNB 3K1AA 5CURA 3VH2A 4J3JA 4PLGA 4YIKA 2AD5A 5DRYA 5T3UA 7MHTA 5CVVA 3NIWA 1OREA 2BFDA 4Z4FA 4XYBA 5CDFA 2RHBA 4RTNA 4O4JF 2P5TB 3EQ8A 3T94A 3ZQUA 3C3JA 5CB4F 1QHHB 3RTBA 3JQGA 2CNWA 1J2UA 1KAQA 4M8IA 4TLMB 1XX6A 3KYJB 3OZIA 3U60B 4U02A 4ZMSA 5EMHA 5AW4A 3UMBA 2HA6A 2O8EA 3WB0A 1FFDA 3GEDA 3RYHA 4AK9A 2PBFA 4FEEA 5H02A 5TE9A 2JLWA 1WM1A 3H9EO 2ZRHA 1VIDA 2BSXA 2OV2A 1EEHA 2DFPA 1A5SB 1ZVMA 2H7XA 4UUAA 1EQ2A 3ZHSA 3BJRA 3I9FA 1TC2A 3AK4A 4F4HA 1HQYE 3L06A 4Z51A 3ZUGA 5JCOC 1BMFD 1L7DA 2HDHA 4DDWA 4RUKA 3VKWA 3N2KB 1JKXA 3IOBA 3BDAA 4Q00A 1Q0HA 4MJLA 4LPKA 3OCUA 4RD3A 4GM1A 4DMMA 1A4RA 2WZBA 4J4BA 4AS1A 1N6LA 4U8HA 4J7AA 2QZ9A 4W5HA 1ZONA 2PGLA 3D3WB 4O33A 5HXAA 3QHPA 5DMHA 3AFOA 4ZC1A 1R3UA 5GADl 3FSGD 3RC2A 4KV7A 2VJBA 4XM1A 4KMSA 1IRXA 1XE3A 2D1RA 1KQ3A 4BCDA 1ONBA 4EY4A 4AKIA 3AUFA 2QP3A 1CYDA 2OZKA 2OGUA 3VSBA 1DHRA 3G8CA 2YJZA 1VA4A 4DIKA 4RK5A 1C14A 2YHIB 3BWXA 1JB1A 1C0PA 4CNQA 2ODNA 2HJHA 4HXEB 3LVBA 4DKJA 4TXMA 4QDUA 4WACA 3B1XA 2EP7A 2Q49A 4ZMRA 1CJMA 3C70A 4RM2A 3C6MA 1T2FA 3DMYA 2FR0A 3U1TA 5JCJD 1DC4A 2ZYSA 1SG0A 1TCBA 3CRNA 3OD5A 1GQOA 3LCJA 2VDQB 3K0CC 3PFHA 1NPDA 1U4SA 4LJ7A 1LV7A 4D80A 1FS6A 1U65A 3C15C 8GPBA 1K3FA 1Y34E 2ZROA 3MCZA 3HRHA 1YS4A 3VJKA 5EP4A 1E2PA 5IT9A 4Z4QA 4AQYB 1JLHA 3AQIA 4MIKA 4EKNB 4UOEA 2WSLA 5IMBA 4ZGBA 1OKKA 2RC5A 4I4CA 4RK7A 1J2EA 2J67A 3M8KA 4FZRA 4YJKA 3V7UA 1Z75A 2GNPA 3A1CA 4OL9A 4RF5A 1XZ8A 1EX7A 2HWWA 1GNTA 1PT5A 2X14A 3DOJA 3LXUX 1H2YA 4D56A 1Z6XA 2M6SA 2C4WA 2FSPA 3OHSX 1LPSA 2Q62A 2QTTA 3N76A 4GI7A 3TEJA 2AKEA 1NPYA 4ZN6A 5JBNA 4X66B 1E0KA 3ZXSA 2WLTA 4OJKA 3M49A 3IR7A 3QEBZ 3ETNA 4RYDA 4CTMA 5EWLB 2HFJA 2CHEA 4Q1AA 1LZLA 1U63A 8ATCA 4N5HX 1PEAA 3SMQA 1YO6A 1DAEA 3RIGA 3V3TA 1G20B 4YJGB 5HMLA 3AF2A 5ALVA 3QVUA 4U63A 1UQTA 4BAGA 5I9SA 1XPOA 4YH1A 1LBHA 1ZGBA 2XAAA 3GEEA 2OFOA 3DUWA 4JL5A 4XQEA 4BNKA 2R7LA 4CEIB 3UHJA 4WKCA 2X13A 3NRBA 3TW6A 3RLIA 1O9BA 5FUWA 3BWMA 4DLVA 1B3BA 2VYQA 4P98A 4C5AA 5HZMA 1TM4E 2BEUA 1GSHA 1QYVA 3L0YA 4HZUA 2PZAA 5DVZA 4DIBA 1RLUA 1V8ZA 1YS1X 2F43A 4L72A 3GFGA 3ZI4A 3C45A 2PQ2A 3AO0B 1ZD4A 5FHQA 5JI2E 4GPD1 1E6EA 4K6CA 1FW6A 3P0IA 1NP6A 5TPZA 3KQHA 3JQCA 1EFVA 2D8MA 4JJFA 4Q5IA 4YCAA 1G59A 2X86A 2BGKA 3H5IA 2CB0A 4KGVA 4Z7QB 3B1FA 5K2MA 4CEJA 3ZW9A 1HE4A 2DULA 2PZKA 5EZYB 4ZV7A 4I3FA 4P81A 5IP5A 1P75A 3NBQA 5IX8A 5GOZA 5E6SA 4B79A 1FRFS 4N3GA 2YHUA 3FTFA 3UWOA 3VOSA 3MJDA 3PITA 2JEOA 3OJFA 5CT8A 4WBNF 2WVAA 4HGOA 1PR2A 4KE9A 4OGKA 3ZOZA 1REQA 1D2RA 4PPYA 3UXEA 4MB0A 1XALA 1N2GA 2WVHA 4KLZA 5FX2A 1K6JA 1VOTA 3WLHA 1P0MA 4TUYB 4PEVA 4DJDC 2CHGA 2RBGA 3HCBA 2X6TA 1GG2A 1OLUA 4TL7A 5AVXA 4YT8A 2YNMD 2HBRA 4MDHA 3TN7A 1K08A 1GDHA 2VOJA 1XU7A 1C8KA 4S2EA 1Q17A 1XCBA 2PL1A 4ZOBA 2BZ1A 3U3KA 3UWMA 3X1YA 4PG6A 1LNSA 4KN9S 2GEDA 2VAVA 4RE6A 4XARA 1BVRA 4YWHA 3TB4A 1QVWA 4D0GA 3STUA 3T6KA 4LF6B 3WLMA 2I8CA 1O6CA 1JS1X 3V8EA 1YL7A 1RE1A 1G0NA 3CONA 4NBNA 4UHFA 2Z2IA 3V2HA 2EBHX 3NB0A 3Q9LA 4MIYA 4HYEA 4NEGA 5GTDA 4F3NA 5F9HA 3RU9A 5T6BA 5DBGA 5EHZA 4KYVA 3U37A 3JQFA 3RRJA 2GEFA 5CXUA 1R8XA 1XZEA 2PH7A 4G25A 1RQGA 1BKYA 3OZCA 2C03A 1SA0B 3DTVD 1QO0A 1EB9A 3KSRA 4OI2A 5D00A 3RUCA 4D4KA 2BGWA 2ADFA 3A3OA 3V1KA 1GITA 3L1IA 4M1QA 1OBOA 5EE3A 5E6UB 3MWYW 2WU4A 3ZJTA 3FHLA 2QD2A 3BJMA 2GQ0A 2NO7A 4JITA 2QKYA 4IINA 4OB7A 4PSAA 2JLRA 4ZO9A 3LPLA 5K6TA 2JJ8A 2PS9A 5BQ5A 2WVJA 1QFJA 1TYBE 1XMQB 3M9WA 3O1IC 1YZVA 1Z15A 2Z83A 3A58B 3L6CA 1B4DA 1OPRA 2CCJA 2CXNA 2CXPA 5EP1A 3RQSA 3BFKA 4W8OA 1OJLA 2O3RA 1B73A 4RZ3A 2IE0A 1G21E 1XEWX 1B74A 3PB3A 4DDHA 1DC5A 1BA3A 1E4YA 1Z7BA 3GNTA 5HOEA 3KYIB 3OTWA 1PWHA 2PWPA 2XUJA 4R9VA 3RGGA 1KP9A 1YFKA 3QUAA 4GVXA 2HQ1A 2JFUA 4W9NA 3RS2A 3G2QA 3GFQA 4XIFA 3P19A 4NSNA 4IGAA 4O3MA 4L08A 2HDOA 2WIKA 5CFLA 2XXBA 4TKZA 1W4CA 4ZICA 1YKGA 3UPTA 4BLPA 4CLOA 3FCAA 3ON5A 1SQ5A 1L2TA 2AHOA 2VKQA 3CUUA 4G5FA 4V24A 1J00A 1MX1A 1KO4A 1NM5C 1OJ7A 3U7QB 3WLEA 1C9NA 5E9AA 4BNGA 2WWXA 5K0JA 2F1HA 3O2NA 2J30A 3IUNA 1QF7A 3PHGA 3CE9A 3SYTA 4CDRA 3CINA 4OHWA 1JSLA 1CIJA 2H5EA 5LD2C 3TZCA 4QXOA 1DRKA 4OXIA 2R9VA 4IAOA 2JFOA 4HLUC 4C78A 2G67A 1ZY2A 2WJ4A 1BX3A 3FWNA 3K6SB 1LDNA 2GCOA 4CVNA 1SUCA 4DSTA 1A2OA 1GQSA 2EFJA 3VYUB 4BJ5A 1ZUNA 3U48A 2F3PA 1DBRA 2UZ3A 3WGUA 3U09A 4U7DA 4NMWA 3AB8A 1QYDA 3GUZA 3O2SB 4I6GA 5HA5A 3O4VA 3LAWA 2Y0BA 5ARCA 3USCS 4CCAA 2AOUB 4TTIA 5K01A 1K88A 3EXFA 1NVAA 1UT8A 3Q7IA 1ISMA 4EMSA 4LV8B 5JSQA 4CM6A 1JJIA 4B74A 2RARA 2DETA 1PEDA 2FA9A 3U44B 5FLYA 1EFLA 2HH9A 4RHEA 1XZPA 1ADFA 1F4LA 1C2TA 5DT9A 2WKRA 3REQA 3T99A 3HYNA 5BYBA 3UHPA 1C4KA 5FL7D 2V7VA 3WA6A 5D85A 2ECFA 2MSDB 3IPYA 2O59A 4FFWA 5BY2A 1UFRA 2NO1A 4C08A 2OOSA 4MQMA 3EH2A 5E7QA 3RF7A 2FPGB 5TC4A 1Q2UA 1WXHA 1ZINA 3HB9A 4UEWA 2RI0A 3OZSA 1UR5A 2Y77A 1DQRA 4QNMA 3GOQA 4B09A 5EWMB 1KI6B 2O52A 3V3KA 1FPQA 5JSHA 3QMPA 4GI2A 4TRJA 4WNCA 1T3GA 4HFMA 5FQNA 2O8NA 3K72B 3OJ0A 2B4AA 1A9TA 5JHHB 4IF4A 5CT6A 1NPTO 2JGKA 5EZYF 2GXSA 4OU4A 4EMTA 1XZBA 3HZRA 7ADHA 4OGWA 3B51X 1BCSA 1TT5A 4KACA 1T3ZA 3WLAA 4AYWA 3T1NA 2AC4A 3WIUA 3TUJC 4DT1A 4YUAA 5KJ1A 1ISIA 1GU7A 3GNLA 4JJIA 4RD6A 3OWOA 4C6TA 4DB4A 2R1TA 3IV7A 1EA5A 1NR1A 3DAOA 5CPBA 3DFFA 3F7NA 4Q15A 1L6RA 3MMSA 1VKZA 2A84A 2QTRA 4TUYF 4I50B 5G1PA 1KIAA 4P9NA 1R5NA 2R8OA 3BD6A 3CXRA 4I66A 3ZLTA 3V48A 1HFWA 1T36B 1ZYUA 4M1EA 3PCTA 4QULA 1TT7A 4PFQA 5DLEA 2RGGA 4HFNA 4CLEA 5C1BA 4PNHA 3E5HA 1AT1A 3F3MA 4XSHA 2QMOA 2IYVA 1F1BA 2W6JA 3AXSA 1M8PA 3FLBA 5IMSA 5MGNA 1FYVA 4I4IA 4F7WA 5EL0A 5C34B 1CUEA 1E6UA 1P8AA 2OB1A 3FG9A 1I51A 1RQPA 5ESDA 1XF1A 3A06A 3BM5A 3AX6A 4C2UA 2HTFA 3K4HA 1OV6A 2PIAA 2W00A 3AERA 3OKCA 4RPJA 3TLXA 2O2EA 4KPFC 1SQGA 2XIJA 1T1SA 1Z88A 3A27A 3O4JA 4URUR 2GD2A 5C1DA 2ZRBA 5JW6A 1ZM7A 4B4KA 1EFAA 2G63A 4EO4A 2A0KA 2JJYA 3FZNA 3VHXB 3D7LA 2WR8A 2WA1A 4R1NA 4EP1A 1Q1GA 1QH1A 3B6KA 3IL2A 1CS0A 4DMUB 2QORA 1XMIA 1E2MA 2A1TS 1E9RA 5A3QA 2XCLA 2E7ZA 3L1VA 4D74A 1NVGA 3TS1A 4UM9D 1VP9A 3PPXA 2PE5A 5EJ4A 3RH0A 2R6ZA 4WLFA 1A2BA 3TX2A 1CDDA 5IW8A 3WZLA 1SJ9A 1J7KA 2FLVA 3LPDA 4LDRA 1MXHA 3COJA 2R8YA 5CVJA 5EY5B 2OBXA 5DNCA 5AI6A 1ODCA 2OA0A 1Q7TA 16PKA 5DNEA 5TPWA 2NSLA 4B4VA 1HL7A 4NY1A 3NDPA 1Z4NA 1GNVA 2ZB3A 1JDNA 1T6BY 1G1AA 1J97A 3DMFA 3R2JA 4FNMA 2BRUC 1A9QA 4V3BA 3VYWA 1ZRNA 1U9JA 5E4JA 4DLBA 3GARA 1L7XA 1WSBA 2R4UA 3UAOA 2FZKA 2NZXA 1G5IA 3GDFA 1X94A 2IS6A